CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 21071309073361069

Job options:

ID        	=	 21071309073361069
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 on
DORMSD    	=	 on

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


HELIX    1   1 ALA A   23  ALA A   32  1                                  10
HELIX    2   2 GLY A   70  CYS A   73  1                                   4
HELIX    3   3 LEU A   75  ARG A   78  1                                   4
HELIX    4   4 THR A  101  CYS A  103  1                                   3
HELIX    5   5 PRO A  107  THR A  111  1                                   5
HELIX    6   6 SER A  129  ASP A  131  1                                   3
HELIX    7   7 ASN B   12  LYS B   15  1                                   4
HELIX    8   8 MET B   41  THR B   55  1                                  15
HELIX    9   9 THR B   81  TRP B   87  1                                   7
HELIX   10  10 CYS B  114  THR B  116  1                                   3
HELIX   11  11 PRO B  133  ASN B  137  1                                   5
HELIX   12  12 PHE B  148  LYS B  159  1                                  12
HELIX   13  13 ALA B  177  HIE B  185  1                                   9
HELIX   14  14 ASN B  195  ASN B  197  1                                   3
HELIX   15  15 GLY B  220  THR B  233  1                                  14
HELIX   16  16 TYR B  241  PHE B  244  1                                   4
HELIX   17  17 ASP B  268  LYS B  276  1                                   9
SHEET    1   1 1 GLN A  65  GLY A  69  0
SHEET    2   2 1 TYR A  96  PRO A 100  0
SHEET    3   3 1 GLY B   7  ALA B   9  0
SHEET    4   4 1 ARG B  65  PHE B  69  0
SHEET    5   5 1 LEU B  93  ASP B  98  0
SHEET    6   6 1 SER B 108  ILE B 111  0
SHEET    7   7 1 VAL B 117  THR B 119  0
SHEET    8   8 1 LEU B 125  SER B 128  0
SHEET    9   9 1 SER B 165  ILE B 170  0
SHEET   10  10 1 TRP B 188  THR B 194  0
SHEET   11  11 1 ALA B 203  CYS B 208  0
SHEET   12  12 1 ALA B 257  MET B 259  0
SHEET   13  13 1 LEU B 279  ILE B 281  0
SHEET   14  14 1 ILE B 289  SER B 291  0
CRYST1   96.511   88.806  100.437  90.00  90.00  90.00               1
ATOM      1  N   ALA A  18      59.772  27.587  39.944  1.00  0.00           N
ATOM      2  H1  ALA A  18      59.383  28.445  40.309  1.00  0.00           H
ATOM      3  H2  ALA A  18      60.765  27.769  39.911  1.00  0.00           H
ATOM      4  H3  ALA A  18      59.620  26.803  40.562  1.00  0.00           H
ATOM      5  CA  ALA A  18      59.350  27.270  38.538  1.00  0.00           C
ATOM      6  HA  ALA A  18      59.633  28.104  37.895  1.00  0.00           H
ATOM      7  CB  ALA A  18      60.044  26.153  37.929  1.00  0.00           C
ATOM      8  HB1 ALA A  18      59.674  25.185  38.268  1.00  0.00           H
ATOM      9  HB2 ALA A  18      59.831  26.154  36.860  1.00  0.00           H
ATOM     10  HB3 ALA A  18      61.128  26.134  38.038  1.00  0.00           H
ATOM     11  C   ALA A  18      57.864  27.116  38.419  1.00  0.00           C
ATOM     12  O   ALA A  18      57.296  26.408  39.228  1.00  0.00           O
ATOM     13  N   PHE A  19      57.195  27.856  37.543  1.00  0.00           N
ATOM     14  H   PHE A  19      57.829  28.501  37.094  1.00  0.00           H
ATOM     15  CA  PHE A  19      55.702  28.120  37.661  1.00  0.00           C
ATOM     16  HA  PHE A  19      55.580  28.362  38.717  1.00  0.00           H
ATOM     17  CB  PHE A  19      55.382  29.296  36.789  1.00  0.00           C
ATOM     18  HB2 PHE A  19      55.880  30.215  37.099  1.00  0.00           H
ATOM     19  HB3 PHE A  19      55.672  28.983  35.786  1.00  0.00           H
ATOM     20  CG  PHE A  19      53.925  29.718  36.845  1.00  0.00           C
ATOM     21  CD1 PHE A  19      53.016  29.316  35.810  1.00  0.00           C
ATOM     22  HD1 PHE A  19      53.441  28.798  34.963  1.00  0.00           H
ATOM     23  CE1 PHE A  19      51.639  29.645  35.883  1.00  0.00           C
ATOM     24  HE1 PHE A  19      50.922  29.358  35.127  1.00  0.00           H
ATOM     25  CZ  PHE A  19      51.181  30.376  37.016  1.00  0.00           C
ATOM     26  HZ  PHE A  19      50.114  30.526  37.090  1.00  0.00           H
ATOM     27  CE2 PHE A  19      52.095  30.699  38.061  1.00  0.00           C
ATOM     28  HE2 PHE A  19      51.707  31.175  38.949  1.00  0.00           H
ATOM     29  CD2 PHE A  19      53.423  30.292  38.011  1.00  0.00           C
ATOM     30  HD2 PHE A  19      54.103  30.587  38.796  1.00  0.00           H
ATOM     31  C   PHE A  19      54.899  26.831  37.408  1.00  0.00           C
ATOM     32  O   PHE A  19      55.317  25.951  36.619  1.00  0.00           O
ATOM     33  N   ALA A  20      53.670  26.790  37.877  1.00  0.00           N
ATOM     34  H   ALA A  20      53.394  27.456  38.584  1.00  0.00           H
ATOM     35  CA  ALA A  20      52.572  25.885  37.334  1.00  0.00           C
ATOM     36  HA  ALA A  20      52.835  25.665  36.299  1.00  0.00           H
ATOM     37  CB  ALA A  20      52.648  24.686  38.221  1.00  0.00           C
ATOM     38  HB1 ALA A  20      53.626  24.229  38.070  1.00  0.00           H
ATOM     39  HB2 ALA A  20      52.362  24.945  39.240  1.00  0.00           H
ATOM     40  HB3 ALA A  20      51.907  23.936  37.944  1.00  0.00           H
ATOM     41  C   ALA A  20      51.151  26.460  37.449  1.00  0.00           C
ATOM     42  O   ALA A  20      50.273  25.881  36.821  1.00  0.00           O
ATOM     43  N   VAL A  21      50.908  27.318  38.368  1.00  0.00           N
ATOM     44  H   VAL A  21      51.666  27.640  38.953  1.00  0.00           H
ATOM     45  CA  VAL A  21      49.546  27.786  38.804  1.00  0.00           C
ATOM     46  HA  VAL A  21      49.071  28.082  37.869  1.00  0.00           H
ATOM     47  CB  VAL A  21      48.653  26.662  39.523  1.00  0.00           C
ATOM     48  HB  VAL A  21      48.663  25.801  38.854  1.00  0.00           H
ATOM     49  CG1 VAL A  21      49.086  26.135  40.892  1.00  0.00           C
ATOM     50 HG11 VAL A  21      48.334  25.387  41.141  1.00  0.00           H
ATOM     51 HG12 VAL A  21      50.076  25.679  40.862  1.00  0.00           H
ATOM     52 HG13 VAL A  21      49.083  26.918  41.650  1.00  0.00           H
ATOM     53  CG2 VAL A  21      47.186  27.086  39.639  1.00  0.00           C
ATOM     54 HG21 VAL A  21      47.073  27.822  40.436  1.00  0.00           H
ATOM     55 HG22 VAL A  21      46.853  27.703  38.804  1.00  0.00           H
ATOM     56 HG23 VAL A  21      46.520  26.233  39.775  1.00  0.00           H
ATOM     57  C   VAL A  21      49.569  29.075  39.663  1.00  0.00           C
ATOM     58  O   VAL A  21      50.426  29.298  40.494  1.00  0.00           O
ATOM     59  N   ASP A  22      48.627  29.969  39.372  1.00  0.00           N
ATOM     60  H   ASP A  22      47.818  29.745  38.810  1.00  0.00           H
ATOM     61  CA  ASP A  22      48.519  31.283  40.052  1.00  0.00           C
ATOM     62  HA  ASP A  22      49.517  31.709  40.156  1.00  0.00           H
ATOM     63  CB  ASP A  22      47.737  32.300  39.165  1.00  0.00           C
ATOM     64  HB2 ASP A  22      48.281  32.439  38.231  1.00  0.00           H
ATOM     65  HB3 ASP A  22      46.787  31.902  38.808  1.00  0.00           H
ATOM     66  CG  ASP A  22      47.500  33.685  39.733  1.00  0.00           C
ATOM     67  OD1 ASP A  22      47.964  34.005  40.849  1.00  0.00           O
ATOM     68  OD2 ASP A  22      46.778  34.487  39.107  1.00  0.00           O
ATOM     69  C   ASP A  22      47.957  31.057  41.479  1.00  0.00           C
ATOM     70  O   ASP A  22      46.879  30.523  41.604  1.00  0.00           O
ATOM     71  N   ALA A  23      48.694  31.587  42.475  1.00  0.00           N
ATOM     72  H   ALA A  23      49.604  31.983  42.282  1.00  0.00           H
ATOM     73  CA  ALA A  23      48.260  31.389  43.908  1.00  0.00           C
ATOM     74  HA  ALA A  23      48.476  30.348  44.148  1.00  0.00           H
ATOM     75  CB  ALA A  23      49.267  32.172  44.817  1.00  0.00           C
ATOM     76  HB1 ALA A  23      49.268  31.735  45.816  1.00  0.00           H
ATOM     77  HB2 ALA A  23      50.187  32.107  44.236  1.00  0.00           H
ATOM     78  HB3 ALA A  23      49.100  33.244  44.923  1.00  0.00           H
ATOM     79  C   ALA A  23      46.827  31.962  44.280  1.00  0.00           C
ATOM     80  O   ALA A  23      46.198  31.388  45.153  1.00  0.00           O
ATOM     81  N   ALA A  24      46.405  33.082  43.695  1.00  0.00           N
ATOM     82  H   ALA A  24      46.932  33.531  42.960  1.00  0.00           H
ATOM     83  CA  ALA A  24      45.011  33.591  43.831  1.00  0.00           C
ATOM     84  HA  ALA A  24      44.778  33.810  44.873  1.00  0.00           H
ATOM     85  CB  ALA A  24      44.871  34.925  43.086  1.00  0.00           C
ATOM     86  HB1 ALA A  24      45.181  34.883  42.042  1.00  0.00           H
ATOM     87  HB2 ALA A  24      43.808  35.156  43.157  1.00  0.00           H
ATOM     88  HB3 ALA A  24      45.506  35.603  43.657  1.00  0.00           H
ATOM     89  C   ALA A  24      43.964  32.539  43.347  1.00  0.00           C
ATOM     90  O   ALA A  24      43.168  32.102  44.110  1.00  0.00           O
ATOM     91  N   LYS A  25      44.091  32.042  42.115  1.00  0.00           N
ATOM     92  H   LYS A  25      44.853  32.408  41.561  1.00  0.00           H
ATOM     93  CA  LYS A  25      43.301  30.872  41.587  1.00  0.00           C
ATOM     94  HA  LYS A  25      42.250  31.157  41.641  1.00  0.00           H
ATOM     95  CB  LYS A  25      43.711  30.617  40.114  1.00  0.00           C
ATOM     96  HB2 LYS A  25      43.700  31.600  39.643  1.00  0.00           H
ATOM     97  HB3 LYS A  25      44.776  30.388  40.076  1.00  0.00           H
ATOM     98  CG  LYS A  25      42.904  29.665  39.240  1.00  0.00           C
ATOM     99  HG2 LYS A  25      41.910  30.044  39.003  1.00  0.00           H
ATOM    100  HG3 LYS A  25      43.265  29.849  38.228  1.00  0.00           H
ATOM    101  CD  LYS A  25      43.015  28.183  39.618  1.00  0.00           C
ATOM    102  HD2 LYS A  25      44.057  27.930  39.818  1.00  0.00           H
ATOM    103  HD3 LYS A  25      42.311  28.021  40.433  1.00  0.00           H
ATOM    104  CE  LYS A  25      42.713  27.259  38.428  1.00  0.00           C
ATOM    105  HE2 LYS A  25      43.256  27.498  37.514  1.00  0.00           H
ATOM    106  HE3 LYS A  25      43.003  26.241  38.686  1.00  0.00           H
ATOM    107  NZ  LYS A  25      41.220  27.266  38.160  1.00  0.00           N
ATOM    108  HZ1 LYS A  25      41.042  26.680  37.358  1.00  0.00           H
ATOM    109  HZ2 LYS A  25      40.711  26.856  38.930  1.00  0.00           H
ATOM    110  HZ3 LYS A  25      40.856  28.188  37.967  1.00  0.00           H
ATOM    111  C   LYS A  25      43.566  29.583  42.390  1.00  0.00           C
ATOM    112  O   LYS A  25      42.573  28.911  42.722  1.00  0.00           O
ATOM    113  N   ALA A  26      44.825  29.220  42.837  1.00  0.00           N
ATOM    114  H   ALA A  26      45.645  29.580  42.371  1.00  0.00           H
ATOM    115  CA  ALA A  26      44.964  27.979  43.531  1.00  0.00           C
ATOM    116  HA  ALA A  26      44.418  27.190  43.014  1.00  0.00           H
ATOM    117  CB  ALA A  26      46.446  27.687  43.608  1.00  0.00           C
ATOM    118  HB1 ALA A  26      46.888  27.617  42.614  1.00  0.00           H
ATOM    119  HB2 ALA A  26      47.014  28.467  44.116  1.00  0.00           H
ATOM    120  HB3 ALA A  26      46.553  26.759  44.170  1.00  0.00           H
ATOM    121  C   ALA A  26      44.375  28.106  44.942  1.00  0.00           C
ATOM    122  O   ALA A  26      43.965  27.047  45.482  1.00  0.00           O
ATOM    123  N   TYR A  27      44.317  29.294  45.574  1.00  0.00           N
ATOM    124  H   TYR A  27      44.831  30.058  45.158  1.00  0.00           H
ATOM    125  CA  TYR A  27      43.612  29.467  46.864  1.00  0.00           C
ATOM    126  HA  TYR A  27      43.850  28.682  47.582  1.00  0.00           H
ATOM    127  CB  TYR A  27      44.087  30.781  47.453  1.00  0.00           C
ATOM    128  HB2 TYR A  27      45.132  30.711  47.757  1.00  0.00           H
ATOM    129  HB3 TYR A  27      43.956  31.585  46.729  1.00  0.00           H
ATOM    130  CG  TYR A  27      43.256  31.177  48.692  1.00  0.00           C
ATOM    131  CD1 TYR A  27      43.122  30.374  49.852  1.00  0.00           C
ATOM    132  HD1 TYR A  27      43.642  29.435  49.968  1.00  0.00           H
ATOM    133  CE1 TYR A  27      42.310  30.764  50.934  1.00  0.00           C
ATOM    134  HE1 TYR A  27      42.205  30.073  51.757  1.00  0.00           H
ATOM    135  CZ  TYR A  27      41.627  31.997  50.898  1.00  0.00           C
ATOM    136  OH  TYR A  27      40.897  32.382  51.980  1.00  0.00           O
ATOM    137  HH  TYR A  27      40.432  33.220  51.919  1.00  0.00           H
ATOM    138  CE2 TYR A  27      41.657  32.810  49.743  1.00  0.00           C
ATOM    139  HE2 TYR A  27      40.845  33.517  49.656  1.00  0.00           H
ATOM    140  CD2 TYR A  27      42.440  32.390  48.603  1.00  0.00           C
ATOM    141  HD2 TYR A  27      42.542  33.019  47.731  1.00  0.00           H
ATOM    142  C   TYR A  27      42.087  29.375  46.861  1.00  0.00           C
ATOM    143  O   TYR A  27      41.455  28.694  47.619  1.00  0.00           O
ATOM    144  N   LYS A  28      41.465  29.933  45.784  1.00  0.00           N
ATOM    145  H   LYS A  28      42.029  30.522  45.188  1.00  0.00           H
ATOM    146  CA  LYS A  28      40.032  29.676  45.387  1.00  0.00           C
ATOM    147  HA  LYS A  28      39.462  29.803  46.307  1.00  0.00           H
ATOM    148  CB  LYS A  28      39.624  30.660  44.251  1.00  0.00           C
ATOM    149  HB2 LYS A  28      40.328  30.412  43.456  1.00  0.00           H
ATOM    150  HB3 LYS A  28      38.590  30.532  43.929  1.00  0.00           H
ATOM    151  CG  LYS A  28      39.793  32.134  44.603  1.00  0.00           C
ATOM    152  HG2 LYS A  28      39.274  32.242  45.555  1.00  0.00           H
ATOM    153  HG3 LYS A  28      40.847  32.397  44.693  1.00  0.00           H
ATOM    154  CD  LYS A  28      39.174  33.187  43.566  1.00  0.00           C
ATOM    155  HD2 LYS A  28      39.339  32.811  42.556  1.00  0.00           H
ATOM    156  HD3 LYS A  28      38.087  33.258  43.552  1.00  0.00           H
ATOM    157  CE  LYS A  28      39.931  34.571  43.781  1.00  0.00           C
ATOM    158  HE2 LYS A  28      39.521  35.042  44.675  1.00  0.00           H
ATOM    159  HE3 LYS A  28      41.010  34.432  43.834  1.00  0.00           H
ATOM    160  NZ  LYS A  28      39.583  35.515  42.733  1.00  0.00           N
ATOM    161  HZ1 LYS A  28      39.671  35.121  41.808  1.00  0.00           H
ATOM    162  HZ2 LYS A  28      38.611  35.788  42.752  1.00  0.00           H
ATOM    163  HZ3 LYS A  28      40.124  36.364  42.816  1.00  0.00           H
ATOM    164  C   LYS A  28      39.804  28.221  44.957  1.00  0.00           C
ATOM    165  O   LYS A  28      38.767  27.733  45.281  1.00  0.00           O
ATOM    166  N   ASP A  29      40.741  27.503  44.311  1.00  0.00           N
ATOM    167  H   ASP A  29      41.617  27.909  44.013  1.00  0.00           H
ATOM    168  CA  ASP A  29      40.538  26.004  44.017  1.00  0.00           C
ATOM    169  HA  ASP A  29      39.574  25.766  43.568  1.00  0.00           H
ATOM    170  CB  ASP A  29      41.482  25.474  42.992  1.00  0.00           C
ATOM    171  HB2 ASP A  29      42.519  25.787  43.117  1.00  0.00           H
ATOM    172  HB3 ASP A  29      41.491  24.389  43.098  1.00  0.00           H
ATOM    173  CG  ASP A  29      41.159  25.878  41.557  1.00  0.00           C
ATOM    174  OD1 ASP A  29      40.238  26.699  41.269  1.00  0.00           O
ATOM    175  OD2 ASP A  29      41.873  25.332  40.686  1.00  0.00           O
ATOM    176  C   ASP A  29      40.615  25.289  45.425  1.00  0.00           C
ATOM    177  O   ASP A  29      39.791  24.399  45.691  1.00  0.00           O
ATOM    178  N   TYR A  30      41.545  25.714  46.301  1.00  0.00           N
ATOM    179  H   TYR A  30      42.142  26.483  46.029  1.00  0.00           H
ATOM    180  CA  TYR A  30      41.687  25.273  47.689  1.00  0.00           C
ATOM    181  HA  TYR A  30      41.841  24.201  47.568  1.00  0.00           H
ATOM    182  CB  TYR A  30      42.870  25.971  48.453  1.00  0.00           C
ATOM    183  HB2 TYR A  30      43.776  25.404  48.241  1.00  0.00           H
ATOM    184  HB3 TYR A  30      43.062  26.988  48.110  1.00  0.00           H
ATOM    185  CG  TYR A  30      42.739  25.932  49.988  1.00  0.00           C
ATOM    186  CD1 TYR A  30      43.557  25.029  50.609  1.00  0.00           C
ATOM    187  HD1 TYR A  30      44.129  24.297  50.057  1.00  0.00           H
ATOM    188  CE1 TYR A  30      43.690  25.075  52.020  1.00  0.00           C
ATOM    189  HE1 TYR A  30      44.297  24.351  52.543  1.00  0.00           H
ATOM    190  CZ  TYR A  30      43.155  26.132  52.731  1.00  0.00           C
ATOM    191  OH  TYR A  30      43.292  26.266  54.084  1.00  0.00           O
ATOM    192  HH  TYR A  30      42.580  26.715  54.545  1.00  0.00           H
ATOM    193  CE2 TYR A  30      42.288  27.054  52.115  1.00  0.00           C
ATOM    194  HE2 TYR A  30      41.869  27.873  52.681  1.00  0.00           H
ATOM    195  CD2 TYR A  30      42.042  26.925  50.750  1.00  0.00           C
ATOM    196  HD2 TYR A  30      41.515  27.717  50.239  1.00  0.00           H
ATOM    197  C   TYR A  30      40.329  25.323  48.338  1.00  0.00           C
ATOM    198  O   TYR A  30      39.754  24.341  48.859  1.00  0.00           O
ATOM    199  N   LEU A  31      39.699  26.530  48.367  1.00  0.00           N
ATOM    200  H   LEU A  31      40.223  27.308  47.992  1.00  0.00           H
ATOM    201  CA  LEU A  31      38.415  26.810  48.978  1.00  0.00           C
ATOM    202  HA  LEU A  31      38.316  26.414  49.988  1.00  0.00           H
ATOM    203  CB  LEU A  31      38.083  28.315  48.975  1.00  0.00           C
ATOM    204  HB2 LEU A  31      38.527  28.804  48.108  1.00  0.00           H
ATOM    205  HB3 LEU A  31      37.003  28.393  48.856  1.00  0.00           H
ATOM    206  CG  LEU A  31      38.461  29.025  50.268  1.00  0.00           C
ATOM    207  HG  LEU A  31      39.444  28.621  50.511  1.00  0.00           H
ATOM    208  CD1 LEU A  31      38.600  30.533  50.017  1.00  0.00           C
ATOM    209 HD11 LEU A  31      39.537  30.756  49.506  1.00  0.00           H
ATOM    210 HD12 LEU A  31      37.747  30.837  49.410  1.00  0.00           H
ATOM    211 HD13 LEU A  31      38.730  30.967  51.008  1.00  0.00           H
ATOM    212  CD2 LEU A  31      37.465  28.692  51.384  1.00  0.00           C
ATOM    213 HD21 LEU A  31      37.735  29.246  52.283  1.00  0.00           H
ATOM    214 HD22 LEU A  31      36.468  28.951  51.029  1.00  0.00           H
ATOM    215 HD23 LEU A  31      37.459  27.631  51.633  1.00  0.00           H
ATOM    216  C   LEU A  31      37.271  25.949  48.257  1.00  0.00           C
ATOM    217  O   LEU A  31      36.410  25.431  48.918  1.00  0.00           O
ATOM    218  N   ALA A  32      37.427  25.776  46.952  1.00  0.00           N
ATOM    219  H   ALA A  32      38.230  26.140  46.460  1.00  0.00           H
ATOM    220  CA  ALA A  32      36.516  24.941  46.160  1.00  0.00           C
ATOM    221  HA  ALA A  32      35.511  25.337  46.306  1.00  0.00           H
ATOM    222  CB  ALA A  32      36.813  25.112  44.686  1.00  0.00           C
ATOM    223  HB1 ALA A  32      36.730  26.189  44.538  1.00  0.00           H
ATOM    224  HB2 ALA A  32      37.834  24.819  44.444  1.00  0.00           H
ATOM    225  HB3 ALA A  32      36.147  24.542  44.037  1.00  0.00           H
ATOM    226  C   ALA A  32      36.645  23.415  46.585  1.00  0.00           C
ATOM    227  O   ALA A  32      35.815  22.578  46.260  1.00  0.00           O
ATOM    228  N   SER A  33      37.715  23.028  47.170  1.00  0.00           N
ATOM    229  H   SER A  33      38.505  23.655  47.124  1.00  0.00           H
ATOM    230  CA  SER A  33      38.002  21.616  47.758  1.00  0.00           C
ATOM    231  HA  SER A  33      37.310  20.924  47.278  1.00  0.00           H
ATOM    232  CB  SER A  33      39.474  21.344  47.401  1.00  0.00           C
ATOM    233  HB2 SER A  33      40.144  21.862  48.087  1.00  0.00           H
ATOM    234  HB3 SER A  33      39.699  20.304  47.634  1.00  0.00           H
ATOM    235  OG  SER A  33      39.742  21.529  46.004  1.00  0.00           O
ATOM    236  HG  SER A  33      39.947  22.453  45.842  1.00  0.00           H
ATOM    237  C   SER A  33      37.702  21.409  49.245  1.00  0.00           C
ATOM    238  O   SER A  33      38.058  20.342  49.801  1.00  0.00           O
ATOM    239  N   GLY A  34      37.033  22.386  49.872  1.00  0.00           N
ATOM    240  H   GLY A  34      36.911  23.205  49.293  1.00  0.00           H
ATOM    241  CA  GLY A  34      36.720  22.392  51.313  1.00  0.00           C
ATOM    242  HA2 GLY A  34      36.045  23.243  51.400  1.00  0.00           H
ATOM    243  HA3 GLY A  34      36.201  21.496  51.654  1.00  0.00           H
ATOM    244  C   GLY A  34      37.923  22.788  52.206  1.00  0.00           C
ATOM    245  O   GLY A  34      37.827  22.610  53.456  1.00  0.00           O
ATOM    246  N   GLY A  35      38.978  23.387  51.696  1.00  0.00           N
ATOM    247  H   GLY A  35      38.967  23.622  50.714  1.00  0.00           H
ATOM    248  CA  GLY A  35      40.092  23.975  52.501  1.00  0.00           C
ATOM    249  HA2 GLY A  35      40.800  23.301  52.984  1.00  0.00           H
ATOM    250  HA3 GLY A  35      40.846  24.423  51.854  1.00  0.00           H
ATOM    251  C   GLY A  35      39.674  25.096  53.459  1.00  0.00           C
ATOM    252  O   GLY A  35      38.981  26.052  53.025  1.00  0.00           O
ATOM    253  N   GLN A  36      39.968  25.117  54.718  1.00  0.00           N
ATOM    254  H   GLN A  36      40.706  24.509  55.043  1.00  0.00           H
ATOM    255  CA  GLN A  36      39.494  26.104  55.698  1.00  0.00           C
ATOM    256  HA  GLN A  36      38.413  26.100  55.562  1.00  0.00           H
ATOM    257  CB  GLN A  36      39.770  25.630  57.145  1.00  0.00           C
ATOM    258  HB2 GLN A  36      39.110  26.116  57.864  1.00  0.00           H
ATOM    259  HB3 GLN A  36      39.498  24.576  57.198  1.00  0.00           H
ATOM    260  CG  GLN A  36      41.237  25.821  57.604  1.00  0.00           C
ATOM    261  HG2 GLN A  36      41.888  25.401  56.837  1.00  0.00           H
ATOM    262  HG3 GLN A  36      41.317  26.888  57.816  1.00  0.00           H
ATOM    263  CD  GLN A  36      41.656  25.200  58.920  1.00  0.00           C
ATOM    264  OE1 GLN A  36      40.939  25.137  59.865  1.00  0.00           O
ATOM    265  NE2 GLN A  36      42.844  24.634  58.902  1.00  0.00           N
ATOM    266 HE21 GLN A  36      43.100  23.955  59.603  1.00  0.00           H
ATOM    267 HE22 GLN A  36      43.395  24.601  58.056  1.00  0.00           H
ATOM    268  C   GLN A  36      40.040  27.550  55.447  1.00  0.00           C
ATOM    269  O   GLN A  36      41.232  27.742  55.203  1.00  0.00           O
ATOM    270  N   PRO A  37      39.153  28.554  55.452  1.00  0.00           N
ATOM    271  CD  PRO A  37      37.674  28.506  55.652  1.00  0.00           C
ATOM    272  HD2 PRO A  37      37.418  28.264  56.684  1.00  0.00           H
ATOM    273  HD3 PRO A  37      37.213  27.711  55.066  1.00  0.00           H
ATOM    274  CG  PRO A  37      37.107  29.913  55.359  1.00  0.00           C
ATOM    275  HG2 PRO A  37      36.357  30.276  56.062  1.00  0.00           H
ATOM    276  HG3 PRO A  37      36.718  29.796  54.347  1.00  0.00           H
ATOM    277  CB  PRO A  37      38.346  30.753  55.307  1.00  0.00           C
ATOM    278  HB2 PRO A  37      38.542  31.193  56.285  1.00  0.00           H
ATOM    279  HB3 PRO A  37      38.266  31.649  54.692  1.00  0.00           H
ATOM    280  CA  PRO A  37      39.561  29.887  54.942  1.00  0.00           C
ATOM    281  HA  PRO A  37      39.595  29.885  53.852  1.00  0.00           H
ATOM    282  C   PRO A  37      40.848  30.444  55.654  1.00  0.00           C
ATOM    283  O   PRO A  37      41.008  30.302  56.895  1.00  0.00           O
ATOM    284  N   ILE A  38      41.686  31.145  54.895  1.00  0.00           N
ATOM    285  H   ILE A  38      41.518  31.256  53.905  1.00  0.00           H
ATOM    286  CA  ILE A  38      42.808  31.863  55.450  1.00  0.00           C
ATOM    287  HA  ILE A  38      43.253  31.226  56.215  1.00  0.00           H
ATOM    288  CB  ILE A  38      43.861  32.078  54.374  1.00  0.00           C
ATOM    289  HB  ILE A  38      43.413  32.465  53.459  1.00  0.00           H
ATOM    290  CG2 ILE A  38      44.907  33.112  54.785  1.00  0.00           C
ATOM    291 HG21 ILE A  38      45.541  32.840  55.629  1.00  0.00           H
ATOM    292 HG22 ILE A  38      45.707  33.275  54.063  1.00  0.00           H
ATOM    293 HG23 ILE A  38      44.427  34.043  55.085  1.00  0.00           H
ATOM    294  CG1 ILE A  38      44.474  30.703  54.018  1.00  0.00           C
ATOM    295 HG12 ILE A  38      45.074  30.322  54.845  1.00  0.00           H
ATOM    296 HG13 ILE A  38      43.646  30.071  53.696  1.00  0.00           H
ATOM    297  CD1 ILE A  38      45.450  30.756  52.799  1.00  0.00           C
ATOM    298 HD11 ILE A  38      46.050  29.845  52.797  1.00  0.00           H
ATOM    299 HD12 ILE A  38      44.948  30.831  51.835  1.00  0.00           H
ATOM    300 HD13 ILE A  38      46.170  31.561  52.947  1.00  0.00           H
ATOM    301  C   ILE A  38      42.443  33.058  56.327  1.00  0.00           C
ATOM    302  O   ILE A  38      41.515  33.829  56.023  1.00  0.00           O
ATOM    303  N   THR A  39      43.251  33.261  57.387  1.00  0.00           N
ATOM    304  H   THR A  39      43.908  32.545  57.659  1.00  0.00           H
ATOM    305  CA  THR A  39      42.985  34.263  58.506  1.00  0.00           C
ATOM    306  HA  THR A  39      42.414  35.127  58.166  1.00  0.00           H
ATOM    307  CB  THR A  39      42.179  33.627  59.682  1.00  0.00           C
ATOM    308  HB  THR A  39      41.157  33.574  59.306  1.00  0.00           H
ATOM    309  CG2 THR A  39      42.510  32.183  59.965  1.00  0.00           C
ATOM    310 HG21 THR A  39      42.158  31.331  59.383  1.00  0.00           H
ATOM    311 HG22 THR A  39      43.584  32.126  60.138  1.00  0.00           H
ATOM    312 HG23 THR A  39      42.008  31.963  60.907  1.00  0.00           H
ATOM    313  OG1 THR A  39      42.098  34.431  60.842  1.00  0.00           O
ATOM    314  HG1 THR A  39      41.151  34.550  60.944  1.00  0.00           H
ATOM    315  C   THR A  39      44.304  34.795  59.099  1.00  0.00           C
ATOM    316  O   THR A  39      45.275  34.071  58.998  1.00  0.00           O
ATOM    317  N   ASN A  40      44.249  35.918  59.730  1.00  0.00           N
ATOM    318  H   ASN A  40      43.433  36.507  59.648  1.00  0.00           H
ATOM    319  CA  ASN A  40      45.304  36.463  60.593  1.00  0.00           C
ATOM    320  HA  ASN A  40      44.944  37.435  60.928  1.00  0.00           H
ATOM    321  CB  ASN A  40      45.679  35.594  61.848  1.00  0.00           C
ATOM    322  HB2 ASN A  40      45.715  34.539  61.574  1.00  0.00           H
ATOM    323  HB3 ASN A  40      46.698  35.856  62.133  1.00  0.00           H
ATOM    324  CG  ASN A  40      44.851  35.871  63.115  1.00  0.00           C
ATOM    325  OD1 ASN A  40      45.240  36.771  63.888  1.00  0.00           O
ATOM    326  ND2 ASN A  40      43.666  35.284  63.243  1.00  0.00           N
ATOM    327 HD21 ASN A  40      43.210  35.459  64.127  1.00  0.00           H
ATOM    328 HD22 ASN A  40      43.407  34.657  62.496  1.00  0.00           H
ATOM    329  C   ASN A  40      46.553  36.857  59.743  1.00  0.00           C
ATOM    330  O   ASN A  40      47.438  36.060  59.474  1.00  0.00           O
ATOM    331  N   CYS A  41      46.662  38.129  59.359  1.00  0.00           N
ATOM    332  H   CYS A  41      45.817  38.682  59.337  1.00  0.00           H
ATOM    333  CA  CYS A  41      47.886  38.825  58.895  1.00  0.00           C
ATOM    334  HA  CYS A  41      48.545  38.042  58.519  1.00  0.00           H
ATOM    335  CB  CYS A  41      47.514  39.754  57.751  1.00  0.00           C
ATOM    336  HB2 CYS A  41      46.850  40.481  58.219  1.00  0.00           H
ATOM    337  HB3 CYS A  41      48.374  40.227  57.276  1.00  0.00           H
ATOM    338  SG  CYS A  41      46.617  38.809  56.451  1.00  0.00           S
ATOM    339  HG  CYS A  41      47.623  38.198  55.819  1.00  0.00           H
ATOM    340  C   CYS A  41      48.600  39.635  59.990  1.00  0.00           C
ATOM    341  O   CYS A  41      47.906  40.105  60.908  1.00  0.00           O
ATOM    342  N   VAL A  42      49.916  39.805  60.004  1.00  0.00           N
ATOM    343  H   VAL A  42      50.417  39.637  59.143  1.00  0.00           H
ATOM    344  CA  VAL A  42      50.668  40.635  60.972  1.00  0.00           C
ATOM    345  HA  VAL A  42      50.247  40.534  61.972  1.00  0.00           H
ATOM    346  CB  VAL A  42      52.111  40.171  60.876  1.00  0.00           C
ATOM    347  HB  VAL A  42      52.348  40.362  59.829  1.00  0.00           H
ATOM    348  CG1 VAL A  42      53.067  40.929  61.784  1.00  0.00           C
ATOM    349 HG11 VAL A  42      54.095  40.569  61.750  1.00  0.00           H
ATOM    350 HG12 VAL A  42      53.102  41.966  61.450  1.00  0.00           H
ATOM    351 HG13 VAL A  42      52.681  40.808  62.797  1.00  0.00           H
ATOM    352  CG2 VAL A  42      52.290  38.689  61.212  1.00  0.00           C
ATOM    353 HG21 VAL A  42      51.927  38.509  62.224  1.00  0.00           H
ATOM    354 HG22 VAL A  42      51.765  38.108  60.453  1.00  0.00           H
ATOM    355 HG23 VAL A  42      53.348  38.428  61.201  1.00  0.00           H
ATOM    356  C   VAL A  42      50.547  42.077  60.603  1.00  0.00           C
ATOM    357  O   VAL A  42      51.027  42.564  59.549  1.00  0.00           O
ATOM    358  N   LYS A  43      49.787  42.763  61.434  1.00  0.00           N
ATOM    359  H   LYS A  43      49.226  42.242  62.093  1.00  0.00           H
ATOM    360  CA  LYS A  43      49.741  44.236  61.424  1.00  0.00           C
ATOM    361  HA  LYS A  43      49.629  44.655  60.424  1.00  0.00           H
ATOM    362  CB  LYS A  43      48.519  44.704  62.235  1.00  0.00           C
ATOM    363  HB2 LYS A  43      47.638  44.194  61.847  1.00  0.00           H
ATOM    364  HB3 LYS A  43      48.529  44.373  63.274  1.00  0.00           H
ATOM    365  CG  LYS A  43      48.105  46.239  62.119  1.00  0.00           C
ATOM    366  HG2 LYS A  43      48.849  46.825  62.658  1.00  0.00           H
ATOM    367  HG3 LYS A  43      48.087  46.476  61.055  1.00  0.00           H
ATOM    368  CD  LYS A  43      46.695  46.525  62.683  1.00  0.00           C
ATOM    369  HD2 LYS A  43      45.858  46.272  62.032  1.00  0.00           H
ATOM    370  HD3 LYS A  43      46.540  45.890  63.555  1.00  0.00           H
ATOM    371  CE  LYS A  43      46.506  48.010  62.936  1.00  0.00           C
ATOM    372  HE2 LYS A  43      47.201  48.389  63.685  1.00  0.00           H
ATOM    373  HE3 LYS A  43      46.648  48.619  62.043  1.00  0.00           H
ATOM    374  NZ  LYS A  43      45.081  48.274  63.413  1.00  0.00           N
ATOM    375  HZ1 LYS A  43      44.919  49.271  63.380  1.00  0.00           H
ATOM    376  HZ2 LYS A  43      44.381  47.911  62.782  1.00  0.00           H
ATOM    377  HZ3 LYS A  43      44.830  47.920  64.325  1.00  0.00           H
ATOM    378  C   LYS A  43      50.958  44.917  61.981  1.00  0.00           C
ATOM    379  O   LYS A  43      51.468  44.487  62.993  1.00  0.00           O
ATOM    380  N   MET A  44      51.351  46.089  61.452  1.00  0.00           N
ATOM    381  H   MET A  44      50.792  46.558  60.753  1.00  0.00           H
ATOM    382  CA  MET A  44      52.472  46.838  62.044  1.00  0.00           C
ATOM    383  HA  MET A  44      53.145  46.088  62.460  1.00  0.00           H
ATOM    384  CB  MET A  44      53.318  47.519  60.874  1.00  0.00           C
ATOM    385  HB2 MET A  44      52.815  48.381  60.434  1.00  0.00           H
ATOM    386  HB3 MET A  44      54.237  47.905  61.313  1.00  0.00           H
ATOM    387  CG  MET A  44      53.619  46.446  59.769  1.00  0.00           C
ATOM    388  HG2 MET A  44      52.693  46.310  59.210  1.00  0.00           H
ATOM    389  HG3 MET A  44      54.307  46.888  59.048  1.00  0.00           H
ATOM    390  SD  MET A  44      54.268  44.811  60.378  1.00  0.00           S
ATOM    391  CE  MET A  44      55.672  45.392  61.427  1.00  0.00           C
ATOM    392  HE1 MET A  44      56.264  44.523  61.714  1.00  0.00           H
ATOM    393  HE2 MET A  44      56.273  46.200  61.010  1.00  0.00           H
ATOM    394  HE3 MET A  44      55.326  45.803  62.376  1.00  0.00           H
ATOM    395  C   MET A  44      52.152  47.929  63.133  1.00  0.00           C
ATOM    396  O   MET A  44      51.068  48.487  63.062  1.00  0.00           O
ATOM    397  N   LEU A  45      53.123  48.313  63.895  1.00  0.00           N
ATOM    398  H   LEU A  45      53.987  47.817  64.060  1.00  0.00           H
ATOM    399  CA  LEU A  45      53.075  49.587  64.666  1.00  0.00           C
ATOM    400  HA  LEU A  45      52.054  49.865  64.925  1.00  0.00           H
ATOM    401  CB  LEU A  45      53.904  49.414  65.981  1.00  0.00           C
ATOM    402  HB2 LEU A  45      54.903  49.056  65.731  1.00  0.00           H
ATOM    403  HB3 LEU A  45      54.031  50.446  66.308  1.00  0.00           H
ATOM    404  CG  LEU A  45      53.283  48.620  67.143  1.00  0.00           C
ATOM    405  HG  LEU A  45      53.921  48.829  68.001  1.00  0.00           H
ATOM    406  CD1 LEU A  45      51.853  48.850  67.554  1.00  0.00           C
ATOM    407 HD11 LEU A  45      51.818  49.886  67.891  1.00  0.00           H
ATOM    408 HD12 LEU A  45      51.177  48.544  66.755  1.00  0.00           H
ATOM    409 HD13 LEU A  45      51.595  48.177  68.371  1.00  0.00           H
ATOM    410  CD2 LEU A  45      53.443  47.094  66.898  1.00  0.00           C
ATOM    411 HD21 LEU A  45      54.472  46.810  66.674  1.00  0.00           H
ATOM    412 HD22 LEU A  45      53.105  46.595  67.806  1.00  0.00           H
ATOM    413 HD23 LEU A  45      52.785  46.902  66.051  1.00  0.00           H
ATOM    414  C   LEU A  45      53.694  50.747  63.825  1.00  0.00           C
ATOM    415  O   LEU A  45      54.589  50.497  63.049  1.00  0.00           O
ATOM    416  N   CYS A  46      53.231  51.993  64.038  1.00  0.00           N
ATOM    417  H   CYS A  46      52.545  52.044  64.777  1.00  0.00           H
ATOM    418  CA  CYS A  46      53.269  53.142  63.121  1.00  0.00           C
ATOM    419  HA  CYS A  46      54.088  52.916  62.438  1.00  0.00           H
ATOM    420  CB  CYS A  46      51.994  52.873  62.237  1.00  0.00           C
ATOM    421  HB2 CYS A  46      51.136  52.451  62.760  1.00  0.00           H
ATOM    422  HB3 CYS A  46      51.706  53.762  61.675  1.00  0.00           H
ATOM    423  SG  CYS A  46      52.393  51.577  61.001  1.00  0.00           S
ATOM    424  HG  CYS A  46      53.492  51.053  61.550  1.00  0.00           H
ATOM    425  C   CYS A  46      53.252  54.546  63.726  1.00  0.00           C
ATOM    426  O   CYS A  46      52.829  54.585  64.839  1.00  0.00           O
ATOM    427  N   THR A  47      53.620  55.682  63.054  1.00  0.00           N
ATOM    428  H   THR A  47      54.009  55.571  62.128  1.00  0.00           H
ATOM    429  CA  THR A  47      53.269  57.113  63.520  1.00  0.00           C
ATOM    430  HA  THR A  47      53.010  57.091  64.579  1.00  0.00           H
ATOM    431  CB  THR A  47      54.437  58.139  63.215  1.00  0.00           C
ATOM    432  HB  THR A  47      54.156  59.167  63.444  1.00  0.00           H
ATOM    433  CG2 THR A  47      55.681  57.728  63.960  1.00  0.00           C
ATOM    434 HG21 THR A  47      56.443  58.485  63.777  1.00  0.00           H
ATOM    435 HG22 THR A  47      55.436  57.694  65.021  1.00  0.00           H
ATOM    436 HG23 THR A  47      56.059  56.769  63.605  1.00  0.00           H
ATOM    437  OG1 THR A  47      54.659  58.011  61.831  1.00  0.00           O
ATOM    438  HG1 THR A  47      55.449  57.484  61.689  1.00  0.00           H
ATOM    439  C   THR A  47      51.952  57.586  62.891  1.00  0.00           C
ATOM    440  O   THR A  47      51.366  58.628  63.228  1.00  0.00           O
ATOM    441  N   HIE A  48      51.496  56.931  61.789  1.00  0.00           N
ATOM    442  H   HIE A  48      51.955  56.066  61.542  1.00  0.00           H
ATOM    443  CA  HIE A  48      50.345  57.338  60.949  1.00  0.00           C
ATOM    444  HA  HIE A  48      50.279  56.588  60.161  1.00  0.00           H
ATOM    445  CB  HIE A  48      49.018  57.140  61.657  1.00  0.00           C
ATOM    446  HB2 HIE A  48      48.946  57.834  62.494  1.00  0.00           H
ATOM    447  HB3 HIE A  48      48.221  57.555  61.040  1.00  0.00           H
ATOM    448  CG  HIE A  48      48.861  55.696  62.046  1.00  0.00           C
ATOM    449  ND1 HIE A  48      49.187  55.236  63.271  1.00  0.00           N
ATOM    450  CE1 HIE A  48      48.887  53.910  63.218  1.00  0.00           C
ATOM    451  HE1 HIE A  48      49.002  53.173  63.999  1.00  0.00           H
ATOM    452  NE2 HIE A  48      48.325  53.569  62.046  1.00  0.00           N
ATOM    453  HE2 HIE A  48      47.842  52.701  61.863  1.00  0.00           H
ATOM    454  CD2 HIE A  48      48.262  54.724  61.266  1.00  0.00           C
ATOM    455  HD2 HIE A  48      47.954  54.804  60.234  1.00  0.00           H
ATOM    456  C   HIE A  48      50.623  58.625  60.119  1.00  0.00           C
ATOM    457  O   HIE A  48      49.752  59.396  59.752  1.00  0.00           O
ATOM    458  N   THR A  49      51.884  58.892  59.857  1.00  0.00           N
ATOM    459  H   THR A  49      52.597  58.452  60.421  1.00  0.00           H
ATOM    460  CA  THR A  49      52.399  60.074  59.120  1.00  0.00           C
ATOM    461  HA  THR A  49      51.528  60.704  58.934  1.00  0.00           H
ATOM    462  CB  THR A  49      53.363  60.916  59.971  1.00  0.00           C
ATOM    463  HB  THR A  49      53.643  61.802  59.400  1.00  0.00           H
ATOM    464  CG2 THR A  49      52.896  61.525  61.236  1.00  0.00           C
ATOM    465 HG21 THR A  49      52.035  62.185  61.131  1.00  0.00           H
ATOM    466 HG22 THR A  49      52.474  60.722  61.842  1.00  0.00           H
ATOM    467 HG23 THR A  49      53.690  61.978  61.830  1.00  0.00           H
ATOM    468  OG1 THR A  49      54.533  60.230  60.200  1.00  0.00           O
ATOM    469  HG1 THR A  49      54.452  59.588  60.909  1.00  0.00           H
ATOM    470  C   THR A  49      53.057  59.696  57.760  1.00  0.00           C
ATOM    471  O   THR A  49      53.471  60.517  56.915  1.00  0.00           O
ATOM    472  N   GLY A  50      53.024  58.378  57.485  1.00  0.00           N
ATOM    473  H   GLY A  50      52.477  57.786  58.093  1.00  0.00           H
ATOM    474  CA  GLY A  50      53.707  57.921  56.222  1.00  0.00           C
ATOM    475  HA2 GLY A  50      54.752  58.232  56.223  1.00  0.00           H
ATOM    476  HA3 GLY A  50      53.646  56.835  56.302  1.00  0.00           H
ATOM    477  C   GLY A  50      52.890  58.349  54.991  1.00  0.00           C
ATOM    478  O   GLY A  50      51.758  58.812  55.072  1.00  0.00           O
ATOM    479  N   THR A  51      53.552  58.202  53.869  1.00  0.00           N
ATOM    480  H   THR A  51      54.464  57.768  53.875  1.00  0.00           H
ATOM    481  CA  THR A  51      53.103  58.625  52.546  1.00  0.00           C
ATOM    482  HA  THR A  51      52.607  59.571  52.764  1.00  0.00           H
ATOM    483  CB  THR A  51      54.268  58.844  51.497  1.00  0.00           C
ATOM    484  HB  THR A  51      53.916  59.198  50.528  1.00  0.00           H
ATOM    485  CG2 THR A  51      55.076  59.984  52.031  1.00  0.00           C
ATOM    486 HG21 THR A  51      54.488  60.899  52.096  1.00  0.00           H
ATOM    487 HG22 THR A  51      55.539  59.784  52.998  1.00  0.00           H
ATOM    488 HG23 THR A  51      55.856  60.304  51.340  1.00  0.00           H
ATOM    489  OG1 THR A  51      55.131  57.704  51.281  1.00  0.00           O
ATOM    490  HG1 THR A  51      54.712  56.993  50.790  1.00  0.00           H
ATOM    491  C   THR A  51      52.016  57.820  51.827  1.00  0.00           C
ATOM    492  O   THR A  51      51.510  58.254  50.798  1.00  0.00           O
ATOM    493  N   GLY A  52      51.471  56.752  52.454  1.00  0.00           N
ATOM    494  H   GLY A  52      51.899  56.403  53.299  1.00  0.00           H
ATOM    495  CA  GLY A  52      50.216  56.105  52.064  1.00  0.00           C
ATOM    496  HA2 GLY A  52      49.933  55.323  52.769  1.00  0.00           H
ATOM    497  HA3 GLY A  52      49.427  56.853  51.996  1.00  0.00           H
ATOM    498  C   GLY A  52      50.088  55.307  50.708  1.00  0.00           C
ATOM    499  O   GLY A  52      49.026  54.665  50.453  1.00  0.00           O
ATOM    500  N   GLN A  53      51.120  55.252  49.894  1.00  0.00           N
ATOM    501  H   GLN A  53      51.830  55.961  50.012  1.00  0.00           H
ATOM    502  CA  GLN A  53      51.115  54.375  48.680  1.00  0.00           C
ATOM    503  HA  GLN A  53      50.244  54.669  48.095  1.00  0.00           H
ATOM    504  CB  GLN A  53      52.428  54.490  47.930  1.00  0.00           C
ATOM    505  HB2 GLN A  53      53.289  54.069  48.449  1.00  0.00           H
ATOM    506  HB3 GLN A  53      52.474  53.844  47.053  1.00  0.00           H
ATOM    507  CG  GLN A  53      52.565  55.859  47.286  1.00  0.00           C
ATOM    508  HG2 GLN A  53      52.783  55.891  46.218  1.00  0.00           H
ATOM    509  HG3 GLN A  53      51.566  56.295  47.316  1.00  0.00           H
ATOM    510  CD  GLN A  53      53.465  56.770  48.094  1.00  0.00           C
ATOM    511  OE1 GLN A  53      54.187  56.367  49.015  1.00  0.00           O
ATOM    512  NE2 GLN A  53      53.672  58.018  47.743  1.00  0.00           N
ATOM    513 HE21 GLN A  53      54.459  58.530  48.116  1.00  0.00           H
ATOM    514 HE22 GLN A  53      53.193  58.312  46.904  1.00  0.00           H
ATOM    515  C   GLN A  53      50.822  52.889  49.072  1.00  0.00           C
ATOM    516  O   GLN A  53      50.955  52.445  50.221  1.00  0.00           O
ATOM    517  N   ALA A  54      50.174  52.217  48.139  1.00  0.00           N
ATOM    518  H   ALA A  54      50.088  52.638  47.225  1.00  0.00           H
ATOM    519  CA  ALA A  54      49.402  51.012  48.366  1.00  0.00           C
ATOM    520  HA  ALA A  54      48.648  51.214  49.126  1.00  0.00           H
ATOM    521  CB  ALA A  54      48.697  50.628  47.076  1.00  0.00           C
ATOM    522  HB1 ALA A  54      49.340  50.319  46.252  1.00  0.00           H
ATOM    523  HB2 ALA A  54      48.056  49.752  47.176  1.00  0.00           H
ATOM    524  HB3 ALA A  54      47.983  51.401  46.792  1.00  0.00           H
ATOM    525  C   ALA A  54      50.256  49.870  48.938  1.00  0.00           C
ATOM    526  O   ALA A  54      49.977  49.297  49.983  1.00  0.00           O
ATOM    527  N   ILE A  55      51.320  49.439  48.217  1.00  0.00           N
ATOM    528  H   ILE A  55      51.434  49.856  47.305  1.00  0.00           H
ATOM    529  CA  ILE A  55      52.422  48.530  48.649  1.00  0.00           C
ATOM    530  HA  ILE A  55      52.175  48.187  49.654  1.00  0.00           H
ATOM    531  CB  ILE A  55      52.515  47.326  47.726  1.00  0.00           C
ATOM    532  HB  ILE A  55      52.574  47.750  46.724  1.00  0.00           H
ATOM    533  CG2 ILE A  55      53.809  46.463  47.997  1.00  0.00           C
ATOM    534 HG21 ILE A  55      53.872  45.547  47.410  1.00  0.00           H
ATOM    535 HG22 ILE A  55      54.754  47.005  48.021  1.00  0.00           H
ATOM    536 HG23 ILE A  55      53.539  46.182  49.015  1.00  0.00           H
ATOM    537  CG1 ILE A  55      51.229  46.486  47.838  1.00  0.00           C
ATOM    538 HG12 ILE A  55      51.273  45.853  48.724  1.00  0.00           H
ATOM    539 HG13 ILE A  55      50.357  47.140  47.868  1.00  0.00           H
ATOM    540  CD1 ILE A  55      51.035  45.554  46.616  1.00  0.00           C
ATOM    541 HD11 ILE A  55      51.900  44.896  46.542  1.00  0.00           H
ATOM    542 HD12 ILE A  55      50.255  44.821  46.822  1.00  0.00           H
ATOM    543 HD13 ILE A  55      50.965  46.113  45.683  1.00  0.00           H
ATOM    544  C   ILE A  55      53.701  49.381  48.781  1.00  0.00           C
ATOM    545  O   ILE A  55      53.936  50.195  47.906  1.00  0.00           O
ATOM    546  N   THR A  56      54.611  49.142  49.752  1.00  0.00           N
ATOM    547  H   THR A  56      54.365  48.392  50.381  1.00  0.00           H
ATOM    548  CA  THR A  56      55.831  49.904  50.001  1.00  0.00           C
ATOM    549  HA  THR A  56      56.200  50.286  49.049  1.00  0.00           H
ATOM    550  CB  THR A  56      55.588  51.091  50.991  1.00  0.00           C
ATOM    551  HB  THR A  56      56.529  51.624  51.132  1.00  0.00           H
ATOM    552  CG2 THR A  56      54.532  52.019  50.571  1.00  0.00           C
ATOM    553 HG21 THR A  56      53.546  51.559  50.644  1.00  0.00           H
ATOM    554 HG22 THR A  56      54.409  52.915  51.179  1.00  0.00           H
ATOM    555 HG23 THR A  56      54.788  52.426  49.593  1.00  0.00           H
ATOM    556  OG1 THR A  56      55.099  50.606  52.278  1.00  0.00           O
ATOM    557  HG1 THR A  56      55.843  50.708  52.876  1.00  0.00           H
ATOM    558  C   THR A  56      56.915  48.885  50.537  1.00  0.00           C
ATOM    559  O   THR A  56      56.656  47.811  51.001  1.00  0.00           O
ATOM    560  N   VAL A  57      58.156  49.352  50.531  1.00  0.00           N
ATOM    561  H   VAL A  57      58.366  50.304  50.266  1.00  0.00           H
ATOM    562  CA  VAL A  57      59.356  48.585  51.050  1.00  0.00           C
ATOM    563  HA  VAL A  57      59.270  47.585  50.624  1.00  0.00           H
ATOM    564  CB  VAL A  57      60.661  49.079  50.322  1.00  0.00           C
ATOM    565  HB  VAL A  57      60.394  49.367  49.305  1.00  0.00           H
ATOM    566  CG1 VAL A  57      61.125  50.456  50.994  1.00  0.00           C
ATOM    567 HG11 VAL A  57      60.322  51.148  51.249  1.00  0.00           H
ATOM    568 HG12 VAL A  57      61.617  50.114  51.904  1.00  0.00           H
ATOM    569 HG13 VAL A  57      61.947  50.850  50.396  1.00  0.00           H
ATOM    570  CG2 VAL A  57      61.781  48.038  50.195  1.00  0.00           C
ATOM    571 HG21 VAL A  57      62.125  47.685  51.167  1.00  0.00           H
ATOM    572 HG22 VAL A  57      61.457  47.184  49.600  1.00  0.00           H
ATOM    573 HG23 VAL A  57      62.552  48.521  49.595  1.00  0.00           H
ATOM    574  C   VAL A  57      59.588  48.460  52.560  1.00  0.00           C
ATOM    575  O   VAL A  57      60.147  47.486  53.026  1.00  0.00           O
ATOM    576  N   THR A  58      58.994  49.398  53.338  1.00  0.00           N
ATOM    577  H   THR A  58      58.516  50.098  52.789  1.00  0.00           H
ATOM    578  CA  THR A  58      58.927  49.610  54.776  1.00  0.00           C
ATOM    579  HA  THR A  58      58.965  48.664  55.315  1.00  0.00           H
ATOM    580  CB  THR A  58      60.040  50.573  55.345  1.00  0.00           C
ATOM    581  HB  THR A  58      59.701  50.907  56.326  1.00  0.00           H
ATOM    582  CG2 THR A  58      61.480  49.985  55.419  1.00  0.00           C
ATOM    583 HG21 THR A  58      61.563  49.389  56.327  1.00  0.00           H
ATOM    584 HG22 THR A  58      61.633  49.307  54.580  1.00  0.00           H
ATOM    585 HG23 THR A  58      62.226  50.779  55.446  1.00  0.00           H
ATOM    586  OG1 THR A  58      60.014  51.761  54.517  1.00  0.00           O
ATOM    587  HG1 THR A  58      59.424  52.381  54.952  1.00  0.00           H
ATOM    588  C   THR A  58      57.550  50.142  55.101  1.00  0.00           C
ATOM    589  O   THR A  58      56.928  50.797  54.235  1.00  0.00           O
ATOM    590  N   PRO A  59      56.955  49.848  56.280  1.00  0.00           N
ATOM    591  CD  PRO A  59      57.559  49.192  57.405  1.00  0.00           C
ATOM    592  HD2 PRO A  59      58.353  49.793  57.849  1.00  0.00           H
ATOM    593  HD3 PRO A  59      57.910  48.179  57.206  1.00  0.00           H
ATOM    594  CG  PRO A  59      56.469  48.878  58.368  1.00  0.00           C
ATOM    595  HG2 PRO A  59      56.837  48.737  59.384  1.00  0.00           H
ATOM    596  HG3 PRO A  59      56.119  47.869  58.153  1.00  0.00           H
ATOM    597  CB  PRO A  59      55.553  50.056  58.104  1.00  0.00           C
ATOM    598  HB2 PRO A  59      56.004  50.867  58.675  1.00  0.00           H
ATOM    599  HB3 PRO A  59      54.525  49.767  58.322  1.00  0.00           H
ATOM    600  CA  PRO A  59      55.681  50.394  56.663  1.00  0.00           C
ATOM    601  HA  PRO A  59      54.920  49.944  56.025  1.00  0.00           H
ATOM    602  C   PRO A  59      55.509  51.948  56.464  1.00  0.00           C
ATOM    603  O   PRO A  59      56.234  52.797  56.969  1.00  0.00           O
ATOM    604  N   GLU A  60      54.349  52.413  55.918  1.00  0.00           N
ATOM    605  H   GLU A  60      53.799  51.644  55.565  1.00  0.00           H
ATOM    606  CA  GLU A  60      54.212  53.700  55.254  1.00  0.00           C
ATOM    607  HA  GLU A  60      54.866  54.361  55.822  1.00  0.00           H
ATOM    608  CB  GLU A  60      54.614  53.609  53.766  1.00  0.00           C
ATOM    609  HB2 GLU A  60      55.481  52.954  53.685  1.00  0.00           H
ATOM    610  HB3 GLU A  60      53.780  53.247  53.164  1.00  0.00           H
ATOM    611  CG  GLU A  60      55.058  54.970  53.063  1.00  0.00           C
ATOM    612  HG2 GLU A  60      55.247  54.863  51.995  1.00  0.00           H
ATOM    613  HG3 GLU A  60      54.229  55.676  53.104  1.00  0.00           H
ATOM    614  CD  GLU A  60      56.350  55.461  53.681  1.00  0.00           C
ATOM    615  OE1 GLU A  60      56.342  56.435  54.427  1.00  0.00           O
ATOM    616  OE2 GLU A  60      57.426  54.849  53.593  1.00  0.00           O
ATOM    617  C   GLU A  60      52.799  54.267  55.404  1.00  0.00           C
ATOM    618  O   GLU A  60      52.408  55.181  54.715  1.00  0.00           O
ATOM    619  N   ALA A  61      51.902  53.714  56.305  1.00  0.00           N
ATOM    620  H   ALA A  61      52.103  52.787  56.652  1.00  0.00           H
ATOM    621  CA  ALA A  61      50.556  54.159  56.622  1.00  0.00           C
ATOM    622  HA  ALA A  61      50.046  54.125  55.659  1.00  0.00           H
ATOM    623  CB  ALA A  61      49.891  53.404  57.797  1.00  0.00           C
ATOM    624  HB1 ALA A  61      49.700  52.346  57.615  1.00  0.00           H
ATOM    625  HB2 ALA A  61      50.522  53.582  58.668  1.00  0.00           H
ATOM    626  HB3 ALA A  61      48.935  53.887  57.999  1.00  0.00           H
ATOM    627  C   ALA A  61      50.595  55.645  57.028  1.00  0.00           C
ATOM    628  O   ALA A  61      51.397  56.130  57.824  1.00  0.00           O
ATOM    629  N   ASN A  62      49.620  56.392  56.476  1.00  0.00           N
ATOM    630  H   ASN A  62      49.024  56.012  55.755  1.00  0.00           H
ATOM    631  CA  ASN A  62      49.124  57.656  57.044  1.00  0.00           C
ATOM    632  HA  ASN A  62      50.014  58.163  57.418  1.00  0.00           H
ATOM    633  CB  ASN A  62      48.664  58.458  55.814  1.00  0.00           C
ATOM    634  HB2 ASN A  62      49.324  58.241  54.975  1.00  0.00           H
ATOM    635  HB3 ASN A  62      47.666  58.091  55.574  1.00  0.00           H
ATOM    636  CG  ASN A  62      48.666  59.963  56.032  1.00  0.00           C
ATOM    637  OD1 ASN A  62      47.664  60.553  56.299  1.00  0.00           O
ATOM    638  ND2 ASN A  62      49.794  60.693  55.994  1.00  0.00           N
ATOM    639 HD21 ASN A  62      49.781  61.697  56.094  1.00  0.00           H
ATOM    640 HD22 ASN A  62      50.669  60.215  55.831  1.00  0.00           H
ATOM    641  C   ASN A  62      47.991  57.511  58.144  1.00  0.00           C
ATOM    642  O   ASN A  62      47.745  56.506  58.738  1.00  0.00           O
ATOM    643  N   MET A  63      47.191  58.547  58.330  1.00  0.00           N
ATOM    644  H   MET A  63      47.379  59.337  57.729  1.00  0.00           H
ATOM    645  CA  MET A  63      46.008  58.629  59.265  1.00  0.00           C
ATOM    646  HA  MET A  63      46.312  58.402  60.287  1.00  0.00           H
ATOM    647  CB  MET A  63      45.405  60.033  59.210  1.00  0.00           C
ATOM    648  HB2 MET A  63      46.232  60.676  59.511  1.00  0.00           H
ATOM    649  HB3 MET A  63      44.970  60.247  58.233  1.00  0.00           H
ATOM    650  CG  MET A  63      44.247  60.226  60.196  1.00  0.00           C
ATOM    651  HG2 MET A  63      43.411  59.894  59.581  1.00  0.00           H
ATOM    652  HG3 MET A  63      44.348  59.458  60.963  1.00  0.00           H
ATOM    653  SD  MET A  63      43.979  61.900  60.738  1.00  0.00           S
ATOM    654  CE  MET A  63      42.968  62.473  59.364  1.00  0.00           C
ATOM    655  HE1 MET A  63      43.605  62.265  58.504  1.00  0.00           H
ATOM    656  HE2 MET A  63      41.949  62.087  59.344  1.00  0.00           H
ATOM    657  HE3 MET A  63      42.854  63.556  59.418  1.00  0.00           H
ATOM    658  C   MET A  63      44.952  57.578  59.039  1.00  0.00           C
ATOM    659  O   MET A  63      44.605  56.815  59.932  1.00  0.00           O
ATOM    660  N   ASP A  64      44.311  57.562  57.863  1.00  0.00           N
ATOM    661  H   ASP A  64      44.652  58.255  57.212  1.00  0.00           H
ATOM    662  CA  ASP A  64      43.113  56.706  57.539  1.00  0.00           C
ATOM    663  HA  ASP A  64      42.398  56.586  58.353  1.00  0.00           H
ATOM    664  CB  ASP A  64      42.329  57.412  56.415  1.00  0.00           C
ATOM    665  HB2 ASP A  64      43.107  57.623  55.681  1.00  0.00           H
ATOM    666  HB3 ASP A  64      41.617  56.687  56.021  1.00  0.00           H
ATOM    667  CG  ASP A  64      41.750  58.761  56.884  1.00  0.00           C
ATOM    668  OD1 ASP A  64      41.393  58.899  58.054  1.00  0.00           O
ATOM    669  OD2 ASP A  64      41.568  59.586  55.927  1.00  0.00           O
ATOM    670  C   ASP A  64      43.538  55.275  57.054  1.00  0.00           C
ATOM    671  O   ASP A  64      43.011  54.679  56.112  1.00  0.00           O
ATOM    672  N   GLN A  65      44.408  54.689  57.800  1.00  0.00           N
ATOM    673  H   GLN A  65      44.757  55.319  58.508  1.00  0.00           H
ATOM    674  CA  GLN A  65      45.101  53.528  57.311  1.00  0.00           C
ATOM    675  HA  GLN A  65      44.386  52.856  56.836  1.00  0.00           H
ATOM    676  CB  GLN A  65      46.269  53.882  56.298  1.00  0.00           C
ATOM    677  HB2 GLN A  65      46.977  54.549  56.790  1.00  0.00           H
ATOM    678  HB3 GLN A  65      46.739  52.905  56.181  1.00  0.00           H
ATOM    679  CG  GLN A  65      45.877  54.511  54.943  1.00  0.00           C
ATOM    680  HG2 GLN A  65      45.044  53.972  54.493  1.00  0.00           H
ATOM    681  HG3 GLN A  65      45.493  55.516  55.119  1.00  0.00           H
ATOM    682  CD  GLN A  65      47.090  54.674  53.989  1.00  0.00           C
ATOM    683  OE1 GLN A  65      48.173  55.111  54.368  1.00  0.00           O
ATOM    684  NE2 GLN A  65      47.001  54.279  52.738  1.00  0.00           N
ATOM    685 HE21 GLN A  65      47.798  54.649  52.239  1.00  0.00           H
ATOM    686 HE22 GLN A  65      46.155  53.989  52.269  1.00  0.00           H
ATOM    687  C   GLN A  65      45.692  52.600  58.356  1.00  0.00           C
ATOM    688  O   GLN A  65      46.377  53.006  59.347  1.00  0.00           O
ATOM    689  N   GLU A  66      45.807  51.315  58.009  1.00  0.00           N
ATOM    690  H   GLU A  66      45.448  51.108  57.087  1.00  0.00           H
ATOM    691  CA  GLU A  66      46.619  50.307  58.767  1.00  0.00           C
ATOM    692  HA  GLU A  66      46.851  50.733  59.743  1.00  0.00           H
ATOM    693  CB  GLU A  66      45.792  49.057  59.024  1.00  0.00           C
ATOM    694  HB2 GLU A  66      45.725  48.516  58.080  1.00  0.00           H
ATOM    695  HB3 GLU A  66      46.289  48.481  59.804  1.00  0.00           H
ATOM    696  CG  GLU A  66      44.302  49.361  59.411  1.00  0.00           C
ATOM    697  HG2 GLU A  66      43.767  49.815  58.576  1.00  0.00           H
ATOM    698  HG3 GLU A  66      43.867  48.372  59.555  1.00  0.00           H
ATOM    699  CD  GLU A  66      44.072  50.175  60.676  1.00  0.00           C
ATOM    700  OE1 GLU A  66      44.930  50.381  61.555  1.00  0.00           O
ATOM    701  OE2 GLU A  66      42.947  50.743  60.718  1.00  0.00           O
ATOM    702  C   GLU A  66      47.880  49.981  57.875  1.00  0.00           C
ATOM    703  O   GLU A  66      47.786  50.198  56.626  1.00  0.00           O
ATOM    704  N   SER A  67      48.920  49.329  58.431  1.00  0.00           N
ATOM    705  H   SER A  67      48.895  49.050  59.402  1.00  0.00           H
ATOM    706  CA  SER A  67      49.949  48.669  57.654  1.00  0.00           C
ATOM    707  HA  SER A  67      49.751  48.878  56.603  1.00  0.00           H
ATOM    708  CB  SER A  67      51.333  49.320  57.726  1.00  0.00           C
ATOM    709  HB2 SER A  67      51.253  50.382  57.494  1.00  0.00           H
ATOM    710  HB3 SER A  67      51.748  49.168  58.723  1.00  0.00           H
ATOM    711  OG  SER A  67      52.292  48.715  56.892  1.00  0.00           O
ATOM    712  HG  SER A  67      52.353  49.191  56.062  1.00  0.00           H
ATOM    713  C   SER A  67      50.031  47.220  58.078  1.00  0.00           C
ATOM    714  O   SER A  67      49.802  46.908  59.268  1.00  0.00           O
ATOM    715  N   PHE A  68      50.322  46.399  57.150  1.00  0.00           N
ATOM    716  H   PHE A  68      50.322  46.743  56.200  1.00  0.00           H
ATOM    717  CA  PHE A  68      50.443  44.921  57.274  1.00  0.00           C
ATOM    718  HA  PHE A  68      50.643  44.703  58.323  1.00  0.00           H
ATOM    719  CB  PHE A  68      49.120  44.257  56.837  1.00  0.00           C
ATOM    720  HB2 PHE A  68      48.824  44.573  55.837  1.00  0.00           H
ATOM    721  HB3 PHE A  68      49.412  43.207  56.866  1.00  0.00           H
ATOM    722  CG  PHE A  68      47.873  44.377  57.720  1.00  0.00           C
ATOM    723  CD1 PHE A  68      47.009  45.504  57.678  1.00  0.00           C
ATOM    724  HD1 PHE A  68      47.184  46.357  57.039  1.00  0.00           H
ATOM    725  CE1 PHE A  68      45.939  45.539  58.573  1.00  0.00           C
ATOM    726  HE1 PHE A  68      45.348  46.442  58.616  1.00  0.00           H
ATOM    727  CZ  PHE A  68      45.616  44.434  59.477  1.00  0.00           C
ATOM    728  HZ  PHE A  68      44.833  44.590  60.205  1.00  0.00           H
ATOM    729  CE2 PHE A  68      46.470  43.309  59.482  1.00  0.00           C
ATOM    730  HE2 PHE A  68      46.273  42.558  60.233  1.00  0.00           H
ATOM    731  CD2 PHE A  68      47.647  43.346  58.627  1.00  0.00           C
ATOM    732  HD2 PHE A  68      48.436  42.654  58.883  1.00  0.00           H
ATOM    733  C   PHE A  68      51.624  44.389  56.499  1.00  0.00           C
ATOM    734  O   PHE A  68      51.997  44.943  55.504  1.00  0.00           O
ATOM    735  N   GLY A  69      52.234  43.309  57.008  1.00  0.00           N
ATOM    736  H   GLY A  69      52.013  43.151  57.981  1.00  0.00           H
ATOM    737  CA  GLY A  69      53.330  42.508  56.383  1.00  0.00           C
ATOM    738  HA2 GLY A  69      54.155  43.183  56.154  1.00  0.00           H
ATOM    739  HA3 GLY A  69      53.715  41.756  57.071  1.00  0.00           H
ATOM    740  C   GLY A  69      52.828  41.792  55.133  1.00  0.00           C
ATOM    741  O   GLY A  69      51.873  40.997  55.158  1.00  0.00           O
ATOM    742  N   GLY A  70      53.438  42.001  54.016  1.00  0.00           N
ATOM    743  H   GLY A  70      54.318  42.487  54.117  1.00  0.00           H
ATOM    744  CA  GLY A  70      52.976  41.513  52.720  1.00  0.00           C
ATOM    745  HA2 GLY A  70      51.972  41.914  52.577  1.00  0.00           H
ATOM    746  HA3 GLY A  70      53.672  41.920  51.987  1.00  0.00           H
ATOM    747  C   GLY A  70      53.014  40.046  52.489  1.00  0.00           C
ATOM    748  O   GLY A  70      52.044  39.462  52.031  1.00  0.00           O
ATOM    749  N   ALA A  71      54.043  39.346  52.948  1.00  0.00           N
ATOM    750  H   ALA A  71      54.830  39.890  53.270  1.00  0.00           H
ATOM    751  CA  ALA A  71      54.079  37.923  53.012  1.00  0.00           C
ATOM    752  HA  ALA A  71      53.967  37.405  52.059  1.00  0.00           H
ATOM    753  CB  ALA A  71      55.468  37.572  53.433  1.00  0.00           C
ATOM    754  HB1 ALA A  71      55.749  38.014  54.389  1.00  0.00           H
ATOM    755  HB2 ALA A  71      55.508  36.494  53.588  1.00  0.00           H
ATOM    756  HB3 ALA A  71      56.183  37.738  52.628  1.00  0.00           H
ATOM    757  C   ALA A  71      53.013  37.316  53.965  1.00  0.00           C
ATOM    758  O   ALA A  71      52.547  36.211  53.732  1.00  0.00           O
ATOM    759  N   SER A  72      52.644  37.967  55.073  1.00  0.00           N
ATOM    760  H   SER A  72      53.181  38.740  55.439  1.00  0.00           H
ATOM    761  CA  SER A  72      51.408  37.518  55.793  1.00  0.00           C
ATOM    762  HA  SER A  72      51.440  36.436  55.916  1.00  0.00           H
ATOM    763  CB  SER A  72      51.377  38.008  57.264  1.00  0.00           C
ATOM    764  HB2 SER A  72      50.639  37.458  57.847  1.00  0.00           H
ATOM    765  HB3 SER A  72      52.332  37.852  57.767  1.00  0.00           H
ATOM    766  OG  SER A  72      50.980  39.361  57.269  1.00  0.00           O
ATOM    767  HG  SER A  72      51.219  39.718  56.410  1.00  0.00           H
ATOM    768  C   SER A  72      50.086  37.632  55.060  1.00  0.00           C
ATOM    769  O   SER A  72      49.143  36.917  55.381  1.00  0.00           O
ATOM    770  N   CYS A  73      50.046  38.562  54.067  1.00  0.00           N
ATOM    771  H   CYS A  73      50.815  39.216  54.064  1.00  0.00           H
ATOM    772  CA  CYS A  73      48.895  38.755  53.156  1.00  0.00           C
ATOM    773  HA  CYS A  73      47.981  38.437  53.658  1.00  0.00           H
ATOM    774  CB  CYS A  73      48.816  40.284  52.732  1.00  0.00           C
ATOM    775  HB2 CYS A  73      49.620  40.535  52.040  1.00  0.00           H
ATOM    776  HB3 CYS A  73      47.861  40.394  52.217  1.00  0.00           H
ATOM    777  SG  CYS A  73      48.697  41.348  54.128  1.00  0.00           S
ATOM    778  HG  CYS A  73      49.936  41.052  54.533  1.00  0.00           H
ATOM    779  C   CYS A  73      48.923  37.953  51.841  1.00  0.00           C
ATOM    780  O   CYS A  73      47.845  37.624  51.349  1.00  0.00           O
ATOM    781  N   CYS A  74      50.109  37.613  51.294  1.00  0.00           N
ATOM    782  H   CYS A  74      50.938  37.953  51.760  1.00  0.00           H
ATOM    783  CA  CYS A  74      50.283  37.112  49.915  1.00  0.00           C
ATOM    784  HA  CYS A  74      49.551  37.595  49.267  1.00  0.00           H
ATOM    785  CB  CYS A  74      51.667  37.520  49.360  1.00  0.00           C
ATOM    786  HB2 CYS A  74      51.761  38.606  49.339  1.00  0.00           H
ATOM    787  HB3 CYS A  74      52.407  37.071  50.023  1.00  0.00           H
ATOM    788  SG  CYS A  74      51.981  36.813  47.665  1.00  0.00           S
ATOM    789  HG  CYS A  74      51.414  37.764  46.918  1.00  0.00           H
ATOM    790  C   CYS A  74      50.107  35.563  49.977  1.00  0.00           C
ATOM    791  O   CYS A  74      50.582  34.867  50.868  1.00  0.00           O
ATOM    792  N   LEU A  75      49.357  35.038  49.032  1.00  0.00           N
ATOM    793  H   LEU A  75      48.891  35.613  48.345  1.00  0.00           H
ATOM    794  CA  LEU A  75      49.053  33.609  49.021  1.00  0.00           C
ATOM    795  HA  LEU A  75      48.815  33.095  49.952  1.00  0.00           H
ATOM    796  CB  LEU A  75      47.845  33.360  48.081  1.00  0.00           C
ATOM    797  HB2 LEU A  75      48.037  33.788  47.097  1.00  0.00           H
ATOM    798  HB3 LEU A  75      47.665  32.286  48.045  1.00  0.00           H
ATOM    799  CG  LEU A  75      46.574  33.940  48.753  1.00  0.00           C
ATOM    800  HG  LEU A  75      46.876  34.903  49.166  1.00  0.00           H
ATOM    801  CD1 LEU A  75      45.527  34.298  47.703  1.00  0.00           C
ATOM    802 HD11 LEU A  75      45.938  34.973  46.953  1.00  0.00           H
ATOM    803 HD12 LEU A  75      45.313  33.311  47.293  1.00  0.00           H
ATOM    804 HD13 LEU A  75      44.587  34.718  48.061  1.00  0.00           H
ATOM    805  CD2 LEU A  75      45.981  33.095  49.808  1.00  0.00           C
ATOM    806 HD21 LEU A  75      45.105  33.549  50.271  1.00  0.00           H
ATOM    807 HD22 LEU A  75      45.814  32.059  49.514  1.00  0.00           H
ATOM    808 HD23 LEU A  75      46.720  33.048  50.608  1.00  0.00           H
ATOM    809  C   LEU A  75      50.246  32.823  48.383  1.00  0.00           C
ATOM    810  O   LEU A  75      50.527  31.679  48.708  1.00  0.00           O
ATOM    811  N   TYR A  76      50.988  33.375  47.455  1.00  0.00           N
ATOM    812  H   TYR A  76      50.679  34.261  47.082  1.00  0.00           H
ATOM    813  CA  TYR A  76      52.336  32.853  47.079  1.00  0.00           C
ATOM    814  HA  TYR A  76      52.236  31.850  46.664  1.00  0.00           H
ATOM    815  CB  TYR A  76      53.051  33.764  46.002  1.00  0.00           C
ATOM    816  HB2 TYR A  76      53.259  34.765  46.381  1.00  0.00           H
ATOM    817  HB3 TYR A  76      54.017  33.306  45.794  1.00  0.00           H
ATOM    818  CG  TYR A  76      52.438  33.881  44.619  1.00  0.00           C
ATOM    819  CD1 TYR A  76      52.555  32.869  43.659  1.00  0.00           C
ATOM    820  HD1 TYR A  76      53.107  31.980  43.923  1.00  0.00           H
ATOM    821  CE1 TYR A  76      51.975  32.959  42.395  1.00  0.00           C
ATOM    822  HE1 TYR A  76      52.214  32.155  41.714  1.00  0.00           H
ATOM    823  CZ  TYR A  76      51.142  34.058  42.106  1.00  0.00           C
ATOM    824  OH  TYR A  76      50.575  34.152  40.886  1.00  0.00           O
ATOM    825  HH  TYR A  76      49.617  34.197  40.921  1.00  0.00           H
ATOM    826  CE2 TYR A  76      51.032  35.102  43.057  1.00  0.00           C
ATOM    827  HE2 TYR A  76      50.349  35.866  42.718  1.00  0.00           H
ATOM    828  CD2 TYR A  76      51.700  35.064  44.286  1.00  0.00           C
ATOM    829  HD2 TYR A  76      51.527  35.890  44.960  1.00  0.00           H
ATOM    830  C   TYR A  76      53.228  32.696  48.334  1.00  0.00           C
ATOM    831  O   TYR A  76      53.997  31.731  48.353  1.00  0.00           O
ATOM    832  N   CYS A  77      53.130  33.477  49.362  1.00  0.00           N
ATOM    833  H   CYS A  77      52.466  34.236  49.303  1.00  0.00           H
ATOM    834  CA  CYS A  77      53.750  33.179  50.670  1.00  0.00           C
ATOM    835  HA  CYS A  77      54.741  32.749  50.521  1.00  0.00           H
ATOM    836  CB  CYS A  77      54.037  34.518  51.475  1.00  0.00           C
ATOM    837  HB2 CYS A  77      53.141  35.135  51.537  1.00  0.00           H
ATOM    838  HB3 CYS A  77      54.298  34.167  52.474  1.00  0.00           H
ATOM    839  SG  CYS A  77      55.238  35.396  50.465  1.00  0.00           S
ATOM    840  HG  CYS A  77      56.318  34.618  50.587  1.00  0.00           H
ATOM    841  C   CYS A  77      52.956  32.111  51.484  1.00  0.00           C
ATOM    842  O   CYS A  77      53.422  30.969  51.603  1.00  0.00           O
ATOM    843  N   ARG A  78      51.839  32.482  52.090  1.00  0.00           N
ATOM    844  H   ARG A  78      51.530  33.413  51.851  1.00  0.00           H
ATOM    845  CA  ARG A  78      50.982  31.689  52.924  1.00  0.00           C
ATOM    846  HA  ARG A  78      51.438  31.478  53.891  1.00  0.00           H
ATOM    847  CB  ARG A  78      49.649  32.382  53.129  1.00  0.00           C
ATOM    848  HB2 ARG A  78      49.208  32.642  52.167  1.00  0.00           H
ATOM    849  HB3 ARG A  78      49.009  31.670  53.650  1.00  0.00           H
ATOM    850  CG  ARG A  78      49.742  33.642  54.010  1.00  0.00           C
ATOM    851  HG2 ARG A  78      50.433  34.288  53.469  1.00  0.00           H
ATOM    852  HG3 ARG A  78      48.759  34.111  53.976  1.00  0.00           H
ATOM    853  CD  ARG A  78      50.188  33.484  55.448  1.00  0.00           C
ATOM    854  HD2 ARG A  78      51.019  32.778  55.466  1.00  0.00           H
ATOM    855  HD3 ARG A  78      50.595  34.375  55.925  1.00  0.00           H
ATOM    856  NE  ARG A  78      49.100  32.910  56.259  1.00  0.00           N
ATOM    857  HE  ARG A  78      49.168  31.907  56.356  1.00  0.00           H
ATOM    858  CZ  ARG A  78      48.341  33.546  57.127  1.00  0.00           C
ATOM    859  NH1 ARG A  78      48.212  34.862  57.213  1.00  0.00           N
ATOM    860 HH11 ARG A  78      48.687  35.514  56.605  1.00  0.00           H
ATOM    861 HH12 ARG A  78      47.833  35.230  58.074  1.00  0.00           H
ATOM    862  NH2 ARG A  78      47.624  32.888  57.946  1.00  0.00           N
ATOM    863 HH21 ARG A  78      47.890  31.914  57.977  1.00  0.00           H
ATOM    864 HH22 ARG A  78      46.947  33.272  58.589  1.00  0.00           H
ATOM    865  C   ARG A  78      50.692  30.302  52.397  1.00  0.00           C
ATOM    866  O   ARG A  78      50.632  29.370  53.246  1.00  0.00           O
ATOM    867  N   CYS A  79      50.587  30.114  51.069  1.00  0.00           N
ATOM    868  H   CYS A  79      50.589  30.912  50.451  1.00  0.00           H
ATOM    869  CA  CYS A  79      50.279  28.897  50.467  1.00  0.00           C
ATOM    870  HA  CYS A  79      49.885  28.238  51.241  1.00  0.00           H
ATOM    871  CB  CYS A  79      49.093  29.106  49.527  1.00  0.00           C
ATOM    872  HB2 CYS A  79      49.431  29.538  48.585  1.00  0.00           H
ATOM    873  HB3 CYS A  79      48.612  28.143  49.356  1.00  0.00           H
ATOM    874  SG  CYS A  79      47.805  30.178  50.212  1.00  0.00           S
ATOM    875  HG  CYS A  79      46.956  29.217  50.587  1.00  0.00           H
ATOM    876  C   CYS A  79      51.525  28.190  49.894  1.00  0.00           C
ATOM    877  O   CYS A  79      51.537  27.029  49.465  1.00  0.00           O
ATOM    878  N   HIE A  80      52.698  28.844  49.880  1.00  0.00           N
ATOM    879  H   HIE A  80      52.554  29.771  50.255  1.00  0.00           H
ATOM    880  CA  HIE A  80      54.051  28.477  49.348  1.00  0.00           C
ATOM    881  HA  HIE A  80      54.656  29.371  49.499  1.00  0.00           H
ATOM    882  CB  HIE A  80      54.629  27.477  50.262  1.00  0.00           C
ATOM    883  HB2 HIE A  80      54.184  26.490  50.133  1.00  0.00           H
ATOM    884  HB3 HIE A  80      55.640  27.400  49.863  1.00  0.00           H
ATOM    885  CG  HIE A  80      54.614  27.954  51.672  1.00  0.00           C
ATOM    886  ND1 HIE A  80      55.759  28.473  52.413  1.00  0.00           N
ATOM    887  CE1 HIE A  80      55.311  28.596  53.670  1.00  0.00           C
ATOM    888  HE1 HIE A  80      55.892  29.013  54.479  1.00  0.00           H
ATOM    889  NE2 HIE A  80      54.062  28.141  53.780  1.00  0.00           N
ATOM    890  HE2 HIE A  80      53.438  28.176  54.573  1.00  0.00           H
ATOM    891  CD2 HIE A  80      53.629  27.732  52.561  1.00  0.00           C
ATOM    892  HD2 HIE A  80      52.672  27.270  52.369  1.00  0.00           H
ATOM    893  C   HIE A  80      54.175  28.271  47.854  1.00  0.00           C
ATOM    894  O   HIE A  80      55.099  27.610  47.372  1.00  0.00           O
ATOM    895  N   ILE A  81      53.311  28.887  47.086  1.00  0.00           N
ATOM    896  H   ILE A  81      52.674  29.543  47.515  1.00  0.00           H
ATOM    897  CA  ILE A  81      53.185  28.794  45.632  1.00  0.00           C
ATOM    898  HA  ILE A  81      53.248  27.727  45.420  1.00  0.00           H
ATOM    899  CB  ILE A  81      51.796  29.236  45.112  1.00  0.00           C
ATOM    900  HB  ILE A  81      51.860  30.298  45.349  1.00  0.00           H
ATOM    901  CG2 ILE A  81      51.750  29.006  43.579  1.00  0.00           C
ATOM    902 HG21 ILE A  81      50.968  29.563  43.065  1.00  0.00           H
ATOM    903 HG22 ILE A  81      52.658  29.301  43.053  1.00  0.00           H
ATOM    904 HG23 ILE A  81      51.507  27.972  43.334  1.00  0.00           H
ATOM    905  CG1 ILE A  81      50.595  28.614  45.728  1.00  0.00           C
ATOM    906 HG12 ILE A  81      50.496  29.017  46.736  1.00  0.00           H
ATOM    907 HG13 ILE A  81      49.648  28.862  45.249  1.00  0.00           H
ATOM    908  CD1 ILE A  81      50.625  27.119  45.869  1.00  0.00           C
ATOM    909 HD11 ILE A  81      50.894  26.555  44.975  1.00  0.00           H
ATOM    910 HD12 ILE A  81      51.363  26.761  46.587  1.00  0.00           H
ATOM    911 HD13 ILE A  81      49.646  26.862  46.273  1.00  0.00           H
ATOM    912  C   ILE A  81      54.445  29.463  44.918  1.00  0.00           C
ATOM    913  O   ILE A  81      54.776  30.588  45.345  1.00  0.00           O
ATOM    914  N   ASP A  82      55.105  28.820  43.919  1.00  0.00           N
ATOM    915  H   ASP A  82      54.716  27.937  43.620  1.00  0.00           H
ATOM    916  CA  ASP A  82      56.070  29.547  43.155  1.00  0.00           C
ATOM    917  HA  ASP A  82      56.716  30.113  43.827  1.00  0.00           H
ATOM    918  CB  ASP A  82      56.917  28.592  42.334  1.00  0.00           C
ATOM    919  HB2 ASP A  82      56.265  27.989  41.702  1.00  0.00           H
ATOM    920  HB3 ASP A  82      57.598  29.083  41.639  1.00  0.00           H
ATOM    921  CG  ASP A  82      57.808  27.720  43.171  1.00  0.00           C
ATOM    922  OD1 ASP A  82      58.540  26.908  42.563  1.00  0.00           O
ATOM    923  OD2 ASP A  82      57.843  27.684  44.407  1.00  0.00           O
ATOM    924  C   ASP A  82      55.432  30.559  42.190  1.00  0.00           C
ATOM    925  O   ASP A  82      54.595  30.319  41.369  1.00  0.00           O
ATOM    926  N   HIE A  83      55.893  31.863  42.322  1.00  0.00           N
ATOM    927  H   HIE A  83      56.707  31.912  42.917  1.00  0.00           H
ATOM    928  CA  HIE A  83      55.448  32.963  41.428  1.00  0.00           C
ATOM    929  HA  HIE A  83      54.358  32.934  41.395  1.00  0.00           H
ATOM    930  CB  HIE A  83      55.879  34.222  42.144  1.00  0.00           C
ATOM    931  HB2 HIE A  83      55.582  34.123  43.188  1.00  0.00           H
ATOM    932  HB3 HIE A  83      56.950  34.407  42.225  1.00  0.00           H
ATOM    933  CG  HIE A  83      55.450  35.472  41.554  1.00  0.00           C
ATOM    934  ND1 HIE A  83      56.170  36.264  40.667  1.00  0.00           N
ATOM    935  CE1 HIE A  83      55.458  37.412  40.551  1.00  0.00           C
ATOM    936  HE1 HIE A  83      55.666  38.196  39.837  1.00  0.00           H
ATOM    937  NE2 HIE A  83      54.383  37.362  41.358  1.00  0.00           N
ATOM    938  HE2 HIE A  83      53.614  37.982  41.149  1.00  0.00           H
ATOM    939  CD2 HIE A  83      54.289  36.128  41.937  1.00  0.00           C
ATOM    940  HD2 HIE A  83      53.511  35.726  42.569  1.00  0.00           H
ATOM    941  C   HIE A  83      55.932  32.715  39.962  1.00  0.00           C
ATOM    942  O   HIE A  83      56.939  32.068  39.629  1.00  0.00           O
ATOM    943  N   PRO A  84      55.228  33.305  38.920  1.00  0.00           N
ATOM    944  CD  PRO A  84      53.936  33.876  39.104  1.00  0.00           C
ATOM    945  HD2 PRO A  84      53.940  34.764  39.736  1.00  0.00           H
ATOM    946  HD3 PRO A  84      53.271  33.142  39.560  1.00  0.00           H
ATOM    947  CG  PRO A  84      53.419  34.310  37.767  1.00  0.00           C
ATOM    948  HG2 PRO A  84      53.258  35.376  37.930  1.00  0.00           H
ATOM    949  HG3 PRO A  84      52.602  33.677  37.421  1.00  0.00           H
ATOM    950  CB  PRO A  84      54.609  34.276  36.774  1.00  0.00           C
ATOM    951  HB2 PRO A  84      55.078  35.257  36.694  1.00  0.00           H
ATOM    952  HB3 PRO A  84      54.301  33.817  35.834  1.00  0.00           H
ATOM    953  CA  PRO A  84      55.613  33.478  37.480  1.00  0.00           C
ATOM    954  HA  PRO A  84      55.598  32.538  36.928  1.00  0.00           H
ATOM    955  C   PRO A  84      57.031  34.137  37.336  1.00  0.00           C
ATOM    956  O   PRO A  84      57.681  33.864  36.289  1.00  0.00           O
ATOM    957  N   ASN A  85      57.569  34.888  38.272  1.00  0.00           N
ATOM    958  H   ASN A  85      57.028  35.110  39.095  1.00  0.00           H
ATOM    959  CA  ASN A  85      59.030  35.247  38.318  1.00  0.00           C
ATOM    960  HA  ASN A  85      59.240  35.622  37.316  1.00  0.00           H
ATOM    961  CB  ASN A  85      59.186  36.400  39.347  1.00  0.00           C
ATOM    962  HB2 ASN A  85      58.490  37.201  39.098  1.00  0.00           H
ATOM    963  HB3 ASN A  85      58.965  36.028  40.348  1.00  0.00           H
ATOM    964  CG  ASN A  85      60.569  36.972  39.496  1.00  0.00           C
ATOM    965  OD1 ASN A  85      61.634  36.292  39.455  1.00  0.00           O
ATOM    966  ND2 ASN A  85      60.708  38.291  39.654  1.00  0.00           N
ATOM    967 HD21 ASN A  85      61.638  38.683  39.617  1.00  0.00           H
ATOM    968 HD22 ASN A  85      59.927  38.928  39.717  1.00  0.00           H
ATOM    969  C   ASN A  85      60.008  34.086  38.479  1.00  0.00           C
ATOM    970  O   ASN A  85      59.793  33.244  39.322  1.00  0.00           O
ATOM    971  N   PRO A  86      61.193  34.032  37.763  1.00  0.00           N
ATOM    972  CD  PRO A  86      61.522  34.864  36.581  1.00  0.00           C
ATOM    973  HD2 PRO A  86      62.088  35.762  36.829  1.00  0.00           H
ATOM    974  HD3 PRO A  86      60.675  35.220  35.995  1.00  0.00           H
ATOM    975  CG  PRO A  86      62.256  33.869  35.686  1.00  0.00           C
ATOM    976  HG2 PRO A  86      62.884  34.346  34.933  1.00  0.00           H
ATOM    977  HG3 PRO A  86      61.573  33.168  35.207  1.00  0.00           H
ATOM    978  CB  PRO A  86      63.109  33.192  36.751  1.00  0.00           C
ATOM    979  HB2 PRO A  86      63.910  33.826  37.131  1.00  0.00           H
ATOM    980  HB3 PRO A  86      63.513  32.271  36.331  1.00  0.00           H
ATOM    981  CA  PRO A  86      62.100  32.875  37.828  1.00  0.00           C
ATOM    982  HA  PRO A  86      61.474  32.041  37.512  1.00  0.00           H
ATOM    983  C   PRO A  86      62.833  32.593  39.115  1.00  0.00           C
ATOM    984  O   PRO A  86      63.353  31.513  39.330  1.00  0.00           O
ATOM    985  N   LYS A  87      62.805  33.510  40.075  1.00  0.00           N
ATOM    986  H   LYS A  87      62.405  34.402  39.823  1.00  0.00           H
ATOM    987  CA  LYS A  87      63.381  33.247  41.400  1.00  0.00           C
ATOM    988  HA  LYS A  87      64.293  32.657  41.320  1.00  0.00           H
ATOM    989  CB  LYS A  87      63.872  34.630  42.009  1.00  0.00           C
ATOM    990  HB2 LYS A  87      64.534  34.574  42.873  1.00  0.00           H
ATOM    991  HB3 LYS A  87      64.397  35.230  41.265  1.00  0.00           H
ATOM    992  CG  LYS A  87      62.744  35.437  42.517  1.00  0.00           C
ATOM    993  HG2 LYS A  87      61.885  35.210  41.885  1.00  0.00           H
ATOM    994  HG3 LYS A  87      62.555  35.120  43.542  1.00  0.00           H
ATOM    995  CD  LYS A  87      63.175  36.944  42.445  1.00  0.00           C
ATOM    996  HD2 LYS A  87      63.970  37.142  43.164  1.00  0.00           H
ATOM    997  HD3 LYS A  87      63.399  37.304  41.441  1.00  0.00           H
ATOM    998  CE  LYS A  87      61.992  37.766  42.958  1.00  0.00           C
ATOM    999  HE2 LYS A  87      61.125  37.435  42.385  1.00  0.00           H
ATOM   1000  HE3 LYS A  87      61.742  37.519  43.989  1.00  0.00           H
ATOM   1001  NZ  LYS A  87      62.102  39.247  42.878  1.00  0.00           N
ATOM   1002  HZ1 LYS A  87      61.989  39.583  41.932  1.00  0.00           H
ATOM   1003  HZ2 LYS A  87      61.367  39.786  43.313  1.00  0.00           H
ATOM   1004  HZ3 LYS A  87      63.016  39.604  43.118  1.00  0.00           H
ATOM   1005  C   LYS A  87      62.445  32.554  42.333  1.00  0.00           C
ATOM   1006  O   LYS A  87      62.847  32.235  43.427  1.00  0.00           O
ATOM   1007  N   GLY A  88      61.188  32.248  42.027  1.00  0.00           N
ATOM   1008  H   GLY A  88      60.946  32.437  41.065  1.00  0.00           H
ATOM   1009  CA  GLY A  88      60.185  31.498  42.809  1.00  0.00           C
ATOM   1010  HA2 GLY A  88      59.350  31.297  42.138  1.00  0.00           H
ATOM   1011  HA3 GLY A  88      60.563  30.558  43.209  1.00  0.00           H
ATOM   1012  C   GLY A  88      59.621  32.318  43.958  1.00  0.00           C
ATOM   1013  O   GLY A  88      58.451  32.246  44.078  1.00  0.00           O
ATOM   1014  N   PHE A  89      60.362  33.124  44.686  1.00  0.00           N
ATOM   1015  H   PHE A  89      61.357  33.131  44.511  1.00  0.00           H
ATOM   1016  CA  PHE A  89      59.728  34.140  45.511  1.00  0.00           C
ATOM   1017  HA  PHE A  89      59.008  33.678  46.187  1.00  0.00           H
ATOM   1018  CB  PHE A  89      60.800  34.804  46.317  1.00  0.00           C
ATOM   1019  HB2 PHE A  89      61.517  35.290  45.656  1.00  0.00           H
ATOM   1020  HB3 PHE A  89      60.318  35.458  47.044  1.00  0.00           H
ATOM   1021  CG  PHE A  89      61.619  33.828  47.155  1.00  0.00           C
ATOM   1022  CD1 PHE A  89      60.935  33.011  48.147  1.00  0.00           C
ATOM   1023  HD1 PHE A  89      59.892  33.193  48.364  1.00  0.00           H
ATOM   1024  CE1 PHE A  89      61.712  32.048  48.865  1.00  0.00           C
ATOM   1025  HE1 PHE A  89      61.217  31.404  49.576  1.00  0.00           H
ATOM   1026  CZ  PHE A  89      63.136  31.958  48.683  1.00  0.00           C
ATOM   1027  HZ  PHE A  89      63.736  31.248  49.233  1.00  0.00           H
ATOM   1028  CE2 PHE A  89      63.780  32.812  47.751  1.00  0.00           C
ATOM   1029  HE2 PHE A  89      64.857  32.732  47.729  1.00  0.00           H
ATOM   1030  CD2 PHE A  89      63.016  33.749  47.029  1.00  0.00           C
ATOM   1031  HD2 PHE A  89      63.571  34.458  46.432  1.00  0.00           H
ATOM   1032  C   PHE A  89      59.057  35.239  44.685  1.00  0.00           C
ATOM   1033  O   PHE A  89      59.582  35.793  43.716  1.00  0.00           O
ATOM   1034  N   CYS A  90      57.858  35.577  45.176  1.00  0.00           N
ATOM   1035  H   CYS A  90      57.506  35.071  45.976  1.00  0.00           H
ATOM   1036  CA  CYS A  90      57.181  36.800  44.784  1.00  0.00           C
ATOM   1037  HA  CYS A  90      57.319  36.820  43.703  1.00  0.00           H
ATOM   1038  CB  CYS A  90      55.677  36.695  45.058  1.00  0.00           C
ATOM   1039  HB2 CYS A  90      55.245  37.547  44.533  1.00  0.00           H
ATOM   1040  HB3 CYS A  90      55.275  35.739  44.723  1.00  0.00           H
ATOM   1041  SG  CYS A  90      55.406  36.821  46.799  1.00  0.00           S
ATOM   1042  HG  CYS A  90      55.962  35.694  47.253  1.00  0.00           H
ATOM   1043  C   CYS A  90      57.807  38.071  45.378  1.00  0.00           C
ATOM   1044  O   CYS A  90      58.538  38.077  46.384  1.00  0.00           O
ATOM   1045  N   ASP A  91      57.597  39.201  44.671  1.00  0.00           N
ATOM   1046  H   ASP A  91      56.867  39.116  43.978  1.00  0.00           H
ATOM   1047  CA  ASP A  91      58.065  40.536  45.063  1.00  0.00           C
ATOM   1048  HA  ASP A  91      59.109  40.494  45.373  1.00  0.00           H
ATOM   1049  CB  ASP A  91      57.780  41.450  43.842  1.00  0.00           C
ATOM   1050  HB2 ASP A  91      58.114  40.991  42.912  1.00  0.00           H
ATOM   1051  HB3 ASP A  91      56.738  41.765  43.780  1.00  0.00           H
ATOM   1052  CG  ASP A  91      58.465  42.832  43.853  1.00  0.00           C
ATOM   1053  OD1 ASP A  91      57.824  43.757  44.386  1.00  0.00           O
ATOM   1054  OD2 ASP A  91      59.629  43.043  43.434  1.00  0.00           O
ATOM   1055  C   ASP A  91      57.403  41.121  46.293  1.00  0.00           C
ATOM   1056  O   ASP A  91      58.109  41.714  47.050  1.00  0.00           O
ATOM   1057  N   LEU A  92      56.229  40.703  46.682  1.00  0.00           N
ATOM   1058  H   LEU A  92      55.628  40.162  46.078  1.00  0.00           H
ATOM   1059  CA  LEU A  92      55.507  41.176  47.969  1.00  0.00           C
ATOM   1060  HA  LEU A  92      55.533  42.264  47.915  1.00  0.00           H
ATOM   1061  CB  LEU A  92      54.007  40.768  47.813  1.00  0.00           C
ATOM   1062  HB2 LEU A  92      53.570  41.118  46.878  1.00  0.00           H
ATOM   1063  HB3 LEU A  92      53.926  39.682  47.855  1.00  0.00           H
ATOM   1064  CG  LEU A  92      53.148  41.467  48.943  1.00  0.00           C
ATOM   1065  HG  LEU A  92      53.246  41.060  49.949  1.00  0.00           H
ATOM   1066  CD1 LEU A  92      53.385  42.995  49.122  1.00  0.00           C
ATOM   1067 HD11 LEU A  92      53.201  43.432  48.140  1.00  0.00           H
ATOM   1068 HD12 LEU A  92      52.624  43.414  49.779  1.00  0.00           H
ATOM   1069 HD13 LEU A  92      54.402  43.080  49.504  1.00  0.00           H
ATOM   1070  CD2 LEU A  92      51.710  41.379  48.440  1.00  0.00           C
ATOM   1071 HD21 LEU A  92      51.468  40.332  48.255  1.00  0.00           H
ATOM   1072 HD22 LEU A  92      51.037  41.788  49.194  1.00  0.00           H
ATOM   1073 HD23 LEU A  92      51.589  41.943  47.515  1.00  0.00           H
ATOM   1074  C   LEU A  92      56.134  40.682  49.256  1.00  0.00           C
ATOM   1075  O   LEU A  92      55.802  41.171  50.366  1.00  0.00           O
ATOM   1076  N   LYS A  93      56.994  39.648  49.128  1.00  0.00           N
ATOM   1077  H   LYS A  93      57.169  39.363  48.175  1.00  0.00           H
ATOM   1078  CA  LYS A  93      57.710  39.035  50.271  1.00  0.00           C
ATOM   1079  HA  LYS A  93      57.043  38.872  51.117  1.00  0.00           H
ATOM   1080  CB  LYS A  93      58.190  37.627  49.874  1.00  0.00           C
ATOM   1081  HB2 LYS A  93      57.387  37.131  49.328  1.00  0.00           H
ATOM   1082  HB3 LYS A  93      58.970  37.800  49.133  1.00  0.00           H
ATOM   1083  CG  LYS A  93      58.724  36.788  51.076  1.00  0.00           C
ATOM   1084  HG2 LYS A  93      58.200  37.115  51.975  1.00  0.00           H
ATOM   1085  HG3 LYS A  93      58.710  35.727  50.829  1.00  0.00           H
ATOM   1086  CD  LYS A  93      60.182  37.144  51.424  1.00  0.00           C
ATOM   1087  HD2 LYS A  93      60.286  38.175  51.760  1.00  0.00           H
ATOM   1088  HD3 LYS A  93      60.383  36.534  52.304  1.00  0.00           H
ATOM   1089  CE  LYS A  93      61.283  36.823  50.404  1.00  0.00           C
ATOM   1090  HE2 LYS A  93      61.252  35.745  50.245  1.00  0.00           H
ATOM   1091  HE3 LYS A  93      61.137  37.428  49.509  1.00  0.00           H
ATOM   1092  NZ  LYS A  93      62.639  37.298  50.895  1.00  0.00           N
ATOM   1093  HZ1 LYS A  93      63.422  36.938  50.369  1.00  0.00           H
ATOM   1094  HZ2 LYS A  93      62.798  38.293  50.826  1.00  0.00           H
ATOM   1095  HZ3 LYS A  93      62.777  36.949  51.832  1.00  0.00           H
ATOM   1096  C   LYS A  93      58.859  39.895  50.676  1.00  0.00           C
ATOM   1097  O   LYS A  93      59.736  40.303  50.013  1.00  0.00           O
ATOM   1098  N   GLY A  94      58.814  40.325  51.930  1.00  0.00           N
ATOM   1099  H   GLY A  94      58.097  40.027  52.575  1.00  0.00           H
ATOM   1100  CA  GLY A  94      59.725  41.281  52.483  1.00  0.00           C
ATOM   1101  HA2 GLY A  94      59.954  41.175  53.543  1.00  0.00           H
ATOM   1102  HA3 GLY A  94      60.703  41.163  52.017  1.00  0.00           H
ATOM   1103  C   GLY A  94      59.449  42.745  52.196  1.00  0.00           C
ATOM   1104  O   GLY A  94      60.119  43.694  52.525  1.00  0.00           O
ATOM   1105  N   LYS A  95      58.273  42.932  51.631  1.00  0.00           N
ATOM   1106  H   LYS A  95      57.728  42.104  51.440  1.00  0.00           H
ATOM   1107  CA  LYS A  95      57.510  44.189  51.382  1.00  0.00           C
ATOM   1108  HA  LYS A  95      58.103  45.056  51.673  1.00  0.00           H
ATOM   1109  CB  LYS A  95      57.242  44.328  49.844  1.00  0.00           C
ATOM   1110  HB2 LYS A  95      56.761  43.402  49.527  1.00  0.00           H
ATOM   1111  HB3 LYS A  95      56.539  45.148  49.697  1.00  0.00           H
ATOM   1112  CG  LYS A  95      58.533  44.533  49.120  1.00  0.00           C
ATOM   1113  HG2 LYS A  95      59.092  45.385  49.508  1.00  0.00           H
ATOM   1114  HG3 LYS A  95      59.033  43.568  49.189  1.00  0.00           H
ATOM   1115  CD  LYS A  95      58.230  44.961  47.691  1.00  0.00           C
ATOM   1116  HD2 LYS A  95      57.661  44.228  47.118  1.00  0.00           H
ATOM   1117  HD3 LYS A  95      57.823  45.972  47.683  1.00  0.00           H
ATOM   1118  CE  LYS A  95      59.554  44.960  46.962  1.00  0.00           C
ATOM   1119  HE2 LYS A  95      60.136  45.731  47.467  1.00  0.00           H
ATOM   1120  HE3 LYS A  95      60.021  43.985  47.105  1.00  0.00           H
ATOM   1121  NZ  LYS A  95      59.605  45.352  45.558  1.00  0.00           N
ATOM   1122  HZ1 LYS A  95      59.100  44.780  44.895  1.00  0.00           H
ATOM   1123  HZ2 LYS A  95      59.226  46.282  45.453  1.00  0.00           H
ATOM   1124  HZ3 LYS A  95      60.568  45.335  45.254  1.00  0.00           H
ATOM   1125  C   LYS A  95      56.207  44.292  52.177  1.00  0.00           C
ATOM   1126  O   LYS A  95      55.720  43.296  52.676  1.00  0.00           O
ATOM   1127  N   TYR A  96      55.621  45.462  52.225  1.00  0.00           N
ATOM   1128  H   TYR A  96      56.100  46.266  51.845  1.00  0.00           H
ATOM   1129  CA  TYR A  96      54.462  45.729  53.066  1.00  0.00           C
ATOM   1130  HA  TYR A  96      54.016  44.888  53.597  1.00  0.00           H
ATOM   1131  CB  TYR A  96      54.904  46.812  54.135  1.00  0.00           C
ATOM   1132  HB2 TYR A  96      55.393  47.638  53.617  1.00  0.00           H
ATOM   1133  HB3 TYR A  96      54.025  47.109  54.706  1.00  0.00           H
ATOM   1134  CG  TYR A  96      55.926  46.212  55.098  1.00  0.00           C
ATOM   1135  CD1 TYR A  96      57.319  46.183  54.674  1.00  0.00           C
ATOM   1136  HD1 TYR A  96      57.590  46.613  53.721  1.00  0.00           H
ATOM   1137  CE1 TYR A  96      58.296  45.672  55.510  1.00  0.00           C
ATOM   1138  HE1 TYR A  96      59.330  45.723  55.201  1.00  0.00           H
ATOM   1139  CZ  TYR A  96      57.892  45.167  56.746  1.00  0.00           C
ATOM   1140  OH  TYR A  96      58.889  44.626  57.519  1.00  0.00           O
ATOM   1141  HH  TYR A  96      58.625  44.294  58.380  1.00  0.00           H
ATOM   1142  CE2 TYR A  96      56.490  45.059  57.155  1.00  0.00           C
ATOM   1143  HE2 TYR A  96      56.212  44.613  58.099  1.00  0.00           H
ATOM   1144  CD2 TYR A  96      55.524  45.615  56.322  1.00  0.00           C
ATOM   1145  HD2 TYR A  96      54.507  45.750  56.660  1.00  0.00           H
ATOM   1146  C   TYR A  96      53.293  46.274  52.281  1.00  0.00           C
ATOM   1147  O   TYR A  96      53.523  46.872  51.262  1.00  0.00           O
ATOM   1148  N   VAL A  97      52.089  46.217  52.820  1.00  0.00           N
ATOM   1149  H   VAL A  97      51.984  45.774  53.721  1.00  0.00           H
ATOM   1150  CA  VAL A  97      50.802  46.743  52.216  1.00  0.00           C
ATOM   1151  HA  VAL A  97      51.189  47.374  51.417  1.00  0.00           H
ATOM   1152  CB  VAL A  97      49.938  45.595  51.655  1.00  0.00           C
ATOM   1153  HB  VAL A  97      50.458  45.271  50.754  1.00  0.00           H
ATOM   1154  CG1 VAL A  97      49.698  44.527  52.686  1.00  0.00           C
ATOM   1155 HG11 VAL A  97      49.213  43.685  52.193  1.00  0.00           H
ATOM   1156 HG12 VAL A  97      50.680  44.180  53.011  1.00  0.00           H
ATOM   1157 HG13 VAL A  97      49.214  44.921  53.580  1.00  0.00           H
ATOM   1158  CG2 VAL A  97      48.582  46.169  51.173  1.00  0.00           C
ATOM   1159 HG21 VAL A  97      47.959  46.509  52.000  1.00  0.00           H
ATOM   1160 HG22 VAL A  97      48.758  46.931  50.414  1.00  0.00           H
ATOM   1161 HG23 VAL A  97      47.850  45.454  50.797  1.00  0.00           H
ATOM   1162  C   VAL A  97      50.130  47.707  53.234  1.00  0.00           C
ATOM   1163  O   VAL A  97      50.063  47.441  54.461  1.00  0.00           O
ATOM   1164  N   GLN A  98      49.629  48.777  52.686  1.00  0.00           N
ATOM   1165  H   GLN A  98      49.861  48.975  51.723  1.00  0.00           H
ATOM   1166  CA  GLN A  98      48.715  49.637  53.428  1.00  0.00           C
ATOM   1167  HA  GLN A  98      48.982  49.537  54.480  1.00  0.00           H
ATOM   1168  CB  GLN A  98      49.013  51.114  53.062  1.00  0.00           C
ATOM   1169  HB2 GLN A  98      49.136  51.294  51.995  1.00  0.00           H
ATOM   1170  HB3 GLN A  98      48.106  51.698  53.221  1.00  0.00           H
ATOM   1171  CG  GLN A  98      50.023  51.860  53.916  1.00  0.00           C
ATOM   1172  HG2 GLN A  98      49.977  52.915  53.647  1.00  0.00           H
ATOM   1173  HG3 GLN A  98      49.741  51.581  54.931  1.00  0.00           H
ATOM   1174  CD  GLN A  98      51.438  51.335  53.835  1.00  0.00           C
ATOM   1175  OE1 GLN A  98      51.976  51.021  54.865  1.00  0.00           O
ATOM   1176  NE2 GLN A  98      51.939  51.051  52.707  1.00  0.00           N
ATOM   1177 HE21 GLN A  98      52.841  50.624  52.554  1.00  0.00           H
ATOM   1178 HE22 GLN A  98      51.442  51.348  51.880  1.00  0.00           H
ATOM   1179  C   GLN A  98      47.281  49.229  53.123  1.00  0.00           C
ATOM   1180  O   GLN A  98      46.882  49.111  52.015  1.00  0.00           O
ATOM   1181  N   ILE A  99      46.554  49.187  54.175  1.00  0.00           N
ATOM   1182  H   ILE A  99      46.977  49.513  55.032  1.00  0.00           H
ATOM   1183  CA  ILE A  99      45.096  48.969  54.085  1.00  0.00           C
ATOM   1184  HA  ILE A  99      44.784  48.714  53.072  1.00  0.00           H
ATOM   1185  CB  ILE A  99      44.731  47.664  54.973  1.00  0.00           C
ATOM   1186  HB  ILE A  99      45.021  47.864  56.005  1.00  0.00           H
ATOM   1187  CG2 ILE A  99      43.276  47.458  54.938  1.00  0.00           C
ATOM   1188 HG21 ILE A  99      42.960  46.427  55.098  1.00  0.00           H
ATOM   1189 HG22 ILE A  99      42.794  48.084  55.689  1.00  0.00           H
ATOM   1190 HG23 ILE A  99      42.804  47.818  54.024  1.00  0.00           H
ATOM   1191  CG1 ILE A  99      45.521  46.388  54.469  1.00  0.00           C
ATOM   1192 HG12 ILE A  99      46.568  46.515  54.744  1.00  0.00           H
ATOM   1193 HG13 ILE A  99      45.269  45.500  55.048  1.00  0.00           H
ATOM   1194  CD1 ILE A  99      45.133  45.986  53.034  1.00  0.00           C
ATOM   1195 HD11 ILE A  99      44.054  46.089  52.918  1.00  0.00           H
ATOM   1196 HD12 ILE A  99      45.626  46.548  52.242  1.00  0.00           H
ATOM   1197 HD13 ILE A  99      45.454  44.945  52.991  1.00  0.00           H
ATOM   1198  C   ILE A  99      44.320  50.225  54.486  1.00  0.00           C
ATOM   1199  O   ILE A  99      44.482  50.709  55.637  1.00  0.00           O
ATOM   1200  N   PRO A 100      43.405  50.775  53.692  1.00  0.00           N
ATOM   1201  CD  PRO A 100      43.251  50.623  52.267  1.00  0.00           C
ATOM   1202  HD2 PRO A 100      42.852  49.653  51.973  1.00  0.00           H
ATOM   1203  HD3 PRO A 100      44.223  50.785  51.801  1.00  0.00           H
ATOM   1204  CG  PRO A 100      42.276  51.698  51.829  1.00  0.00           C
ATOM   1205  HG2 PRO A 100      41.657  51.325  51.014  1.00  0.00           H
ATOM   1206  HG3 PRO A 100      42.783  52.621  51.550  1.00  0.00           H
ATOM   1207  CB  PRO A 100      41.437  51.835  53.078  1.00  0.00           C
ATOM   1208  HB2 PRO A 100      40.726  51.013  53.161  1.00  0.00           H
ATOM   1209  HB3 PRO A 100      40.911  52.789  53.084  1.00  0.00           H
ATOM   1210  CA  PRO A 100      42.369  51.740  54.214  1.00  0.00           C
ATOM   1211  HA  PRO A 100      42.802  52.731  54.349  1.00  0.00           H
ATOM   1212  C   PRO A 100      41.675  51.324  55.485  1.00  0.00           C
ATOM   1213  O   PRO A 100      41.360  50.115  55.539  1.00  0.00           O
ATOM   1214  N   THR A 101      41.517  52.197  56.475  1.00  0.00           N
ATOM   1215  H   THR A 101      41.646  53.184  56.309  1.00  0.00           H
ATOM   1216  CA  THR A 101      41.001  51.707  57.880  1.00  0.00           C
ATOM   1217  HA  THR A 101      41.644  50.887  58.200  1.00  0.00           H
ATOM   1218  CB  THR A 101      41.091  52.866  58.823  1.00  0.00           C
ATOM   1219  HB  THR A 101      42.122  53.221  58.820  1.00  0.00           H
ATOM   1220  CG2 THR A 101      40.144  54.098  58.487  1.00  0.00           C
ATOM   1221 HG21 THR A 101      40.513  54.971  59.025  1.00  0.00           H
ATOM   1222 HG22 THR A 101      40.057  54.278  57.416  1.00  0.00           H
ATOM   1223 HG23 THR A 101      39.135  53.799  58.773  1.00  0.00           H
ATOM   1224  OG1 THR A 101      40.762  52.470  60.116  1.00  0.00           O
ATOM   1225  HG1 THR A 101      41.511  51.955  60.424  1.00  0.00           H
ATOM   1226  C   THR A 101      39.560  51.171  57.967  1.00  0.00           C
ATOM   1227  O   THR A 101      39.267  50.303  58.771  1.00  0.00           O
ATOM   1228  N   THR A 102      38.835  51.459  56.896  1.00  0.00           N
ATOM   1229  H   THR A 102      39.289  52.204  56.388  1.00  0.00           H
ATOM   1230  CA  THR A 102      37.560  50.807  56.553  1.00  0.00           C
ATOM   1231  HA  THR A 102      36.968  50.818  57.468  1.00  0.00           H
ATOM   1232  CB  THR A 102      36.779  51.766  55.638  1.00  0.00           C
ATOM   1233  HB  THR A 102      35.766  51.450  55.385  1.00  0.00           H
ATOM   1234  CG2 THR A 102      36.485  53.197  56.094  1.00  0.00           C
ATOM   1235 HG21 THR A 102      36.198  53.774  55.214  1.00  0.00           H
ATOM   1236 HG22 THR A 102      35.751  53.238  56.899  1.00  0.00           H
ATOM   1237 HG23 THR A 102      37.323  53.753  56.514  1.00  0.00           H
ATOM   1238  OG1 THR A 102      37.377  51.872  54.353  1.00  0.00           O
ATOM   1239  HG1 THR A 102      37.100  51.085  53.880  1.00  0.00           H
ATOM   1240  C   THR A 102      37.591  49.394  55.889  1.00  0.00           C
ATOM   1241  O   THR A 102      36.615  48.935  55.338  1.00  0.00           O
ATOM   1242  N   CYS A 103      38.783  48.690  55.792  1.00  0.00           N
ATOM   1243  H   CYS A 103      39.616  49.165  56.109  1.00  0.00           H
ATOM   1244  CA  CYS A 103      38.962  47.468  54.921  1.00  0.00           C
ATOM   1245  HA  CYS A 103      38.013  46.936  54.853  1.00  0.00           H
ATOM   1246  CB  CYS A 103      39.653  47.890  53.608  1.00  0.00           C
ATOM   1247  HB2 CYS A 103      40.559  48.443  53.859  1.00  0.00           H
ATOM   1248  HB3 CYS A 103      39.895  46.998  53.031  1.00  0.00           H
ATOM   1249  SG  CYS A 103      38.607  49.035  52.765  1.00  0.00           S
ATOM   1250  HG  CYS A 103      39.084  49.958  53.605  1.00  0.00           H
ATOM   1251  C   CYS A 103      39.872  46.448  55.755  1.00  0.00           C
ATOM   1252  O   CYS A 103      40.415  45.480  55.163  1.00  0.00           O
ATOM   1253  N   ALA A 104      39.921  46.583  57.084  1.00  0.00           N
ATOM   1254  H   ALA A 104      39.403  47.340  57.507  1.00  0.00           H
ATOM   1255  CA  ALA A 104      40.976  46.010  57.961  1.00  0.00           C
ATOM   1256  HA  ALA A 104      41.917  45.994  57.412  1.00  0.00           H
ATOM   1257  CB  ALA A 104      41.153  46.997  59.068  1.00  0.00           C
ATOM   1258  HB1 ALA A 104      40.187  47.151  59.550  1.00  0.00           H
ATOM   1259  HB2 ALA A 104      41.890  46.577  59.752  1.00  0.00           H
ATOM   1260  HB3 ALA A 104      41.664  47.925  58.813  1.00  0.00           H
ATOM   1261  C   ALA A 104      40.729  44.581  58.335  1.00  0.00           C
ATOM   1262  O   ALA A 104      41.661  43.946  58.828  1.00  0.00           O
ATOM   1263  N   ASN A 105      39.486  44.036  58.165  1.00  0.00           N
ATOM   1264  H   ASN A 105      38.689  44.632  57.994  1.00  0.00           H
ATOM   1265  CA  ASN A 105      39.212  42.612  58.539  1.00  0.00           C
ATOM   1266  HA  ASN A 105      39.786  42.393  59.439  1.00  0.00           H
ATOM   1267  CB  ASN A 105      37.716  42.450  58.959  1.00  0.00           C
ATOM   1268  HB2 ASN A 105      37.001  42.549  58.142  1.00  0.00           H
ATOM   1269  HB3 ASN A 105      37.540  41.450  59.357  1.00  0.00           H
ATOM   1270  CG  ASN A 105      37.355  43.377  60.123  1.00  0.00           C
ATOM   1271  OD1 ASN A 105      37.857  43.119  61.217  1.00  0.00           O
ATOM   1272  ND2 ASN A 105      36.474  44.354  59.931  1.00  0.00           N
ATOM   1273 HD21 ASN A 105      36.093  44.834  60.733  1.00  0.00           H
ATOM   1274 HD22 ASN A 105      36.221  44.645  58.998  1.00  0.00           H
ATOM   1275  C   ASN A 105      39.636  41.553  57.578  1.00  0.00           C
ATOM   1276  O   ASN A 105      39.769  40.357  57.964  1.00  0.00           O
ATOM   1277  N   ASP A 106      39.873  41.927  56.306  1.00  0.00           N
ATOM   1278  H   ASP A 106      40.069  42.861  55.975  1.00  0.00           H
ATOM   1279  CA  ASP A 106      40.280  40.904  55.292  1.00  0.00           C
ATOM   1280  HA  ASP A 106      40.798  40.063  55.752  1.00  0.00           H
ATOM   1281  CB  ASP A 106      39.162  40.330  54.513  1.00  0.00           C
ATOM   1282  HB2 ASP A 106      38.388  40.045  55.225  1.00  0.00           H
ATOM   1283  HB3 ASP A 106      38.773  41.064  53.808  1.00  0.00           H
ATOM   1284  CG  ASP A 106      39.430  39.069  53.670  1.00  0.00           C
ATOM   1285  OD1 ASP A 106      40.569  38.626  53.671  1.00  0.00           O
ATOM   1286  OD2 ASP A 106      38.463  38.566  53.122  1.00  0.00           O
ATOM   1287  C   ASP A 106      41.406  41.450  54.398  1.00  0.00           C
ATOM   1288  O   ASP A 106      41.152  41.904  53.294  1.00  0.00           O
ATOM   1289  N   PRO A 107      42.740  41.550  54.768  1.00  0.00           N
ATOM   1290  CD  PRO A 107      43.229  41.338  56.113  1.00  0.00           C
ATOM   1291  HD2 PRO A 107      43.472  40.279  56.207  1.00  0.00           H
ATOM   1292  HD3 PRO A 107      42.711  41.586  57.039  1.00  0.00           H
ATOM   1293  CG  PRO A 107      44.557  42.021  56.160  1.00  0.00           C
ATOM   1294  HG2 PRO A 107      45.161  41.703  57.010  1.00  0.00           H
ATOM   1295  HG3 PRO A 107      44.225  43.050  56.296  1.00  0.00           H
ATOM   1296  CB  PRO A 107      45.070  41.849  54.743  1.00  0.00           C
ATOM   1297  HB2 PRO A 107      45.533  40.884  54.537  1.00  0.00           H
ATOM   1298  HB3 PRO A 107      45.875  42.560  54.559  1.00  0.00           H
ATOM   1299  CA  PRO A 107      43.845  41.980  53.839  1.00  0.00           C
ATOM   1300  HA  PRO A 107      43.580  43.009  53.597  1.00  0.00           H
ATOM   1301  C   PRO A 107      43.877  41.086  52.562  1.00  0.00           C
ATOM   1302  O   PRO A 107      44.109  41.597  51.483  1.00  0.00           O
ATOM   1303  N   VAL A 108      43.614  39.732  52.659  1.00  0.00           N
ATOM   1304  H   VAL A 108      43.438  39.371  53.585  1.00  0.00           H
ATOM   1305  CA  VAL A 108      43.654  38.795  51.555  1.00  0.00           C
ATOM   1306  HA  VAL A 108      44.652  38.854  51.120  1.00  0.00           H
ATOM   1307  CB  VAL A 108      43.527  37.319  52.131  1.00  0.00           C
ATOM   1308  HB  VAL A 108      42.531  37.171  52.548  1.00  0.00           H
ATOM   1309  CG1 VAL A 108      43.738  36.302  50.979  1.00  0.00           C
ATOM   1310 HG11 VAL A 108      43.614  35.285  51.349  1.00  0.00           H
ATOM   1311 HG12 VAL A 108      42.911  36.345  50.271  1.00  0.00           H
ATOM   1312 HG13 VAL A 108      44.709  36.414  50.496  1.00  0.00           H
ATOM   1313  CG2 VAL A 108      44.503  36.860  53.201  1.00  0.00           C
ATOM   1314 HG21 VAL A 108      45.400  36.515  52.686  1.00  0.00           H
ATOM   1315 HG22 VAL A 108      44.813  37.621  53.917  1.00  0.00           H
ATOM   1316 HG23 VAL A 108      44.085  35.995  53.717  1.00  0.00           H
ATOM   1317  C   VAL A 108      42.574  39.155  50.544  1.00  0.00           C
ATOM   1318  O   VAL A 108      42.816  39.460  49.397  1.00  0.00           O
ATOM   1319  N   GLY A 109      41.340  39.283  51.042  1.00  0.00           N
ATOM   1320  H   GLY A 109      41.160  38.984  51.990  1.00  0.00           H
ATOM   1321  CA  GLY A 109      40.199  39.670  50.264  1.00  0.00           C
ATOM   1322  HA2 GLY A 109      40.171  39.005  49.401  1.00  0.00           H
ATOM   1323  HA3 GLY A 109      39.277  39.627  50.844  1.00  0.00           H
ATOM   1324  C   GLY A 109      40.392  41.145  49.735  1.00  0.00           C
ATOM   1325  O   GLY A 109      39.853  41.470  48.710  1.00  0.00           O
ATOM   1326  N   PHE A 110      41.016  42.128  50.401  1.00  0.00           N
ATOM   1327  H   PHE A 110      41.195  41.889  51.365  1.00  0.00           H
ATOM   1328  CA  PHE A 110      41.200  43.471  49.919  1.00  0.00           C
ATOM   1329  HA  PHE A 110      40.285  43.924  49.537  1.00  0.00           H
ATOM   1330  CB  PHE A 110      41.698  44.360  51.038  1.00  0.00           C
ATOM   1331  HB2 PHE A 110      41.088  44.322  51.941  1.00  0.00           H
ATOM   1332  HB3 PHE A 110      42.708  44.078  51.333  1.00  0.00           H
ATOM   1333  CG  PHE A 110      41.653  45.842  50.684  1.00  0.00           C
ATOM   1334  CD1 PHE A 110      40.403  46.497  50.595  1.00  0.00           C
ATOM   1335  HD1 PHE A 110      39.439  46.030  50.738  1.00  0.00           H
ATOM   1336  CE1 PHE A 110      40.370  47.840  50.150  1.00  0.00           C
ATOM   1337  HE1 PHE A 110      39.407  48.313  50.031  1.00  0.00           H
ATOM   1338  CZ  PHE A 110      41.547  48.514  49.833  1.00  0.00           C
ATOM   1339  HZ  PHE A 110      41.426  49.445  49.299  1.00  0.00           H
ATOM   1340  CE2 PHE A 110      42.798  47.915  49.983  1.00  0.00           C
ATOM   1341  HE2 PHE A 110      43.716  48.388  49.665  1.00  0.00           H
ATOM   1342  CD2 PHE A 110      42.797  46.533  50.327  1.00  0.00           C
ATOM   1343  HD2 PHE A 110      43.795  46.125  50.387  1.00  0.00           H
ATOM   1344  C   PHE A 110      42.089  43.474  48.624  1.00  0.00           C
ATOM   1345  O   PHE A 110      41.722  43.953  47.581  1.00  0.00           O
ATOM   1346  N   THR A 111      43.246  42.814  48.808  1.00  0.00           N
ATOM   1347  H   THR A 111      43.375  42.279  49.655  1.00  0.00           H
ATOM   1348  CA  THR A 111      44.184  42.589  47.748  1.00  0.00           C
ATOM   1349  HA  THR A 111      44.668  43.529  47.483  1.00  0.00           H
ATOM   1350  CB  THR A 111      45.269  41.573  48.234  1.00  0.00           C
ATOM   1351  HB  THR A 111      44.828  40.623  48.536  1.00  0.00           H
ATOM   1352  CG2 THR A 111      46.357  41.336  47.208  1.00  0.00           C
ATOM   1353 HG21 THR A 111      46.841  42.262  46.895  1.00  0.00           H
ATOM   1354 HG22 THR A 111      47.203  40.865  47.709  1.00  0.00           H
ATOM   1355 HG23 THR A 111      46.005  40.870  46.288  1.00  0.00           H
ATOM   1356  OG1 THR A 111      45.943  42.142  49.316  1.00  0.00           O
ATOM   1357  HG1 THR A 111      45.577  41.880  50.164  1.00  0.00           H
ATOM   1358  C   THR A 111      43.603  41.887  46.555  1.00  0.00           C
ATOM   1359  O   THR A 111      43.877  42.279  45.376  1.00  0.00           O
ATOM   1360  N   LEU A 112      42.697  40.932  46.754  1.00  0.00           N
ATOM   1361  H   LEU A 112      42.398  40.744  47.701  1.00  0.00           H
ATOM   1362  CA  LEU A 112      41.994  40.103  45.697  1.00  0.00           C
ATOM   1363  HA  LEU A 112      42.739  40.021  44.905  1.00  0.00           H
ATOM   1364  CB  LEU A 112      41.786  38.706  46.258  1.00  0.00           C
ATOM   1365  HB2 LEU A 112      41.424  38.670  47.286  1.00  0.00           H
ATOM   1366  HB3 LEU A 112      41.049  38.196  45.637  1.00  0.00           H
ATOM   1367  CG  LEU A 112      42.898  37.683  46.168  1.00  0.00           C
ATOM   1368  HG  LEU A 112      43.128  37.712  45.103  1.00  0.00           H
ATOM   1369  CD1 LEU A 112      44.185  38.077  46.897  1.00  0.00           C
ATOM   1370 HD11 LEU A 112      45.003  37.460  46.524  1.00  0.00           H
ATOM   1371 HD12 LEU A 112      44.425  39.138  46.824  1.00  0.00           H
ATOM   1372 HD13 LEU A 112      44.186  37.737  47.933  1.00  0.00           H
ATOM   1373  CD2 LEU A 112      42.495  36.244  46.434  1.00  0.00           C
ATOM   1374 HD21 LEU A 112      43.332  35.588  46.193  1.00  0.00           H
ATOM   1375 HD22 LEU A 112      42.270  36.198  47.499  1.00  0.00           H
ATOM   1376 HD23 LEU A 112      41.594  36.007  45.870  1.00  0.00           H
ATOM   1377  C   LEU A 112      40.837  40.727  44.966  1.00  0.00           C
ATOM   1378  O   LEU A 112      40.302  40.014  44.072  1.00  0.00           O
ATOM   1379  N   LYS A 113      40.512  41.947  45.425  1.00  0.00           N
ATOM   1380  H   LYS A 113      41.024  42.331  46.206  1.00  0.00           H
ATOM   1381  CA  LYS A 113      39.445  42.717  44.710  1.00  0.00           C
ATOM   1382  HA  LYS A 113      39.175  42.210  43.784  1.00  0.00           H
ATOM   1383  CB  LYS A 113      38.095  42.899  45.540  1.00  0.00           C
ATOM   1384  HB2 LYS A 113      38.439  43.456  46.412  1.00  0.00           H
ATOM   1385  HB3 LYS A 113      37.386  43.509  44.979  1.00  0.00           H
ATOM   1386  CG  LYS A 113      37.403  41.623  45.889  1.00  0.00           C
ATOM   1387  HG2 LYS A 113      37.236  40.975  45.029  1.00  0.00           H
ATOM   1388  HG3 LYS A 113      38.177  41.095  46.447  1.00  0.00           H
ATOM   1389  CD  LYS A 113      36.051  41.850  46.655  1.00  0.00           C
ATOM   1390  HD2 LYS A 113      35.521  42.507  45.965  1.00  0.00           H
ATOM   1391  HD3 LYS A 113      35.529  40.912  46.844  1.00  0.00           H
ATOM   1392  CE  LYS A 113      36.230  42.578  48.102  1.00  0.00           C
ATOM   1393  HE2 LYS A 113      36.737  43.529  47.934  1.00  0.00           H
ATOM   1394  HE3 LYS A 113      35.204  42.664  48.460  1.00  0.00           H
ATOM   1395  NZ  LYS A 113      36.916  41.824  49.089  1.00  0.00           N
ATOM   1396  HZ1 LYS A 113      37.909  41.932  48.943  1.00  0.00           H
ATOM   1397  HZ2 LYS A 113      36.735  42.078  50.050  1.00  0.00           H
ATOM   1398  HZ3 LYS A 113      36.760  40.830  49.001  1.00  0.00           H
ATOM   1399  C   LYS A 113      39.936  44.110  44.265  1.00  0.00           C
ATOM   1400  O   LYS A 113      39.697  44.559  43.145  1.00  0.00           O
ATOM   1401  N   ASN A 114      40.709  44.920  45.090  1.00  0.00           N
ATOM   1402  H   ASN A 114      40.858  44.527  46.008  1.00  0.00           H
ATOM   1403  CA  ASN A 114      41.100  46.323  44.768  1.00  0.00           C
ATOM   1404  HA  ASN A 114      40.243  46.909  44.438  1.00  0.00           H
ATOM   1405  CB  ASN A 114      41.528  46.973  46.064  1.00  0.00           C
ATOM   1406  HB2 ASN A 114      41.155  46.381  46.900  1.00  0.00           H
ATOM   1407  HB3 ASN A 114      42.588  46.844  46.281  1.00  0.00           H
ATOM   1408  CG  ASN A 114      41.187  48.459  46.159  1.00  0.00           C
ATOM   1409  OD1 ASN A 114      41.955  49.244  45.611  1.00  0.00           O
ATOM   1410  ND2 ASN A 114      40.099  48.918  46.744  1.00  0.00           N
ATOM   1411 HD21 ASN A 114      39.951  49.906  46.596  1.00  0.00           H
ATOM   1412 HD22 ASN A 114      39.403  48.264  47.074  1.00  0.00           H
ATOM   1413  C   ASN A 114      42.206  46.505  43.639  1.00  0.00           C
ATOM   1414  O   ASN A 114      42.852  45.547  43.181  1.00  0.00           O
ATOM   1415  N   THR A 115      42.392  47.768  43.278  1.00  0.00           N
ATOM   1416  H   THR A 115      41.805  48.484  43.681  1.00  0.00           H
ATOM   1417  CA  THR A 115      43.303  48.131  42.183  1.00  0.00           C
ATOM   1418  HA  THR A 115      44.163  47.463  42.140  1.00  0.00           H
ATOM   1419  CB  THR A 115      42.606  48.092  40.824  1.00  0.00           C
ATOM   1420  HB  THR A 115      42.325  47.081  40.529  1.00  0.00           H
ATOM   1421  CG2 THR A 115      41.197  48.843  40.692  1.00  0.00           C
ATOM   1422 HG21 THR A 115      41.143  49.846  41.116  1.00  0.00           H
ATOM   1423 HG22 THR A 115      40.902  48.828  39.643  1.00  0.00           H
ATOM   1424 HG23 THR A 115      40.431  48.285  41.231  1.00  0.00           H
ATOM   1425  OG1 THR A 115      43.457  48.584  39.870  1.00  0.00           O
ATOM   1426  HG1 THR A 115      44.279  48.104  39.994  1.00  0.00           H
ATOM   1427  C   THR A 115      44.042  49.451  42.515  1.00  0.00           C
ATOM   1428  O   THR A 115      43.432  50.359  43.144  1.00  0.00           O
ATOM   1429  N   VAL A 116      45.290  49.606  42.102  1.00  0.00           N
ATOM   1430  H   VAL A 116      45.709  48.759  41.745  1.00  0.00           H
ATOM   1431  CA  VAL A 116      45.969  50.861  42.430  1.00  0.00           C
ATOM   1432  HA  VAL A 116      45.568  51.196  43.387  1.00  0.00           H
ATOM   1433  CB  VAL A 116      47.487  50.511  42.554  1.00  0.00           C
ATOM   1434  HB  VAL A 116      47.908  50.141  41.619  1.00  0.00           H
ATOM   1435  CG1 VAL A 116      48.415  51.733  42.787  1.00  0.00           C
ATOM   1436 HG11 VAL A 116      48.332  52.108  43.807  1.00  0.00           H
ATOM   1437 HG12 VAL A 116      49.463  51.435  42.817  1.00  0.00           H
ATOM   1438 HG13 VAL A 116      48.347  52.573  42.095  1.00  0.00           H
ATOM   1439  CG2 VAL A 116      47.749  49.525  43.733  1.00  0.00           C
ATOM   1440 HG21 VAL A 116      48.807  49.267  43.787  1.00  0.00           H
ATOM   1441 HG22 VAL A 116      47.448  50.029  44.652  1.00  0.00           H
ATOM   1442 HG23 VAL A 116      47.075  48.669  43.707  1.00  0.00           H
ATOM   1443  C   VAL A 116      45.679  51.981  41.441  1.00  0.00           C
ATOM   1444  O   VAL A 116      45.411  51.720  40.266  1.00  0.00           O
ATOM   1445  N   CYS A 117      45.593  53.272  41.883  1.00  0.00           N
ATOM   1446  H   CYS A 117      45.790  53.444  42.859  1.00  0.00           H
ATOM   1447  CA  CYS A 117      45.462  54.441  41.007  1.00  0.00           C
ATOM   1448  HA  CYS A 117      44.844  54.123  40.167  1.00  0.00           H
ATOM   1449  CB  CYS A 117      44.727  55.528  41.849  1.00  0.00           C
ATOM   1450  HB2 CYS A 117      45.359  55.819  42.688  1.00  0.00           H
ATOM   1451  HB3 CYS A 117      44.603  56.462  41.299  1.00  0.00           H
ATOM   1452  SG  CYS A 117      43.099  54.992  42.471  1.00  0.00           S
ATOM   1453  HG  CYS A 117      43.601  54.438  43.578  1.00  0.00           H
ATOM   1454  C   CYS A 117      46.746  54.891  40.346  1.00  0.00           C
ATOM   1455  O   CYS A 117      47.682  55.136  41.078  1.00  0.00           O
ATOM   1456  N   THR A 118      46.884  55.054  39.001  1.00  0.00           N
ATOM   1457  H   THR A 118      46.169  54.747  38.358  1.00  0.00           H
ATOM   1458  CA  THR A 118      48.245  55.225  38.428  1.00  0.00           C
ATOM   1459  HA  THR A 118      48.966  54.603  38.958  1.00  0.00           H
ATOM   1460  CB  THR A 118      48.315  54.752  36.881  1.00  0.00           C
ATOM   1461  HB  THR A 118      49.354  54.671  36.560  1.00  0.00           H
ATOM   1462  CG2 THR A 118      47.753  53.359  36.622  1.00  0.00           C
ATOM   1463 HG21 THR A 118      47.703  53.191  35.546  1.00  0.00           H
ATOM   1464 HG22 THR A 118      48.441  52.638  37.064  1.00  0.00           H
ATOM   1465 HG23 THR A 118      46.731  53.357  37.002  1.00  0.00           H
ATOM   1466  OG1 THR A 118      47.514  55.638  36.094  1.00  0.00           O
ATOM   1467  HG1 THR A 118      48.181  56.233  35.744  1.00  0.00           H
ATOM   1468  C   THR A 118      48.863  56.624  38.572  1.00  0.00           C
ATOM   1469  O   THR A 118      50.036  56.803  38.390  1.00  0.00           O
ATOM   1470  N   VAL A 119      48.071  57.661  38.969  1.00  0.00           N
ATOM   1471  H   VAL A 119      47.083  57.463  39.035  1.00  0.00           H
ATOM   1472  CA  VAL A 119      48.544  59.071  39.159  1.00  0.00           C
ATOM   1473  HA  VAL A 119      49.344  59.199  38.430  1.00  0.00           H
ATOM   1474  CB  VAL A 119      47.411  60.057  38.702  1.00  0.00           C
ATOM   1475  HB  VAL A 119      47.077  59.694  37.730  1.00  0.00           H
ATOM   1476  CG1 VAL A 119      46.327  60.094  39.764  1.00  0.00           C
ATOM   1477 HG11 VAL A 119      45.445  60.256  39.143  1.00  0.00           H
ATOM   1478 HG12 VAL A 119      46.081  59.135  40.218  1.00  0.00           H
ATOM   1479 HG13 VAL A 119      46.428  60.914  40.475  1.00  0.00           H
ATOM   1480  CG2 VAL A 119      47.996  61.487  38.524  1.00  0.00           C
ATOM   1481 HG21 VAL A 119      48.189  62.016  39.458  1.00  0.00           H
ATOM   1482 HG22 VAL A 119      48.952  61.315  38.031  1.00  0.00           H
ATOM   1483 HG23 VAL A 119      47.421  62.158  37.886  1.00  0.00           H
ATOM   1484  C   VAL A 119      49.032  59.213  40.575  1.00  0.00           C
ATOM   1485  O   VAL A 119      49.549  60.337  40.906  1.00  0.00           O
ATOM   1486  N   CYS A 120      48.917  58.275  41.510  1.00  0.00           N
ATOM   1487  H   CYS A 120      48.513  57.395  41.223  1.00  0.00           H
ATOM   1488  CA  CYS A 120      49.424  58.384  42.913  1.00  0.00           C
ATOM   1489  HA  CYS A 120      50.190  59.148  43.049  1.00  0.00           H
ATOM   1490  CB  CYS A 120      48.357  58.971  43.876  1.00  0.00           C
ATOM   1491  HB2 CYS A 120      48.594  58.967  44.940  1.00  0.00           H
ATOM   1492  HB3 CYS A 120      48.198  60.001  43.557  1.00  0.00           H
ATOM   1493  SG  CYS A 120      46.832  57.927  43.887  1.00  0.00           S
ATOM   1494  HG  CYS A 120      46.409  58.920  44.674  1.00  0.00           H
ATOM   1495  C   CYS A 120      50.013  57.210  43.573  1.00  0.00           C
ATOM   1496  O   CYS A 120      50.692  57.412  44.565  1.00  0.00           O
ATOM   1497  N   GLY A 121      49.688  55.976  43.102  1.00  0.00           N
ATOM   1498  H   GLY A 121      49.252  55.886  42.196  1.00  0.00           H
ATOM   1499  CA  GLY A 121      50.029  54.745  43.807  1.00  0.00           C
ATOM   1500  HA2 GLY A 121      49.907  53.948  43.074  1.00  0.00           H
ATOM   1501  HA3 GLY A 121      51.069  54.722  44.133  1.00  0.00           H
ATOM   1502  C   GLY A 121      49.217  54.350  44.991  1.00  0.00           C
ATOM   1503  O   GLY A 121      49.640  53.438  45.648  1.00  0.00           O
ATOM   1504  N   MET A 122      48.113  55.081  45.260  1.00  0.00           N
ATOM   1505  H   MET A 122      47.866  55.753  44.547  1.00  0.00           H
ATOM   1506  CA  MET A 122      47.075  54.657  46.303  1.00  0.00           C
ATOM   1507  HA  MET A 122      47.585  54.184  47.142  1.00  0.00           H
ATOM   1508  CB  MET A 122      46.398  55.809  47.009  1.00  0.00           C
ATOM   1509  HB2 MET A 122      45.859  56.383  46.255  1.00  0.00           H
ATOM   1510  HB3 MET A 122      45.629  55.465  47.700  1.00  0.00           H
ATOM   1511  CG  MET A 122      47.275  56.860  47.695  1.00  0.00           C
ATOM   1512  HG2 MET A 122      48.048  56.371  48.287  1.00  0.00           H
ATOM   1513  HG3 MET A 122      47.779  57.396  46.891  1.00  0.00           H
ATOM   1514  SD  MET A 122      46.311  58.114  48.607  1.00  0.00           S
ATOM   1515  CE  MET A 122      45.534  57.384  50.024  1.00  0.00           C
ATOM   1516  HE1 MET A 122      44.703  56.774  49.668  1.00  0.00           H
ATOM   1517  HE2 MET A 122      46.284  56.727  50.464  1.00  0.00           H
ATOM   1518  HE3 MET A 122      45.109  58.091  50.736  1.00  0.00           H
ATOM   1519  C   MET A 122      46.083  53.670  45.811  1.00  0.00           C
ATOM   1520  O   MET A 122      45.834  53.637  44.646  1.00  0.00           O
ATOM   1521  N   TRP A 123      45.553  52.855  46.703  1.00  0.00           N
ATOM   1522  H   TRP A 123      45.736  52.913  47.695  1.00  0.00           H
ATOM   1523  CA  TRP A 123      44.474  51.947  46.367  1.00  0.00           C
ATOM   1524  HA  TRP A 123      44.730  51.288  45.537  1.00  0.00           H
ATOM   1525  CB  TRP A 123      44.005  51.127  47.597  1.00  0.00           C
ATOM   1526  HB2 TRP A 123      43.709  51.714  48.466  1.00  0.00           H
ATOM   1527  HB3 TRP A 123      43.063  50.627  47.368  1.00  0.00           H
ATOM   1528  CG  TRP A 123      44.927  49.985  48.038  1.00  0.00           C
ATOM   1529  CD1 TRP A 123      45.641  49.932  49.186  1.00  0.00           C
ATOM   1530  HD1 TRP A 123      45.660  50.704  49.941  1.00  0.00           H
ATOM   1531  NE1 TRP A 123      46.355  48.775  49.194  1.00  0.00           N
ATOM   1532  HE1 TRP A 123      46.964  48.501  49.952  1.00  0.00           H
ATOM   1533  CE2 TRP A 123      46.073  47.972  48.145  1.00  0.00           C
ATOM   1534  CZ2 TRP A 123      46.559  46.734  47.764  1.00  0.00           C
ATOM   1535  HZ2 TRP A 123      47.124  46.126  48.455  1.00  0.00           H
ATOM   1536  CH2 TRP A 123      46.155  46.285  46.526  1.00  0.00           C
ATOM   1537  HH2 TRP A 123      46.501  45.331  46.155  1.00  0.00           H
ATOM   1538  CZ3 TRP A 123      45.366  47.017  45.637  1.00  0.00           C
ATOM   1539  HZ3 TRP A 123      45.049  46.663  44.667  1.00  0.00           H
ATOM   1540  CE3 TRP A 123      44.885  48.278  46.012  1.00  0.00           C
ATOM   1541  HE3 TRP A 123      44.300  48.880  45.331  1.00  0.00           H
ATOM   1542  CD2 TRP A 123      45.176  48.821  47.322  1.00  0.00           C
ATOM   1543  C   TRP A 123      43.192  52.631  45.831  1.00  0.00           C
ATOM   1544  O   TRP A 123      42.975  53.752  46.315  1.00  0.00           O
ATOM   1545  N   LYS A 124      42.359  52.177  44.919  1.00  0.00           N
ATOM   1546  H   LYS A 124      42.559  51.261  44.543  1.00  0.00           H
ATOM   1547  CA  LYS A 124      41.118  52.758  44.377  1.00  0.00           C
ATOM   1548  HA  LYS A 124      41.283  53.798  44.092  1.00  0.00           H
ATOM   1549  CB  LYS A 124      40.650  52.026  43.103  1.00  0.00           C
ATOM   1550  HB2 LYS A 124      41.543  51.801  42.520  1.00  0.00           H
ATOM   1551  HB3 LYS A 124      40.211  51.089  43.446  1.00  0.00           H
ATOM   1552  CG  LYS A 124      39.652  52.758  42.286  1.00  0.00           C
ATOM   1553  HG2 LYS A 124      38.750  53.059  42.818  1.00  0.00           H
ATOM   1554  HG3 LYS A 124      39.990  53.729  41.923  1.00  0.00           H
ATOM   1555  CD  LYS A 124      39.107  51.917  41.035  1.00  0.00           C
ATOM   1556  HD2 LYS A 124      40.003  51.619  40.491  1.00  0.00           H
ATOM   1557  HD3 LYS A 124      38.570  51.062  41.446  1.00  0.00           H
ATOM   1558  CE  LYS A 124      38.179  52.779  40.182  1.00  0.00           C
ATOM   1559  HE2 LYS A 124      37.212  52.844  40.680  1.00  0.00           H
ATOM   1560  HE3 LYS A 124      38.642  53.757  40.052  1.00  0.00           H
ATOM   1561  NZ  LYS A 124      37.840  52.124  38.865  1.00  0.00           N
ATOM   1562  HZ1 LYS A 124      38.631  51.633  38.474  1.00  0.00           H
ATOM   1563  HZ2 LYS A 124      37.064  51.490  38.992  1.00  0.00           H
ATOM   1564  HZ3 LYS A 124      37.696  52.804  38.133  1.00  0.00           H
ATOM   1565  C   LYS A 124      40.021  52.765  45.430  1.00  0.00           C
ATOM   1566  O   LYS A 124      39.717  51.679  45.958  1.00  0.00           O
ATOM   1567  N   GLY A 125      39.341  53.868  45.748  1.00  0.00           N
ATOM   1568  H   GLY A 125      39.523  54.729  45.252  1.00  0.00           H
ATOM   1569  CA  GLY A 125      38.245  53.915  46.675  1.00  0.00           C
ATOM   1570  HA2 GLY A 125      37.530  54.686  46.389  1.00  0.00           H
ATOM   1571  HA3 GLY A 125      37.732  52.955  46.640  1.00  0.00           H
ATOM   1572  C   GLY A 125      38.601  54.198  48.143  1.00  0.00           C
ATOM   1573  O   GLY A 125      39.767  54.222  48.410  1.00  0.00           O
ATOM   1574  N   TYR A 126      37.594  54.305  49.032  1.00  0.00           N
ATOM   1575  H   TYR A 126      36.659  54.524  48.720  1.00  0.00           H
ATOM   1576  CA  TYR A 126      37.844  54.242  50.493  1.00  0.00           C
ATOM   1577  HA  TYR A 126      36.909  54.509  50.986  1.00  0.00           H
ATOM   1578  CB  TYR A 126      38.238  52.840  51.011  1.00  0.00           C
ATOM   1579  HB2 TYR A 126      39.212  52.653  50.559  1.00  0.00           H
ATOM   1580  HB3 TYR A 126      38.361  52.880  52.093  1.00  0.00           H
ATOM   1581  CG  TYR A 126      37.263  51.627  50.713  1.00  0.00           C
ATOM   1582  CD1 TYR A 126      36.021  51.531  51.309  1.00  0.00           C
ATOM   1583  HD1 TYR A 126      35.709  52.243  52.059  1.00  0.00           H
ATOM   1584  CE1 TYR A 126      35.054  50.565  50.927  1.00  0.00           C
ATOM   1585  HE1 TYR A 126      34.086  50.640  51.401  1.00  0.00           H
ATOM   1586  CZ  TYR A 126      35.409  49.565  49.964  1.00  0.00           C
ATOM   1587  OH  TYR A 126      34.425  48.715  49.501  1.00  0.00           O
ATOM   1588  HH  TYR A 126      33.765  48.490  50.161  1.00  0.00           H
ATOM   1589  CE2 TYR A 126      36.620  49.710  49.258  1.00  0.00           C
ATOM   1590  HE2 TYR A 126      36.823  49.089  48.398  1.00  0.00           H
ATOM   1591  CD2 TYR A 126      37.534  50.762  49.609  1.00  0.00           C
ATOM   1592  HD2 TYR A 126      38.352  51.012  48.951  1.00  0.00           H
ATOM   1593  C   TYR A 126      38.786  55.273  51.114  1.00  0.00           C
ATOM   1594  O   TYR A 126      39.291  55.065  52.259  1.00  0.00           O
ATOM   1595  N   GLY A 127      39.166  56.322  50.432  1.00  0.00           N
ATOM   1596  H   GLY A 127      38.791  56.424  49.500  1.00  0.00           H
ATOM   1597  CA  GLY A 127      39.951  57.479  50.852  1.00  0.00           C
ATOM   1598  HA2 GLY A 127      39.340  58.378  50.770  1.00  0.00           H
ATOM   1599  HA3 GLY A 127      40.366  57.311  51.846  1.00  0.00           H
ATOM   1600  C   GLY A 127      41.121  57.657  49.957  1.00  0.00           C
ATOM   1601  O   GLY A 127      42.203  57.907  50.495  1.00  0.00           O
ATOM   1602  N   CYS A 128      40.919  57.533  48.669  1.00  0.00           N
ATOM   1603  H   CYS A 128      39.994  57.474  48.268  1.00  0.00           H
ATOM   1604  CA  CYS A 128      42.072  57.718  47.716  1.00  0.00           C
ATOM   1605  HA  CYS A 128      42.968  57.222  48.089  1.00  0.00           H
ATOM   1606  CB  CYS A 128      41.620  57.271  46.285  1.00  0.00           C
ATOM   1607  HB2 CYS A 128      40.830  56.524  46.368  1.00  0.00           H
ATOM   1608  HB3 CYS A 128      41.282  58.151  45.738  1.00  0.00           H
ATOM   1609  SG  CYS A 128      43.061  56.607  45.500  1.00  0.00           S
ATOM   1610  HG  CYS A 128      43.087  55.512  46.265  1.00  0.00           H
ATOM   1611  C   CYS A 128      42.548  59.192  47.739  1.00  0.00           C
ATOM   1612  O   CYS A 128      41.856  60.022  48.379  1.00  0.00           O
ATOM   1613  N   SER A 129      43.669  59.551  47.099  1.00  0.00           N
ATOM   1614  H   SER A 129      44.175  58.867  46.556  1.00  0.00           H
ATOM   1615  CA  SER A 129      44.312  60.880  47.228  1.00  0.00           C
ATOM   1616  HA  SER A 129      44.602  61.044  48.266  1.00  0.00           H
ATOM   1617  CB  SER A 129      45.588  60.866  46.474  1.00  0.00           C
ATOM   1618  HB2 SER A 129      46.124  61.814  46.431  1.00  0.00           H
ATOM   1619  HB3 SER A 129      46.333  60.236  46.962  1.00  0.00           H
ATOM   1620  OG  SER A 129      45.304  60.298  45.152  1.00  0.00           O
ATOM   1621  HG  SER A 129      45.854  60.778  44.528  1.00  0.00           H
ATOM   1622  C   SER A 129      43.418  62.017  46.754  1.00  0.00           C
ATOM   1623  O   SER A 129      43.503  63.103  47.324  1.00  0.00           O
ATOM   1624  N   CYS A 130      42.528  61.785  45.747  1.00  0.00           N
ATOM   1625  H   CYS A 130      42.551  60.849  45.367  1.00  0.00           H
ATOM   1626  CA  CYS A 130      41.673  62.743  45.039  1.00  0.00           C
ATOM   1627  HA  CYS A 130      42.334  63.551  44.723  1.00  0.00           H
ATOM   1628  CB  CYS A 130      41.175  62.152  43.700  1.00  0.00           C
ATOM   1629  HB2 CYS A 130      40.489  62.846  43.215  1.00  0.00           H
ATOM   1630  HB3 CYS A 130      42.011  61.930  43.037  1.00  0.00           H
ATOM   1631  SG  CYS A 130      40.272  60.680  44.142  1.00  0.00           S
ATOM   1632  HG  CYS A 130      39.139  61.190  43.651  1.00  0.00           H
ATOM   1633  C   CYS A 130      40.467  63.399  45.777  1.00  0.00           C
ATOM   1634  O   CYS A 130      40.106  64.544  45.462  1.00  0.00           O
ATOM   1635  N   ASP A 131      40.062  62.753  46.910  1.00  0.00           N
ATOM   1636  H   ASP A 131      40.447  61.847  47.135  1.00  0.00           H
ATOM   1637  CA  ASP A 131      39.028  63.203  47.875  1.00  0.00           C
ATOM   1638  HA  ASP A 131      38.366  63.968  47.468  1.00  0.00           H
ATOM   1639  CB  ASP A 131      38.192  61.941  48.309  1.00  0.00           C
ATOM   1640  HB2 ASP A 131      38.823  61.057  48.396  1.00  0.00           H
ATOM   1641  HB3 ASP A 131      37.673  62.156  49.244  1.00  0.00           H
ATOM   1642  CG  ASP A 131      37.132  61.570  47.338  1.00  0.00           C
ATOM   1643  OD1 ASP A 131      36.589  60.435  47.455  1.00  0.00           O
ATOM   1644  OD2 ASP A 131      36.645  62.350  46.563  1.00  0.00           O
ATOM   1645  C   ASP A 131      39.626  63.917  49.101  1.00  0.00           C
ATOM   1646  O   ASP A 131      38.861  64.666  49.670  1.00  0.00           O
ATOM   1647  N   GLN A 132      40.918  63.754  49.345  1.00  0.00           N
ATOM   1648  H   GLN A 132      41.503  63.274  48.676  1.00  0.00           H
ATOM   1649  CA  GLN A 132      41.510  64.447  50.466  1.00  0.00           C
ATOM   1650  HA  GLN A 132      40.782  64.339  51.271  1.00  0.00           H
ATOM   1651  CB  GLN A 132      42.856  63.883  50.850  1.00  0.00           C
ATOM   1652  HB2 GLN A 132      43.651  64.166  50.160  1.00  0.00           H
ATOM   1653  HB3 GLN A 132      43.119  64.215  51.854  1.00  0.00           H
ATOM   1654  CG  GLN A 132      43.040  62.361  50.938  1.00  0.00           C
ATOM   1655  HG2 GLN A 132      42.986  61.912  49.946  1.00  0.00           H
ATOM   1656  HG3 GLN A 132      44.019  62.139  51.361  1.00  0.00           H
ATOM   1657  CD  GLN A 132      42.025  61.792  51.880  1.00  0.00           C
ATOM   1658  OE1 GLN A 132      41.682  62.357  52.929  1.00  0.00           O
ATOM   1659  NE2 GLN A 132      41.729  60.526  51.764  1.00  0.00           N
ATOM   1660 HE21 GLN A 132      41.176  60.084  52.484  1.00  0.00           H
ATOM   1661 HE22 GLN A 132      42.083  60.003  50.975  1.00  0.00           H
ATOM   1662  C   GLN A 132      41.711  66.013  50.108  1.00  0.00           C
ATOM   1663  O   GLN A 132      42.229  66.390  49.057  1.00  0.00           O
ATOM   1664  N   LEU A 133      41.497  66.825  51.173  1.00  0.00           N
ATOM   1665  H   LEU A 133      41.139  66.370  52.001  1.00  0.00           H
ATOM   1666  CA  LEU A 133      41.864  68.279  51.163  1.00  0.00           C
ATOM   1667  HA  LEU A 133      41.486  68.656  50.213  1.00  0.00           H
ATOM   1668  CB  LEU A 133      41.258  68.935  52.469  1.00  0.00           C
ATOM   1669  HB2 LEU A 133      41.544  68.285  53.295  1.00  0.00           H
ATOM   1670  HB3 LEU A 133      41.721  69.911  52.615  1.00  0.00           H
ATOM   1671  CG  LEU A 133      39.662  69.082  52.293  1.00  0.00           C
ATOM   1672  HG  LEU A 133      39.156  68.183  51.941  1.00  0.00           H
ATOM   1673  CD1 LEU A 133      39.130  69.404  53.676  1.00  0.00           C
ATOM   1674 HD11 LEU A 133      38.119  69.793  53.556  1.00  0.00           H
ATOM   1675 HD12 LEU A 133      39.249  68.534  54.322  1.00  0.00           H
ATOM   1676 HD13 LEU A 133      39.645  70.300  54.022  1.00  0.00           H
ATOM   1677  CD2 LEU A 133      39.410  70.231  51.292  1.00  0.00           C
ATOM   1678 HD21 LEU A 133      39.908  70.089  50.333  1.00  0.00           H
ATOM   1679 HD22 LEU A 133      38.331  70.355  51.195  1.00  0.00           H
ATOM   1680 HD23 LEU A 133      39.846  71.187  51.583  1.00  0.00           H
ATOM   1681  C   LEU A 133      43.388  68.529  51.169  1.00  0.00           C
ATOM   1682  O   LEU A 133      43.866  69.559  50.610  1.00  0.00           O
ATOM   1683  N   ARG A 134      44.178  67.572  51.633  1.00  0.00           N
ATOM   1684  H   ARG A 134      43.714  66.788  52.068  1.00  0.00           H
ATOM   1685  CA  ARG A 134      45.607  67.404  51.359  1.00  0.00           C
ATOM   1686  HA  ARG A 134      45.921  68.003  50.504  1.00  0.00           H
ATOM   1687  CB  ARG A 134      46.395  68.217  52.490  1.00  0.00           C
ATOM   1688  HB2 ARG A 134      46.004  69.234  52.529  1.00  0.00           H
ATOM   1689  HB3 ARG A 134      46.385  67.714  53.456  1.00  0.00           H
ATOM   1690  CG  ARG A 134      47.905  68.293  52.230  1.00  0.00           C
ATOM   1691  HG2 ARG A 134      48.343  68.852  53.057  1.00  0.00           H
ATOM   1692  HG3 ARG A 134      48.351  67.305  52.118  1.00  0.00           H
ATOM   1693  CD  ARG A 134      48.138  69.211  50.992  1.00  0.00           C
ATOM   1694  HD2 ARG A 134      48.019  68.491  50.183  1.00  0.00           H
ATOM   1695  HD3 ARG A 134      47.479  70.077  50.933  1.00  0.00           H
ATOM   1696  NE  ARG A 134      49.499  69.553  50.805  1.00  0.00           N
ATOM   1697  HE  ARG A 134      50.116  69.438  51.597  1.00  0.00           H
ATOM   1698  CZ  ARG A 134      49.983  70.277  49.748  1.00  0.00           C
ATOM   1699  NH1 ARG A 134      51.092  70.981  49.952  1.00  0.00           N
ATOM   1700 HH11 ARG A 134      51.589  70.970  50.831  1.00  0.00           H
ATOM   1701 HH12 ARG A 134      51.585  71.383  49.167  1.00  0.00           H
ATOM   1702  NH2 ARG A 134      49.471  70.314  48.586  1.00  0.00           N
ATOM   1703 HH21 ARG A 134      48.606  69.840  48.367  1.00  0.00           H
ATOM   1704 HH22 ARG A 134      50.086  70.677  47.873  1.00  0.00           H
ATOM   1705  C   ARG A 134      46.088  65.932  51.235  1.00  0.00           C
ATOM   1706  O   ARG A 134      46.117  65.284  52.233  1.00  0.00           O
ATOM   1707  N   GLU A 135      46.526  65.353  50.084  1.00  0.00           N
ATOM   1708  H   GLU A 135      46.718  66.029  49.359  1.00  0.00           H
ATOM   1709  CA  GLU A 135      46.955  63.960  49.816  1.00  0.00           C
ATOM   1710  HA  GLU A 135      46.140  63.377  50.243  1.00  0.00           H
ATOM   1711  CB  GLU A 135      47.015  63.795  48.321  1.00  0.00           C
ATOM   1712  HB2 GLU A 135      47.159  62.754  48.030  1.00  0.00           H
ATOM   1713  HB3 GLU A 135      46.032  64.158  48.021  1.00  0.00           H
ATOM   1714  CG  GLU A 135      48.114  64.679  47.641  1.00  0.00           C
ATOM   1715  HG2 GLU A 135      47.955  65.729  47.886  1.00  0.00           H
ATOM   1716  HG3 GLU A 135      49.121  64.396  47.949  1.00  0.00           H
ATOM   1717  CD  GLU A 135      47.987  64.663  46.128  1.00  0.00           C
ATOM   1718  OE1 GLU A 135      48.655  63.803  45.493  1.00  0.00           O
ATOM   1719  OE2 GLU A 135      47.168  65.417  45.521  1.00  0.00           O
ATOM   1720  C   GLU A 135      48.206  63.518  50.658  1.00  0.00           C
ATOM   1721  O   GLU A 135      49.133  64.328  50.625  1.00  0.00           O
ATOM   1722  N   PRO A 136      48.324  62.341  51.382  1.00  0.00           N
ATOM   1723  CD  PRO A 136      47.380  61.221  51.237  1.00  0.00           C
ATOM   1724  HD2 PRO A 136      46.839  61.280  50.292  1.00  0.00           H
ATOM   1725  HD3 PRO A 136      46.679  61.222  52.071  1.00  0.00           H
ATOM   1726  CG  PRO A 136      48.270  59.992  51.252  1.00  0.00           C
ATOM   1727  HG2 PRO A 136      48.724  59.785  50.283  1.00  0.00           H
ATOM   1728  HG3 PRO A 136      47.706  59.098  51.518  1.00  0.00           H
ATOM   1729  CB  PRO A 136      49.308  60.377  52.297  1.00  0.00           C
ATOM   1730  HB2 PRO A 136      50.250  59.857  52.128  1.00  0.00           H
ATOM   1731  HB3 PRO A 136      48.989  60.127  53.308  1.00  0.00           H
ATOM   1732  CA  PRO A 136      49.499  61.856  52.075  1.00  0.00           C
ATOM   1733  HA  PRO A 136      49.471  62.325  53.059  1.00  0.00           H
ATOM   1734  C   PRO A 136      50.934  62.050  51.484  1.00  0.00           C
ATOM   1735  O   PRO A 136      51.835  61.957  52.240  1.00  0.00           O
ATOM   1736  N   MET A 137      51.118  62.098  50.189  1.00  0.00           N
ATOM   1737  H   MET A 137      50.372  62.084  49.508  1.00  0.00           H
ATOM   1738  CA  MET A 137      52.473  62.391  49.606  1.00  0.00           C
ATOM   1739  HA  MET A 137      53.108  61.945  50.372  1.00  0.00           H
ATOM   1740  CB  MET A 137      52.709  61.539  48.384  1.00  0.00           C
ATOM   1741  HB2 MET A 137      52.586  60.476  48.590  1.00  0.00           H
ATOM   1742  HB3 MET A 137      52.013  61.687  47.558  1.00  0.00           H
ATOM   1743  CG  MET A 137      54.093  61.718  47.735  1.00  0.00           C
ATOM   1744  HG2 MET A 137      54.758  61.705  48.598  1.00  0.00           H
ATOM   1745  HG3 MET A 137      54.219  60.823  47.127  1.00  0.00           H
ATOM   1746  SD  MET A 137      54.233  63.084  46.592  1.00  0.00           S
ATOM   1747  CE  MET A 137      53.149  62.725  45.217  1.00  0.00           C
ATOM   1748  HE1 MET A 137      53.139  61.641  45.108  1.00  0.00           H
ATOM   1749  HE2 MET A 137      52.128  63.054  45.414  1.00  0.00           H
ATOM   1750  HE3 MET A 137      53.494  63.278  44.343  1.00  0.00           H
ATOM   1751  C   MET A 137      52.879  63.883  49.352  1.00  0.00           C
ATOM   1752  O   MET A 137      53.967  64.355  49.720  1.00  0.00           O
ATOM   1753  N   LEU A 138      51.887  64.717  49.051  1.00  0.00           N
ATOM   1754  H   LEU A 138      50.952  64.338  49.045  1.00  0.00           H
ATOM   1755  CA  LEU A 138      52.016  66.127  49.255  1.00  0.00           C
ATOM   1756  HA  LEU A 138      53.035  66.411  48.994  1.00  0.00           H
ATOM   1757  CB  LEU A 138      51.121  66.997  48.317  1.00  0.00           C
ATOM   1758  HB2 LEU A 138      50.083  67.064  48.642  1.00  0.00           H
ATOM   1759  HB3 LEU A 138      51.648  67.951  48.299  1.00  0.00           H
ATOM   1760  CG  LEU A 138      51.231  66.608  46.805  1.00  0.00           C
ATOM   1761  HG  LEU A 138      51.030  65.539  46.733  1.00  0.00           H
ATOM   1762  CD1 LEU A 138      50.149  67.301  45.910  1.00  0.00           C
ATOM   1763 HD11 LEU A 138      49.213  67.099  46.432  1.00  0.00           H
ATOM   1764 HD12 LEU A 138      50.327  68.363  45.743  1.00  0.00           H
ATOM   1765 HD13 LEU A 138      50.197  66.872  44.909  1.00  0.00           H
ATOM   1766  CD2 LEU A 138      52.601  66.894  46.170  1.00  0.00           C
ATOM   1767 HD21 LEU A 138      53.295  66.155  46.573  1.00  0.00           H
ATOM   1768 HD22 LEU A 138      52.471  66.738  45.099  1.00  0.00           H
ATOM   1769 HD23 LEU A 138      52.883  67.930  46.356  1.00  0.00           H
ATOM   1770  C   LEU A 138      51.873  66.648  50.654  1.00  0.00           C
ATOM   1771  O   LEU A 138      51.979  67.853  50.913  1.00  0.00           O
ATOM   1772  N   GLN A 139      51.363  65.816  51.582  1.00  0.00           N
ATOM   1773  H   GLN A 139      50.999  64.903  51.350  1.00  0.00           H
ATOM   1774  CA  GLN A 139      51.355  66.087  53.010  1.00  0.00           C
ATOM   1775  HA  GLN A 139      50.603  66.876  53.029  1.00  0.00           H
ATOM   1776  CB  GLN A 139      50.687  64.952  53.904  1.00  0.00           C
ATOM   1777  HB2 GLN A 139      50.964  63.969  53.522  1.00  0.00           H
ATOM   1778  HB3 GLN A 139      51.132  65.054  54.894  1.00  0.00           H
ATOM   1779  CG  GLN A 139      49.218  65.165  53.961  1.00  0.00           C
ATOM   1780  HG2 GLN A 139      48.878  66.097  54.412  1.00  0.00           H
ATOM   1781  HG3 GLN A 139      48.853  65.206  52.935  1.00  0.00           H
ATOM   1782  CD  GLN A 139      48.396  64.106  54.750  1.00  0.00           C
ATOM   1783  OE1 GLN A 139      49.006  63.361  55.569  1.00  0.00           O
ATOM   1784  NE2 GLN A 139      47.195  63.765  54.347  1.00  0.00           N
ATOM   1785 HE21 GLN A 139      46.719  63.003  54.807  1.00  0.00           H
ATOM   1786 HE22 GLN A 139      46.842  64.174  53.493  1.00  0.00           H
ATOM   1787  C   GLN A 139      52.645  66.589  53.593  1.00  0.00           C
ATOM   1788  O   GLN A 139      52.651  67.730  54.108  1.00  0.00           O
ATOM   1789  OXT GLN A 139      53.567  65.753  53.551  1.00  0.00           O
TER    1790      GLN A 139
ATOM   1791  N   SER B   1      59.451  58.490  83.309  1.00  0.00           N
ATOM   1792  H1  SER B   1      60.453  58.565  83.408  1.00  0.00           H
ATOM   1793  H2  SER B   1      59.095  59.398  83.573  1.00  0.00           H
ATOM   1794  H3  SER B   1      59.121  58.332  82.368  1.00  0.00           H
ATOM   1795  CA  SER B   1      58.953  57.377  84.089  1.00  0.00           C
ATOM   1796  HA  SER B   1      59.548  57.458  84.999  1.00  0.00           H
ATOM   1797  CB  SER B   1      57.551  57.559  84.659  1.00  0.00           C
ATOM   1798  HB2 SER B   1      57.433  56.909  85.527  1.00  0.00           H
ATOM   1799  HB3 SER B   1      57.321  58.565  85.008  1.00  0.00           H
ATOM   1800  OG  SER B   1      56.656  57.176  83.711  1.00  0.00           O
ATOM   1801  HG  SER B   1      55.792  57.001  84.090  1.00  0.00           H
ATOM   1802  C   SER B   1      59.194  56.074  83.360  1.00  0.00           C
ATOM   1803  O   SER B   1      59.277  56.095  82.102  1.00  0.00           O
ATOM   1804  N   GLN B   2      59.137  54.961  84.084  1.00  0.00           N
ATOM   1805  H   GLN B   2      58.779  55.051  85.024  1.00  0.00           H
ATOM   1806  CA  GLN B   2      59.336  53.701  83.507  1.00  0.00           C
ATOM   1807  HA  GLN B   2      60.246  53.783  82.912  1.00  0.00           H
ATOM   1808  CB  GLN B   2      59.610  52.604  84.573  1.00  0.00           C
ATOM   1809  HB2 GLN B   2      58.783  52.645  85.282  1.00  0.00           H
ATOM   1810  HB3 GLN B   2      59.438  51.693  84.000  1.00  0.00           H
ATOM   1811  CG  GLN B   2      61.005  52.775  85.157  1.00  0.00           C
ATOM   1812  HG2 GLN B   2      61.624  52.831  84.261  1.00  0.00           H
ATOM   1813  HG3 GLN B   2      61.014  53.734  85.673  1.00  0.00           H
ATOM   1814  CD  GLN B   2      61.492  51.625  86.012  1.00  0.00           C
ATOM   1815  OE1 GLN B   2      60.805  50.657  86.353  1.00  0.00           O
ATOM   1816  NE2 GLN B   2      62.739  51.641  86.402  1.00  0.00           N
ATOM   1817 HE21 GLN B   2      63.013  50.817  86.918  1.00  0.00           H
ATOM   1818 HE22 GLN B   2      63.349  52.425  86.221  1.00  0.00           H
ATOM   1819  C   GLN B   2      58.236  53.339  82.479  1.00  0.00           C
ATOM   1820  O   GLN B   2      58.525  52.636  81.532  1.00  0.00           O
ATOM   1821  N   ALA B   3      57.093  53.885  82.597  1.00  0.00           N
ATOM   1822  H   ALA B   3      56.938  54.300  83.504  1.00  0.00           H
ATOM   1823  CA  ALA B   3      56.040  53.860  81.611  1.00  0.00           C
ATOM   1824  HA  ALA B   3      55.681  52.831  81.581  1.00  0.00           H
ATOM   1825  CB  ALA B   3      54.922  54.621  82.176  1.00  0.00           C
ATOM   1826  HB1 ALA B   3      53.989  54.441  81.643  1.00  0.00           H
ATOM   1827  HB2 ALA B   3      54.725  54.225  83.172  1.00  0.00           H
ATOM   1828  HB3 ALA B   3      55.043  55.705  82.168  1.00  0.00           H
ATOM   1829  C   ALA B   3      56.255  54.402  80.208  1.00  0.00           C
ATOM   1830  O   ALA B   3      55.649  53.914  79.283  1.00  0.00           O
ATOM   1831  N   TRP B   4      57.153  55.381  80.094  1.00  0.00           N
ATOM   1832  H   TRP B   4      57.647  55.607  80.946  1.00  0.00           H
ATOM   1833  CA  TRP B   4      57.362  56.148  78.836  1.00  0.00           C
ATOM   1834  HA  TRP B   4      56.531  56.022  78.142  1.00  0.00           H
ATOM   1835  CB  TRP B   4      57.262  57.709  79.068  1.00  0.00           C
ATOM   1836  HB2 TRP B   4      57.826  58.040  79.940  1.00  0.00           H
ATOM   1837  HB3 TRP B   4      57.721  58.183  78.201  1.00  0.00           H
ATOM   1838  CG  TRP B   4      55.857  58.138  79.301  1.00  0.00           C
ATOM   1839  CD1 TRP B   4      55.161  58.081  80.484  1.00  0.00           C
ATOM   1840  HD1 TRP B   4      55.641  57.901  81.435  1.00  0.00           H
ATOM   1841  NE1 TRP B   4      53.972  58.721  80.342  1.00  0.00           N
ATOM   1842  HE1 TRP B   4      53.274  58.877  81.055  1.00  0.00           H
ATOM   1843  CE2 TRP B   4      53.790  59.087  79.050  1.00  0.00           C
ATOM   1844  CZ2 TRP B   4      52.749  59.712  78.288  1.00  0.00           C
ATOM   1845  HZ2 TRP B   4      51.810  59.943  78.767  1.00  0.00           H
ATOM   1846  CH2 TRP B   4      52.821  59.795  76.914  1.00  0.00           C
ATOM   1847  HH2 TRP B   4      51.992  60.253  76.394  1.00  0.00           H
ATOM   1848  CZ3 TRP B   4      53.960  59.316  76.241  1.00  0.00           C
ATOM   1849  HZ3 TRP B   4      54.176  59.440  75.190  1.00  0.00           H
ATOM   1850  CE3 TRP B   4      55.020  58.731  76.981  1.00  0.00           C
ATOM   1851  HE3 TRP B   4      55.864  58.399  76.393  1.00  0.00           H
ATOM   1852  CD2 TRP B   4      54.915  58.602  78.346  1.00  0.00           C
ATOM   1853  C   TRP B   4      58.676  55.737  78.143  1.00  0.00           C
ATOM   1854  O   TRP B   4      58.778  55.900  76.942  1.00  0.00           O
ATOM   1855  N   GLN B   5      59.592  55.066  78.755  1.00  0.00           N
ATOM   1856  H   GLN B   5      59.532  54.978  79.760  1.00  0.00           H
ATOM   1857  CA  GLN B   5      60.602  54.119  78.197  1.00  0.00           C
ATOM   1858  HA  GLN B   5      61.177  54.729  77.501  1.00  0.00           H
ATOM   1859  CB  GLN B   5      61.510  53.558  79.333  1.00  0.00           C
ATOM   1860  HB2 GLN B   5      60.932  53.009  80.077  1.00  0.00           H
ATOM   1861  HB3 GLN B   5      62.286  52.948  78.871  1.00  0.00           H
ATOM   1862  CG  GLN B   5      62.265  54.727  80.069  1.00  0.00           C
ATOM   1863  HG2 GLN B   5      63.040  55.119  79.410  1.00  0.00           H
ATOM   1864  HG3 GLN B   5      61.474  55.474  80.127  1.00  0.00           H
ATOM   1865  CD  GLN B   5      62.907  54.233  81.342  1.00  0.00           C
ATOM   1866  OE1 GLN B   5      63.074  55.018  82.220  1.00  0.00           O
ATOM   1867  NE2 GLN B   5      63.281  53.025  81.571  1.00  0.00           N
ATOM   1868 HE21 GLN B   5      63.930  52.878  82.331  1.00  0.00           H
ATOM   1869 HE22 GLN B   5      63.050  52.277  80.933  1.00  0.00           H
ATOM   1870  C   GLN B   5      59.952  52.921  77.473  1.00  0.00           C
ATOM   1871  O   GLN B   5      58.777  52.673  77.691  1.00  0.00           O
ATOM   1872  N   PRO B   6      60.676  52.091  76.724  1.00  0.00           N
ATOM   1873  CD  PRO B   6      62.012  52.303  76.141  1.00  0.00           C
ATOM   1874  HD2 PRO B   6      62.775  51.911  76.813  1.00  0.00           H
ATOM   1875  HD3 PRO B   6      62.187  53.337  75.842  1.00  0.00           H
ATOM   1876  CG  PRO B   6      62.149  51.359  74.883  1.00  0.00           C
ATOM   1877  HG2 PRO B   6      63.007  50.699  75.014  1.00  0.00           H
ATOM   1878  HG3 PRO B   6      62.569  51.749  73.956  1.00  0.00           H
ATOM   1879  CB  PRO B   6      60.840  50.611  74.854  1.00  0.00           C
ATOM   1880  HB2 PRO B   6      60.924  49.531  74.728  1.00  0.00           H
ATOM   1881  HB3 PRO B   6      60.313  51.087  74.027  1.00  0.00           H
ATOM   1882  CA  PRO B   6      60.087  50.902  76.156  1.00  0.00           C
ATOM   1883  HA  PRO B   6      59.044  51.084  75.894  1.00  0.00           H
ATOM   1884  C   PRO B   6      60.085  49.671  77.094  1.00  0.00           C
ATOM   1885  O   PRO B   6      59.364  48.712  76.885  1.00  0.00           O
ATOM   1886  N   GLY B   7      60.843  49.730  78.166  1.00  0.00           N
ATOM   1887  H   GLY B   7      61.448  50.501  78.410  1.00  0.00           H
ATOM   1888  CA  GLY B   7      60.982  48.609  79.071  1.00  0.00           C
ATOM   1889  HA2 GLY B   7      60.033  48.356  79.545  1.00  0.00           H
ATOM   1890  HA3 GLY B   7      61.397  47.847  78.411  1.00  0.00           H
ATOM   1891  C   GLY B   7      61.916  48.931  80.152  1.00  0.00           C
ATOM   1892  O   GLY B   7      62.166  50.127  80.276  1.00  0.00           O
ATOM   1893  N   VAL B   8      62.409  47.940  80.849  1.00  0.00           N
ATOM   1894  H   VAL B   8      62.147  46.995  80.611  1.00  0.00           H
ATOM   1895  CA  VAL B   8      63.265  48.139  81.998  1.00  0.00           C
ATOM   1896  HA  VAL B   8      63.731  49.121  81.913  1.00  0.00           H
ATOM   1897  CB  VAL B   8      62.449  47.995  83.324  1.00  0.00           C
ATOM   1898  HB  VAL B   8      61.962  47.024  83.412  1.00  0.00           H
ATOM   1899  CG1 VAL B   8      63.378  48.164  84.634  1.00  0.00           C
ATOM   1900 HG11 VAL B   8      64.004  47.295  84.835  1.00  0.00           H
ATOM   1901 HG12 VAL B   8      64.119  48.943  84.451  1.00  0.00           H
ATOM   1902 HG13 VAL B   8      62.885  48.419  85.572  1.00  0.00           H
ATOM   1903  CG2 VAL B   8      61.491  49.125  83.461  1.00  0.00           C
ATOM   1904 HG21 VAL B   8      61.945  50.088  83.229  1.00  0.00           H
ATOM   1905 HG22 VAL B   8      60.609  48.980  82.836  1.00  0.00           H
ATOM   1906 HG23 VAL B   8      61.088  49.063  84.472  1.00  0.00           H
ATOM   1907  C   VAL B   8      64.353  47.055  81.944  1.00  0.00           C
ATOM   1908  O   VAL B   8      64.129  45.968  81.393  1.00  0.00           O
ATOM   1909  N   ALA B   9      65.507  47.341  82.506  1.00  0.00           N
ATOM   1910  H   ALA B   9      65.614  48.200  83.026  1.00  0.00           H
ATOM   1911  CA  ALA B   9      66.734  46.548  82.365  1.00  0.00           C
ATOM   1912  HA  ALA B   9      66.495  45.551  81.996  1.00  0.00           H
ATOM   1913  CB  ALA B   9      67.693  47.180  81.365  1.00  0.00           C
ATOM   1914  HB1 ALA B   9      68.510  46.465  81.269  1.00  0.00           H
ATOM   1915  HB2 ALA B   9      67.171  47.253  80.411  1.00  0.00           H
ATOM   1916  HB3 ALA B   9      67.923  48.176  81.743  1.00  0.00           H
ATOM   1917  C   ALA B   9      67.400  46.383  83.773  1.00  0.00           C
ATOM   1918  O   ALA B   9      67.343  47.281  84.616  1.00  0.00           O
ATOM   1919  N   MET B  10      68.100  45.273  83.977  1.00  0.00           N
ATOM   1920  H   MET B  10      68.105  44.535  83.287  1.00  0.00           H
ATOM   1921  CA  MET B  10      68.738  45.008  85.313  1.00  0.00           C
ATOM   1922  HA  MET B  10      67.894  44.874  85.989  1.00  0.00           H
ATOM   1923  CB  MET B  10      69.427  43.668  85.372  1.00  0.00           C
ATOM   1924  HB2 MET B  10      68.873  42.816  84.977  1.00  0.00           H
ATOM   1925  HB3 MET B  10      70.272  43.598  84.687  1.00  0.00           H
ATOM   1926  CG  MET B  10      69.822  43.312  86.848  1.00  0.00           C
ATOM   1927  HG2 MET B  10      70.459  44.084  87.280  1.00  0.00           H
ATOM   1928  HG3 MET B  10      68.904  43.295  87.435  1.00  0.00           H
ATOM   1929  SD  MET B  10      70.693  41.743  87.072  1.00  0.00           S
ATOM   1930  CE  MET B  10      69.257  40.632  86.818  1.00  0.00           C
ATOM   1931  HE1 MET B  10      68.869  40.678  85.800  1.00  0.00           H
ATOM   1932  HE2 MET B  10      69.583  39.593  86.868  1.00  0.00           H
ATOM   1933  HE3 MET B  10      68.541  40.819  87.618  1.00  0.00           H
ATOM   1934  C   MET B  10      69.684  46.115  85.795  1.00  0.00           C
ATOM   1935  O   MET B  10      70.592  46.364  85.000  1.00  0.00           O
ATOM   1936  N   PRO B  11      69.538  46.783  86.961  1.00  0.00           N
ATOM   1937  CD  PRO B  11      68.437  46.716  87.812  1.00  0.00           C
ATOM   1938  HD2 PRO B  11      68.558  45.829  88.434  1.00  0.00           H
ATOM   1939  HD3 PRO B  11      67.491  46.621  87.279  1.00  0.00           H
ATOM   1940  CG  PRO B  11      68.487  48.028  88.576  1.00  0.00           C
ATOM   1941  HG2 PRO B  11      68.323  47.762  89.621  1.00  0.00           H
ATOM   1942  HG3 PRO B  11      67.682  48.673  88.223  1.00  0.00           H
ATOM   1943  CB  PRO B  11      69.837  48.728  88.403  1.00  0.00           C
ATOM   1944  HB2 PRO B  11      70.275  48.893  89.388  1.00  0.00           H
ATOM   1945  HB3 PRO B  11      69.718  49.736  88.006  1.00  0.00           H
ATOM   1946  CA  PRO B  11      70.542  47.731  87.486  1.00  0.00           C
ATOM   1947  HA  PRO B  11      71.063  48.393  86.795  1.00  0.00           H
ATOM   1948  C   PRO B  11      71.781  47.063  88.175  1.00  0.00           C
ATOM   1949  O   PRO B  11      71.768  45.909  88.593  1.00  0.00           O
ATOM   1950  N   ASN B  12      72.903  47.795  88.216  1.00  0.00           N
ATOM   1951  H   ASN B  12      72.983  48.756  87.917  1.00  0.00           H
ATOM   1952  CA  ASN B  12      74.154  47.183  88.750  1.00  0.00           C
ATOM   1953  HA  ASN B  12      74.458  46.380  88.078  1.00  0.00           H
ATOM   1954  CB  ASN B  12      75.318  48.217  88.682  1.00  0.00           C
ATOM   1955  HB2 ASN B  12      75.289  48.765  87.741  1.00  0.00           H
ATOM   1956  HB3 ASN B  12      75.334  48.975  89.465  1.00  0.00           H
ATOM   1957  CG  ASN B  12      76.728  47.677  88.654  1.00  0.00           C
ATOM   1958  OD1 ASN B  12      76.947  46.652  88.089  1.00  0.00           O
ATOM   1959  ND2 ASN B  12      77.686  48.242  89.360  1.00  0.00           N
ATOM   1960 HD21 ASN B  12      78.454  47.617  89.560  1.00  0.00           H
ATOM   1961 HD22 ASN B  12      77.472  49.078  89.883  1.00  0.00           H
ATOM   1962  C   ASN B  12      74.098  46.589  90.227  1.00  0.00           C
ATOM   1963  O   ASN B  12      74.560  45.469  90.335  1.00  0.00           O
ATOM   1964  N   LEU B  13      73.353  47.171  91.166  1.00  0.00           N
ATOM   1965  H   LEU B  13      73.143  48.134  90.949  1.00  0.00           H
ATOM   1966  CA  LEU B  13      73.117  46.685  92.509  1.00  0.00           C
ATOM   1967  HA  LEU B  13      74.087  46.759  93.002  1.00  0.00           H
ATOM   1968  CB  LEU B  13      72.127  47.636  93.197  1.00  0.00           C
ATOM   1969  HB2 LEU B  13      72.549  48.641  93.202  1.00  0.00           H
ATOM   1970  HB3 LEU B  13      71.280  47.568  92.514  1.00  0.00           H
ATOM   1971  CG  LEU B  13      71.852  47.258  94.645  1.00  0.00           C
ATOM   1972  HG  LEU B  13      71.564  46.212  94.538  1.00  0.00           H
ATOM   1973  CD1 LEU B  13      73.038  47.551  95.595  1.00  0.00           C
ATOM   1974 HD11 LEU B  13      72.718  47.159  96.560  1.00  0.00           H
ATOM   1975 HD12 LEU B  13      73.970  47.159  95.186  1.00  0.00           H
ATOM   1976 HD13 LEU B  13      73.155  48.634  95.586  1.00  0.00           H
ATOM   1977  CD2 LEU B  13      70.706  48.081  95.281  1.00  0.00           C
ATOM   1978 HD21 LEU B  13      70.931  49.146  95.336  1.00  0.00           H
ATOM   1979 HD22 LEU B  13      69.731  47.884  94.835  1.00  0.00           H
ATOM   1980 HD23 LEU B  13      70.537  47.788  96.317  1.00  0.00           H
ATOM   1981  C   LEU B  13      72.598  45.184  92.613  1.00  0.00           C
ATOM   1982  O   LEU B  13      72.992  44.546  93.585  1.00  0.00           O
ATOM   1983  N   TYR B  14      71.944  44.665  91.596  1.00  0.00           N
ATOM   1984  H   TYR B  14      72.079  45.046  90.670  1.00  0.00           H
ATOM   1985  CA  TYR B  14      71.408  43.312  91.591  1.00  0.00           C
ATOM   1986  HA  TYR B  14      71.316  42.915  92.602  1.00  0.00           H
ATOM   1987  CB  TYR B  14      69.932  43.222  91.006  1.00  0.00           C
ATOM   1988  HB2 TYR B  14      70.003  43.427  89.938  1.00  0.00           H
ATOM   1989  HB3 TYR B  14      69.583  42.205  91.185  1.00  0.00           H
ATOM   1990  CG  TYR B  14      68.924  44.224  91.663  1.00  0.00           C
ATOM   1991  CD1 TYR B  14      68.906  45.643  91.391  1.00  0.00           C
ATOM   1992  HD1 TYR B  14      69.707  45.970  90.744  1.00  0.00           H
ATOM   1993  CE1 TYR B  14      67.971  46.490  91.956  1.00  0.00           C
ATOM   1994  HE1 TYR B  14      67.981  47.552  91.755  1.00  0.00           H
ATOM   1995  CZ  TYR B  14      67.019  46.016  92.883  1.00  0.00           C
ATOM   1996  OH  TYR B  14      66.144  46.802  93.502  1.00  0.00           O
ATOM   1997  HH  TYR B  14      66.191  47.707  93.184  1.00  0.00           H
ATOM   1998  CE2 TYR B  14      66.967  44.634  93.160  1.00  0.00           C
ATOM   1999  HE2 TYR B  14      66.228  44.345  93.893  1.00  0.00           H
ATOM   2000  CD2 TYR B  14      67.945  43.797  92.558  1.00  0.00           C
ATOM   2001  HD2 TYR B  14      67.843  42.735  92.728  1.00  0.00           H
ATOM   2002  C   TYR B  14      72.285  42.360  90.782  1.00  0.00           C
ATOM   2003  O   TYR B  14      72.347  41.219  91.138  1.00  0.00           O
ATOM   2004  N   LYS B  15      73.013  42.865  89.765  1.00  0.00           N
ATOM   2005  H   LYS B  15      72.960  43.864  89.628  1.00  0.00           H
ATOM   2006  CA  LYS B  15      74.085  42.111  89.096  1.00  0.00           C
ATOM   2007  HA  LYS B  15      73.728  41.182  88.652  1.00  0.00           H
ATOM   2008  CB  LYS B  15      74.673  42.991  87.978  1.00  0.00           C
ATOM   2009  HB2 LYS B  15      74.855  43.985  88.387  1.00  0.00           H
ATOM   2010  HB3 LYS B  15      75.653  42.635  87.661  1.00  0.00           H
ATOM   2011  CG  LYS B  15      73.732  43.154  86.699  1.00  0.00           C
ATOM   2012  HG2 LYS B  15      73.376  42.169  86.396  1.00  0.00           H
ATOM   2013  HG3 LYS B  15      72.909  43.776  87.051  1.00  0.00           H
ATOM   2014  CD  LYS B  15      74.564  43.768  85.585  1.00  0.00           C
ATOM   2015  HD2 LYS B  15      74.926  44.711  85.997  1.00  0.00           H
ATOM   2016  HD3 LYS B  15      75.324  43.082  85.209  1.00  0.00           H
ATOM   2017  CE  LYS B  15      73.696  44.001  84.346  1.00  0.00           C
ATOM   2018  HE2 LYS B  15      73.589  42.996  83.935  1.00  0.00           H
ATOM   2019  HE3 LYS B  15      72.746  44.473  84.594  1.00  0.00           H
ATOM   2020  NZ  LYS B  15      74.389  44.843  83.310  1.00  0.00           N
ATOM   2021  HZ1 LYS B  15      74.054  44.549  82.404  1.00  0.00           H
ATOM   2022  HZ2 LYS B  15      74.518  45.824  83.516  1.00  0.00           H
ATOM   2023  HZ3 LYS B  15      75.376  44.657  83.200  1.00  0.00           H
ATOM   2024  C   LYS B  15      75.184  41.841  90.043  1.00  0.00           C
ATOM   2025  O   LYS B  15      75.650  40.693  89.957  1.00  0.00           O
ATOM   2026  N   MET B  16      75.544  42.781  90.973  1.00  0.00           N
ATOM   2027  H   MET B  16      75.002  43.633  90.972  1.00  0.00           H
ATOM   2028  CA  MET B  16      76.627  42.515  91.878  1.00  0.00           C
ATOM   2029  HA  MET B  16      77.355  42.084  91.191  1.00  0.00           H
ATOM   2030  CB  MET B  16      77.229  43.787  92.547  1.00  0.00           C
ATOM   2031  HB2 MET B  16      78.221  43.579  92.947  1.00  0.00           H
ATOM   2032  HB3 MET B  16      77.505  44.512  91.781  1.00  0.00           H
ATOM   2033  CG  MET B  16      76.323  44.418  93.479  1.00  0.00           C
ATOM   2034  HG2 MET B  16      76.358  45.506  93.534  1.00  0.00           H
ATOM   2035  HG3 MET B  16      75.302  44.199  93.165  1.00  0.00           H
ATOM   2036  SD  MET B  16      76.401  43.873  95.179  1.00  0.00           S
ATOM   2037  CE  MET B  16      77.979  44.598  95.639  1.00  0.00           C
ATOM   2038  HE1 MET B  16      78.505  44.023  96.401  1.00  0.00           H
ATOM   2039  HE2 MET B  16      78.645  44.537  94.778  1.00  0.00           H
ATOM   2040  HE3 MET B  16      77.830  45.651  95.878  1.00  0.00           H
ATOM   2041  C   MET B  16      76.463  41.435  92.962  1.00  0.00           C
ATOM   2042  O   MET B  16      77.397  40.986  93.646  1.00  0.00           O
ATOM   2043  N   GLN B  17      75.202  40.928  93.049  1.00  0.00           N
ATOM   2044  H   GLN B  17      74.559  41.512  92.534  1.00  0.00           H
ATOM   2045  CA  GLN B  17      74.810  40.084  94.194  1.00  0.00           C
ATOM   2046  HA  GLN B  17      75.206  40.480  95.130  1.00  0.00           H
ATOM   2047  CB  GLN B  17      73.245  40.168  94.378  1.00  0.00           C
ATOM   2048  HB2 GLN B  17      72.737  39.917  93.447  1.00  0.00           H
ATOM   2049  HB3 GLN B  17      72.855  39.458  95.107  1.00  0.00           H
ATOM   2050  CG  GLN B  17      72.730  41.505  94.952  1.00  0.00           C
ATOM   2051  HG2 GLN B  17      72.595  42.274  94.191  1.00  0.00           H
ATOM   2052  HG3 GLN B  17      71.714  41.311  95.297  1.00  0.00           H
ATOM   2053  CD  GLN B  17      73.420  42.045  96.255  1.00  0.00           C
ATOM   2054  OE1 GLN B  17      74.186  41.389  96.924  1.00  0.00           O
ATOM   2055  NE2 GLN B  17      73.175  43.282  96.572  1.00  0.00           N
ATOM   2056 HE21 GLN B  17      73.657  43.688  97.361  1.00  0.00           H
ATOM   2057 HE22 GLN B  17      72.674  43.890  95.939  1.00  0.00           H
ATOM   2058  C   GLN B  17      75.349  38.637  94.046  1.00  0.00           C
ATOM   2059  O   GLN B  17      75.883  38.250  92.994  1.00  0.00           O
ATOM   2060  N   ARG B  18      75.078  37.796  95.109  1.00  0.00           N
ATOM   2061  H   ARG B  18      74.863  38.320  95.945  1.00  0.00           H
ATOM   2062  CA  ARG B  18      75.044  36.329  95.143  1.00  0.00           C
ATOM   2063  HA  ARG B  18      74.833  35.937  94.148  1.00  0.00           H
ATOM   2064  CB  ARG B  18      76.445  35.666  95.594  1.00  0.00           C
ATOM   2065  HB2 ARG B  18      76.736  36.003  96.589  1.00  0.00           H
ATOM   2066  HB3 ARG B  18      76.313  34.586  95.541  1.00  0.00           H
ATOM   2067  CG  ARG B  18      77.548  36.021  94.627  1.00  0.00           C
ATOM   2068  HG2 ARG B  18      77.116  35.820  93.647  1.00  0.00           H
ATOM   2069  HG3 ARG B  18      77.659  37.100  94.736  1.00  0.00           H
ATOM   2070  CD  ARG B  18      78.887  35.268  94.918  1.00  0.00           C
ATOM   2071  HD2 ARG B  18      79.312  35.552  95.881  1.00  0.00           H
ATOM   2072  HD3 ARG B  18      78.652  34.206  94.998  1.00  0.00           H
ATOM   2073  NE  ARG B  18      79.903  35.471  93.824  1.00  0.00           N
ATOM   2074  HE  ARG B  18      79.995  34.747  93.125  1.00  0.00           H
ATOM   2075  CZ  ARG B  18      80.670  36.534  93.787  1.00  0.00           C
ATOM   2076  NH1 ARG B  18      81.393  36.561  92.721  1.00  0.00           N
ATOM   2077 HH11 ARG B  18      81.357  35.739  92.135  1.00  0.00           H
ATOM   2078 HH12 ARG B  18      81.911  37.398  92.493  1.00  0.00           H
ATOM   2079  NH2 ARG B  18      80.850  37.480  94.703  1.00  0.00           N
ATOM   2080 HH21 ARG B  18      80.163  37.515  95.442  1.00  0.00           H
ATOM   2081 HH22 ARG B  18      81.436  38.295  94.592  1.00  0.00           H
ATOM   2082  C   ARG B  18      73.874  35.844  96.042  1.00  0.00           C
ATOM   2083  O   ARG B  18      74.086  35.349  97.137  1.00  0.00           O
ATOM   2084  N   MET B  19      72.674  36.124  95.506  1.00  0.00           N
ATOM   2085  H   MET B  19      72.676  36.655  94.647  1.00  0.00           H
ATOM   2086  CA  MET B  19      71.353  35.594  95.980  1.00  0.00           C
ATOM   2087  HA  MET B  19      71.435  35.549  97.066  1.00  0.00           H
ATOM   2088  CB  MET B  19      70.209  36.527  95.653  1.00  0.00           C
ATOM   2089  HB2 MET B  19      70.149  36.544  94.564  1.00  0.00           H
ATOM   2090  HB3 MET B  19      69.285  36.031  95.950  1.00  0.00           H
ATOM   2091  CG  MET B  19      70.365  37.921  96.195  1.00  0.00           C
ATOM   2092  HG2 MET B  19      71.405  38.170  95.985  1.00  0.00           H
ATOM   2093  HG3 MET B  19      69.702  38.606  95.667  1.00  0.00           H
ATOM   2094  SD  MET B  19      70.197  38.273  97.949  1.00  0.00           S
ATOM   2095  CE  MET B  19      68.463  37.804  98.185  1.00  0.00           C
ATOM   2096  HE1 MET B  19      67.902  38.232  97.354  1.00  0.00           H
ATOM   2097  HE2 MET B  19      68.209  36.744  98.221  1.00  0.00           H
ATOM   2098  HE3 MET B  19      68.125  38.057  99.190  1.00  0.00           H
ATOM   2099  C   MET B  19      71.071  34.180  95.450  1.00  0.00           C
ATOM   2100  O   MET B  19      71.671  33.800  94.422  1.00  0.00           O
ATOM   2101  N   LEU B  20      70.227  33.399  96.173  1.00  0.00           N
ATOM   2102  H   LEU B  20      69.929  33.735  97.078  1.00  0.00           H
ATOM   2103  CA  LEU B  20      69.872  32.012  95.850  1.00  0.00           C
ATOM   2104  HA  LEU B  20      70.606  31.609  95.152  1.00  0.00           H
ATOM   2105  CB  LEU B  20      69.885  31.227  97.191  1.00  0.00           C
ATOM   2106  HB2 LEU B  20      69.083  31.717  97.743  1.00  0.00           H
ATOM   2107  HB3 LEU B  20      69.553  30.212  96.974  1.00  0.00           H
ATOM   2108  CG  LEU B  20      71.202  31.136  97.971  1.00  0.00           C
ATOM   2109  HG  LEU B  20      71.630  32.121  98.157  1.00  0.00           H
ATOM   2110  CD1 LEU B  20      70.881  30.578  99.385  1.00  0.00           C
ATOM   2111 HD11 LEU B  20      70.281  29.677  99.252  1.00  0.00           H
ATOM   2112 HD12 LEU B  20      71.746  30.357 100.009  1.00  0.00           H
ATOM   2113 HD13 LEU B  20      70.319  31.342  99.922  1.00  0.00           H
ATOM   2114  CD2 LEU B  20      72.385  30.388  97.278  1.00  0.00           C
ATOM   2115 HD21 LEU B  20      72.089  29.364  97.051  1.00  0.00           H
ATOM   2116 HD22 LEU B  20      72.649  30.920  96.364  1.00  0.00           H
ATOM   2117 HD23 LEU B  20      73.309  30.352  97.855  1.00  0.00           H
ATOM   2118  C   LEU B  20      68.523  31.830  95.166  1.00  0.00           C
ATOM   2119  O   LEU B  20      67.630  32.595  95.359  1.00  0.00           O
ATOM   2120  N   LEU B  21      68.387  30.757  94.344  1.00  0.00           N
ATOM   2121  H   LEU B  21      69.177  30.138  94.234  1.00  0.00           H
ATOM   2122  CA  LEU B  21      67.238  30.534  93.470  1.00  0.00           C
ATOM   2123  HA  LEU B  21      67.084  31.421  92.857  1.00  0.00           H
ATOM   2124  CB  LEU B  21      67.568  29.361  92.473  1.00  0.00           C
ATOM   2125  HB2 LEU B  21      68.535  29.490  91.988  1.00  0.00           H
ATOM   2126  HB3 LEU B  21      67.654  28.469  93.094  1.00  0.00           H
ATOM   2127  CG  LEU B  21      66.620  29.126  91.348  1.00  0.00           C
ATOM   2128  HG  LEU B  21      65.583  29.043  91.672  1.00  0.00           H
ATOM   2129  CD1 LEU B  21      66.567  30.322  90.398  1.00  0.00           C
ATOM   2130 HD11 LEU B  21      67.528  30.805  90.222  1.00  0.00           H
ATOM   2131 HD12 LEU B  21      65.986  30.180  89.487  1.00  0.00           H
ATOM   2132 HD13 LEU B  21      65.872  31.015  90.871  1.00  0.00           H
ATOM   2133  CD2 LEU B  21      67.072  27.826  90.663  1.00  0.00           C
ATOM   2134 HD21 LEU B  21      66.428  27.624  89.808  1.00  0.00           H
ATOM   2135 HD22 LEU B  21      68.120  27.930  90.381  1.00  0.00           H
ATOM   2136 HD23 LEU B  21      67.073  27.029  91.407  1.00  0.00           H
ATOM   2137  C   LEU B  21      65.888  30.287  94.183  1.00  0.00           C
ATOM   2138  O   LEU B  21      65.814  29.571  95.127  1.00  0.00           O
ATOM   2139  N   GLU B  22      64.843  31.027  93.727  1.00  0.00           N
ATOM   2140  H   GLU B  22      64.879  31.525  92.849  1.00  0.00           H
ATOM   2141  CA  GLU B  22      63.613  31.176  94.516  1.00  0.00           C
ATOM   2142  HA  GLU B  22      63.547  30.221  95.038  1.00  0.00           H
ATOM   2143  CB  GLU B  22      63.720  32.384  95.536  1.00  0.00           C
ATOM   2144  HB2 GLU B  22      64.635  32.218  96.104  1.00  0.00           H
ATOM   2145  HB3 GLU B  22      63.891  33.305  94.979  1.00  0.00           H
ATOM   2146  CG  GLU B  22      62.625  32.450  96.620  1.00  0.00           C
ATOM   2147  HG2 GLU B  22      63.010  33.062  97.436  1.00  0.00           H
ATOM   2148  HG3 GLU B  22      61.783  32.928  96.120  1.00  0.00           H
ATOM   2149  CD  GLU B  22      62.125  31.103  97.104  1.00  0.00           C
ATOM   2150  OE1 GLU B  22      62.891  30.283  97.676  1.00  0.00           O
ATOM   2151  OE2 GLU B  22      60.885  30.876  96.979  1.00  0.00           O
ATOM   2152  C   GLU B  22      62.413  31.217  93.562  1.00  0.00           C
ATOM   2153  O   GLU B  22      62.661  31.303  92.365  1.00  0.00           O
ATOM   2154  N   LYS B  23      61.141  31.230  94.035  1.00  0.00           N
ATOM   2155  H   LYS B  23      61.070  31.294  95.040  1.00  0.00           H
ATOM   2156  CA  LYS B  23      59.954  31.350  93.226  1.00  0.00           C
ATOM   2157  HA  LYS B  23      60.082  30.835  92.274  1.00  0.00           H
ATOM   2158  CB  LYS B  23      58.745  30.761  93.949  1.00  0.00           C
ATOM   2159  HB2 LYS B  23      58.547  31.391  94.817  1.00  0.00           H
ATOM   2160  HB3 LYS B  23      57.817  30.766  93.379  1.00  0.00           H
ATOM   2161  CG  LYS B  23      59.011  29.269  94.351  1.00  0.00           C
ATOM   2162  HG2 LYS B  23      59.174  28.744  93.410  1.00  0.00           H
ATOM   2163  HG3 LYS B  23      59.961  29.146  94.872  1.00  0.00           H
ATOM   2164  CD  LYS B  23      57.831  28.620  95.115  1.00  0.00           C
ATOM   2165  HD2 LYS B  23      56.891  28.749  94.578  1.00  0.00           H
ATOM   2166  HD3 LYS B  23      58.047  27.561  94.978  1.00  0.00           H
ATOM   2167  CE  LYS B  23      57.781  28.973  96.582  1.00  0.00           C
ATOM   2168  HE2 LYS B  23      57.484  30.013  96.714  1.00  0.00           H
ATOM   2169  HE3 LYS B  23      57.125  28.197  96.976  1.00  0.00           H
ATOM   2170  NZ  LYS B  23      59.124  28.831  97.135  1.00  0.00           N
ATOM   2171  HZ1 LYS B  23      59.684  29.671  97.090  1.00  0.00           H
ATOM   2172  HZ2 LYS B  23      59.114  28.433  98.063  1.00  0.00           H
ATOM   2173  HZ3 LYS B  23      59.565  28.014  96.737  1.00  0.00           H
ATOM   2174  C   LYS B  23      59.800  32.819  92.786  1.00  0.00           C
ATOM   2175  O   LYS B  23      60.025  33.753  93.567  1.00  0.00           O
ATOM   2176  N   CYS B  24      59.283  33.045  91.522  1.00  0.00           N
ATOM   2177  H   CYS B  24      59.211  32.240  90.917  1.00  0.00           H
ATOM   2178  CA  CYS B  24      58.944  34.360  91.049  1.00  0.00           C
ATOM   2179  HA  CYS B  24      59.710  35.038  91.426  1.00  0.00           H
ATOM   2180  CB  CYS B  24      58.990  34.472  89.547  1.00  0.00           C
ATOM   2181  HB2 CYS B  24      59.864  33.961  89.145  1.00  0.00           H
ATOM   2182  HB3 CYS B  24      58.063  34.004  89.216  1.00  0.00           H
ATOM   2183  SG  CYS B  24      59.117  36.173  89.051  1.00  0.00           S
ATOM   2184  HG  CYS B  24      59.829  36.561  90.113  1.00  0.00           H
ATOM   2185  C   CYS B  24      57.552  34.755  91.603  1.00  0.00           C
ATOM   2186  O   CYS B  24      56.559  33.970  91.555  1.00  0.00           O
ATOM   2187  N   ASP B  25      57.544  36.047  91.992  1.00  0.00           N
ATOM   2188  H   ASP B  25      58.488  36.385  92.111  1.00  0.00           H
ATOM   2189  CA  ASP B  25      56.468  36.506  92.882  1.00  0.00           C
ATOM   2190  HA  ASP B  25      55.640  35.801  92.798  1.00  0.00           H
ATOM   2191  CB  ASP B  25      57.061  36.557  94.275  1.00  0.00           C
ATOM   2192  HB2 ASP B  25      57.449  35.550  94.426  1.00  0.00           H
ATOM   2193  HB3 ASP B  25      57.891  37.261  94.337  1.00  0.00           H
ATOM   2194  CG  ASP B  25      56.012  36.842  95.318  1.00  0.00           C
ATOM   2195  OD1 ASP B  25      56.439  37.244  96.443  1.00  0.00           O
ATOM   2196  OD2 ASP B  25      54.815  36.668  95.162  1.00  0.00           O
ATOM   2197  C   ASP B  25      55.913  37.879  92.473  1.00  0.00           C
ATOM   2198  O   ASP B  25      55.774  38.813  93.274  1.00  0.00           O
ATOM   2199  N   LEU B  26      55.538  38.015  91.191  1.00  0.00           N
ATOM   2200  H   LEU B  26      55.759  37.199  90.639  1.00  0.00           H
ATOM   2201  CA  LEU B  26      55.007  39.284  90.525  1.00  0.00           C
ATOM   2202  HA  LEU B  26      55.778  40.050  90.598  1.00  0.00           H
ATOM   2203  CB  LEU B  26      54.809  39.042  89.012  1.00  0.00           C
ATOM   2204  HB2 LEU B  26      54.018  38.302  88.887  1.00  0.00           H
ATOM   2205  HB3 LEU B  26      54.538  40.024  88.623  1.00  0.00           H
ATOM   2206  CG  LEU B  26      56.096  38.607  88.294  1.00  0.00           C
ATOM   2207  HG  LEU B  26      56.396  37.674  88.770  1.00  0.00           H
ATOM   2208  CD1 LEU B  26      55.896  38.333  86.799  1.00  0.00           C
ATOM   2209 HD11 LEU B  26      55.479  39.233  86.346  1.00  0.00           H
ATOM   2210 HD12 LEU B  26      56.809  37.987  86.314  1.00  0.00           H
ATOM   2211 HD13 LEU B  26      55.169  37.532  86.663  1.00  0.00           H
ATOM   2212  CD2 LEU B  26      57.256  39.532  88.448  1.00  0.00           C
ATOM   2213 HD21 LEU B  26      58.093  39.276  87.799  1.00  0.00           H
ATOM   2214 HD22 LEU B  26      56.879  40.550  88.352  1.00  0.00           H
ATOM   2215 HD23 LEU B  26      57.606  39.468  89.478  1.00  0.00           H
ATOM   2216  C   LEU B  26      53.684  39.917  91.068  1.00  0.00           C
ATOM   2217  O   LEU B  26      52.566  39.422  91.113  1.00  0.00           O
ATOM   2218  N   GLN B  27      53.759  41.207  91.448  1.00  0.00           N
ATOM   2219  H   GLN B  27      54.698  41.565  91.341  1.00  0.00           H
ATOM   2220  CA  GLN B  27      52.596  42.127  91.779  1.00  0.00           C
ATOM   2221  HA  GLN B  27      51.987  41.619  92.527  1.00  0.00           H
ATOM   2222  CB  GLN B  27      53.183  43.431  92.389  1.00  0.00           C
ATOM   2223  HB2 GLN B  27      53.790  43.990  91.677  1.00  0.00           H
ATOM   2224  HB3 GLN B  27      52.352  44.058  92.711  1.00  0.00           H
ATOM   2225  CG  GLN B  27      53.981  43.154  93.647  1.00  0.00           C
ATOM   2226  HG2 GLN B  27      53.930  44.097  94.192  1.00  0.00           H
ATOM   2227  HG3 GLN B  27      53.447  42.389  94.210  1.00  0.00           H
ATOM   2228  CD  GLN B  27      55.417  42.684  93.580  1.00  0.00           C
ATOM   2229  OE1 GLN B  27      55.960  42.440  92.494  1.00  0.00           O
ATOM   2230  NE2 GLN B  27      56.190  42.741  94.610  1.00  0.00           N
ATOM   2231 HE21 GLN B  27      57.053  42.228  94.504  1.00  0.00           H
ATOM   2232 HE22 GLN B  27      55.726  42.856  95.500  1.00  0.00           H
ATOM   2233  C   GLN B  27      51.666  42.464  90.620  1.00  0.00           C
ATOM   2234  O   GLN B  27      50.467  42.750  90.843  1.00  0.00           O
ATOM   2235  N   ASN B  28      52.152  42.665  89.386  1.00  0.00           N
ATOM   2236  H   ASN B  28      53.135  42.481  89.244  1.00  0.00           H
ATOM   2237  CA  ASN B  28      51.401  42.925  88.246  1.00  0.00           C
ATOM   2238  HA  ASN B  28      50.448  43.387  88.500  1.00  0.00           H
ATOM   2239  CB  ASN B  28      52.154  44.004  87.391  1.00  0.00           C
ATOM   2240  HB2 ASN B  28      53.154  43.668  87.118  1.00  0.00           H
ATOM   2241  HB3 ASN B  28      51.516  44.214  86.532  1.00  0.00           H
ATOM   2242  CG  ASN B  28      52.278  45.429  88.003  1.00  0.00           C
ATOM   2243  OD1 ASN B  28      51.424  45.825  88.795  1.00  0.00           O
ATOM   2244  ND2 ASN B  28      53.258  46.185  87.566  1.00  0.00           N
ATOM   2245 HD21 ASN B  28      53.441  47.044  88.065  1.00  0.00           H
ATOM   2246 HD22 ASN B  28      53.693  45.881  86.707  1.00  0.00           H
ATOM   2247  C   ASN B  28      51.088  41.666  87.438  1.00  0.00           C
ATOM   2248  O   ASN B  28      50.860  41.709  86.222  1.00  0.00           O
ATOM   2249  N   TYR B  29      51.097  40.513  88.053  1.00  0.00           N
ATOM   2250  H   TYR B  29      51.390  40.461  89.018  1.00  0.00           H
ATOM   2251  CA  TYR B  29      50.632  39.300  87.489  1.00  0.00           C
ATOM   2252  HA  TYR B  29      51.182  39.062  86.578  1.00  0.00           H
ATOM   2253  CB  TYR B  29      50.688  38.166  88.547  1.00  0.00           C
ATOM   2254  HB2 TYR B  29      51.716  38.165  88.909  1.00  0.00           H
ATOM   2255  HB3 TYR B  29      50.059  38.364  89.415  1.00  0.00           H
ATOM   2256  CG  TYR B  29      50.300  36.789  87.986  1.00  0.00           C
ATOM   2257  CD1 TYR B  29      48.957  36.394  87.816  1.00  0.00           C
ATOM   2258  HD1 TYR B  29      48.158  37.046  88.136  1.00  0.00           H
ATOM   2259  CE1 TYR B  29      48.695  35.248  87.107  1.00  0.00           C
ATOM   2260  HE1 TYR B  29      47.696  34.880  86.925  1.00  0.00           H
ATOM   2261  CZ  TYR B  29      49.723  34.461  86.547  1.00  0.00           C
ATOM   2262  OH  TYR B  29      49.549  33.242  85.961  1.00  0.00           O
ATOM   2263  HH  TYR B  29      48.612  33.029  85.961  1.00  0.00           H
ATOM   2264  CE2 TYR B  29      51.025  34.926  86.635  1.00  0.00           C
ATOM   2265  HE2 TYR B  29      51.779  34.289  86.197  1.00  0.00           H
ATOM   2266  CD2 TYR B  29      51.387  36.044  87.411  1.00  0.00           C
ATOM   2267  HD2 TYR B  29      52.424  36.335  87.330  1.00  0.00           H
ATOM   2268  C   TYR B  29      49.158  39.411  87.056  1.00  0.00           C
ATOM   2269  O   TYR B  29      48.390  40.064  87.781  1.00  0.00           O
ATOM   2270  N   GLY B  30      48.792  38.888  85.864  1.00  0.00           N
ATOM   2271  H   GLY B  30      49.476  38.447  85.267  1.00  0.00           H
ATOM   2272  CA  GLY B  30      47.513  39.119  85.287  1.00  0.00           C
ATOM   2273  HA2 GLY B  30      47.256  38.313  84.600  1.00  0.00           H
ATOM   2274  HA3 GLY B  30      46.694  38.925  85.979  1.00  0.00           H
ATOM   2275  C   GLY B  30      47.277  40.495  84.635  1.00  0.00           C
ATOM   2276  O   GLY B  30      46.279  40.547  83.860  1.00  0.00           O
ATOM   2277  N   ASP B  31      48.028  41.557  84.919  1.00  0.00           N
ATOM   2278  H   ASP B  31      48.763  41.543  85.611  1.00  0.00           H
ATOM   2279  CA  ASP B  31      47.798  42.909  84.428  1.00  0.00           C
ATOM   2280  HA  ASP B  31      46.715  43.015  84.490  1.00  0.00           H
ATOM   2281  CB  ASP B  31      48.551  43.920  85.303  1.00  0.00           C
ATOM   2282  HB2 ASP B  31      48.350  43.680  86.348  1.00  0.00           H
ATOM   2283  HB3 ASP B  31      49.597  43.701  85.089  1.00  0.00           H
ATOM   2284  CG  ASP B  31      48.216  45.387  85.085  1.00  0.00           C
ATOM   2285  OD1 ASP B  31      49.005  46.259  85.603  1.00  0.00           O
ATOM   2286  OD2 ASP B  31      47.106  45.746  84.536  1.00  0.00           O
ATOM   2287  C   ASP B  31      48.152  43.063  82.939  1.00  0.00           C
ATOM   2288  O   ASP B  31      48.983  42.256  82.420  1.00  0.00           O
ATOM   2289  N   SER B  32      47.636  44.099  82.237  1.00  0.00           N
ATOM   2290  H   SER B  32      46.850  44.673  82.510  1.00  0.00           H
ATOM   2291  CA  SER B  32      48.021  44.426  80.814  1.00  0.00           C
ATOM   2292  HA  SER B  32      49.036  44.063  80.651  1.00  0.00           H
ATOM   2293  CB  SER B  32      47.010  43.712  79.900  1.00  0.00           C
ATOM   2294  HB2 SER B  32      47.360  43.807  78.872  1.00  0.00           H
ATOM   2295  HB3 SER B  32      47.132  42.643  80.075  1.00  0.00           H
ATOM   2296  OG  SER B  32      45.655  44.040  80.177  1.00  0.00           O
ATOM   2297  HG  SER B  32      45.343  43.466  80.881  1.00  0.00           H
ATOM   2298  C   SER B  32      48.020  45.872  80.387  1.00  0.00           C
ATOM   2299  O   SER B  32      47.356  46.801  80.936  1.00  0.00           O
ATOM   2300  N   ALA B  33      48.910  46.101  79.346  1.00  0.00           N
ATOM   2301  H   ALA B  33      49.210  45.271  78.855  1.00  0.00           H
ATOM   2302  CA  ALA B  33      48.972  47.387  78.690  1.00  0.00           C
ATOM   2303  HA  ALA B  33      48.860  48.208  79.397  1.00  0.00           H
ATOM   2304  CB  ALA B  33      50.343  47.546  78.093  1.00  0.00           C
ATOM   2305  HB1 ALA B  33      51.087  47.258  78.835  1.00  0.00           H
ATOM   2306  HB2 ALA B  33      50.410  46.765  77.336  1.00  0.00           H
ATOM   2307  HB3 ALA B  33      50.609  48.564  77.805  1.00  0.00           H
ATOM   2308  C   ALA B  33      47.764  47.592  77.713  1.00  0.00           C
ATOM   2309  O   ALA B  33      47.159  46.667  77.197  1.00  0.00           O
ATOM   2310  N   THR B  34      47.466  48.832  77.443  1.00  0.00           N
ATOM   2311  H   THR B  34      48.016  49.537  77.913  1.00  0.00           H
ATOM   2312  CA  THR B  34      46.441  49.369  76.514  1.00  0.00           C
ATOM   2313  HA  THR B  34      45.620  48.658  76.428  1.00  0.00           H
ATOM   2314  CB  THR B  34      45.858  50.744  76.973  1.00  0.00           C
ATOM   2315  HB  THR B  34      46.574  51.565  77.021  1.00  0.00           H
ATOM   2316  CG2 THR B  34      44.727  51.113  75.997  1.00  0.00           C
ATOM   2317 HG21 THR B  34      43.871  50.475  76.218  1.00  0.00           H
ATOM   2318 HG22 THR B  34      44.512  52.181  76.022  1.00  0.00           H
ATOM   2319 HG23 THR B  34      44.880  51.031  74.921  1.00  0.00           H
ATOM   2320  OG1 THR B  34      45.308  50.609  78.273  1.00  0.00           O
ATOM   2321  HG1 THR B  34      46.046  50.161  78.694  1.00  0.00           H
ATOM   2322  C   THR B  34      46.953  49.491  75.103  1.00  0.00           C
ATOM   2323  O   THR B  34      47.643  50.436  74.739  1.00  0.00           O
ATOM   2324  N   LEU B  35      46.630  48.461  74.255  1.00  0.00           N
ATOM   2325  H   LEU B  35      45.939  47.831  74.636  1.00  0.00           H
ATOM   2326  CA  LEU B  35      47.168  48.177  72.876  1.00  0.00           C
ATOM   2327  HA  LEU B  35      48.088  48.740  72.720  1.00  0.00           H
ATOM   2328  CB  LEU B  35      47.627  46.726  72.870  1.00  0.00           C
ATOM   2329  HB2 LEU B  35      47.648  46.323  73.882  1.00  0.00           H
ATOM   2330  HB3 LEU B  35      46.862  46.080  72.440  1.00  0.00           H
ATOM   2331  CG  LEU B  35      48.935  46.360  72.125  1.00  0.00           C
ATOM   2332  HG  LEU B  35      48.954  46.967  71.220  1.00  0.00           H
ATOM   2333  CD1 LEU B  35      50.221  46.691  72.857  1.00  0.00           C
ATOM   2334 HD11 LEU B  35      50.529  45.937  73.580  1.00  0.00           H
ATOM   2335 HD12 LEU B  35      51.003  46.682  72.098  1.00  0.00           H
ATOM   2336 HD13 LEU B  35      50.248  47.736  73.168  1.00  0.00           H
ATOM   2337  CD2 LEU B  35      49.105  44.953  71.587  1.00  0.00           C
ATOM   2338 HD21 LEU B  35      50.008  44.962  70.977  1.00  0.00           H
ATOM   2339 HD22 LEU B  35      49.231  44.183  72.348  1.00  0.00           H
ATOM   2340 HD23 LEU B  35      48.258  44.695  70.950  1.00  0.00           H
ATOM   2341  C   LEU B  35      46.170  48.653  71.778  1.00  0.00           C
ATOM   2342  O   LEU B  35      44.959  48.433  71.920  1.00  0.00           O
ATOM   2343  N   PRO B  36      46.627  49.080  70.579  1.00  0.00           N
ATOM   2344  CD  PRO B  36      47.980  49.618  70.276  1.00  0.00           C
ATOM   2345  HD2 PRO B  36      48.683  48.833  69.995  1.00  0.00           H
ATOM   2346  HD3 PRO B  36      48.490  50.088  71.117  1.00  0.00           H
ATOM   2347  CG  PRO B  36      47.779  50.475  69.062  1.00  0.00           C
ATOM   2348  HG2 PRO B  36      48.668  50.441  68.432  1.00  0.00           H
ATOM   2349  HG3 PRO B  36      47.667  51.480  69.467  1.00  0.00           H
ATOM   2350  CB  PRO B  36      46.559  49.879  68.293  1.00  0.00           C
ATOM   2351  HB2 PRO B  36      46.946  49.047  67.706  1.00  0.00           H
ATOM   2352  HB3 PRO B  36      45.964  50.665  67.829  1.00  0.00           H
ATOM   2353  CA  PRO B  36      45.740  49.337  69.404  1.00  0.00           C
ATOM   2354  HA  PRO B  36      45.118  50.191  69.676  1.00  0.00           H
ATOM   2355  C   PRO B  36      44.921  48.123  68.925  1.00  0.00           C
ATOM   2356  O   PRO B  36      45.387  47.002  69.146  1.00  0.00           O
ATOM   2357  N   LYS B  37      43.731  48.288  68.362  1.00  0.00           N
ATOM   2358  H   LYS B  37      43.440  49.233  68.157  1.00  0.00           H
ATOM   2359  CA  LYS B  37      42.904  47.167  67.885  1.00  0.00           C
ATOM   2360  HA  LYS B  37      42.774  46.497  68.735  1.00  0.00           H
ATOM   2361  CB  LYS B  37      41.574  47.717  67.396  1.00  0.00           C
ATOM   2362  HB2 LYS B  37      41.016  48.193  68.203  1.00  0.00           H
ATOM   2363  HB3 LYS B  37      41.741  48.561  66.728  1.00  0.00           H
ATOM   2364  CG  LYS B  37      40.692  46.644  66.656  1.00  0.00           C
ATOM   2365  HG2 LYS B  37      41.182  46.404  65.713  1.00  0.00           H
ATOM   2366  HG3 LYS B  37      40.483  45.827  67.347  1.00  0.00           H
ATOM   2367  CD  LYS B  37      39.329  47.206  66.194  1.00  0.00           C
ATOM   2368  HD2 LYS B  37      38.722  47.459  67.063  1.00  0.00           H
ATOM   2369  HD3 LYS B  37      39.507  48.186  65.753  1.00  0.00           H
ATOM   2370  CE  LYS B  37      38.679  46.134  65.446  1.00  0.00           C
ATOM   2371  HE2 LYS B  37      39.343  45.683  64.709  1.00  0.00           H
ATOM   2372  HE3 LYS B  37      38.412  45.354  66.160  1.00  0.00           H
ATOM   2373  NZ  LYS B  37      37.456  46.641  64.846  1.00  0.00           N
ATOM   2374  HZ1 LYS B  37      36.825  47.074  65.506  1.00  0.00           H
ATOM   2375  HZ2 LYS B  37      37.840  47.364  64.254  1.00  0.00           H
ATOM   2376  HZ3 LYS B  37      36.816  45.966  64.452  1.00  0.00           H
ATOM   2377  C   LYS B  37      43.580  46.493  66.716  1.00  0.00           C
ATOM   2378  O   LYS B  37      44.166  47.126  65.835  1.00  0.00           O
ATOM   2379  N   GLY B  38      43.485  45.189  66.739  1.00  0.00           N
ATOM   2380  H   GLY B  38      42.818  44.813  67.397  1.00  0.00           H
ATOM   2381  CA  GLY B  38      43.901  44.347  65.618  1.00  0.00           C
ATOM   2382  HA2 GLY B  38      43.204  43.515  65.522  1.00  0.00           H
ATOM   2383  HA3 GLY B  38      43.795  44.926  64.701  1.00  0.00           H
ATOM   2384  C   GLY B  38      45.332  43.880  65.739  1.00  0.00           C
ATOM   2385  O   GLY B  38      45.607  42.910  65.056  1.00  0.00           O
ATOM   2386  N   ILE B  39      46.147  44.550  66.549  1.00  0.00           N
ATOM   2387  H   ILE B  39      45.851  45.413  66.982  1.00  0.00           H
ATOM   2388  CA  ILE B  39      47.510  44.142  66.873  1.00  0.00           C
ATOM   2389  HA  ILE B  39      48.041  43.980  65.935  1.00  0.00           H
ATOM   2390  CB  ILE B  39      48.394  45.243  67.613  1.00  0.00           C
ATOM   2391  HB  ILE B  39      47.935  45.478  68.573  1.00  0.00           H
ATOM   2392  CG2 ILE B  39      49.801  44.808  68.073  1.00  0.00           C
ATOM   2393 HG21 ILE B  39      50.308  44.439  67.181  1.00  0.00           H
ATOM   2394 HG22 ILE B  39      50.417  45.612  68.474  1.00  0.00           H
ATOM   2395 HG23 ILE B  39      49.836  43.957  68.753  1.00  0.00           H
ATOM   2396  CG1 ILE B  39      48.568  46.620  66.882  1.00  0.00           C
ATOM   2397 HG12 ILE B  39      47.542  46.988  66.853  1.00  0.00           H
ATOM   2398 HG13 ILE B  39      49.065  47.349  67.522  1.00  0.00           H
ATOM   2399  CD1 ILE B  39      49.218  46.618  65.534  1.00  0.00           C
ATOM   2400 HD11 ILE B  39      49.260  47.644  65.168  1.00  0.00           H
ATOM   2401 HD12 ILE B  39      50.238  46.234  65.541  1.00  0.00           H
ATOM   2402 HD13 ILE B  39      48.680  46.000  64.815  1.00  0.00           H
ATOM   2403  C   ILE B  39      47.596  42.753  67.546  1.00  0.00           C
ATOM   2404  O   ILE B  39      46.846  42.305  68.436  1.00  0.00           O
ATOM   2405  N   MET B  40      48.504  41.954  66.998  1.00  0.00           N
ATOM   2406  H   MET B  40      49.039  42.258  66.197  1.00  0.00           H
ATOM   2407  CA  MET B  40      49.003  40.679  67.531  1.00  0.00           C
ATOM   2408  HA  MET B  40      48.149  40.194  68.004  1.00  0.00           H
ATOM   2409  CB  MET B  40      49.248  39.790  66.302  1.00  0.00           C
ATOM   2410  HB2 MET B  40      48.410  39.760  65.605  1.00  0.00           H
ATOM   2411  HB3 MET B  40      50.152  40.127  65.794  1.00  0.00           H
ATOM   2412  CG  MET B  40      49.543  38.365  66.819  1.00  0.00           C
ATOM   2413  HG2 MET B  40      50.149  38.433  67.722  1.00  0.00           H
ATOM   2414  HG3 MET B  40      48.555  38.145  67.222  1.00  0.00           H
ATOM   2415  SD  MET B  40      50.283  37.187  65.751  1.00  0.00           S
ATOM   2416  CE  MET B  40      49.142  37.341  64.412  1.00  0.00           C
ATOM   2417  HE1 MET B  40      49.681  38.046  63.780  1.00  0.00           H
ATOM   2418  HE2 MET B  40      49.028  36.373  63.924  1.00  0.00           H
ATOM   2419  HE3 MET B  40      48.164  37.709  64.723  1.00  0.00           H
ATOM   2420  C   MET B  40      50.118  41.005  68.599  1.00  0.00           C
ATOM   2421  O   MET B  40      51.147  41.521  68.274  1.00  0.00           O
ATOM   2422  N   MET B  41      49.912  40.793  69.957  1.00  0.00           N
ATOM   2423  H   MET B  41      48.976  40.539  70.237  1.00  0.00           H
ATOM   2424  CA  MET B  41      50.817  41.343  71.047  1.00  0.00           C
ATOM   2425  HA  MET B  41      50.609  42.411  71.115  1.00  0.00           H
ATOM   2426  CB  MET B  41      50.369  40.892  72.443  1.00  0.00           C
ATOM   2427  HB2 MET B  41      49.431  41.440  72.526  1.00  0.00           H
ATOM   2428  HB3 MET B  41      50.134  39.836  72.580  1.00  0.00           H
ATOM   2429  CG  MET B  41      51.286  41.458  73.575  1.00  0.00           C
ATOM   2430  HG2 MET B  41      51.343  42.535  73.418  1.00  0.00           H
ATOM   2431  HG3 MET B  41      50.766  41.335  74.525  1.00  0.00           H
ATOM   2432  SD  MET B  41      52.959  40.748  73.885  1.00  0.00           S
ATOM   2433  CE  MET B  41      52.488  39.269  74.633  1.00  0.00           C
ATOM   2434  HE1 MET B  41      51.921  38.704  73.893  1.00  0.00           H
ATOM   2435  HE2 MET B  41      53.456  38.847  74.901  1.00  0.00           H
ATOM   2436  HE3 MET B  41      51.866  39.422  75.514  1.00  0.00           H
ATOM   2437  C   MET B  41      52.344  41.126  70.800  1.00  0.00           C
ATOM   2438  O   MET B  41      53.169  42.015  70.920  1.00  0.00           O
ATOM   2439  N   ASN B  42      52.787  39.941  70.276  1.00  0.00           N
ATOM   2440  H   ASN B  42      52.136  39.195  70.081  1.00  0.00           H
ATOM   2441  CA  ASN B  42      54.259  39.656  70.091  1.00  0.00           C
ATOM   2442  HA  ASN B  42      54.726  39.753  71.071  1.00  0.00           H
ATOM   2443  CB  ASN B  42      54.428  38.140  69.710  1.00  0.00           C
ATOM   2444  HB2 ASN B  42      53.783  37.490  70.301  1.00  0.00           H
ATOM   2445  HB3 ASN B  42      54.147  37.944  68.676  1.00  0.00           H
ATOM   2446  CG  ASN B  42      55.936  37.824  69.815  1.00  0.00           C
ATOM   2447  OD1 ASN B  42      56.567  37.984  70.831  1.00  0.00           O
ATOM   2448  ND2 ASN B  42      56.499  37.168  68.806  1.00  0.00           N
ATOM   2449 HD21 ASN B  42      57.465  36.879  68.862  1.00  0.00           H
ATOM   2450 HD22 ASN B  42      55.843  36.805  68.129  1.00  0.00           H
ATOM   2451  C   ASN B  42      54.903  40.656  69.090  1.00  0.00           C
ATOM   2452  O   ASN B  42      56.072  41.012  69.221  1.00  0.00           O
ATOM   2453  N   VAL B  43      54.129  41.111  68.068  1.00  0.00           N
ATOM   2454  H   VAL B  43      53.150  40.885  67.962  1.00  0.00           H
ATOM   2455  CA  VAL B  43      54.574  42.194  67.114  1.00  0.00           C
ATOM   2456  HA  VAL B  43      55.444  41.906  66.524  1.00  0.00           H
ATOM   2457  CB  VAL B  43      53.476  42.446  66.150  1.00  0.00           C
ATOM   2458  HB  VAL B  43      52.630  42.789  66.746  1.00  0.00           H
ATOM   2459  CG1 VAL B  43      53.924  43.445  65.019  1.00  0.00           C
ATOM   2460 HG11 VAL B  43      53.828  44.488  65.324  1.00  0.00           H
ATOM   2461 HG12 VAL B  43      54.971  43.340  64.738  1.00  0.00           H
ATOM   2462 HG13 VAL B  43      53.225  43.257  64.204  1.00  0.00           H
ATOM   2463  CG2 VAL B  43      52.960  41.228  65.360  1.00  0.00           C
ATOM   2464 HG21 VAL B  43      53.685  40.900  64.614  1.00  0.00           H
ATOM   2465 HG22 VAL B  43      52.638  40.417  66.014  1.00  0.00           H
ATOM   2466 HG23 VAL B  43      52.015  41.466  64.872  1.00  0.00           H
ATOM   2467  C   VAL B  43      54.865  43.529  67.920  1.00  0.00           C
ATOM   2468  O   VAL B  43      55.871  44.210  67.704  1.00  0.00           O
ATOM   2469  N   ALA B  44      54.156  43.805  68.973  1.00  0.00           N
ATOM   2470  H   ALA B  44      53.403  43.231  69.324  1.00  0.00           H
ATOM   2471  CA  ALA B  44      54.572  44.940  69.836  1.00  0.00           C
ATOM   2472  HA  ALA B  44      54.924  45.734  69.177  1.00  0.00           H
ATOM   2473  CB  ALA B  44      53.366  45.486  70.639  1.00  0.00           C
ATOM   2474  HB1 ALA B  44      53.655  46.103  71.490  1.00  0.00           H
ATOM   2475  HB2 ALA B  44      52.789  46.111  69.957  1.00  0.00           H
ATOM   2476  HB3 ALA B  44      52.657  44.719  70.952  1.00  0.00           H
ATOM   2477  C   ALA B  44      55.773  44.533  70.758  1.00  0.00           C
ATOM   2478  O   ALA B  44      56.627  45.380  71.113  1.00  0.00           O
ATOM   2479  N   LYS B  45      55.849  43.260  71.143  1.00  0.00           N
ATOM   2480  H   LYS B  45      55.085  42.658  70.869  1.00  0.00           H
ATOM   2481  CA  LYS B  45      56.897  42.700  72.023  1.00  0.00           C
ATOM   2482  HA  LYS B  45      56.857  43.358  72.891  1.00  0.00           H
ATOM   2483  CB  LYS B  45      56.622  41.263  72.515  1.00  0.00           C
ATOM   2484  HB2 LYS B  45      55.641  41.194  72.985  1.00  0.00           H
ATOM   2485  HB3 LYS B  45      56.656  40.609  71.645  1.00  0.00           H
ATOM   2486  CG  LYS B  45      57.667  40.951  73.634  1.00  0.00           C
ATOM   2487  HG2 LYS B  45      58.717  41.032  73.350  1.00  0.00           H
ATOM   2488  HG3 LYS B  45      57.441  41.458  74.572  1.00  0.00           H
ATOM   2489  CD  LYS B  45      57.536  39.386  73.801  1.00  0.00           C
ATOM   2490  HD2 LYS B  45      57.588  38.832  72.864  1.00  0.00           H
ATOM   2491  HD3 LYS B  45      58.343  39.134  74.489  1.00  0.00           H
ATOM   2492  CE  LYS B  45      56.336  38.933  74.581  1.00  0.00           C
ATOM   2493  HE2 LYS B  45      56.375  39.292  75.609  1.00  0.00           H
ATOM   2494  HE3 LYS B  45      55.368  39.121  74.116  1.00  0.00           H
ATOM   2495  NZ  LYS B  45      56.396  37.479  74.810  1.00  0.00           N
ATOM   2496  HZ1 LYS B  45      56.542  36.959  73.957  1.00  0.00           H
ATOM   2497  HZ2 LYS B  45      57.179  37.297  75.421  1.00  0.00           H
ATOM   2498  HZ3 LYS B  45      55.633  37.110  75.359  1.00  0.00           H
ATOM   2499  C   LYS B  45      58.319  42.785  71.382  1.00  0.00           C
ATOM   2500  O   LYS B  45      59.234  43.301  72.009  1.00  0.00           O
ATOM   2501  N   TYR B  46      58.448  42.490  70.110  1.00  0.00           N
ATOM   2502  H   TYR B  46      57.704  42.019  69.616  1.00  0.00           H
ATOM   2503  CA  TYR B  46      59.641  42.723  69.218  1.00  0.00           C
ATOM   2504  HA  TYR B  46      60.527  42.536  69.824  1.00  0.00           H
ATOM   2505  CB  TYR B  46      59.626  41.779  67.930  1.00  0.00           C
ATOM   2506  HB2 TYR B  46      58.598  41.752  67.568  1.00  0.00           H
ATOM   2507  HB3 TYR B  46      60.192  42.245  67.123  1.00  0.00           H
ATOM   2508  CG  TYR B  46      60.130  40.419  68.277  1.00  0.00           C
ATOM   2509  CD1 TYR B  46      59.307  39.446  68.925  1.00  0.00           C
ATOM   2510  HD1 TYR B  46      58.255  39.665  69.032  1.00  0.00           H
ATOM   2511  CE1 TYR B  46      59.852  38.283  69.447  1.00  0.00           C
ATOM   2512  HE1 TYR B  46      59.212  37.639  70.032  1.00  0.00           H
ATOM   2513  CZ  TYR B  46      61.199  37.963  69.185  1.00  0.00           C
ATOM   2514  OH  TYR B  46      61.806  36.856  69.730  1.00  0.00           O
ATOM   2515  HH  TYR B  46      61.214  36.461  70.375  1.00  0.00           H
ATOM   2516  CE2 TYR B  46      62.052  38.904  68.524  1.00  0.00           C
ATOM   2517  HE2 TYR B  46      63.121  38.797  68.412  1.00  0.00           H
ATOM   2518  CD2 TYR B  46      61.545  40.117  68.120  1.00  0.00           C
ATOM   2519  HD2 TYR B  46      62.225  40.900  67.818  1.00  0.00           H
ATOM   2520  C   TYR B  46      59.849  44.143  68.888  1.00  0.00           C
ATOM   2521  O   TYR B  46      60.989  44.574  68.620  1.00  0.00           O
ATOM   2522  N   THR B  47      58.788  44.912  68.800  1.00  0.00           N
ATOM   2523  H   THR B  47      57.893  44.443  68.828  1.00  0.00           H
ATOM   2524  CA  THR B  47      58.932  46.381  68.584  1.00  0.00           C
ATOM   2525  HA  THR B  47      59.635  46.558  67.771  1.00  0.00           H
ATOM   2526  CB  THR B  47      57.567  47.086  68.209  1.00  0.00           C
ATOM   2527  HB  THR B  47      56.807  46.794  68.934  1.00  0.00           H
ATOM   2528  CG2 THR B  47      57.615  48.676  68.209  1.00  0.00           C
ATOM   2529 HG21 THR B  47      57.844  49.039  69.210  1.00  0.00           H
ATOM   2530 HG22 THR B  47      58.352  49.085  67.518  1.00  0.00           H
ATOM   2531 HG23 THR B  47      56.652  49.110  67.938  1.00  0.00           H
ATOM   2532  OG1 THR B  47      57.100  46.617  66.974  1.00  0.00           O
ATOM   2533  HG1 THR B  47      56.735  45.732  67.045  1.00  0.00           H
ATOM   2534  C   THR B  47      59.573  47.143  69.734  1.00  0.00           C
ATOM   2535  O   THR B  47      60.670  47.766  69.589  1.00  0.00           O
ATOM   2536  N   GLN B  48      59.114  46.911  71.020  1.00  0.00           N
ATOM   2537  H   GLN B  48      58.232  46.471  71.239  1.00  0.00           H
ATOM   2538  CA  GLN B  48      59.817  47.427  72.169  1.00  0.00           C
ATOM   2539  HA  GLN B  48      59.886  48.502  71.998  1.00  0.00           H
ATOM   2540  CB  GLN B  48      58.976  47.115  73.401  1.00  0.00           C
ATOM   2541  HB2 GLN B  48      58.390  46.203  73.290  1.00  0.00           H
ATOM   2542  HB3 GLN B  48      59.602  47.056  74.292  1.00  0.00           H
ATOM   2543  CG  GLN B  48      58.147  48.245  73.735  1.00  0.00           C
ATOM   2544  HG2 GLN B  48      58.765  49.123  73.924  1.00  0.00           H
ATOM   2545  HG3 GLN B  48      57.584  48.397  72.814  1.00  0.00           H
ATOM   2546  CD  GLN B  48      57.155  48.118  74.904  1.00  0.00           C
ATOM   2547  OE1 GLN B  48      57.168  47.083  75.521  1.00  0.00           O
ATOM   2548  NE2 GLN B  48      56.399  49.150  75.105  1.00  0.00           N
ATOM   2549 HE21 GLN B  48      55.616  49.179  75.743  1.00  0.00           H
ATOM   2550 HE22 GLN B  48      56.402  49.954  74.493  1.00  0.00           H
ATOM   2551  C   GLN B  48      61.211  46.821  72.384  1.00  0.00           C
ATOM   2552  O   GLN B  48      62.177  47.446  72.860  1.00  0.00           O
ATOM   2553  N   LEU B  49      61.433  45.571  71.952  1.00  0.00           N
ATOM   2554  H   LEU B  49      60.624  45.009  71.725  1.00  0.00           H
ATOM   2555  CA  LEU B  49      62.764  44.957  71.898  1.00  0.00           C
ATOM   2556  HA  LEU B  49      63.075  44.911  72.942  1.00  0.00           H
ATOM   2557  CB  LEU B  49      62.780  43.455  71.530  1.00  0.00           C
ATOM   2558  HB2 LEU B  49      62.228  42.897  72.287  1.00  0.00           H
ATOM   2559  HB3 LEU B  49      62.413  43.343  70.509  1.00  0.00           H
ATOM   2560  CG  LEU B  49      64.167  42.822  71.427  1.00  0.00           C
ATOM   2561  HG  LEU B  49      64.800  43.463  70.814  1.00  0.00           H
ATOM   2562  CD1 LEU B  49      64.638  42.560  72.916  1.00  0.00           C
ATOM   2563 HD11 LEU B  49      65.034  43.477  73.351  1.00  0.00           H
ATOM   2564 HD12 LEU B  49      63.802  42.238  73.538  1.00  0.00           H
ATOM   2565 HD13 LEU B  49      65.480  41.869  72.955  1.00  0.00           H
ATOM   2566  CD2 LEU B  49      64.135  41.453  70.745  1.00  0.00           C
ATOM   2567 HD21 LEU B  49      65.094  41.010  71.016  1.00  0.00           H
ATOM   2568 HD22 LEU B  49      63.314  40.809  71.059  1.00  0.00           H
ATOM   2569 HD23 LEU B  49      64.078  41.608  69.668  1.00  0.00           H
ATOM   2570  C   LEU B  49      63.696  45.789  71.051  1.00  0.00           C
ATOM   2571  O   LEU B  49      64.752  46.188  71.531  1.00  0.00           O
ATOM   2572  N   CYS B  50      63.356  46.012  69.754  1.00  0.00           N
ATOM   2573  H   CYS B  50      62.548  45.541  69.374  1.00  0.00           H
ATOM   2574  CA  CYS B  50      64.086  46.813  68.824  1.00  0.00           C
ATOM   2575  HA  CYS B  50      65.121  46.496  68.701  1.00  0.00           H
ATOM   2576  CB  CYS B  50      63.399  46.859  67.447  1.00  0.00           C
ATOM   2577  HB2 CYS B  50      62.323  46.945  67.597  1.00  0.00           H
ATOM   2578  HB3 CYS B  50      63.892  47.584  66.799  1.00  0.00           H
ATOM   2579  SG  CYS B  50      63.585  45.212  66.649  1.00  0.00           S
ATOM   2580  HG  CYS B  50      63.366  44.478  67.744  1.00  0.00           H
ATOM   2581  C   CYS B  50      64.289  48.285  69.303  1.00  0.00           C
ATOM   2582  O   CYS B  50      65.285  48.849  69.032  1.00  0.00           O
ATOM   2583  N   GLN B  51      63.268  48.921  69.945  1.00  0.00           N
ATOM   2584  H   GLN B  51      62.319  48.577  69.913  1.00  0.00           H
ATOM   2585  CA  GLN B  51      63.491  50.286  70.523  1.00  0.00           C
ATOM   2586  HA  GLN B  51      63.900  50.904  69.723  1.00  0.00           H
ATOM   2587  CB  GLN B  51      62.168  50.927  71.001  1.00  0.00           C
ATOM   2588  HB2 GLN B  51      61.740  50.331  71.808  1.00  0.00           H
ATOM   2589  HB3 GLN B  51      62.406  51.892  71.447  1.00  0.00           H
ATOM   2590  CG  GLN B  51      61.255  51.269  69.867  1.00  0.00           C
ATOM   2591  HG2 GLN B  51      61.697  52.090  69.303  1.00  0.00           H
ATOM   2592  HG3 GLN B  51      61.124  50.376  69.257  1.00  0.00           H
ATOM   2593  CD  GLN B  51      59.861  51.560  70.278  1.00  0.00           C
ATOM   2594  OE1 GLN B  51      59.229  50.954  71.159  1.00  0.00           O
ATOM   2595  NE2 GLN B  51      59.286  52.537  69.664  1.00  0.00           N
ATOM   2596 HE21 GLN B  51      58.360  52.821  69.952  1.00  0.00           H
ATOM   2597 HE22 GLN B  51      59.690  52.954  68.837  1.00  0.00           H
ATOM   2598  C   GLN B  51      64.461  50.320  71.771  1.00  0.00           C
ATOM   2599  O   GLN B  51      65.306  51.235  71.884  1.00  0.00           O
ATOM   2600  N   TYR B  52      64.373  49.250  72.648  1.00  0.00           N
ATOM   2601  H   TYR B  52      63.586  48.617  72.624  1.00  0.00           H
ATOM   2602  CA  TYR B  52      65.378  49.089  73.721  1.00  0.00           C
ATOM   2603  HA  TYR B  52      65.403  49.950  74.389  1.00  0.00           H
ATOM   2604  CB  TYR B  52      64.964  47.856  74.530  1.00  0.00           C
ATOM   2605  HB2 TYR B  52      63.935  47.985  74.864  1.00  0.00           H
ATOM   2606  HB3 TYR B  52      65.082  47.004  73.861  1.00  0.00           H
ATOM   2607  CG  TYR B  52      65.995  47.626  75.636  1.00  0.00           C
ATOM   2608  CD1 TYR B  52      66.080  48.602  76.659  1.00  0.00           C
ATOM   2609  HD1 TYR B  52      65.336  49.359  76.858  1.00  0.00           H
ATOM   2610  CE1 TYR B  52      67.195  48.697  77.487  1.00  0.00           C
ATOM   2611  HE1 TYR B  52      67.290  49.363  78.332  1.00  0.00           H
ATOM   2612  CZ  TYR B  52      68.268  47.790  77.293  1.00  0.00           C
ATOM   2613  OH  TYR B  52      69.313  47.970  78.068  1.00  0.00           O
ATOM   2614  HH  TYR B  52      69.044  48.314  78.923  1.00  0.00           H
ATOM   2615  CE2 TYR B  52      68.266  46.859  76.280  1.00  0.00           C
ATOM   2616  HE2 TYR B  52      69.088  46.184  76.093  1.00  0.00           H
ATOM   2617  CD2 TYR B  52      67.093  46.772  75.403  1.00  0.00           C
ATOM   2618  HD2 TYR B  52      67.038  45.991  74.660  1.00  0.00           H
ATOM   2619  C   TYR B  52      66.770  48.863  73.156  1.00  0.00           C
ATOM   2620  O   TYR B  52      67.671  49.688  73.467  1.00  0.00           O
ATOM   2621  N   LEU B  53      66.888  47.948  72.255  1.00  0.00           N
ATOM   2622  H   LEU B  53      66.094  47.372  72.013  1.00  0.00           H
ATOM   2623  CA  LEU B  53      68.175  47.593  71.613  1.00  0.00           C
ATOM   2624  HA  LEU B  53      68.829  47.255  72.416  1.00  0.00           H
ATOM   2625  CB  LEU B  53      67.893  46.454  70.581  1.00  0.00           C
ATOM   2626  HB2 LEU B  53      67.042  46.745  69.964  1.00  0.00           H
ATOM   2627  HB3 LEU B  53      68.692  46.475  69.840  1.00  0.00           H
ATOM   2628  CG  LEU B  53      67.786  45.052  71.243  1.00  0.00           C
ATOM   2629  HG  LEU B  53      66.998  45.103  71.994  1.00  0.00           H
ATOM   2630  CD1 LEU B  53      67.319  44.071  70.137  1.00  0.00           C
ATOM   2631 HD11 LEU B  53      68.085  43.754  69.429  1.00  0.00           H
ATOM   2632 HD12 LEU B  53      66.989  43.192  70.691  1.00  0.00           H
ATOM   2633 HD13 LEU B  53      66.495  44.505  69.572  1.00  0.00           H
ATOM   2634  CD2 LEU B  53      69.023  44.502  71.924  1.00  0.00           C
ATOM   2635 HD21 LEU B  53      68.900  43.481  72.286  1.00  0.00           H
ATOM   2636 HD22 LEU B  53      69.767  44.503  71.127  1.00  0.00           H
ATOM   2637 HD23 LEU B  53      69.267  45.184  72.738  1.00  0.00           H
ATOM   2638  C   LEU B  53      68.813  48.779  70.813  1.00  0.00           C
ATOM   2639  O   LEU B  53      70.055  48.917  70.778  1.00  0.00           O
ATOM   2640  N   ASN B  54      68.015  49.722  70.270  1.00  0.00           N
ATOM   2641  H   ASN B  54      67.018  49.565  70.240  1.00  0.00           H
ATOM   2642  CA  ASN B  54      68.529  50.985  69.603  1.00  0.00           C
ATOM   2643  HA  ASN B  54      69.175  50.711  68.768  1.00  0.00           H
ATOM   2644  CB  ASN B  54      67.370  51.897  69.099  1.00  0.00           C
ATOM   2645  HB2 ASN B  54      66.496  51.657  69.704  1.00  0.00           H
ATOM   2646  HB3 ASN B  54      67.621  52.957  69.079  1.00  0.00           H
ATOM   2647  CG  ASN B  54      66.939  51.698  67.683  1.00  0.00           C
ATOM   2648  OD1 ASN B  54      67.646  51.177  66.834  1.00  0.00           O
ATOM   2649  ND2 ASN B  54      65.905  52.418  67.343  1.00  0.00           N
ATOM   2650 HD21 ASN B  54      65.667  52.513  66.366  1.00  0.00           H
ATOM   2651 HD22 ASN B  54      65.394  52.944  68.038  1.00  0.00           H
ATOM   2652  C   ASN B  54      69.354  51.909  70.620  1.00  0.00           C
ATOM   2653  O   ASN B  54      70.217  52.710  70.238  1.00  0.00           O
ATOM   2654  N   THR B  55      69.206  51.692  71.952  1.00  0.00           N
ATOM   2655  H   THR B  55      68.497  51.035  72.243  1.00  0.00           H
ATOM   2656  CA  THR B  55      69.961  52.443  72.931  1.00  0.00           C
ATOM   2657  HA  THR B  55      69.849  53.489  72.646  1.00  0.00           H
ATOM   2658  CB  THR B  55      69.248  52.534  74.259  1.00  0.00           C
ATOM   2659  HB  THR B  55      69.811  53.276  74.824  1.00  0.00           H
ATOM   2660  CG2 THR B  55      67.819  52.969  74.282  1.00  0.00           C
ATOM   2661 HG21 THR B  55      67.414  53.007  75.293  1.00  0.00           H
ATOM   2662 HG22 THR B  55      67.714  53.942  73.803  1.00  0.00           H
ATOM   2663 HG23 THR B  55      67.232  52.221  73.748  1.00  0.00           H
ATOM   2664  OG1 THR B  55      69.266  51.271  74.976  1.00  0.00           O
ATOM   2665  HG1 THR B  55      68.705  50.650  74.506  1.00  0.00           H
ATOM   2666  C   THR B  55      71.444  51.944  73.061  1.00  0.00           C
ATOM   2667  O   THR B  55      72.315  52.671  73.490  1.00  0.00           O
ATOM   2668  N   LEU B  56      71.797  50.681  72.611  1.00  0.00           N
ATOM   2669  H   LEU B  56      71.137  50.067  72.156  1.00  0.00           H
ATOM   2670  CA  LEU B  56      73.071  50.134  72.840  1.00  0.00           C
ATOM   2671  HA  LEU B  56      73.510  50.589  73.728  1.00  0.00           H
ATOM   2672  CB  LEU B  56      72.892  48.621  73.050  1.00  0.00           C
ATOM   2673  HB2 LEU B  56      72.795  48.168  72.063  1.00  0.00           H
ATOM   2674  HB3 LEU B  56      73.867  48.279  73.396  1.00  0.00           H
ATOM   2675  CG  LEU B  56      71.824  48.018  73.981  1.00  0.00           C
ATOM   2676  HG  LEU B  56      70.842  47.933  73.516  1.00  0.00           H
ATOM   2677  CD1 LEU B  56      72.164  46.546  74.132  1.00  0.00           C
ATOM   2678 HD11 LEU B  56      72.426  46.055  73.195  1.00  0.00           H
ATOM   2679 HD12 LEU B  56      73.028  46.425  74.786  1.00  0.00           H
ATOM   2680 HD13 LEU B  56      71.468  45.897  74.665  1.00  0.00           H
ATOM   2681  CD2 LEU B  56      71.804  48.721  75.344  1.00  0.00           C
ATOM   2682 HD21 LEU B  56      71.528  49.748  75.102  1.00  0.00           H
ATOM   2683 HD22 LEU B  56      71.128  48.188  76.013  1.00  0.00           H
ATOM   2684 HD23 LEU B  56      72.788  48.694  75.811  1.00  0.00           H
ATOM   2685  C   LEU B  56      74.208  50.385  71.767  1.00  0.00           C
ATOM   2686  O   LEU B  56      73.933  50.873  70.692  1.00  0.00           O
ATOM   2687  N   THR B  57      75.476  50.111  72.126  1.00  0.00           N
ATOM   2688  H   THR B  57      75.535  49.628  73.011  1.00  0.00           H
ATOM   2689  CA  THR B  57      76.708  50.208  71.329  1.00  0.00           C
ATOM   2690  HA  THR B  57      76.678  51.181  70.838  1.00  0.00           H
ATOM   2691  CB  THR B  57      77.918  50.252  72.265  1.00  0.00           C
ATOM   2692  HB  THR B  57      78.847  50.293  71.696  1.00  0.00           H
ATOM   2693  CG2 THR B  57      78.031  51.423  73.218  1.00  0.00           C
ATOM   2694 HG21 THR B  57      78.979  51.471  73.753  1.00  0.00           H
ATOM   2695 HG22 THR B  57      77.922  52.321  72.610  1.00  0.00           H
ATOM   2696 HG23 THR B  57      77.180  51.377  73.898  1.00  0.00           H
ATOM   2697  OG1 THR B  57      78.065  49.055  72.981  1.00  0.00           O
ATOM   2698  HG1 THR B  57      78.662  48.563  72.412  1.00  0.00           H
ATOM   2699  C   THR B  57      76.804  49.233  70.164  1.00  0.00           C
ATOM   2700  O   THR B  57      77.902  48.868  69.746  1.00  0.00           O
ATOM   2701  N   LEU B  58      75.682  48.629  69.668  1.00  0.00           N
ATOM   2702  H   LEU B  58      74.820  48.885  70.128  1.00  0.00           H
ATOM   2703  CA  LEU B  58      75.782  47.500  68.709  1.00  0.00           C
ATOM   2704  HA  LEU B  58      76.457  46.771  69.159  1.00  0.00           H
ATOM   2705  CB  LEU B  58      74.459  46.722  68.615  1.00  0.00           C
ATOM   2706  HB2 LEU B  58      74.789  45.801  68.134  1.00  0.00           H
ATOM   2707  HB3 LEU B  58      74.148  46.523  69.641  1.00  0.00           H
ATOM   2708  CG  LEU B  58      73.280  47.091  67.702  1.00  0.00           C
ATOM   2709  HG  LEU B  58      73.459  47.402  66.673  1.00  0.00           H
ATOM   2710  CD1 LEU B  58      72.238  45.965  67.695  1.00  0.00           C
ATOM   2711 HD11 LEU B  58      72.728  45.047  67.371  1.00  0.00           H
ATOM   2712 HD12 LEU B  58      71.692  45.816  68.627  1.00  0.00           H
ATOM   2713 HD13 LEU B  58      71.446  46.147  66.969  1.00  0.00           H
ATOM   2714  CD2 LEU B  58      72.649  48.298  68.453  1.00  0.00           C
ATOM   2715 HD21 LEU B  58      73.278  49.184  68.531  1.00  0.00           H
ATOM   2716 HD22 LEU B  58      71.745  48.607  67.928  1.00  0.00           H
ATOM   2717 HD23 LEU B  58      72.420  48.067  69.493  1.00  0.00           H
ATOM   2718  C   LEU B  58      76.238  47.982  67.343  1.00  0.00           C
ATOM   2719  O   LEU B  58      75.720  48.991  66.882  1.00  0.00           O
ATOM   2720  N   ALA B  59      77.002  47.195  66.596  1.00  0.00           N
ATOM   2721  H   ALA B  59      77.318  46.362  67.072  1.00  0.00           H
ATOM   2722  CA  ALA B  59      77.653  47.657  65.360  1.00  0.00           C
ATOM   2723  HA  ALA B  59      78.076  48.658  65.440  1.00  0.00           H
ATOM   2724  CB  ALA B  59      78.867  46.675  65.172  1.00  0.00           C
ATOM   2725  HB1 ALA B  59      78.461  45.704  64.888  1.00  0.00           H
ATOM   2726  HB2 ALA B  59      79.575  47.147  64.491  1.00  0.00           H
ATOM   2727  HB3 ALA B  59      79.489  46.592  66.063  1.00  0.00           H
ATOM   2728  C   ALA B  59      76.662  47.473  64.193  1.00  0.00           C
ATOM   2729  O   ALA B  59      75.883  46.493  64.269  1.00  0.00           O
ATOM   2730  N   VAL B  60      76.776  48.278  63.138  1.00  0.00           N
ATOM   2731  H   VAL B  60      77.592  48.868  63.068  1.00  0.00           H
ATOM   2732  CA  VAL B  60      75.807  48.255  61.999  1.00  0.00           C
ATOM   2733  HA  VAL B  60      75.261  47.313  61.940  1.00  0.00           H
ATOM   2734  CB  VAL B  60      74.779  49.386  62.283  1.00  0.00           C
ATOM   2735  HB  VAL B  60      75.368  50.303  62.266  1.00  0.00           H
ATOM   2736  CG1 VAL B  60      73.758  49.401  61.135  1.00  0.00           C
ATOM   2737 HG11 VAL B  60      73.163  50.300  61.291  1.00  0.00           H
ATOM   2738 HG12 VAL B  60      74.230  49.464  60.155  1.00  0.00           H
ATOM   2739 HG13 VAL B  60      73.178  48.479  61.181  1.00  0.00           H
ATOM   2740  CG2 VAL B  60      73.997  49.219  63.597  1.00  0.00           C
ATOM   2741 HG21 VAL B  60      73.225  49.987  63.557  1.00  0.00           H
ATOM   2742 HG22 VAL B  60      73.567  48.223  63.704  1.00  0.00           H
ATOM   2743 HG23 VAL B  60      74.557  49.517  64.484  1.00  0.00           H
ATOM   2744  C   VAL B  60      76.568  48.343  60.667  1.00  0.00           C
ATOM   2745  O   VAL B  60      76.644  49.459  60.087  1.00  0.00           O
ATOM   2746  N   PRO B  61      77.202  47.284  60.067  1.00  0.00           N
ATOM   2747  CD  PRO B  61      77.278  45.989  60.666  1.00  0.00           C
ATOM   2748  HD2 PRO B  61      76.330  45.677  61.103  1.00  0.00           H
ATOM   2749  HD3 PRO B  61      78.006  46.157  61.460  1.00  0.00           H
ATOM   2750  CG  PRO B  61      77.819  45.173  59.517  1.00  0.00           C
ATOM   2751  HG2 PRO B  61      77.003  44.804  58.895  1.00  0.00           H
ATOM   2752  HG3 PRO B  61      78.443  44.347  59.858  1.00  0.00           H
ATOM   2753  CB  PRO B  61      78.663  46.085  58.651  1.00  0.00           C
ATOM   2754  HB2 PRO B  61      78.779  45.761  57.617  1.00  0.00           H
ATOM   2755  HB3 PRO B  61      79.666  46.018  59.072  1.00  0.00           H
ATOM   2756  CA  PRO B  61      77.863  47.380  58.779  1.00  0.00           C
ATOM   2757  HA  PRO B  61      78.525  48.245  58.830  1.00  0.00           H
ATOM   2758  C   PRO B  61      76.910  47.659  57.596  1.00  0.00           C
ATOM   2759  O   PRO B  61      75.691  47.318  57.558  1.00  0.00           O
ATOM   2760  N   TYR B  62      77.429  48.183  56.499  1.00  0.00           N
ATOM   2761  H   TYR B  62      78.316  48.666  56.478  1.00  0.00           H
ATOM   2762  CA  TYR B  62      76.817  47.999  55.157  1.00  0.00           C
ATOM   2763  HA  TYR B  62      75.791  48.365  55.151  1.00  0.00           H
ATOM   2764  CB  TYR B  62      77.520  48.769  53.995  1.00  0.00           C
ATOM   2765  HB2 TYR B  62      77.834  49.748  54.356  1.00  0.00           H
ATOM   2766  HB3 TYR B  62      78.491  48.325  53.778  1.00  0.00           H
ATOM   2767  CG  TYR B  62      76.682  48.847  52.752  1.00  0.00           C
ATOM   2768  CD1 TYR B  62      77.030  48.224  51.606  1.00  0.00           C
ATOM   2769  HD1 TYR B  62      77.895  47.579  51.562  1.00  0.00           H
ATOM   2770  CE1 TYR B  62      76.357  48.402  50.393  1.00  0.00           C
ATOM   2771  HE1 TYR B  62      76.755  48.008  49.469  1.00  0.00           H
ATOM   2772  CZ  TYR B  62      75.339  49.374  50.347  1.00  0.00           C
ATOM   2773  OH  TYR B  62      74.753  49.723  49.219  1.00  0.00           O
ATOM   2774  HH  TYR B  62      75.435  49.704  48.543  1.00  0.00           H
ATOM   2775  CE2 TYR B  62      74.904  49.944  51.555  1.00  0.00           C
ATOM   2776  HE2 TYR B  62      74.003  50.537  51.493  1.00  0.00           H
ATOM   2777  CD2 TYR B  62      75.574  49.675  52.751  1.00  0.00           C
ATOM   2778  HD2 TYR B  62      75.218  50.185  53.634  1.00  0.00           H
ATOM   2779  C   TYR B  62      76.828  46.536  54.722  1.00  0.00           C
ATOM   2780  O   TYR B  62      77.785  45.843  55.104  1.00  0.00           O
ATOM   2781  N   ASN B  63      75.782  46.102  53.958  1.00  0.00           N
ATOM   2782  H   ASN B  63      75.216  46.818  53.526  1.00  0.00           H
ATOM   2783  CA  ASN B  63      75.394  44.630  53.838  1.00  0.00           C
ATOM   2784  HA  ASN B  63      74.352  44.555  53.527  1.00  0.00           H
ATOM   2785  CB  ASN B  63      76.323  43.966  52.827  1.00  0.00           C
ATOM   2786  HB2 ASN B  63      77.267  44.503  52.924  1.00  0.00           H
ATOM   2787  HB3 ASN B  63      76.668  42.932  52.857  1.00  0.00           H
ATOM   2788  CG  ASN B  63      75.998  44.360  51.406  1.00  0.00           C
ATOM   2789  OD1 ASN B  63      74.835  44.331  51.035  1.00  0.00           O
ATOM   2790  ND2 ASN B  63      77.009  44.771  50.653  1.00  0.00           N
ATOM   2791 HD21 ASN B  63      76.773  44.860  49.675  1.00  0.00           H
ATOM   2792 HD22 ASN B  63      77.978  44.615  50.893  1.00  0.00           H
ATOM   2793  C   ASN B  63      75.467  43.931  55.272  1.00  0.00           C
ATOM   2794  O   ASN B  63      76.104  42.882  55.531  1.00  0.00           O
ATOM   2795  N   MET B  64      74.833  44.570  56.241  1.00  0.00           N
ATOM   2796  H   MET B  64      74.285  45.405  56.095  1.00  0.00           H
ATOM   2797  CA  MET B  64      74.563  43.932  57.499  1.00  0.00           C
ATOM   2798  HA  MET B  64      75.514  43.821  58.019  1.00  0.00           H
ATOM   2799  CB  MET B  64      73.584  44.833  58.293  1.00  0.00           C
ATOM   2800  HB2 MET B  64      73.837  45.890  58.208  1.00  0.00           H
ATOM   2801  HB3 MET B  64      72.542  44.735  57.990  1.00  0.00           H
ATOM   2802  CG  MET B  64      73.500  44.420  59.772  1.00  0.00           C
ATOM   2803  HG2 MET B  64      73.123  43.402  59.865  1.00  0.00           H
ATOM   2804  HG3 MET B  64      74.466  44.478  60.273  1.00  0.00           H
ATOM   2805  SD  MET B  64      72.322  45.440  60.717  1.00  0.00           S
ATOM   2806  CE  MET B  64      72.548  44.628  62.304  1.00  0.00           C
ATOM   2807  HE1 MET B  64      72.310  43.565  62.327  1.00  0.00           H
ATOM   2808  HE2 MET B  64      73.583  44.724  62.630  1.00  0.00           H
ATOM   2809  HE3 MET B  64      71.914  45.213  62.971  1.00  0.00           H
ATOM   2810  C   MET B  64      73.901  42.524  57.268  1.00  0.00           C
ATOM   2811  O   MET B  64      73.179  42.274  56.305  1.00  0.00           O
ATOM   2812  N   ARG B  65      74.107  41.611  58.193  1.00  0.00           N
ATOM   2813  H   ARG B  65      74.681  41.948  58.953  1.00  0.00           H
ATOM   2814  CA  ARG B  65      73.342  40.357  58.229  1.00  0.00           C
ATOM   2815  HA  ARG B  65      72.416  40.424  57.659  1.00  0.00           H
ATOM   2816  CB  ARG B  65      74.046  39.231  57.622  1.00  0.00           C
ATOM   2817  HB2 ARG B  65      73.323  38.416  57.665  1.00  0.00           H
ATOM   2818  HB3 ARG B  65      74.264  39.463  56.579  1.00  0.00           H
ATOM   2819  CG  ARG B  65      75.356  38.787  58.316  1.00  0.00           C
ATOM   2820  HG2 ARG B  65      76.059  39.613  58.423  1.00  0.00           H
ATOM   2821  HG3 ARG B  65      75.068  38.428  59.304  1.00  0.00           H
ATOM   2822  CD  ARG B  65      76.020  37.594  57.579  1.00  0.00           C
ATOM   2823  HD2 ARG B  65      76.701  37.185  58.325  1.00  0.00           H
ATOM   2824  HD3 ARG B  65      75.335  36.784  57.330  1.00  0.00           H
ATOM   2825  NE  ARG B  65      76.646  38.067  56.290  1.00  0.00           N
ATOM   2826  HE  ARG B  65      76.229  38.792  55.723  1.00  0.00           H
ATOM   2827  CZ  ARG B  65      77.874  37.654  55.990  1.00  0.00           C
ATOM   2828  NH1 ARG B  65      78.572  36.775  56.622  1.00  0.00           N
ATOM   2829 HH11 ARG B  65      78.303  36.313  57.480  1.00  0.00           H
ATOM   2830 HH12 ARG B  65      79.508  36.610  56.282  1.00  0.00           H
ATOM   2831  NH2 ARG B  65      78.595  38.246  55.054  1.00  0.00           N
ATOM   2832 HH21 ARG B  65      78.129  39.007  54.582  1.00  0.00           H
ATOM   2833 HH22 ARG B  65      79.374  37.782  54.608  1.00  0.00           H
ATOM   2834  C   ARG B  65      72.952  39.956  59.714  1.00  0.00           C
ATOM   2835  O   ARG B  65      73.715  40.000  60.681  1.00  0.00           O
ATOM   2836  N   VAL B  66      71.737  39.451  59.856  1.00  0.00           N
ATOM   2837  H   VAL B  66      71.076  39.547  59.098  1.00  0.00           H
ATOM   2838  CA  VAL B  66      70.926  39.117  61.053  1.00  0.00           C
ATOM   2839  HA  VAL B  66      71.681  39.064  61.837  1.00  0.00           H
ATOM   2840  CB  VAL B  66      70.032  40.295  61.453  1.00  0.00           C
ATOM   2841  HB  VAL B  66      69.373  40.467  60.602  1.00  0.00           H
ATOM   2842  CG1 VAL B  66      69.046  39.906  62.633  1.00  0.00           C
ATOM   2843 HG11 VAL B  66      69.636  39.619  63.504  1.00  0.00           H
ATOM   2844 HG12 VAL B  66      68.396  40.723  62.947  1.00  0.00           H
ATOM   2845 HG13 VAL B  66      68.435  39.048  62.351  1.00  0.00           H
ATOM   2846  CG2 VAL B  66      70.778  41.570  61.519  1.00  0.00           C
ATOM   2847 HG21 VAL B  66      70.938  41.913  60.497  1.00  0.00           H
ATOM   2848 HG22 VAL B  66      70.286  42.286  62.177  1.00  0.00           H
ATOM   2849 HG23 VAL B  66      71.737  41.350  61.989  1.00  0.00           H
ATOM   2850  C   VAL B  66      70.297  37.778  60.850  1.00  0.00           C
ATOM   2851  O   VAL B  66      69.863  37.545  59.693  1.00  0.00           O
ATOM   2852  N   ILE B  67      70.304  36.993  61.915  1.00  0.00           N
ATOM   2853  H   ILE B  67      70.877  37.345  62.669  1.00  0.00           H
ATOM   2854  CA  ILE B  67      69.567  35.702  61.948  1.00  0.00           C
ATOM   2855  HA  ILE B  67      68.821  35.698  61.154  1.00  0.00           H
ATOM   2856  CB  ILE B  67      70.437  34.491  61.581  1.00  0.00           C
ATOM   2857  HB  ILE B  67      70.857  34.569  60.578  1.00  0.00           H
ATOM   2858  CG2 ILE B  67      71.600  34.485  62.607  1.00  0.00           C
ATOM   2859 HG21 ILE B  67      71.149  34.489  63.599  1.00  0.00           H
ATOM   2860 HG22 ILE B  67      72.210  33.582  62.627  1.00  0.00           H
ATOM   2861 HG23 ILE B  67      72.384  35.232  62.483  1.00  0.00           H
ATOM   2862  CG1 ILE B  67      69.737  33.142  61.539  1.00  0.00           C
ATOM   2863 HG12 ILE B  67      69.606  32.768  62.555  1.00  0.00           H
ATOM   2864 HG13 ILE B  67      68.801  33.252  60.993  1.00  0.00           H
ATOM   2865  CD1 ILE B  67      70.573  32.034  60.967  1.00  0.00           C
ATOM   2866 HD11 ILE B  67      71.508  31.874  61.504  1.00  0.00           H
ATOM   2867 HD12 ILE B  67      70.082  31.078  61.151  1.00  0.00           H
ATOM   2868 HD13 ILE B  67      70.832  32.231  59.927  1.00  0.00           H
ATOM   2869  C   ILE B  67      68.881  35.625  63.287  1.00  0.00           C
ATOM   2870  O   ILE B  67      69.441  36.053  64.343  1.00  0.00           O
ATOM   2871  N   HIE B  68      67.593  35.123  63.248  1.00  0.00           N
ATOM   2872  H   HIE B  68      67.231  34.817  62.357  1.00  0.00           H
ATOM   2873  CA  HIE B  68      66.631  34.868  64.374  1.00  0.00           C
ATOM   2874  HA  HIE B  68      67.080  34.998  65.359  1.00  0.00           H
ATOM   2875  CB  HIE B  68      65.515  35.939  64.224  1.00  0.00           C
ATOM   2876  HB2 HIE B  68      66.001  36.898  64.403  1.00  0.00           H
ATOM   2877  HB3 HIE B  68      65.091  35.931  63.221  1.00  0.00           H
ATOM   2878  CG  HIE B  68      64.392  35.942  65.243  1.00  0.00           C
ATOM   2879  ND1 HIE B  68      64.663  35.812  66.594  1.00  0.00           N
ATOM   2880  CE1 HIE B  68      63.441  35.819  67.127  1.00  0.00           C
ATOM   2881  HE1 HIE B  68      63.069  35.699  68.134  1.00  0.00           H
ATOM   2882  NE2 HIE B  68      62.530  35.984  66.159  1.00  0.00           N
ATOM   2883  HE2 HIE B  68      61.546  35.938  66.382  1.00  0.00           H
ATOM   2884  CD2 HIE B  68      63.086  36.132  64.958  1.00  0.00           C
ATOM   2885  HD2 HIE B  68      62.534  36.188  64.032  1.00  0.00           H
ATOM   2886  C   HIE B  68      66.228  33.418  64.493  1.00  0.00           C
ATOM   2887  O   HIE B  68      66.300  32.590  63.606  1.00  0.00           O
ATOM   2888  N   PHE B  69      65.787  33.034  65.665  1.00  0.00           N
ATOM   2889  H   PHE B  69      66.021  33.632  66.445  1.00  0.00           H
ATOM   2890  CA  PHE B  69      65.445  31.668  65.990  1.00  0.00           C
ATOM   2891  HA  PHE B  69      65.313  31.099  65.070  1.00  0.00           H
ATOM   2892  CB  PHE B  69      66.605  30.958  66.763  1.00  0.00           C
ATOM   2893  HB2 PHE B  69      66.940  31.651  67.536  1.00  0.00           H
ATOM   2894  HB3 PHE B  69      66.198  29.976  67.003  1.00  0.00           H
ATOM   2895  CG  PHE B  69      67.793  30.644  65.892  1.00  0.00           C
ATOM   2896  CD1 PHE B  69      67.881  29.341  65.392  1.00  0.00           C
ATOM   2897  HD1 PHE B  69      67.022  28.686  65.398  1.00  0.00           H
ATOM   2898  CE1 PHE B  69      69.003  29.024  64.582  1.00  0.00           C
ATOM   2899  HE1 PHE B  69      69.076  28.039  64.145  1.00  0.00           H
ATOM   2900  CZ  PHE B  69      69.923  30.010  64.290  1.00  0.00           C
ATOM   2901  HZ  PHE B  69      70.812  29.833  63.704  1.00  0.00           H
ATOM   2902  CE2 PHE B  69      69.818  31.294  64.781  1.00  0.00           C
ATOM   2903  HE2 PHE B  69      70.523  32.106  64.682  1.00  0.00           H
ATOM   2904  CD2 PHE B  69      68.798  31.606  65.747  1.00  0.00           C
ATOM   2905  HD2 PHE B  69      68.725  32.628  66.090  1.00  0.00           H
ATOM   2906  C   PHE B  69      64.111  31.563  66.722  1.00  0.00           C
ATOM   2907  O   PHE B  69      63.737  32.537  67.411  1.00  0.00           O
ATOM   2908  N   GLY B  70      63.397  30.427  66.599  1.00  0.00           N
ATOM   2909  H   GLY B  70      63.575  29.928  65.739  1.00  0.00           H
ATOM   2910  CA  GLY B  70      62.022  30.226  67.222  1.00  0.00           C
ATOM   2911  HA2 GLY B  70      61.790  29.165  67.126  1.00  0.00           H
ATOM   2912  HA3 GLY B  70      62.105  30.541  68.262  1.00  0.00           H
ATOM   2913  C   GLY B  70      60.873  31.056  66.690  1.00  0.00           C
ATOM   2914  O   GLY B  70      59.840  31.189  67.333  1.00  0.00           O
ATOM   2915  N   ALA B  71      61.117  31.720  65.549  1.00  0.00           N
ATOM   2916  H   ALA B  71      61.952  31.473  65.039  1.00  0.00           H
ATOM   2917  CA  ALA B  71      60.472  32.884  65.043  1.00  0.00           C
ATOM   2918  HA  ALA B  71      60.350  33.705  65.750  1.00  0.00           H
ATOM   2919  CB  ALA B  71      61.369  33.402  63.917  1.00  0.00           C
ATOM   2920  HB1 ALA B  71      60.968  34.184  63.271  1.00  0.00           H
ATOM   2921  HB2 ALA B  71      62.324  33.701  64.349  1.00  0.00           H
ATOM   2922  HB3 ALA B  71      61.501  32.580  63.213  1.00  0.00           H
ATOM   2923  C   ALA B  71      59.005  32.702  64.538  1.00  0.00           C
ATOM   2924  O   ALA B  71      58.436  33.609  63.948  1.00  0.00           O
ATOM   2925  N   GLY B  72      58.383  31.504  64.662  1.00  0.00           N
ATOM   2926  H   GLY B  72      58.784  30.811  65.277  1.00  0.00           H
ATOM   2927  CA  GLY B  72      57.163  31.164  64.048  1.00  0.00           C
ATOM   2928  HA2 GLY B  72      56.967  31.890  63.259  1.00  0.00           H
ATOM   2929  HA3 GLY B  72      57.356  30.169  63.647  1.00  0.00           H
ATOM   2930  C   GLY B  72      55.928  31.122  64.991  1.00  0.00           C
ATOM   2931  O   GLY B  72      56.081  31.255  66.189  1.00  0.00           O
ATOM   2932  N   SER B  73      54.750  30.912  64.482  1.00  0.00           N
ATOM   2933  H   SER B  73      54.652  30.583  63.532  1.00  0.00           H
ATOM   2934  CA  SER B  73      53.489  30.853  65.261  1.00  0.00           C
ATOM   2935  HA  SER B  73      53.768  30.668  66.298  1.00  0.00           H
ATOM   2936  CB  SER B  73      52.835  32.211  65.313  1.00  0.00           C
ATOM   2937  HB2 SER B  73      51.973  32.070  65.965  1.00  0.00           H
ATOM   2938  HB3 SER B  73      53.604  32.886  65.689  1.00  0.00           H
ATOM   2939  OG  SER B  73      52.419  32.494  63.961  1.00  0.00           O
ATOM   2940  HG  SER B  73      53.177  32.863  63.502  1.00  0.00           H
ATOM   2941  C   SER B  73      52.440  29.782  64.754  1.00  0.00           C
ATOM   2942  O   SER B  73      52.396  29.302  63.642  1.00  0.00           O
ATOM   2943  N   ASP B  74      51.565  29.369  65.663  1.00  0.00           N
ATOM   2944  H   ASP B  74      51.769  29.683  66.601  1.00  0.00           H
ATOM   2945  CA  ASP B  74      50.358  28.545  65.455  1.00  0.00           C
ATOM   2946  HA  ASP B  74      50.725  27.643  64.965  1.00  0.00           H
ATOM   2947  CB  ASP B  74      49.723  28.343  66.840  1.00  0.00           C
ATOM   2948  HB2 ASP B  74      48.899  27.640  66.714  1.00  0.00           H
ATOM   2949  HB3 ASP B  74      50.405  27.946  67.591  1.00  0.00           H
ATOM   2950  CG  ASP B  74      49.205  29.668  67.371  1.00  0.00           C
ATOM   2951  OD1 ASP B  74      48.242  29.610  68.117  1.00  0.00           O
ATOM   2952  OD2 ASP B  74      49.704  30.784  67.130  1.00  0.00           O
ATOM   2953  C   ASP B  74      49.319  29.186  64.451  1.00  0.00           C
ATOM   2954  O   ASP B  74      48.490  28.445  63.865  1.00  0.00           O
ATOM   2955  N   LYS B  75      49.492  30.417  64.059  1.00  0.00           N
ATOM   2956  H   LYS B  75      50.151  30.928  64.628  1.00  0.00           H
ATOM   2957  CA  LYS B  75      48.883  31.065  62.974  1.00  0.00           C
ATOM   2958  HA  LYS B  75      47.905  30.627  62.773  1.00  0.00           H
ATOM   2959  CB  LYS B  75      48.626  32.511  63.364  1.00  0.00           C
ATOM   2960  HB2 LYS B  75      49.520  32.994  63.756  1.00  0.00           H
ATOM   2961  HB3 LYS B  75      48.344  33.096  62.488  1.00  0.00           H
ATOM   2962  CG  LYS B  75      47.537  32.680  64.430  1.00  0.00           C
ATOM   2963  HG2 LYS B  75      46.589  32.329  64.023  1.00  0.00           H
ATOM   2964  HG3 LYS B  75      47.713  32.009  65.271  1.00  0.00           H
ATOM   2965  CD  LYS B  75      47.347  34.120  64.890  1.00  0.00           C
ATOM   2966  HD2 LYS B  75      48.145  34.402  65.578  1.00  0.00           H
ATOM   2967  HD3 LYS B  75      47.287  34.860  64.092  1.00  0.00           H
ATOM   2968  CE  LYS B  75      46.011  34.281  65.576  1.00  0.00           C
ATOM   2969  HE2 LYS B  75      45.910  35.345  65.791  1.00  0.00           H
ATOM   2970  HE3 LYS B  75      45.266  33.873  64.893  1.00  0.00           H
ATOM   2971  NZ  LYS B  75      45.914  33.533  66.831  1.00  0.00           N
ATOM   2972  HZ1 LYS B  75      45.047  33.697  67.323  1.00  0.00           H
ATOM   2973  HZ2 LYS B  75      45.849  32.553  66.595  1.00  0.00           H
ATOM   2974  HZ3 LYS B  75      46.707  33.707  67.433  1.00  0.00           H
ATOM   2975  C   LYS B  75      49.693  31.057  61.680  1.00  0.00           C
ATOM   2976  O   LYS B  75      49.254  31.546  60.648  1.00  0.00           O
ATOM   2977  N   GLY B  76      50.824  30.340  61.619  1.00  0.00           N
ATOM   2978  H   GLY B  76      51.031  29.932  62.520  1.00  0.00           H
ATOM   2979  CA  GLY B  76      51.652  30.086  60.499  1.00  0.00           C
ATOM   2980  HA2 GLY B  76      52.444  29.415  60.831  1.00  0.00           H
ATOM   2981  HA3 GLY B  76      51.032  29.715  59.683  1.00  0.00           H
ATOM   2982  C   GLY B  76      52.507  31.282  60.045  1.00  0.00           C
ATOM   2983  O   GLY B  76      53.103  31.218  58.984  1.00  0.00           O
ATOM   2984  N   VAL B  77      52.536  32.377  60.856  1.00  0.00           N
ATOM   2985  H   VAL B  77      52.131  32.231  61.769  1.00  0.00           H
ATOM   2986  CA  VAL B  77      53.139  33.694  60.529  1.00  0.00           C
ATOM   2987  HA  VAL B  77      53.513  33.807  59.511  1.00  0.00           H
ATOM   2988  CB  VAL B  77      51.966  34.790  60.659  1.00  0.00           C
ATOM   2989  HB  VAL B  77      52.381  35.787  60.508  1.00  0.00           H
ATOM   2990  CG1 VAL B  77      50.935  34.688  59.551  1.00  0.00           C
ATOM   2991 HG11 VAL B  77      50.320  35.584  59.631  1.00  0.00           H
ATOM   2992 HG12 VAL B  77      51.329  34.757  58.537  1.00  0.00           H
ATOM   2993 HG13 VAL B  77      50.320  33.791  59.625  1.00  0.00           H
ATOM   2994  CG2 VAL B  77      51.231  34.829  61.977  1.00  0.00           C
ATOM   2995 HG21 VAL B  77      50.918  33.813  62.217  1.00  0.00           H
ATOM   2996 HG22 VAL B  77      51.935  35.149  62.745  1.00  0.00           H
ATOM   2997 HG23 VAL B  77      50.383  35.514  61.984  1.00  0.00           H
ATOM   2998  C   VAL B  77      54.327  34.053  61.440  1.00  0.00           C
ATOM   2999  O   VAL B  77      54.596  33.355  62.404  1.00  0.00           O
ATOM   3000  N   ALA B  78      54.941  35.119  61.109  1.00  0.00           N
ATOM   3001  H   ALA B  78      54.649  35.609  60.275  1.00  0.00           H
ATOM   3002  CA  ALA B  78      56.251  35.531  61.711  1.00  0.00           C
ATOM   3003  HA  ALA B  78      56.538  34.822  62.488  1.00  0.00           H
ATOM   3004  CB  ALA B  78      57.353  35.442  60.666  1.00  0.00           C
ATOM   3005  HB1 ALA B  78      57.244  34.577  60.012  1.00  0.00           H
ATOM   3006  HB2 ALA B  78      57.442  36.310  60.013  1.00  0.00           H
ATOM   3007  HB3 ALA B  78      58.247  35.333  61.281  1.00  0.00           H
ATOM   3008  C   ALA B  78      56.135  36.929  62.367  1.00  0.00           C
ATOM   3009  O   ALA B  78      56.423  37.920  61.776  1.00  0.00           O
ATOM   3010  N   PRO B  79      55.542  37.045  63.603  1.00  0.00           N
ATOM   3011  CD  PRO B  79      55.008  35.978  64.438  1.00  0.00           C
ATOM   3012  HD2 PRO B  79      55.809  35.256  64.598  1.00  0.00           H
ATOM   3013  HD3 PRO B  79      54.172  35.451  63.978  1.00  0.00           H
ATOM   3014  CG  PRO B  79      54.559  36.561  65.746  1.00  0.00           C
ATOM   3015  HG2 PRO B  79      55.353  36.297  66.445  1.00  0.00           H
ATOM   3016  HG3 PRO B  79      53.601  36.152  66.067  1.00  0.00           H
ATOM   3017  CB  PRO B  79      54.358  38.025  65.364  1.00  0.00           C
ATOM   3018  HB2 PRO B  79      54.471  38.743  66.177  1.00  0.00           H
ATOM   3019  HB3 PRO B  79      53.314  38.139  65.071  1.00  0.00           H
ATOM   3020  CA  PRO B  79      55.179  38.328  64.133  1.00  0.00           C
ATOM   3021  HA  PRO B  79      54.581  38.771  63.337  1.00  0.00           H
ATOM   3022  C   PRO B  79      56.457  39.267  64.406  1.00  0.00           C
ATOM   3023  O   PRO B  79      56.405  40.451  64.195  1.00  0.00           O
ATOM   3024  N   GLY B  80      57.605  38.666  64.825  1.00  0.00           N
ATOM   3025  H   GLY B  80      57.692  37.660  64.856  1.00  0.00           H
ATOM   3026  CA  GLY B  80      58.855  39.452  65.080  1.00  0.00           C
ATOM   3027  HA2 GLY B  80      58.636  40.352  65.654  1.00  0.00           H
ATOM   3028  HA3 GLY B  80      59.518  38.812  65.662  1.00  0.00           H
ATOM   3029  C   GLY B  80      59.590  39.755  63.786  1.00  0.00           C
ATOM   3030  O   GLY B  80      60.232  40.791  63.689  1.00  0.00           O
ATOM   3031  N   THR B  81      59.526  38.845  62.814  1.00  0.00           N
ATOM   3032  H   THR B  81      59.131  37.957  63.087  1.00  0.00           H
ATOM   3033  CA  THR B  81      60.383  38.931  61.670  1.00  0.00           C
ATOM   3034  HA  THR B  81      61.417  39.060  61.989  1.00  0.00           H
ATOM   3035  CB  THR B  81      60.353  37.629  60.832  1.00  0.00           C
ATOM   3036  HB  THR B  81      59.472  37.525  60.199  1.00  0.00           H
ATOM   3037  CG2 THR B  81      61.495  37.668  59.731  1.00  0.00           C
ATOM   3038 HG21 THR B  81      61.696  36.629  59.472  1.00  0.00           H
ATOM   3039 HG22 THR B  81      61.161  38.296  58.905  1.00  0.00           H
ATOM   3040 HG23 THR B  81      62.403  38.134  60.113  1.00  0.00           H
ATOM   3041  OG1 THR B  81      60.615  36.610  61.752  1.00  0.00           O
ATOM   3042  HG1 THR B  81      60.748  35.774  61.299  1.00  0.00           H
ATOM   3043  C   THR B  81      59.922  40.146  60.719  1.00  0.00           C
ATOM   3044  O   THR B  81      60.706  40.822  60.072  1.00  0.00           O
ATOM   3045  N   ALA B  82      58.641  40.544  60.876  1.00  0.00           N
ATOM   3046  H   ALA B  82      58.043  39.896  61.368  1.00  0.00           H
ATOM   3047  CA  ALA B  82      57.950  41.686  60.317  1.00  0.00           C
ATOM   3048  HA  ALA B  82      58.133  41.617  59.244  1.00  0.00           H
ATOM   3049  CB  ALA B  82      56.523  41.545  60.814  1.00  0.00           C
ATOM   3050  HB1 ALA B  82      56.501  41.738  61.887  1.00  0.00           H
ATOM   3051  HB2 ALA B  82      55.857  42.298  60.390  1.00  0.00           H
ATOM   3052  HB3 ALA B  82      56.110  40.589  60.492  1.00  0.00           H
ATOM   3053  C   ALA B  82      58.504  43.011  60.846  1.00  0.00           C
ATOM   3054  O   ALA B  82      58.633  44.004  60.141  1.00  0.00           O
ATOM   3055  N   VAL B  83      58.967  42.938  62.091  1.00  0.00           N
ATOM   3056  H   VAL B  83      58.956  42.036  62.546  1.00  0.00           H
ATOM   3057  CA  VAL B  83      59.446  44.100  62.864  1.00  0.00           C
ATOM   3058  HA  VAL B  83      58.983  45.003  62.466  1.00  0.00           H
ATOM   3059  CB  VAL B  83      59.072  43.921  64.411  1.00  0.00           C
ATOM   3060  HB  VAL B  83      59.490  43.002  64.822  1.00  0.00           H
ATOM   3061  CG1 VAL B  83      59.607  45.064  65.279  1.00  0.00           C
ATOM   3062 HG11 VAL B  83      59.098  45.210  66.232  1.00  0.00           H
ATOM   3063 HG12 VAL B  83      60.675  44.852  65.335  1.00  0.00           H
ATOM   3064 HG13 VAL B  83      59.541  46.033  64.783  1.00  0.00           H
ATOM   3065  CG2 VAL B  83      57.603  43.910  64.516  1.00  0.00           C
ATOM   3066 HG21 VAL B  83      57.267  44.942  64.410  1.00  0.00           H
ATOM   3067 HG22 VAL B  83      57.152  43.273  63.755  1.00  0.00           H
ATOM   3068 HG23 VAL B  83      57.362  43.556  65.518  1.00  0.00           H
ATOM   3069  C   VAL B  83      61.014  44.221  62.721  1.00  0.00           C
ATOM   3070  O   VAL B  83      61.545  45.324  62.745  1.00  0.00           O
ATOM   3071  N   LEU B  84      61.757  43.140  62.440  1.00  0.00           N
ATOM   3072  H   LEU B  84      61.312  42.234  62.477  1.00  0.00           H
ATOM   3073  CA  LEU B  84      63.235  43.193  62.128  1.00  0.00           C
ATOM   3074  HA  LEU B  84      63.624  43.926  62.835  1.00  0.00           H
ATOM   3075  CB  LEU B  84      63.874  41.748  62.354  1.00  0.00           C
ATOM   3076  HB2 LEU B  84      63.260  41.058  61.776  1.00  0.00           H
ATOM   3077  HB3 LEU B  84      64.923  41.802  62.062  1.00  0.00           H
ATOM   3078  CG  LEU B  84      63.874  41.264  63.790  1.00  0.00           C
ATOM   3079  HG  LEU B  84      62.902  41.333  64.278  1.00  0.00           H
ATOM   3080  CD1 LEU B  84      64.264  39.763  63.836  1.00  0.00           C
ATOM   3081 HD11 LEU B  84      64.034  39.390  64.834  1.00  0.00           H
ATOM   3082 HD12 LEU B  84      63.646  39.225  63.118  1.00  0.00           H
ATOM   3083 HD13 LEU B  84      65.301  39.621  63.530  1.00  0.00           H
ATOM   3084  CD2 LEU B  84      64.859  42.004  64.709  1.00  0.00           C
ATOM   3085 HD21 LEU B  84      65.855  42.002  64.267  1.00  0.00           H
ATOM   3086 HD22 LEU B  84      64.679  43.064  64.889  1.00  0.00           H
ATOM   3087 HD23 LEU B  84      64.935  41.512  65.679  1.00  0.00           H
ATOM   3088  C   LEU B  84      63.525  43.646  60.725  1.00  0.00           C
ATOM   3089  O   LEU B  84      64.407  44.510  60.457  1.00  0.00           O
ATOM   3090  N   ARG B  85      62.676  43.228  59.746  1.00  0.00           N
ATOM   3091  H   ARG B  85      61.935  42.609  60.041  1.00  0.00           H
ATOM   3092  CA  ARG B  85      62.606  43.718  58.325  1.00  0.00           C
ATOM   3093  HA  ARG B  85      63.622  43.718  57.930  1.00  0.00           H
ATOM   3094  CB  ARG B  85      61.736  42.688  57.456  1.00  0.00           C
ATOM   3095  HB2 ARG B  85      62.050  41.645  57.496  1.00  0.00           H
ATOM   3096  HB3 ARG B  85      60.724  42.561  57.839  1.00  0.00           H
ATOM   3097  CG  ARG B  85      61.637  43.119  55.988  1.00  0.00           C
ATOM   3098  HG2 ARG B  85      60.586  43.300  55.764  1.00  0.00           H
ATOM   3099  HG3 ARG B  85      62.146  44.033  55.681  1.00  0.00           H
ATOM   3100  CD  ARG B  85      62.062  41.939  55.152  1.00  0.00           C
ATOM   3101  HD2 ARG B  85      61.635  41.033  55.582  1.00  0.00           H
ATOM   3102  HD3 ARG B  85      61.677  42.203  54.167  1.00  0.00           H
ATOM   3103  NE  ARG B  85      63.559  41.822  55.034  1.00  0.00           N
ATOM   3104  HE  ARG B  85      64.136  42.505  55.503  1.00  0.00           H
ATOM   3105  CZ  ARG B  85      64.277  40.951  54.299  1.00  0.00           C
ATOM   3106  NH1 ARG B  85      63.720  39.974  53.607  1.00  0.00           N
ATOM   3107 HH11 ARG B  85      62.736  39.746  53.593  1.00  0.00           H
ATOM   3108 HH12 ARG B  85      64.328  39.398  53.043  1.00  0.00           H
ATOM   3109  NH2 ARG B  85      65.617  40.998  54.266  1.00  0.00           N
ATOM   3110 HH21 ARG B  85      66.074  41.744  54.772  1.00  0.00           H
ATOM   3111 HH22 ARG B  85      66.154  40.324  53.739  1.00  0.00           H
ATOM   3112  C   ARG B  85      62.130  45.174  58.354  1.00  0.00           C
ATOM   3113  O   ARG B  85      62.425  45.977  57.422  1.00  0.00           O
ATOM   3114  N   GLN B  86      61.431  45.661  59.414  1.00  0.00           N
ATOM   3115  H   GLN B  86      61.274  44.984  60.146  1.00  0.00           H
ATOM   3116  CA  GLN B  86      61.152  47.095  59.601  1.00  0.00           C
ATOM   3117  HA  GLN B  86      60.952  47.530  58.621  1.00  0.00           H
ATOM   3118  CB  GLN B  86      59.778  47.210  60.348  1.00  0.00           C
ATOM   3119  HB2 GLN B  86      58.983  46.775  59.741  1.00  0.00           H
ATOM   3120  HB3 GLN B  86      59.893  46.586  61.234  1.00  0.00           H
ATOM   3121  CG  GLN B  86      59.313  48.603  60.811  1.00  0.00           C
ATOM   3122  HG2 GLN B  86      60.045  49.229  61.322  1.00  0.00           H
ATOM   3123  HG3 GLN B  86      59.006  49.204  59.955  1.00  0.00           H
ATOM   3124  CD  GLN B  86      58.195  48.599  61.787  1.00  0.00           C
ATOM   3125  OE1 GLN B  86      57.931  47.682  62.540  1.00  0.00           O
ATOM   3126  NE2 GLN B  86      57.512  49.702  61.975  1.00  0.00           N
ATOM   3127 HE21 GLN B  86      56.684  49.673  62.552  1.00  0.00           H
ATOM   3128 HE22 GLN B  86      57.732  50.582  61.530  1.00  0.00           H
ATOM   3129  C   GLN B  86      62.321  47.832  60.260  1.00  0.00           C
ATOM   3130  O   GLN B  86      62.721  48.913  59.824  1.00  0.00           O
ATOM   3131  N   TRP B  87      62.918  47.351  61.403  1.00  0.00           N
ATOM   3132  H   TRP B  87      62.478  46.512  61.753  1.00  0.00           H
ATOM   3133  CA  TRP B  87      64.099  47.869  62.164  1.00  0.00           C
ATOM   3134  HA  TRP B  87      63.858  48.902  62.417  1.00  0.00           H
ATOM   3135  CB  TRP B  87      64.383  46.996  63.354  1.00  0.00           C
ATOM   3136  HB2 TRP B  87      63.480  46.817  63.937  1.00  0.00           H
ATOM   3137  HB3 TRP B  87      64.810  46.028  63.093  1.00  0.00           H
ATOM   3138  CG  TRP B  87      65.348  47.537  64.284  1.00  0.00           C
ATOM   3139  CD1 TRP B  87      65.406  48.835  64.655  1.00  0.00           C
ATOM   3140  HD1 TRP B  87      64.660  49.501  64.246  1.00  0.00           H
ATOM   3141  NE1 TRP B  87      66.289  48.963  65.687  1.00  0.00           N
ATOM   3142  HE1 TRP B  87      66.418  49.839  66.174  1.00  0.00           H
ATOM   3143  CE2 TRP B  87      66.924  47.742  66.047  1.00  0.00           C
ATOM   3144  CZ2 TRP B  87      67.861  47.387  67.002  1.00  0.00           C
ATOM   3145  HZ2 TRP B  87      68.314  48.134  67.637  1.00  0.00           H
ATOM   3146  CH2 TRP B  87      68.188  46.010  67.050  1.00  0.00           C
ATOM   3147  HH2 TRP B  87      68.931  45.628  67.733  1.00  0.00           H
ATOM   3148  CZ3 TRP B  87      67.611  45.100  66.128  1.00  0.00           C
ATOM   3149  HZ3 TRP B  87      67.849  44.048  66.163  1.00  0.00           H
ATOM   3150  CE3 TRP B  87      66.706  45.479  65.150  1.00  0.00           C
ATOM   3151  HE3 TRP B  87      66.112  44.763  64.601  1.00  0.00           H
ATOM   3152  CD2 TRP B  87      66.290  46.838  65.174  1.00  0.00           C
ATOM   3153  C   TRP B  87      65.488  48.191  61.436  1.00  0.00           C
ATOM   3154  O   TRP B  87      65.867  49.353  61.338  1.00  0.00           O
ATOM   3155  N   LEU B  88      66.021  47.152  60.802  1.00  0.00           N
ATOM   3156  H   LEU B  88      65.453  46.321  60.881  1.00  0.00           H
ATOM   3157  CA  LEU B  88      67.403  47.205  60.237  1.00  0.00           C
ATOM   3158  HA  LEU B  88      68.143  47.551  60.959  1.00  0.00           H
ATOM   3159  CB  LEU B  88      67.692  45.742  59.780  1.00  0.00           C
ATOM   3160  HB2 LEU B  88      66.995  45.492  58.980  1.00  0.00           H
ATOM   3161  HB3 LEU B  88      68.647  45.615  59.269  1.00  0.00           H
ATOM   3162  CG  LEU B  88      67.515  44.604  60.868  1.00  0.00           C
ATOM   3163  HG  LEU B  88      66.620  44.827  61.449  1.00  0.00           H
ATOM   3164  CD1 LEU B  88      67.409  43.260  60.234  1.00  0.00           C
ATOM   3165 HD11 LEU B  88      68.433  42.917  60.089  1.00  0.00           H
ATOM   3166 HD12 LEU B  88      66.950  42.659  61.019  1.00  0.00           H
ATOM   3167 HD13 LEU B  88      66.793  43.241  59.335  1.00  0.00           H
ATOM   3168  CD2 LEU B  88      68.692  44.733  61.860  1.00  0.00           C
ATOM   3169 HD21 LEU B  88      69.619  45.039  61.377  1.00  0.00           H
ATOM   3170 HD22 LEU B  88      68.333  45.464  62.584  1.00  0.00           H
ATOM   3171 HD23 LEU B  88      68.782  43.774  62.370  1.00  0.00           H
ATOM   3172  C   LEU B  88      67.446  48.095  58.983  1.00  0.00           C
ATOM   3173  O   LEU B  88      66.444  48.243  58.265  1.00  0.00           O
ATOM   3174  N   PRO B  89      68.672  48.563  58.599  1.00  0.00           N
ATOM   3175  CD  PRO B  89      70.013  48.321  59.261  1.00  0.00           C
ATOM   3176  HD2 PRO B  89      70.124  47.252  59.441  1.00  0.00           H
ATOM   3177  HD3 PRO B  89      70.089  48.896  60.183  1.00  0.00           H
ATOM   3178  CG  PRO B  89      71.098  48.708  58.300  1.00  0.00           C
ATOM   3179  HG2 PRO B  89      71.449  47.935  57.617  1.00  0.00           H
ATOM   3180  HG3 PRO B  89      71.954  49.200  58.762  1.00  0.00           H
ATOM   3181  CB  PRO B  89      70.392  49.872  57.591  1.00  0.00           C
ATOM   3182  HB2 PRO B  89      70.913  50.069  56.654  1.00  0.00           H
ATOM   3183  HB3 PRO B  89      70.500  50.751  58.227  1.00  0.00           H
ATOM   3184  CA  PRO B  89      68.956  49.371  57.394  1.00  0.00           C
ATOM   3185  HA  PRO B  89      68.255  50.206  57.354  1.00  0.00           H
ATOM   3186  C   PRO B  89      68.800  48.548  56.091  1.00  0.00           C
ATOM   3187  O   PRO B  89      68.652  47.335  56.079  1.00  0.00           O
ATOM   3188  N   THR B  90      68.794  49.318  54.991  1.00  0.00           N
ATOM   3189  H   THR B  90      68.769  50.321  55.108  1.00  0.00           H
ATOM   3190  CA  THR B  90      68.495  48.883  53.653  1.00  0.00           C
ATOM   3191  HA  THR B  90      67.557  48.328  53.641  1.00  0.00           H
ATOM   3192  CB  THR B  90      68.204  50.174  52.947  1.00  0.00           C
ATOM   3193  HB  THR B  90      69.150  50.714  52.979  1.00  0.00           H
ATOM   3194  CG2 THR B  90      67.927  50.001  51.449  1.00  0.00           C
ATOM   3195 HG21 THR B  90      66.957  49.519  51.328  1.00  0.00           H
ATOM   3196 HG22 THR B  90      67.811  50.964  50.953  1.00  0.00           H
ATOM   3197 HG23 THR B  90      68.689  49.540  50.819  1.00  0.00           H
ATOM   3198  OG1 THR B  90      67.276  51.065  53.505  1.00  0.00           O
ATOM   3199  HG1 THR B  90      67.764  51.481  54.219  1.00  0.00           H
ATOM   3200  C   THR B  90      69.573  47.996  52.997  1.00  0.00           C
ATOM   3201  O   THR B  90      70.773  48.312  53.086  1.00  0.00           O
ATOM   3202  N   GLY B  91      69.207  46.909  52.329  1.00  0.00           N
ATOM   3203  H   GLY B  91      68.210  46.749  52.350  1.00  0.00           H
ATOM   3204  CA  GLY B  91      70.143  45.906  51.809  1.00  0.00           C
ATOM   3205  HA2 GLY B  91      69.698  45.361  50.976  1.00  0.00           H
ATOM   3206  HA3 GLY B  91      71.120  46.287  51.512  1.00  0.00           H
ATOM   3207  C   GLY B  91      70.614  44.953  52.926  1.00  0.00           C
ATOM   3208  O   GLY B  91      71.619  44.319  52.663  1.00  0.00           O
ATOM   3209  N   THR B  92      70.086  44.936  54.131  1.00  0.00           N
ATOM   3210  H   THR B  92      69.377  45.596  54.416  1.00  0.00           H
ATOM   3211  CA  THR B  92      70.424  43.987  55.164  1.00  0.00           C
ATOM   3212  HA  THR B  92      71.501  43.825  55.128  1.00  0.00           H
ATOM   3213  CB  THR B  92      69.895  44.442  56.561  1.00  0.00           C
ATOM   3214  HB  THR B  92      68.826  44.636  56.466  1.00  0.00           H
ATOM   3215  CG2 THR B  92      70.108  43.476  57.725  1.00  0.00           C
ATOM   3216 HG21 THR B  92      70.979  42.831  57.616  1.00  0.00           H
ATOM   3217 HG22 THR B  92      70.205  44.168  58.562  1.00  0.00           H
ATOM   3218 HG23 THR B  92      69.250  42.826  57.897  1.00  0.00           H
ATOM   3219  OG1 THR B  92      70.530  45.642  56.857  1.00  0.00           O
ATOM   3220  HG1 THR B  92      69.841  46.308  56.800  1.00  0.00           H
ATOM   3221  C   THR B  92      69.749  42.631  54.831  1.00  0.00           C
ATOM   3222  O   THR B  92      68.600  42.423  54.489  1.00  0.00           O
ATOM   3223  N   LEU B  93      70.624  41.583  54.911  1.00  0.00           N
ATOM   3224  H   LEU B  93      71.580  41.725  55.203  1.00  0.00           H
ATOM   3225  CA  LEU B  93      70.132  40.212  54.859  1.00  0.00           C
ATOM   3226  HA  LEU B  93      69.468  40.072  54.006  1.00  0.00           H
ATOM   3227  CB  LEU B  93      71.352  39.374  54.664  1.00  0.00           C
ATOM   3228  HB2 LEU B  93      71.568  39.421  53.597  1.00  0.00           H
ATOM   3229  HB3 LEU B  93      72.133  39.758  55.321  1.00  0.00           H
ATOM   3230  CG  LEU B  93      71.397  37.856  54.937  1.00  0.00           C
ATOM   3231  HG  LEU B  93      71.227  37.656  55.995  1.00  0.00           H
ATOM   3232  CD1 LEU B  93      70.331  37.051  54.304  1.00  0.00           C
ATOM   3233 HD11 LEU B  93      70.464  35.982  54.463  1.00  0.00           H
ATOM   3234 HD12 LEU B  93      69.389  37.391  54.735  1.00  0.00           H
ATOM   3235 HD13 LEU B  93      70.249  37.206  53.228  1.00  0.00           H
ATOM   3236  CD2 LEU B  93      72.680  37.159  54.503  1.00  0.00           C
ATOM   3237 HD21 LEU B  93      72.640  36.915  53.441  1.00  0.00           H
ATOM   3238 HD22 LEU B  93      73.574  37.699  54.816  1.00  0.00           H
ATOM   3239 HD23 LEU B  93      72.637  36.197  55.013  1.00  0.00           H
ATOM   3240  C   LEU B  93      69.416  39.829  56.176  1.00  0.00           C
ATOM   3241  O   LEU B  93      69.980  40.058  57.318  1.00  0.00           O
ATOM   3242  N   LEU B  94      68.278  39.187  56.038  1.00  0.00           N
ATOM   3243  H   LEU B  94      67.987  39.093  55.076  1.00  0.00           H
ATOM   3244  CA  LEU B  94      67.519  38.695  57.164  1.00  0.00           C
ATOM   3245  HA  LEU B  94      68.022  38.918  58.105  1.00  0.00           H
ATOM   3246  CB  LEU B  94      66.170  39.414  57.198  1.00  0.00           C
ATOM   3247  HB2 LEU B  94      66.300  40.496  57.218  1.00  0.00           H
ATOM   3248  HB3 LEU B  94      65.598  39.194  56.297  1.00  0.00           H
ATOM   3249  CG  LEU B  94      65.291  39.040  58.325  1.00  0.00           C
ATOM   3250  HG  LEU B  94      64.909  38.024  58.224  1.00  0.00           H
ATOM   3251  CD1 LEU B  94      65.931  39.065  59.773  1.00  0.00           C
ATOM   3252 HD11 LEU B  94      65.239  38.802  60.573  1.00  0.00           H
ATOM   3253 HD12 LEU B  94      66.620  38.220  59.782  1.00  0.00           H
ATOM   3254 HD13 LEU B  94      66.510  39.965  59.980  1.00  0.00           H
ATOM   3255  CD2 LEU B  94      64.131  39.953  58.380  1.00  0.00           C
ATOM   3256 HD21 LEU B  94      63.451  39.778  59.214  1.00  0.00           H
ATOM   3257 HD22 LEU B  94      64.542  40.953  58.526  1.00  0.00           H
ATOM   3258 HD23 LEU B  94      63.666  39.876  57.397  1.00  0.00           H
ATOM   3259  C   LEU B  94      67.365  37.172  57.049  1.00  0.00           C
ATOM   3260  O   LEU B  94      66.742  36.854  56.110  1.00  0.00           O
ATOM   3261  N   VAL B  95      67.737  36.367  58.034  1.00  0.00           N
ATOM   3262  H   VAL B  95      68.237  36.666  58.859  1.00  0.00           H
ATOM   3263  CA  VAL B  95      67.229  34.918  58.040  1.00  0.00           C
ATOM   3264  HA  VAL B  95      66.524  34.730  57.230  1.00  0.00           H
ATOM   3265  CB  VAL B  95      68.362  33.873  57.787  1.00  0.00           C
ATOM   3266  HB  VAL B  95      69.194  33.954  58.486  1.00  0.00           H
ATOM   3267  CG1 VAL B  95      67.961  32.408  57.986  1.00  0.00           C
ATOM   3268 HG11 VAL B  95      67.107  32.459  57.311  1.00  0.00           H
ATOM   3269 HG12 VAL B  95      68.734  31.707  57.670  1.00  0.00           H
ATOM   3270 HG13 VAL B  95      67.524  32.229  58.969  1.00  0.00           H
ATOM   3271  CG2 VAL B  95      68.994  34.074  56.394  1.00  0.00           C
ATOM   3272 HG21 VAL B  95      69.503  35.036  56.338  1.00  0.00           H
ATOM   3273 HG22 VAL B  95      69.764  33.307  56.302  1.00  0.00           H
ATOM   3274 HG23 VAL B  95      68.288  33.880  55.587  1.00  0.00           H
ATOM   3275  C   VAL B  95      66.460  34.669  59.307  1.00  0.00           C
ATOM   3276  O   VAL B  95      66.804  35.066  60.393  1.00  0.00           O
ATOM   3277  N   ASP B  96      65.478  33.769  59.285  1.00  0.00           N
ATOM   3278  H   ASP B  96      65.356  33.296  58.401  1.00  0.00           H
ATOM   3279  CA  ASP B  96      64.760  33.193  60.518  1.00  0.00           C
ATOM   3280  HA  ASP B  96      65.393  33.342  61.393  1.00  0.00           H
ATOM   3281  CB  ASP B  96      63.428  33.950  60.867  1.00  0.00           C
ATOM   3282  HB2 ASP B  96      63.005  33.451  61.738  1.00  0.00           H
ATOM   3283  HB3 ASP B  96      63.708  34.942  61.221  1.00  0.00           H
ATOM   3284  CG  ASP B  96      62.266  33.979  59.933  1.00  0.00           C
ATOM   3285  OD1 ASP B  96      62.392  33.377  58.821  1.00  0.00           O
ATOM   3286  OD2 ASP B  96      61.158  34.395  60.473  1.00  0.00           O
ATOM   3287  C   ASP B  96      64.511  31.643  60.521  1.00  0.00           C
ATOM   3288  O   ASP B  96      64.739  31.070  59.443  1.00  0.00           O
ATOM   3289  N   SER B  97      64.008  30.953  61.562  1.00  0.00           N
ATOM   3290  H   SER B  97      63.566  31.552  62.244  1.00  0.00           H
ATOM   3291  CA  SER B  97      63.841  29.515  61.638  1.00  0.00           C
ATOM   3292  HA  SER B  97      63.374  29.164  60.718  1.00  0.00           H
ATOM   3293  CB  SER B  97      65.257  28.931  61.850  1.00  0.00           C
ATOM   3294  HB2 SER B  97      65.763  29.181  60.918  1.00  0.00           H
ATOM   3295  HB3 SER B  97      65.714  29.425  62.706  1.00  0.00           H
ATOM   3296  OG  SER B  97      65.288  27.464  62.007  1.00  0.00           O
ATOM   3297  HG  SER B  97      64.808  27.028  61.299  1.00  0.00           H
ATOM   3298  C   SER B  97      62.931  29.103  62.860  1.00  0.00           C
ATOM   3299  O   SER B  97      63.047  29.642  63.968  1.00  0.00           O
ATOM   3300  N   ASP B  98      62.160  28.035  62.647  1.00  0.00           N
ATOM   3301  H   ASP B  98      62.122  27.625  61.725  1.00  0.00           H
ATOM   3302  CA  ASP B  98      61.432  27.532  63.823  1.00  0.00           C
ATOM   3303  HA  ASP B  98      62.057  27.539  64.716  1.00  0.00           H
ATOM   3304  CB  ASP B  98      60.212  28.409  64.204  1.00  0.00           C
ATOM   3305  HB2 ASP B  98      60.633  29.412  64.140  1.00  0.00           H
ATOM   3306  HB3 ASP B  98      59.458  28.299  63.424  1.00  0.00           H
ATOM   3307  CG  ASP B  98      59.554  27.998  65.470  1.00  0.00           C
ATOM   3308  OD1 ASP B  98      58.388  28.327  65.713  1.00  0.00           O
ATOM   3309  OD2 ASP B  98      60.184  27.534  66.429  1.00  0.00           O
ATOM   3310  C   ASP B  98      60.926  26.073  63.506  1.00  0.00           C
ATOM   3311  O   ASP B  98      60.751  25.784  62.283  1.00  0.00           O
ATOM   3312  N   LEU B  99      60.683  25.239  64.520  1.00  0.00           N
ATOM   3313  H   LEU B  99      60.720  25.541  65.483  1.00  0.00           H
ATOM   3314  CA  LEU B  99      60.362  23.846  64.212  1.00  0.00           C
ATOM   3315  HA  LEU B  99      61.208  23.393  63.695  1.00  0.00           H
ATOM   3316  CB  LEU B  99      60.453  23.039  65.543  1.00  0.00           C
ATOM   3317  HB2 LEU B  99      61.495  23.020  65.864  1.00  0.00           H
ATOM   3318  HB3 LEU B  99      59.869  23.642  66.238  1.00  0.00           H
ATOM   3319  CG  LEU B  99      59.832  21.620  65.585  1.00  0.00           C
ATOM   3320  HG  LEU B  99      58.797  21.697  65.250  1.00  0.00           H
ATOM   3321  CD1 LEU B  99      60.653  20.646  64.805  1.00  0.00           C
ATOM   3322 HD11 LEU B  99      60.695  20.933  63.754  1.00  0.00           H
ATOM   3323 HD12 LEU B  99      61.661  20.711  65.214  1.00  0.00           H
ATOM   3324 HD13 LEU B  99      60.351  19.618  65.005  1.00  0.00           H
ATOM   3325  CD2 LEU B  99      59.816  21.042  67.009  1.00  0.00           C
ATOM   3326 HD21 LEU B  99      60.828  20.983  67.409  1.00  0.00           H
ATOM   3327 HD22 LEU B  99      59.131  21.608  67.640  1.00  0.00           H
ATOM   3328 HD23 LEU B  99      59.451  20.019  66.922  1.00  0.00           H
ATOM   3329  C   LEU B  99      59.042  23.558  63.439  1.00  0.00           C
ATOM   3330  O   LEU B  99      58.944  22.565  62.709  1.00  0.00           O
ATOM   3331  N   ASN B 100      57.929  24.262  63.819  1.00  0.00           N
ATOM   3332  H   ASN B 100      58.108  24.883  64.595  1.00  0.00           H
ATOM   3333  CA  ASN B 100      56.613  24.136  63.274  1.00  0.00           C
ATOM   3334  HA  ASN B 100      56.465  23.171  62.788  1.00  0.00           H
ATOM   3335  CB  ASN B 100      55.617  24.274  64.527  1.00  0.00           C
ATOM   3336  HB2 ASN B 100      55.974  25.063  65.188  1.00  0.00           H
ATOM   3337  HB3 ASN B 100      54.694  24.505  63.995  1.00  0.00           H
ATOM   3338  CG  ASN B 100      55.545  23.063  65.378  1.00  0.00           C
ATOM   3339  OD1 ASN B 100      54.927  22.119  65.113  1.00  0.00           O
ATOM   3340  ND2 ASN B 100      56.253  23.098  66.468  1.00  0.00           N
ATOM   3341 HD21 ASN B 100      56.072  22.419  67.193  1.00  0.00           H
ATOM   3342 HD22 ASN B 100      56.833  23.897  66.679  1.00  0.00           H
ATOM   3343  C   ASN B 100      56.323  25.177  62.192  1.00  0.00           C
ATOM   3344  O   ASN B 100      56.697  26.365  62.417  1.00  0.00           O
ATOM   3345  N   ASP B 101      55.864  24.775  60.981  1.00  0.00           N
ATOM   3346  H   ASP B 101      55.390  23.895  61.121  1.00  0.00           H
ATOM   3347  CA  ASP B 101      55.952  25.387  59.645  1.00  0.00           C
ATOM   3348  HA  ASP B 101      56.976  25.721  59.472  1.00  0.00           H
ATOM   3349  CB  ASP B 101      55.661  24.299  58.571  1.00  0.00           C
ATOM   3350  HB2 ASP B 101      56.172  23.341  58.675  1.00  0.00           H
ATOM   3351  HB3 ASP B 101      54.644  23.927  58.692  1.00  0.00           H
ATOM   3352  CG  ASP B 101      55.782  24.814  57.128  1.00  0.00           C
ATOM   3353  OD1 ASP B 101      55.928  24.083  56.141  1.00  0.00           O
ATOM   3354  OD2 ASP B 101      55.802  25.995  56.909  1.00  0.00           O
ATOM   3355  C   ASP B 101      55.017  26.665  59.519  1.00  0.00           C
ATOM   3356  O   ASP B 101      53.759  26.694  59.738  1.00  0.00           O
ATOM   3357  N   PHE B 102      55.747  27.679  59.065  1.00  0.00           N
ATOM   3358  H   PHE B 102      56.529  27.444  58.471  1.00  0.00           H
ATOM   3359  CA  PHE B 102      55.340  29.026  59.072  1.00  0.00           C
ATOM   3360  HA  PHE B 102      54.258  29.051  58.937  1.00  0.00           H
ATOM   3361  CB  PHE B 102      55.778  29.737  60.367  1.00  0.00           C
ATOM   3362  HB2 PHE B 102      55.172  30.638  60.273  1.00  0.00           H
ATOM   3363  HB3 PHE B 102      55.353  29.077  61.124  1.00  0.00           H
ATOM   3364  CG  PHE B 102      57.311  30.037  60.576  1.00  0.00           C
ATOM   3365  CD1 PHE B 102      58.279  29.011  60.716  1.00  0.00           C
ATOM   3366  HD1 PHE B 102      57.882  28.013  60.602  1.00  0.00           H
ATOM   3367  CE1 PHE B 102      59.622  29.361  60.911  1.00  0.00           C
ATOM   3368  HE1 PHE B 102      60.351  28.566  60.953  1.00  0.00           H
ATOM   3369  CZ  PHE B 102      60.013  30.704  60.919  1.00  0.00           C
ATOM   3370  HZ  PHE B 102      61.051  31.003  60.923  1.00  0.00           H
ATOM   3371  CE2 PHE B 102      59.012  31.732  60.838  1.00  0.00           C
ATOM   3372  HE2 PHE B 102      59.308  32.770  60.861  1.00  0.00           H
ATOM   3373  CD2 PHE B 102      57.691  31.394  60.744  1.00  0.00           C
ATOM   3374  HD2 PHE B 102      56.914  32.123  60.570  1.00  0.00           H
ATOM   3375  C   PHE B 102      55.916  29.795  57.900  1.00  0.00           C
ATOM   3376  O   PHE B 102      56.702  29.245  57.129  1.00  0.00           O
ATOM   3377  N   VAL B 103      55.450  30.981  57.596  1.00  0.00           N
ATOM   3378  H   VAL B 103      54.861  31.487  58.242  1.00  0.00           H
ATOM   3379  CA  VAL B 103      56.015  31.844  56.568  1.00  0.00           C
ATOM   3380  HA  VAL B 103      56.998  31.441  56.321  1.00  0.00           H
ATOM   3381  CB  VAL B 103      55.094  31.856  55.331  1.00  0.00           C
ATOM   3382  HB  VAL B 103      54.619  30.891  55.154  1.00  0.00           H
ATOM   3383  CG1 VAL B 103      53.925  32.849  55.424  1.00  0.00           C
ATOM   3384 HG11 VAL B 103      53.362  32.529  56.301  1.00  0.00           H
ATOM   3385 HG12 VAL B 103      54.248  33.887  55.349  1.00  0.00           H
ATOM   3386 HG13 VAL B 103      53.202  32.777  54.612  1.00  0.00           H
ATOM   3387  CG2 VAL B 103      55.983  32.107  54.065  1.00  0.00           C
ATOM   3388 HG21 VAL B 103      55.394  32.080  53.149  1.00  0.00           H
ATOM   3389 HG22 VAL B 103      56.367  33.126  54.092  1.00  0.00           H
ATOM   3390 HG23 VAL B 103      56.805  31.395  54.151  1.00  0.00           H
ATOM   3391  C   VAL B 103      56.245  33.318  57.144  1.00  0.00           C
ATOM   3392  O   VAL B 103      55.717  33.635  58.170  1.00  0.00           O
ATOM   3393  N   SER B 104      57.126  34.039  56.512  1.00  0.00           N
ATOM   3394  H   SER B 104      57.322  33.878  55.535  1.00  0.00           H
ATOM   3395  CA  SER B 104      57.981  35.057  57.053  1.00  0.00           C
ATOM   3396  HA  SER B 104      57.476  35.702  57.772  1.00  0.00           H
ATOM   3397  CB  SER B 104      59.186  34.371  57.729  1.00  0.00           C
ATOM   3398  HB2 SER B 104      58.897  33.656  58.498  1.00  0.00           H
ATOM   3399  HB3 SER B 104      59.717  33.794  56.972  1.00  0.00           H
ATOM   3400  OG  SER B 104      59.898  35.326  58.406  1.00  0.00           O
ATOM   3401  HG  SER B 104      60.340  34.939  59.165  1.00  0.00           H
ATOM   3402  C   SER B 104      58.432  35.989  55.914  1.00  0.00           C
ATOM   3403  O   SER B 104      58.660  35.549  54.788  1.00  0.00           O
ATOM   3404  N   ASP B 105      58.602  37.266  56.179  1.00  0.00           N
ATOM   3405  H   ASP B 105      58.289  37.495  57.112  1.00  0.00           H
ATOM   3406  CA  ASP B 105      59.182  38.332  55.402  1.00  0.00           C
ATOM   3407  HA  ASP B 105      58.611  38.531  54.495  1.00  0.00           H
ATOM   3408  CB  ASP B 105      59.024  39.616  56.211  1.00  0.00           C
ATOM   3409  HB2 ASP B 105      59.657  39.681  57.096  1.00  0.00           H
ATOM   3410  HB3 ASP B 105      59.328  40.484  55.626  1.00  0.00           H
ATOM   3411  CG  ASP B 105      57.642  39.940  56.744  1.00  0.00           C
ATOM   3412  OD1 ASP B 105      56.977  40.711  56.023  1.00  0.00           O
ATOM   3413  OD2 ASP B 105      57.205  39.321  57.746  1.00  0.00           O
ATOM   3414  C   ASP B 105      60.680  38.087  55.054  1.00  0.00           C
ATOM   3415  O   ASP B 105      61.207  38.823  54.170  1.00  0.00           O
ATOM   3416  N   ALA B 106      61.367  37.165  55.686  1.00  0.00           N
ATOM   3417  H   ALA B 106      60.827  36.670  56.381  1.00  0.00           H
ATOM   3418  CA  ALA B 106      62.842  36.938  55.621  1.00  0.00           C
ATOM   3419  HA  ALA B 106      63.421  37.861  55.654  1.00  0.00           H
ATOM   3420  CB  ALA B 106      63.199  36.007  56.804  1.00  0.00           C
ATOM   3421  HB1 ALA B 106      63.005  36.549  57.730  1.00  0.00           H
ATOM   3422  HB2 ALA B 106      62.716  35.031  56.759  1.00  0.00           H
ATOM   3423  HB3 ALA B 106      64.256  35.746  56.748  1.00  0.00           H
ATOM   3424  C   ALA B 106      63.349  36.320  54.309  1.00  0.00           C
ATOM   3425  O   ALA B 106      62.661  35.844  53.445  1.00  0.00           O
ATOM   3426  N   ASP B 107      64.694  36.402  54.080  1.00  0.00           N
ATOM   3427  H   ASP B 107      65.264  36.701  54.859  1.00  0.00           H
ATOM   3428  CA  ASP B 107      65.487  35.907  52.829  1.00  0.00           C
ATOM   3429  HA  ASP B 107      64.933  36.120  51.914  1.00  0.00           H
ATOM   3430  CB  ASP B 107      66.794  36.787  52.779  1.00  0.00           C
ATOM   3431  HB2 ASP B 107      67.342  36.661  53.713  1.00  0.00           H
ATOM   3432  HB3 ASP B 107      67.399  36.444  51.939  1.00  0.00           H
ATOM   3433  CG  ASP B 107      66.495  38.272  52.668  1.00  0.00           C
ATOM   3434  OD1 ASP B 107      65.582  38.733  51.960  1.00  0.00           O
ATOM   3435  OD2 ASP B 107      67.251  39.049  53.298  1.00  0.00           O
ATOM   3436  C   ASP B 107      65.766  34.425  52.747  1.00  0.00           C
ATOM   3437  O   ASP B 107      65.911  33.885  51.649  1.00  0.00           O
ATOM   3438  N   SER B 108      65.615  33.749  53.933  1.00  0.00           N
ATOM   3439  H   SER B 108      65.531  34.397  54.703  1.00  0.00           H
ATOM   3440  CA  SER B 108      65.345  32.364  54.133  1.00  0.00           C
ATOM   3441  HA  SER B 108      64.785  31.937  53.302  1.00  0.00           H
ATOM   3442  CB  SER B 108      66.630  31.529  54.264  1.00  0.00           C
ATOM   3443  HB2 SER B 108      67.171  31.710  55.192  1.00  0.00           H
ATOM   3444  HB3 SER B 108      66.404  30.465  54.319  1.00  0.00           H
ATOM   3445  OG  SER B 108      67.407  31.619  53.071  1.00  0.00           O
ATOM   3446  HG  SER B 108      67.111  30.911  52.493  1.00  0.00           H
ATOM   3447  C   SER B 108      64.597  32.206  55.446  1.00  0.00           C
ATOM   3448  O   SER B 108      64.737  32.990  56.339  1.00  0.00           O
ATOM   3449  N   THR B 109      63.872  31.045  55.515  1.00  0.00           N
ATOM   3450  H   THR B 109      63.716  30.406  54.749  1.00  0.00           H
ATOM   3451  CA  THR B 109      63.054  30.677  56.649  1.00  0.00           C
ATOM   3452  HA  THR B 109      63.502  31.134  57.532  1.00  0.00           H
ATOM   3453  CB  THR B 109      61.638  31.157  56.320  1.00  0.00           C
ATOM   3454  HB  THR B 109      61.291  30.662  55.413  1.00  0.00           H
ATOM   3455  CG2 THR B 109      60.638  30.920  57.425  1.00  0.00           C
ATOM   3456 HG21 THR B 109      59.735  31.513  57.285  1.00  0.00           H
ATOM   3457 HG22 THR B 109      60.381  29.863  57.485  1.00  0.00           H
ATOM   3458 HG23 THR B 109      61.072  31.267  58.363  1.00  0.00           H
ATOM   3459  OG1 THR B 109      61.672  32.517  56.294  1.00  0.00           O
ATOM   3460  HG1 THR B 109      61.922  32.751  57.191  1.00  0.00           H
ATOM   3461  C   THR B 109      63.131  29.168  56.789  1.00  0.00           C
ATOM   3462  O   THR B 109      62.432  28.321  56.217  1.00  0.00           O
ATOM   3463  N   LEU B 110      64.165  28.766  57.566  1.00  0.00           N
ATOM   3464  H   LEU B 110      64.494  29.495  58.183  1.00  0.00           H
ATOM   3465  CA  LEU B 110      64.592  27.376  57.717  1.00  0.00           C
ATOM   3466  HA  LEU B 110      64.526  26.940  56.721  1.00  0.00           H
ATOM   3467  CB  LEU B 110      66.056  27.479  58.160  1.00  0.00           C
ATOM   3468  HB2 LEU B 110      66.058  28.075  59.073  1.00  0.00           H
ATOM   3469  HB3 LEU B 110      66.458  26.504  58.433  1.00  0.00           H
ATOM   3470  CG  LEU B 110      67.077  28.149  57.230  1.00  0.00           C
ATOM   3471  HG  LEU B 110      66.761  29.122  56.854  1.00  0.00           H
ATOM   3472  CD1 LEU B 110      68.379  28.287  57.862  1.00  0.00           C
ATOM   3473 HD11 LEU B 110      68.647  27.285  58.198  1.00  0.00           H
ATOM   3474 HD12 LEU B 110      69.093  28.644  57.120  1.00  0.00           H
ATOM   3475 HD13 LEU B 110      68.340  28.945  58.731  1.00  0.00           H
ATOM   3476  CD2 LEU B 110      67.252  27.183  55.979  1.00  0.00           C
ATOM   3477 HD21 LEU B 110      66.331  26.824  55.520  1.00  0.00           H
ATOM   3478 HD22 LEU B 110      67.854  27.650  55.200  1.00  0.00           H
ATOM   3479 HD23 LEU B 110      67.757  26.250  56.227  1.00  0.00           H
ATOM   3480  C   LEU B 110      63.643  26.631  58.770  1.00  0.00           C
ATOM   3481  O   LEU B 110      63.657  26.967  59.959  1.00  0.00           O
ATOM   3482  N   ILE B 111      62.785  25.750  58.252  1.00  0.00           N
ATOM   3483  H   ILE B 111      62.878  25.433  57.297  1.00  0.00           H
ATOM   3484  CA  ILE B 111      61.968  24.956  59.189  1.00  0.00           C
ATOM   3485  HA  ILE B 111      61.518  25.599  59.945  1.00  0.00           H
ATOM   3486  CB  ILE B 111      60.894  24.296  58.322  1.00  0.00           C
ATOM   3487  HB  ILE B 111      61.394  23.789  57.496  1.00  0.00           H
ATOM   3488  CG2 ILE B 111      60.092  23.190  59.011  1.00  0.00           C
ATOM   3489 HG21 ILE B 111      60.714  22.351  59.323  1.00  0.00           H
ATOM   3490 HG22 ILE B 111      59.641  23.516  59.949  1.00  0.00           H
ATOM   3491 HG23 ILE B 111      59.355  22.829  58.293  1.00  0.00           H
ATOM   3492  CG1 ILE B 111      60.012  25.360  57.628  1.00  0.00           C
ATOM   3493 HG12 ILE B 111      60.652  25.895  56.926  1.00  0.00           H
ATOM   3494 HG13 ILE B 111      59.229  24.923  57.009  1.00  0.00           H
ATOM   3495  CD1 ILE B 111      59.466  26.382  58.599  1.00  0.00           C
ATOM   3496 HD11 ILE B 111      58.528  26.774  58.208  1.00  0.00           H
ATOM   3497 HD12 ILE B 111      59.466  25.927  59.590  1.00  0.00           H
ATOM   3498 HD13 ILE B 111      60.135  27.239  58.681  1.00  0.00           H
ATOM   3499  C   ILE B 111      62.870  23.947  59.860  1.00  0.00           C
ATOM   3500  O   ILE B 111      63.708  23.397  59.142  1.00  0.00           O
ATOM   3501  N   GLY B 112      62.635  23.751  61.181  1.00  0.00           N
ATOM   3502  H   GLY B 112      61.991  24.413  61.589  1.00  0.00           H
ATOM   3503  CA  GLY B 112      63.334  22.811  62.014  1.00  0.00           C
ATOM   3504  HA2 GLY B 112      62.693  21.987  62.330  1.00  0.00           H
ATOM   3505  HA3 GLY B 112      64.172  22.286  61.556  1.00  0.00           H
ATOM   3506  C   GLY B 112      63.813  23.418  63.285  1.00  0.00           C
ATOM   3507  O   GLY B 112      63.666  24.579  63.644  1.00  0.00           O
ATOM   3508  N   ASP B 113      64.220  22.502  64.207  1.00  0.00           N
ATOM   3509  H   ASP B 113      64.078  21.516  64.043  1.00  0.00           H
ATOM   3510  CA  ASP B 113      64.869  22.875  65.455  1.00  0.00           C
ATOM   3511  HA  ASP B 113      64.251  23.613  65.966  1.00  0.00           H
ATOM   3512  CB  ASP B 113      65.005  21.634  66.333  1.00  0.00           C
ATOM   3513  HB2 ASP B 113      64.024  21.160  66.348  1.00  0.00           H
ATOM   3514  HB3 ASP B 113      65.753  20.934  65.960  1.00  0.00           H
ATOM   3515  CG  ASP B 113      65.250  21.956  67.875  1.00  0.00           C
ATOM   3516  OD1 ASP B 113      65.538  21.043  68.650  1.00  0.00           O
ATOM   3517  OD2 ASP B 113      65.097  23.169  68.260  1.00  0.00           O
ATOM   3518  C   ASP B 113      66.330  23.477  65.306  1.00  0.00           C
ATOM   3519  O   ASP B 113      66.936  23.287  64.226  1.00  0.00           O
ATOM   3520  N   CYS B 114      66.788  24.419  66.128  1.00  0.00           N
ATOM   3521  H   CYS B 114      66.323  24.629  66.999  1.00  0.00           H
ATOM   3522  CA  CYS B 114      67.985  25.212  65.749  1.00  0.00           C
ATOM   3523  HA  CYS B 114      67.756  25.729  64.816  1.00  0.00           H
ATOM   3524  CB  CYS B 114      68.310  26.341  66.757  1.00  0.00           C
ATOM   3525  HB2 CYS B 114      69.044  27.022  66.326  1.00  0.00           H
ATOM   3526  HB3 CYS B 114      67.399  26.908  66.949  1.00  0.00           H
ATOM   3527  SG  CYS B 114      68.943  25.727  68.327  1.00  0.00           S
ATOM   3528  HG  CYS B 114      68.033  24.804  68.654  1.00  0.00           H
ATOM   3529  C   CYS B 114      69.272  24.415  65.398  1.00  0.00           C
ATOM   3530  O   CYS B 114      69.911  24.657  64.412  1.00  0.00           O
ATOM   3531  N   ALA B 115      69.551  23.329  66.097  1.00  0.00           N
ATOM   3532  H   ALA B 115      68.895  23.006  66.794  1.00  0.00           H
ATOM   3533  CA  ALA B 115      70.668  22.395  65.857  1.00  0.00           C
ATOM   3534  HA  ALA B 115      71.567  22.984  66.043  1.00  0.00           H
ATOM   3535  CB  ALA B 115      70.629  21.336  66.915  1.00  0.00           C
ATOM   3536  HB1 ALA B 115      71.474  20.648  66.872  1.00  0.00           H
ATOM   3537  HB2 ALA B 115      70.584  21.798  67.901  1.00  0.00           H
ATOM   3538  HB3 ALA B 115      69.745  20.710  66.793  1.00  0.00           H
ATOM   3539  C   ALA B 115      70.732  21.850  64.360  1.00  0.00           C
ATOM   3540  O   ALA B 115      71.772  21.376  63.884  1.00  0.00           O
ATOM   3541  N   THR B 116      69.602  21.945  63.656  1.00  0.00           N
ATOM   3542  H   THR B 116      68.831  22.303  64.201  1.00  0.00           H
ATOM   3543  CA  THR B 116      69.452  21.630  62.255  1.00  0.00           C
ATOM   3544  HA  THR B 116      69.972  20.683  62.110  1.00  0.00           H
ATOM   3545  CB  THR B 116      68.098  21.309  61.735  1.00  0.00           C
ATOM   3546  HB  THR B 116      68.078  21.040  60.679  1.00  0.00           H
ATOM   3547  CG2 THR B 116      67.349  20.201  62.496  1.00  0.00           C
ATOM   3548 HG21 THR B 116      67.730  19.183  62.422  1.00  0.00           H
ATOM   3549 HG22 THR B 116      67.328  20.454  63.556  1.00  0.00           H
ATOM   3550 HG23 THR B 116      66.393  20.133  61.978  1.00  0.00           H
ATOM   3551  OG1 THR B 116      67.221  22.461  61.809  1.00  0.00           O
ATOM   3552  HG1 THR B 116      67.230  22.731  62.730  1.00  0.00           H
ATOM   3553  C   THR B 116      70.010  22.673  61.271  1.00  0.00           C
ATOM   3554  O   THR B 116      70.619  22.348  60.247  1.00  0.00           O
ATOM   3555  N   VAL B 117      69.876  23.950  61.576  1.00  0.00           N
ATOM   3556  H   VAL B 117      69.565  24.215  62.499  1.00  0.00           H
ATOM   3557  CA  VAL B 117      70.381  25.075  60.762  1.00  0.00           C
ATOM   3558  HA  VAL B 117      70.061  24.901  59.735  1.00  0.00           H
ATOM   3559  CB  VAL B 117      69.994  26.428  61.399  1.00  0.00           C
ATOM   3560  HB  VAL B 117      70.295  26.442  62.446  1.00  0.00           H
ATOM   3561  CG1 VAL B 117      70.732  27.662  60.960  1.00  0.00           C
ATOM   3562 HG11 VAL B 117      70.651  27.791  59.880  1.00  0.00           H
ATOM   3563 HG12 VAL B 117      70.437  28.594  61.442  1.00  0.00           H
ATOM   3564 HG13 VAL B 117      71.791  27.597  61.211  1.00  0.00           H
ATOM   3565  CG2 VAL B 117      68.516  26.567  61.421  1.00  0.00           C
ATOM   3566 HG21 VAL B 117      68.031  25.662  61.785  1.00  0.00           H
ATOM   3567 HG22 VAL B 117      68.426  27.434  62.076  1.00  0.00           H
ATOM   3568 HG23 VAL B 117      68.220  26.807  60.399  1.00  0.00           H
ATOM   3569  C   VAL B 117      71.971  24.966  60.701  1.00  0.00           C
ATOM   3570  O   VAL B 117      72.640  24.569  61.615  1.00  0.00           O
ATOM   3571  N   HIE B 118      72.587  25.308  59.569  1.00  0.00           N
ATOM   3572  H   HIE B 118      72.006  25.791  58.898  1.00  0.00           H
ATOM   3573  CA  HIE B 118      74.045  25.371  59.418  1.00  0.00           C
ATOM   3574  HA  HIE B 118      74.561  25.194  60.362  1.00  0.00           H
ATOM   3575  CB  HIE B 118      74.490  24.200  58.532  1.00  0.00           C
ATOM   3576  HB2 HIE B 118      74.491  23.359  59.225  1.00  0.00           H
ATOM   3577  HB3 HIE B 118      73.739  23.957  57.780  1.00  0.00           H
ATOM   3578  CG  HIE B 118      75.852  24.324  57.859  1.00  0.00           C
ATOM   3579  ND1 HIE B 118      76.137  25.034  56.650  1.00  0.00           N
ATOM   3580  CE1 HIE B 118      77.435  25.000  56.525  1.00  0.00           C
ATOM   3581  HE1 HIE B 118      78.019  25.508  55.771  1.00  0.00           H
ATOM   3582  NE2 HIE B 118      78.016  24.415  57.568  1.00  0.00           N
ATOM   3583  HE2 HIE B 118      78.984  24.127  57.584  1.00  0.00           H
ATOM   3584  CD2 HIE B 118      77.055  23.895  58.404  1.00  0.00           C
ATOM   3585  HD2 HIE B 118      77.244  23.247  59.248  1.00  0.00           H
ATOM   3586  C   HIE B 118      74.519  26.705  58.743  1.00  0.00           C
ATOM   3587  O   HIE B 118      73.794  27.256  57.909  1.00  0.00           O
ATOM   3588  N   THR B 119      75.684  27.265  59.004  1.00  0.00           N
ATOM   3589  H   THR B 119      76.209  27.001  59.825  1.00  0.00           H
ATOM   3590  CA  THR B 119      76.280  28.346  58.164  1.00  0.00           C
ATOM   3591  HA  THR B 119      76.018  28.263  57.109  1.00  0.00           H
ATOM   3592  CB  THR B 119      75.651  29.789  58.441  1.00  0.00           C
ATOM   3593  HB  THR B 119      74.657  29.815  57.995  1.00  0.00           H
ATOM   3594  CG2 THR B 119      75.538  30.039  59.992  1.00  0.00           C
ATOM   3595 HG21 THR B 119      76.409  29.532  60.407  1.00  0.00           H
ATOM   3596 HG22 THR B 119      75.499  31.097  60.251  1.00  0.00           H
ATOM   3597 HG23 THR B 119      74.603  29.571  60.301  1.00  0.00           H
ATOM   3598  OG1 THR B 119      76.479  30.784  57.887  1.00  0.00           O
ATOM   3599  HG1 THR B 119      76.321  30.691  56.944  1.00  0.00           H
ATOM   3600  C   THR B 119      77.850  28.276  58.319  1.00  0.00           C
ATOM   3601  O   THR B 119      78.381  27.962  59.424  1.00  0.00           O
ATOM   3602  N   ALA B 120      78.639  28.565  57.265  1.00  0.00           N
ATOM   3603  H   ALA B 120      78.127  28.780  56.421  1.00  0.00           H
ATOM   3604  CA  ALA B 120      80.106  28.629  57.319  1.00  0.00           C
ATOM   3605  HA  ALA B 120      80.510  27.768  57.852  1.00  0.00           H
ATOM   3606  CB  ALA B 120      80.447  28.454  55.887  1.00  0.00           C
ATOM   3607  HB1 ALA B 120      81.525  28.566  55.773  1.00  0.00           H
ATOM   3608  HB2 ALA B 120      80.038  27.568  55.402  1.00  0.00           H
ATOM   3609  HB3 ALA B 120      80.154  29.243  55.195  1.00  0.00           H
ATOM   3610  C   ALA B 120      80.648  29.927  57.928  1.00  0.00           C
ATOM   3611  O   ALA B 120      81.804  30.026  58.375  1.00  0.00           O
ATOM   3612  N   ASN B 121      79.824  31.008  57.944  1.00  0.00           N
ATOM   3613  H   ASN B 121      78.888  30.924  57.575  1.00  0.00           H
ATOM   3614  CA  ASN B 121      80.213  32.407  58.132  1.00  0.00           C
ATOM   3615  HA  ASN B 121      81.272  32.523  57.899  1.00  0.00           H
ATOM   3616  CB  ASN B 121      79.465  33.261  57.122  1.00  0.00           C
ATOM   3617  HB2 ASN B 121      78.412  33.341  57.392  1.00  0.00           H
ATOM   3618  HB3 ASN B 121      80.036  34.185  57.214  1.00  0.00           H
ATOM   3619  CG  ASN B 121      79.392  32.754  55.733  1.00  0.00           C
ATOM   3620  OD1 ASN B 121      78.547  31.841  55.502  1.00  0.00           O
ATOM   3621  ND2 ASN B 121      80.170  33.283  54.784  1.00  0.00           N
ATOM   3622 HD21 ASN B 121      80.150  32.767  53.916  1.00  0.00           H
ATOM   3623 HD22 ASN B 121      80.851  34.001  54.986  1.00  0.00           H
ATOM   3624  C   ASN B 121      79.940  32.905  59.570  1.00  0.00           C
ATOM   3625  O   ASN B 121      79.033  32.452  60.278  1.00  0.00           O
ATOM   3626  N   LYS B 122      80.629  34.020  59.930  1.00  0.00           N
ATOM   3627  H   LYS B 122      81.405  34.309  59.354  1.00  0.00           H
ATOM   3628  CA  LYS B 122      80.181  34.866  61.032  1.00  0.00           C
ATOM   3629  HA  LYS B 122      79.911  34.244  61.885  1.00  0.00           H
ATOM   3630  CB  LYS B 122      81.366  35.725  61.583  1.00  0.00           C
ATOM   3631  HB2 LYS B 122      81.661  36.548  60.932  1.00  0.00           H
ATOM   3632  HB3 LYS B 122      80.976  36.232  62.466  1.00  0.00           H
ATOM   3633  CG  LYS B 122      82.653  35.026  62.006  1.00  0.00           C
ATOM   3634  HG2 LYS B 122      83.053  34.626  61.075  1.00  0.00           H
ATOM   3635  HG3 LYS B 122      83.367  35.802  62.281  1.00  0.00           H
ATOM   3636  CD  LYS B 122      82.556  33.825  62.911  1.00  0.00           C
ATOM   3637  HD2 LYS B 122      82.155  34.152  63.870  1.00  0.00           H
ATOM   3638  HD3 LYS B 122      82.012  32.969  62.513  1.00  0.00           H
ATOM   3639  CE  LYS B 122      84.059  33.457  63.076  1.00  0.00           C
ATOM   3640  HE2 LYS B 122      84.353  32.877  62.201  1.00  0.00           H
ATOM   3641  HE3 LYS B 122      84.643  34.363  63.238  1.00  0.00           H
ATOM   3642  NZ  LYS B 122      84.234  32.572  64.244  1.00  0.00           N
ATOM   3643  HZ1 LYS B 122      85.162  32.175  64.247  1.00  0.00           H
ATOM   3644  HZ2 LYS B 122      84.120  33.168  65.052  1.00  0.00           H
ATOM   3645  HZ3 LYS B 122      83.593  31.792  64.252  1.00  0.00           H
ATOM   3646  C   LYS B 122      79.006  35.883  60.696  1.00  0.00           C
ATOM   3647  O   LYS B 122      78.859  36.318  59.542  1.00  0.00           O
ATOM   3648  N   TRP B 123      78.192  36.265  61.735  1.00  0.00           N
ATOM   3649  H   TRP B 123      78.302  35.800  62.625  1.00  0.00           H
ATOM   3650  CA  TRP B 123      77.064  37.139  61.568  1.00  0.00           C
ATOM   3651  HA  TRP B 123      77.242  37.736  60.673  1.00  0.00           H
ATOM   3652  CB  TRP B 123      75.762  36.290  61.548  1.00  0.00           C
ATOM   3653  HB2 TRP B 123      75.569  35.909  62.551  1.00  0.00           H
ATOM   3654  HB3 TRP B 123      74.843  36.860  61.413  1.00  0.00           H
ATOM   3655  CG  TRP B 123      75.668  35.230  60.535  1.00  0.00           C
ATOM   3656  CD1 TRP B 123      76.340  34.085  60.511  1.00  0.00           C
ATOM   3657  HD1 TRP B 123      77.144  33.824  61.183  1.00  0.00           H
ATOM   3658  NE1 TRP B 123      76.057  33.379  59.365  1.00  0.00           N
ATOM   3659  HE1 TRP B 123      76.589  32.575  59.062  1.00  0.00           H
ATOM   3660  CE2 TRP B 123      75.008  33.941  58.683  1.00  0.00           C
ATOM   3661  CZ2 TRP B 123      74.326  33.600  57.509  1.00  0.00           C
ATOM   3662  HZ2 TRP B 123      74.608  32.732  56.932  1.00  0.00           H
ATOM   3663  CH2 TRP B 123      73.205  34.349  57.176  1.00  0.00           C
ATOM   3664  HH2 TRP B 123      72.683  34.048  56.279  1.00  0.00           H
ATOM   3665  CZ3 TRP B 123      72.736  35.434  57.911  1.00  0.00           C
ATOM   3666  HZ3 TRP B 123      71.792  35.925  57.730  1.00  0.00           H
ATOM   3667  CE3 TRP B 123      73.483  35.808  59.026  1.00  0.00           C
ATOM   3668  HE3 TRP B 123      73.105  36.598  59.658  1.00  0.00           H
ATOM   3669  CD2 TRP B 123      74.695  35.088  59.426  1.00  0.00           C
ATOM   3670  C   TRP B 123      76.949  38.163  62.702  1.00  0.00           C
ATOM   3671  O   TRP B 123      77.527  38.023  63.757  1.00  0.00           O
ATOM   3672  N   ASP B 124      76.165  39.246  62.483  1.00  0.00           N
ATOM   3673  H   ASP B 124      75.816  39.321  61.538  1.00  0.00           H
ATOM   3674  CA  ASP B 124      76.271  40.526  63.155  1.00  0.00           C
ATOM   3675  HA  ASP B 124      77.312  40.656  63.452  1.00  0.00           H
ATOM   3676  CB  ASP B 124      76.029  41.738  62.196  1.00  0.00           C
ATOM   3677  HB2 ASP B 124      74.952  41.887  62.115  1.00  0.00           H
ATOM   3678  HB3 ASP B 124      76.445  42.626  62.671  1.00  0.00           H
ATOM   3679  CG  ASP B 124      76.643  41.639  60.762  1.00  0.00           C
ATOM   3680  OD1 ASP B 124      77.652  40.930  60.653  1.00  0.00           O
ATOM   3681  OD2 ASP B 124      76.168  42.287  59.825  1.00  0.00           O
ATOM   3682  C   ASP B 124      75.400  40.684  64.359  1.00  0.00           C
ATOM   3683  O   ASP B 124      75.866  41.204  65.385  1.00  0.00           O
ATOM   3684  N   LEU B 125      74.189  40.124  64.288  1.00  0.00           N
ATOM   3685  H   LEU B 125      73.854  39.690  63.439  1.00  0.00           H
ATOM   3686  CA  LEU B 125      73.226  40.037  65.403  1.00  0.00           C
ATOM   3687  HA  LEU B 125      73.743  40.283  66.330  1.00  0.00           H
ATOM   3688  CB  LEU B 125      72.310  41.244  65.255  1.00  0.00           C
ATOM   3689  HB2 LEU B 125      72.855  42.188  65.275  1.00  0.00           H
ATOM   3690  HB3 LEU B 125      71.942  41.196  64.230  1.00  0.00           H
ATOM   3691  CG  LEU B 125      71.066  41.382  66.202  1.00  0.00           C
ATOM   3692  HG  LEU B 125      70.420  40.540  65.956  1.00  0.00           H
ATOM   3693  CD1 LEU B 125      71.389  41.467  67.697  1.00  0.00           C
ATOM   3694 HD11 LEU B 125      71.941  42.383  67.912  1.00  0.00           H
ATOM   3695 HD12 LEU B 125      70.551  41.425  68.392  1.00  0.00           H
ATOM   3696 HD13 LEU B 125      72.101  40.657  67.850  1.00  0.00           H
ATOM   3697  CD2 LEU B 125      70.403  42.693  65.740  1.00  0.00           C
ATOM   3698 HD21 LEU B 125      69.376  42.759  66.100  1.00  0.00           H
ATOM   3699 HD22 LEU B 125      70.977  43.536  66.123  1.00  0.00           H
ATOM   3700 HD23 LEU B 125      70.245  42.833  64.670  1.00  0.00           H
ATOM   3701  C   LEU B 125      72.566  38.691  65.353  1.00  0.00           C
ATOM   3702  O   LEU B 125      72.103  38.245  64.301  1.00  0.00           O
ATOM   3703  N   ILE B 126      72.360  38.125  66.544  1.00  0.00           N
ATOM   3704  H   ILE B 126      72.655  38.543  67.414  1.00  0.00           H
ATOM   3705  CA  ILE B 126      71.914  36.755  66.731  1.00  0.00           C
ATOM   3706  HA  ILE B 126      71.487  36.430  65.782  1.00  0.00           H
ATOM   3707  CB  ILE B 126      73.064  35.788  67.059  1.00  0.00           C
ATOM   3708  HB  ILE B 126      73.571  36.183  67.939  1.00  0.00           H
ATOM   3709  CG2 ILE B 126      72.424  34.433  67.393  1.00  0.00           C
ATOM   3710 HG21 ILE B 126      71.770  34.395  68.264  1.00  0.00           H
ATOM   3711 HG22 ILE B 126      72.062  33.977  66.471  1.00  0.00           H
ATOM   3712 HG23 ILE B 126      73.191  33.748  67.755  1.00  0.00           H
ATOM   3713  CG1 ILE B 126      74.088  35.732  65.858  1.00  0.00           C
ATOM   3714 HG12 ILE B 126      73.658  35.887  64.869  1.00  0.00           H
ATOM   3715 HG13 ILE B 126      74.760  36.589  65.822  1.00  0.00           H
ATOM   3716  CD1 ILE B 126      75.020  34.443  65.908  1.00  0.00           C
ATOM   3717 HD11 ILE B 126      75.847  34.497  65.199  1.00  0.00           H
ATOM   3718 HD12 ILE B 126      75.263  34.235  66.950  1.00  0.00           H
ATOM   3719 HD13 ILE B 126      74.439  33.627  65.479  1.00  0.00           H
ATOM   3720  C   ILE B 126      70.756  36.718  67.758  1.00  0.00           C
ATOM   3721  O   ILE B 126      70.997  36.859  68.955  1.00  0.00           O
ATOM   3722  N   ILE B 127      69.523  36.344  67.413  1.00  0.00           N
ATOM   3723  H   ILE B 127      69.404  35.911  66.509  1.00  0.00           H
ATOM   3724  CA  ILE B 127      68.339  36.530  68.220  1.00  0.00           C
ATOM   3725  HA  ILE B 127      68.628  36.879  69.212  1.00  0.00           H
ATOM   3726  CB  ILE B 127      67.514  37.634  67.572  1.00  0.00           C
ATOM   3727  HB  ILE B 127      67.102  37.268  66.632  1.00  0.00           H
ATOM   3728  CG2 ILE B 127      66.298  38.092  68.381  1.00  0.00           C
ATOM   3729 HG21 ILE B 127      66.644  38.758  69.172  1.00  0.00           H
ATOM   3730 HG22 ILE B 127      65.614  38.580  67.687  1.00  0.00           H
ATOM   3731 HG23 ILE B 127      65.749  37.264  68.829  1.00  0.00           H
ATOM   3732  CG1 ILE B 127      68.333  38.899  67.113  1.00  0.00           C
ATOM   3733 HG12 ILE B 127      68.851  39.420  67.918  1.00  0.00           H
ATOM   3734 HG13 ILE B 127      69.039  38.497  66.386  1.00  0.00           H
ATOM   3735  CD1 ILE B 127      67.545  39.948  66.303  1.00  0.00           C
ATOM   3736 HD11 ILE B 127      66.816  39.621  65.562  1.00  0.00           H
ATOM   3737 HD12 ILE B 127      66.953  40.579  66.966  1.00  0.00           H
ATOM   3738 HD13 ILE B 127      68.239  40.573  65.741  1.00  0.00           H
ATOM   3739  C   ILE B 127      67.583  35.165  68.407  1.00  0.00           C
ATOM   3740  O   ILE B 127      67.610  34.310  67.521  1.00  0.00           O
ATOM   3741  N   SER B 128      66.902  34.960  69.541  1.00  0.00           N
ATOM   3742  H   SER B 128      66.967  35.661  70.265  1.00  0.00           H
ATOM   3743  CA  SER B 128      65.990  33.758  69.784  1.00  0.00           C
ATOM   3744  HA  SER B 128      65.829  33.282  68.817  1.00  0.00           H
ATOM   3745  CB  SER B 128      66.689  32.653  70.544  1.00  0.00           C
ATOM   3746  HB2 SER B 128      67.427  32.154  69.916  1.00  0.00           H
ATOM   3747  HB3 SER B 128      67.191  33.059  71.422  1.00  0.00           H
ATOM   3748  OG  SER B 128      65.693  31.770  70.963  1.00  0.00           O
ATOM   3749  HG  SER B 128      65.713  31.575  71.903  1.00  0.00           H
ATOM   3750  C   SER B 128      64.624  34.021  70.420  1.00  0.00           C
ATOM   3751  O   SER B 128      64.664  34.491  71.524  1.00  0.00           O
ATOM   3752  N   ASP B 129      63.501  33.613  69.841  1.00  0.00           N
ATOM   3753  H   ASP B 129      63.549  33.360  68.864  1.00  0.00           H
ATOM   3754  CA  ASP B 129      62.111  33.622  70.419  1.00  0.00           C
ATOM   3755  HA  ASP B 129      62.164  34.373  71.207  1.00  0.00           H
ATOM   3756  CB  ASP B 129      61.012  33.972  69.338  1.00  0.00           C
ATOM   3757  HB2 ASP B 129      61.434  34.660  68.606  1.00  0.00           H
ATOM   3758  HB3 ASP B 129      60.633  33.076  68.845  1.00  0.00           H
ATOM   3759  CG  ASP B 129      59.802  34.616  70.007  1.00  0.00           C
ATOM   3760  OD1 ASP B 129      59.932  35.066  71.207  1.00  0.00           O
ATOM   3761  OD2 ASP B 129      58.759  34.668  69.382  1.00  0.00           O
ATOM   3762  C   ASP B 129      61.799  32.288  71.219  1.00  0.00           C
ATOM   3763  O   ASP B 129      60.639  31.997  71.617  1.00  0.00           O
ATOM   3764  N   MET B 130      62.801  31.462  71.460  1.00  0.00           N
ATOM   3765  H   MET B 130      63.707  31.789  71.156  1.00  0.00           H
ATOM   3766  CA  MET B 130      62.682  30.035  71.924  1.00  0.00           C
ATOM   3767  HA  MET B 130      61.962  29.559  71.258  1.00  0.00           H
ATOM   3768  CB  MET B 130      63.948  29.145  71.580  1.00  0.00           C
ATOM   3769  HB2 MET B 130      64.845  29.582  72.017  1.00  0.00           H
ATOM   3770  HB3 MET B 130      63.881  28.176  72.075  1.00  0.00           H
ATOM   3771  CG  MET B 130      64.079  28.709  70.084  1.00  0.00           C
ATOM   3772  HG2 MET B 130      63.253  28.036  69.850  1.00  0.00           H
ATOM   3773  HG3 MET B 130      64.124  29.587  69.440  1.00  0.00           H
ATOM   3774  SD  MET B 130      65.562  27.761  69.527  1.00  0.00           S
ATOM   3775  CE  MET B 130      66.893  28.784  70.162  1.00  0.00           C
ATOM   3776  HE1 MET B 130      67.833  28.252  70.013  1.00  0.00           H
ATOM   3777  HE2 MET B 130      67.000  29.788  69.753  1.00  0.00           H
ATOM   3778  HE3 MET B 130      66.884  28.889  71.247  1.00  0.00           H
ATOM   3779  C   MET B 130      62.251  29.951  73.414  1.00  0.00           C
ATOM   3780  O   MET B 130      62.548  30.803  74.188  1.00  0.00           O
ATOM   3781  N   TYR B 131      61.480  28.940  73.801  1.00  0.00           N
ATOM   3782  H   TYR B 131      61.253  28.340  73.021  1.00  0.00           H
ATOM   3783  CA  TYR B 131      60.891  28.567  75.064  1.00  0.00           C
ATOM   3784  HA  TYR B 131      61.449  29.030  75.878  1.00  0.00           H
ATOM   3785  CB  TYR B 131      59.453  29.088  75.170  1.00  0.00           C
ATOM   3786  HB2 TYR B 131      59.415  30.156  74.957  1.00  0.00           H
ATOM   3787  HB3 TYR B 131      58.879  28.580  74.395  1.00  0.00           H
ATOM   3788  CG  TYR B 131      58.774  28.827  76.522  1.00  0.00           C
ATOM   3789  CD1 TYR B 131      59.316  29.348  77.701  1.00  0.00           C
ATOM   3790  HD1 TYR B 131      60.209  29.954  77.665  1.00  0.00           H
ATOM   3791  CE1 TYR B 131      58.792  28.964  78.941  1.00  0.00           C
ATOM   3792  HE1 TYR B 131      59.166  29.340  79.881  1.00  0.00           H
ATOM   3793  CZ  TYR B 131      57.650  28.151  78.930  1.00  0.00           C
ATOM   3794  OH  TYR B 131      56.982  27.951  80.136  1.00  0.00           O
ATOM   3795  HH  TYR B 131      56.083  27.639  80.013  1.00  0.00           H
ATOM   3796  CE2 TYR B 131      56.985  27.758  77.760  1.00  0.00           C
ATOM   3797  HE2 TYR B 131      56.044  27.230  77.804  1.00  0.00           H
ATOM   3798  CD2 TYR B 131      57.601  27.997  76.557  1.00  0.00           C
ATOM   3799  HD2 TYR B 131      57.261  27.533  75.644  1.00  0.00           H
ATOM   3800  C   TYR B 131      61.003  26.981  75.188  1.00  0.00           C
ATOM   3801  O   TYR B 131      60.746  26.209  74.245  1.00  0.00           O
ATOM   3802  N   ASP B 132      61.405  26.574  76.402  1.00  0.00           N
ATOM   3803  H   ASP B 132      61.621  27.233  77.136  1.00  0.00           H
ATOM   3804  CA  ASP B 132      61.726  25.157  76.586  1.00  0.00           C
ATOM   3805  HA  ASP B 132      62.522  24.882  75.894  1.00  0.00           H
ATOM   3806  CB  ASP B 132      62.446  25.004  77.934  1.00  0.00           C
ATOM   3807  HB2 ASP B 132      63.395  25.524  77.801  1.00  0.00           H
ATOM   3808  HB3 ASP B 132      61.880  25.577  78.669  1.00  0.00           H
ATOM   3809  CG  ASP B 132      62.653  23.451  78.270  1.00  0.00           C
ATOM   3810  OD1 ASP B 132      62.211  23.011  79.326  1.00  0.00           O
ATOM   3811  OD2 ASP B 132      63.140  22.670  77.434  1.00  0.00           O
ATOM   3812  C   ASP B 132      60.522  24.215  76.465  1.00  0.00           C
ATOM   3813  O   ASP B 132      59.591  24.345  77.257  1.00  0.00           O
ATOM   3814  N   PRO B 133      60.503  23.207  75.571  1.00  0.00           N
ATOM   3815  CD  PRO B 133      61.523  23.012  74.502  1.00  0.00           C
ATOM   3816  HD2 PRO B 133      62.345  22.461  74.961  1.00  0.00           H
ATOM   3817  HD3 PRO B 133      61.872  23.968  74.112  1.00  0.00           H
ATOM   3818  CG  PRO B 133      60.832  22.205  73.411  1.00  0.00           C
ATOM   3819  HG2 PRO B 133      61.473  21.600  72.770  1.00  0.00           H
ATOM   3820  HG3 PRO B 133      60.362  22.924  72.741  1.00  0.00           H
ATOM   3821  CB  PRO B 133      59.796  21.359  74.144  1.00  0.00           C
ATOM   3822  HB2 PRO B 133      60.269  20.488  74.598  1.00  0.00           H
ATOM   3823  HB3 PRO B 133      58.960  21.003  73.541  1.00  0.00           H
ATOM   3824  CA  PRO B 133      59.352  22.291  75.311  1.00  0.00           C
ATOM   3825  HA  PRO B 133      58.447  22.788  74.962  1.00  0.00           H
ATOM   3826  C   PRO B 133      58.985  21.501  76.566  1.00  0.00           C
ATOM   3827  O   PRO B 133      57.787  21.188  76.697  1.00  0.00           O
ATOM   3828  N   LYS B 134      59.977  21.114  77.419  1.00  0.00           N
ATOM   3829  H   LYS B 134      60.925  21.449  77.333  1.00  0.00           H
ATOM   3830  CA  LYS B 134      59.667  20.279  78.587  1.00  0.00           C
ATOM   3831  HA  LYS B 134      59.205  19.350  78.255  1.00  0.00           H
ATOM   3832  CB  LYS B 134      60.980  19.749  79.108  1.00  0.00           C
ATOM   3833  HB2 LYS B 134      61.683  20.561  79.292  1.00  0.00           H
ATOM   3834  HB3 LYS B 134      60.816  19.244  80.060  1.00  0.00           H
ATOM   3835  CG  LYS B 134      61.683  18.830  78.081  1.00  0.00           C
ATOM   3836  HG2 LYS B 134      60.930  18.237  77.561  1.00  0.00           H
ATOM   3837  HG3 LYS B 134      62.189  19.447  77.339  1.00  0.00           H
ATOM   3838  CD  LYS B 134      62.576  17.835  78.771  1.00  0.00           C
ATOM   3839  HD2 LYS B 134      63.549  18.253  79.027  1.00  0.00           H
ATOM   3840  HD3 LYS B 134      62.078  17.323  79.594  1.00  0.00           H
ATOM   3841  CE  LYS B 134      62.886  16.687  77.802  1.00  0.00           C
ATOM   3842  HE2 LYS B 134      61.931  16.189  77.635  1.00  0.00           H
ATOM   3843  HE3 LYS B 134      63.241  17.091  76.854  1.00  0.00           H
ATOM   3844  NZ  LYS B 134      63.815  15.647  78.300  1.00  0.00           N
ATOM   3845  HZ1 LYS B 134      63.885  14.861  77.670  1.00  0.00           H
ATOM   3846  HZ2 LYS B 134      64.784  15.908  78.188  1.00  0.00           H
ATOM   3847  HZ3 LYS B 134      63.482  15.377  79.215  1.00  0.00           H
ATOM   3848  C   LYS B 134      58.992  21.107  79.606  1.00  0.00           C
ATOM   3849  O   LYS B 134      57.931  20.647  80.087  1.00  0.00           O
ATOM   3850  N   THR B 135      59.481  22.298  79.878  1.00  0.00           N
ATOM   3851  H   THR B 135      60.362  22.571  79.467  1.00  0.00           H
ATOM   3852  CA  THR B 135      58.795  23.331  80.671  1.00  0.00           C
ATOM   3853  HA  THR B 135      58.704  22.956  81.690  1.00  0.00           H
ATOM   3854  CB  THR B 135      59.711  24.541  80.788  1.00  0.00           C
ATOM   3855  HB  THR B 135      59.979  24.948  79.813  1.00  0.00           H
ATOM   3856  CG2 THR B 135      59.092  25.658  81.628  1.00  0.00           C
ATOM   3857 HG21 THR B 135      59.739  26.536  81.643  1.00  0.00           H
ATOM   3858 HG22 THR B 135      58.238  26.086  81.103  1.00  0.00           H
ATOM   3859 HG23 THR B 135      58.777  25.364  82.629  1.00  0.00           H
ATOM   3860  OG1 THR B 135      60.900  24.149  81.444  1.00  0.00           O
ATOM   3861  HG1 THR B 135      61.366  23.594  80.814  1.00  0.00           H
ATOM   3862  C   THR B 135      57.432  23.821  80.184  1.00  0.00           C
ATOM   3863  O   THR B 135      56.554  24.070  81.027  1.00  0.00           O
ATOM   3864  N   LYS B 136      57.197  24.074  78.841  1.00  0.00           N
ATOM   3865  H   LYS B 136      58.031  23.990  78.278  1.00  0.00           H
ATOM   3866  CA  LYS B 136      55.845  24.288  78.225  1.00  0.00           C
ATOM   3867  HA  LYS B 136      55.495  25.221  78.666  1.00  0.00           H
ATOM   3868  CB  LYS B 136      56.075  24.431  76.657  1.00  0.00           C
ATOM   3869  HB2 LYS B 136      56.857  25.178  76.524  1.00  0.00           H
ATOM   3870  HB3 LYS B 136      56.379  23.541  76.106  1.00  0.00           H
ATOM   3871  CG  LYS B 136      54.761  24.948  75.982  1.00  0.00           C
ATOM   3872  HG2 LYS B 136      53.903  24.308  76.186  1.00  0.00           H
ATOM   3873  HG3 LYS B 136      54.562  25.900  76.474  1.00  0.00           H
ATOM   3874  CD  LYS B 136      54.790  25.144  74.492  1.00  0.00           C
ATOM   3875  HD2 LYS B 136      55.742  25.652  74.342  1.00  0.00           H
ATOM   3876  HD3 LYS B 136      54.771  24.160  74.024  1.00  0.00           H
ATOM   3877  CE  LYS B 136      53.505  25.706  74.042  1.00  0.00           C
ATOM   3878  HE2 LYS B 136      52.653  25.045  74.205  1.00  0.00           H
ATOM   3879  HE3 LYS B 136      53.263  26.577  74.652  1.00  0.00           H
ATOM   3880  NZ  LYS B 136      53.463  26.213  72.618  1.00  0.00           N
ATOM   3881  HZ1 LYS B 136      52.532  26.415  72.283  1.00  0.00           H
ATOM   3882  HZ2 LYS B 136      54.077  26.962  72.333  1.00  0.00           H
ATOM   3883  HZ3 LYS B 136      53.778  25.465  72.017  1.00  0.00           H
ATOM   3884  C   LYS B 136      54.844  23.169  78.488  1.00  0.00           C
ATOM   3885  O   LYS B 136      53.714  23.315  78.912  1.00  0.00           O
ATOM   3886  N   ASN B 137      55.264  21.941  78.268  1.00  0.00           N
ATOM   3887  H   ASN B 137      56.150  21.811  77.800  1.00  0.00           H
ATOM   3888  CA  ASN B 137      54.408  20.759  78.519  1.00  0.00           C
ATOM   3889  HA  ASN B 137      53.430  20.962  78.082  1.00  0.00           H
ATOM   3890  CB  ASN B 137      54.970  19.483  77.920  1.00  0.00           C
ATOM   3891  HB2 ASN B 137      55.191  19.632  76.863  1.00  0.00           H
ATOM   3892  HB3 ASN B 137      55.879  19.170  78.432  1.00  0.00           H
ATOM   3893  CG  ASN B 137      54.042  18.323  78.018  1.00  0.00           C
ATOM   3894  OD1 ASN B 137      52.963  18.417  78.568  1.00  0.00           O
ATOM   3895  ND2 ASN B 137      54.547  17.214  77.557  1.00  0.00           N
ATOM   3896 HD21 ASN B 137      54.146  16.305  77.740  1.00  0.00           H
ATOM   3897 HD22 ASN B 137      55.508  17.277  77.251  1.00  0.00           H
ATOM   3898  C   ASN B 137      54.068  20.725  80.047  1.00  0.00           C
ATOM   3899  O   ASN B 137      52.851  20.638  80.463  1.00  0.00           O
ATOM   3900  N   VAL B 138      55.068  20.782  80.915  1.00  0.00           N
ATOM   3901  H   VAL B 138      56.014  20.829  80.563  1.00  0.00           H
ATOM   3902  CA  VAL B 138      54.985  20.807  82.417  1.00  0.00           C
ATOM   3903  HA  VAL B 138      53.994  21.111  82.753  1.00  0.00           H
ATOM   3904  CB  VAL B 138      55.018  19.399  83.028  1.00  0.00           C
ATOM   3905  HB  VAL B 138      56.051  19.049  83.026  1.00  0.00           H
ATOM   3906  CG1 VAL B 138      54.537  19.448  84.539  1.00  0.00           C
ATOM   3907 HG11 VAL B 138      55.238  19.977  85.185  1.00  0.00           H
ATOM   3908 HG12 VAL B 138      53.521  19.830  84.633  1.00  0.00           H
ATOM   3909 HG13 VAL B 138      54.528  18.421  84.905  1.00  0.00           H
ATOM   3910  CG2 VAL B 138      54.087  18.336  82.387  1.00  0.00           C
ATOM   3911 HG21 VAL B 138      54.057  18.405  81.300  1.00  0.00           H
ATOM   3912 HG22 VAL B 138      54.369  17.351  82.760  1.00  0.00           H
ATOM   3913 HG23 VAL B 138      53.101  18.662  82.717  1.00  0.00           H
ATOM   3914  C   VAL B 138      56.054  21.648  83.075  1.00  0.00           C
ATOM   3915  O   VAL B 138      57.203  21.268  82.924  1.00  0.00           O
ATOM   3916  N   THR B 139      55.639  22.683  83.813  1.00  0.00           N
ATOM   3917  H   THR B 139      54.740  23.117  83.664  1.00  0.00           H
ATOM   3918  CA  THR B 139      56.612  23.488  84.472  1.00  0.00           C
ATOM   3919  HA  THR B 139      57.588  23.439  83.988  1.00  0.00           H
ATOM   3920  CB  THR B 139      56.209  24.946  84.736  1.00  0.00           C
ATOM   3921  HB  THR B 139      55.176  25.024  85.077  1.00  0.00           H
ATOM   3922  CG2 THR B 139      57.055  25.615  85.836  1.00  0.00           C
ATOM   3923 HG21 THR B 139      56.986  25.071  86.778  1.00  0.00           H
ATOM   3924 HG22 THR B 139      58.088  25.535  85.498  1.00  0.00           H
ATOM   3925 HG23 THR B 139      56.782  26.649  86.050  1.00  0.00           H
ATOM   3926  OG1 THR B 139      56.430  25.609  83.514  1.00  0.00           O
ATOM   3927  HG1 THR B 139      56.252  24.982  82.809  1.00  0.00           H
ATOM   3928  C   THR B 139      56.896  22.735  85.812  1.00  0.00           C
ATOM   3929  O   THR B 139      55.985  22.209  86.491  1.00  0.00           O
ATOM   3930  N   LYS B 140      58.166  22.657  86.211  1.00  0.00           N
ATOM   3931  H   LYS B 140      58.862  23.081  85.613  1.00  0.00           H
ATOM   3932  CA  LYS B 140      58.665  21.897  87.409  1.00  0.00           C
ATOM   3933  HA  LYS B 140      57.836  21.451  87.958  1.00  0.00           H
ATOM   3934  CB  LYS B 140      59.426  20.684  86.893  1.00  0.00           C
ATOM   3935  HB2 LYS B 140      60.226  21.086  86.271  1.00  0.00           H
ATOM   3936  HB3 LYS B 140      59.946  20.208  87.724  1.00  0.00           H
ATOM   3937  CG  LYS B 140      58.571  19.645  86.159  1.00  0.00           C
ATOM   3938  HG2 LYS B 140      57.691  19.382  86.746  1.00  0.00           H
ATOM   3939  HG3 LYS B 140      58.154  20.037  85.231  1.00  0.00           H
ATOM   3940  CD  LYS B 140      59.311  18.326  85.778  1.00  0.00           C
ATOM   3941  HD2 LYS B 140      60.288  18.641  85.414  1.00  0.00           H
ATOM   3942  HD3 LYS B 140      59.306  17.800  86.733  1.00  0.00           H
ATOM   3943  CE  LYS B 140      58.598  17.568  84.676  1.00  0.00           C
ATOM   3944  HE2 LYS B 140      57.626  17.328  85.109  1.00  0.00           H
ATOM   3945  HE3 LYS B 140      58.494  18.225  83.812  1.00  0.00           H
ATOM   3946  NZ  LYS B 140      59.266  16.231  84.326  1.00  0.00           N
ATOM   3947  HZ1 LYS B 140      59.018  15.759  83.468  1.00  0.00           H
ATOM   3948  HZ2 LYS B 140      60.268  16.217  84.200  1.00  0.00           H
ATOM   3949  HZ3 LYS B 140      59.122  15.652  85.141  1.00  0.00           H
ATOM   3950  C   LYS B 140      59.405  22.717  88.419  1.00  0.00           C
ATOM   3951  O   LYS B 140      59.687  23.830  88.037  1.00  0.00           O
ATOM   3952  N   GLU B 141      59.834  22.214  89.634  1.00  0.00           N
ATOM   3953  H   GLU B 141      59.445  21.327  89.920  1.00  0.00           H
ATOM   3954  CA  GLU B 141      60.750  22.934  90.497  1.00  0.00           C
ATOM   3955  HA  GLU B 141      60.448  23.977  90.598  1.00  0.00           H
ATOM   3956  CB  GLU B 141      60.929  22.289  91.896  1.00  0.00           C
ATOM   3957  HB2 GLU B 141      60.009  22.464  92.453  1.00  0.00           H
ATOM   3958  HB3 GLU B 141      61.148  21.221  91.888  1.00  0.00           H
ATOM   3959  CG  GLU B 141      62.061  22.868  92.806  1.00  0.00           C
ATOM   3960  HG2 GLU B 141      61.939  22.256  93.699  1.00  0.00           H
ATOM   3961  HG3 GLU B 141      63.037  22.658  92.369  1.00  0.00           H
ATOM   3962  CD  GLU B 141      61.848  24.332  93.154  1.00  0.00           C
ATOM   3963  OE1 GLU B 141      61.842  25.162  92.232  1.00  0.00           O
ATOM   3964  OE2 GLU B 141      61.744  24.613  94.382  1.00  0.00           O
ATOM   3965  C   GLU B 141      62.089  23.042  89.678  1.00  0.00           C
ATOM   3966  O   GLU B 141      62.408  22.156  88.895  1.00  0.00           O
ATOM   3967  N   ASN B 142      62.652  24.231  89.832  1.00  0.00           N
ATOM   3968  H   ASN B 142      62.430  24.796  90.639  1.00  0.00           H
ATOM   3969  CA  ASN B 142      63.549  24.849  88.876  1.00  0.00           C
ATOM   3970  HA  ASN B 142      63.111  24.681  87.892  1.00  0.00           H
ATOM   3971  CB  ASN B 142      63.593  26.414  89.069  1.00  0.00           C
ATOM   3972  HB2 ASN B 142      62.688  26.838  89.505  1.00  0.00           H
ATOM   3973  HB3 ASN B 142      64.302  26.676  89.853  1.00  0.00           H
ATOM   3974  CG  ASN B 142      64.046  27.292  87.861  1.00  0.00           C
ATOM   3975  OD1 ASN B 142      64.463  26.787  86.820  1.00  0.00           O
ATOM   3976  ND2 ASN B 142      64.179  28.536  88.049  1.00  0.00           N
ATOM   3977 HD21 ASN B 142      64.469  29.038  87.222  1.00  0.00           H
ATOM   3978 HD22 ASN B 142      63.644  28.844  88.848  1.00  0.00           H
ATOM   3979  C   ASN B 142      64.994  24.307  88.788  1.00  0.00           C
ATOM   3980  O   ASN B 142      65.591  23.823  89.786  1.00  0.00           O
ATOM   3981  N   ASP B 143      65.614  24.389  87.636  1.00  0.00           N
ATOM   3982  H   ASP B 143      65.024  24.540  86.830  1.00  0.00           H
ATOM   3983  CA  ASP B 143      66.982  24.120  87.334  1.00  0.00           C
ATOM   3984  HA  ASP B 143      67.658  24.596  88.044  1.00  0.00           H
ATOM   3985  CB  ASP B 143      67.215  22.562  87.269  1.00  0.00           C
ATOM   3986  HB2 ASP B 143      68.185  22.413  86.793  1.00  0.00           H
ATOM   3987  HB3 ASP B 143      67.336  22.192  88.287  1.00  0.00           H
ATOM   3988  CG  ASP B 143      66.180  21.645  86.639  1.00  0.00           C
ATOM   3989  OD1 ASP B 143      66.151  20.464  87.001  1.00  0.00           O
ATOM   3990  OD2 ASP B 143      65.461  22.109  85.703  1.00  0.00           O
ATOM   3991  C   ASP B 143      67.353  24.576  85.929  1.00  0.00           C
ATOM   3992  O   ASP B 143      66.468  24.724  85.068  1.00  0.00           O
ATOM   3993  N   SER B 144      68.622  24.626  85.597  1.00  0.00           N
ATOM   3994  H   SER B 144      69.339  24.662  86.308  1.00  0.00           H
ATOM   3995  CA  SER B 144      69.234  24.775  84.245  1.00  0.00           C
ATOM   3996  HA  SER B 144      68.830  25.667  83.767  1.00  0.00           H
ATOM   3997  CB  SER B 144      70.719  24.967  84.286  1.00  0.00           C
ATOM   3998  HB2 SER B 144      70.968  25.887  84.814  1.00  0.00           H
ATOM   3999  HB3 SER B 144      71.200  24.095  84.729  1.00  0.00           H
ATOM   4000  OG  SER B 144      71.222  25.072  82.945  1.00  0.00           O
ATOM   4001  HG  SER B 144      72.115  24.742  83.069  1.00  0.00           H
ATOM   4002  C   SER B 144      68.764  23.774  83.200  1.00  0.00           C
ATOM   4003  O   SER B 144      69.054  22.607  83.292  1.00  0.00           O
ATOM   4004  N   LYS B 145      68.060  24.318  82.177  1.00  0.00           N
ATOM   4005  H   LYS B 145      68.095  25.324  82.089  1.00  0.00           H
ATOM   4006  CA  LYS B 145      67.574  23.568  80.977  1.00  0.00           C
ATOM   4007  HA  LYS B 145      67.289  22.544  81.219  1.00  0.00           H
ATOM   4008  CB  LYS B 145      66.262  24.147  80.463  1.00  0.00           C
ATOM   4009  HB2 LYS B 145      66.446  25.112  79.991  1.00  0.00           H
ATOM   4010  HB3 LYS B 145      65.848  23.456  79.729  1.00  0.00           H
ATOM   4011  CG  LYS B 145      65.100  24.353  81.520  1.00  0.00           C
ATOM   4012  HG2 LYS B 145      65.537  25.029  82.255  1.00  0.00           H
ATOM   4013  HG3 LYS B 145      64.252  24.811  81.012  1.00  0.00           H
ATOM   4014  CD  LYS B 145      64.675  23.074  82.249  1.00  0.00           C
ATOM   4015  HD2 LYS B 145      64.328  22.359  81.503  1.00  0.00           H
ATOM   4016  HD3 LYS B 145      65.500  22.606  82.785  1.00  0.00           H
ATOM   4017  CE  LYS B 145      63.511  23.422  83.098  1.00  0.00           C
ATOM   4018  HE2 LYS B 145      63.009  24.277  82.645  1.00  0.00           H
ATOM   4019  HE3 LYS B 145      62.742  22.650  83.067  1.00  0.00           H
ATOM   4020  NZ  LYS B 145      63.839  23.849  84.466  1.00  0.00           N
ATOM   4021  HZ1 LYS B 145      63.058  23.919  85.103  1.00  0.00           H
ATOM   4022  HZ2 LYS B 145      64.600  23.349  84.905  1.00  0.00           H
ATOM   4023  HZ3 LYS B 145      64.223  24.782  84.439  1.00  0.00           H
ATOM   4024  C   LYS B 145      68.608  23.527  79.815  1.00  0.00           C
ATOM   4025  O   LYS B 145      69.239  24.495  79.419  1.00  0.00           O
ATOM   4026  N   GLU B 146      68.757  22.333  79.262  1.00  0.00           N
ATOM   4027  H   GLU B 146      68.432  21.486  79.706  1.00  0.00           H
ATOM   4028  CA  GLU B 146      69.518  22.039  78.085  1.00  0.00           C
ATOM   4029  HA  GLU B 146      70.198  22.840  77.793  1.00  0.00           H
ATOM   4030  CB  GLU B 146      70.394  20.856  78.330  1.00  0.00           C
ATOM   4031  HB2 GLU B 146      69.719  20.107  78.744  1.00  0.00           H
ATOM   4032  HB3 GLU B 146      70.770  20.399  77.415  1.00  0.00           H
ATOM   4033  CG  GLU B 146      71.494  21.177  79.314  1.00  0.00           C
ATOM   4034  HG2 GLU B 146      71.350  22.178  79.721  1.00  0.00           H
ATOM   4035  HG3 GLU B 146      71.549  20.457  80.131  1.00  0.00           H
ATOM   4036  CD  GLU B 146      72.907  21.321  78.730  1.00  0.00           C
ATOM   4037  OE1 GLU B 146      73.339  22.413  78.304  1.00  0.00           O
ATOM   4038  OE2 GLU B 146      73.540  20.238  78.463  1.00  0.00           O
ATOM   4039  C   GLU B 146      68.589  21.772  76.858  1.00  0.00           C
ATOM   4040  O   GLU B 146      67.436  21.420  76.949  1.00  0.00           O
ATOM   4041  N   GLY B 147      69.164  21.901  75.603  1.00  0.00           N
ATOM   4042  H   GLY B 147      70.139  22.149  75.517  1.00  0.00           H
ATOM   4043  CA  GLY B 147      68.441  21.570  74.418  1.00  0.00           C
ATOM   4044  HA2 GLY B 147      68.753  20.610  74.007  1.00  0.00           H
ATOM   4045  HA3 GLY B 147      67.367  21.547  74.602  1.00  0.00           H
ATOM   4046  C   GLY B 147      68.844  22.507  73.294  1.00  0.00           C
ATOM   4047  O   GLY B 147      70.026  22.367  72.867  1.00  0.00           O
ATOM   4048  N   PHE B 148      68.052  23.514  72.881  1.00  0.00           N
ATOM   4049  H   PHE B 148      67.202  23.720  73.386  1.00  0.00           H
ATOM   4050  CA  PHE B 148      68.490  24.514  71.922  1.00  0.00           C
ATOM   4051  HA  PHE B 148      68.919  24.036  71.041  1.00  0.00           H
ATOM   4052  CB  PHE B 148      67.345  25.440  71.368  1.00  0.00           C
ATOM   4053  HB2 PHE B 148      67.800  26.159  70.687  1.00  0.00           H
ATOM   4054  HB3 PHE B 148      66.772  24.866  70.640  1.00  0.00           H
ATOM   4055  CG  PHE B 148      66.399  26.053  72.417  1.00  0.00           C
ATOM   4056  CD1 PHE B 148      66.862  27.173  73.185  1.00  0.00           C
ATOM   4057  HD1 PHE B 148      67.817  27.655  73.041  1.00  0.00           H
ATOM   4058  CE1 PHE B 148      65.974  27.677  74.156  1.00  0.00           C
ATOM   4059  HE1 PHE B 148      66.326  28.590  74.614  1.00  0.00           H
ATOM   4060  CZ  PHE B 148      64.712  27.148  74.326  1.00  0.00           C
ATOM   4061  HZ  PHE B 148      64.022  27.557  75.048  1.00  0.00           H
ATOM   4062  CE2 PHE B 148      64.284  26.025  73.723  1.00  0.00           C
ATOM   4063  HE2 PHE B 148      63.419  25.449  74.018  1.00  0.00           H
ATOM   4064  CD2 PHE B 148      65.199  25.442  72.780  1.00  0.00           C
ATOM   4065  HD2 PHE B 148      64.927  24.522  72.283  1.00  0.00           H
ATOM   4066  C   PHE B 148      69.597  25.371  72.585  1.00  0.00           C
ATOM   4067  O   PHE B 148      70.514  25.829  71.920  1.00  0.00           O
ATOM   4068  N   PHE B 149      69.658  25.471  73.951  1.00  0.00           N
ATOM   4069  H   PHE B 149      68.951  25.001  74.498  1.00  0.00           H
ATOM   4070  CA  PHE B 149      70.551  26.370  74.650  1.00  0.00           C
ATOM   4071  HA  PHE B 149      70.599  27.289  74.066  1.00  0.00           H
ATOM   4072  CB  PHE B 149      70.173  26.518  76.103  1.00  0.00           C
ATOM   4073  HB2 PHE B 149      69.811  25.534  76.403  1.00  0.00           H
ATOM   4074  HB3 PHE B 149      71.018  26.751  76.750  1.00  0.00           H
ATOM   4075  CG  PHE B 149      69.034  27.493  76.364  1.00  0.00           C
ATOM   4076  CD1 PHE B 149      69.087  28.846  75.978  1.00  0.00           C
ATOM   4077  HD1 PHE B 149      69.963  29.240  75.484  1.00  0.00           H
ATOM   4078  CE1 PHE B 149      68.068  29.744  76.458  1.00  0.00           C
ATOM   4079  HE1 PHE B 149      68.036  30.775  76.139  1.00  0.00           H
ATOM   4080  CZ  PHE B 149      66.959  29.291  77.158  1.00  0.00           C
ATOM   4081  HZ  PHE B 149      66.184  29.997  77.416  1.00  0.00           H
ATOM   4082  CE2 PHE B 149      66.907  27.933  77.517  1.00  0.00           C
ATOM   4083  HE2 PHE B 149      66.019  27.639  78.057  1.00  0.00           H
ATOM   4084  CD2 PHE B 149      67.970  27.042  77.170  1.00  0.00           C
ATOM   4085  HD2 PHE B 149      67.894  25.982  77.363  1.00  0.00           H
ATOM   4086  C   PHE B 149      71.987  25.766  74.498  1.00  0.00           C
ATOM   4087  O   PHE B 149      72.929  26.526  74.199  1.00  0.00           O
ATOM   4088  N   THR B 150      72.103  24.430  74.493  1.00  0.00           N
ATOM   4089  H   THR B 150      71.316  23.866  74.783  1.00  0.00           H
ATOM   4090  CA  THR B 150      73.342  23.790  74.197  1.00  0.00           C
ATOM   4091  HA  THR B 150      74.152  24.196  74.802  1.00  0.00           H
ATOM   4092  CB  THR B 150      73.106  22.298  74.488  1.00  0.00           C
ATOM   4093  HB  THR B 150      72.520  21.843  73.689  1.00  0.00           H
ATOM   4094  CG2 THR B 150      74.382  21.475  74.604  1.00  0.00           C
ATOM   4095 HG21 THR B 150      75.259  22.055  74.316  1.00  0.00           H
ATOM   4096 HG22 THR B 150      74.413  21.061  75.611  1.00  0.00           H
ATOM   4097 HG23 THR B 150      74.314  20.630  73.919  1.00  0.00           H
ATOM   4098  OG1 THR B 150      72.398  22.167  75.690  1.00  0.00           O
ATOM   4099  HG1 THR B 150      72.983  22.420  76.408  1.00  0.00           H
ATOM   4100  C   THR B 150      73.822  24.078  72.772  1.00  0.00           C
ATOM   4101  O   THR B 150      75.021  24.268  72.511  1.00  0.00           O
ATOM   4102  N   TYR B 151      72.953  23.979  71.769  1.00  0.00           N
ATOM   4103  H   TYR B 151      72.052  23.534  71.877  1.00  0.00           H
ATOM   4104  CA  TYR B 151      73.367  24.258  70.325  1.00  0.00           C
ATOM   4105  HA  TYR B 151      74.347  23.839  70.099  1.00  0.00           H
ATOM   4106  CB  TYR B 151      72.324  23.873  69.278  1.00  0.00           C
ATOM   4107  HB2 TYR B 151      72.135  22.806  69.396  1.00  0.00           H
ATOM   4108  HB3 TYR B 151      71.371  24.351  69.507  1.00  0.00           H
ATOM   4109  CG  TYR B 151      72.879  24.050  67.797  1.00  0.00           C
ATOM   4110  CD1 TYR B 151      73.657  23.037  67.252  1.00  0.00           C
ATOM   4111  HD1 TYR B 151      73.945  22.177  67.839  1.00  0.00           H
ATOM   4112  CE1 TYR B 151      74.256  23.290  66.021  1.00  0.00           C
ATOM   4113  HE1 TYR B 151      75.041  22.653  65.641  1.00  0.00           H
ATOM   4114  CZ  TYR B 151      73.860  24.375  65.212  1.00  0.00           C
ATOM   4115  OH  TYR B 151      74.375  24.547  63.974  1.00  0.00           O
ATOM   4116  HH  TYR B 151      73.690  24.576  63.302  1.00  0.00           H
ATOM   4117  CE2 TYR B 151      72.908  25.303  65.697  1.00  0.00           C
ATOM   4118  HE2 TYR B 151      72.632  26.171  65.117  1.00  0.00           H
ATOM   4119  CD2 TYR B 151      72.436  25.190  66.994  1.00  0.00           C
ATOM   4120  HD2 TYR B 151      71.713  25.890  67.385  1.00  0.00           H
ATOM   4121  C   TYR B 151      73.719  25.733  70.154  1.00  0.00           C
ATOM   4122  O   TYR B 151      74.680  26.112  69.551  1.00  0.00           O
ATOM   4123  N   ILE B 152      72.916  26.644  70.749  1.00  0.00           N
ATOM   4124  H   ILE B 152      72.075  26.324  71.208  1.00  0.00           H
ATOM   4125  CA  ILE B 152      73.100  28.096  70.465  1.00  0.00           C
ATOM   4126  HA  ILE B 152      73.357  28.129  69.406  1.00  0.00           H
ATOM   4127  CB  ILE B 152      71.809  28.881  70.729  1.00  0.00           C
ATOM   4128  HB  ILE B 152      70.950  28.214  70.658  1.00  0.00           H
ATOM   4129  CG2 ILE B 152      71.747  29.709  72.070  1.00  0.00           C
ATOM   4130 HG21 ILE B 152      72.448  30.543  72.109  1.00  0.00           H
ATOM   4131 HG22 ILE B 152      70.755  30.158  72.134  1.00  0.00           H
ATOM   4132 HG23 ILE B 152      71.928  29.095  72.952  1.00  0.00           H
ATOM   4133  CG1 ILE B 152      71.545  29.797  69.558  1.00  0.00           C
ATOM   4134 HG12 ILE B 152      72.044  30.736  69.796  1.00  0.00           H
ATOM   4135 HG13 ILE B 152      71.911  29.365  68.626  1.00  0.00           H
ATOM   4136  CD1 ILE B 152      70.067  30.141  69.344  1.00  0.00           C
ATOM   4137 HD11 ILE B 152      69.927  30.954  68.632  1.00  0.00           H
ATOM   4138 HD12 ILE B 152      69.544  29.259  68.974  1.00  0.00           H
ATOM   4139 HD13 ILE B 152      69.548  30.387  70.271  1.00  0.00           H
ATOM   4140  C   ILE B 152      74.311  28.627  71.340  1.00  0.00           C
ATOM   4141  O   ILE B 152      75.051  29.530  70.859  1.00  0.00           O
ATOM   4142  N   CYS B 153      74.684  28.086  72.478  1.00  0.00           N
ATOM   4143  H   CYS B 153      74.102  27.357  72.865  1.00  0.00           H
ATOM   4144  CA  CYS B 153      75.916  28.524  73.100  1.00  0.00           C
ATOM   4145  HA  CYS B 153      75.810  29.609  73.120  1.00  0.00           H
ATOM   4146  CB  CYS B 153      76.064  28.043  74.548  1.00  0.00           C
ATOM   4147  HB2 CYS B 153      75.897  26.978  74.709  1.00  0.00           H
ATOM   4148  HB3 CYS B 153      77.089  28.240  74.861  1.00  0.00           H
ATOM   4149  SG  CYS B 153      74.928  29.103  75.551  1.00  0.00           S
ATOM   4150  HG  CYS B 153      73.894  28.259  75.526  1.00  0.00           H
ATOM   4151  C   CYS B 153      77.171  28.049  72.277  1.00  0.00           C
ATOM   4152  O   CYS B 153      78.181  28.802  72.128  1.00  0.00           O
ATOM   4153  N   GLY B 154      77.043  26.885  71.622  1.00  0.00           N
ATOM   4154  H   GLY B 154      76.214  26.327  71.769  1.00  0.00           H
ATOM   4155  CA  GLY B 154      78.243  26.375  70.750  1.00  0.00           C
ATOM   4156  HA2 GLY B 154      79.213  26.400  71.248  1.00  0.00           H
ATOM   4157  HA3 GLY B 154      78.046  25.306  70.665  1.00  0.00           H
ATOM   4158  C   GLY B 154      78.347  26.828  69.318  1.00  0.00           C
ATOM   4159  O   GLY B 154      79.425  27.067  68.836  1.00  0.00           O
ATOM   4160  N   PHE B 155      77.159  27.280  68.824  1.00  0.00           N
ATOM   4161  H   PHE B 155      76.251  27.000  69.165  1.00  0.00           H
ATOM   4162  CA  PHE B 155      77.052  28.004  67.579  1.00  0.00           C
ATOM   4163  HA  PHE B 155      77.733  27.512  66.884  1.00  0.00           H
ATOM   4164  CB  PHE B 155      75.625  27.841  67.126  1.00  0.00           C
ATOM   4165  HB2 PHE B 155      75.480  26.762  67.084  1.00  0.00           H
ATOM   4166  HB3 PHE B 155      75.107  28.229  68.003  1.00  0.00           H
ATOM   4167  CG  PHE B 155      75.201  28.432  65.802  1.00  0.00           C
ATOM   4168  CD1 PHE B 155      74.639  29.734  65.824  1.00  0.00           C
ATOM   4169  HD1 PHE B 155      74.537  30.284  66.748  1.00  0.00           H
ATOM   4170  CE1 PHE B 155      74.093  30.323  64.699  1.00  0.00           C
ATOM   4171  HE1 PHE B 155      73.684  31.316  64.813  1.00  0.00           H
ATOM   4172  CZ  PHE B 155      74.143  29.653  63.466  1.00  0.00           C
ATOM   4173  HZ  PHE B 155      73.669  30.089  62.599  1.00  0.00           H
ATOM   4174  CE2 PHE B 155      74.740  28.397  63.369  1.00  0.00           C
ATOM   4175  HE2 PHE B 155      74.740  27.960  62.382  1.00  0.00           H
ATOM   4176  CD2 PHE B 155      75.303  27.764  64.506  1.00  0.00           C
ATOM   4177  HD2 PHE B 155      75.790  26.800  64.479  1.00  0.00           H
ATOM   4178  C   PHE B 155      77.565  29.411  67.622  1.00  0.00           C
ATOM   4179  O   PHE B 155      78.195  29.942  66.744  1.00  0.00           O
ATOM   4180  N   ILE B 156      77.215  30.168  68.708  1.00  0.00           N
ATOM   4181  H   ILE B 156      76.673  29.696  69.417  1.00  0.00           H
ATOM   4182  CA  ILE B 156      77.661  31.557  68.928  1.00  0.00           C
ATOM   4183  HA  ILE B 156      77.334  32.299  68.199  1.00  0.00           H
ATOM   4184  CB  ILE B 156      76.949  32.235  70.201  1.00  0.00           C
ATOM   4185  HB  ILE B 156      77.029  31.480  70.983  1.00  0.00           H
ATOM   4186  CG2 ILE B 156      77.716  33.489  70.702  1.00  0.00           C
ATOM   4187 HG21 ILE B 156      78.770  33.325  70.926  1.00  0.00           H
ATOM   4188 HG22 ILE B 156      77.583  34.219  69.903  1.00  0.00           H
ATOM   4189 HG23 ILE B 156      77.275  33.967  71.576  1.00  0.00           H
ATOM   4190  CG1 ILE B 156      75.406  32.493  70.089  1.00  0.00           C
ATOM   4191 HG12 ILE B 156      75.126  33.248  69.354  1.00  0.00           H
ATOM   4192 HG13 ILE B 156      74.871  31.635  69.681  1.00  0.00           H
ATOM   4193  CD1 ILE B 156      74.732  32.675  71.456  1.00  0.00           C
ATOM   4194 HD11 ILE B 156      74.631  31.694  71.920  1.00  0.00           H
ATOM   4195 HD12 ILE B 156      75.234  33.295  72.199  1.00  0.00           H
ATOM   4196 HD13 ILE B 156      73.737  33.060  71.233  1.00  0.00           H
ATOM   4197  C   ILE B 156      79.144  31.693  68.851  1.00  0.00           C
ATOM   4198  O   ILE B 156      79.667  32.506  68.073  1.00  0.00           O
ATOM   4199  N   GLN B 157      79.899  30.900  69.689  1.00  0.00           N
ATOM   4200  H   GLN B 157      79.336  30.272  70.244  1.00  0.00           H
ATOM   4201  CA  GLN B 157      81.368  30.880  69.856  1.00  0.00           C
ATOM   4202  HA  GLN B 157      81.607  31.944  69.875  1.00  0.00           H
ATOM   4203  CB  GLN B 157      81.784  30.391  71.274  1.00  0.00           C
ATOM   4204  HB2 GLN B 157      82.813  30.681  71.482  1.00  0.00           H
ATOM   4205  HB3 GLN B 157      81.048  30.665  72.030  1.00  0.00           H
ATOM   4206  CG  GLN B 157      81.835  28.850  71.395  1.00  0.00           C
ATOM   4207  HG2 GLN B 157      81.042  28.334  70.854  1.00  0.00           H
ATOM   4208  HG3 GLN B 157      82.656  28.364  70.867  1.00  0.00           H
ATOM   4209  CD  GLN B 157      81.761  28.281  72.786  1.00  0.00           C
ATOM   4210  OE1 GLN B 157      82.727  27.836  73.312  1.00  0.00           O
ATOM   4211  NE2 GLN B 157      80.644  28.215  73.461  1.00  0.00           N
ATOM   4212 HE21 GLN B 157      80.806  27.853  74.390  1.00  0.00           H
ATOM   4213 HE22 GLN B 157      79.792  28.571  73.052  1.00  0.00           H
ATOM   4214  C   GLN B 157      82.086  30.336  68.617  1.00  0.00           C
ATOM   4215  O   GLN B 157      83.280  30.040  68.627  1.00  0.00           O
ATOM   4216  N   GLN B 158      81.387  30.315  67.445  1.00  0.00           N
ATOM   4217  H   GLN B 158      80.409  30.555  67.525  1.00  0.00           H
ATOM   4218  CA  GLN B 158      81.934  29.949  66.118  1.00  0.00           C
ATOM   4219  HA  GLN B 158      83.018  30.053  66.091  1.00  0.00           H
ATOM   4220  CB  GLN B 158      81.536  28.478  65.916  1.00  0.00           C
ATOM   4221  HB2 GLN B 158      80.486  28.350  66.178  1.00  0.00           H
ATOM   4222  HB3 GLN B 158      81.617  28.311  64.842  1.00  0.00           H
ATOM   4223  CG  GLN B 158      82.444  27.421  66.649  1.00  0.00           C
ATOM   4224  HG2 GLN B 158      83.480  27.752  66.717  1.00  0.00           H
ATOM   4225  HG3 GLN B 158      82.054  27.164  67.634  1.00  0.00           H
ATOM   4226  CD  GLN B 158      82.452  26.189  65.763  1.00  0.00           C
ATOM   4227  OE1 GLN B 158      81.446  25.715  65.254  1.00  0.00           O
ATOM   4228  NE2 GLN B 158      83.515  25.492  65.676  1.00  0.00           N
ATOM   4229 HE21 GLN B 158      83.391  24.570  65.284  1.00  0.00           H
ATOM   4230 HE22 GLN B 158      84.270  25.652  66.328  1.00  0.00           H
ATOM   4231  C   GLN B 158      81.279  30.814  64.987  1.00  0.00           C
ATOM   4232  O   GLN B 158      81.894  30.838  63.909  1.00  0.00           O
ATOM   4233  N   LYS B 159      80.178  31.558  65.187  1.00  0.00           N
ATOM   4234  H   LYS B 159      79.680  31.379  66.048  1.00  0.00           H
ATOM   4235  CA  LYS B 159      79.390  32.138  64.001  1.00  0.00           C
ATOM   4236  HA  LYS B 159      79.975  32.234  63.087  1.00  0.00           H
ATOM   4237  CB  LYS B 159      78.278  31.218  63.596  1.00  0.00           C
ATOM   4238  HB2 LYS B 159      77.636  31.040  64.459  1.00  0.00           H
ATOM   4239  HB3 LYS B 159      77.763  31.740  62.789  1.00  0.00           H
ATOM   4240  CG  LYS B 159      78.740  29.814  63.119  1.00  0.00           C
ATOM   4241  HG2 LYS B 159      79.274  29.425  63.986  1.00  0.00           H
ATOM   4242  HG3 LYS B 159      77.776  29.348  62.915  1.00  0.00           H
ATOM   4243  CD  LYS B 159      79.549  29.694  61.879  1.00  0.00           C
ATOM   4244  HD2 LYS B 159      79.006  29.886  60.954  1.00  0.00           H
ATOM   4245  HD3 LYS B 159      80.306  30.479  61.877  1.00  0.00           H
ATOM   4246  CE  LYS B 159      80.299  28.395  61.825  1.00  0.00           C
ATOM   4247  HE2 LYS B 159      80.931  28.390  60.936  1.00  0.00           H
ATOM   4248  HE3 LYS B 159      80.944  28.234  62.689  1.00  0.00           H
ATOM   4249  NZ  LYS B 159      79.371  27.252  61.801  1.00  0.00           N
ATOM   4250  HZ1 LYS B 159      78.933  27.087  62.695  1.00  0.00           H
ATOM   4251  HZ2 LYS B 159      78.634  27.370  61.120  1.00  0.00           H
ATOM   4252  HZ3 LYS B 159      79.963  26.474  61.547  1.00  0.00           H
ATOM   4253  C   LYS B 159      78.824  33.577  64.343  1.00  0.00           C
ATOM   4254  O   LYS B 159      78.150  34.248  63.600  1.00  0.00           O
ATOM   4255  N   LEU B 160      79.090  34.126  65.562  1.00  0.00           N
ATOM   4256  H   LEU B 160      79.609  33.541  66.202  1.00  0.00           H
ATOM   4257  CA  LEU B 160      78.993  35.606  65.822  1.00  0.00           C
ATOM   4258  HA  LEU B 160      78.365  36.065  65.057  1.00  0.00           H
ATOM   4259  CB  LEU B 160      78.391  35.794  67.213  1.00  0.00           C
ATOM   4260  HB2 LEU B 160      77.414  35.316  67.141  1.00  0.00           H
ATOM   4261  HB3 LEU B 160      78.956  35.142  67.879  1.00  0.00           H
ATOM   4262  CG  LEU B 160      78.329  37.245  67.818  1.00  0.00           C
ATOM   4263  HG  LEU B 160      79.275  37.779  67.906  1.00  0.00           H
ATOM   4264  CD1 LEU B 160      77.319  38.118  67.012  1.00  0.00           C
ATOM   4265 HD11 LEU B 160      77.760  38.277  66.028  1.00  0.00           H
ATOM   4266 HD12 LEU B 160      76.350  37.622  67.052  1.00  0.00           H
ATOM   4267 HD13 LEU B 160      77.142  39.087  67.478  1.00  0.00           H
ATOM   4268  CD2 LEU B 160      77.726  37.060  69.242  1.00  0.00           C
ATOM   4269 HD21 LEU B 160      78.405  36.530  69.910  1.00  0.00           H
ATOM   4270 HD22 LEU B 160      77.517  38.049  69.651  1.00  0.00           H
ATOM   4271 HD23 LEU B 160      76.808  36.497  69.075  1.00  0.00           H
ATOM   4272  C   LEU B 160      80.297  36.329  65.617  1.00  0.00           C
ATOM   4273  O   LEU B 160      81.347  35.991  66.217  1.00  0.00           O
ATOM   4274  N   ALA B 161      80.178  37.400  64.835  1.00  0.00           N
ATOM   4275  H   ALA B 161      79.305  37.756  64.473  1.00  0.00           H
ATOM   4276  CA  ALA B 161      81.375  38.235  64.524  1.00  0.00           C
ATOM   4277  HA  ALA B 161      82.209  37.639  64.156  1.00  0.00           H
ATOM   4278  CB  ALA B 161      80.983  39.103  63.342  1.00  0.00           C
ATOM   4279  HB1 ALA B 161      80.244  39.880  63.540  1.00  0.00           H
ATOM   4280  HB2 ALA B 161      81.796  39.675  62.896  1.00  0.00           H
ATOM   4281  HB3 ALA B 161      80.600  38.500  62.518  1.00  0.00           H
ATOM   4282  C   ALA B 161      81.871  39.040  65.765  1.00  0.00           C
ATOM   4283  O   ALA B 161      81.040  39.461  66.582  1.00  0.00           O
ATOM   4284  N   LEU B 162      83.194  39.253  66.003  1.00  0.00           N
ATOM   4285  H   LEU B 162      83.880  38.767  65.443  1.00  0.00           H
ATOM   4286  CA  LEU B 162      83.741  40.296  66.883  1.00  0.00           C
ATOM   4287  HA  LEU B 162      83.448  39.955  67.876  1.00  0.00           H
ATOM   4288  CB  LEU B 162      85.290  40.327  66.965  1.00  0.00           C
ATOM   4289  HB2 LEU B 162      85.651  40.426  65.941  1.00  0.00           H
ATOM   4290  HB3 LEU B 162      85.561  41.288  67.403  1.00  0.00           H
ATOM   4291  CG  LEU B 162      85.954  39.043  67.630  1.00  0.00           C
ATOM   4292  HG  LEU B 162      85.508  38.139  67.214  1.00  0.00           H
ATOM   4293  CD1 LEU B 162      87.430  38.932  67.213  1.00  0.00           C
ATOM   4294 HD11 LEU B 162      88.044  39.820  67.367  1.00  0.00           H
ATOM   4295 HD12 LEU B 162      87.937  38.087  67.679  1.00  0.00           H
ATOM   4296 HD13 LEU B 162      87.480  38.613  66.171  1.00  0.00           H
ATOM   4297  CD2 LEU B 162      85.856  39.083  69.146  1.00  0.00           C
ATOM   4298 HD21 LEU B 162      86.337  40.006  69.469  1.00  0.00           H
ATOM   4299 HD22 LEU B 162      84.813  38.981  69.445  1.00  0.00           H
ATOM   4300 HD23 LEU B 162      86.424  38.229  69.514  1.00  0.00           H
ATOM   4301  C   LEU B 162      83.116  41.631  66.492  1.00  0.00           C
ATOM   4302  O   LEU B 162      82.967  41.951  65.336  1.00  0.00           O
ATOM   4303  N   GLY B 163      82.545  42.323  67.472  1.00  0.00           N
ATOM   4304  H   GLY B 163      82.697  41.959  68.401  1.00  0.00           H
ATOM   4305  CA  GLY B 163      81.712  43.505  67.321  1.00  0.00           C
ATOM   4306  HA2 GLY B 163      81.921  44.157  68.169  1.00  0.00           H
ATOM   4307  HA3 GLY B 163      82.026  44.033  66.421  1.00  0.00           H
ATOM   4308  C   GLY B 163      80.164  43.358  67.195  1.00  0.00           C
ATOM   4309  O   GLY B 163      79.461  44.357  67.522  1.00  0.00           O
ATOM   4310  N   GLY B 164      79.641  42.136  67.047  1.00  0.00           N
ATOM   4311  H   GLY B 164      80.257  41.394  66.747  1.00  0.00           H
ATOM   4312  CA  GLY B 164      78.176  41.863  67.031  1.00  0.00           C
ATOM   4313  HA2 GLY B 164      77.657  42.641  66.472  1.00  0.00           H
ATOM   4314  HA3 GLY B 164      77.982  40.929  66.504  1.00  0.00           H
ATOM   4315  C   GLY B 164      77.466  41.789  68.392  1.00  0.00           C
ATOM   4316  O   GLY B 164      78.081  41.857  69.466  1.00  0.00           O
ATOM   4317  N   SER B 165      76.173  41.383  68.401  1.00  0.00           N
ATOM   4318  H   SER B 165      75.786  41.094  67.514  1.00  0.00           H
ATOM   4319  CA  SER B 165      75.345  41.300  69.617  1.00  0.00           C
ATOM   4320  HA  SER B 165      75.947  41.107  70.505  1.00  0.00           H
ATOM   4321  CB  SER B 165      74.833  42.763  69.886  1.00  0.00           C
ATOM   4322  HB2 SER B 165      75.641  43.274  70.409  1.00  0.00           H
ATOM   4323  HB3 SER B 165      74.650  43.119  68.872  1.00  0.00           H
ATOM   4324  OG  SER B 165      73.646  42.943  70.609  1.00  0.00           O
ATOM   4325  HG  SER B 165      73.830  42.535  71.458  1.00  0.00           H
ATOM   4326  C   SER B 165      74.326  40.163  69.575  1.00  0.00           C
ATOM   4327  O   SER B 165      74.082  39.545  68.566  1.00  0.00           O
ATOM   4328  N   VAL B 166      73.870  39.758  70.743  1.00  0.00           N
ATOM   4329  H   VAL B 166      74.127  40.324  71.539  1.00  0.00           H
ATOM   4330  CA  VAL B 166      72.936  38.627  70.930  1.00  0.00           C
ATOM   4331  HA  VAL B 166      72.570  38.378  69.934  1.00  0.00           H
ATOM   4332  CB  VAL B 166      73.790  37.487  71.430  1.00  0.00           C
ATOM   4333  HB  VAL B 166      74.743  37.570  70.906  1.00  0.00           H
ATOM   4334  CG1 VAL B 166      74.216  37.406  72.982  1.00  0.00           C
ATOM   4335 HG11 VAL B 166      74.901  38.200  73.279  1.00  0.00           H
ATOM   4336 HG12 VAL B 166      73.292  37.431  73.559  1.00  0.00           H
ATOM   4337 HG13 VAL B 166      74.667  36.423  73.119  1.00  0.00           H
ATOM   4338  CG2 VAL B 166      73.149  36.085  71.078  1.00  0.00           C
ATOM   4339 HG21 VAL B 166      73.634  35.270  71.615  1.00  0.00           H
ATOM   4340 HG22 VAL B 166      72.137  36.125  71.479  1.00  0.00           H
ATOM   4341 HG23 VAL B 166      73.005  35.817  70.031  1.00  0.00           H
ATOM   4342  C   VAL B 166      71.763  39.082  71.827  1.00  0.00           C
ATOM   4343  O   VAL B 166      71.933  40.000  72.612  1.00  0.00           O
ATOM   4344  N   ALA B 167      70.628  38.461  71.583  1.00  0.00           N
ATOM   4345  H   ALA B 167      70.545  37.891  70.753  1.00  0.00           H
ATOM   4346  CA  ALA B 167      69.402  38.540  72.411  1.00  0.00           C
ATOM   4347  HA  ALA B 167      69.754  38.632  73.439  1.00  0.00           H
ATOM   4348  CB  ALA B 167      68.441  39.672  71.914  1.00  0.00           C
ATOM   4349  HB1 ALA B 167      68.977  40.612  72.040  1.00  0.00           H
ATOM   4350  HB2 ALA B 167      68.264  39.563  70.843  1.00  0.00           H
ATOM   4351  HB3 ALA B 167      67.558  39.653  72.553  1.00  0.00           H
ATOM   4352  C   ALA B 167      68.596  37.187  72.393  1.00  0.00           C
ATOM   4353  O   ALA B 167      67.931  36.834  71.451  1.00  0.00           O
ATOM   4354  N   ILE B 168      68.683  36.343  73.422  1.00  0.00           N
ATOM   4355  H   ILE B 168      69.139  36.680  74.258  1.00  0.00           H
ATOM   4356  CA  ILE B 168      68.017  35.046  73.636  1.00  0.00           C
ATOM   4357  HA  ILE B 168      67.576  34.654  72.720  1.00  0.00           H
ATOM   4358  CB  ILE B 168      69.093  33.970  74.010  1.00  0.00           C
ATOM   4359  HB  ILE B 168      69.461  34.281  74.988  1.00  0.00           H
ATOM   4360  CG2 ILE B 168      68.370  32.619  74.190  1.00  0.00           C
ATOM   4361 HG21 ILE B 168      67.494  32.593  73.543  1.00  0.00           H
ATOM   4362 HG22 ILE B 168      69.114  31.866  73.929  1.00  0.00           H
ATOM   4363 HG23 ILE B 168      67.926  32.465  75.173  1.00  0.00           H
ATOM   4364  CG1 ILE B 168      70.326  33.840  73.065  1.00  0.00           C
ATOM   4365 HG12 ILE B 168      70.897  34.769  73.099  1.00  0.00           H
ATOM   4366 HG13 ILE B 168      70.995  33.099  73.502  1.00  0.00           H
ATOM   4367  CD1 ILE B 168      70.157  33.561  71.590  1.00  0.00           C
ATOM   4368 HD11 ILE B 168      69.372  32.818  71.449  1.00  0.00           H
ATOM   4369 HD12 ILE B 168      69.700  34.453  71.163  1.00  0.00           H
ATOM   4370 HD13 ILE B 168      71.118  33.481  71.083  1.00  0.00           H
ATOM   4371  C   ILE B 168      66.916  35.185  74.694  1.00  0.00           C
ATOM   4372  O   ILE B 168      67.112  35.659  75.799  1.00  0.00           O
ATOM   4373  N   LYS B 169      65.680  34.745  74.344  1.00  0.00           N
ATOM   4374  H   LYS B 169      65.523  34.433  73.396  1.00  0.00           H
ATOM   4375  CA  LYS B 169      64.499  34.788  75.239  1.00  0.00           C
ATOM   4376  HA  LYS B 169      64.512  35.765  75.721  1.00  0.00           H
ATOM   4377  CB  LYS B 169      63.239  34.626  74.434  1.00  0.00           C
ATOM   4378  HB2 LYS B 169      63.223  35.293  73.572  1.00  0.00           H
ATOM   4379  HB3 LYS B 169      63.198  33.547  74.288  1.00  0.00           H
ATOM   4380  CG  LYS B 169      61.992  34.896  75.336  1.00  0.00           C
ATOM   4381  HG2 LYS B 169      61.973  34.102  76.083  1.00  0.00           H
ATOM   4382  HG3 LYS B 169      62.265  35.861  75.764  1.00  0.00           H
ATOM   4383  CD  LYS B 169      60.685  34.927  74.560  1.00  0.00           C
ATOM   4384  HD2 LYS B 169      59.838  35.328  75.117  1.00  0.00           H
ATOM   4385  HD3 LYS B 169      60.901  35.483  73.647  1.00  0.00           H
ATOM   4386  CE  LYS B 169      60.249  33.534  74.203  1.00  0.00           C
ATOM   4387  HE2 LYS B 169      61.106  33.049  73.735  1.00  0.00           H
ATOM   4388  HE3 LYS B 169      60.036  32.905  75.068  1.00  0.00           H
ATOM   4389  NZ  LYS B 169      59.019  33.550  73.398  1.00  0.00           N
ATOM   4390  HZ1 LYS B 169      58.291  33.991  73.942  1.00  0.00           H
ATOM   4391  HZ2 LYS B 169      59.259  34.030  72.543  1.00  0.00           H
ATOM   4392  HZ3 LYS B 169      58.757  32.603  73.164  1.00  0.00           H
ATOM   4393  C   LYS B 169      64.669  33.723  76.398  1.00  0.00           C
ATOM   4394  O   LYS B 169      64.860  32.555  76.176  1.00  0.00           O
ATOM   4395  N   ILE B 170      64.578  34.187  77.650  1.00  0.00           N
ATOM   4396  H   ILE B 170      64.355  35.162  77.786  1.00  0.00           H
ATOM   4397  CA  ILE B 170      64.456  33.410  78.892  1.00  0.00           C
ATOM   4398  HA  ILE B 170      64.362  32.344  78.682  1.00  0.00           H
ATOM   4399  CB  ILE B 170      65.694  33.583  79.796  1.00  0.00           C
ATOM   4400  HB  ILE B 170      65.528  32.980  80.689  1.00  0.00           H
ATOM   4401  CG2 ILE B 170      66.951  33.077  79.125  1.00  0.00           C
ATOM   4402 HG21 ILE B 170      67.791  33.070  79.820  1.00  0.00           H
ATOM   4403 HG22 ILE B 170      66.766  32.045  78.827  1.00  0.00           H
ATOM   4404 HG23 ILE B 170      67.174  33.685  78.249  1.00  0.00           H
ATOM   4405  CG1 ILE B 170      65.729  35.023  80.275  1.00  0.00           C
ATOM   4406 HG12 ILE B 170      65.989  35.510  79.335  1.00  0.00           H
ATOM   4407 HG13 ILE B 170      64.788  35.301  80.750  1.00  0.00           H
ATOM   4408  CD1 ILE B 170      66.817  35.349  81.336  1.00  0.00           C
ATOM   4409 HD11 ILE B 170      66.645  34.733  82.219  1.00  0.00           H
ATOM   4410 HD12 ILE B 170      67.758  35.124  80.834  1.00  0.00           H
ATOM   4411 HD13 ILE B 170      66.734  36.411  81.567  1.00  0.00           H
ATOM   4412  C   ILE B 170      63.164  33.591  79.690  1.00  0.00           C
ATOM   4413  O   ILE B 170      62.407  34.507  79.328  1.00  0.00           O
ATOM   4414  N   THR B 171      62.887  32.826  80.754  1.00  0.00           N
ATOM   4415  H   THR B 171      63.389  31.951  80.794  1.00  0.00           H
ATOM   4416  CA  THR B 171      61.876  33.021  81.815  1.00  0.00           C
ATOM   4417  HA  THR B 171      61.600  34.071  81.910  1.00  0.00           H
ATOM   4418  CB  THR B 171      60.526  32.306  81.460  1.00  0.00           C
ATOM   4419  HB  THR B 171      59.838  32.540  82.273  1.00  0.00           H
ATOM   4420  CG2 THR B 171      59.911  32.591  80.030  1.00  0.00           C
ATOM   4421 HG21 THR B 171      58.902  32.216  79.859  1.00  0.00           H
ATOM   4422 HG22 THR B 171      59.867  33.662  79.830  1.00  0.00           H
ATOM   4423 HG23 THR B 171      60.601  32.151  79.311  1.00  0.00           H
ATOM   4424  OG1 THR B 171      60.627  30.890  81.541  1.00  0.00           O
ATOM   4425  HG1 THR B 171      59.884  30.597  82.073  1.00  0.00           H
ATOM   4426  C   THR B 171      62.434  32.430  83.140  1.00  0.00           C
ATOM   4427  O   THR B 171      63.565  31.917  83.077  1.00  0.00           O
ATOM   4428  N   GLU B 172      61.635  32.378  84.231  1.00  0.00           N
ATOM   4429  H   GLU B 172      60.812  32.963  84.206  1.00  0.00           H
ATOM   4430  CA  GLU B 172      62.082  31.749  85.469  1.00  0.00           C
ATOM   4431  HA  GLU B 172      62.969  32.245  85.865  1.00  0.00           H
ATOM   4432  CB  GLU B 172      60.934  31.879  86.556  1.00  0.00           C
ATOM   4433  HB2 GLU B 172      60.761  32.939  86.737  1.00  0.00           H
ATOM   4434  HB3 GLU B 172      60.022  31.538  86.067  1.00  0.00           H
ATOM   4435  CG  GLU B 172      61.204  31.107  87.837  1.00  0.00           C
ATOM   4436  HG2 GLU B 172      61.707  30.197  87.509  1.00  0.00           H
ATOM   4437  HG3 GLU B 172      61.930  31.713  88.378  1.00  0.00           H
ATOM   4438  CD  GLU B 172      59.923  30.976  88.768  1.00  0.00           C
ATOM   4439  OE1 GLU B 172      58.827  31.281  88.360  1.00  0.00           O
ATOM   4440  OE2 GLU B 172      60.079  30.421  89.893  1.00  0.00           O
ATOM   4441  C   GLU B 172      62.451  30.288  85.220  1.00  0.00           C
ATOM   4442  O   GLU B 172      63.597  29.858  85.515  1.00  0.00           O
ATOM   4443  N   HIE B 173      61.549  29.500  84.599  1.00  0.00           N
ATOM   4444  H   HIE B 173      60.646  29.900  84.389  1.00  0.00           H
ATOM   4445  CA  HIE B 173      61.780  28.085  84.317  1.00  0.00           C
ATOM   4446  HA  HIE B 173      62.438  27.729  85.110  1.00  0.00           H
ATOM   4447  CB  HIE B 173      60.459  27.277  84.580  1.00  0.00           C
ATOM   4448  HB2 HIE B 173      59.688  27.825  84.037  1.00  0.00           H
ATOM   4449  HB3 HIE B 173      60.538  26.217  84.341  1.00  0.00           H
ATOM   4450  CG  HIE B 173      60.070  27.332  86.008  1.00  0.00           C
ATOM   4451  ND1 HIE B 173      60.810  26.727  86.984  1.00  0.00           N
ATOM   4452  CE1 HIE B 173      60.419  27.334  88.148  1.00  0.00           C
ATOM   4453  HE1 HIE B 173      60.627  27.036  89.165  1.00  0.00           H
ATOM   4454  NE2 HIE B 173      59.437  28.195  87.809  1.00  0.00           N
ATOM   4455  HE2 HIE B 173      58.852  28.648  88.497  1.00  0.00           H
ATOM   4456  CD2 HIE B 173      59.184  28.264  86.512  1.00  0.00           C
ATOM   4457  HD2 HIE B 173      58.581  28.970  85.960  1.00  0.00           H
ATOM   4458  C   HIE B 173      62.530  27.699  83.052  1.00  0.00           C
ATOM   4459  O   HIE B 173      63.003  26.547  82.969  1.00  0.00           O
ATOM   4460  N   SER B 174      62.744  28.568  82.069  1.00  0.00           N
ATOM   4461  H   SER B 174      62.428  29.517  82.210  1.00  0.00           H
ATOM   4462  CA  SER B 174      63.352  28.358  80.736  1.00  0.00           C
ATOM   4463  HA  SER B 174      63.520  27.282  80.688  1.00  0.00           H
ATOM   4464  CB  SER B 174      62.331  28.447  79.592  1.00  0.00           C
ATOM   4465  HB2 SER B 174      61.625  27.644  79.805  1.00  0.00           H
ATOM   4466  HB3 SER B 174      61.938  29.463  79.603  1.00  0.00           H
ATOM   4467  OG  SER B 174      62.941  28.259  78.309  1.00  0.00           O
ATOM   4468  HG  SER B 174      63.182  29.119  77.958  1.00  0.00           H
ATOM   4469  C   SER B 174      64.660  29.214  80.605  1.00  0.00           C
ATOM   4470  O   SER B 174      64.558  30.285  80.056  1.00  0.00           O
ATOM   4471  N   TRP B 175      65.798  28.782  81.060  1.00  0.00           N
ATOM   4472  H   TRP B 175      65.724  27.829  81.388  1.00  0.00           H
ATOM   4473  CA  TRP B 175      67.014  29.483  81.146  1.00  0.00           C
ATOM   4474  HA  TRP B 175      67.097  30.201  80.330  1.00  0.00           H
ATOM   4475  CB  TRP B 175      67.138  30.157  82.474  1.00  0.00           C
ATOM   4476  HB2 TRP B 175      67.961  30.868  82.551  1.00  0.00           H
ATOM   4477  HB3 TRP B 175      66.197  30.706  82.505  1.00  0.00           H
ATOM   4478  CG  TRP B 175      67.237  29.300  83.654  1.00  0.00           C
ATOM   4479  CD1 TRP B 175      66.177  28.677  84.271  1.00  0.00           C
ATOM   4480  HD1 TRP B 175      65.186  28.746  83.848  1.00  0.00           H
ATOM   4481  NE1 TRP B 175      66.585  27.943  85.380  1.00  0.00           N
ATOM   4482  HE1 TRP B 175      65.955  27.280  85.810  1.00  0.00           H
ATOM   4483  CE2 TRP B 175      67.927  28.198  85.622  1.00  0.00           C
ATOM   4484  CZ2 TRP B 175      68.759  27.741  86.624  1.00  0.00           C
ATOM   4485  HZ2 TRP B 175      68.363  27.240  87.494  1.00  0.00           H
ATOM   4486  CH2 TRP B 175      70.096  28.186  86.600  1.00  0.00           C
ATOM   4487  HH2 TRP B 175      70.810  27.934  87.370  1.00  0.00           H
ATOM   4488  CZ3 TRP B 175      70.544  28.998  85.519  1.00  0.00           C
ATOM   4489  HZ3 TRP B 175      71.588  29.261  85.435  1.00  0.00           H
ATOM   4490  CE3 TRP B 175      69.682  29.417  84.498  1.00  0.00           C
ATOM   4491  HE3 TRP B 175      70.097  30.139  83.810  1.00  0.00           H
ATOM   4492  CD2 TRP B 175      68.328  29.015  84.522  1.00  0.00           C
ATOM   4493  C   TRP B 175      68.149  28.451  80.982  1.00  0.00           C
ATOM   4494  O   TRP B 175      67.946  27.208  81.105  1.00  0.00           O
ATOM   4495  N   ASN B 176      69.353  28.965  80.905  1.00  0.00           N
ATOM   4496  H   ASN B 176      69.435  29.970  80.842  1.00  0.00           H
ATOM   4497  CA  ASN B 176      70.600  28.208  80.948  1.00  0.00           C
ATOM   4498  HA  ASN B 176      70.446  27.260  81.463  1.00  0.00           H
ATOM   4499  CB  ASN B 176      70.927  27.909  79.444  1.00  0.00           C
ATOM   4500  HB2 ASN B 176      70.061  27.408  79.010  1.00  0.00           H
ATOM   4501  HB3 ASN B 176      71.042  28.853  78.911  1.00  0.00           H
ATOM   4502  CG  ASN B 176      72.136  26.976  79.359  1.00  0.00           C
ATOM   4503  OD1 ASN B 176      73.263  27.385  79.291  1.00  0.00           O
ATOM   4504  ND2 ASN B 176      71.899  25.672  79.350  1.00  0.00           N
ATOM   4505 HD21 ASN B 176      72.634  24.998  79.510  1.00  0.00           H
ATOM   4506 HD22 ASN B 176      70.990  25.303  79.592  1.00  0.00           H
ATOM   4507  C   ASN B 176      71.735  28.959  81.589  1.00  0.00           C
ATOM   4508  O   ASN B 176      71.957  30.175  81.311  1.00  0.00           O
ATOM   4509  N   ALA B 177      72.587  28.235  82.336  1.00  0.00           N
ATOM   4510  H   ALA B 177      72.300  27.274  82.463  1.00  0.00           H
ATOM   4511  CA  ALA B 177      73.649  28.726  83.139  1.00  0.00           C
ATOM   4512  HA  ALA B 177      73.348  29.656  83.622  1.00  0.00           H
ATOM   4513  CB  ALA B 177      73.943  27.721  84.288  1.00  0.00           C
ATOM   4514  HB1 ALA B 177      73.084  27.464  84.908  1.00  0.00           H
ATOM   4515  HB2 ALA B 177      74.166  26.792  83.764  1.00  0.00           H
ATOM   4516  HB3 ALA B 177      74.794  28.000  84.909  1.00  0.00           H
ATOM   4517  C   ALA B 177      75.017  29.032  82.388  1.00  0.00           C
ATOM   4518  O   ALA B 177      75.670  30.009  82.641  1.00  0.00           O
ATOM   4519  N   ASP B 178      75.380  28.159  81.427  1.00  0.00           N
ATOM   4520  H   ASP B 178      74.669  27.470  81.226  1.00  0.00           H
ATOM   4521  CA  ASP B 178      76.460  28.384  80.508  1.00  0.00           C
ATOM   4522  HA  ASP B 178      77.377  28.553  81.072  1.00  0.00           H
ATOM   4523  CB  ASP B 178      76.768  27.199  79.627  1.00  0.00           C
ATOM   4524  HB2 ASP B 178      75.873  26.761  79.187  1.00  0.00           H
ATOM   4525  HB3 ASP B 178      77.442  27.455  78.810  1.00  0.00           H
ATOM   4526  CG  ASP B 178      77.381  26.106  80.457  1.00  0.00           C
ATOM   4527  OD1 ASP B 178      78.500  26.348  80.973  1.00  0.00           O
ATOM   4528  OD2 ASP B 178      76.841  24.945  80.526  1.00  0.00           O
ATOM   4529  C   ASP B 178      76.225  29.663  79.717  1.00  0.00           C
ATOM   4530  O   ASP B 178      77.177  30.332  79.310  1.00  0.00           O
ATOM   4531  N   LEU B 179      74.935  30.013  79.440  1.00  0.00           N
ATOM   4532  H   LEU B 179      74.291  29.248  79.580  1.00  0.00           H
ATOM   4533  CA  LEU B 179      74.558  31.269  78.669  1.00  0.00           C
ATOM   4534  HA  LEU B 179      75.252  31.396  77.839  1.00  0.00           H
ATOM   4535  CB  LEU B 179      73.126  31.043  78.108  1.00  0.00           C
ATOM   4536  HB2 LEU B 179      73.094  30.152  77.481  1.00  0.00           H
ATOM   4537  HB3 LEU B 179      72.416  31.022  78.935  1.00  0.00           H
ATOM   4538  CG  LEU B 179      72.677  32.268  77.250  1.00  0.00           C
ATOM   4539  HG  LEU B 179      72.901  33.189  77.789  1.00  0.00           H
ATOM   4540  CD1 LEU B 179      73.374  32.349  75.846  1.00  0.00           C
ATOM   4541 HD11 LEU B 179      73.299  31.377  75.359  1.00  0.00           H
ATOM   4542 HD12 LEU B 179      72.767  32.978  75.195  1.00  0.00           H
ATOM   4543 HD13 LEU B 179      74.363  32.796  75.742  1.00  0.00           H
ATOM   4544  CD2 LEU B 179      71.185  32.021  77.019  1.00  0.00           C
ATOM   4545 HD21 LEU B 179      70.691  31.941  77.987  1.00  0.00           H
ATOM   4546 HD22 LEU B 179      70.728  32.854  76.486  1.00  0.00           H
ATOM   4547 HD23 LEU B 179      71.071  31.108  76.434  1.00  0.00           H
ATOM   4548  C   LEU B 179      74.783  32.425  79.607  1.00  0.00           C
ATOM   4549  O   LEU B 179      75.338  33.450  79.190  1.00  0.00           O
ATOM   4550  N   TYR B 180      74.407  32.327  80.869  1.00  0.00           N
ATOM   4551  H   TYR B 180      73.828  31.544  81.137  1.00  0.00           H
ATOM   4552  CA  TYR B 180      74.845  33.407  81.827  1.00  0.00           C
ATOM   4553  HA  TYR B 180      74.643  34.409  81.448  1.00  0.00           H
ATOM   4554  CB  TYR B 180      74.121  33.232  83.169  1.00  0.00           C
ATOM   4555  HB2 TYR B 180      74.113  32.166  83.397  1.00  0.00           H
ATOM   4556  HB3 TYR B 180      74.710  33.716  83.947  1.00  0.00           H
ATOM   4557  CG  TYR B 180      72.690  33.762  83.271  1.00  0.00           C
ATOM   4558  CD1 TYR B 180      71.570  32.855  83.320  1.00  0.00           C
ATOM   4559  HD1 TYR B 180      71.792  31.798  83.290  1.00  0.00           H
ATOM   4560  CE1 TYR B 180      70.264  33.360  83.511  1.00  0.00           C
ATOM   4561  HE1 TYR B 180      69.380  32.740  83.476  1.00  0.00           H
ATOM   4562  CZ  TYR B 180      70.002  34.734  83.691  1.00  0.00           C
ATOM   4563  OH  TYR B 180      68.802  35.120  84.130  1.00  0.00           O
ATOM   4564  HH  TYR B 180      68.167  34.448  84.388  1.00  0.00           H
ATOM   4565  CE2 TYR B 180      71.131  35.660  83.705  1.00  0.00           C
ATOM   4566  HE2 TYR B 180      70.919  36.697  83.921  1.00  0.00           H
ATOM   4567  CD2 TYR B 180      72.440  35.194  83.364  1.00  0.00           C
ATOM   4568  HD2 TYR B 180      73.230  35.924  83.264  1.00  0.00           H
ATOM   4569  C   TYR B 180      76.377  33.501  82.044  1.00  0.00           C
ATOM   4570  O   TYR B 180      76.865  34.646  82.152  1.00  0.00           O
ATOM   4571  N   LYS B 181      77.195  32.389  82.043  1.00  0.00           N
ATOM   4572  H   LYS B 181      76.732  31.494  81.972  1.00  0.00           H
ATOM   4573  CA  LYS B 181      78.651  32.470  81.800  1.00  0.00           C
ATOM   4574  HA  LYS B 181      79.096  33.023  82.627  1.00  0.00           H
ATOM   4575  CB  LYS B 181      79.213  31.037  82.033  1.00  0.00           C
ATOM   4576  HB2 LYS B 181      79.086  30.682  83.056  1.00  0.00           H
ATOM   4577  HB3 LYS B 181      78.822  30.328  81.303  1.00  0.00           H
ATOM   4578  CG  LYS B 181      80.774  30.973  81.770  1.00  0.00           C
ATOM   4579  HG2 LYS B 181      80.994  31.186  80.724  1.00  0.00           H
ATOM   4580  HG3 LYS B 181      81.236  31.826  82.267  1.00  0.00           H
ATOM   4581  CD  LYS B 181      81.427  29.681  82.255  1.00  0.00           C
ATOM   4582  HD2 LYS B 181      81.428  29.588  83.341  1.00  0.00           H
ATOM   4583  HD3 LYS B 181      80.913  28.809  81.851  1.00  0.00           H
ATOM   4584  CE  LYS B 181      82.979  29.689  81.886  1.00  0.00           C
ATOM   4585  HE2 LYS B 181      83.115  29.616  80.807  1.00  0.00           H
ATOM   4586  HE3 LYS B 181      83.271  30.708  82.141  1.00  0.00           H
ATOM   4587  NZ  LYS B 181      83.776  28.608  82.618  1.00  0.00           N
ATOM   4588  HZ1 LYS B 181      84.744  28.606  82.328  1.00  0.00           H
ATOM   4589  HZ2 LYS B 181      83.636  28.701  83.614  1.00  0.00           H
ATOM   4590  HZ3 LYS B 181      83.389  27.741  82.273  1.00  0.00           H
ATOM   4591  C   LYS B 181      79.006  33.133  80.464  1.00  0.00           C
ATOM   4592  O   LYS B 181      79.968  33.906  80.381  1.00  0.00           O
ATOM   4593  N   LEU B 182      78.235  32.871  79.406  1.00  0.00           N
ATOM   4594  H   LEU B 182      77.534  32.146  79.463  1.00  0.00           H
ATOM   4595  CA  LEU B 182      78.565  33.390  78.036  1.00  0.00           C
ATOM   4596  HA  LEU B 182      79.603  33.085  77.901  1.00  0.00           H
ATOM   4597  CB  LEU B 182      77.882  32.565  77.012  1.00  0.00           C
ATOM   4598  HB2 LEU B 182      78.261  31.572  77.254  1.00  0.00           H
ATOM   4599  HB3 LEU B 182      76.812  32.678  77.183  1.00  0.00           H
ATOM   4600  CG  LEU B 182      78.100  32.942  75.494  1.00  0.00           C
ATOM   4601  HG  LEU B 182      77.705  33.951  75.374  1.00  0.00           H
ATOM   4602  CD1 LEU B 182      79.557  32.903  75.117  1.00  0.00           C
ATOM   4603 HD11 LEU B 182      79.995  33.809  75.536  1.00  0.00           H
ATOM   4604 HD12 LEU B 182      80.052  31.993  75.457  1.00  0.00           H
ATOM   4605 HD13 LEU B 182      79.685  32.887  74.035  1.00  0.00           H
ATOM   4606  CD2 LEU B 182      77.363  31.990  74.554  1.00  0.00           C
ATOM   4607 HD21 LEU B 182      77.949  31.089  74.376  1.00  0.00           H
ATOM   4608 HD22 LEU B 182      76.330  31.868  74.882  1.00  0.00           H
ATOM   4609 HD23 LEU B 182      77.265  32.411  73.553  1.00  0.00           H
ATOM   4610  C   LEU B 182      78.494  34.906  77.827  1.00  0.00           C
ATOM   4611  O   LEU B 182      79.234  35.448  77.000  1.00  0.00           O
ATOM   4612  N   MET B 183      77.617  35.593  78.584  1.00  0.00           N
ATOM   4613  H   MET B 183      76.861  35.167  79.101  1.00  0.00           H
ATOM   4614  CA  MET B 183      77.649  37.104  78.629  1.00  0.00           C
ATOM   4615  HA  MET B 183      77.315  37.470  77.658  1.00  0.00           H
ATOM   4616  CB  MET B 183      76.470  37.577  79.499  1.00  0.00           C
ATOM   4617  HB2 MET B 183      76.631  37.225  80.518  1.00  0.00           H
ATOM   4618  HB3 MET B 183      76.666  38.645  79.600  1.00  0.00           H
ATOM   4619  CG  MET B 183      75.010  37.273  79.196  1.00  0.00           C
ATOM   4620  HG2 MET B 183      74.836  36.206  79.333  1.00  0.00           H
ATOM   4621  HG3 MET B 183      74.454  37.805  79.967  1.00  0.00           H
ATOM   4622  SD  MET B 183      74.582  37.763  77.532  1.00  0.00           S
ATOM   4623  CE  MET B 183      74.847  36.188  76.610  1.00  0.00           C
ATOM   4624  HE1 MET B 183      74.449  35.363  77.200  1.00  0.00           H
ATOM   4625  HE2 MET B 183      74.515  36.156  75.572  1.00  0.00           H
ATOM   4626  HE3 MET B 183      75.909  35.953  76.539  1.00  0.00           H
ATOM   4627  C   MET B 183      78.966  37.837  78.955  1.00  0.00           C
ATOM   4628  O   MET B 183      79.137  39.006  78.651  1.00  0.00           O
ATOM   4629  N   GLY B 184      79.900  37.061  79.496  1.00  0.00           N
ATOM   4630  H   GLY B 184      79.683  36.125  79.806  1.00  0.00           H
ATOM   4631  CA  GLY B 184      81.192  37.666  79.808  1.00  0.00           C
ATOM   4632  HA2 GLY B 184      80.958  38.622  80.275  1.00  0.00           H
ATOM   4633  HA3 GLY B 184      81.743  37.086  80.548  1.00  0.00           H
ATOM   4634  C   GLY B 184      82.079  37.923  78.620  1.00  0.00           C
ATOM   4635  O   GLY B 184      82.828  38.864  78.637  1.00  0.00           O
ATOM   4636  N   HIE B 185      81.835  37.312  77.412  1.00  0.00           N
ATOM   4637  H   HIE B 185      81.105  36.615  77.443  1.00  0.00           H
ATOM   4638  CA  HIE B 185      82.588  37.527  76.171  1.00  0.00           C
ATOM   4639  HA  HIE B 185      83.627  37.618  76.487  1.00  0.00           H
ATOM   4640  CB  HIE B 185      82.422  36.226  75.341  1.00  0.00           C
ATOM   4641  HB2 HIE B 185      81.367  35.999  75.184  1.00  0.00           H
ATOM   4642  HB3 HIE B 185      82.899  36.480  74.395  1.00  0.00           H
ATOM   4643  CG  HIE B 185      83.184  35.078  75.980  1.00  0.00           C
ATOM   4644  ND1 HIE B 185      84.482  34.674  75.673  1.00  0.00           N
ATOM   4645  CE1 HIE B 185      84.792  33.638  76.483  1.00  0.00           C
ATOM   4646  HE1 HIE B 185      85.726  33.099  76.423  1.00  0.00           H
ATOM   4647  NE2 HIE B 185      83.780  33.440  77.317  1.00  0.00           N
ATOM   4648  HE2 HIE B 185      83.782  32.683  77.984  1.00  0.00           H
ATOM   4649  CD2 HIE B 185      82.752  34.332  77.051  1.00  0.00           C
ATOM   4650  HD2 HIE B 185      81.783  34.317  77.528  1.00  0.00           H
ATOM   4651  C   HIE B 185      82.204  38.787  75.485  1.00  0.00           C
ATOM   4652  O   HIE B 185      82.523  38.930  74.271  1.00  0.00           O
ATOM   4653  N   PHE B 186      81.420  39.703  76.130  1.00  0.00           N
ATOM   4654  H   PHE B 186      81.390  39.492  77.117  1.00  0.00           H
ATOM   4655  CA  PHE B 186      80.829  40.900  75.598  1.00  0.00           C
ATOM   4656  HA  PHE B 186      81.117  41.081  74.562  1.00  0.00           H
ATOM   4657  CB  PHE B 186      79.287  40.751  75.628  1.00  0.00           C
ATOM   4658  HB2 PHE B 186      78.921  40.561  76.637  1.00  0.00           H
ATOM   4659  HB3 PHE B 186      78.823  41.695  75.339  1.00  0.00           H
ATOM   4660  CG  PHE B 186      78.653  39.706  74.666  1.00  0.00           C
ATOM   4661  CD1 PHE B 186      78.602  38.340  74.931  1.00  0.00           C
ATOM   4662  HD1 PHE B 186      79.041  37.923  75.825  1.00  0.00           H
ATOM   4663  CE1 PHE B 186      78.389  37.345  73.955  1.00  0.00           C
ATOM   4664  HE1 PHE B 186      78.559  36.304  74.189  1.00  0.00           H
ATOM   4665  CZ  PHE B 186      77.841  37.808  72.729  1.00  0.00           C
ATOM   4666  HZ  PHE B 186      77.443  37.074  72.044  1.00  0.00           H
ATOM   4667  CE2 PHE B 186      77.721  39.160  72.531  1.00  0.00           C
ATOM   4668  HE2 PHE B 186      77.361  39.458  71.557  1.00  0.00           H
ATOM   4669  CD2 PHE B 186      78.121  40.165  73.421  1.00  0.00           C
ATOM   4670  HD2 PHE B 186      77.939  41.196  73.155  1.00  0.00           H
ATOM   4671  C   PHE B 186      81.320  42.148  76.288  1.00  0.00           C
ATOM   4672  O   PHE B 186      81.547  42.135  77.513  1.00  0.00           O
ATOM   4673  N   ALA B 187      81.451  43.289  75.572  1.00  0.00           N
ATOM   4674  H   ALA B 187      81.246  43.223  74.585  1.00  0.00           H
ATOM   4675  CA  ALA B 187      81.890  44.534  76.157  1.00  0.00           C
ATOM   4676  HA  ALA B 187      82.867  44.479  76.637  1.00  0.00           H
ATOM   4677  CB  ALA B 187      81.922  45.503  75.044  1.00  0.00           C
ATOM   4678  HB1 ALA B 187      82.581  45.206  74.229  1.00  0.00           H
ATOM   4679  HB2 ALA B 187      80.906  45.751  74.738  1.00  0.00           H
ATOM   4680  HB3 ALA B 187      82.382  46.420  75.415  1.00  0.00           H
ATOM   4681  C   ALA B 187      80.902  45.035  77.280  1.00  0.00           C
ATOM   4682  O   ALA B 187      81.280  45.606  78.294  1.00  0.00           O
ATOM   4683  N   TRP B 188      79.597  44.872  76.978  1.00  0.00           N
ATOM   4684  H   TRP B 188      79.282  44.430  76.127  1.00  0.00           H
ATOM   4685  CA  TRP B 188      78.510  45.104  77.950  1.00  0.00           C
ATOM   4686  HA  TRP B 188      78.866  44.863  78.952  1.00  0.00           H
ATOM   4687  CB  TRP B 188      78.159  46.585  77.979  1.00  0.00           C
ATOM   4688  HB2 TRP B 188      79.056  47.189  78.114  1.00  0.00           H
ATOM   4689  HB3 TRP B 188      77.655  46.751  77.026  1.00  0.00           H
ATOM   4690  CG  TRP B 188      77.101  46.879  79.089  1.00  0.00           C
ATOM   4691  CD1 TRP B 188      77.341  47.116  80.404  1.00  0.00           C
ATOM   4692  HD1 TRP B 188      78.295  47.176  80.908  1.00  0.00           H
ATOM   4693  NE1 TRP B 188      76.167  47.346  80.981  1.00  0.00           N
ATOM   4694  HE1 TRP B 188      76.086  47.554  81.966  1.00  0.00           H
ATOM   4695  CE2 TRP B 188      75.058  47.099  80.169  1.00  0.00           C
ATOM   4696  CZ2 TRP B 188      73.698  47.284  80.360  1.00  0.00           C
ATOM   4697  HZ2 TRP B 188      73.292  47.644  81.295  1.00  0.00           H
ATOM   4698  CH2 TRP B 188      72.867  47.178  79.275  1.00  0.00           C
ATOM   4699  HH2 TRP B 188      71.825  47.455  79.337  1.00  0.00           H
ATOM   4700  CZ3 TRP B 188      73.353  46.717  78.013  1.00  0.00           C
ATOM   4701  HZ3 TRP B 188      72.604  46.583  77.246  1.00  0.00           H
ATOM   4702  CE3 TRP B 188      74.737  46.748  77.784  1.00  0.00           C
ATOM   4703  HE3 TRP B 188      75.176  46.556  76.815  1.00  0.00           H
ATOM   4704  CD2 TRP B 188      75.624  46.936  78.895  1.00  0.00           C
ATOM   4705  C   TRP B 188      77.298  44.111  77.858  1.00  0.00           C
ATOM   4706  O   TRP B 188      76.984  43.652  76.799  1.00  0.00           O
ATOM   4707  N   TRP B 189      76.486  43.851  78.961  1.00  0.00           N
ATOM   4708  H   TRP B 189      76.703  44.407  79.776  1.00  0.00           H
ATOM   4709  CA  TRP B 189      75.355  42.923  78.892  1.00  0.00           C
ATOM   4710  HA  TRP B 189      74.898  43.004  77.906  1.00  0.00           H
ATOM   4711  CB  TRP B 189      75.734  41.538  79.290  1.00  0.00           C
ATOM   4712  HB2 TRP B 189      74.942  40.909  78.885  1.00  0.00           H
ATOM   4713  HB3 TRP B 189      76.684  41.235  78.850  1.00  0.00           H
ATOM   4714  CG  TRP B 189      75.824  41.342  80.801  1.00  0.00           C
ATOM   4715  CD1 TRP B 189      76.775  41.791  81.567  1.00  0.00           C
ATOM   4716  HD1 TRP B 189      77.710  42.112  81.131  1.00  0.00           H
ATOM   4717  NE1 TRP B 189      76.545  41.433  82.878  1.00  0.00           N
ATOM   4718  HE1 TRP B 189      77.192  41.553  83.644  1.00  0.00           H
ATOM   4719  CE2 TRP B 189      75.295  40.853  83.014  1.00  0.00           C
ATOM   4720  CZ2 TRP B 189      74.527  40.464  84.143  1.00  0.00           C
ATOM   4721  HZ2 TRP B 189      74.903  40.608  85.145  1.00  0.00           H
ATOM   4722  CH2 TRP B 189      73.244  39.952  83.865  1.00  0.00           C
ATOM   4723  HH2 TRP B 189      72.517  39.648  84.603  1.00  0.00           H
ATOM   4724  CZ3 TRP B 189      72.782  39.722  82.544  1.00  0.00           C
ATOM   4725  HZ3 TRP B 189      71.764  39.375  82.447  1.00  0.00           H
ATOM   4726  CE3 TRP B 189      73.539  40.179  81.487  1.00  0.00           C
ATOM   4727  HE3 TRP B 189      73.143  40.069  80.488  1.00  0.00           H
ATOM   4728  CD2 TRP B 189      74.815  40.768  81.669  1.00  0.00           C
ATOM   4729  C   TRP B 189      74.147  43.341  79.795  1.00  0.00           C
ATOM   4730  O   TRP B 189      74.308  44.129  80.690  1.00  0.00           O
ATOM   4731  N   THR B 190      72.949  42.712  79.524  1.00  0.00           N
ATOM   4732  H   THR B 190      72.860  42.063  78.756  1.00  0.00           H
ATOM   4733  CA  THR B 190      71.727  42.984  80.293  1.00  0.00           C
ATOM   4734  HA  THR B 190      72.125  43.027  81.307  1.00  0.00           H
ATOM   4735  CB  THR B 190      71.122  44.422  80.116  1.00  0.00           C
ATOM   4736  HB  THR B 190      71.923  45.161  80.122  1.00  0.00           H
ATOM   4737  CG2 THR B 190      70.440  44.541  78.816  1.00  0.00           C
ATOM   4738 HG21 THR B 190      70.355  45.595  78.551  1.00  0.00           H
ATOM   4739 HG22 THR B 190      71.048  44.086  78.034  1.00  0.00           H
ATOM   4740 HG23 THR B 190      69.403  44.209  78.876  1.00  0.00           H
ATOM   4741  OG1 THR B 190      70.223  44.730  81.070  1.00  0.00           O
ATOM   4742  HG1 THR B 190      70.684  45.453  81.501  1.00  0.00           H
ATOM   4743  C   THR B 190      70.758  41.806  80.265  1.00  0.00           C
ATOM   4744  O   THR B 190      70.773  40.999  79.351  1.00  0.00           O
ATOM   4745  N   ALA B 191      69.823  41.781  81.223  1.00  0.00           N
ATOM   4746  H   ALA B 191      69.793  42.501  81.931  1.00  0.00           H
ATOM   4747  CA  ALA B 191      68.570  41.068  81.029  1.00  0.00           C
ATOM   4748  HA  ALA B 191      68.573  40.536  80.078  1.00  0.00           H
ATOM   4749  CB  ALA B 191      68.395  40.027  82.120  1.00  0.00           C
ATOM   4750  HB1 ALA B 191      68.526  40.513  83.086  1.00  0.00           H
ATOM   4751  HB2 ALA B 191      67.363  39.674  82.130  1.00  0.00           H
ATOM   4752  HB3 ALA B 191      69.190  39.296  81.975  1.00  0.00           H
ATOM   4753  C   ALA B 191      67.417  42.166  81.049  1.00  0.00           C
ATOM   4754  O   ALA B 191      67.514  43.165  81.820  1.00  0.00           O
ATOM   4755  N   PHE B 192      66.445  42.015  80.149  1.00  0.00           N
ATOM   4756  H   PHE B 192      66.642  41.340  79.424  1.00  0.00           H
ATOM   4757  CA  PHE B 192      65.534  43.140  79.662  1.00  0.00           C
ATOM   4758  HA  PHE B 192      65.618  43.964  80.370  1.00  0.00           H
ATOM   4759  CB  PHE B 192      66.129  43.669  78.360  1.00  0.00           C
ATOM   4760  HB2 PHE B 192      67.114  44.116  78.497  1.00  0.00           H
ATOM   4761  HB3 PHE B 192      66.247  42.757  77.774  1.00  0.00           H
ATOM   4762  CG  PHE B 192      65.068  44.527  77.651  1.00  0.00           C
ATOM   4763  CD1 PHE B 192      64.707  45.806  78.172  1.00  0.00           C
ATOM   4764  HD1 PHE B 192      65.307  46.265  78.944  1.00  0.00           H
ATOM   4765  CE1 PHE B 192      63.711  46.582  77.595  1.00  0.00           C
ATOM   4766  HE1 PHE B 192      63.511  47.566  77.992  1.00  0.00           H
ATOM   4767  CZ  PHE B 192      63.040  46.080  76.449  1.00  0.00           C
ATOM   4768  HZ  PHE B 192      62.286  46.738  76.042  1.00  0.00           H
ATOM   4769  CE2 PHE B 192      63.388  44.813  75.922  1.00  0.00           C
ATOM   4770  HE2 PHE B 192      62.928  44.404  75.035  1.00  0.00           H
ATOM   4771  CD2 PHE B 192      64.326  44.016  76.545  1.00  0.00           C
ATOM   4772  HD2 PHE B 192      64.612  43.062  76.126  1.00  0.00           H
ATOM   4773  C   PHE B 192      64.011  42.720  79.646  1.00  0.00           C
ATOM   4774  O   PHE B 192      63.714  41.581  79.132  1.00  0.00           O
ATOM   4775  N   VAL B 193      63.206  43.686  80.042  1.00  0.00           N
ATOM   4776  H   VAL B 193      63.577  44.594  80.284  1.00  0.00           H
ATOM   4777  CA  VAL B 193      61.718  43.474  80.249  1.00  0.00           C
ATOM   4778  HA  VAL B 193      61.445  42.451  79.990  1.00  0.00           H
ATOM   4779  CB  VAL B 193      61.396  43.643  81.788  1.00  0.00           C
ATOM   4780  HB  VAL B 193      61.959  44.520  82.105  1.00  0.00           H
ATOM   4781  CG1 VAL B 193      59.943  44.007  82.069  1.00  0.00           C
ATOM   4782 HG11 VAL B 193      59.754  44.287  83.105  1.00  0.00           H
ATOM   4783 HG12 VAL B 193      59.665  44.874  81.469  1.00  0.00           H
ATOM   4784 HG13 VAL B 193      59.246  43.232  81.751  1.00  0.00           H
ATOM   4785  CG2 VAL B 193      61.800  42.394  82.520  1.00  0.00           C
ATOM   4786 HG21 VAL B 193      61.493  42.467  83.564  1.00  0.00           H
ATOM   4787 HG22 VAL B 193      61.251  41.561  82.081  1.00  0.00           H
ATOM   4788 HG23 VAL B 193      62.885  42.379  82.617  1.00  0.00           H
ATOM   4789  C   VAL B 193      61.032  44.455  79.397  1.00  0.00           C
ATOM   4790  O   VAL B 193      61.075  45.661  79.622  1.00  0.00           O
ATOM   4791  N   THR B 194      60.258  44.005  78.446  1.00  0.00           N
ATOM   4792  H   THR B 194      60.261  43.003  78.313  1.00  0.00           H
ATOM   4793  CA  THR B 194      59.356  44.860  77.718  1.00  0.00           C
ATOM   4794  HA  THR B 194      59.885  45.762  77.411  1.00  0.00           H
ATOM   4795  CB  THR B 194      58.887  44.245  76.384  1.00  0.00           C
ATOM   4796  HB  THR B 194      58.244  44.902  75.798  1.00  0.00           H
ATOM   4797  CG2 THR B 194      60.047  43.951  75.399  1.00  0.00           C
ATOM   4798 HG21 THR B 194      60.500  44.884  75.065  1.00  0.00           H
ATOM   4799 HG22 THR B 194      60.779  43.287  75.858  1.00  0.00           H
ATOM   4800 HG23 THR B 194      59.638  43.461  74.516  1.00  0.00           H
ATOM   4801  OG1 THR B 194      58.173  43.024  76.579  1.00  0.00           O
ATOM   4802  HG1 THR B 194      58.829  42.467  77.005  1.00  0.00           H
ATOM   4803  C   THR B 194      58.076  45.307  78.435  1.00  0.00           C
ATOM   4804  O   THR B 194      57.388  44.523  79.055  1.00  0.00           O
ATOM   4805  N   ASN B 195      57.751  46.616  78.312  1.00  0.00           N
ATOM   4806  H   ASN B 195      58.324  47.259  77.785  1.00  0.00           H
ATOM   4807  CA  ASN B 195      56.632  47.202  78.948  1.00  0.00           C
ATOM   4808  HA  ASN B 195      56.549  46.963  80.008  1.00  0.00           H
ATOM   4809  CB  ASN B 195      56.681  48.735  78.861  1.00  0.00           C
ATOM   4810  HB2 ASN B 195      56.892  49.005  77.827  1.00  0.00           H
ATOM   4811  HB3 ASN B 195      55.686  49.067  79.158  1.00  0.00           H
ATOM   4812  CG  ASN B 195      57.689  49.442  79.721  1.00  0.00           C
ATOM   4813  OD1 ASN B 195      58.108  48.990  80.715  1.00  0.00           O
ATOM   4814  ND2 ASN B 195      57.938  50.733  79.440  1.00  0.00           N
ATOM   4815 HD21 ASN B 195      58.483  51.253  80.113  1.00  0.00           H
ATOM   4816 HD22 ASN B 195      57.617  51.326  78.687  1.00  0.00           H
ATOM   4817  C   ASN B 195      55.289  46.526  78.493  1.00  0.00           C
ATOM   4818  O   ASN B 195      54.409  46.357  79.306  1.00  0.00           O
ATOM   4819  N   VAL B 196      55.193  45.956  77.277  1.00  0.00           N
ATOM   4820  H   VAL B 196      55.958  45.944  76.618  1.00  0.00           H
ATOM   4821  CA  VAL B 196      53.946  45.206  76.834  1.00  0.00           C
ATOM   4822  HA  VAL B 196      53.124  45.827  77.191  1.00  0.00           H
ATOM   4823  CB  VAL B 196      53.912  45.071  75.304  1.00  0.00           C
ATOM   4824  HB  VAL B 196      53.040  44.462  75.066  1.00  0.00           H
ATOM   4825  CG1 VAL B 196      53.588  46.355  74.614  1.00  0.00           C
ATOM   4826 HG11 VAL B 196      52.654  46.695  75.062  1.00  0.00           H
ATOM   4827 HG12 VAL B 196      54.401  47.064  74.768  1.00  0.00           H
ATOM   4828 HG13 VAL B 196      53.544  46.367  73.525  1.00  0.00           H
ATOM   4829  CG2 VAL B 196      55.025  44.255  74.568  1.00  0.00           C
ATOM   4830 HG21 VAL B 196      54.935  43.218  74.890  1.00  0.00           H
ATOM   4831 HG22 VAL B 196      54.686  44.238  73.532  1.00  0.00           H
ATOM   4832 HG23 VAL B 196      56.030  44.640  74.741  1.00  0.00           H
ATOM   4833  C   VAL B 196      53.729  43.772  77.439  1.00  0.00           C
ATOM   4834  O   VAL B 196      52.709  43.231  77.147  1.00  0.00           O
ATOM   4835  N   ASN B 197      54.737  43.303  78.288  1.00  0.00           N
ATOM   4836  H   ASN B 197      55.508  43.936  78.446  1.00  0.00           H
ATOM   4837  CA  ASN B 197      54.780  41.952  78.745  1.00  0.00           C
ATOM   4838  HA  ASN B 197      53.827  41.438  78.868  1.00  0.00           H
ATOM   4839  CB  ASN B 197      55.492  41.136  77.611  1.00  0.00           C
ATOM   4840  HB2 ASN B 197      54.946  41.476  76.731  1.00  0.00           H
ATOM   4841  HB3 ASN B 197      56.552  41.370  77.708  1.00  0.00           H
ATOM   4842  CG  ASN B 197      55.157  39.650  77.762  1.00  0.00           C
ATOM   4843  OD1 ASN B 197      54.043  39.245  77.504  1.00  0.00           O
ATOM   4844  ND2 ASN B 197      56.142  38.810  77.996  1.00  0.00           N
ATOM   4845 HD21 ASN B 197      56.028  37.808  78.033  1.00  0.00           H
ATOM   4846 HD22 ASN B 197      57.015  39.221  78.295  1.00  0.00           H
ATOM   4847  C   ASN B 197      55.504  41.901  80.143  1.00  0.00           C
ATOM   4848  O   ASN B 197      55.913  40.830  80.616  1.00  0.00           O
ATOM   4849  N   ALA B 198      55.553  42.971  80.867  1.00  0.00           N
ATOM   4850  H   ALA B 198      55.313  43.846  80.423  1.00  0.00           H
ATOM   4851  CA  ALA B 198      56.063  43.058  82.285  1.00  0.00           C
ATOM   4852  HA  ALA B 198      57.068  42.636  82.301  1.00  0.00           H
ATOM   4853  CB  ALA B 198      56.186  44.516  82.566  1.00  0.00           C
ATOM   4854  HB1 ALA B 198      56.541  44.585  83.594  1.00  0.00           H
ATOM   4855  HB2 ALA B 198      57.017  44.995  82.048  1.00  0.00           H
ATOM   4856  HB3 ALA B 198      55.261  45.040  82.323  1.00  0.00           H
ATOM   4857  C   ALA B 198      55.203  42.303  83.321  1.00  0.00           C
ATOM   4858  O   ALA B 198      55.588  42.111  84.424  1.00  0.00           O
ATOM   4859  N   SER B 199      54.052  41.695  82.929  1.00  0.00           N
ATOM   4860  H   SER B 199      53.947  41.835  81.934  1.00  0.00           H
ATOM   4861  CA  SER B 199      53.098  40.840  83.649  1.00  0.00           C
ATOM   4862  HA  SER B 199      52.859  41.216  84.643  1.00  0.00           H
ATOM   4863  CB  SER B 199      51.749  40.750  82.825  1.00  0.00           C
ATOM   4864  HB2 SER B 199      51.077  39.997  83.237  1.00  0.00           H
ATOM   4865  HB3 SER B 199      51.230  41.709  82.809  1.00  0.00           H
ATOM   4866  OG  SER B 199      52.076  40.361  81.493  1.00  0.00           O
ATOM   4867  HG  SER B 199      51.652  39.513  81.338  1.00  0.00           H
ATOM   4868  C   SER B 199      53.727  39.438  83.773  1.00  0.00           C
ATOM   4869  O   SER B 199      53.137  38.591  84.516  1.00  0.00           O
ATOM   4870  N   SER B 200      54.790  39.095  83.012  1.00  0.00           N
ATOM   4871  H   SER B 200      55.145  39.721  82.303  1.00  0.00           H
ATOM   4872  CA  SER B 200      55.387  37.768  82.959  1.00  0.00           C
ATOM   4873  HA  SER B 200      54.774  37.134  83.599  1.00  0.00           H
ATOM   4874  CB  SER B 200      55.391  37.157  81.528  1.00  0.00           C
ATOM   4875  HB2 SER B 200      54.359  37.010  81.208  1.00  0.00           H
ATOM   4876  HB3 SER B 200      55.880  37.802  80.799  1.00  0.00           H
ATOM   4877  OG  SER B 200      56.017  35.863  81.489  1.00  0.00           O
ATOM   4878  HG  SER B 200      55.792  35.637  80.583  1.00  0.00           H
ATOM   4879  C   SER B 200      56.836  37.697  83.500  1.00  0.00           C
ATOM   4880  O   SER B 200      57.588  38.681  83.483  1.00  0.00           O
ATOM   4881  N   SER B 201      57.276  36.631  84.184  1.00  0.00           N
ATOM   4882  H   SER B 201      56.657  35.848  84.333  1.00  0.00           H
ATOM   4883  CA  SER B 201      58.628  36.306  84.465  1.00  0.00           C
ATOM   4884  HA  SER B 201      59.027  36.975  85.228  1.00  0.00           H
ATOM   4885  CB  SER B 201      58.591  34.901  85.063  1.00  0.00           C
ATOM   4886  HB2 SER B 201      59.388  34.652  85.763  1.00  0.00           H
ATOM   4887  HB3 SER B 201      57.712  34.852  85.706  1.00  0.00           H
ATOM   4888  OG  SER B 201      58.502  33.837  84.091  1.00  0.00           O
ATOM   4889  HG  SER B 201      58.064  33.115  84.547  1.00  0.00           H
ATOM   4890  C   SER B 201      59.580  36.272  83.274  1.00  0.00           C
ATOM   4891  O   SER B 201      60.814  36.199  83.488  1.00  0.00           O
ATOM   4892  N   GLU B 202      59.068  36.236  82.053  1.00  0.00           N
ATOM   4893  H   GLU B 202      58.060  36.175  82.044  1.00  0.00           H
ATOM   4894  CA  GLU B 202      59.778  36.278  80.748  1.00  0.00           C
ATOM   4895  HA  GLU B 202      60.474  35.441  80.698  1.00  0.00           H
ATOM   4896  CB  GLU B 202      58.665  36.126  79.669  1.00  0.00           C
ATOM   4897  HB2 GLU B 202      58.162  35.159  79.693  1.00  0.00           H
ATOM   4898  HB3 GLU B 202      58.034  37.013  79.623  1.00  0.00           H
ATOM   4899  CG  GLU B 202      59.234  36.091  78.202  1.00  0.00           C
ATOM   4900  HG2 GLU B 202      59.987  36.878  78.202  1.00  0.00           H
ATOM   4901  HG3 GLU B 202      59.756  35.163  77.966  1.00  0.00           H
ATOM   4902  CD  GLU B 202      58.279  36.419  77.129  1.00  0.00           C
ATOM   4903  OE1 GLU B 202      58.673  37.359  76.434  1.00  0.00           O
ATOM   4904  OE2 GLU B 202      57.125  35.984  77.118  1.00  0.00           O
ATOM   4905  C   GLU B 202      60.671  37.583  80.638  1.00  0.00           C
ATOM   4906  O   GLU B 202      60.249  38.681  81.085  1.00  0.00           O
ATOM   4907  N   ALA B 203      61.872  37.446  79.979  1.00  0.00           N
ATOM   4908  H   ALA B 203      62.055  36.558  79.534  1.00  0.00           H
ATOM   4909  CA  ALA B 203      62.857  38.459  79.686  1.00  0.00           C
ATOM   4910  HA  ALA B 203      62.291  39.344  79.397  1.00  0.00           H
ATOM   4911  CB  ALA B 203      63.748  38.780  80.997  1.00  0.00           C
ATOM   4912  HB1 ALA B 203      64.411  37.929  81.149  1.00  0.00           H
ATOM   4913  HB2 ALA B 203      64.388  39.654  80.876  1.00  0.00           H
ATOM   4914  HB3 ALA B 203      63.127  38.977  81.871  1.00  0.00           H
ATOM   4915  C   ALA B 203      63.712  38.026  78.536  1.00  0.00           C
ATOM   4916  O   ALA B 203      63.902  36.849  78.243  1.00  0.00           O
ATOM   4917  N   PHE B 204      64.281  38.993  77.773  1.00  0.00           N
ATOM   4918  H   PHE B 204      64.164  39.977  77.971  1.00  0.00           H
ATOM   4919  CA  PHE B 204      65.501  38.646  76.926  1.00  0.00           C
ATOM   4920  HA  PHE B 204      65.484  37.609  76.591  1.00  0.00           H
ATOM   4921  CB  PHE B 204      65.460  39.438  75.653  1.00  0.00           C
ATOM   4922  HB2 PHE B 204      65.621  40.471  75.962  1.00  0.00           H
ATOM   4923  HB3 PHE B 204      66.312  39.184  75.024  1.00  0.00           H
ATOM   4924  CG  PHE B 204      64.233  39.170  74.796  1.00  0.00           C
ATOM   4925  CD1 PHE B 204      63.111  39.972  74.844  1.00  0.00           C
ATOM   4926  HD1 PHE B 204      63.070  40.820  75.511  1.00  0.00           H
ATOM   4927  CE1 PHE B 204      62.065  39.877  73.882  1.00  0.00           C
ATOM   4928  HE1 PHE B 204      61.257  40.583  73.758  1.00  0.00           H
ATOM   4929  CZ  PHE B 204      62.139  38.795  72.937  1.00  0.00           C
ATOM   4930  HZ  PHE B 204      61.486  38.680  72.084  1.00  0.00           H
ATOM   4931  CE2 PHE B 204      63.224  37.916  72.953  1.00  0.00           C
ATOM   4932  HE2 PHE B 204      63.401  37.266  72.109  1.00  0.00           H
ATOM   4933  CD2 PHE B 204      64.263  38.107  73.883  1.00  0.00           C
ATOM   4934  HD2 PHE B 204      65.106  37.442  73.998  1.00  0.00           H
ATOM   4935  C   PHE B 204      66.823  38.950  77.635  1.00  0.00           C
ATOM   4936  O   PHE B 204      67.037  39.995  78.278  1.00  0.00           O
ATOM   4937  N   LEU B 205      67.740  37.958  77.429  1.00  0.00           N
ATOM   4938  H   LEU B 205      67.488  37.131  76.907  1.00  0.00           H
ATOM   4939  CA  LEU B 205      69.082  37.982  77.905  1.00  0.00           C
ATOM   4940  HA  LEU B 205      69.251  38.685  78.720  1.00  0.00           H
ATOM   4941  CB  LEU B 205      69.590  36.593  78.396  1.00  0.00           C
ATOM   4942  HB2 LEU B 205      68.999  36.372  79.285  1.00  0.00           H
ATOM   4943  HB3 LEU B 205      69.370  35.855  77.625  1.00  0.00           H
ATOM   4944  CG  LEU B 205      71.076  36.471  78.809  1.00  0.00           C
ATOM   4945  HG  LEU B 205      71.714  36.818  77.997  1.00  0.00           H
ATOM   4946  CD1 LEU B 205      71.311  37.380  80.005  1.00  0.00           C
ATOM   4947 HD11 LEU B 205      70.582  37.185  80.792  1.00  0.00           H
ATOM   4948 HD12 LEU B 205      72.262  37.169  80.493  1.00  0.00           H
ATOM   4949 HD13 LEU B 205      71.275  38.432  79.722  1.00  0.00           H
ATOM   4950  CD2 LEU B 205      71.440  35.020  79.162  1.00  0.00           C
ATOM   4951 HD21 LEU B 205      72.518  34.882  79.248  1.00  0.00           H
ATOM   4952 HD22 LEU B 205      71.020  34.911  80.162  1.00  0.00           H
ATOM   4953 HD23 LEU B 205      71.074  34.336  78.396  1.00  0.00           H
ATOM   4954  C   LEU B 205      69.954  38.439  76.729  1.00  0.00           C
ATOM   4955  O   LEU B 205      69.994  37.877  75.614  1.00  0.00           O
ATOM   4956  N   ILE B 206      70.663  39.614  76.916  1.00  0.00           N
ATOM   4957  H   ILE B 206      70.546  40.041  77.824  1.00  0.00           H
ATOM   4958  CA  ILE B 206      71.282  40.427  75.846  1.00  0.00           C
ATOM   4959  HA  ILE B 206      71.317  39.827  74.937  1.00  0.00           H
ATOM   4960  CB  ILE B 206      70.457  41.698  75.630  1.00  0.00           C
ATOM   4961  HB  ILE B 206      70.288  42.313  76.514  1.00  0.00           H
ATOM   4962  CG2 ILE B 206      71.109  42.764  74.657  1.00  0.00           C
ATOM   4963 HG21 ILE B 206      71.159  42.348  73.650  1.00  0.00           H
ATOM   4964 HG22 ILE B 206      70.533  43.687  74.595  1.00  0.00           H
ATOM   4965 HG23 ILE B 206      72.054  43.124  75.062  1.00  0.00           H
ATOM   4966  CG1 ILE B 206      69.003  41.376  75.149  1.00  0.00           C
ATOM   4967 HG12 ILE B 206      69.062  41.078  74.102  1.00  0.00           H
ATOM   4968 HG13 ILE B 206      68.633  40.489  75.662  1.00  0.00           H
ATOM   4969  CD1 ILE B 206      68.016  42.464  75.338  1.00  0.00           C
ATOM   4970 HD11 ILE B 206      68.199  42.915  76.314  1.00  0.00           H
ATOM   4971 HD12 ILE B 206      68.267  43.153  74.531  1.00  0.00           H
ATOM   4972 HD13 ILE B 206      66.956  42.250  75.202  1.00  0.00           H
ATOM   4973  C   ILE B 206      72.755  40.725  76.150  1.00  0.00           C
ATOM   4974  O   ILE B 206      73.073  41.145  77.222  1.00  0.00           O
ATOM   4975  N   GLY B 207      73.658  40.620  75.185  1.00  0.00           N
ATOM   4976  H   GLY B 207      73.377  40.097  74.368  1.00  0.00           H
ATOM   4977  CA  GLY B 207      75.044  40.994  75.196  1.00  0.00           C
ATOM   4978  HA2 GLY B 207      75.271  41.418  76.174  1.00  0.00           H
ATOM   4979  HA3 GLY B 207      75.664  40.130  74.956  1.00  0.00           H
ATOM   4980  C   GLY B 207      75.290  41.966  74.013  1.00  0.00           C
ATOM   4981  O   GLY B 207      74.933  41.669  72.852  1.00  0.00           O
ATOM   4982  N   CYS B 208      76.050  43.014  74.160  1.00  0.00           N
ATOM   4983  H   CYS B 208      76.292  43.269  75.107  1.00  0.00           H
ATOM   4984  CA  CYS B 208      76.491  44.068  73.257  1.00  0.00           C
ATOM   4985  HA  CYS B 208      75.977  43.812  72.330  1.00  0.00           H
ATOM   4986  CB  CYS B 208      75.839  45.383  73.737  1.00  0.00           C
ATOM   4987  HB2 CYS B 208      74.764  45.356  73.917  1.00  0.00           H
ATOM   4988  HB3 CYS B 208      76.300  45.826  74.619  1.00  0.00           H
ATOM   4989  SG  CYS B 208      76.269  46.614  72.477  1.00  0.00           S
ATOM   4990  HG  CYS B 208      76.298  47.582  73.397  1.00  0.00           H
ATOM   4991  C   CYS B 208      78.064  44.067  73.015  1.00  0.00           C
ATOM   4992  O   CYS B 208      78.906  43.986  73.936  1.00  0.00           O
ATOM   4993  N   ASN B 209      78.392  44.152  71.744  1.00  0.00           N
ATOM   4994  H   ASN B 209      77.597  44.395  71.171  1.00  0.00           H
ATOM   4995  CA  ASN B 209      79.689  44.025  71.068  1.00  0.00           C
ATOM   4996  HA  ASN B 209      79.541  43.949  69.991  1.00  0.00           H
ATOM   4997  CB  ASN B 209      80.521  45.328  71.191  1.00  0.00           C
ATOM   4998  HB2 ASN B 209      80.740  45.535  72.239  1.00  0.00           H
ATOM   4999  HB3 ASN B 209      81.522  45.201  70.780  1.00  0.00           H
ATOM   5000  CG  ASN B 209      79.884  46.604  70.600  1.00  0.00           C
ATOM   5001  OD1 ASN B 209      79.770  47.601  71.308  1.00  0.00           O
ATOM   5002  ND2 ASN B 209      79.262  46.576  69.400  1.00  0.00           N
ATOM   5003 HD21 ASN B 209      78.875  47.486  69.197  1.00  0.00           H
ATOM   5004 HD22 ASN B 209      79.293  45.736  68.839  1.00  0.00           H
ATOM   5005  C   ASN B 209      80.445  42.806  71.687  1.00  0.00           C
ATOM   5006  O   ASN B 209      81.202  42.922  72.603  1.00  0.00           O
ATOM   5007  N   TYR B 210      80.334  41.632  71.048  1.00  0.00           N
ATOM   5008  H   TYR B 210      79.641  41.522  70.321  1.00  0.00           H
ATOM   5009  CA  TYR B 210      81.213  40.453  71.232  1.00  0.00           C
ATOM   5010  HA  TYR B 210      80.964  40.100  72.233  1.00  0.00           H
ATOM   5011  CB  TYR B 210      80.736  39.428  70.211  1.00  0.00           C
ATOM   5012  HB2 TYR B 210      79.657  39.439  70.059  1.00  0.00           H
ATOM   5013  HB3 TYR B 210      81.031  39.842  69.247  1.00  0.00           H
ATOM   5014  CG  TYR B 210      81.119  37.924  70.362  1.00  0.00           C
ATOM   5015  CD1 TYR B 210      81.026  37.255  71.590  1.00  0.00           C
ATOM   5016  HD1 TYR B 210      80.461  37.751  72.365  1.00  0.00           H
ATOM   5017  CE1 TYR B 210      81.549  35.951  71.724  1.00  0.00           C
ATOM   5018  HE1 TYR B 210      81.350  35.451  72.661  1.00  0.00           H
ATOM   5019  CZ  TYR B 210      82.301  35.394  70.669  1.00  0.00           C
ATOM   5020  OH  TYR B 210      82.687  34.077  70.785  1.00  0.00           O
ATOM   5021  HH  TYR B 210      82.536  33.758  71.678  1.00  0.00           H
ATOM   5022  CE2 TYR B 210      82.372  36.076  69.425  1.00  0.00           C
ATOM   5023  HE2 TYR B 210      82.865  35.689  68.545  1.00  0.00           H
ATOM   5024  CD2 TYR B 210      81.782  37.358  69.257  1.00  0.00           C
ATOM   5025  HD2 TYR B 210      81.899  37.869  68.313  1.00  0.00           H
ATOM   5026  C   TYR B 210      82.701  40.738  71.067  1.00  0.00           C
ATOM   5027  O   TYR B 210      83.113  41.219  70.003  1.00  0.00           O
ATOM   5028  N   LEU B 211      83.488  40.219  72.003  1.00  0.00           N
ATOM   5029  H   LEU B 211      83.030  39.931  72.857  1.00  0.00           H
ATOM   5030  CA  LEU B 211      84.965  40.355  72.082  1.00  0.00           C
ATOM   5031  HA  LEU B 211      85.364  40.848  71.196  1.00  0.00           H
ATOM   5032  CB  LEU B 211      85.289  41.227  73.361  1.00  0.00           C
ATOM   5033  HB2 LEU B 211      85.151  40.677  74.292  1.00  0.00           H
ATOM   5034  HB3 LEU B 211      86.375  41.318  73.356  1.00  0.00           H
ATOM   5035  CG  LEU B 211      84.650  42.583  73.510  1.00  0.00           C
ATOM   5036  HG  LEU B 211      83.618  42.266  73.661  1.00  0.00           H
ATOM   5037  CD1 LEU B 211      85.224  43.349  74.700  1.00  0.00           C
ATOM   5038 HD11 LEU B 211      86.201  43.736  74.409  1.00  0.00           H
ATOM   5039 HD12 LEU B 211      84.542  44.187  74.846  1.00  0.00           H
ATOM   5040 HD13 LEU B 211      85.246  42.737  75.601  1.00  0.00           H
ATOM   5041  CD2 LEU B 211      84.939  43.438  72.303  1.00  0.00           C
ATOM   5042 HD21 LEU B 211      84.396  42.948  71.494  1.00  0.00           H
ATOM   5043 HD22 LEU B 211      84.518  44.436  72.422  1.00  0.00           H
ATOM   5044 HD23 LEU B 211      86.000  43.568  72.090  1.00  0.00           H
ATOM   5045  C   LEU B 211      85.734  38.997  72.186  1.00  0.00           C
ATOM   5046  O   LEU B 211      86.980  38.856  72.129  1.00  0.00           O
ATOM   5047  N   GLY B 212      84.967  37.924  72.278  1.00  0.00           N
ATOM   5048  H   GLY B 212      84.006  38.234  72.278  1.00  0.00           H
ATOM   5049  CA  GLY B 212      85.397  36.548  72.420  1.00  0.00           C
ATOM   5050  HA2 GLY B 212      84.476  35.973  72.520  1.00  0.00           H
ATOM   5051  HA3 GLY B 212      85.949  36.203  71.546  1.00  0.00           H
ATOM   5052  C   GLY B 212      86.291  36.225  73.567  1.00  0.00           C
ATOM   5053  O   GLY B 212      86.966  35.194  73.459  1.00  0.00           O
ATOM   5054  N   LYS B 213      86.328  37.080  74.605  1.00  0.00           N
ATOM   5055  H   LYS B 213      85.744  37.903  74.656  1.00  0.00           H
ATOM   5056  CA  LYS B 213      87.238  37.039  75.753  1.00  0.00           C
ATOM   5057  HA  LYS B 213      87.425  36.042  76.151  1.00  0.00           H
ATOM   5058  CB  LYS B 213      88.602  37.550  75.386  1.00  0.00           C
ATOM   5059  HB2 LYS B 213      89.222  37.151  76.189  1.00  0.00           H
ATOM   5060  HB3 LYS B 213      88.926  37.149  74.425  1.00  0.00           H
ATOM   5061  CG  LYS B 213      88.689  39.110  75.377  1.00  0.00           C
ATOM   5062  HG2 LYS B 213      87.854  39.580  74.857  1.00  0.00           H
ATOM   5063  HG3 LYS B 213      88.801  39.609  76.339  1.00  0.00           H
ATOM   5064  CD  LYS B 213      89.947  39.475  74.582  1.00  0.00           C
ATOM   5065  HD2 LYS B 213      89.997  38.989  73.608  1.00  0.00           H
ATOM   5066  HD3 LYS B 213      90.016  40.558  74.481  1.00  0.00           H
ATOM   5067  CE  LYS B 213      91.217  38.977  75.406  1.00  0.00           C
ATOM   5068  HE2 LYS B 213      91.405  39.622  76.265  1.00  0.00           H
ATOM   5069  HE3 LYS B 213      90.980  38.016  75.863  1.00  0.00           H
ATOM   5070  NZ  LYS B 213      92.392  38.858  74.453  1.00  0.00           N
ATOM   5071  HZ1 LYS B 213      92.174  38.105  73.817  1.00  0.00           H
ATOM   5072  HZ2 LYS B 213      92.388  39.622  73.792  1.00  0.00           H
ATOM   5073  HZ3 LYS B 213      93.310  38.708  74.847  1.00  0.00           H
ATOM   5074  C   LYS B 213      86.604  37.894  76.875  1.00  0.00           C
ATOM   5075  O   LYS B 213      86.053  38.955  76.556  1.00  0.00           O
ATOM   5076  N   PRO B 214      86.574  37.384  78.115  1.00  0.00           N
ATOM   5077  CD  PRO B 214      86.733  36.028  78.504  1.00  0.00           C
ATOM   5078  HD2 PRO B 214      87.614  35.889  79.130  1.00  0.00           H
ATOM   5079  HD3 PRO B 214      86.594  35.354  77.659  1.00  0.00           H
ATOM   5080  CG  PRO B 214      85.525  35.753  79.450  1.00  0.00           C
ATOM   5081  HG2 PRO B 214      85.603  34.883  80.101  1.00  0.00           H
ATOM   5082  HG3 PRO B 214      84.622  35.663  78.845  1.00  0.00           H
ATOM   5083  CB  PRO B 214      85.588  37.060  80.251  1.00  0.00           C
ATOM   5084  HB2 PRO B 214      86.341  36.939  81.030  1.00  0.00           H
ATOM   5085  HB3 PRO B 214      84.629  37.321  80.698  1.00  0.00           H
ATOM   5086  CA  PRO B 214      85.985  38.135  79.286  1.00  0.00           C
ATOM   5087  HA  PRO B 214      85.084  38.636  78.931  1.00  0.00           H
ATOM   5088  C   PRO B 214      86.989  39.112  79.952  1.00  0.00           C
ATOM   5089  O   PRO B 214      88.147  38.873  80.043  1.00  0.00           O
ATOM   5090  N   ARG B 215      86.495  40.262  80.491  1.00  0.00           N
ATOM   5091  H   ARG B 215      85.558  40.578  80.286  1.00  0.00           H
ATOM   5092  CA  ARG B 215      87.241  41.123  81.509  1.00  0.00           C
ATOM   5093  HA  ARG B 215      88.283  41.258  81.218  1.00  0.00           H
ATOM   5094  CB  ARG B 215      86.669  42.502  81.566  1.00  0.00           C
ATOM   5095  HB2 ARG B 215      86.439  42.777  80.537  1.00  0.00           H
ATOM   5096  HB3 ARG B 215      85.687  42.513  82.041  1.00  0.00           H
ATOM   5097  CG  ARG B 215      87.504  43.667  82.143  1.00  0.00           C
ATOM   5098  HG2 ARG B 215      87.807  43.427  83.162  1.00  0.00           H
ATOM   5099  HG3 ARG B 215      88.361  43.837  81.492  1.00  0.00           H
ATOM   5100  CD  ARG B 215      86.784  44.977  82.142  1.00  0.00           C
ATOM   5101  HD2 ARG B 215      87.338  45.647  82.799  1.00  0.00           H
ATOM   5102  HD3 ARG B 215      86.832  45.288  81.099  1.00  0.00           H
ATOM   5103  NE  ARG B 215      85.479  44.890  82.787  1.00  0.00           N
ATOM   5104  HE  ARG B 215      85.236  44.050  83.293  1.00  0.00           H
ATOM   5105  CZ  ARG B 215      84.596  45.867  82.938  1.00  0.00           C
ATOM   5106  NH1 ARG B 215      84.645  47.002  82.237  1.00  0.00           N
ATOM   5107 HH11 ARG B 215      85.268  47.164  81.458  1.00  0.00           H
ATOM   5108 HH12 ARG B 215      83.907  47.680  82.363  1.00  0.00           H
ATOM   5109  NH2 ARG B 215      83.487  45.616  83.621  1.00  0.00           N
ATOM   5110 HH21 ARG B 215      83.300  44.736  84.081  1.00  0.00           H
ATOM   5111 HH22 ARG B 215      82.826  46.367  83.763  1.00  0.00           H
ATOM   5112  C   ARG B 215      87.268  40.605  82.924  1.00  0.00           C
ATOM   5113  O   ARG B 215      88.344  40.511  83.529  1.00  0.00           O
ATOM   5114  N   GLU B 216      86.153  39.974  83.359  1.00  0.00           N
ATOM   5115  H   GLU B 216      85.317  40.032  82.796  1.00  0.00           H
ATOM   5116  CA  GLU B 216      85.967  39.177  84.600  1.00  0.00           C
ATOM   5117  HA  GLU B 216      86.949  38.830  84.921  1.00  0.00           H
ATOM   5118  CB  GLU B 216      85.235  40.061  85.684  1.00  0.00           C
ATOM   5119  HB2 GLU B 216      84.859  39.403  86.467  1.00  0.00           H
ATOM   5120  HB3 GLU B 216      85.942  40.812  86.038  1.00  0.00           H
ATOM   5121  CG  GLU B 216      83.978  40.874  85.349  1.00  0.00           C
ATOM   5122  HG2 GLU B 216      83.340  40.211  84.764  1.00  0.00           H
ATOM   5123  HG3 GLU B 216      83.375  40.929  86.255  1.00  0.00           H
ATOM   5124  CD  GLU B 216      84.176  42.309  84.865  1.00  0.00           C
ATOM   5125  OE1 GLU B 216      85.322  42.772  84.678  1.00  0.00           O
ATOM   5126  OE2 GLU B 216      83.163  42.906  84.456  1.00  0.00           O
ATOM   5127  C   GLU B 216      85.096  37.965  84.233  1.00  0.00           C
ATOM   5128  O   GLU B 216      84.259  37.968  83.312  1.00  0.00           O
ATOM   5129  N   GLN B 217      85.229  36.915  85.010  1.00  0.00           N
ATOM   5130  H   GLN B 217      86.076  36.869  85.559  1.00  0.00           H
ATOM   5131  CA  GLN B 217      84.297  35.807  84.916  1.00  0.00           C
ATOM   5132  HA  GLN B 217      83.986  35.674  83.880  1.00  0.00           H
ATOM   5133  CB  GLN B 217      84.975  34.600  85.450  1.00  0.00           C
ATOM   5134  HB2 GLN B 217      85.987  34.642  85.046  1.00  0.00           H
ATOM   5135  HB3 GLN B 217      85.136  34.688  86.524  1.00  0.00           H
ATOM   5136  CG  GLN B 217      84.279  33.221  85.092  1.00  0.00           C
ATOM   5137  HG2 GLN B 217      84.602  32.415  85.752  1.00  0.00           H
ATOM   5138  HG3 GLN B 217      83.218  33.343  85.312  1.00  0.00           H
ATOM   5139  CD  GLN B 217      84.478  32.842  83.607  1.00  0.00           C
ATOM   5140  OE1 GLN B 217      83.697  32.873  82.678  1.00  0.00           O
ATOM   5141  NE2 GLN B 217      85.731  32.587  83.249  1.00  0.00           N
ATOM   5142 HE21 GLN B 217      86.003  32.610  82.277  1.00  0.00           H
ATOM   5143 HE22 GLN B 217      86.414  32.382  83.965  1.00  0.00           H
ATOM   5144  C   GLN B 217      82.980  36.038  85.739  1.00  0.00           C
ATOM   5145  O   GLN B 217      83.058  36.449  86.873  1.00  0.00           O
ATOM   5146  N   ILE B 218      81.816  35.670  85.227  1.00  0.00           N
ATOM   5147  H   ILE B 218      81.679  35.198  84.344  1.00  0.00           H
ATOM   5148  CA  ILE B 218      80.558  35.799  85.943  1.00  0.00           C
ATOM   5149  HA  ILE B 218      80.536  36.688  86.574  1.00  0.00           H
ATOM   5150  CB  ILE B 218      79.417  35.974  84.903  1.00  0.00           C
ATOM   5151  HB  ILE B 218      79.387  35.085  84.273  1.00  0.00           H
ATOM   5152  CG2 ILE B 218      78.015  35.991  85.616  1.00  0.00           C
ATOM   5153 HG21 ILE B 218      77.915  36.752  86.391  1.00  0.00           H
ATOM   5154 HG22 ILE B 218      77.179  36.264  84.973  1.00  0.00           H
ATOM   5155 HG23 ILE B 218      77.696  35.088  86.138  1.00  0.00           H
ATOM   5156  CG1 ILE B 218      79.445  37.266  83.997  1.00  0.00           C
ATOM   5157 HG12 ILE B 218      79.065  38.111  84.573  1.00  0.00           H
ATOM   5158 HG13 ILE B 218      80.454  37.587  83.736  1.00  0.00           H
ATOM   5159  CD1 ILE B 218      78.705  37.243  82.689  1.00  0.00           C
ATOM   5160 HD11 ILE B 218      78.923  38.186  82.188  1.00  0.00           H
ATOM   5161 HD12 ILE B 218      79.215  36.448  82.147  1.00  0.00           H
ATOM   5162 HD13 ILE B 218      77.628  37.114  82.792  1.00  0.00           H
ATOM   5163  C   ILE B 218      80.409  34.472  86.714  1.00  0.00           C
ATOM   5164  O   ILE B 218      80.808  33.426  86.206  1.00  0.00           O
ATOM   5165  N   ASP B 219      79.703  34.349  87.908  1.00  0.00           N
ATOM   5166  H   ASP B 219      79.543  35.267  88.297  1.00  0.00           H
ATOM   5167  CA  ASP B 219      79.363  33.198  88.723  1.00  0.00           C
ATOM   5168  HA  ASP B 219      80.248  32.562  88.730  1.00  0.00           H
ATOM   5169  CB  ASP B 219      79.128  33.570  90.130  1.00  0.00           C
ATOM   5170  HB2 ASP B 219      78.243  34.204  90.174  1.00  0.00           H
ATOM   5171  HB3 ASP B 219      78.940  32.603  90.596  1.00  0.00           H
ATOM   5172  CG  ASP B 219      80.298  34.306  90.758  1.00  0.00           C
ATOM   5173  OD1 ASP B 219      80.632  35.398  90.279  1.00  0.00           O
ATOM   5174  OD2 ASP B 219      80.872  33.836  91.759  1.00  0.00           O
ATOM   5175  C   ASP B 219      78.167  32.387  88.120  1.00  0.00           C
ATOM   5176  O   ASP B 219      77.342  31.862  88.901  1.00  0.00           O
ATOM   5177  N   GLY B 220      78.150  32.416  86.797  1.00  0.00           N
ATOM   5178  H   GLY B 220      78.916  32.889  86.339  1.00  0.00           H
ATOM   5179  CA  GLY B 220      77.311  31.728  85.874  1.00  0.00           C
ATOM   5180  HA2 GLY B 220      77.387  32.283  84.938  1.00  0.00           H
ATOM   5181  HA3 GLY B 220      77.790  30.765  85.698  1.00  0.00           H
ATOM   5182  C   GLY B 220      75.827  31.682  86.444  1.00  0.00           C
ATOM   5183  O   GLY B 220      75.062  32.724  86.328  1.00  0.00           O
ATOM   5184  N   TYR B 221      75.449  30.477  86.904  1.00  0.00           N
ATOM   5185  H   TYR B 221      76.020  29.666  86.718  1.00  0.00           H
ATOM   5186  CA  TYR B 221      74.130  30.169  87.451  1.00  0.00           C
ATOM   5187  HA  TYR B 221      73.521  30.175  86.547  1.00  0.00           H
ATOM   5188  CB  TYR B 221      74.152  28.739  87.991  1.00  0.00           C
ATOM   5189  HB2 TYR B 221      73.109  28.422  88.018  1.00  0.00           H
ATOM   5190  HB3 TYR B 221      74.619  28.113  87.231  1.00  0.00           H
ATOM   5191  CG  TYR B 221      74.796  28.569  89.376  1.00  0.00           C
ATOM   5192  CD1 TYR B 221      74.066  28.721  90.626  1.00  0.00           C
ATOM   5193  HD1 TYR B 221      72.991  28.818  90.632  1.00  0.00           H
ATOM   5194  CE1 TYR B 221      74.711  28.644  91.892  1.00  0.00           C
ATOM   5195  HE1 TYR B 221      74.236  28.954  92.812  1.00  0.00           H
ATOM   5196  CZ  TYR B 221      76.104  28.328  91.969  1.00  0.00           C
ATOM   5197  OH  TYR B 221      76.783  28.326  93.134  1.00  0.00           O
ATOM   5198  HH  TYR B 221      77.714  28.202  92.937  1.00  0.00           H
ATOM   5199  CE2 TYR B 221      76.777  28.063  90.749  1.00  0.00           C
ATOM   5200  HE2 TYR B 221      77.795  27.731  90.892  1.00  0.00           H
ATOM   5201  CD2 TYR B 221      76.166  28.378  89.511  1.00  0.00           C
ATOM   5202  HD2 TYR B 221      76.720  28.205  88.600  1.00  0.00           H
ATOM   5203  C   TYR B 221      73.439  31.080  88.445  1.00  0.00           C
ATOM   5204  O   TYR B 221      72.207  31.152  88.539  1.00  0.00           O
ATOM   5205  N   VAL B 222      74.256  31.813  89.234  1.00  0.00           N
ATOM   5206  H   VAL B 222      75.201  31.775  88.879  1.00  0.00           H
ATOM   5207  CA  VAL B 222      73.853  32.867  90.278  1.00  0.00           C
ATOM   5208  HA  VAL B 222      73.219  32.453  91.062  1.00  0.00           H
ATOM   5209  CB  VAL B 222      75.126  33.176  91.014  1.00  0.00           C
ATOM   5210  HB  VAL B 222      75.833  33.552  90.275  1.00  0.00           H
ATOM   5211  CG1 VAL B 222      74.955  34.308  92.037  1.00  0.00           C
ATOM   5212 HG11 VAL B 222      75.898  34.372  92.579  1.00  0.00           H
ATOM   5213 HG12 VAL B 222      74.852  35.248  91.494  1.00  0.00           H
ATOM   5214 HG13 VAL B 222      74.055  34.275  92.650  1.00  0.00           H
ATOM   5215  CG2 VAL B 222      75.762  32.006  91.755  1.00  0.00           C
ATOM   5216 HG21 VAL B 222      76.770  32.267  92.077  1.00  0.00           H
ATOM   5217 HG22 VAL B 222      75.237  31.652  92.643  1.00  0.00           H
ATOM   5218 HG23 VAL B 222      75.874  31.160  91.078  1.00  0.00           H
ATOM   5219  C   VAL B 222      73.220  34.074  89.684  1.00  0.00           C
ATOM   5220  O   VAL B 222      72.442  34.810  90.296  1.00  0.00           O
ATOM   5221  N   MET B 223      73.381  34.373  88.394  1.00  0.00           N
ATOM   5222  H   MET B 223      73.938  33.753  87.823  1.00  0.00           H
ATOM   5223  CA  MET B 223      72.774  35.544  87.850  1.00  0.00           C
ATOM   5224  HA  MET B 223      72.753  36.415  88.505  1.00  0.00           H
ATOM   5225  CB  MET B 223      73.621  35.963  86.641  1.00  0.00           C
ATOM   5226  HB2 MET B 223      74.647  36.033  87.001  1.00  0.00           H
ATOM   5227  HB3 MET B 223      73.509  35.210  85.861  1.00  0.00           H
ATOM   5228  CG  MET B 223      73.185  37.333  86.118  1.00  0.00           C
ATOM   5229  HG2 MET B 223      73.581  37.541  85.124  1.00  0.00           H
ATOM   5230  HG3 MET B 223      72.122  37.400  85.887  1.00  0.00           H
ATOM   5231  SD  MET B 223      73.515  38.675  87.264  1.00  0.00           S
ATOM   5232  CE  MET B 223      75.368  38.770  87.125  1.00  0.00           C
ATOM   5233  HE1 MET B 223      75.771  37.859  87.567  1.00  0.00           H
ATOM   5234  HE2 MET B 223      75.727  38.850  86.099  1.00  0.00           H
ATOM   5235  HE3 MET B 223      75.698  39.663  87.656  1.00  0.00           H
ATOM   5236  C   MET B 223      71.236  35.375  87.591  1.00  0.00           C
ATOM   5237  O   MET B 223      70.537  36.374  87.772  1.00  0.00           O
ATOM   5238  N   HIE B 224      70.709  34.203  87.343  1.00  0.00           N
ATOM   5239  H   HIE B 224      71.275  33.394  87.129  1.00  0.00           H
ATOM   5240  CA  HIE B 224      69.295  33.900  87.265  1.00  0.00           C
ATOM   5241  HA  HIE B 224      68.774  34.608  86.620  1.00  0.00           H
ATOM   5242  CB  HIE B 224      69.178  32.447  86.773  1.00  0.00           C
ATOM   5243  HB2 HIE B 224      69.812  32.207  85.919  1.00  0.00           H
ATOM   5244  HB3 HIE B 224      69.297  31.770  87.618  1.00  0.00           H
ATOM   5245  CG  HIE B 224      67.780  32.348  86.233  1.00  0.00           C
ATOM   5246  ND1 HIE B 224      67.315  32.976  85.032  1.00  0.00           N
ATOM   5247  CE1 HIE B 224      66.108  32.551  84.816  1.00  0.00           C
ATOM   5248  HE1 HIE B 224      65.436  32.906  84.048  1.00  0.00           H
ATOM   5249  NE2 HIE B 224      65.723  31.595  85.734  1.00  0.00           N
ATOM   5250  HE2 HIE B 224      64.875  31.050  85.675  1.00  0.00           H
ATOM   5251  CD2 HIE B 224      66.768  31.468  86.579  1.00  0.00           C
ATOM   5252  HD2 HIE B 224      66.876  30.683  87.313  1.00  0.00           H
ATOM   5253  C   HIE B 224      68.710  33.921  88.734  1.00  0.00           C
ATOM   5254  O   HIE B 224      67.484  34.133  88.803  1.00  0.00           O
ATOM   5255  N   ALA B 225      69.428  33.778  89.819  1.00  0.00           N
ATOM   5256  H   ALA B 225      70.422  33.683  89.667  1.00  0.00           H
ATOM   5257  CA  ALA B 225      68.934  33.868  91.158  1.00  0.00           C
ATOM   5258  HA  ALA B 225      67.906  33.504  91.182  1.00  0.00           H
ATOM   5259  CB  ALA B 225      69.924  33.132  92.020  1.00  0.00           C
ATOM   5260  HB1 ALA B 225      70.905  33.603  91.961  1.00  0.00           H
ATOM   5261  HB2 ALA B 225      69.735  33.028  93.089  1.00  0.00           H
ATOM   5262  HB3 ALA B 225      70.141  32.087  91.799  1.00  0.00           H
ATOM   5263  C   ALA B 225      68.798  35.343  91.602  1.00  0.00           C
ATOM   5264  O   ALA B 225      67.781  35.850  92.063  1.00  0.00           O
ATOM   5265  N   ASN B 226      69.828  36.132  91.230  1.00  0.00           N
ATOM   5266  H   ASN B 226      70.632  35.637  90.872  1.00  0.00           H
ATOM   5267  CA  ASN B 226      69.752  37.588  91.276  1.00  0.00           C
ATOM   5268  HA  ASN B 226      69.533  37.801  92.323  1.00  0.00           H
ATOM   5269  CB  ASN B 226      71.137  38.171  90.916  1.00  0.00           C
ATOM   5270  HB2 ASN B 226      71.325  37.825  89.900  1.00  0.00           H
ATOM   5271  HB3 ASN B 226      70.999  39.252  90.933  1.00  0.00           H
ATOM   5272  CG  ASN B 226      72.285  37.747  91.865  1.00  0.00           C
ATOM   5273  OD1 ASN B 226      72.063  37.423  93.075  1.00  0.00           O
ATOM   5274  ND2 ASN B 226      73.514  37.800  91.398  1.00  0.00           N
ATOM   5275 HD21 ASN B 226      74.368  37.796  91.938  1.00  0.00           H
ATOM   5276 HD22 ASN B 226      73.671  38.016  90.424  1.00  0.00           H
ATOM   5277  C   ASN B 226      68.674  38.208  90.473  1.00  0.00           C
ATOM   5278  O   ASN B 226      67.982  39.104  90.949  1.00  0.00           O
ATOM   5279  N   TYR B 227      68.418  37.589  89.327  1.00  0.00           N
ATOM   5280  H   TYR B 227      69.144  37.016  88.920  1.00  0.00           H
ATOM   5281  CA  TYR B 227      67.301  37.975  88.498  1.00  0.00           C
ATOM   5282  HA  TYR B 227      67.481  39.039  88.348  1.00  0.00           H
ATOM   5283  CB  TYR B 227      67.430  37.235  87.149  1.00  0.00           C
ATOM   5284  HB2 TYR B 227      68.310  37.663  86.670  1.00  0.00           H
ATOM   5285  HB3 TYR B 227      67.669  36.184  87.310  1.00  0.00           H
ATOM   5286  CG  TYR B 227      66.258  37.419  86.194  1.00  0.00           C
ATOM   5287  CD1 TYR B 227      66.060  38.569  85.427  1.00  0.00           C
ATOM   5288  HD1 TYR B 227      66.828  39.329  85.421  1.00  0.00           H
ATOM   5289  CE1 TYR B 227      64.877  38.640  84.636  1.00  0.00           C
ATOM   5290  HE1 TYR B 227      64.724  39.514  84.021  1.00  0.00           H
ATOM   5291  CZ  TYR B 227      63.801  37.738  84.762  1.00  0.00           C
ATOM   5292  OH  TYR B 227      62.623  37.993  84.187  1.00  0.00           O
ATOM   5293  HH  TYR B 227      62.156  37.166  84.044  1.00  0.00           H
ATOM   5294  CE2 TYR B 227      64.024  36.600  85.597  1.00  0.00           C
ATOM   5295  HE2 TYR B 227      63.253  35.882  85.835  1.00  0.00           H
ATOM   5296  CD2 TYR B 227      65.246  36.470  86.254  1.00  0.00           C
ATOM   5297  HD2 TYR B 227      65.312  35.640  86.942  1.00  0.00           H
ATOM   5298  C   TYR B 227      65.999  37.746  89.082  1.00  0.00           C
ATOM   5299  O   TYR B 227      65.175  38.614  89.036  1.00  0.00           O
ATOM   5300  N   ILE B 228      65.597  36.582  89.689  1.00  0.00           N
ATOM   5301  H   ILE B 228      66.159  35.748  89.789  1.00  0.00           H
ATOM   5302  CA  ILE B 228      64.270  36.521  90.453  1.00  0.00           C
ATOM   5303  HA  ILE B 228      63.431  36.757  89.797  1.00  0.00           H
ATOM   5304  CB  ILE B 228      64.163  35.051  91.056  1.00  0.00           C
ATOM   5305  HB  ILE B 228      65.093  34.801  91.567  1.00  0.00           H
ATOM   5306  CG2 ILE B 228      62.959  34.847  91.999  1.00  0.00           C
ATOM   5307 HG21 ILE B 228      63.208  33.887  92.453  1.00  0.00           H
ATOM   5308 HG22 ILE B 228      62.957  35.614  92.773  1.00  0.00           H
ATOM   5309 HG23 ILE B 228      62.073  34.947  91.372  1.00  0.00           H
ATOM   5310  CG1 ILE B 228      64.209  34.038  89.909  1.00  0.00           C
ATOM   5311 HG12 ILE B 228      65.078  34.292  89.300  1.00  0.00           H
ATOM   5312 HG13 ILE B 228      64.329  33.027  90.297  1.00  0.00           H
ATOM   5313  CD1 ILE B 228      62.974  34.081  88.974  1.00  0.00           C
ATOM   5314 HD11 ILE B 228      62.038  33.813  89.464  1.00  0.00           H
ATOM   5315 HD12 ILE B 228      62.908  35.092  88.572  1.00  0.00           H
ATOM   5316 HD13 ILE B 228      63.275  33.429  88.155  1.00  0.00           H
ATOM   5317  C   ILE B 228      64.262  37.505  91.601  1.00  0.00           C
ATOM   5318  O   ILE B 228      63.259  38.242  91.776  1.00  0.00           O
ATOM   5319  N   PHE B 229      65.345  37.668  92.414  1.00  0.00           N
ATOM   5320  H   PHE B 229      66.133  37.036  92.401  1.00  0.00           H
ATOM   5321  CA  PHE B 229      65.416  38.775  93.367  1.00  0.00           C
ATOM   5322  HA  PHE B 229      64.581  38.512  94.017  1.00  0.00           H
ATOM   5323  CB  PHE B 229      66.730  38.614  94.183  1.00  0.00           C
ATOM   5324  HB2 PHE B 229      66.749  37.767  94.869  1.00  0.00           H
ATOM   5325  HB3 PHE B 229      67.592  38.485  93.527  1.00  0.00           H
ATOM   5326  CG  PHE B 229      67.149  39.892  95.019  1.00  0.00           C
ATOM   5327  CD1 PHE B 229      66.448  40.314  96.132  1.00  0.00           C
ATOM   5328  HD1 PHE B 229      65.805  39.644  96.683  1.00  0.00           H
ATOM   5329  CE1 PHE B 229      66.713  41.536  96.735  1.00  0.00           C
ATOM   5330  HE1 PHE B 229      66.151  41.820  97.613  1.00  0.00           H
ATOM   5331  CZ  PHE B 229      67.707  42.360  96.172  1.00  0.00           C
ATOM   5332  HZ  PHE B 229      67.900  43.240  96.767  1.00  0.00           H
ATOM   5333  CE2 PHE B 229      68.511  41.916  95.158  1.00  0.00           C
ATOM   5334  HE2 PHE B 229      69.297  42.549  94.772  1.00  0.00           H
ATOM   5335  CD2 PHE B 229      68.209  40.718  94.516  1.00  0.00           C
ATOM   5336  HD2 PHE B 229      68.802  40.404  93.670  1.00  0.00           H
ATOM   5337  C   PHE B 229      65.105  40.154  92.789  1.00  0.00           C
ATOM   5338  O   PHE B 229      64.273  40.880  93.338  1.00  0.00           O
ATOM   5339  N   TRP B 230      65.714  40.496  91.670  1.00  0.00           N
ATOM   5340  H   TRP B 230      66.244  39.781  91.192  1.00  0.00           H
ATOM   5341  CA  TRP B 230      65.447  41.734  90.990  1.00  0.00           C
ATOM   5342  HA  TRP B 230      65.720  42.542  91.668  1.00  0.00           H
ATOM   5343  CB  TRP B 230      66.366  41.929  89.830  1.00  0.00           C
ATOM   5344  HB2 TRP B 230      67.426  42.118  89.996  1.00  0.00           H
ATOM   5345  HB3 TRP B 230      66.377  40.999  89.261  1.00  0.00           H
ATOM   5346  CG  TRP B 230      65.939  43.074  88.971  1.00  0.00           C
ATOM   5347  CD1 TRP B 230      65.936  44.385  89.376  1.00  0.00           C
ATOM   5348  HD1 TRP B 230      66.008  44.722  90.400  1.00  0.00           H
ATOM   5349  NE1 TRP B 230      65.598  45.192  88.336  1.00  0.00           N
ATOM   5350  HE1 TRP B 230      65.663  46.195  88.430  1.00  0.00           H
ATOM   5351  CE2 TRP B 230      65.545  44.501  87.203  1.00  0.00           C
ATOM   5352  CZ2 TRP B 230      65.346  44.916  85.913  1.00  0.00           C
ATOM   5353  HZ2 TRP B 230      65.332  45.987  85.774  1.00  0.00           H
ATOM   5354  CH2 TRP B 230      65.347  44.006  84.838  1.00  0.00           C
ATOM   5355  HH2 TRP B 230      65.248  44.350  83.819  1.00  0.00           H
ATOM   5356  CZ3 TRP B 230      65.580  42.631  85.131  1.00  0.00           C
ATOM   5357  HZ3 TRP B 230      65.501  41.933  84.311  1.00  0.00           H
ATOM   5358  CE3 TRP B 230      65.720  42.187  86.452  1.00  0.00           C
ATOM   5359  HE3 TRP B 230      65.802  41.142  86.714  1.00  0.00           H
ATOM   5360  CD2 TRP B 230      65.619  43.133  87.558  1.00  0.00           C
ATOM   5361  C   TRP B 230      63.948  41.839  90.588  1.00  0.00           C
ATOM   5362  O   TRP B 230      63.308  42.802  91.030  1.00  0.00           O
ATOM   5363  N   ARG B 231      63.364  40.792  90.006  1.00  0.00           N
ATOM   5364  H   ARG B 231      64.006  40.179  89.525  1.00  0.00           H
ATOM   5365  CA  ARG B 231      61.932  40.749  89.613  1.00  0.00           C
ATOM   5366  HA  ARG B 231      61.828  41.710  89.109  1.00  0.00           H
ATOM   5367  CB  ARG B 231      61.566  39.593  88.678  1.00  0.00           C
ATOM   5368  HB2 ARG B 231      61.791  38.658  89.193  1.00  0.00           H
ATOM   5369  HB3 ARG B 231      60.480  39.657  88.603  1.00  0.00           H
ATOM   5370  CG  ARG B 231      62.211  39.487  87.304  1.00  0.00           C
ATOM   5371  HG2 ARG B 231      63.288  39.503  87.470  1.00  0.00           H
ATOM   5372  HG3 ARG B 231      61.766  38.572  86.911  1.00  0.00           H
ATOM   5373  CD  ARG B 231      61.884  40.613  86.281  1.00  0.00           C
ATOM   5374  HD2 ARG B 231      62.443  41.533  86.450  1.00  0.00           H
ATOM   5375  HD3 ARG B 231      62.336  40.316  85.335  1.00  0.00           H
ATOM   5376  NE  ARG B 231      60.412  40.717  86.175  1.00  0.00           N
ATOM   5377  HE  ARG B 231      59.921  41.171  86.932  1.00  0.00           H
ATOM   5378  CZ  ARG B 231      59.681  40.378  85.138  1.00  0.00           C
ATOM   5379  NH1 ARG B 231      60.147  39.583  84.184  1.00  0.00           N
ATOM   5380 HH11 ARG B 231      61.136  39.454  84.027  1.00  0.00           H
ATOM   5381 HH12 ARG B 231      59.468  39.349  83.474  1.00  0.00           H
ATOM   5382  NH2 ARG B 231      58.401  40.797  85.059  1.00  0.00           N
ATOM   5383 HH21 ARG B 231      58.065  41.317  85.857  1.00  0.00           H
ATOM   5384 HH22 ARG B 231      57.772  40.358  84.402  1.00  0.00           H
ATOM   5385  C   ARG B 231      61.019  40.882  90.798  1.00  0.00           C
ATOM   5386  O   ARG B 231      60.086  41.692  90.682  1.00  0.00           O
ATOM   5387  N   ASN B 232      61.226  40.171  91.857  1.00  0.00           N
ATOM   5388  H   ASN B 232      61.922  39.444  91.775  1.00  0.00           H
ATOM   5389  CA  ASN B 232      60.335  40.189  93.071  1.00  0.00           C
ATOM   5390  HA  ASN B 232      59.316  40.132  92.689  1.00  0.00           H
ATOM   5391  CB  ASN B 232      60.507  38.868  93.961  1.00  0.00           C
ATOM   5392  HB2 ASN B 232      61.497  38.973  94.405  1.00  0.00           H
ATOM   5393  HB3 ASN B 232      59.686  38.838  94.679  1.00  0.00           H
ATOM   5394  CG  ASN B 232      60.494  37.484  93.323  1.00  0.00           C
ATOM   5395  OD1 ASN B 232      60.318  37.338  92.175  1.00  0.00           O
ATOM   5396  ND2 ASN B 232      60.656  36.425  94.120  1.00  0.00           N
ATOM   5397 HD21 ASN B 232      60.567  35.543  93.637  1.00  0.00           H
ATOM   5398 HD22 ASN B 232      60.894  36.532  95.095  1.00  0.00           H
ATOM   5399  C   ASN B 232      60.449  41.459  93.905  1.00  0.00           C
ATOM   5400  O   ASN B 232      59.414  41.845  94.497  1.00  0.00           O
ATOM   5401  N   THR B 233      61.564  42.181  93.916  1.00  0.00           N
ATOM   5402  H   THR B 233      62.358  41.634  93.615  1.00  0.00           H
ATOM   5403  CA  THR B 233      61.692  43.514  94.620  1.00  0.00           C
ATOM   5404  HA  THR B 233      61.112  43.390  95.534  1.00  0.00           H
ATOM   5405  CB  THR B 233      63.092  43.776  95.132  1.00  0.00           C
ATOM   5406  HB  THR B 233      63.208  44.829  95.391  1.00  0.00           H
ATOM   5407  CG2 THR B 233      63.375  42.941  96.359  1.00  0.00           C
ATOM   5408 HG21 THR B 233      63.196  41.878  96.193  1.00  0.00           H
ATOM   5409 HG22 THR B 233      64.388  43.118  96.720  1.00  0.00           H
ATOM   5410 HG23 THR B 233      62.641  43.223  97.114  1.00  0.00           H
ATOM   5411  OG1 THR B 233      64.069  43.416  94.247  1.00  0.00           O
ATOM   5412  HG1 THR B 233      64.099  42.459  94.167  1.00  0.00           H
ATOM   5413  C   THR B 233      61.074  44.685  93.877  1.00  0.00           C
ATOM   5414  O   THR B 233      60.770  45.752  94.468  1.00  0.00           O
ATOM   5415  N   ASN B 234      60.856  44.546  92.593  1.00  0.00           N
ATOM   5416  H   ASN B 234      61.059  43.630  92.219  1.00  0.00           H
ATOM   5417  CA  ASN B 234      60.531  45.641  91.654  1.00  0.00           C
ATOM   5418  HA  ASN B 234      60.245  46.475  92.294  1.00  0.00           H
ATOM   5419  CB  ASN B 234      61.721  46.044  90.821  1.00  0.00           C
ATOM   5420  HB2 ASN B 234      62.026  45.264  90.124  1.00  0.00           H
ATOM   5421  HB3 ASN B 234      61.448  46.936  90.257  1.00  0.00           H
ATOM   5422  CG  ASN B 234      62.935  46.328  91.634  1.00  0.00           C
ATOM   5423  OD1 ASN B 234      63.138  47.453  91.985  1.00  0.00           O
ATOM   5424  ND2 ASN B 234      63.788  45.415  91.937  1.00  0.00           N
ATOM   5425 HD21 ASN B 234      64.528  45.787  92.516  1.00  0.00           H
ATOM   5426 HD22 ASN B 234      63.720  44.428  91.732  1.00  0.00           H
ATOM   5427  C   ASN B 234      59.341  45.344  90.660  1.00  0.00           C
ATOM   5428  O   ASN B 234      59.493  44.596  89.721  1.00  0.00           O
ATOM   5429  N   PRO B 235      58.147  45.894  90.939  1.00  0.00           N
ATOM   5430  CD  PRO B 235      57.715  46.572  92.199  1.00  0.00           C
ATOM   5431  HD2 PRO B 235      58.230  47.528  92.291  1.00  0.00           H
ATOM   5432  HD3 PRO B 235      57.944  46.013  93.106  1.00  0.00           H
ATOM   5433  CG  PRO B 235      56.288  46.995  92.013  1.00  0.00           C
ATOM   5434  HG2 PRO B 235      56.244  47.990  91.571  1.00  0.00           H
ATOM   5435  HG3 PRO B 235      55.685  46.905  92.917  1.00  0.00           H
ATOM   5436  CB  PRO B 235      55.741  46.092  90.970  1.00  0.00           C
ATOM   5437  HB2 PRO B 235      54.869  46.515  90.471  1.00  0.00           H
ATOM   5438  HB3 PRO B 235      55.516  45.110  91.386  1.00  0.00           H
ATOM   5439  CA  PRO B 235      56.952  45.859  90.095  1.00  0.00           C
ATOM   5440  HA  PRO B 235      56.804  44.859  89.688  1.00  0.00           H
ATOM   5441  C   PRO B 235      57.034  46.827  88.914  1.00  0.00           C
ATOM   5442  O   PRO B 235      57.100  48.055  89.025  1.00  0.00           O
ATOM   5443  N   ILE B 236      57.101  46.257  87.710  1.00  0.00           N
ATOM   5444  H   ILE B 236      57.003  45.252  87.706  1.00  0.00           H
ATOM   5445  CA  ILE B 236      57.367  46.860  86.428  1.00  0.00           C
ATOM   5446  HA  ILE B 236      57.795  47.852  86.571  1.00  0.00           H
ATOM   5447  CB  ILE B 236      58.373  46.067  85.589  1.00  0.00           C
ATOM   5448  HB  ILE B 236      58.000  45.059  85.409  1.00  0.00           H
ATOM   5449  CG2 ILE B 236      58.607  46.852  84.253  1.00  0.00           C
ATOM   5450 HG21 ILE B 236      58.963  47.873  84.395  1.00  0.00           H
ATOM   5451 HG22 ILE B 236      59.471  46.361  83.804  1.00  0.00           H
ATOM   5452 HG23 ILE B 236      57.702  46.784  83.649  1.00  0.00           H
ATOM   5453  CG1 ILE B 236      59.652  45.980  86.433  1.00  0.00           C
ATOM   5454 HG12 ILE B 236      60.070  46.974  86.589  1.00  0.00           H
ATOM   5455 HG13 ILE B 236      59.420  45.437  87.349  1.00  0.00           H
ATOM   5456  CD1 ILE B 236      60.800  45.134  85.811  1.00  0.00           C
ATOM   5457 HD11 ILE B 236      61.225  45.565  84.904  1.00  0.00           H
ATOM   5458 HD12 ILE B 236      61.633  44.925  86.483  1.00  0.00           H
ATOM   5459 HD13 ILE B 236      60.422  44.137  85.587  1.00  0.00           H
ATOM   5460  C   ILE B 236      55.955  47.038  85.685  1.00  0.00           C
ATOM   5461  O   ILE B 236      55.126  46.115  85.562  1.00  0.00           O
ATOM   5462  N   GLN B 237      55.585  48.338  85.573  1.00  0.00           N
ATOM   5463  H   GLN B 237      56.256  49.075  85.739  1.00  0.00           H
ATOM   5464  CA  GLN B 237      54.280  48.756  85.088  1.00  0.00           C
ATOM   5465  HA  GLN B 237      53.601  48.254  85.778  1.00  0.00           H
ATOM   5466  CB  GLN B 237      54.046  50.292  85.181  1.00  0.00           C
ATOM   5467  HB2 GLN B 237      54.076  50.489  86.252  1.00  0.00           H
ATOM   5468  HB3 GLN B 237      54.807  50.925  84.724  1.00  0.00           H
ATOM   5469  CG  GLN B 237      52.703  50.707  84.515  1.00  0.00           C
ATOM   5470  HG2 GLN B 237      52.905  50.699  83.444  1.00  0.00           H
ATOM   5471  HG3 GLN B 237      51.973  49.973  84.855  1.00  0.00           H
ATOM   5472  CD  GLN B 237      52.165  52.053  84.918  1.00  0.00           C
ATOM   5473  OE1 GLN B 237      52.911  52.946  85.393  1.00  0.00           O
ATOM   5474  NE2 GLN B 237      50.851  52.288  84.754  1.00  0.00           N
ATOM   5475 HE21 GLN B 237      50.533  53.246  84.760  1.00  0.00           H
ATOM   5476 HE22 GLN B 237      50.278  51.608  84.275  1.00  0.00           H
ATOM   5477  C   GLN B 237      54.082  48.159  83.703  1.00  0.00           C
ATOM   5478  O   GLN B 237      55.014  48.090  82.889  1.00  0.00           O
ATOM   5479  N   LEU B 238      52.921  47.733  83.324  1.00  0.00           N
ATOM   5480  H   LEU B 238      52.166  47.841  83.987  1.00  0.00           H
ATOM   5481  CA  LEU B 238      52.520  47.319  81.924  1.00  0.00           C
ATOM   5482  HA  LEU B 238      53.297  46.729  81.439  1.00  0.00           H
ATOM   5483  CB  LEU B 238      51.319  46.389  81.879  1.00  0.00           C
ATOM   5484  HB2 LEU B 238      50.647  46.786  82.640  1.00  0.00           H
ATOM   5485  HB3 LEU B 238      50.888  46.574  80.895  1.00  0.00           H
ATOM   5486  CG  LEU B 238      51.416  44.884  82.176  1.00  0.00           C
ATOM   5487  HG  LEU B 238      50.439  44.401  82.152  1.00  0.00           H
ATOM   5488  CD1 LEU B 238      52.236  44.176  81.052  1.00  0.00           C
ATOM   5489 HD11 LEU B 238      51.625  44.248  80.152  1.00  0.00           H
ATOM   5490 HD12 LEU B 238      53.205  44.660  80.926  1.00  0.00           H
ATOM   5491 HD13 LEU B 238      52.362  43.100  81.176  1.00  0.00           H
ATOM   5492  CD2 LEU B 238      52.186  44.588  83.472  1.00  0.00           C
ATOM   5493 HD21 LEU B 238      53.210  44.952  83.392  1.00  0.00           H
ATOM   5494 HD22 LEU B 238      51.605  45.034  84.280  1.00  0.00           H
ATOM   5495 HD23 LEU B 238      52.129  43.500  83.529  1.00  0.00           H
ATOM   5496  C   LEU B 238      52.313  48.587  81.107  1.00  0.00           C
ATOM   5497  O   LEU B 238      51.420  49.394  81.470  1.00  0.00           O
ATOM   5498  N   SER B 239      53.045  48.879  80.040  1.00  0.00           N
ATOM   5499  H   SER B 239      53.855  48.288  79.918  1.00  0.00           H
ATOM   5500  CA  SER B 239      52.796  50.073  79.229  1.00  0.00           C
ATOM   5501  HA  SER B 239      51.784  50.442  79.400  1.00  0.00           H
ATOM   5502  CB  SER B 239      53.498  51.226  80.009  1.00  0.00           C
ATOM   5503  HB2 SER B 239      53.061  51.327  81.003  1.00  0.00           H
ATOM   5504  HB3 SER B 239      54.545  50.998  80.210  1.00  0.00           H
ATOM   5505  OG  SER B 239      53.346  52.591  79.463  1.00  0.00           O
ATOM   5506  HG  SER B 239      54.193  52.945  79.182  1.00  0.00           H
ATOM   5507  C   SER B 239      53.118  50.013  77.777  1.00  0.00           C
ATOM   5508  O   SER B 239      53.954  49.234  77.336  1.00  0.00           O
ATOM   5509  N   SER B 240      52.378  50.780  76.939  1.00  0.00           N
ATOM   5510  H   SER B 240      51.707  51.439  77.305  1.00  0.00           H
ATOM   5511  CA  SER B 240      52.397  50.717  75.520  1.00  0.00           C
ATOM   5512  HA  SER B 240      53.150  49.994  75.205  1.00  0.00           H
ATOM   5513  CB  SER B 240      51.007  50.193  75.085  1.00  0.00           C
ATOM   5514  HB2 SER B 240      51.073  49.973  74.019  1.00  0.00           H
ATOM   5515  HB3 SER B 240      50.620  49.340  75.641  1.00  0.00           H
ATOM   5516  OG  SER B 240      50.129  51.247  75.135  1.00  0.00           O
ATOM   5517  HG  SER B 240      49.246  50.978  74.872  1.00  0.00           H
ATOM   5518  C   SER B 240      52.875  52.024  74.789  1.00  0.00           C
ATOM   5519  O   SER B 240      53.036  52.065  73.570  1.00  0.00           O
ATOM   5520  N   TYR B 241      53.063  53.108  75.561  1.00  0.00           N
ATOM   5521  H   TYR B 241      52.925  52.971  76.552  1.00  0.00           H
ATOM   5522  CA  TYR B 241      53.430  54.421  74.995  1.00  0.00           C
ATOM   5523  HA  TYR B 241      52.533  54.804  74.509  1.00  0.00           H
ATOM   5524  CB  TYR B 241      53.768  55.423  76.105  1.00  0.00           C
ATOM   5525  HB2 TYR B 241      54.534  54.998  76.753  1.00  0.00           H
ATOM   5526  HB3 TYR B 241      54.097  56.390  75.726  1.00  0.00           H
ATOM   5527  CG  TYR B 241      52.695  55.871  77.108  1.00  0.00           C
ATOM   5528  CD1 TYR B 241      51.394  56.363  76.685  1.00  0.00           C
ATOM   5529  HD1 TYR B 241      51.149  56.423  75.635  1.00  0.00           H
ATOM   5530  CE1 TYR B 241      50.472  56.765  77.632  1.00  0.00           C
ATOM   5531  HE1 TYR B 241      49.580  57.220  77.226  1.00  0.00           H
ATOM   5532  CZ  TYR B 241      50.738  56.665  79.001  1.00  0.00           C
ATOM   5533  OH  TYR B 241      49.825  56.941  79.964  1.00  0.00           O
ATOM   5534  HH  TYR B 241      48.986  57.197  79.576  1.00  0.00           H
ATOM   5535  CE2 TYR B 241      51.969  56.107  79.406  1.00  0.00           C
ATOM   5536  HE2 TYR B 241      52.225  56.072  80.455  1.00  0.00           H
ATOM   5537  CD2 TYR B 241      52.997  55.747  78.470  1.00  0.00           C
ATOM   5538  HD2 TYR B 241      54.001  55.518  78.796  1.00  0.00           H
ATOM   5539  C   TYR B 241      54.628  54.419  74.006  1.00  0.00           C
ATOM   5540  O   TYR B 241      54.663  55.354  73.196  1.00  0.00           O
ATOM   5541  N   SER B 242      55.683  53.552  73.965  1.00  0.00           N
ATOM   5542  H   SER B 242      55.807  53.006  74.806  1.00  0.00           H
ATOM   5543  CA  SER B 242      56.805  53.497  72.987  1.00  0.00           C
ATOM   5544  HA  SER B 242      57.291  54.465  72.861  1.00  0.00           H
ATOM   5545  CB  SER B 242      57.836  52.450  73.447  1.00  0.00           C
ATOM   5546  HB2 SER B 242      58.799  52.699  73.001  1.00  0.00           H
ATOM   5547  HB3 SER B 242      58.035  52.716  74.485  1.00  0.00           H
ATOM   5548  OG  SER B 242      57.496  51.079  73.363  1.00  0.00           O
ATOM   5549  HG  SER B 242      57.947  50.843  72.550  1.00  0.00           H
ATOM   5550  C   SER B 242      56.313  53.204  71.592  1.00  0.00           C
ATOM   5551  O   SER B 242      56.952  53.637  70.634  1.00  0.00           O
ATOM   5552  N   LEU B 243      55.117  52.633  71.466  1.00  0.00           N
ATOM   5553  H   LEU B 243      54.538  52.329  72.236  1.00  0.00           H
ATOM   5554  CA  LEU B 243      54.646  52.043  70.228  1.00  0.00           C
ATOM   5555  HA  LEU B 243      55.485  51.511  69.779  1.00  0.00           H
ATOM   5556  CB  LEU B 243      53.560  51.010  70.471  1.00  0.00           C
ATOM   5557  HB2 LEU B 243      52.706  51.419  71.010  1.00  0.00           H
ATOM   5558  HB3 LEU B 243      53.274  50.579  69.511  1.00  0.00           H
ATOM   5559  CG  LEU B 243      53.931  49.807  71.442  1.00  0.00           C
ATOM   5560  HG  LEU B 243      54.096  50.209  72.442  1.00  0.00           H
ATOM   5561  CD1 LEU B 243      52.741  48.886  71.497  1.00  0.00           C
ATOM   5562 HD11 LEU B 243      52.981  48.074  72.185  1.00  0.00           H
ATOM   5563 HD12 LEU B 243      51.903  49.464  71.888  1.00  0.00           H
ATOM   5564 HD13 LEU B 243      52.452  48.465  70.534  1.00  0.00           H
ATOM   5565  CD2 LEU B 243      55.173  49.010  71.031  1.00  0.00           C
ATOM   5566 HD21 LEU B 243      54.969  48.351  70.187  1.00  0.00           H
ATOM   5567 HD22 LEU B 243      56.027  49.620  70.738  1.00  0.00           H
ATOM   5568 HD23 LEU B 243      55.514  48.404  71.870  1.00  0.00           H
ATOM   5569  C   LEU B 243      54.137  53.035  69.132  1.00  0.00           C
ATOM   5570  O   LEU B 243      53.871  52.698  67.963  1.00  0.00           O
ATOM   5571  N   PHE B 244      54.040  54.313  69.441  1.00  0.00           N
ATOM   5572  H   PHE B 244      54.228  54.509  70.414  1.00  0.00           H
ATOM   5573  CA  PHE B 244      53.691  55.414  68.562  1.00  0.00           C
ATOM   5574  HA  PHE B 244      53.374  54.986  67.611  1.00  0.00           H
ATOM   5575  CB  PHE B 244      52.476  56.154  69.147  1.00  0.00           C
ATOM   5576  HB2 PHE B 244      52.791  56.842  69.931  1.00  0.00           H
ATOM   5577  HB3 PHE B 244      52.024  56.629  68.276  1.00  0.00           H
ATOM   5578  CG  PHE B 244      51.487  55.229  69.768  1.00  0.00           C
ATOM   5579  CD1 PHE B 244      50.442  54.689  68.956  1.00  0.00           C
ATOM   5580  HD1 PHE B 244      50.380  54.960  67.913  1.00  0.00           H
ATOM   5581  CE1 PHE B 244      49.613  53.711  69.543  1.00  0.00           C
ATOM   5582  HE1 PHE B 244      48.925  53.160  68.919  1.00  0.00           H
ATOM   5583  CZ  PHE B 244      49.739  53.287  70.898  1.00  0.00           C
ATOM   5584  HZ  PHE B 244      49.157  52.452  71.261  1.00  0.00           H
ATOM   5585  CE2 PHE B 244      50.743  53.893  71.753  1.00  0.00           C
ATOM   5586  HE2 PHE B 244      50.829  53.591  72.786  1.00  0.00           H
ATOM   5587  CD2 PHE B 244      51.599  54.899  71.177  1.00  0.00           C
ATOM   5588  HD2 PHE B 244      52.382  55.313  71.795  1.00  0.00           H
ATOM   5589  C   PHE B 244      54.828  56.397  68.294  1.00  0.00           C
ATOM   5590  O   PHE B 244      54.656  57.292  67.451  1.00  0.00           O
ATOM   5591  N   ASP B 245      55.931  56.207  68.963  1.00  0.00           N
ATOM   5592  H   ASP B 245      55.935  55.528  69.711  1.00  0.00           H
ATOM   5593  CA  ASP B 245      57.117  57.025  68.830  1.00  0.00           C
ATOM   5594  HA  ASP B 245      56.882  58.004  68.413  1.00  0.00           H
ATOM   5595  CB  ASP B 245      57.776  57.367  70.165  1.00  0.00           C
ATOM   5596  HB2 ASP B 245      57.123  58.123  70.602  1.00  0.00           H
ATOM   5597  HB3 ASP B 245      57.871  56.453  70.752  1.00  0.00           H
ATOM   5598  CG  ASP B 245      59.113  58.108  70.055  1.00  0.00           C
ATOM   5599  OD1 ASP B 245      59.959  58.065  70.957  1.00  0.00           O
ATOM   5600  OD2 ASP B 245      59.322  58.819  68.986  1.00  0.00           O
ATOM   5601  C   ASP B 245      58.042  56.332  67.767  1.00  0.00           C
ATOM   5602  O   ASP B 245      59.180  55.834  68.075  1.00  0.00           O
ATOM   5603  N   MET B 246      57.493  56.234  66.531  1.00  0.00           N
ATOM   5604  H   MET B 246      56.573  56.619  66.373  1.00  0.00           H
ATOM   5605  CA  MET B 246      58.048  55.339  65.435  1.00  0.00           C
ATOM   5606  HA  MET B 246      58.740  54.674  65.952  1.00  0.00           H
ATOM   5607  CB  MET B 246      56.908  54.411  64.919  1.00  0.00           C
ATOM   5608  HB2 MET B 246      56.015  54.961  64.623  1.00  0.00           H
ATOM   5609  HB3 MET B 246      57.329  53.849  64.086  1.00  0.00           H
ATOM   5610  CG  MET B 246      56.502  53.385  65.882  1.00  0.00           C
ATOM   5611  HG2 MET B 246      56.103  53.875  66.770  1.00  0.00           H
ATOM   5612  HG3 MET B 246      55.615  52.936  65.435  1.00  0.00           H
ATOM   5613  SD  MET B 246      57.632  52.115  66.498  1.00  0.00           S
ATOM   5614  CE  MET B 246      57.413  50.813  65.260  1.00  0.00           C
ATOM   5615  HE1 MET B 246      57.583  51.304  64.302  1.00  0.00           H
ATOM   5616  HE2 MET B 246      58.109  49.980  65.350  1.00  0.00           H
ATOM   5617  HE3 MET B 246      56.393  50.460  65.106  1.00  0.00           H
ATOM   5618  C   MET B 246      58.929  56.073  64.292  1.00  0.00           C
ATOM   5619  O   MET B 246      59.567  55.346  63.607  1.00  0.00           O
ATOM   5620  N   SER B 247      58.988  57.393  64.244  1.00  0.00           N
ATOM   5621  H   SER B 247      58.579  57.914  65.006  1.00  0.00           H
ATOM   5622  CA  SER B 247      59.820  58.087  63.240  1.00  0.00           C
ATOM   5623  HA  SER B 247      59.523  57.748  62.248  1.00  0.00           H
ATOM   5624  CB  SER B 247      59.450  59.567  63.468  1.00  0.00           C
ATOM   5625  HB2 SER B 247      59.705  60.149  62.583  1.00  0.00           H
ATOM   5626  HB3 SER B 247      58.378  59.715  63.604  1.00  0.00           H
ATOM   5627  OG  SER B 247      60.016  59.999  64.670  1.00  0.00           O
ATOM   5628  HG  SER B 247      60.399  60.845  64.426  1.00  0.00           H
ATOM   5629  C   SER B 247      61.401  57.924  63.494  1.00  0.00           C
ATOM   5630  O   SER B 247      62.229  58.039  62.632  1.00  0.00           O
ATOM   5631  N   LYS B 248      61.733  57.573  64.660  1.00  0.00           N
ATOM   5632  H   LYS B 248      61.106  57.793  65.421  1.00  0.00           H
ATOM   5633  CA  LYS B 248      63.083  57.240  65.124  1.00  0.00           C
ATOM   5634  HA  LYS B 248      63.822  57.378  64.335  1.00  0.00           H
ATOM   5635  CB  LYS B 248      63.619  58.186  66.207  1.00  0.00           C
ATOM   5636  HB2 LYS B 248      64.682  57.975  66.328  1.00  0.00           H
ATOM   5637  HB3 LYS B 248      63.582  59.228  65.890  1.00  0.00           H
ATOM   5638  CG  LYS B 248      62.970  58.125  67.582  1.00  0.00           C
ATOM   5639  HG2 LYS B 248      61.939  58.450  67.443  1.00  0.00           H
ATOM   5640  HG3 LYS B 248      62.945  57.117  67.995  1.00  0.00           H
ATOM   5641  CD  LYS B 248      63.736  59.139  68.425  1.00  0.00           C
ATOM   5642  HD2 LYS B 248      64.815  59.004  68.343  1.00  0.00           H
ATOM   5643  HD3 LYS B 248      63.622  60.116  67.955  1.00  0.00           H
ATOM   5644  CE  LYS B 248      63.164  59.207  69.830  1.00  0.00           C
ATOM   5645  HE2 LYS B 248      62.991  58.229  70.278  1.00  0.00           H
ATOM   5646  HE3 LYS B 248      63.919  59.732  70.416  1.00  0.00           H
ATOM   5647  NZ  LYS B 248      61.920  59.951  69.943  1.00  0.00           N
ATOM   5648  HZ1 LYS B 248      61.615  60.007  70.904  1.00  0.00           H
ATOM   5649  HZ2 LYS B 248      61.943  60.932  69.704  1.00  0.00           H
ATOM   5650  HZ3 LYS B 248      61.199  59.469  69.425  1.00  0.00           H
ATOM   5651  C   LYS B 248      63.241  55.734  65.392  1.00  0.00           C
ATOM   5652  O   LYS B 248      64.226  55.309  66.078  1.00  0.00           O
ATOM   5653  N   PHE B 249      62.388  54.882  64.757  1.00  0.00           N
ATOM   5654  H   PHE B 249      61.621  55.179  64.170  1.00  0.00           H
ATOM   5655  CA  PHE B 249      62.559  53.399  64.652  1.00  0.00           C
ATOM   5656  HA  PHE B 249      62.691  53.013  65.663  1.00  0.00           H
ATOM   5657  CB  PHE B 249      61.288  52.756  64.204  1.00  0.00           C
ATOM   5658  HB2 PHE B 249      60.486  53.294  64.708  1.00  0.00           H
ATOM   5659  HB3 PHE B 249      61.068  52.947  63.154  1.00  0.00           H
ATOM   5660  CG  PHE B 249      61.126  51.276  64.515  1.00  0.00           C
ATOM   5661  CD1 PHE B 249      61.015  50.903  65.875  1.00  0.00           C
ATOM   5662  HD1 PHE B 249      60.808  51.700  66.574  1.00  0.00           H
ATOM   5663  CE1 PHE B 249      60.981  49.535  66.167  1.00  0.00           C
ATOM   5664  HE1 PHE B 249      60.999  49.145  67.174  1.00  0.00           H
ATOM   5665  CZ  PHE B 249      60.996  48.611  65.164  1.00  0.00           C
ATOM   5666  HZ  PHE B 249      60.988  47.550  65.365  1.00  0.00           H
ATOM   5667  CE2 PHE B 249      61.096  48.986  63.790  1.00  0.00           C
ATOM   5668  HE2 PHE B 249      61.021  48.276  62.979  1.00  0.00           H
ATOM   5669  CD2 PHE B 249      61.245  50.371  63.497  1.00  0.00           C
ATOM   5670  HD2 PHE B 249      61.389  50.632  62.459  1.00  0.00           H
ATOM   5671  C   PHE B 249      63.742  52.892  63.761  1.00  0.00           C
ATOM   5672  O   PHE B 249      64.174  51.816  64.096  1.00  0.00           O
ATOM   5673  N   PRO B 250      64.325  53.582  62.732  1.00  0.00           N
ATOM   5674  CD  PRO B 250      63.674  54.699  62.066  1.00  0.00           C
ATOM   5675  HD2 PRO B 250      63.981  55.679  62.433  1.00  0.00           H
ATOM   5676  HD3 PRO B 250      62.601  54.521  62.146  1.00  0.00           H
ATOM   5677  CG  PRO B 250      64.113  54.610  60.579  1.00  0.00           C
ATOM   5678  HG2 PRO B 250      64.058  55.557  60.042  1.00  0.00           H
ATOM   5679  HG3 PRO B 250      63.487  53.801  60.203  1.00  0.00           H
ATOM   5680  CB  PRO B 250      65.548  54.053  60.721  1.00  0.00           C
ATOM   5681  HB2 PRO B 250      66.199  54.868  61.038  1.00  0.00           H
ATOM   5682  HB3 PRO B 250      65.885  53.516  59.835  1.00  0.00           H
ATOM   5683  CA  PRO B 250      65.397  53.007  61.859  1.00  0.00           C
ATOM   5684  HA  PRO B 250      65.034  52.005  61.635  1.00  0.00           H
ATOM   5685  C   PRO B 250      66.684  52.799  62.637  1.00  0.00           C
ATOM   5686  O   PRO B 250      67.187  53.726  63.274  1.00  0.00           O
ATOM   5687  N   LEU B 251      67.241  51.601  62.427  1.00  0.00           N
ATOM   5688  H   LEU B 251      66.647  50.922  61.974  1.00  0.00           H
ATOM   5689  CA  LEU B 251      68.555  51.282  62.991  1.00  0.00           C
ATOM   5690  HA  LEU B 251      68.479  51.347  64.076  1.00  0.00           H
ATOM   5691  CB  LEU B 251      68.883  49.759  62.769  1.00  0.00           C
ATOM   5692  HB2 LEU B 251      68.124  49.141  63.249  1.00  0.00           H
ATOM   5693  HB3 LEU B 251      68.907  49.713  61.680  1.00  0.00           H
ATOM   5694  CG  LEU B 251      70.243  49.313  63.326  1.00  0.00           C
ATOM   5695  HG  LEU B 251      70.985  49.857  62.741  1.00  0.00           H
ATOM   5696  CD1 LEU B 251      70.395  49.608  64.799  1.00  0.00           C
ATOM   5697 HD11 LEU B 251      71.322  49.086  65.040  1.00  0.00           H
ATOM   5698 HD12 LEU B 251      70.632  50.651  65.009  1.00  0.00           H
ATOM   5699 HD13 LEU B 251      69.615  49.166  65.418  1.00  0.00           H
ATOM   5700  CD2 LEU B 251      70.427  47.830  63.163  1.00  0.00           C
ATOM   5701 HD21 LEU B 251      70.153  47.598  62.134  1.00  0.00           H
ATOM   5702 HD22 LEU B 251      71.452  47.493  63.313  1.00  0.00           H
ATOM   5703 HD23 LEU B 251      69.781  47.275  63.844  1.00  0.00           H
ATOM   5704  C   LEU B 251      69.585  52.243  62.410  1.00  0.00           C
ATOM   5705  O   LEU B 251      69.929  52.138  61.230  1.00  0.00           O
ATOM   5706  N   LYS B 252      70.083  53.184  63.229  1.00  0.00           N
ATOM   5707  H   LYS B 252      69.907  53.076  64.218  1.00  0.00           H
ATOM   5708  CA  LYS B 252      71.077  54.220  62.781  1.00  0.00           C
ATOM   5709  HA  LYS B 252      70.773  54.439  61.757  1.00  0.00           H
ATOM   5710  CB  LYS B 252      70.977  55.502  63.535  1.00  0.00           C
ATOM   5711  HB2 LYS B 252      70.993  55.257  64.597  1.00  0.00           H
ATOM   5712  HB3 LYS B 252      71.867  56.057  63.240  1.00  0.00           H
ATOM   5713  CG  LYS B 252      69.718  56.270  63.243  1.00  0.00           C
ATOM   5714  HG2 LYS B 252      68.867  55.615  63.429  1.00  0.00           H
ATOM   5715  HG3 LYS B 252      69.717  57.027  64.028  1.00  0.00           H
ATOM   5716  CD  LYS B 252      69.553  56.751  61.802  1.00  0.00           C
ATOM   5717  HD2 LYS B 252      70.379  57.406  61.524  1.00  0.00           H
ATOM   5718  HD3 LYS B 252      69.521  55.863  61.172  1.00  0.00           H
ATOM   5719  CE  LYS B 252      68.300  57.529  61.509  1.00  0.00           C
ATOM   5720  HE2 LYS B 252      67.380  56.968  61.676  1.00  0.00           H
ATOM   5721  HE3 LYS B 252      68.190  58.293  62.279  1.00  0.00           H
ATOM   5722  NZ  LYS B 252      68.378  58.255  60.255  1.00  0.00           N
ATOM   5723  HZ1 LYS B 252      69.126  58.924  60.144  1.00  0.00           H
ATOM   5724  HZ2 LYS B 252      68.540  57.617  59.489  1.00  0.00           H
ATOM   5725  HZ3 LYS B 252      67.490  58.716  60.118  1.00  0.00           H
ATOM   5726  C   LYS B 252      72.435  53.614  62.678  1.00  0.00           C
ATOM   5727  O   LYS B 252      72.766  52.899  63.620  1.00  0.00           O
ATOM   5728  N   LEU B 253      73.127  53.822  61.603  1.00  0.00           N
ATOM   5729  H   LEU B 253      72.675  54.308  60.842  1.00  0.00           H
ATOM   5730  CA  LEU B 253      74.575  53.428  61.444  1.00  0.00           C
ATOM   5731  HA  LEU B 253      74.602  52.346  61.316  1.00  0.00           H
ATOM   5732  CB  LEU B 253      75.199  54.046  60.157  1.00  0.00           C
ATOM   5733  HB2 LEU B 253      75.174  55.135  60.211  1.00  0.00           H
ATOM   5734  HB3 LEU B 253      76.256  53.818  60.019  1.00  0.00           H
ATOM   5735  CG  LEU B 253      74.471  53.753  58.856  1.00  0.00           C
ATOM   5736  HG  LEU B 253      73.416  53.615  59.090  1.00  0.00           H
ATOM   5737  CD1 LEU B 253      74.864  54.645  57.664  1.00  0.00           C
ATOM   5738 HD11 LEU B 253      75.863  54.365  57.331  1.00  0.00           H
ATOM   5739 HD12 LEU B 253      74.199  54.576  56.803  1.00  0.00           H
ATOM   5740 HD13 LEU B 253      74.802  55.688  57.973  1.00  0.00           H
ATOM   5741  CD2 LEU B 253      74.928  52.333  58.434  1.00  0.00           C
ATOM   5742 HD21 LEU B 253      75.990  52.208  58.222  1.00  0.00           H
ATOM   5743 HD22 LEU B 253      74.657  51.570  59.163  1.00  0.00           H
ATOM   5744 HD23 LEU B 253      74.416  52.077  57.506  1.00  0.00           H
ATOM   5745  C   LEU B 253      75.479  53.724  62.659  1.00  0.00           C
ATOM   5746  O   LEU B 253      75.279  54.864  63.088  1.00  0.00           O
ATOM   5747  N   ARG B 254      76.504  52.925  63.081  1.00  0.00           N
ATOM   5748  H   ARG B 254      76.815  52.172  62.485  1.00  0.00           H
ATOM   5749  CA  ARG B 254      77.392  53.205  64.122  1.00  0.00           C
ATOM   5750  HA  ARG B 254      77.038  54.135  64.568  1.00  0.00           H
ATOM   5751  CB  ARG B 254      77.458  52.009  65.112  1.00  0.00           C
ATOM   5752  HB2 ARG B 254      77.239  51.061  64.621  1.00  0.00           H
ATOM   5753  HB3 ARG B 254      78.506  51.867  65.376  1.00  0.00           H
ATOM   5754  CG  ARG B 254      76.675  52.140  66.359  1.00  0.00           C
ATOM   5755  HG2 ARG B 254      76.839  51.223  66.924  1.00  0.00           H
ATOM   5756  HG3 ARG B 254      77.067  52.933  66.997  1.00  0.00           H
ATOM   5757  CD  ARG B 254      75.136  52.381  66.044  1.00  0.00           C
ATOM   5758  HD2 ARG B 254      74.930  53.365  65.622  1.00  0.00           H
ATOM   5759  HD3 ARG B 254      74.779  51.680  65.289  1.00  0.00           H
ATOM   5760  NE  ARG B 254      74.338  52.132  67.269  1.00  0.00           N
ATOM   5761  HE  ARG B 254      74.818  51.979  68.144  1.00  0.00           H
ATOM   5762  CZ  ARG B 254      73.007  52.265  67.404  1.00  0.00           C
ATOM   5763  NH1 ARG B 254      72.314  52.512  66.342  1.00  0.00           N
ATOM   5764 HH11 ARG B 254      72.752  52.410  65.438  1.00  0.00           H
ATOM   5765 HH12 ARG B 254      71.384  52.832  66.573  1.00  0.00           H
ATOM   5766  NH2 ARG B 254      72.421  52.112  68.566  1.00  0.00           N
ATOM   5767 HH21 ARG B 254      72.957  51.640  69.281  1.00  0.00           H
ATOM   5768 HH22 ARG B 254      71.464  52.398  68.715  1.00  0.00           H
ATOM   5769  C   ARG B 254      78.805  53.608  63.737  1.00  0.00           C
ATOM   5770  O   ARG B 254      79.639  53.784  64.647  1.00  0.00           O
ATOM   5771  N   GLY B 255      79.142  53.854  62.475  1.00  0.00           N
ATOM   5772  H   GLY B 255      78.434  53.736  61.765  1.00  0.00           H
ATOM   5773  CA  GLY B 255      80.432  54.112  61.971  1.00  0.00           C
ATOM   5774  HA2 GLY B 255      80.447  54.545  60.970  1.00  0.00           H
ATOM   5775  HA3 GLY B 255      80.957  54.859  62.567  1.00  0.00           H
ATOM   5776  C   GLY B 255      81.261  52.850  61.727  1.00  0.00           C
ATOM   5777  O   GLY B 255      82.502  52.923  61.690  1.00  0.00           O
ATOM   5778  N   THR B 256      80.587  51.699  61.670  1.00  0.00           N
ATOM   5779  H   THR B 256      79.578  51.697  61.709  1.00  0.00           H
ATOM   5780  CA  THR B 256      81.231  50.385  61.623  1.00  0.00           C
ATOM   5781  HA  THR B 256      81.826  50.230  62.524  1.00  0.00           H
ATOM   5782  CB  THR B 256      80.173  49.224  61.633  1.00  0.00           C
ATOM   5783  HB  THR B 256      79.439  49.255  60.828  1.00  0.00           H
ATOM   5784  CG2 THR B 256      80.709  47.791  61.917  1.00  0.00           C
ATOM   5785 HG21 THR B 256      81.323  47.384  61.113  1.00  0.00           H
ATOM   5786 HG22 THR B 256      81.107  47.694  62.927  1.00  0.00           H
ATOM   5787 HG23 THR B 256      79.760  47.256  61.947  1.00  0.00           H
ATOM   5788  OG1 THR B 256      79.394  49.532  62.754  1.00  0.00           O
ATOM   5789  HG1 THR B 256      80.017  49.847  63.413  1.00  0.00           H
ATOM   5790  C   THR B 256      82.168  50.132  60.403  1.00  0.00           C
ATOM   5791  O   THR B 256      81.639  49.947  59.291  1.00  0.00           O
ATOM   5792  N   ALA B 257      83.442  50.304  60.536  1.00  0.00           N
ATOM   5793  H   ALA B 257      83.825  50.535  61.441  1.00  0.00           H
ATOM   5794  CA  ALA B 257      84.433  49.852  59.526  1.00  0.00           C
ATOM   5795  HA  ALA B 257      84.112  50.431  58.660  1.00  0.00           H
ATOM   5796  CB  ALA B 257      85.808  50.404  59.980  1.00  0.00           C
ATOM   5797  HB1 ALA B 257      86.553  50.069  59.259  1.00  0.00           H
ATOM   5798  HB2 ALA B 257      85.741  51.490  59.924  1.00  0.00           H
ATOM   5799  HB3 ALA B 257      85.995  50.100  61.010  1.00  0.00           H
ATOM   5800  C   ALA B 257      84.471  48.269  59.391  1.00  0.00           C
ATOM   5801  O   ALA B 257      83.904  47.620  60.263  1.00  0.00           O
ATOM   5802  N   VAL B 258      85.082  47.626  58.386  1.00  0.00           N
ATOM   5803  H   VAL B 258      85.659  48.178  57.768  1.00  0.00           H
ATOM   5804  CA  VAL B 258      85.080  46.127  58.305  1.00  0.00           C
ATOM   5805  HA  VAL B 258      84.789  45.669  59.250  1.00  0.00           H
ATOM   5806  CB  VAL B 258      84.042  45.631  57.270  1.00  0.00           C
ATOM   5807  HB  VAL B 258      84.265  45.986  56.264  1.00  0.00           H
ATOM   5808  CG1 VAL B 258      84.098  44.108  57.210  1.00  0.00           C
ATOM   5809 HG11 VAL B 258      83.842  43.681  58.180  1.00  0.00           H
ATOM   5810 HG12 VAL B 258      83.436  43.818  56.394  1.00  0.00           H
ATOM   5811 HG13 VAL B 258      85.109  43.892  56.864  1.00  0.00           H
ATOM   5812  CG2 VAL B 258      82.599  46.130  57.534  1.00  0.00           C
ATOM   5813 HG21 VAL B 258      82.499  47.211  57.629  1.00  0.00           H
ATOM   5814 HG22 VAL B 258      82.014  45.759  56.692  1.00  0.00           H
ATOM   5815 HG23 VAL B 258      82.114  45.632  58.373  1.00  0.00           H
ATOM   5816  C   VAL B 258      86.469  45.491  58.173  1.00  0.00           C
ATOM   5817  O   VAL B 258      87.249  45.887  57.330  1.00  0.00           O
ATOM   5818  N   MET B 259      86.734  44.341  58.834  1.00  0.00           N
ATOM   5819  H   MET B 259      85.971  44.054  59.430  1.00  0.00           H
ATOM   5820  CA  MET B 259      88.087  43.686  58.729  1.00  0.00           C
ATOM   5821  HA  MET B 259      88.472  43.862  57.725  1.00  0.00           H
ATOM   5822  CB  MET B 259      89.076  44.278  59.788  1.00  0.00           C
ATOM   5823  HB2 MET B 259      88.652  44.196  60.789  1.00  0.00           H
ATOM   5824  HB3 MET B 259      89.979  43.674  59.693  1.00  0.00           H
ATOM   5825  CG  MET B 259      89.459  45.753  59.581  1.00  0.00           C
ATOM   5826  HG2 MET B 259      89.955  45.788  58.611  1.00  0.00           H
ATOM   5827  HG3 MET B 259      88.484  46.239  59.599  1.00  0.00           H
ATOM   5828  SD  MET B 259      90.571  46.272  60.868  1.00  0.00           S
ATOM   5829  CE  MET B 259      90.684  48.046  60.612  1.00  0.00           C
ATOM   5830  HE1 MET B 259      91.655  48.167  60.132  1.00  0.00           H
ATOM   5831  HE2 MET B 259      89.866  48.441  60.009  1.00  0.00           H
ATOM   5832  HE3 MET B 259      90.725  48.526  61.590  1.00  0.00           H
ATOM   5833  C   MET B 259      88.025  42.160  58.969  1.00  0.00           C
ATOM   5834  O   MET B 259      87.029  41.579  59.410  1.00  0.00           O
ATOM   5835  N   SER B 260      89.053  41.447  58.535  1.00  0.00           N
ATOM   5836  H   SER B 260      89.753  41.947  58.005  1.00  0.00           H
ATOM   5837  CA  SER B 260      89.289  40.006  58.889  1.00  0.00           C
ATOM   5838  HA  SER B 260      88.504  39.791  59.614  1.00  0.00           H
ATOM   5839  CB  SER B 260      89.046  39.032  57.756  1.00  0.00           C
ATOM   5840  HB2 SER B 260      87.989  39.143  57.514  1.00  0.00           H
ATOM   5841  HB3 SER B 260      89.739  39.272  56.950  1.00  0.00           H
ATOM   5842  OG  SER B 260      89.309  37.729  58.205  1.00  0.00           O
ATOM   5843  HG  SER B 260      89.255  37.083  57.497  1.00  0.00           H
ATOM   5844  C   SER B 260      90.786  39.963  59.424  1.00  0.00           C
ATOM   5845  O   SER B 260      91.710  40.146  58.646  1.00  0.00           O
ATOM   5846  N   LEU B 261      90.898  39.878  60.743  1.00  0.00           N
ATOM   5847  H   LEU B 261      89.994  39.823  61.190  1.00  0.00           H
ATOM   5848  CA  LEU B 261      92.119  39.886  61.498  1.00  0.00           C
ATOM   5849  HA  LEU B 261      92.977  40.176  60.891  1.00  0.00           H
ATOM   5850  CB  LEU B 261      92.065  40.948  62.517  1.00  0.00           C
ATOM   5851  HB2 LEU B 261      91.281  40.766  63.252  1.00  0.00           H
ATOM   5852  HB3 LEU B 261      93.078  40.990  62.917  1.00  0.00           H
ATOM   5853  CG  LEU B 261      91.708  42.392  62.085  1.00  0.00           C
ATOM   5854  HG  LEU B 261      90.642  42.464  61.869  1.00  0.00           H
ATOM   5855  CD1 LEU B 261      92.092  43.377  63.144  1.00  0.00           C
ATOM   5856 HD11 LEU B 261      93.174  43.294  63.249  1.00  0.00           H
ATOM   5857 HD12 LEU B 261      91.823  44.402  62.889  1.00  0.00           H
ATOM   5858 HD13 LEU B 261      91.655  43.189  64.125  1.00  0.00           H
ATOM   5859  CD2 LEU B 261      92.396  42.751  60.714  1.00  0.00           C
ATOM   5860 HD21 LEU B 261      92.277  43.835  60.688  1.00  0.00           H
ATOM   5861 HD22 LEU B 261      93.426  42.396  60.721  1.00  0.00           H
ATOM   5862 HD23 LEU B 261      91.825  42.308  59.898  1.00  0.00           H
ATOM   5863  C   LEU B 261      92.378  38.507  62.190  1.00  0.00           C
ATOM   5864  O   LEU B 261      91.507  37.936  62.900  1.00  0.00           O
ATOM   5865  N   LYS B 262      93.623  38.005  61.991  1.00  0.00           N
ATOM   5866  H   LYS B 262      94.213  38.374  61.259  1.00  0.00           H
ATOM   5867  CA  LYS B 262      94.212  36.872  62.704  1.00  0.00           C
ATOM   5868  HA  LYS B 262      93.540  36.013  62.703  1.00  0.00           H
ATOM   5869  CB  LYS B 262      95.563  36.383  62.003  1.00  0.00           C
ATOM   5870  HB2 LYS B 262      96.389  37.032  62.292  1.00  0.00           H
ATOM   5871  HB3 LYS B 262      95.770  35.469  62.559  1.00  0.00           H
ATOM   5872  CG  LYS B 262      95.415  36.206  60.542  1.00  0.00           C
ATOM   5873  HG2 LYS B 262      94.599  35.518  60.321  1.00  0.00           H
ATOM   5874  HG3 LYS B 262      95.235  37.155  60.037  1.00  0.00           H
ATOM   5875  CD  LYS B 262      96.676  35.527  59.908  1.00  0.00           C
ATOM   5876  HD2 LYS B 262      97.552  36.174  59.942  1.00  0.00           H
ATOM   5877  HD3 LYS B 262      97.038  34.742  60.572  1.00  0.00           H
ATOM   5878  CE  LYS B 262      96.422  35.043  58.433  1.00  0.00           C
ATOM   5879  HE2 LYS B 262      95.705  34.223  58.467  1.00  0.00           H
ATOM   5880  HE3 LYS B 262      95.874  35.802  57.874  1.00  0.00           H
ATOM   5881  NZ  LYS B 262      97.567  34.547  57.696  1.00  0.00           N
ATOM   5882  HZ1 LYS B 262      97.383  34.310  56.732  1.00  0.00           H
ATOM   5883  HZ2 LYS B 262      98.376  35.152  57.703  1.00  0.00           H
ATOM   5884  HZ3 LYS B 262      97.888  33.727  58.192  1.00  0.00           H
ATOM   5885  C   LYS B 262      94.465  37.092  64.202  1.00  0.00           C
ATOM   5886  O   LYS B 262      94.466  38.172  64.773  1.00  0.00           O
ATOM   5887  N   GLU B 263      94.571  35.937  64.985  1.00  0.00           N
ATOM   5888  H   GLU B 263      94.755  35.091  64.465  1.00  0.00           H
ATOM   5889  CA  GLU B 263      94.377  35.931  66.474  1.00  0.00           C
ATOM   5890  HA  GLU B 263      93.342  36.224  66.651  1.00  0.00           H
ATOM   5891  CB  GLU B 263      94.628  34.516  66.992  1.00  0.00           C
ATOM   5892  HB2 GLU B 263      95.642  34.259  66.685  1.00  0.00           H
ATOM   5893  HB3 GLU B 263      94.582  34.549  68.081  1.00  0.00           H
ATOM   5894  CG  GLU B 263      93.752  33.436  66.391  1.00  0.00           C
ATOM   5895  HG2 GLU B 263      94.089  33.288  65.365  1.00  0.00           H
ATOM   5896  HG3 GLU B 263      93.728  32.471  66.897  1.00  0.00           H
ATOM   5897  CD  GLU B 263      92.300  33.750  66.100  1.00  0.00           C
ATOM   5898  OE1 GLU B 263      91.666  34.554  66.829  1.00  0.00           O
ATOM   5899  OE2 GLU B 263      91.715  33.213  65.109  1.00  0.00           O
ATOM   5900  C   GLU B 263      95.288  36.907  67.203  1.00  0.00           C
ATOM   5901  O   GLU B 263      94.912  37.475  68.235  1.00  0.00           O
ATOM   5902  N   GLY B 264      96.551  36.993  66.833  1.00  0.00           N
ATOM   5903  H   GLY B 264      96.844  36.745  65.898  1.00  0.00           H
ATOM   5904  CA  GLY B 264      97.507  37.961  67.423  1.00  0.00           C
ATOM   5905  HA2 GLY B 264      97.166  38.270  68.411  1.00  0.00           H
ATOM   5906  HA3 GLY B 264      98.439  37.398  67.474  1.00  0.00           H
ATOM   5907  C   GLY B 264      97.740  39.216  66.608  1.00  0.00           C
ATOM   5908  O   GLY B 264      98.676  39.972  66.846  1.00  0.00           O
ATOM   5909  N   GLN B 265      96.924  39.487  65.581  1.00  0.00           N
ATOM   5910  H   GLN B 265      96.158  38.850  65.413  1.00  0.00           H
ATOM   5911  CA  GLN B 265      96.724  40.782  64.975  1.00  0.00           C
ATOM   5912  HA  GLN B 265      97.712  41.235  65.060  1.00  0.00           H
ATOM   5913  CB  GLN B 265      96.305  40.597  63.495  1.00  0.00           C
ATOM   5914  HB2 GLN B 265      95.397  40.002  63.400  1.00  0.00           H
ATOM   5915  HB3 GLN B 265      96.128  41.553  63.000  1.00  0.00           H
ATOM   5916  CG  GLN B 265      97.444  39.922  62.672  1.00  0.00           C
ATOM   5917  HG2 GLN B 265      98.255  40.649  62.695  1.00  0.00           H
ATOM   5918  HG3 GLN B 265      97.749  38.945  63.047  1.00  0.00           H
ATOM   5919  CD  GLN B 265      96.994  39.627  61.259  1.00  0.00           C
ATOM   5920  OE1 GLN B 265      95.870  39.880  60.878  1.00  0.00           O
ATOM   5921  NE2 GLN B 265      97.905  39.147  60.396  1.00  0.00           N
ATOM   5922 HE21 GLN B 265      97.531  38.727  59.558  1.00  0.00           H
ATOM   5923 HE22 GLN B 265      98.899  39.254  60.538  1.00  0.00           H
ATOM   5924  C   GLN B 265      95.724  41.642  65.774  1.00  0.00           C
ATOM   5925  O   GLN B 265      95.579  42.773  65.459  1.00  0.00           O
ATOM   5926  N   ILE B 266      95.077  41.089  66.767  1.00  0.00           N
ATOM   5927  H   ILE B 266      95.043  40.082  66.836  1.00  0.00           H
ATOM   5928  CA  ILE B 266      94.220  41.759  67.764  1.00  0.00           C
ATOM   5929  HA  ILE B 266      93.423  42.414  67.412  1.00  0.00           H
ATOM   5930  CB  ILE B 266      93.487  40.676  68.539  1.00  0.00           C
ATOM   5931  HB  ILE B 266      94.209  39.979  68.964  1.00  0.00           H
ATOM   5932  CG2 ILE B 266      92.773  41.212  69.771  1.00  0.00           C
ATOM   5933 HG21 ILE B 266      93.506  41.751  70.372  1.00  0.00           H
ATOM   5934 HG22 ILE B 266      91.996  41.934  69.518  1.00  0.00           H
ATOM   5935 HG23 ILE B 266      92.157  40.470  70.278  1.00  0.00           H
ATOM   5936  CG1 ILE B 266      92.460  40.027  67.612  1.00  0.00           C
ATOM   5937 HG12 ILE B 266      93.036  39.497  66.855  1.00  0.00           H
ATOM   5938 HG13 ILE B 266      91.881  39.355  68.246  1.00  0.00           H
ATOM   5939  CD1 ILE B 266      91.322  40.900  67.056  1.00  0.00           C
ATOM   5940 HD11 ILE B 266      90.833  41.556  67.776  1.00  0.00           H
ATOM   5941 HD12 ILE B 266      91.691  41.578  66.286  1.00  0.00           H
ATOM   5942 HD13 ILE B 266      90.604  40.220  66.599  1.00  0.00           H
ATOM   5943  C   ILE B 266      95.116  42.605  68.709  1.00  0.00           C
ATOM   5944  O   ILE B 266      96.232  42.101  69.049  1.00  0.00           O
ATOM   5945  N   ASN B 267      94.583  43.770  69.097  1.00  0.00           N
ATOM   5946  H   ASN B 267      93.598  43.871  68.897  1.00  0.00           H
ATOM   5947  CA  ASN B 267      95.262  44.621  70.044  1.00  0.00           C
ATOM   5948  HA  ASN B 267      95.729  44.002  70.809  1.00  0.00           H
ATOM   5949  CB  ASN B 267      96.343  45.466  69.365  1.00  0.00           C
ATOM   5950  HB2 ASN B 267      96.711  46.043  70.213  1.00  0.00           H
ATOM   5951  HB3 ASN B 267      97.112  44.911  68.826  1.00  0.00           H
ATOM   5952  CG  ASN B 267      95.713  46.416  68.379  1.00  0.00           C
ATOM   5953  OD1 ASN B 267      94.837  47.174  68.632  1.00  0.00           O
ATOM   5954  ND2 ASN B 267      96.024  46.241  67.137  1.00  0.00           N
ATOM   5955 HD21 ASN B 267      95.577  46.845  66.461  1.00  0.00           H
ATOM   5956 HD22 ASN B 267      96.643  45.484  66.884  1.00  0.00           H
ATOM   5957  C   ASN B 267      94.147  45.430  70.849  1.00  0.00           C
ATOM   5958  O   ASN B 267      93.026  45.519  70.424  1.00  0.00           O
ATOM   5959  N   ASP B 268      94.509  46.097  71.940  1.00  0.00           N
ATOM   5960  H   ASP B 268      95.509  46.127  72.078  1.00  0.00           H
ATOM   5961  CA  ASP B 268      93.610  46.888  72.836  1.00  0.00           C
ATOM   5962  HA  ASP B 268      92.891  46.237  73.334  1.00  0.00           H
ATOM   5963  CB  ASP B 268      94.374  47.544  73.998  1.00  0.00           C
ATOM   5964  HB2 ASP B 268      95.022  48.352  73.659  1.00  0.00           H
ATOM   5965  HB3 ASP B 268      93.578  47.953  74.621  1.00  0.00           H
ATOM   5966  CG  ASP B 268      95.231  46.634  74.820  1.00  0.00           C
ATOM   5967  OD1 ASP B 268      95.103  45.369  74.841  1.00  0.00           O
ATOM   5968  OD2 ASP B 268      95.993  47.187  75.637  1.00  0.00           O
ATOM   5969  C   ASP B 268      92.822  47.920  72.057  1.00  0.00           C
ATOM   5970  O   ASP B 268      91.707  48.364  72.430  1.00  0.00           O
ATOM   5971  N   MET B 269      93.274  48.466  70.911  1.00  0.00           N
ATOM   5972  H   MET B 269      94.014  47.989  70.416  1.00  0.00           H
ATOM   5973  CA  MET B 269      92.637  49.519  70.120  1.00  0.00           C
ATOM   5974  HA  MET B 269      92.041  50.178  70.750  1.00  0.00           H
ATOM   5975  CB  MET B 269      93.680  50.383  69.360  1.00  0.00           C
ATOM   5976  HB2 MET B 269      94.061  49.932  68.444  1.00  0.00           H
ATOM   5977  HB3 MET B 269      93.091  51.283  69.186  1.00  0.00           H
ATOM   5978  CG  MET B 269      94.888  50.755  70.233  1.00  0.00           C
ATOM   5979  HG2 MET B 269      95.299  51.683  69.836  1.00  0.00           H
ATOM   5980  HG3 MET B 269      94.473  50.884  71.233  1.00  0.00           H
ATOM   5981  SD  MET B 269      96.119  49.446  70.393  1.00  0.00           S
ATOM   5982  CE  MET B 269      96.980  49.654  68.862  1.00  0.00           C
ATOM   5983  HE1 MET B 269      96.309  49.644  68.003  1.00  0.00           H
ATOM   5984  HE2 MET B 269      97.481  50.622  68.857  1.00  0.00           H
ATOM   5985  HE3 MET B 269      97.776  48.927  68.699  1.00  0.00           H
ATOM   5986  C   MET B 269      91.666  48.863  69.135  1.00  0.00           C
ATOM   5987  O   MET B 269      90.676  49.495  68.874  1.00  0.00           O
ATOM   5988  N   ILE B 270      91.898  47.670  68.638  1.00  0.00           N
ATOM   5989  H   ILE B 270      92.846  47.369  68.814  1.00  0.00           H
ATOM   5990  CA  ILE B 270      90.923  46.820  67.912  1.00  0.00           C
ATOM   5991  HA  ILE B 270      90.450  47.442  67.151  1.00  0.00           H
ATOM   5992  CB  ILE B 270      91.555  45.616  67.263  1.00  0.00           C
ATOM   5993  HB  ILE B 270      92.265  45.122  67.926  1.00  0.00           H
ATOM   5994  CG2 ILE B 270      90.471  44.573  66.833  1.00  0.00           C
ATOM   5995 HG21 ILE B 270      89.629  45.009  66.296  1.00  0.00           H
ATOM   5996 HG22 ILE B 270      90.979  43.820  66.230  1.00  0.00           H
ATOM   5997 HG23 ILE B 270      90.002  43.945  67.589  1.00  0.00           H
ATOM   5998  CG1 ILE B 270      92.392  45.984  66.013  1.00  0.00           C
ATOM   5999 HG12 ILE B 270      93.307  46.462  66.362  1.00  0.00           H
ATOM   6000 HG13 ILE B 270      92.701  45.020  65.609  1.00  0.00           H
ATOM   6001  CD1 ILE B 270      91.712  46.792  64.810  1.00  0.00           C
ATOM   6002 HD11 ILE B 270      91.295  47.707  65.232  1.00  0.00           H
ATOM   6003 HD12 ILE B 270      92.333  46.979  63.934  1.00  0.00           H
ATOM   6004 HD13 ILE B 270      90.870  46.187  64.473  1.00  0.00           H
ATOM   6005  C   ILE B 270      89.780  46.462  68.834  1.00  0.00           C
ATOM   6006  O   ILE B 270      88.640  46.753  68.428  1.00  0.00           O
ATOM   6007  N   LEU B 271      90.060  45.894  70.034  1.00  0.00           N
ATOM   6008  H   LEU B 271      91.032  45.678  70.207  1.00  0.00           H
ATOM   6009  CA  LEU B 271      89.040  45.655  71.002  1.00  0.00           C
ATOM   6010  HA  LEU B 271      88.336  44.906  70.641  1.00  0.00           H
ATOM   6011  CB  LEU B 271      89.770  45.036  72.192  1.00  0.00           C
ATOM   6012  HB2 LEU B 271      90.491  45.786  72.520  1.00  0.00           H
ATOM   6013  HB3 LEU B 271      89.084  44.866  73.022  1.00  0.00           H
ATOM   6014  CG  LEU B 271      90.401  43.616  71.880  1.00  0.00           C
ATOM   6015  HG  LEU B 271      91.112  43.634  71.053  1.00  0.00           H
ATOM   6016  CD1 LEU B 271      91.237  43.193  73.073  1.00  0.00           C
ATOM   6017 HD11 LEU B 271      91.861  44.007  73.440  1.00  0.00           H
ATOM   6018 HD12 LEU B 271      90.580  43.032  73.927  1.00  0.00           H
ATOM   6019 HD13 LEU B 271      91.889  42.364  72.797  1.00  0.00           H
ATOM   6020  CD2 LEU B 271      89.356  42.550  71.607  1.00  0.00           C
ATOM   6021 HD21 LEU B 271      89.810  41.560  71.652  1.00  0.00           H
ATOM   6022 HD22 LEU B 271      88.606  42.643  72.392  1.00  0.00           H
ATOM   6023 HD23 LEU B 271      88.963  42.719  70.604  1.00  0.00           H
ATOM   6024  C   LEU B 271      88.270  46.929  71.549  1.00  0.00           C
ATOM   6025  O   LEU B 271      87.084  46.780  71.854  1.00  0.00           O
ATOM   6026  N   SER B 272      88.838  48.165  71.606  1.00  0.00           N
ATOM   6027  H   SER B 272      89.821  48.279  71.404  1.00  0.00           H
ATOM   6028  CA  SER B 272      88.054  49.398  71.823  1.00  0.00           C
ATOM   6029  HA  SER B 272      87.307  49.253  72.604  1.00  0.00           H
ATOM   6030  CB  SER B 272      88.924  50.575  72.286  1.00  0.00           C
ATOM   6031  HB2 SER B 272      89.426  50.246  73.196  1.00  0.00           H
ATOM   6032  HB3 SER B 272      89.703  50.629  71.526  1.00  0.00           H
ATOM   6033  OG  SER B 272      88.393  51.856  72.337  1.00  0.00           O
ATOM   6034  HG  SER B 272      89.182  52.390  72.216  1.00  0.00           H
ATOM   6035  C   SER B 272      87.246  49.696  70.574  1.00  0.00           C
ATOM   6036  O   SER B 272      86.063  49.914  70.760  1.00  0.00           O
ATOM   6037  N   LEU B 273      87.766  49.762  69.323  1.00  0.00           N
ATOM   6038  H   LEU B 273      88.750  49.662  69.117  1.00  0.00           H
ATOM   6039  CA  LEU B 273      86.859  49.984  68.169  1.00  0.00           C
ATOM   6040  HA  LEU B 273      86.460  50.998  68.210  1.00  0.00           H
ATOM   6041  CB  LEU B 273      87.600  49.826  66.835  1.00  0.00           C
ATOM   6042  HB2 LEU B 273      88.022  48.829  66.960  1.00  0.00           H
ATOM   6043  HB3 LEU B 273      86.979  49.779  65.941  1.00  0.00           H
ATOM   6044  CG  LEU B 273      88.659  51.020  66.663  1.00  0.00           C
ATOM   6045  HG  LEU B 273      89.377  51.086  67.480  1.00  0.00           H
ATOM   6046  CD1 LEU B 273      89.474  50.776  65.407  1.00  0.00           C
ATOM   6047 HD11 LEU B 273      90.006  49.829  65.503  1.00  0.00           H
ATOM   6048 HD12 LEU B 273      88.784  50.801  64.564  1.00  0.00           H
ATOM   6049 HD13 LEU B 273      90.164  51.597  65.215  1.00  0.00           H
ATOM   6050  CD2 LEU B 273      87.970  52.389  66.687  1.00  0.00           C
ATOM   6051 HD21 LEU B 273      87.446  52.613  67.616  1.00  0.00           H
ATOM   6052 HD22 LEU B 273      88.710  53.189  66.672  1.00  0.00           H
ATOM   6053 HD23 LEU B 273      87.270  52.512  65.861  1.00  0.00           H
ATOM   6054  C   LEU B 273      85.687  49.000  67.984  1.00  0.00           C
ATOM   6055  O   LEU B 273      84.524  49.419  67.626  1.00  0.00           O
ATOM   6056  N   LEU B 274      85.908  47.734  68.208  1.00  0.00           N
ATOM   6057  H   LEU B 274      86.875  47.453  68.285  1.00  0.00           H
ATOM   6058  CA  LEU B 274      84.897  46.677  68.279  1.00  0.00           C
ATOM   6059  HA  LEU B 274      84.310  46.632  67.361  1.00  0.00           H
ATOM   6060  CB  LEU B 274      85.655  45.347  68.691  1.00  0.00           C
ATOM   6061  HB2 LEU B 274      86.206  45.528  69.614  1.00  0.00           H
ATOM   6062  HB3 LEU B 274      84.831  44.673  68.928  1.00  0.00           H
ATOM   6063  CG  LEU B 274      86.443  44.720  67.545  1.00  0.00           C
ATOM   6064  HG  LEU B 274      87.147  45.468  67.180  1.00  0.00           H
ATOM   6065  CD1 LEU B 274      87.133  43.474  67.975  1.00  0.00           C
ATOM   6066 HD11 LEU B 274      87.601  43.010  67.107  1.00  0.00           H
ATOM   6067 HD12 LEU B 274      87.934  43.708  68.676  1.00  0.00           H
ATOM   6068 HD13 LEU B 274      86.446  42.747  68.409  1.00  0.00           H
ATOM   6069  CD2 LEU B 274      85.509  44.371  66.370  1.00  0.00           C
ATOM   6070 HD21 LEU B 274      85.972  43.811  65.557  1.00  0.00           H
ATOM   6071 HD22 LEU B 274      84.595  43.896  66.729  1.00  0.00           H
ATOM   6072 HD23 LEU B 274      85.158  45.301  65.924  1.00  0.00           H
ATOM   6073  C   LEU B 274      83.949  46.996  69.408  1.00  0.00           C
ATOM   6074  O   LEU B 274      82.774  46.990  69.083  1.00  0.00           O
ATOM   6075  N   SER B 275      84.437  47.347  70.612  1.00  0.00           N
ATOM   6076  H   SER B 275      85.436  47.449  70.720  1.00  0.00           H
ATOM   6077  CA  SER B 275      83.624  47.736  71.761  1.00  0.00           C
ATOM   6078  HA  SER B 275      82.857  46.986  71.957  1.00  0.00           H
ATOM   6079  CB  SER B 275      84.500  47.807  73.046  1.00  0.00           C
ATOM   6080  HB2 SER B 275      85.301  48.536  72.929  1.00  0.00           H
ATOM   6081  HB3 SER B 275      83.950  48.025  73.962  1.00  0.00           H
ATOM   6082  OG  SER B 275      85.047  46.556  73.335  1.00  0.00           O
ATOM   6083  HG  SER B 275      85.827  46.518  72.777  1.00  0.00           H
ATOM   6084  C   SER B 275      82.880  49.070  71.650  1.00  0.00           C
ATOM   6085  O   SER B 275      81.984  49.304  72.423  1.00  0.00           O
ATOM   6086  N   LYS B 276      83.084  49.786  70.572  1.00  0.00           N
ATOM   6087  H   LYS B 276      83.575  49.364  69.797  1.00  0.00           H
ATOM   6088  CA  LYS B 276      82.250  51.000  70.285  1.00  0.00           C
ATOM   6089  HA  LYS B 276      81.610  51.242  71.133  1.00  0.00           H
ATOM   6090  CB  LYS B 276      83.169  52.180  69.988  1.00  0.00           C
ATOM   6091  HB2 LYS B 276      83.817  51.839  69.180  1.00  0.00           H
ATOM   6092  HB3 LYS B 276      82.699  53.132  69.743  1.00  0.00           H
ATOM   6093  CG  LYS B 276      84.070  52.539  71.198  1.00  0.00           C
ATOM   6094  HG2 LYS B 276      83.365  52.886  71.953  1.00  0.00           H
ATOM   6095  HG3 LYS B 276      84.602  51.660  71.565  1.00  0.00           H
ATOM   6096  CD  LYS B 276      85.083  53.601  70.893  1.00  0.00           C
ATOM   6097  HD2 LYS B 276      85.862  53.193  70.248  1.00  0.00           H
ATOM   6098  HD3 LYS B 276      84.803  54.519  70.376  1.00  0.00           H
ATOM   6099  CE  LYS B 276      85.811  54.046  72.149  1.00  0.00           C
ATOM   6100  HE2 LYS B 276      85.055  54.431  72.834  1.00  0.00           H
ATOM   6101  HE3 LYS B 276      86.327  53.246  72.680  1.00  0.00           H
ATOM   6102  NZ  LYS B 276      86.733  55.121  71.861  1.00  0.00           N
ATOM   6103  HZ1 LYS B 276      86.170  55.934  71.657  1.00  0.00           H
ATOM   6104  HZ2 LYS B 276      87.300  55.303  72.677  1.00  0.00           H
ATOM   6105  HZ3 LYS B 276      87.321  54.860  71.083  1.00  0.00           H
ATOM   6106  C   LYS B 276      81.209  50.761  69.211  1.00  0.00           C
ATOM   6107  O   LYS B 276      80.539  51.753  68.813  1.00  0.00           O
ATOM   6108  N   GLY B 277      81.020  49.586  68.698  1.00  0.00           N
ATOM   6109  H   GLY B 277      81.701  48.899  68.988  1.00  0.00           H
ATOM   6110  CA  GLY B 277      80.380  49.342  67.446  1.00  0.00           C
ATOM   6111  HA2 GLY B 277      80.305  48.289  67.174  1.00  0.00           H
ATOM   6112  HA3 GLY B 277      79.363  49.734  67.437  1.00  0.00           H
ATOM   6113  C   GLY B 277      81.095  50.034  66.217  1.00  0.00           C
ATOM   6114  O   GLY B 277      80.544  50.021  65.121  1.00  0.00           O
ATOM   6115  N   ARG B 278      82.296  50.562  66.348  1.00  0.00           N
ATOM   6116  H   ARG B 278      82.735  50.507  67.256  1.00  0.00           H
ATOM   6117  CA  ARG B 278      83.056  51.125  65.241  1.00  0.00           C
ATOM   6118  HA  ARG B 278      82.380  51.625  64.548  1.00  0.00           H
ATOM   6119  CB  ARG B 278      84.078  52.136  65.790  1.00  0.00           C
ATOM   6120  HB2 ARG B 278      84.717  51.829  66.618  1.00  0.00           H
ATOM   6121  HB3 ARG B 278      84.721  52.545  65.011  1.00  0.00           H
ATOM   6122  CG  ARG B 278      83.269  53.357  66.322  1.00  0.00           C
ATOM   6123  HG2 ARG B 278      82.683  53.796  65.515  1.00  0.00           H
ATOM   6124  HG3 ARG B 278      82.601  53.000  67.105  1.00  0.00           H
ATOM   6125  CD  ARG B 278      84.164  54.551  66.802  1.00  0.00           C
ATOM   6126  HD2 ARG B 278      84.885  54.172  67.526  1.00  0.00           H
ATOM   6127  HD3 ARG B 278      84.672  54.934  65.917  1.00  0.00           H
ATOM   6128  NE  ARG B 278      83.412  55.610  67.547  1.00  0.00           N
ATOM   6129  HE  ARG B 278      82.415  55.578  67.701  1.00  0.00           H
ATOM   6130  CZ  ARG B 278      83.965  56.666  68.090  1.00  0.00           C
ATOM   6131  NH1 ARG B 278      85.258  56.945  67.929  1.00  0.00           N
ATOM   6132 HH11 ARG B 278      85.802  56.559  67.170  1.00  0.00           H
ATOM   6133 HH12 ARG B 278      85.452  57.832  68.370  1.00  0.00           H
ATOM   6134  NH2 ARG B 278      83.342  57.455  68.994  1.00  0.00           N
ATOM   6135 HH21 ARG B 278      82.382  57.292  69.260  1.00  0.00           H
ATOM   6136 HH22 ARG B 278      83.790  58.182  69.533  1.00  0.00           H
ATOM   6137  C   ARG B 278      83.826  50.139  64.359  1.00  0.00           C
ATOM   6138  O   ARG B 278      84.414  50.545  63.332  1.00  0.00           O
ATOM   6139  N   LEU B 279      83.821  48.867  64.647  1.00  0.00           N
ATOM   6140  H   LEU B 279      83.481  48.651  65.574  1.00  0.00           H
ATOM   6141  CA  LEU B 279      84.378  47.823  63.856  1.00  0.00           C
ATOM   6142  HA  LEU B 279      84.249  48.120  62.815  1.00  0.00           H
ATOM   6143  CB  LEU B 279      85.818  47.750  64.122  1.00  0.00           C
ATOM   6144  HB2 LEU B 279      86.270  48.685  63.791  1.00  0.00           H
ATOM   6145  HB3 LEU B 279      86.044  47.681  65.187  1.00  0.00           H
ATOM   6146  CG  LEU B 279      86.625  46.576  63.448  1.00  0.00           C
ATOM   6147  HG  LEU B 279      86.177  45.602  63.644  1.00  0.00           H
ATOM   6148  CD1 LEU B 279      86.860  46.789  61.920  1.00  0.00           C
ATOM   6149 HD11 LEU B 279      87.548  45.999  61.617  1.00  0.00           H
ATOM   6150 HD12 LEU B 279      86.053  46.666  61.198  1.00  0.00           H
ATOM   6151 HD13 LEU B 279      87.349  47.756  61.797  1.00  0.00           H
ATOM   6152  CD2 LEU B 279      88.014  46.522  64.082  1.00  0.00           C
ATOM   6153 HD21 LEU B 279      88.509  45.750  63.492  1.00  0.00           H
ATOM   6154 HD22 LEU B 279      88.556  47.467  64.062  1.00  0.00           H
ATOM   6155 HD23 LEU B 279      87.841  46.267  65.127  1.00  0.00           H
ATOM   6156  C   LEU B 279      83.649  46.442  63.982  1.00  0.00           C
ATOM   6157  O   LEU B 279      83.076  46.150  64.970  1.00  0.00           O
ATOM   6158  N   ILE B 280      83.790  45.630  62.928  1.00  0.00           N
ATOM   6159  H   ILE B 280      84.204  45.955  62.066  1.00  0.00           H
ATOM   6160  CA  ILE B 280      83.283  44.229  62.852  1.00  0.00           C
ATOM   6161  HA  ILE B 280      83.245  43.954  63.906  1.00  0.00           H
ATOM   6162  CB  ILE B 280      81.811  44.265  62.360  1.00  0.00           C
ATOM   6163  HB  ILE B 280      81.198  45.078  62.748  1.00  0.00           H
ATOM   6164  CG2 ILE B 280      81.543  44.121  60.893  1.00  0.00           C
ATOM   6165 HG21 ILE B 280      80.542  44.480  60.654  1.00  0.00           H
ATOM   6166 HG22 ILE B 280      82.249  44.802  60.416  1.00  0.00           H
ATOM   6167 HG23 ILE B 280      81.699  43.090  60.578  1.00  0.00           H
ATOM   6168  CG1 ILE B 280      81.081  43.089  63.015  1.00  0.00           C
ATOM   6169 HG12 ILE B 280      81.433  42.124  62.652  1.00  0.00           H
ATOM   6170 HG13 ILE B 280      81.268  43.052  64.089  1.00  0.00           H
ATOM   6171  CD1 ILE B 280      79.496  43.084  62.914  1.00  0.00           C
ATOM   6172 HD11 ILE B 280      79.058  42.403  63.643  1.00  0.00           H
ATOM   6173 HD12 ILE B 280      79.079  44.064  63.146  1.00  0.00           H
ATOM   6174 HD13 ILE B 280      79.147  42.782  61.926  1.00  0.00           H
ATOM   6175  C   ILE B 280      84.279  43.421  62.117  1.00  0.00           C
ATOM   6176  O   ILE B 280      84.730  43.777  60.986  1.00  0.00           O
ATOM   6177  N   ILE B 281      84.676  42.267  62.676  1.00  0.00           N
ATOM   6178  H   ILE B 281      84.153  41.986  63.493  1.00  0.00           H
ATOM   6179  CA  ILE B 281      85.529  41.309  62.019  1.00  0.00           C
ATOM   6180  HA  ILE B 281      86.161  41.877  61.337  1.00  0.00           H
ATOM   6181  CB  ILE B 281      86.551  40.950  63.128  1.00  0.00           C
ATOM   6182  HB  ILE B 281      86.053  40.644  64.048  1.00  0.00           H
ATOM   6183  CG2 ILE B 281      87.481  39.759  62.783  1.00  0.00           C
ATOM   6184 HG21 ILE B 281      88.080  39.542  63.666  1.00  0.00           H
ATOM   6185 HG22 ILE B 281      86.897  38.903  62.443  1.00  0.00           H
ATOM   6186 HG23 ILE B 281      88.073  40.206  61.985  1.00  0.00           H
ATOM   6187  CG1 ILE B 281      87.498  42.158  63.472  1.00  0.00           C
ATOM   6188 HG12 ILE B 281      88.102  42.362  62.588  1.00  0.00           H
ATOM   6189 HG13 ILE B 281      86.907  43.051  63.678  1.00  0.00           H
ATOM   6190  CD1 ILE B 281      88.546  41.944  64.583  1.00  0.00           C
ATOM   6191 HD11 ILE B 281      89.276  41.234  64.195  1.00  0.00           H
ATOM   6192 HD12 ILE B 281      88.972  42.940  64.702  1.00  0.00           H
ATOM   6193 HD13 ILE B 281      87.970  41.623  65.451  1.00  0.00           H
ATOM   6194  C   ILE B 281      84.821  40.017  61.425  1.00  0.00           C
ATOM   6195  O   ILE B 281      84.214  39.294  62.214  1.00  0.00           O
ATOM   6196  N   ARG B 282      84.873  39.838  60.091  1.00  0.00           N
ATOM   6197  H   ARG B 282      85.356  40.555  59.568  1.00  0.00           H
ATOM   6198  CA  ARG B 282      84.453  38.710  59.294  1.00  0.00           C
ATOM   6199  HA  ARG B 282      84.824  37.785  59.736  1.00  0.00           H
ATOM   6200  CB  ARG B 282      82.904  38.620  59.183  1.00  0.00           C
ATOM   6201  HB2 ARG B 282      82.620  37.760  58.577  1.00  0.00           H
ATOM   6202  HB3 ARG B 282      82.659  38.380  60.217  1.00  0.00           H
ATOM   6203  CG  ARG B 282      82.042  39.874  58.814  1.00  0.00           C
ATOM   6204  HG2 ARG B 282      82.212  40.673  59.535  1.00  0.00           H
ATOM   6205  HG3 ARG B 282      82.285  40.244  57.817  1.00  0.00           H
ATOM   6206  CD  ARG B 282      80.586  39.514  58.753  1.00  0.00           C
ATOM   6207  HD2 ARG B 282      80.321  38.810  57.965  1.00  0.00           H
ATOM   6208  HD3 ARG B 282      80.383  38.950  59.663  1.00  0.00           H
ATOM   6209  NE  ARG B 282      79.637  40.666  58.596  1.00  0.00           N
ATOM   6210  HE  ARG B 282      79.151  40.978  59.425  1.00  0.00           H
ATOM   6211  CZ  ARG B 282      79.074  41.098  57.522  1.00  0.00           C
ATOM   6212  NH1 ARG B 282      77.940  41.752  57.621  1.00  0.00           N
ATOM   6213 HH11 ARG B 282      77.576  41.869  58.556  1.00  0.00           H
ATOM   6214 HH12 ARG B 282      77.392  42.160  56.877  1.00  0.00           H
ATOM   6215  NH2 ARG B 282      79.570  40.812  56.331  1.00  0.00           N
ATOM   6216 HH21 ARG B 282      80.452  40.334  56.215  1.00  0.00           H
ATOM   6217 HH22 ARG B 282      79.027  40.916  55.486  1.00  0.00           H
ATOM   6218  C   ARG B 282      85.129  38.711  57.934  1.00  0.00           C
ATOM   6219  O   ARG B 282      85.352  39.757  57.322  1.00  0.00           O
ATOM   6220  N   GLU B 283      85.347  37.561  57.398  1.00  0.00           N
ATOM   6221  H   GLU B 283      85.045  36.691  57.813  1.00  0.00           H
ATOM   6222  CA  GLU B 283      85.974  37.254  56.120  1.00  0.00           C
ATOM   6223  HA  GLU B 283      86.819  37.925  55.968  1.00  0.00           H
ATOM   6224  CB  GLU B 283      86.430  35.757  56.113  1.00  0.00           C
ATOM   6225  HB2 GLU B 283      86.803  35.548  57.116  1.00  0.00           H
ATOM   6226  HB3 GLU B 283      85.526  35.190  55.891  1.00  0.00           H
ATOM   6227  CG  GLU B 283      87.471  35.338  55.020  1.00  0.00           C
ATOM   6228  HG2 GLU B 283      87.818  34.343  55.301  1.00  0.00           H
ATOM   6229  HG3 GLU B 283      87.125  35.348  53.987  1.00  0.00           H
ATOM   6230  CD  GLU B 283      88.559  36.309  55.059  1.00  0.00           C
ATOM   6231  OE1 GLU B 283      88.561  37.257  54.252  1.00  0.00           O
ATOM   6232  OE2 GLU B 283      89.421  36.310  56.000  1.00  0.00           O
ATOM   6233  C   GLU B 283      85.079  37.574  54.945  1.00  0.00           C
ATOM   6234  O   GLU B 283      83.844  37.366  54.943  1.00  0.00           O
ATOM   6235  N   ASN B 284      85.781  37.992  53.841  1.00  0.00           N
ATOM   6236  H   ASN B 284      86.780  38.120  53.903  1.00  0.00           H
ATOM   6237  CA  ASN B 284      85.003  38.314  52.584  1.00  0.00           C
ATOM   6238  HA  ASN B 284      84.098  38.816  52.923  1.00  0.00           H
ATOM   6239  CB  ASN B 284      85.847  39.357  51.747  1.00  0.00           C
ATOM   6240  HB2 ASN B 284      85.980  40.135  52.499  1.00  0.00           H
ATOM   6241  HB3 ASN B 284      86.833  38.993  51.460  1.00  0.00           H
ATOM   6242  CG  ASN B 284      85.251  40.109  50.607  1.00  0.00           C
ATOM   6243  OD1 ASN B 284      85.853  40.209  49.514  1.00  0.00           O
ATOM   6244  ND2 ASN B 284      84.041  40.681  50.812  1.00  0.00           N
ATOM   6245 HD21 ASN B 284      83.719  41.294  50.076  1.00  0.00           H
ATOM   6246 HD22 ASN B 284      83.729  40.754  51.769  1.00  0.00           H
ATOM   6247  C   ASN B 284      84.459  37.171  51.786  1.00  0.00           C
ATOM   6248  O   ASN B 284      83.939  37.405  50.665  1.00  0.00           O
ATOM   6249  N   ASN B 285      84.364  35.959  52.331  1.00  0.00           N
ATOM   6250  H   ASN B 285      84.772  35.819  53.244  1.00  0.00           H
ATOM   6251  CA  ASN B 285      83.716  34.834  51.724  1.00  0.00           C
ATOM   6252  HA  ASN B 285      84.214  34.531  50.803  1.00  0.00           H
ATOM   6253  CB  ASN B 285      83.704  33.696  52.736  1.00  0.00           C
ATOM   6254  HB2 ASN B 285      83.387  34.023  53.726  1.00  0.00           H
ATOM   6255  HB3 ASN B 285      83.010  32.925  52.402  1.00  0.00           H
ATOM   6256  CG  ASN B 285      84.958  32.859  52.774  1.00  0.00           C
ATOM   6257  OD1 ASN B 285      85.835  33.038  53.634  1.00  0.00           O
ATOM   6258  ND2 ASN B 285      85.181  32.007  51.788  1.00  0.00           N
ATOM   6259 HD21 ASN B 285      86.004  31.423  51.808  1.00  0.00           H
ATOM   6260 HD22 ASN B 285      84.501  31.877  51.052  1.00  0.00           H
ATOM   6261  C   ASN B 285      82.253  35.152  51.369  1.00  0.00           C
ATOM   6262  O   ASN B 285      81.628  36.018  52.002  1.00  0.00           O
ATOM   6263  N   ARG B 286      81.644  34.538  50.363  1.00  0.00           N
ATOM   6264  H   ARG B 286      82.195  33.844  49.877  1.00  0.00           H
ATOM   6265  CA  ARG B 286      80.203  34.368  50.163  1.00  0.00           C
ATOM   6266  HA  ARG B 286      79.653  35.263  49.871  1.00  0.00           H
ATOM   6267  CB  ARG B 286      80.053  33.434  48.919  1.00  0.00           C
ATOM   6268  HB2 ARG B 286      80.703  33.762  48.108  1.00  0.00           H
ATOM   6269  HB3 ARG B 286      80.346  32.429  49.223  1.00  0.00           H
ATOM   6270  CG  ARG B 286      78.576  33.482  48.413  1.00  0.00           C
ATOM   6271  HG2 ARG B 286      77.829  33.122  49.121  1.00  0.00           H
ATOM   6272  HG3 ARG B 286      78.255  34.499  48.187  1.00  0.00           H
ATOM   6273  CD  ARG B 286      78.376  32.613  47.173  1.00  0.00           C
ATOM   6274  HD2 ARG B 286      78.713  31.612  47.442  1.00  0.00           H
ATOM   6275  HD3 ARG B 286      77.330  32.397  46.957  1.00  0.00           H
ATOM   6276  NE  ARG B 286      79.167  32.993  45.998  1.00  0.00           N
ATOM   6277  HE  ARG B 286      79.943  32.383  45.789  1.00  0.00           H
ATOM   6278  CZ  ARG B 286      78.925  33.942  45.090  1.00  0.00           C
ATOM   6279  NH1 ARG B 286      79.753  34.152  44.126  1.00  0.00           N
ATOM   6280 HH11 ARG B 286      80.699  33.841  44.294  1.00  0.00           H
ATOM   6281 HH12 ARG B 286      79.494  34.841  43.434  1.00  0.00           H
ATOM   6282  NH2 ARG B 286      77.883  34.697  45.239  1.00  0.00           N
ATOM   6283 HH21 ARG B 286      77.131  34.414  45.851  1.00  0.00           H
ATOM   6284 HH22 ARG B 286      77.697  35.373  44.512  1.00  0.00           H
ATOM   6285  C   ARG B 286      79.469  33.657  51.333  1.00  0.00           C
ATOM   6286  O   ARG B 286      80.053  32.768  52.001  1.00  0.00           O
ATOM   6287  N   VAL B 287      78.155  33.980  51.472  1.00  0.00           N
ATOM   6288  H   VAL B 287      77.844  34.670  50.803  1.00  0.00           H
ATOM   6289  CA  VAL B 287      77.211  33.413  52.455  1.00  0.00           C
ATOM   6290  HA  VAL B 287      77.782  33.462  53.382  1.00  0.00           H
ATOM   6291  CB  VAL B 287      76.011  34.350  52.616  1.00  0.00           C
ATOM   6292  HB  VAL B 287      75.788  34.598  51.579  1.00  0.00           H
ATOM   6293  CG1 VAL B 287      74.869  33.534  53.266  1.00  0.00           C
ATOM   6294 HG11 VAL B 287      74.073  34.247  53.478  1.00  0.00           H
ATOM   6295 HG12 VAL B 287      74.530  32.772  52.565  1.00  0.00           H
ATOM   6296 HG13 VAL B 287      75.243  33.155  54.217  1.00  0.00           H
ATOM   6297  CG2 VAL B 287      76.349  35.643  53.330  1.00  0.00           C
ATOM   6298 HG21 VAL B 287      75.461  36.273  53.382  1.00  0.00           H
ATOM   6299 HG22 VAL B 287      76.749  35.502  54.334  1.00  0.00           H
ATOM   6300 HG23 VAL B 287      77.236  36.128  52.924  1.00  0.00           H
ATOM   6301  C   VAL B 287      76.900  31.948  52.116  1.00  0.00           C
ATOM   6302  O   VAL B 287      76.622  31.639  50.933  1.00  0.00           O
ATOM   6303  N   VAL B 288      76.878  31.113  53.112  1.00  0.00           N
ATOM   6304  H   VAL B 288      77.147  31.456  54.024  1.00  0.00           H
ATOM   6305  CA  VAL B 288      76.578  29.676  53.081  1.00  0.00           C
ATOM   6306  HA  VAL B 288      75.973  29.289  52.260  1.00  0.00           H
ATOM   6307  CB  VAL B 288      77.904  28.879  53.059  1.00  0.00           C
ATOM   6308  HB  VAL B 288      78.729  29.279  53.649  1.00  0.00           H
ATOM   6309  CG1 VAL B 288      77.626  27.359  53.429  1.00  0.00           C
ATOM   6310 HG11 VAL B 288      78.451  26.652  53.509  1.00  0.00           H
ATOM   6311 HG12 VAL B 288      77.194  27.290  54.427  1.00  0.00           H
ATOM   6312 HG13 VAL B 288      76.855  26.939  52.782  1.00  0.00           H
ATOM   6313  CG2 VAL B 288      78.587  28.961  51.650  1.00  0.00           C
ATOM   6314 HG21 VAL B 288      78.913  29.967  51.386  1.00  0.00           H
ATOM   6315 HG22 VAL B 288      79.399  28.239  51.730  1.00  0.00           H
ATOM   6316 HG23 VAL B 288      77.900  28.534  50.919  1.00  0.00           H
ATOM   6317  C   VAL B 288      75.727  29.431  54.275  1.00  0.00           C
ATOM   6318  O   VAL B 288      76.126  29.665  55.406  1.00  0.00           O
ATOM   6319  N   ILE B 289      74.548  28.966  53.930  1.00  0.00           N
ATOM   6320  H   ILE B 289      74.350  28.808  52.952  1.00  0.00           H
ATOM   6321  CA  ILE B 289      73.492  28.628  54.860  1.00  0.00           C
ATOM   6322  HA  ILE B 289      74.079  28.229  55.687  1.00  0.00           H
ATOM   6323  CB  ILE B 289      72.695  29.899  55.260  1.00  0.00           C
ATOM   6324  HB  ILE B 289      73.467  30.550  55.669  1.00  0.00           H
ATOM   6325  CG2 ILE B 289      72.105  30.440  53.896  1.00  0.00           C
ATOM   6326 HG21 ILE B 289      71.411  29.750  53.417  1.00  0.00           H
ATOM   6327 HG22 ILE B 289      71.446  31.282  54.112  1.00  0.00           H
ATOM   6328 HG23 ILE B 289      72.865  30.704  53.161  1.00  0.00           H
ATOM   6329  CG1 ILE B 289      71.705  29.711  56.497  1.00  0.00           C
ATOM   6330 HG12 ILE B 289      70.717  29.573  56.056  1.00  0.00           H
ATOM   6331 HG13 ILE B 289      72.009  28.934  57.198  1.00  0.00           H
ATOM   6332  CD1 ILE B 289      71.718  30.964  57.408  1.00  0.00           C
ATOM   6333 HD11 ILE B 289      72.745  30.935  57.773  1.00  0.00           H
ATOM   6334 HD12 ILE B 289      71.692  31.904  56.856  1.00  0.00           H
ATOM   6335 HD13 ILE B 289      70.994  30.895  58.219  1.00  0.00           H
ATOM   6336  C   ILE B 289      72.666  27.455  54.412  1.00  0.00           C
ATOM   6337  O   ILE B 289      72.369  27.401  53.179  1.00  0.00           O
ATOM   6338  N   SER B 290      72.523  26.461  55.321  1.00  0.00           N
ATOM   6339  H   SER B 290      72.776  26.563  56.294  1.00  0.00           H
ATOM   6340  CA  SER B 290      71.778  25.225  54.902  1.00  0.00           C
ATOM   6341  HA  SER B 290      71.141  25.429  54.041  1.00  0.00           H
ATOM   6342  CB  SER B 290      72.902  24.258  54.390  1.00  0.00           C
ATOM   6343  HB2 SER B 290      73.688  24.761  53.827  1.00  0.00           H
ATOM   6344  HB3 SER B 290      73.466  23.856  55.231  1.00  0.00           H
ATOM   6345  OG  SER B 290      72.413  23.190  53.581  1.00  0.00           O
ATOM   6346  HG  SER B 290      73.154  22.584  53.651  1.00  0.00           H
ATOM   6347  C   SER B 290      71.130  24.644  56.149  1.00  0.00           C
ATOM   6348  O   SER B 290      71.089  25.249  57.184  1.00  0.00           O
ATOM   6349  N   SER B 291      70.557  23.479  56.011  1.00  0.00           N
ATOM   6350  H   SER B 291      70.653  23.065  55.095  1.00  0.00           H
ATOM   6351  CA  SER B 291      69.959  22.744  57.182  1.00  0.00           C
ATOM   6352  HA  SER B 291      70.640  22.820  58.029  1.00  0.00           H
ATOM   6353  CB  SER B 291      68.654  23.333  57.595  1.00  0.00           C
ATOM   6354  HB2 SER B 291      68.833  24.177  58.261  1.00  0.00           H
ATOM   6355  HB3 SER B 291      68.059  23.567  56.712  1.00  0.00           H
ATOM   6356  OG  SER B 291      68.017  22.488  58.546  1.00  0.00           O
ATOM   6357  HG  SER B 291      67.451  23.076  59.051  1.00  0.00           H
ATOM   6358  C   SER B 291      69.864  21.221  56.864  1.00  0.00           C
ATOM   6359  O   SER B 291      69.919  20.700  55.735  1.00  0.00           O
ATOM   6360  N   ASP B 292      69.711  20.448  57.989  1.00  0.00           N
ATOM   6361  H   ASP B 292      69.848  20.979  58.837  1.00  0.00           H
ATOM   6362  CA  ASP B 292      69.361  19.040  57.867  1.00  0.00           C
ATOM   6363  HA  ASP B 292      70.108  18.653  57.174  1.00  0.00           H
ATOM   6364  CB  ASP B 292      69.479  18.365  59.265  1.00  0.00           C
ATOM   6365  HB2 ASP B 292      68.745  18.862  59.899  1.00  0.00           H
ATOM   6366  HB3 ASP B 292      69.203  17.311  59.289  1.00  0.00           H
ATOM   6367  CG  ASP B 292      70.836  18.517  59.896  1.00  0.00           C
ATOM   6368  OD1 ASP B 292      70.903  18.894  61.032  1.00  0.00           O
ATOM   6369  OD2 ASP B 292      71.889  18.321  59.343  1.00  0.00           O
ATOM   6370  C   ASP B 292      67.932  18.831  57.360  1.00  0.00           C
ATOM   6371  O   ASP B 292      67.729  17.895  56.569  1.00  0.00           O
ATOM   6372  N   VAL B 293      67.010  19.734  57.675  1.00  0.00           N
ATOM   6373  H   VAL B 293      67.187  20.572  58.210  1.00  0.00           H
ATOM   6374  CA  VAL B 293      65.629  19.624  57.200  1.00  0.00           C
ATOM   6375  HA  VAL B 293      65.369  18.576  57.051  1.00  0.00           H
ATOM   6376  CB  VAL B 293      64.706  20.292  58.199  1.00  0.00           C
ATOM   6377  HB  VAL B 293      64.939  21.339  58.394  1.00  0.00           H
ATOM   6378  CG1 VAL B 293      63.337  20.389  57.589  1.00  0.00           C
ATOM   6379 HG11 VAL B 293      62.972  19.386  57.366  1.00  0.00           H
ATOM   6380 HG12 VAL B 293      62.573  20.821  58.235  1.00  0.00           H
ATOM   6381 HG13 VAL B 293      63.298  21.021  56.702  1.00  0.00           H
ATOM   6382  CG2 VAL B 293      64.689  19.488  59.600  1.00  0.00           C
ATOM   6383 HG21 VAL B 293      64.144  20.054  60.356  1.00  0.00           H
ATOM   6384 HG22 VAL B 293      64.060  18.607  59.471  1.00  0.00           H
ATOM   6385 HG23 VAL B 293      65.689  19.183  59.908  1.00  0.00           H
ATOM   6386  C   VAL B 293      65.620  20.213  55.789  1.00  0.00           C
ATOM   6387  O   VAL B 293      65.946  21.398  55.688  1.00  0.00           O
ATOM   6388  N   LEU B 294      65.353  19.400  54.776  1.00  0.00           N
ATOM   6389  H   LEU B 294      65.368  18.437  55.078  1.00  0.00           H
ATOM   6390  CA  LEU B 294      65.330  19.716  53.361  1.00  0.00           C
ATOM   6391  HA  LEU B 294      66.323  20.048  53.059  1.00  0.00           H
ATOM   6392  CB  LEU B 294      65.010  18.382  52.691  1.00  0.00           C
ATOM   6393  HB2 LEU B 294      65.833  17.701  52.905  1.00  0.00           H
ATOM   6394  HB3 LEU B 294      64.141  18.013  53.235  1.00  0.00           H
ATOM   6395  CG  LEU B 294      64.721  18.480  51.182  1.00  0.00           C
ATOM   6396  HG  LEU B 294      63.878  19.141  50.982  1.00  0.00           H
ATOM   6397  CD1 LEU B 294      65.800  19.101  50.251  1.00  0.00           C
ATOM   6398 HD11 LEU B 294      65.402  19.177  49.239  1.00  0.00           H
ATOM   6399 HD12 LEU B 294      66.004  20.143  50.497  1.00  0.00           H
ATOM   6400 HD13 LEU B 294      66.690  18.471  50.242  1.00  0.00           H
ATOM   6401  CD2 LEU B 294      64.341  17.092  50.618  1.00  0.00           C
ATOM   6402 HD21 LEU B 294      64.319  17.091  49.529  1.00  0.00           H
ATOM   6403 HD22 LEU B 294      64.872  16.225  51.013  1.00  0.00           H
ATOM   6404 HD23 LEU B 294      63.314  16.952  50.955  1.00  0.00           H
ATOM   6405  C   LEU B 294      64.334  20.890  53.095  1.00  0.00           C
ATOM   6406  O   LEU B 294      63.100  20.805  53.309  1.00  0.00           O
ATOM   6407  N   VAL B 295      64.826  21.926  52.411  1.00  0.00           N
ATOM   6408  H   VAL B 295      65.807  21.983  52.176  1.00  0.00           H
ATOM   6409  CA  VAL B 295      64.171  23.160  52.217  1.00  0.00           C
ATOM   6410  HA  VAL B 295      63.894  23.477  53.223  1.00  0.00           H
ATOM   6411  CB  VAL B 295      65.059  24.252  51.587  1.00  0.00           C
ATOM   6412  HB  VAL B 295      64.455  25.150  51.457  1.00  0.00           H
ATOM   6413  CG1 VAL B 295      66.153  24.666  52.538  1.00  0.00           C
ATOM   6414 HG11 VAL B 295      66.508  25.604  52.109  1.00  0.00           H
ATOM   6415 HG12 VAL B 295      65.747  24.823  53.537  1.00  0.00           H
ATOM   6416 HG13 VAL B 295      66.902  23.875  52.563  1.00  0.00           H
ATOM   6417  CG2 VAL B 295      65.584  23.827  50.225  1.00  0.00           C
ATOM   6418 HG21 VAL B 295      66.106  22.871  50.278  1.00  0.00           H
ATOM   6419 HG22 VAL B 295      64.852  23.886  49.419  1.00  0.00           H
ATOM   6420 HG23 VAL B 295      66.372  24.536  49.973  1.00  0.00           H
ATOM   6421  C   VAL B 295      62.974  23.124  51.306  1.00  0.00           C
ATOM   6422  O   VAL B 295      62.826  22.370  50.349  1.00  0.00           O
ATOM   6423  N   ASN B 296      62.174  24.136  51.595  1.00  0.00           N
ATOM   6424  H   ASN B 296      62.579  24.775  52.264  1.00  0.00           H
ATOM   6425  CA  ASN B 296      61.025  24.507  50.799  1.00  0.00           C
ATOM   6426  HA  ASN B 296      60.408  23.650  50.531  1.00  0.00           H
ATOM   6427  CB  ASN B 296      60.113  25.452  51.700  1.00  0.00           C
ATOM   6428  HB2 ASN B 296      59.857  24.887  52.596  1.00  0.00           H
ATOM   6429  HB3 ASN B 296      60.665  26.344  51.995  1.00  0.00           H
ATOM   6430  CG  ASN B 296      58.805  25.910  51.068  1.00  0.00           C
ATOM   6431  OD1 ASN B 296      58.228  25.237  50.180  1.00  0.00           O
ATOM   6432  ND2 ASN B 296      58.151  26.963  51.578  1.00  0.00           N
ATOM   6433 HD21 ASN B 296      57.282  27.347  51.237  1.00  0.00           H
ATOM   6434 HD22 ASN B 296      58.502  27.401  52.418  1.00  0.00           H
ATOM   6435  C   ASN B 296      61.511  25.193  49.555  1.00  0.00           C
ATOM   6436  O   ASN B 296      62.164  26.236  49.672  1.00  0.00           O
ATOM   6437  N   ASN B 297      61.238  24.671  48.356  1.00  0.00           N
ATOM   6438  H   ASN B 297      60.665  23.841  48.309  1.00  0.00           H
ATOM   6439  CA  ASN B 297      61.402  25.534  47.207  1.00  0.00           C
ATOM   6440  HA  ASN B 297      61.154  26.555  47.496  1.00  0.00           H
ATOM   6441  CB  ASN B 297      62.864  25.365  46.703  1.00  0.00           C
ATOM   6442  HB2 ASN B 297      63.487  26.087  47.230  1.00  0.00           H
ATOM   6443  HB3 ASN B 297      63.103  24.314  46.868  1.00  0.00           H
ATOM   6444  CG  ASN B 297      63.176  25.612  45.239  1.00  0.00           C
ATOM   6445  OD1 ASN B 297      62.481  26.162  44.405  1.00  0.00           O
ATOM   6446  ND2 ASN B 297      64.249  25.059  44.760  1.00  0.00           N
ATOM   6447 HD21 ASN B 297      64.434  25.277  43.792  1.00  0.00           H
ATOM   6448 HD22 ASN B 297      64.942  24.589  45.324  1.00  0.00           H
ATOM   6449  C   ASN B 297      60.400  25.222  46.123  1.00  0.00           C
ATOM   6450  O   ASN B 297      60.466  24.102  45.475  1.00  0.00           O
ATOM   6451  OXT ASN B 297      59.488  26.095  45.872  1.00  0.00           O
TER    6452      ASN B 297
HETATM 6453 ZN   ZN  B 420      58.126  26.939  45.787  1.00  0.00          Zn
HETATM 6454 ZN   ZN  B 421      36.056  58.973  47.284  1.00  0.00          Zn
HETATM 6455 CL   CL  B 422      67.430  35.908  19.768  1.00  0.00          Cl
HETATM 6456 CL   CL  B 423      94.457  67.127  39.362  1.00  0.00          Cl
HETATM 6457 CL   CL  B 424      37.416  57.606  47.289  1.00  0.00          Cl
HETATM 6458 CL   CL  B 425      81.853  54.691  74.063  1.00  0.00          Cl
HETATM 6459 CL   CL  B 426      86.314  86.533  31.015  1.00  0.00          Cl
END


A second structure was input as follows:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 nsp10 / nsp16 hetero-oligomeric complex |  P0DTD1 PRO_0000449628,
TITLE    3 PRO_0000449633
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   20-MAY-20 1MOD    1       16:46
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.0.0
REMARK   3  OSTAT   hetero-1-1-mer
REMARK   3  OSRSN   TEMPLATE
REMARK   3  QSPRD   NA
REMARK   3  QMN4    -1.19
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    SAM
REMARK   3  BIND    A.43
REMARK   3  BIND 2  A.47
REMARK   3  BIND 3  A.71
REMARK   3  BIND 4  A.72
REMARK   3  BIND 5  A.73
REMARK   3  BIND 6  A.74
REMARK   3  BIND 7  A.80
REMARK   3  BIND 8  A.81
REMARK   3  BIND 9  A.99
REMARK   3  BIND 10  A.100
REMARK   3  BIND 11  A.101
REMARK   3  BIND 12  A.113
REMARK   3  BIND 13  A.114
REMARK   3  BIND 14  A.115
REMARK   3  BIND 15  A.130
REMARK   3  BIND 16  A.131
REMARK   3  BIND 17  A.132
REMARK   3  BIND 18  A.149
REMARK   3  BIND 19  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    ZN
REMARK   3  BIND    B.74
REMARK   3  BIND 2  B.77
REMARK   3  BIND 3  B.83
REMARK   3  BIND 4  B.90
REMARK   3  BIND 5  _.12
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    ZN
REMARK   3  BIND    B.117
REMARK   3  BIND 2  B.120
REMARK   3  BIND 3  B.128
REMARK   3  BIND 4  B.130
REMARK   3  BIND 5  _.13
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   6w75
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2020-05-15
REMARK   3  SMTLE   6w75.1
REMARK   3  SMTLV   2020-05-20
REMARK   3  MTHD    X-RAY DIFFRACTION 1.95 A
REMARK   3  FOUND   HHblits
REMARK   3  SIM     0.62
REMARK   3  SID     100.00
REMARK   3  OSTAT   hetero-1-1-mer
REMARK   3  LIGND   SAM
REMARK   3  LIGND 2 ZN
REMARK   3  LIGND 3 ZN
REMARK   3  ALN A TRG SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLT
REMARK   3  ALN A TRG LAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCA
REMARK   3  ALN A TRG TVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEH
REMARK   3  ALN A TRG SWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWR
REMARK   3  ALN A TRG NTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVI
REMARK   3  ALN A TRG SSDVLVNN
REMARK   3  ALN A TPL -SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLT
REMARK   3  ALN A TPL LAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCA
REMARK   3  ALN A TPL TVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEH
REMARK   3  ALN A TPL SWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWR
REMARK   3  ALN A TPL NTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVI
REMARK   3  ALN A TPL SSDVLVNN
REMARK   3  ALN A OFF 4
REMARK   3  ALN B TRG AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVT
REMARK   3  ALN B TRG PEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV
REMARK   3  ALN B TRG CTVCGMWKGYGCSCDQLREPMLQ
REMARK   3  ALN B TPL AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVT
REMARK   3  ALN B TPL PEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV
REMARK   3  ALN B TPL CTVCGMWKGYGCSCDQLREPMLQ
REMARK   3  ALN B OFF 3
ATOM      1  N   ALA B  18      58.979 -10.488 -20.193  1.00  0.27           N  
ATOM      2  CA  ALA B  18      58.238  -9.280 -20.688  1.00  0.27           C  
ATOM      3  C   ALA B  18      57.914  -8.206 -19.659  1.00  0.27           C  
ATOM      4  O   ALA B  18      57.715  -7.062 -20.034  1.00  0.27           O  
ATOM      5  CB  ALA B  18      56.940  -9.738 -21.384  1.00  0.27           C  
ATOM      6  N   PHE B  19      57.864  -8.528 -18.342  1.00  0.33           N  
ATOM      7  CA  PHE B  19      57.697  -7.537 -17.290  1.00  0.33           C  
ATOM      8  C   PHE B  19      58.796  -6.481 -17.307  1.00  0.33           C  
ATOM      9  O   PHE B  19      59.975  -6.798 -17.449  1.00  0.33           O  
ATOM     10  CB  PHE B  19      57.663  -8.266 -15.916  1.00  0.33           C  
ATOM     11  CG  PHE B  19      57.516  -7.323 -14.753  1.00  0.33           C  
ATOM     12  CD1 PHE B  19      56.311  -6.641 -14.537  1.00  0.33           C  
ATOM     13  CD2 PHE B  19      58.610  -7.056 -13.912  1.00  0.33           C  
ATOM     14  CE1 PHE B  19      56.199  -5.707 -13.501  1.00  0.33           C  
ATOM     15  CE2 PHE B  19      58.499  -6.123 -12.875  1.00  0.33           C  
ATOM     16  CZ  PHE B  19      57.292  -5.449 -12.667  1.00  0.33           C  
ATOM     17  N   ALA B  20      58.394  -5.210 -17.166  1.00  0.43           N  
ATOM     18  CA  ALA B  20      59.301  -4.104 -17.124  1.00  0.43           C  
ATOM     19  C   ALA B  20      58.677  -3.077 -16.201  1.00  0.43           C  
ATOM     20  O   ALA B  20      57.492  -2.771 -16.302  1.00  0.43           O  
ATOM     21  CB  ALA B  20      59.503  -3.555 -18.551  1.00  0.43           C  
ATOM     22  N   VAL B  21      59.454  -2.552 -15.235  1.00  0.67           N  
ATOM     23  CA  VAL B  21      59.034  -1.466 -14.361  1.00  0.67           C  
ATOM     24  C   VAL B  21      58.948  -0.143 -15.118  1.00  0.67           C  
ATOM     25  O   VAL B  21      59.935   0.324 -15.683  1.00  0.67           O  
ATOM     26  CB  VAL B  21      59.995  -1.334 -13.180  1.00  0.67           C  
ATOM     27  CG1 VAL B  21      59.662  -0.119 -12.291  1.00  0.67           C  
ATOM     28  CG2 VAL B  21      59.956  -2.621 -12.332  1.00  0.67           C  
ATOM     29  N   ASP B  22      57.764   0.512 -15.124  1.00  0.85           N  
ATOM     30  CA  ASP B  22      57.555   1.792 -15.776  1.00  0.85           C  
ATOM     31  C   ASP B  22      57.606   2.889 -14.716  1.00  0.85           C  
ATOM     32  O   ASP B  22      56.605   3.322 -14.143  1.00  0.85           O  
ATOM     33  CB  ASP B  22      56.239   1.778 -16.596  1.00  0.85           C  
ATOM     34  CG  ASP B  22      56.072   3.009 -17.485  1.00  0.85           C  
ATOM     35  OD1 ASP B  22      56.798   4.022 -17.280  1.00  0.85           O  
ATOM     36  OD2 ASP B  22      55.156   2.971 -18.344  1.00  0.85           O  
ATOM     37  N   ALA B  23      58.834   3.347 -14.405  1.00  0.93           N  
ATOM     38  CA  ALA B  23      59.077   4.412 -13.457  1.00  0.93           C  
ATOM     39  C   ALA B  23      58.507   5.764 -13.876  1.00  0.93           C  
ATOM     40  O   ALA B  23      58.024   6.534 -13.049  1.00  0.93           O  
ATOM     41  CB  ALA B  23      60.585   4.535 -13.187  1.00  0.93           C  
ATOM     42  N   ALA B  24      58.563   6.089 -15.184  1.00  0.93           N  
ATOM     43  CA  ALA B  24      58.036   7.313 -15.738  1.00  0.93           C  
ATOM     44  C   ALA B  24      56.543   7.456 -15.584  1.00  0.93           C  
ATOM     45  O   ALA B  24      56.060   8.513 -15.188  1.00  0.93           O  
ATOM     46  CB  ALA B  24      58.343   7.379 -17.239  1.00  0.93           C  
ATOM     47  N   LYS B  25      55.772   6.392 -15.876  1.00  0.87           N  
ATOM     48  CA  LYS B  25      54.350   6.364 -15.607  1.00  0.87           C  
ATOM     49  C   LYS B  25      54.030   6.472 -14.124  1.00  0.87           C  
ATOM     50  O   LYS B  25      53.200   7.281 -13.723  1.00  0.87           O  
ATOM     51  CB  LYS B  25      53.746   5.070 -16.185  1.00  0.87           C  
ATOM     52  CG  LYS B  25      52.251   4.887 -15.911  1.00  0.87           C  
ATOM     53  CD  LYS B  25      51.713   3.558 -16.460  1.00  0.87           C  
ATOM     54  CE  LYS B  25      50.315   3.227 -15.936  1.00  0.87           C  
ATOM     55  NZ  LYS B  25      49.402   4.358 -16.200  1.00  0.87           N  
ATOM     56  N   ALA B  26      54.746   5.714 -13.266  1.00  0.89           N  
ATOM     57  CA  ALA B  26      54.539   5.715 -11.831  1.00  0.89           C  
ATOM     58  C   ALA B  26      54.744   7.074 -11.167  1.00  0.89           C  
ATOM     59  O   ALA B  26      53.963   7.487 -10.311  1.00  0.89           O  
ATOM     60  CB  ALA B  26      55.482   4.681 -11.190  1.00  0.89           C  
ATOM     61  N   TYR B  27      55.790   7.825 -11.574  1.00  0.90           N  
ATOM     62  CA  TYR B  27      56.007   9.192 -11.132  1.00  0.90           C  
ATOM     63  C   TYR B  27      54.888  10.133 -11.574  1.00  0.90           C  
ATOM     64  O   TYR B  27      54.400  10.942 -10.793  1.00  0.90           O  
ATOM     65  CB  TYR B  27      57.394   9.705 -11.608  1.00  0.90           C  
ATOM     66  CG  TYR B  27      57.773  11.031 -10.978  1.00  0.90           C  
ATOM     67  CD1 TYR B  27      57.974  11.134  -9.594  1.00  0.90           C  
ATOM     68  CD2 TYR B  27      57.896  12.194 -11.755  1.00  0.90           C  
ATOM     69  CE1 TYR B  27      58.292  12.366  -9.002  1.00  0.90           C  
ATOM     70  CE2 TYR B  27      58.267  13.412 -11.169  1.00  0.90           C  
ATOM     71  CZ  TYR B  27      58.469  13.504  -9.794  1.00  0.90           C  
ATOM     72  OH  TYR B  27      58.833  14.735  -9.209  1.00  0.90           O  
ATOM     73  N   LYS B  28      54.418  10.027 -12.833  1.00  0.89           N  
ATOM     74  CA  LYS B  28      53.311  10.831 -13.329  1.00  0.89           C  
ATOM     75  C   LYS B  28      51.983  10.579 -12.621  1.00  0.89           C  
ATOM     76  O   LYS B  28      51.290  11.534 -12.268  1.00  0.89           O  
ATOM     77  CB  LYS B  28      53.141  10.643 -14.853  1.00  0.89           C  
ATOM     78  CG  LYS B  28      54.359  11.129 -15.658  1.00  0.89           C  
ATOM     79  CD  LYS B  28      54.320  10.696 -17.137  1.00  0.89           C  
ATOM     80  CE  LYS B  28      55.620  11.027 -17.886  1.00  0.89           C  
ATOM     81  NZ  LYS B  28      55.603  10.526 -19.282  1.00  0.89           N  
ATOM     82  N   ASP B  29      51.633   9.300 -12.363  1.00  0.88           N  
ATOM     83  CA  ASP B  29      50.482   8.896 -11.572  1.00  0.88           C  
ATOM     84  C   ASP B  29      50.595   9.392 -10.115  1.00  0.88           C  
ATOM     85  O   ASP B  29      49.646   9.922  -9.544  1.00  0.88           O  
ATOM     86  CB  ASP B  29      50.263   7.347 -11.664  1.00  0.88           C  
ATOM     87  CG  ASP B  29      49.896   6.835 -13.068  1.00  0.88           C  
ATOM     88  OD1 ASP B  29      49.434   7.634 -13.918  1.00  0.88           O  
ATOM     89  OD2 ASP B  29      50.041   5.605 -13.330  1.00  0.88           O  
ATOM     90  N   TYR B  30      51.794   9.310  -9.487  1.00  0.91           N  
ATOM     91  CA  TYR B  30      52.074   9.873  -8.169  1.00  0.91           C  
ATOM     92  C   TYR B  30      51.837  11.384  -8.097  1.00  0.91           C  
ATOM     93  O   TYR B  30      51.174  11.868  -7.180  1.00  0.91           O  
ATOM     94  CB  TYR B  30      53.537   9.492  -7.783  1.00  0.91           C  
ATOM     95  CG  TYR B  30      54.128  10.221  -6.602  1.00  0.91           C  
ATOM     96  CD1 TYR B  30      53.908   9.803  -5.281  1.00  0.91           C  
ATOM     97  CD2 TYR B  30      54.933  11.348  -6.830  1.00  0.91           C  
ATOM     98  CE1 TYR B  30      54.503  10.490  -4.212  1.00  0.91           C  
ATOM     99  CE2 TYR B  30      55.527  12.031  -5.764  1.00  0.91           C  
ATOM    100  CZ  TYR B  30      55.323  11.595  -4.452  1.00  0.91           C  
ATOM    101  OH  TYR B  30      55.906  12.283  -3.370  1.00  0.91           O  
ATOM    102  N   LEU B  31      52.325  12.158  -9.087  1.00  0.91           N  
ATOM    103  CA  LEU B  31      52.079  13.590  -9.189  1.00  0.91           C  
ATOM    104  C   LEU B  31      50.612  13.953  -9.375  1.00  0.91           C  
ATOM    105  O   LEU B  31      50.105  14.888  -8.762  1.00  0.91           O  
ATOM    106  CB  LEU B  31      52.847  14.197 -10.381  1.00  0.91           C  
ATOM    107  CG  LEU B  31      54.378  14.175 -10.257  1.00  0.91           C  
ATOM    108  CD1 LEU B  31      54.986  14.659 -11.579  1.00  0.91           C  
ATOM    109  CD2 LEU B  31      54.896  15.011  -9.079  1.00  0.91           C  
ATOM    110  N   ALA B  32      49.886  13.198 -10.224  1.00  0.90           N  
ATOM    111  CA  ALA B  32      48.462  13.355 -10.456  1.00  0.90           C  
ATOM    112  C   ALA B  32      47.617  13.100  -9.213  1.00  0.90           C  
ATOM    113  O   ALA B  32      46.572  13.715  -9.020  1.00  0.90           O  
ATOM    114  CB  ALA B  32      48.019  12.419 -11.592  1.00  0.90           C  
ATOM    115  N   SER B  33      48.095  12.222  -8.310  1.00  0.85           N  
ATOM    116  CA  SER B  33      47.434  11.931  -7.044  1.00  0.85           C  
ATOM    117  C   SER B  33      47.803  12.910  -5.944  1.00  0.85           C  
ATOM    118  O   SER B  33      47.341  12.783  -4.813  1.00  0.85           O  
ATOM    119  CB  SER B  33      47.828  10.534  -6.503  1.00  0.85           C  
ATOM    120  OG  SER B  33      47.311   9.498  -7.335  1.00  0.85           O  
ATOM    121  N   GLY B  34      48.632  13.933  -6.243  1.00  0.92           N  
ATOM    122  CA  GLY B  34      48.980  14.983  -5.289  1.00  0.92           C  
ATOM    123  C   GLY B  34      50.281  14.760  -4.582  1.00  0.92           C  
ATOM    124  O   GLY B  34      50.590  15.434  -3.604  1.00  0.92           O  
ATOM    125  N   GLY B  35      51.084  13.791  -5.057  1.00  0.94           N  
ATOM    126  CA  GLY B  35      52.425  13.524  -4.562  1.00  0.94           C  
ATOM    127  C   GLY B  35      53.372  14.688  -4.616  1.00  0.94           C  
ATOM    128  O   GLY B  35      53.402  15.458  -5.571  1.00  0.94           O  
ATOM    129  N   GLN B  36      54.224  14.819  -3.585  1.00  0.87           N  
ATOM    130  CA  GLN B  36      55.212  15.875  -3.521  1.00  0.87           C  
ATOM    131  C   GLN B  36      56.323  15.638  -4.548  1.00  0.87           C  
ATOM    132  O   GLN B  36      56.953  14.581  -4.450  1.00  0.87           O  
ATOM    133  CB  GLN B  36      55.849  15.936  -2.115  1.00  0.87           C  
ATOM    134  CG  GLN B  36      56.844  17.106  -1.941  1.00  0.87           C  
ATOM    135  CD  GLN B  36      57.419  17.139  -0.526  1.00  0.87           C  
ATOM    136  OE1 GLN B  36      57.186  16.269   0.308  1.00  0.87           O  
ATOM    137  NE2 GLN B  36      58.204  18.203  -0.229  1.00  0.87           N  
ATOM    138  N   PRO B  37      56.606  16.504  -5.528  1.00  0.95           N  
ATOM    139  CA  PRO B  37      57.727  16.364  -6.459  1.00  0.95           C  
ATOM    140  C   PRO B  37      59.072  16.006  -5.851  1.00  0.95           C  
ATOM    141  O   PRO B  37      59.342  16.374  -4.706  1.00  0.95           O  
ATOM    142  CB  PRO B  37      57.798  17.712  -7.190  1.00  0.95           C  
ATOM    143  CG  PRO B  37      56.390  18.294  -7.067  1.00  0.95           C  
ATOM    144  CD  PRO B  37      55.921  17.783  -5.709  1.00  0.95           C  
ATOM    145  N   ILE B  38      59.945  15.305  -6.602  1.00  0.91           N  
ATOM    146  CA  ILE B  38      61.319  15.033  -6.198  1.00  0.91           C  
ATOM    147  C   ILE B  38      62.089  16.322  -5.960  1.00  0.91           C  
ATOM    148  O   ILE B  38      62.128  17.234  -6.782  1.00  0.91           O  
ATOM    149  CB  ILE B  38      62.059  14.142  -7.202  1.00  0.91           C  
ATOM    150  CG1 ILE B  38      61.468  12.716  -7.196  1.00  0.91           C  
ATOM    151  CG2 ILE B  38      63.583  14.083  -6.934  1.00  0.91           C  
ATOM    152  CD1 ILE B  38      61.916  11.863  -8.389  1.00  0.91           C  
ATOM    153  N   THR B  39      62.741  16.414  -4.787  1.00  0.89           N  
ATOM    154  CA  THR B  39      63.383  17.621  -4.313  1.00  0.89           C  
ATOM    155  C   THR B  39      64.875  17.490  -4.438  1.00  0.89           C  
ATOM    156  O   THR B  39      65.420  16.464  -4.854  1.00  0.89           O  
ATOM    157  CB  THR B  39      63.040  17.974  -2.870  1.00  0.89           C  
ATOM    158  OG1 THR B  39      63.420  16.943  -1.968  1.00  0.89           O  
ATOM    159  CG2 THR B  39      61.526  18.155  -2.740  1.00  0.89           C  
ATOM    160  N   ASN B  40      65.589  18.586  -4.114  1.00  0.87           N  
ATOM    161  CA  ASN B  40      67.036  18.658  -4.090  1.00  0.87           C  
ATOM    162  C   ASN B  40      67.656  18.485  -5.460  1.00  0.87           C  
ATOM    163  O   ASN B  40      68.780  18.020  -5.609  1.00  0.87           O  
ATOM    164  CB  ASN B  40      67.689  17.702  -3.054  1.00  0.87           C  
ATOM    165  CG  ASN B  40      67.366  18.134  -1.628  1.00  0.87           C  
ATOM    166  OD1 ASN B  40      67.546  19.293  -1.247  1.00  0.87           O  
ATOM    167  ND2 ASN B  40      66.951  17.164  -0.777  1.00  0.87           N  
ATOM    168  N   CYS B  41      66.927  18.916  -6.503  1.00  0.91           N  
ATOM    169  CA  CYS B  41      67.498  19.213  -7.794  1.00  0.91           C  
ATOM    170  C   CYS B  41      68.412  20.421  -7.675  1.00  0.91           C  
ATOM    171  O   CYS B  41      68.097  21.414  -7.027  1.00  0.91           O  
ATOM    172  CB  CYS B  41      66.415  19.404  -8.878  1.00  0.91           C  
ATOM    173  SG  CYS B  41      65.278  17.981  -8.983  1.00  0.91           S  
ATOM    174  N   VAL B  42      69.610  20.321  -8.260  1.00  0.91           N  
ATOM    175  CA  VAL B  42      70.730  21.194  -7.991  1.00  0.91           C  
ATOM    176  C   VAL B  42      70.669  22.356  -8.937  1.00  0.91           C  
ATOM    177  O   VAL B  42      71.085  22.266 -10.090  1.00  0.91           O  
ATOM    178  CB  VAL B  42      72.095  20.518  -8.116  1.00  0.91           C  
ATOM    179  CG1 VAL B  42      73.219  21.536  -7.837  1.00  0.91           C  
ATOM    180  CG2 VAL B  42      72.197  19.361  -7.105  1.00  0.91           C  
ATOM    181  N   LYS B  43      70.123  23.485  -8.466  1.00  0.86           N  
ATOM    182  CA  LYS B  43      70.041  24.680  -9.262  1.00  0.86           C  
ATOM    183  C   LYS B  43      71.349  25.443  -9.301  1.00  0.86           C  
ATOM    184  O   LYS B  43      72.004  25.649  -8.280  1.00  0.86           O  
ATOM    185  CB  LYS B  43      68.915  25.594  -8.764  1.00  0.86           C  
ATOM    186  CG  LYS B  43      68.624  26.695  -9.779  1.00  0.86           C  
ATOM    187  CD  LYS B  43      67.295  27.390  -9.542  1.00  0.86           C  
ATOM    188  CE  LYS B  43      67.327  28.323  -8.348  1.00  0.86           C  
ATOM    189  NZ  LYS B  43      66.161  29.202  -8.410  1.00  0.86           N  
ATOM    190  N   MET B  44      71.762  25.873 -10.505  1.00  0.84           N  
ATOM    191  CA  MET B  44      73.034  26.517 -10.709  1.00  0.84           C  
ATOM    192  C   MET B  44      72.898  28.021 -10.723  1.00  0.84           C  
ATOM    193  O   MET B  44      71.872  28.584 -11.095  1.00  0.84           O  
ATOM    194  CB  MET B  44      73.691  26.086 -12.043  1.00  0.84           C  
ATOM    195  CG  MET B  44      73.692  24.565 -12.288  1.00  0.84           C  
ATOM    196  SD  MET B  44      74.300  23.538 -10.917  1.00  0.84           S  
ATOM    197  CE  MET B  44      75.962  24.240 -10.787  1.00  0.84           C  
ATOM    198  N   LEU B  45      73.974  28.724 -10.336  1.00  0.84           N  
ATOM    199  CA  LEU B  45      74.070  30.154 -10.531  1.00  0.84           C  
ATOM    200  C   LEU B  45      74.536  30.426 -11.943  1.00  0.84           C  
ATOM    201  O   LEU B  45      75.457  29.786 -12.445  1.00  0.84           O  
ATOM    202  CB  LEU B  45      75.067  30.773  -9.534  1.00  0.84           C  
ATOM    203  CG  LEU B  45      74.551  30.782  -8.088  1.00  0.84           C  
ATOM    204  CD1 LEU B  45      75.715  30.931  -7.106  1.00  0.84           C  
ATOM    205  CD2 LEU B  45      73.538  31.913  -7.882  1.00  0.84           C  
ATOM    206  N   CYS B  46      73.906  31.377 -12.640  1.00  0.85           N  
ATOM    207  CA  CYS B  46      74.250  31.665 -14.011  1.00  0.85           C  
ATOM    208  C   CYS B  46      73.795  33.071 -14.303  1.00  0.85           C  
ATOM    209  O   CYS B  46      73.190  33.723 -13.459  1.00  0.85           O  
ATOM    210  CB  CYS B  46      73.680  30.631 -15.032  1.00  0.85           C  
ATOM    211  SG  CYS B  46      71.872  30.394 -14.954  1.00  0.85           S  
ATOM    212  N   THR B  47      74.135  33.602 -15.491  1.00  0.84           N  
ATOM    213  CA  THR B  47      73.802  34.958 -15.891  1.00  0.84           C  
ATOM    214  C   THR B  47      72.369  35.142 -16.348  1.00  0.84           C  
ATOM    215  O   THR B  47      71.862  36.257 -16.361  1.00  0.84           O  
ATOM    216  CB  THR B  47      74.672  35.397 -17.060  1.00  0.84           C  
ATOM    217  OG1 THR B  47      74.649  34.432 -18.104  1.00  0.84           O  
ATOM    218  CG2 THR B  47      76.131  35.534 -16.592  1.00  0.84           C  
ATOM    219  N   HIS B  48      71.697  34.044 -16.755  1.00  0.82           N  
ATOM    220  CA  HIS B  48      70.362  34.051 -17.335  1.00  0.82           C  
ATOM    221  C   HIS B  48      70.284  34.798 -18.665  1.00  0.82           C  
ATOM    222  O   HIS B  48      69.269  35.370 -19.055  1.00  0.82           O  
ATOM    223  CB  HIS B  48      69.282  34.460 -16.322  1.00  0.82           C  
ATOM    224  CG  HIS B  48      69.192  33.468 -15.205  1.00  0.82           C  
ATOM    225  ND1 HIS B  48      68.251  32.479 -15.330  1.00  0.82           N  
ATOM    226  CD2 HIS B  48      69.868  33.325 -14.036  1.00  0.82           C  
ATOM    227  CE1 HIS B  48      68.344  31.756 -14.237  1.00  0.82           C  
ATOM    228  NE2 HIS B  48      69.318  32.220 -13.417  1.00  0.82           N  
ATOM    229  N   THR B  49      71.401  34.753 -19.419  1.00  0.89           N  
ATOM    230  CA  THR B  49      71.578  35.395 -20.715  1.00  0.89           C  
ATOM    231  C   THR B  49      72.011  34.383 -21.752  1.00  0.89           C  
ATOM    232  O   THR B  49      72.548  34.736 -22.797  1.00  0.89           O  
ATOM    233  CB  THR B  49      72.563  36.572 -20.705  1.00  0.89           C  
ATOM    234  OG1 THR B  49      73.860  36.252 -20.216  1.00  0.89           O  
ATOM    235  CG2 THR B  49      72.028  37.666 -19.774  1.00  0.89           C  
ATOM    236  N   GLY B  50      71.782  33.083 -21.469  1.00  0.95           N  
ATOM    237  CA  GLY B  50      72.174  31.971 -22.325  1.00  0.95           C  
ATOM    238  C   GLY B  50      71.284  31.723 -23.510  1.00  0.95           C  
ATOM    239  O   GLY B  50      70.315  32.435 -23.776  1.00  0.95           O  
ATOM    240  N   THR B  51      71.593  30.644 -24.253  1.00  0.95           N  
ATOM    241  CA  THR B  51      70.899  30.251 -25.482  1.00  0.95           C  
ATOM    242  C   THR B  51      69.449  29.864 -25.311  1.00  0.95           C  
ATOM    243  O   THR B  51      68.633  30.009 -26.218  1.00  0.95           O  
ATOM    244  CB  THR B  51      71.562  29.124 -26.274  1.00  0.95           C  
ATOM    245  OG1 THR B  51      71.603  27.885 -25.579  1.00  0.95           O  
ATOM    246  CG2 THR B  51      73.005  29.517 -26.589  1.00  0.95           C  
ATOM    247  N   GLY B  52      69.103  29.325 -24.131  1.00  0.98           N  
ATOM    248  CA  GLY B  52      67.801  28.774 -23.818  1.00  0.98           C  
ATOM    249  C   GLY B  52      67.590  27.353 -24.266  1.00  0.98           C  
ATOM    250  O   GLY B  52      66.502  26.806 -24.102  1.00  0.98           O  
ATOM    251  N   GLN B  53      68.623  26.707 -24.847  1.00  0.93           N  
ATOM    252  CA  GLN B  53      68.570  25.313 -25.259  1.00  0.93           C  
ATOM    253  C   GLN B  53      68.339  24.348 -24.114  1.00  0.93           C  
ATOM    254  O   GLN B  53      68.710  24.596 -22.972  1.00  0.93           O  
ATOM    255  CB  GLN B  53      69.793  24.879 -26.094  1.00  0.93           C  
ATOM    256  CG  GLN B  53      69.852  25.582 -27.467  1.00  0.93           C  
ATOM    257  CD  GLN B  53      70.962  24.998 -28.339  1.00  0.93           C  
ATOM    258  OE1 GLN B  53      72.107  24.848 -27.914  1.00  0.93           O  
ATOM    259  NE2 GLN B  53      70.637  24.656 -29.608  1.00  0.93           N  
ATOM    260  N   ALA B  54      67.657  23.222 -24.383  1.00  0.99           N  
ATOM    261  CA  ALA B  54      67.171  22.360 -23.334  1.00  0.99           C  
ATOM    262  C   ALA B  54      68.219  21.658 -22.484  1.00  0.99           C  
ATOM    263  O   ALA B  54      68.158  21.709 -21.259  1.00  0.99           O  
ATOM    264  CB  ALA B  54      66.289  21.291 -23.986  1.00  0.99           C  
ATOM    265  N   ILE B  55      69.208  21.004 -23.120  1.00  0.94           N  
ATOM    266  CA  ILE B  55      70.232  20.236 -22.431  1.00  0.94           C  
ATOM    267  C   ILE B  55      71.567  20.628 -23.019  1.00  0.94           C  
ATOM    268  O   ILE B  55      71.804  20.498 -24.220  1.00  0.94           O  
ATOM    269  CB  ILE B  55      70.052  18.724 -22.556  1.00  0.94           C  
ATOM    270  CG1 ILE B  55      68.652  18.271 -22.076  1.00  0.94           C  
ATOM    271  CG2 ILE B  55      71.160  18.026 -21.739  1.00  0.94           C  
ATOM    272  CD1 ILE B  55      68.348  16.794 -22.356  1.00  0.94           C  
ATOM    273  N   THR B  56      72.478  21.150 -22.184  1.00  0.92           N  
ATOM    274  CA  THR B  56      73.669  21.841 -22.651  1.00  0.92           C  
ATOM    275  C   THR B  56      74.877  21.443 -21.830  1.00  0.92           C  
ATOM    276  O   THR B  56      74.770  20.861 -20.756  1.00  0.92           O  
ATOM    277  CB  THR B  56      73.496  23.355 -22.612  1.00  0.92           C  
ATOM    278  OG1 THR B  56      72.991  23.781 -21.358  1.00  0.92           O  
ATOM    279  CG2 THR B  56      72.471  23.775 -23.680  1.00  0.92           C  
ATOM    280  N   VAL B  57      76.107  21.703 -22.331  1.00  0.89           N  
ATOM    281  CA  VAL B  57      77.340  21.333 -21.641  1.00  0.89           C  
ATOM    282  C   VAL B  57      77.707  22.253 -20.483  1.00  0.89           C  
ATOM    283  O   VAL B  57      78.547  21.915 -19.660  1.00  0.89           O  
ATOM    284  CB  VAL B  57      78.537  21.268 -22.589  1.00  0.89           C  
ATOM    285  CG1 VAL B  57      78.311  20.185 -23.661  1.00  0.89           C  
ATOM    286  CG2 VAL B  57      78.818  22.640 -23.235  1.00  0.89           C  
ATOM    287  N   THR B  58      77.076  23.436 -20.393  1.00  0.86           N  
ATOM    288  CA  THR B  58      77.303  24.429 -19.357  1.00  0.86           C  
ATOM    289  C   THR B  58      75.944  25.091 -19.174  1.00  0.86           C  
ATOM    290  O   THR B  58      75.158  24.997 -20.118  1.00  0.86           O  
ATOM    291  CB  THR B  58      78.399  25.433 -19.731  1.00  0.86           C  
ATOM    292  OG1 THR B  58      78.787  26.251 -18.640  1.00  0.86           O  
ATOM    293  CG2 THR B  58      77.994  26.361 -20.881  1.00  0.86           C  
ATOM    294  N   PRO B  59      75.545  25.705 -18.058  1.00  0.92           N  
ATOM    295  CA  PRO B  59      74.270  26.406 -17.909  1.00  0.92           C  
ATOM    296  C   PRO B  59      73.944  27.460 -18.952  1.00  0.92           C  
ATOM    297  O   PRO B  59      74.699  28.418 -19.082  1.00  0.92           O  
ATOM    298  CB  PRO B  59      74.413  27.077 -16.533  1.00  0.92           C  
ATOM    299  CG  PRO B  59      75.269  26.101 -15.740  1.00  0.92           C  
ATOM    300  CD  PRO B  59      76.279  25.659 -16.796  1.00  0.92           C  
ATOM    301  N   GLU B  60      72.789  27.335 -19.634  1.00  0.89           N  
ATOM    302  CA  GLU B  60      72.403  28.177 -20.752  1.00  0.89           C  
ATOM    303  C   GLU B  60      71.004  28.738 -20.563  1.00  0.89           C  
ATOM    304  O   GLU B  60      70.288  29.009 -21.524  1.00  0.89           O  
ATOM    305  CB  GLU B  60      72.455  27.374 -22.075  1.00  0.89           C  
ATOM    306  CG  GLU B  60      73.893  27.118 -22.585  1.00  0.89           C  
ATOM    307  CD  GLU B  60      74.567  28.381 -23.118  1.00  0.89           C  
ATOM    308  OE1 GLU B  60      73.881  29.432 -23.237  1.00  0.89           O  
ATOM    309  OE2 GLU B  60      75.774  28.280 -23.451  1.00  0.89           O  
ATOM    310  N   ALA B  61      70.548  28.924 -19.303  1.00  0.96           N  
ATOM    311  CA  ALA B  61      69.267  29.545 -19.024  1.00  0.96           C  
ATOM    312  C   ALA B  61      69.144  30.942 -19.591  1.00  0.96           C  
ATOM    313  O   ALA B  61      70.089  31.731 -19.577  1.00  0.96           O  
ATOM    314  CB  ALA B  61      68.950  29.599 -17.516  1.00  0.96           C  
ATOM    315  N   ASN B  62      67.952  31.258 -20.122  1.00  0.90           N  
ATOM    316  CA  ASN B  62      67.591  32.596 -20.520  1.00  0.90           C  
ATOM    317  C   ASN B  62      66.842  33.231 -19.357  1.00  0.90           C  
ATOM    318  O   ASN B  62      66.817  32.679 -18.265  1.00  0.90           O  
ATOM    319  CB  ASN B  62      66.856  32.585 -21.891  1.00  0.90           C  
ATOM    320  CG  ASN B  62      65.525  31.841 -21.872  1.00  0.90           C  
ATOM    321  OD1 ASN B  62      64.883  31.674 -20.841  1.00  0.90           O  
ATOM    322  ND2 ASN B  62      65.051  31.413 -23.066  1.00  0.90           N  
ATOM    323  N   MET B  63      66.204  34.401 -19.538  1.00  0.86           N  
ATOM    324  CA  MET B  63      65.515  35.071 -18.446  1.00  0.86           C  
ATOM    325  C   MET B  63      64.308  34.303 -17.883  1.00  0.86           C  
ATOM    326  O   MET B  63      63.920  34.486 -16.732  1.00  0.86           O  
ATOM    327  CB  MET B  63      65.104  36.486 -18.918  1.00  0.86           C  
ATOM    328  CG  MET B  63      64.590  37.413 -17.799  1.00  0.86           C  
ATOM    329  SD  MET B  63      64.173  39.101 -18.341  1.00  0.86           S  
ATOM    330  CE  MET B  63      62.678  38.649 -19.269  1.00  0.86           C  
ATOM    331  N   ASP B  64      63.729  33.384 -18.683  1.00  0.89           N  
ATOM    332  CA  ASP B  64      62.518  32.663 -18.365  1.00  0.89           C  
ATOM    333  C   ASP B  64      62.819  31.213 -17.978  1.00  0.89           C  
ATOM    334  O   ASP B  64      61.931  30.356 -17.941  1.00  0.89           O  
ATOM    335  CB  ASP B  64      61.548  32.696 -19.574  1.00  0.89           C  
ATOM    336  CG  ASP B  64      61.171  34.124 -19.944  1.00  0.89           C  
ATOM    337  OD1 ASP B  64      60.851  34.920 -19.025  1.00  0.89           O  
ATOM    338  OD2 ASP B  64      61.182  34.421 -21.169  1.00  0.89           O  
ATOM    339  N   GLN B  65      64.086  30.876 -17.644  1.00  0.89           N  
ATOM    340  CA  GLN B  65      64.458  29.520 -17.290  1.00  0.89           C  
ATOM    341  C   GLN B  65      65.348  29.484 -16.070  1.00  0.89           C  
ATOM    342  O   GLN B  65      65.923  30.475 -15.653  1.00  0.89           O  
ATOM    343  CB  GLN B  65      65.230  28.823 -18.435  1.00  0.89           C  
ATOM    344  CG  GLN B  65      64.394  28.610 -19.714  1.00  0.89           C  
ATOM    345  CD  GLN B  65      65.320  28.237 -20.863  1.00  0.89           C  
ATOM    346  OE1 GLN B  65      66.497  28.593 -20.856  1.00  0.89           O  
ATOM    347  NE2 GLN B  65      64.805  27.505 -21.877  1.00  0.89           N  
ATOM    348  N   GLU B  66      65.479  28.295 -15.467  1.00  0.89           N  
ATOM    349  CA  GLU B  66      66.459  28.021 -14.441  1.00  0.89           C  
ATOM    350  C   GLU B  66      67.315  26.876 -14.932  1.00  0.89           C  
ATOM    351  O   GLU B  66      66.823  25.952 -15.581  1.00  0.89           O  
ATOM    352  CB  GLU B  66      65.791  27.587 -13.122  1.00  0.89           C  
ATOM    353  CG  GLU B  66      64.974  28.693 -12.421  1.00  0.89           C  
ATOM    354  CD  GLU B  66      65.784  29.702 -11.612  1.00  0.89           C  
ATOM    355  OE1 GLU B  66      65.175  30.178 -10.611  1.00  0.89           O  
ATOM    356  OE2 GLU B  66      66.992  29.926 -11.859  1.00  0.89           O  
ATOM    357  N   SER B  67      68.630  26.913 -14.643  1.00  0.93           N  
ATOM    358  CA  SER B  67      69.561  25.876 -15.063  1.00  0.93           C  
ATOM    359  C   SER B  67      69.867  24.971 -13.901  1.00  0.93           C  
ATOM    360  O   SER B  67      70.209  25.427 -12.813  1.00  0.93           O  
ATOM    361  CB  SER B  67      70.961  26.383 -15.494  1.00  0.93           C  
ATOM    362  OG  SER B  67      70.948  27.258 -16.620  1.00  0.93           O  
ATOM    363  N   PHE B  68      69.794  23.650 -14.108  1.00  0.89           N  
ATOM    364  CA  PHE B  68      70.055  22.679 -13.071  1.00  0.89           C  
ATOM    365  C   PHE B  68      71.107  21.700 -13.547  1.00  0.89           C  
ATOM    366  O   PHE B  68      71.222  21.440 -14.743  1.00  0.89           O  
ATOM    367  CB  PHE B  68      68.803  21.840 -12.740  1.00  0.89           C  
ATOM    368  CG  PHE B  68      67.691  22.635 -12.119  1.00  0.89           C  
ATOM    369  CD1 PHE B  68      66.788  23.365 -12.909  1.00  0.89           C  
ATOM    370  CD2 PHE B  68      67.488  22.591 -10.733  1.00  0.89           C  
ATOM    371  CE1 PHE B  68      65.716  24.047 -12.320  1.00  0.89           C  
ATOM    372  CE2 PHE B  68      66.426  23.281 -10.139  1.00  0.89           C  
ATOM    373  CZ  PHE B  68      65.540  24.015 -10.934  1.00  0.89           C  
ATOM    374  N   GLY B  69      71.898  21.120 -12.614  1.00  0.93           N  
ATOM    375  CA  GLY B  69      72.717  19.927 -12.868  1.00  0.93           C  
ATOM    376  C   GLY B  69      71.874  18.772 -13.328  1.00  0.93           C  
ATOM    377  O   GLY B  69      70.850  18.459 -12.725  1.00  0.93           O  
ATOM    378  N   GLY B  70      72.262  18.106 -14.424  1.00  0.96           N  
ATOM    379  CA  GLY B  70      71.357  17.221 -15.132  1.00  0.96           C  
ATOM    380  C   GLY B  70      71.086  15.910 -14.450  1.00  0.96           C  
ATOM    381  O   GLY B  70      69.968  15.400 -14.476  1.00  0.96           O  
ATOM    382  N   ALA B  71      72.085  15.322 -13.768  1.00  0.93           N  
ATOM    383  CA  ALA B  71      71.925  14.084 -13.035  1.00  0.93           C  
ATOM    384  C   ALA B  71      70.906  14.184 -11.913  1.00  0.93           C  
ATOM    385  O   ALA B  71      70.180  13.231 -11.627  1.00  0.93           O  
ATOM    386  CB  ALA B  71      73.274  13.646 -12.450  1.00  0.93           C  
ATOM    387  N   SER B  72      70.818  15.370 -11.267  1.00  0.92           N  
ATOM    388  CA  SER B  72      69.905  15.613 -10.171  1.00  0.92           C  
ATOM    389  C   SER B  72      68.442  15.717 -10.587  1.00  0.92           C  
ATOM    390  O   SER B  72      67.543  15.487  -9.775  1.00  0.92           O  
ATOM    391  CB  SER B  72      70.307  16.801  -9.254  1.00  0.92           C  
ATOM    392  OG  SER B  72      70.125  18.078  -9.838  1.00  0.92           O  
ATOM    393  N   CYS B  73      68.193  15.971 -11.893  1.00  0.95           N  
ATOM    394  CA  CYS B  73      66.887  16.126 -12.517  1.00  0.95           C  
ATOM    395  C   CYS B  73      66.498  14.936 -13.375  1.00  0.95           C  
ATOM    396  O   CYS B  73      65.500  14.966 -14.092  1.00  0.95           O  
ATOM    397  CB  CYS B  73      66.875  17.357 -13.449  1.00  0.95           C  
ATOM    398  SG  CYS B  73      67.268  18.874 -12.547  1.00  0.95           S  
ATOM    399  N   CYS B  74      67.264  13.835 -13.329  1.00  0.94           N  
ATOM    400  CA  CYS B  74      66.905  12.619 -14.029  1.00  0.94           C  
ATOM    401  C   CYS B  74      66.247  11.657 -13.064  1.00  0.94           C  
ATOM    402  O   CYS B  74      66.834  11.277 -12.055  1.00  0.94           O  
ATOM    403  CB  CYS B  74      68.155  11.968 -14.680  1.00  0.94           C  
ATOM    404  SG  CYS B  74      67.833  10.401 -15.565  1.00  0.94           S  
ATOM    405  N   LEU B  75      65.016  11.194 -13.379  1.00  0.94           N  
ATOM    406  CA  LEU B  75      64.284  10.218 -12.582  1.00  0.94           C  
ATOM    407  C   LEU B  75      65.053   8.926 -12.376  1.00  0.94           C  
ATOM    408  O   LEU B  75      65.167   8.414 -11.270  1.00  0.94           O  
ATOM    409  CB  LEU B  75      62.952   9.864 -13.297  1.00  0.94           C  
ATOM    410  CG  LEU B  75      62.044   8.859 -12.553  1.00  0.94           C  
ATOM    411  CD1 LEU B  75      61.437   9.477 -11.288  1.00  0.94           C  
ATOM    412  CD2 LEU B  75      60.946   8.275 -13.451  1.00  0.94           C  
ATOM    413  N   TYR B  76      65.642   8.390 -13.457  1.00  0.87           N  
ATOM    414  CA  TYR B  76      66.374   7.138 -13.444  1.00  0.87           C  
ATOM    415  C   TYR B  76      67.633   7.197 -12.593  1.00  0.87           C  
ATOM    416  O   TYR B  76      67.902   6.310 -11.791  1.00  0.87           O  
ATOM    417  CB  TYR B  76      66.696   6.698 -14.892  1.00  0.87           C  
ATOM    418  CG  TYR B  76      65.439   6.704 -15.713  1.00  0.87           C  
ATOM    419  CD1 TYR B  76      64.498   5.678 -15.556  1.00  0.87           C  
ATOM    420  CD2 TYR B  76      65.156   7.758 -16.598  1.00  0.87           C  
ATOM    421  CE1 TYR B  76      63.275   5.724 -16.238  1.00  0.87           C  
ATOM    422  CE2 TYR B  76      63.932   7.809 -17.277  1.00  0.87           C  
ATOM    423  CZ  TYR B  76      62.991   6.795 -17.088  1.00  0.87           C  
ATOM    424  OH  TYR B  76      61.782   6.823 -17.798  1.00  0.87           O  
ATOM    425  N   CYS B  77      68.399   8.304 -12.700  1.00  0.90           N  
ATOM    426  CA  CYS B  77      69.541   8.559 -11.839  1.00  0.90           C  
ATOM    427  C   CYS B  77      69.143   8.752 -10.382  1.00  0.90           C  
ATOM    428  O   CYS B  77      69.741   8.170  -9.491  1.00  0.90           O  
ATOM    429  CB  CYS B  77      70.322   9.830 -12.272  1.00  0.90           C  
ATOM    430  SG  CYS B  77      71.187   9.732 -13.871  1.00  0.90           S  
ATOM    431  N   ARG B  78      68.105   9.564 -10.097  1.00  0.81           N  
ATOM    432  CA  ARG B  78      67.634   9.813  -8.743  1.00  0.81           C  
ATOM    433  C   ARG B  78      67.014   8.641  -8.021  1.00  0.81           C  
ATOM    434  O   ARG B  78      67.179   8.502  -6.812  1.00  0.81           O  
ATOM    435  CB  ARG B  78      66.634  10.984  -8.715  1.00  0.81           C  
ATOM    436  CG  ARG B  78      67.288  12.339  -9.030  1.00  0.81           C  
ATOM    437  CD  ARG B  78      68.391  12.783  -8.064  1.00  0.81           C  
ATOM    438  NE  ARG B  78      67.816  12.901  -6.693  1.00  0.81           N  
ATOM    439  CZ  ARG B  78      67.186  13.991  -6.238  1.00  0.81           C  
ATOM    440  NH1 ARG B  78      66.975  15.081  -6.969  1.00  0.81           N  
ATOM    441  NH2 ARG B  78      66.704  14.004  -4.998  1.00  0.81           N  
ATOM    442  N   CYS B  79      66.273   7.785  -8.737  1.00  0.89           N  
ATOM    443  CA  CYS B  79      65.617   6.644  -8.137  1.00  0.89           C  
ATOM    444  C   CYS B  79      66.472   5.392  -8.222  1.00  0.89           C  
ATOM    445  O   CYS B  79      66.072   4.343  -7.727  1.00  0.89           O  
ATOM    446  CB  CYS B  79      64.275   6.367  -8.857  1.00  0.89           C  
ATOM    447  SG  CYS B  79      63.044   7.686  -8.606  1.00  0.89           S  
ATOM    448  N   HIS B  80      67.679   5.482  -8.827  1.00  0.78           N  
ATOM    449  CA  HIS B  80      68.621   4.381  -8.960  1.00  0.78           C  
ATOM    450  C   HIS B  80      68.073   3.219  -9.775  1.00  0.78           C  
ATOM    451  O   HIS B  80      68.103   2.061  -9.370  1.00  0.78           O  
ATOM    452  CB  HIS B  80      69.195   3.961  -7.596  1.00  0.78           C  
ATOM    453  CG  HIS B  80      69.813   5.126  -6.895  1.00  0.78           C  
ATOM    454  ND1 HIS B  80      71.151   5.367  -7.105  1.00  0.78           N  
ATOM    455  CD2 HIS B  80      69.296   6.041  -6.034  1.00  0.78           C  
ATOM    456  CE1 HIS B  80      71.436   6.411  -6.357  1.00  0.78           C  
ATOM    457  NE2 HIS B  80      70.345   6.867  -5.690  1.00  0.78           N  
ATOM    458  N   ILE B  81      67.538   3.551 -10.966  1.00  0.82           N  
ATOM    459  CA  ILE B  81      66.835   2.653 -11.869  1.00  0.82           C  
ATOM    460  C   ILE B  81      67.580   2.711 -13.190  1.00  0.82           C  
ATOM    461  O   ILE B  81      68.146   3.746 -13.534  1.00  0.82           O  
ATOM    462  CB  ILE B  81      65.368   3.087 -12.066  1.00  0.82           C  
ATOM    463  CG1 ILE B  81      64.589   2.996 -10.733  1.00  0.82           C  
ATOM    464  CG2 ILE B  81      64.649   2.258 -13.156  1.00  0.82           C  
ATOM    465  CD1 ILE B  81      63.161   3.556 -10.795  1.00  0.82           C  
ATOM    466  N   ASP B  82      67.602   1.608 -13.972  1.00  0.84           N  
ATOM    467  CA  ASP B  82      68.149   1.581 -15.316  1.00  0.84           C  
ATOM    468  C   ASP B  82      67.521   2.616 -16.241  1.00  0.84           C  
ATOM    469  O   ASP B  82      66.318   2.882 -16.218  1.00  0.84           O  
ATOM    470  CB  ASP B  82      67.948   0.198 -15.985  1.00  0.84           C  
ATOM    471  CG  ASP B  82      68.653  -0.919 -15.236  1.00  0.84           C  
ATOM    472  OD1 ASP B  82      69.626  -0.631 -14.498  1.00  0.84           O  
ATOM    473  OD2 ASP B  82      68.203  -2.081 -15.399  1.00  0.84           O  
ATOM    474  N   HIS B  83      68.335   3.260 -17.094  1.00  0.83           N  
ATOM    475  CA  HIS B  83      67.822   4.186 -18.083  1.00  0.83           C  
ATOM    476  C   HIS B  83      67.078   3.457 -19.203  1.00  0.83           C  
ATOM    477  O   HIS B  83      67.517   2.376 -19.593  1.00  0.83           O  
ATOM    478  CB  HIS B  83      68.941   5.079 -18.655  1.00  0.83           C  
ATOM    479  CG  HIS B  83      69.498   6.010 -17.627  1.00  0.83           C  
ATOM    480  ND1 HIS B  83      70.385   5.531 -16.685  1.00  0.83           N  
ATOM    481  CD2 HIS B  83      69.185   7.302 -17.356  1.00  0.83           C  
ATOM    482  CE1 HIS B  83      70.593   6.526 -15.860  1.00  0.83           C  
ATOM    483  NE2 HIS B  83      69.891   7.627 -16.217  1.00  0.83           N  
ATOM    484  N   PRO B  84      65.982   3.959 -19.779  1.00  0.86           N  
ATOM    485  CA  PRO B  84      65.099   3.148 -20.615  1.00  0.86           C  
ATOM    486  C   PRO B  84      65.603   3.115 -22.045  1.00  0.86           C  
ATOM    487  O   PRO B  84      64.925   3.579 -22.960  1.00  0.86           O  
ATOM    488  CB  PRO B  84      63.738   3.873 -20.520  1.00  0.86           C  
ATOM    489  CG  PRO B  84      64.117   5.324 -20.246  1.00  0.86           C  
ATOM    490  CD  PRO B  84      65.305   5.158 -19.309  1.00  0.86           C  
ATOM    491  N   ASN B  85      66.794   2.545 -22.275  1.00  0.75           N  
ATOM    492  CA  ASN B  85      67.340   2.368 -23.593  1.00  0.75           C  
ATOM    493  C   ASN B  85      68.363   1.230 -23.528  1.00  0.75           C  
ATOM    494  O   ASN B  85      68.835   0.939 -22.431  1.00  0.75           O  
ATOM    495  CB  ASN B  85      67.883   3.713 -24.198  1.00  0.75           C  
ATOM    496  CG  ASN B  85      69.033   4.360 -23.417  1.00  0.75           C  
ATOM    497  OD1 ASN B  85      70.140   3.827 -23.391  1.00  0.75           O  
ATOM    498  ND2 ASN B  85      68.812   5.575 -22.856  1.00  0.75           N  
ATOM    499  N   PRO B  86      68.736   0.544 -24.616  1.00  0.85           N  
ATOM    500  CA  PRO B  86      69.635  -0.614 -24.586  1.00  0.85           C  
ATOM    501  C   PRO B  86      71.000  -0.383 -23.977  1.00  0.85           C  
ATOM    502  O   PRO B  86      71.531  -1.277 -23.330  1.00  0.85           O  
ATOM    503  CB  PRO B  86      69.793  -0.987 -26.067  1.00  0.85           C  
ATOM    504  CG  PRO B  86      68.459  -0.592 -26.697  1.00  0.85           C  
ATOM    505  CD  PRO B  86      68.026   0.634 -25.892  1.00  0.85           C  
ATOM    506  N   LYS B  87      71.606   0.792 -24.224  1.00  0.86           N  
ATOM    507  CA  LYS B  87      72.932   1.128 -23.743  1.00  0.86           C  
ATOM    508  C   LYS B  87      72.945   1.570 -22.286  1.00  0.86           C  
ATOM    509  O   LYS B  87      73.997   1.625 -21.658  1.00  0.86           O  
ATOM    510  CB  LYS B  87      73.517   2.290 -24.589  1.00  0.86           C  
ATOM    511  CG  LYS B  87      73.713   1.955 -26.078  1.00  0.86           C  
ATOM    512  CD  LYS B  87      74.286   3.145 -26.871  1.00  0.86           C  
ATOM    513  CE  LYS B  87      74.508   2.838 -28.357  1.00  0.86           C  
ATOM    514  NZ  LYS B  87      75.043   4.026 -29.064  1.00  0.86           N  
ATOM    515  N   GLY B  88      71.769   1.930 -21.730  1.00  0.88           N  
ATOM    516  CA  GLY B  88      71.622   2.534 -20.409  1.00  0.88           C  
ATOM    517  C   GLY B  88      72.220   3.913 -20.303  1.00  0.88           C  
ATOM    518  O   GLY B  88      72.630   4.361 -19.240  1.00  0.88           O  
ATOM    519  N   PHE B  89      72.288   4.633 -21.436  1.00  0.75           N  
ATOM    520  CA  PHE B  89      72.857   5.964 -21.512  1.00  0.75           C  
ATOM    521  C   PHE B  89      71.885   7.001 -20.939  1.00  0.75           C  
ATOM    522  O   PHE B  89      70.669   6.883 -21.087  1.00  0.75           O  
ATOM    523  CB  PHE B  89      73.284   6.258 -22.984  1.00  0.75           C  
ATOM    524  CG  PHE B  89      73.704   7.684 -23.251  1.00  0.75           C  
ATOM    525  CD1 PHE B  89      74.969   8.166 -22.875  1.00  0.75           C  
ATOM    526  CD2 PHE B  89      72.799   8.570 -23.860  1.00  0.75           C  
ATOM    527  CE1 PHE B  89      75.320   9.503 -23.107  1.00  0.75           C  
ATOM    528  CE2 PHE B  89      73.148   9.905 -24.092  1.00  0.75           C  
ATOM    529  CZ  PHE B  89      74.411  10.372 -23.719  1.00  0.75           C  
ATOM    530  N   CYS B  90      72.417   8.056 -20.285  1.00  0.86           N  
ATOM    531  CA  CYS B  90      71.632   9.160 -19.759  1.00  0.86           C  
ATOM    532  C   CYS B  90      71.993  10.410 -20.532  1.00  0.86           C  
ATOM    533  O   CYS B  90      73.169  10.728 -20.696  1.00  0.86           O  
ATOM    534  CB  CYS B  90      71.954   9.418 -18.258  1.00  0.86           C  
ATOM    535  SG  CYS B  90      70.854  10.628 -17.435  1.00  0.86           S  
ATOM    536  N   ASP B  91      70.992  11.167 -21.002  1.00  0.86           N  
ATOM    537  CA  ASP B  91      71.165  12.383 -21.759  1.00  0.86           C  
ATOM    538  C   ASP B  91      71.323  13.614 -20.867  1.00  0.86           C  
ATOM    539  O   ASP B  91      71.775  14.669 -21.312  1.00  0.86           O  
ATOM    540  CB  ASP B  91      69.980  12.518 -22.761  1.00  0.86           C  
ATOM    541  CG  ASP B  91      68.598  12.275 -22.154  1.00  0.86           C  
ATOM    542  OD1 ASP B  91      68.486  12.159 -20.903  1.00  0.86           O  
ATOM    543  OD2 ASP B  91      67.647  12.146 -22.962  1.00  0.86           O  
ATOM    544  N   LEU B  92      71.016  13.484 -19.560  1.00  0.90           N  
ATOM    545  CA  LEU B  92      71.089  14.573 -18.608  1.00  0.90           C  
ATOM    546  C   LEU B  92      72.361  14.587 -17.776  1.00  0.90           C  
ATOM    547  O   LEU B  92      72.932  15.639 -17.517  1.00  0.90           O  
ATOM    548  CB  LEU B  92      69.872  14.497 -17.658  1.00  0.90           C  
ATOM    549  CG  LEU B  92      68.524  14.830 -18.321  1.00  0.90           C  
ATOM    550  CD1 LEU B  92      67.354  14.418 -17.416  1.00  0.90           C  
ATOM    551  CD2 LEU B  92      68.436  16.329 -18.634  1.00  0.90           C  
ATOM    552  N   LYS B  93      72.853  13.418 -17.325  1.00  0.86           N  
ATOM    553  CA  LYS B  93      74.020  13.314 -16.458  1.00  0.86           C  
ATOM    554  C   LYS B  93      75.279  13.933 -17.048  1.00  0.86           C  
ATOM    555  O   LYS B  93      75.690  13.612 -18.163  1.00  0.86           O  
ATOM    556  CB  LYS B  93      74.289  11.819 -16.146  1.00  0.86           C  
ATOM    557  CG  LYS B  93      75.508  11.522 -15.253  1.00  0.86           C  
ATOM    558  CD  LYS B  93      75.807  10.014 -15.162  1.00  0.86           C  
ATOM    559  CE  LYS B  93      77.130   9.654 -14.463  1.00  0.86           C  
ATOM    560  NZ  LYS B  93      77.088  10.000 -13.029  1.00  0.86           N  
ATOM    561  N   GLY B  94      75.941  14.841 -16.297  1.00  0.91           N  
ATOM    562  CA  GLY B  94      77.143  15.503 -16.789  1.00  0.91           C  
ATOM    563  C   GLY B  94      76.863  16.685 -17.668  1.00  0.91           C  
ATOM    564  O   GLY B  94      77.767  17.249 -18.276  1.00  0.91           O  
ATOM    565  N   LYS B  95      75.590  17.077 -17.765  1.00  0.86           N  
ATOM    566  CA  LYS B  95      75.140  18.206 -18.536  1.00  0.86           C  
ATOM    567  C   LYS B  95      74.220  19.026 -17.680  1.00  0.86           C  
ATOM    568  O   LYS B  95      73.976  18.712 -16.520  1.00  0.86           O  
ATOM    569  CB  LYS B  95      74.422  17.760 -19.830  1.00  0.86           C  
ATOM    570  CG  LYS B  95      75.412  17.139 -20.821  1.00  0.86           C  
ATOM    571  CD  LYS B  95      74.777  16.826 -22.182  1.00  0.86           C  
ATOM    572  CE  LYS B  95      75.787  16.529 -23.289  1.00  0.86           C  
ATOM    573  NZ  LYS B  95      76.688  15.448 -22.846  1.00  0.86           N  
ATOM    574  N   TYR B  96      73.729  20.147 -18.223  1.00  0.90           N  
ATOM    575  CA  TYR B  96      72.876  21.063 -17.508  1.00  0.90           C  
ATOM    576  C   TYR B  96      71.576  21.155 -18.245  1.00  0.90           C  
ATOM    577  O   TYR B  96      71.548  21.246 -19.471  1.00  0.90           O  
ATOM    578  CB  TYR B  96      73.502  22.468 -17.405  1.00  0.90           C  
ATOM    579  CG  TYR B  96      74.743  22.347 -16.582  1.00  0.90           C  
ATOM    580  CD1 TYR B  96      75.963  22.015 -17.186  1.00  0.90           C  
ATOM    581  CD2 TYR B  96      74.670  22.417 -15.185  1.00  0.90           C  
ATOM    582  CE1 TYR B  96      77.084  21.713 -16.412  1.00  0.90           C  
ATOM    583  CE2 TYR B  96      75.790  22.126 -14.401  1.00  0.90           C  
ATOM    584  CZ  TYR B  96      76.982  21.749 -15.019  1.00  0.90           C  
ATOM    585  OH  TYR B  96      78.059  21.326 -14.244  1.00  0.90           O  
ATOM    586  N   VAL B  97      70.458  21.104 -17.504  1.00  0.97           N  
ATOM    587  CA  VAL B  97      69.134  21.147 -18.081  1.00  0.97           C  
ATOM    588  C   VAL B  97      68.482  22.456 -17.732  1.00  0.97           C  
ATOM    589  O   VAL B  97      68.502  22.916 -16.588  1.00  0.97           O  
ATOM    590  CB  VAL B  97      68.256  19.961 -17.686  1.00  0.97           C  
ATOM    591  CG1 VAL B  97      68.021  19.860 -16.165  1.00  0.97           C  
ATOM    592  CG2 VAL B  97      66.928  19.993 -18.463  1.00  0.97           C  
ATOM    593  N   GLN B  98      67.903  23.110 -18.750  1.00  0.94           N  
ATOM    594  CA  GLN B  98      67.209  24.363 -18.611  1.00  0.94           C  
ATOM    595  C   GLN B  98      65.734  24.073 -18.484  1.00  0.94           C  
ATOM    596  O   GLN B  98      65.128  23.427 -19.337  1.00  0.94           O  
ATOM    597  CB  GLN B  98      67.467  25.282 -19.822  1.00  0.94           C  
ATOM    598  CG  GLN B  98      68.830  26.015 -19.785  1.00  0.94           C  
ATOM    599  CD  GLN B  98      70.083  25.136 -19.757  1.00  0.94           C  
ATOM    600  OE1 GLN B  98      70.979  25.347 -18.935  1.00  0.94           O  
ATOM    601  NE2 GLN B  98      70.191  24.183 -20.701  1.00  0.94           N  
ATOM    602  N   ILE B  99      65.114  24.536 -17.392  1.00  0.96           N  
ATOM    603  CA  ILE B  99      63.728  24.245 -17.077  1.00  0.96           C  
ATOM    604  C   ILE B  99      63.017  25.588 -17.089  1.00  0.96           C  
ATOM    605  O   ILE B  99      63.545  26.506 -16.462  1.00  0.96           O  
ATOM    606  CB  ILE B  99      63.604  23.596 -15.701  1.00  0.96           C  
ATOM    607  CG1 ILE B  99      64.491  22.333 -15.582  1.00  0.96           C  
ATOM    608  CG2 ILE B  99      62.135  23.273 -15.361  1.00  0.96           C  
ATOM    609  CD1 ILE B  99      64.076  21.173 -16.492  1.00  0.96           C  
ATOM    610  N   PRO B 100      61.892  25.834 -17.768  1.00  0.97           N  
ATOM    611  CA  PRO B 100      61.073  27.036 -17.569  1.00  0.97           C  
ATOM    612  C   PRO B 100      60.815  27.383 -16.109  1.00  0.97           C  
ATOM    613  O   PRO B 100      60.549  26.474 -15.324  1.00  0.97           O  
ATOM    614  CB  PRO B 100      59.760  26.752 -18.324  1.00  0.97           C  
ATOM    615  CG  PRO B 100      60.072  25.580 -19.258  1.00  0.97           C  
ATOM    616  CD  PRO B 100      61.168  24.816 -18.523  1.00  0.97           C  
ATOM    617  N   THR B 101      60.852  28.669 -15.708  1.00  0.89           N  
ATOM    618  CA  THR B 101      60.706  29.091 -14.305  1.00  0.89           C  
ATOM    619  C   THR B 101      59.408  28.656 -13.655  1.00  0.89           C  
ATOM    620  O   THR B 101      59.364  28.329 -12.473  1.00  0.89           O  
ATOM    621  CB  THR B 101      60.835  30.591 -14.080  1.00  0.89           C  
ATOM    622  OG1 THR B 101      59.947  31.324 -14.913  1.00  0.89           O  
ATOM    623  CG2 THR B 101      62.252  31.027 -14.438  1.00  0.89           C  
ATOM    624  N   THR B 102      58.332  28.607 -14.461  1.00  0.88           N  
ATOM    625  CA  THR B 102      57.002  28.118 -14.126  1.00  0.88           C  
ATOM    626  C   THR B 102      56.948  26.645 -13.750  1.00  0.88           C  
ATOM    627  O   THR B 102      56.024  26.220 -13.066  1.00  0.88           O  
ATOM    628  CB  THR B 102      55.992  28.338 -15.255  1.00  0.88           C  
ATOM    629  OG1 THR B 102      56.430  27.795 -16.492  1.00  0.88           O  
ATOM    630  CG2 THR B 102      55.790  29.838 -15.506  1.00  0.88           C  
ATOM    631  N   CYS B 103      57.941  25.844 -14.190  1.00  0.92           N  
ATOM    632  CA  CYS B 103      58.007  24.412 -13.959  1.00  0.92           C  
ATOM    633  C   CYS B 103      59.246  24.023 -13.157  1.00  0.92           C  
ATOM    634  O   CYS B 103      59.555  22.846 -12.983  1.00  0.92           O  
ATOM    635  CB  CYS B 103      58.054  23.659 -15.314  1.00  0.92           C  
ATOM    636  SG  CYS B 103      56.634  24.021 -16.405  1.00  0.92           S  
ATOM    637  N   ALA B 104      59.994  25.006 -12.606  1.00  0.95           N  
ATOM    638  CA  ALA B 104      61.225  24.787 -11.862  1.00  0.95           C  
ATOM    639  C   ALA B 104      61.036  24.124 -10.494  1.00  0.95           C  
ATOM    640  O   ALA B 104      62.001  23.730  -9.843  1.00  0.95           O  
ATOM    641  CB  ALA B 104      61.985  26.122 -11.706  1.00  0.95           C  
ATOM    642  N   ASN B 105      59.776  23.980 -10.031  1.00  0.90           N  
ATOM    643  CA  ASN B 105      59.404  23.255  -8.828  1.00  0.90           C  
ATOM    644  C   ASN B 105      59.439  21.731  -8.982  1.00  0.90           C  
ATOM    645  O   ASN B 105      59.537  21.017  -7.990  1.00  0.90           O  
ATOM    646  CB  ASN B 105      58.002  23.714  -8.324  1.00  0.90           C  
ATOM    647  CG  ASN B 105      56.903  23.388  -9.334  1.00  0.90           C  
ATOM    648  OD1 ASN B 105      56.962  23.808 -10.486  1.00  0.90           O  
ATOM    649  ND2 ASN B 105      55.886  22.607  -8.901  1.00  0.90           N  
ATOM    650  N   ASP B 106      59.389  21.216 -10.229  1.00  0.96           N  
ATOM    651  CA  ASP B 106      59.480  19.795 -10.515  1.00  0.96           C  
ATOM    652  C   ASP B 106      60.340  19.611 -11.771  1.00  0.96           C  
ATOM    653  O   ASP B 106      59.812  19.356 -12.859  1.00  0.96           O  
ATOM    654  CB  ASP B 106      58.049  19.203 -10.690  1.00  0.96           C  
ATOM    655  CG  ASP B 106      57.988  17.702 -10.947  1.00  0.96           C  
ATOM    656  OD1 ASP B 106      59.005  16.981 -10.747  1.00  0.96           O  
ATOM    657  OD2 ASP B 106      56.896  17.240 -11.371  1.00  0.96           O  
ATOM    658  N   PRO B 107      61.675  19.727 -11.712  1.00  0.99           N  
ATOM    659  CA  PRO B 107      62.518  19.512 -12.880  1.00  0.99           C  
ATOM    660  C   PRO B 107      62.475  18.087 -13.385  1.00  0.99           C  
ATOM    661  O   PRO B 107      62.551  17.894 -14.596  1.00  0.99           O  
ATOM    662  CB  PRO B 107      63.930  19.888 -12.412  1.00  0.99           C  
ATOM    663  CG  PRO B 107      63.704  20.831 -11.234  1.00  0.99           C  
ATOM    664  CD  PRO B 107      62.440  20.272 -10.586  1.00  0.99           C  
ATOM    665  N   VAL B 108      62.365  17.083 -12.485  1.00  0.98           N  
ATOM    666  CA  VAL B 108      62.264  15.670 -12.835  1.00  0.98           C  
ATOM    667  C   VAL B 108      61.000  15.391 -13.626  1.00  0.98           C  
ATOM    668  O   VAL B 108      61.000  14.692 -14.636  1.00  0.98           O  
ATOM    669  CB  VAL B 108      62.300  14.751 -11.611  1.00  0.98           C  
ATOM    670  CG1 VAL B 108      62.167  13.284 -12.063  1.00  0.98           C  
ATOM    671  CG2 VAL B 108      63.625  14.917 -10.844  1.00  0.98           C  
ATOM    672  N   GLY B 109      59.860  15.968 -13.200  1.00  1.00           N  
ATOM    673  CA  GLY B 109      58.615  15.832 -13.932  1.00  1.00           C  
ATOM    674  C   GLY B 109      58.588  16.554 -15.238  1.00  1.00           C  
ATOM    675  O   GLY B 109      57.976  16.082 -16.192  1.00  1.00           O  
ATOM    676  N   PHE B 110      59.261  17.715 -15.338  1.00  0.94           N  
ATOM    677  CA  PHE B 110      59.395  18.432 -16.589  1.00  0.94           C  
ATOM    678  C   PHE B 110      60.180  17.652 -17.642  1.00  0.94           C  
ATOM    679  O   PHE B 110      59.727  17.532 -18.777  1.00  0.94           O  
ATOM    680  CB  PHE B 110      60.045  19.822 -16.354  1.00  0.94           C  
ATOM    681  CG  PHE B 110      60.007  20.663 -17.607  1.00  0.94           C  
ATOM    682  CD1 PHE B 110      58.881  21.440 -17.914  1.00  0.94           C  
ATOM    683  CD2 PHE B 110      61.057  20.601 -18.537  1.00  0.94           C  
ATOM    684  CE1 PHE B 110      58.803  22.140 -19.125  1.00  0.94           C  
ATOM    685  CE2 PHE B 110      60.970  21.282 -19.755  1.00  0.94           C  
ATOM    686  CZ  PHE B 110      59.846  22.054 -20.051  1.00  0.94           C  
ATOM    687  N   THR B 111      61.348  17.075 -17.288  1.00  0.96           N  
ATOM    688  CA  THR B 111      62.192  16.331 -18.228  1.00  0.96           C  
ATOM    689  C   THR B 111      61.519  15.087 -18.775  1.00  0.96           C  
ATOM    690  O   THR B 111      61.632  14.766 -19.950  1.00  0.96           O  
ATOM    691  CB  THR B 111      63.575  15.964 -17.686  1.00  0.96           C  
ATOM    692  OG1 THR B 111      63.497  15.176 -16.506  1.00  0.96           O  
ATOM    693  CG2 THR B 111      64.343  17.242 -17.326  1.00  0.96           C  
ATOM    694  N   LEU B 112      60.764  14.368 -17.926  1.00  0.95           N  
ATOM    695  CA  LEU B 112      59.959  13.220 -18.301  1.00  0.95           C  
ATOM    696  C   LEU B 112      58.753  13.479 -19.185  1.00  0.95           C  
ATOM    697  O   LEU B 112      58.315  12.604 -19.928  1.00  0.95           O  
ATOM    698  CB  LEU B 112      59.359  12.564 -17.050  1.00  0.95           C  
ATOM    699  CG  LEU B 112      60.369  11.803 -16.193  1.00  0.95           C  
ATOM    700  CD1 LEU B 112      59.705  11.512 -14.846  1.00  0.95           C  
ATOM    701  CD2 LEU B 112      60.850  10.518 -16.882  1.00  0.95           C  
ATOM    702  N   LYS B 113      58.093  14.639 -19.031  1.00  0.91           N  
ATOM    703  CA  LYS B 113      56.880  14.934 -19.763  1.00  0.91           C  
ATOM    704  C   LYS B 113      57.133  15.700 -21.051  1.00  0.91           C  
ATOM    705  O   LYS B 113      56.195  15.946 -21.802  1.00  0.91           O  
ATOM    706  CB  LYS B 113      55.934  15.802 -18.898  1.00  0.91           C  
ATOM    707  CG  LYS B 113      55.379  15.100 -17.649  1.00  0.91           C  
ATOM    708  CD  LYS B 113      54.646  16.085 -16.717  1.00  0.91           C  
ATOM    709  CE  LYS B 113      54.133  15.430 -15.430  1.00  0.91           C  
ATOM    710  NZ  LYS B 113      53.511  16.425 -14.524  1.00  0.91           N  
ATOM    711  N   ASN B 114      58.391  16.073 -21.343  1.00  0.93           N  
ATOM    712  CA  ASN B 114      58.707  16.948 -22.453  1.00  0.93           C  
ATOM    713  C   ASN B 114      59.827  16.379 -23.287  1.00  0.93           C  
ATOM    714  O   ASN B 114      60.576  15.501 -22.875  1.00  0.93           O  
ATOM    715  CB  ASN B 114      59.119  18.354 -21.965  1.00  0.93           C  
ATOM    716  CG  ASN B 114      57.885  19.054 -21.421  1.00  0.93           C  
ATOM    717  OD1 ASN B 114      57.048  19.531 -22.184  1.00  0.93           O  
ATOM    718  ND2 ASN B 114      57.760  19.144 -20.081  1.00  0.93           N  
ATOM    719  N   THR B 115      59.949  16.898 -24.520  1.00  0.92           N  
ATOM    720  CA  THR B 115      60.810  16.329 -25.545  1.00  0.92           C  
ATOM    721  C   THR B 115      61.657  17.442 -26.110  1.00  0.92           C  
ATOM    722  O   THR B 115      61.165  18.534 -26.402  1.00  0.92           O  
ATOM    723  CB  THR B 115      60.006  15.682 -26.668  1.00  0.92           C  
ATOM    724  OG1 THR B 115      59.262  14.587 -26.162  1.00  0.92           O  
ATOM    725  CG2 THR B 115      60.883  15.102 -27.782  1.00  0.92           C  
ATOM    726  N   VAL B 116      62.978  17.220 -26.257  1.00  0.95           N  
ATOM    727  CA  VAL B 116      63.882  18.168 -26.893  1.00  0.95           C  
ATOM    728  C   VAL B 116      63.716  18.088 -28.404  1.00  0.95           C  
ATOM    729  O   VAL B 116      63.658  17.006 -28.982  1.00  0.95           O  
ATOM    730  CB  VAL B 116      65.338  17.909 -26.516  1.00  0.95           C  
ATOM    731  CG1 VAL B 116      66.285  18.946 -27.155  1.00  0.95           C  
ATOM    732  CG2 VAL B 116      65.470  17.963 -24.985  1.00  0.95           C  
ATOM    733  N   CYS B 117      63.599  19.229 -29.114  1.00  0.97           N  
ATOM    734  CA  CYS B 117      63.615  19.219 -30.565  1.00  0.97           C  
ATOM    735  C   CYS B 117      64.982  18.831 -31.101  1.00  0.97           C  
ATOM    736  O   CYS B 117      65.991  19.445 -30.768  1.00  0.97           O  
ATOM    737  CB  CYS B 117      63.217  20.600 -31.141  1.00  0.97           C  
ATOM    738  SG  CYS B 117      62.975  20.651 -32.954  1.00  0.97           S  
ATOM    739  N   THR B 118      65.027  17.825 -31.989  1.00  0.94           N  
ATOM    740  CA  THR B 118      66.244  17.282 -32.574  1.00  0.94           C  
ATOM    741  C   THR B 118      66.887  18.212 -33.589  1.00  0.94           C  
ATOM    742  O   THR B 118      68.037  18.027 -33.970  1.00  0.94           O  
ATOM    743  CB  THR B 118      65.979  15.937 -33.244  1.00  0.94           C  
ATOM    744  OG1 THR B 118      64.900  16.016 -34.167  1.00  0.94           O  
ATOM    745  CG2 THR B 118      65.556  14.903 -32.190  1.00  0.94           C  
ATOM    746  N   VAL B 119      66.144  19.246 -34.039  1.00  0.96           N  
ATOM    747  CA  VAL B 119      66.608  20.248 -34.988  1.00  0.96           C  
ATOM    748  C   VAL B 119      67.226  21.460 -34.303  1.00  0.96           C  
ATOM    749  O   VAL B 119      68.369  21.819 -34.568  1.00  0.96           O  
ATOM    750  CB  VAL B 119      65.462  20.693 -35.897  1.00  0.96           C  
ATOM    751  CG1 VAL B 119      65.936  21.748 -36.918  1.00  0.96           C  
ATOM    752  CG2 VAL B 119      64.905  19.461 -36.637  1.00  0.96           C  
ATOM    753  N   CYS B 120      66.489  22.137 -33.389  1.00  0.98           N  
ATOM    754  CA  CYS B 120      66.958  23.384 -32.795  1.00  0.98           C  
ATOM    755  C   CYS B 120      67.506  23.241 -31.382  1.00  0.98           C  
ATOM    756  O   CYS B 120      68.087  24.175 -30.836  1.00  0.98           O  
ATOM    757  CB  CYS B 120      65.825  24.449 -32.779  1.00  0.98           C  
ATOM    758  SG  CYS B 120      64.323  23.939 -31.890  1.00  0.98           S  
ATOM    759  N   GLY B 121      67.334  22.070 -30.732  1.00  0.99           N  
ATOM    760  CA  GLY B 121      67.817  21.823 -29.374  1.00  0.99           C  
ATOM    761  C   GLY B 121      66.998  22.447 -28.271  1.00  0.99           C  
ATOM    762  O   GLY B 121      67.344  22.366 -27.097  1.00  0.99           O  
ATOM    763  N   MET B 122      65.872  23.088 -28.617  1.00  0.93           N  
ATOM    764  CA  MET B 122      64.975  23.707 -27.667  1.00  0.93           C  
ATOM    765  C   MET B 122      63.887  22.722 -27.283  1.00  0.93           C  
ATOM    766  O   MET B 122      63.568  21.802 -28.035  1.00  0.93           O  
ATOM    767  CB  MET B 122      64.284  24.949 -28.275  1.00  0.93           C  
ATOM    768  CG  MET B 122      65.211  26.000 -28.919  1.00  0.93           C  
ATOM    769  SD  MET B 122      66.363  26.829 -27.794  1.00  0.93           S  
ATOM    770  CE  MET B 122      65.135  27.776 -26.857  1.00  0.93           C  
ATOM    771  N   TRP B 123      63.263  22.877 -26.100  1.00  0.93           N  
ATOM    772  CA  TRP B 123      62.110  22.075 -25.732  1.00  0.93           C  
ATOM    773  C   TRP B 123      60.916  22.292 -26.655  1.00  0.93           C  
ATOM    774  O   TRP B 123      60.610  23.412 -27.079  1.00  0.93           O  
ATOM    775  CB  TRP B 123      61.678  22.359 -24.278  1.00  0.93           C  
ATOM    776  CG  TRP B 123      62.673  21.959 -23.209  1.00  0.93           C  
ATOM    777  CD1 TRP B 123      63.410  22.765 -22.389  1.00  0.93           C  
ATOM    778  CD2 TRP B 123      62.937  20.609 -22.783  1.00  0.93           C  
ATOM    779  NE1 TRP B 123      64.123  22.010 -21.487  1.00  0.93           N  
ATOM    780  CE2 TRP B 123      63.857  20.682 -21.720  1.00  0.93           C  
ATOM    781  CE3 TRP B 123      62.436  19.388 -23.213  1.00  0.93           C  
ATOM    782  CZ2 TRP B 123      64.306  19.534 -21.082  1.00  0.93           C  
ATOM    783  CZ3 TRP B 123      62.894  18.229 -22.571  1.00  0.93           C  
ATOM    784  CH2 TRP B 123      63.820  18.299 -21.528  1.00  0.93           C  
ATOM    785  N   LYS B 124      60.195  21.209 -27.008  1.00  0.91           N  
ATOM    786  CA  LYS B 124      58.943  21.313 -27.734  1.00  0.91           C  
ATOM    787  C   LYS B 124      57.875  21.990 -26.884  1.00  0.91           C  
ATOM    788  O   LYS B 124      57.617  21.592 -25.757  1.00  0.91           O  
ATOM    789  CB  LYS B 124      58.437  19.932 -28.216  1.00  0.91           C  
ATOM    790  CG  LYS B 124      59.368  19.198 -29.202  1.00  0.91           C  
ATOM    791  CD  LYS B 124      59.541  19.863 -30.584  1.00  0.91           C  
ATOM    792  CE  LYS B 124      58.268  19.903 -31.454  1.00  0.91           C  
ATOM    793  NZ  LYS B 124      58.516  20.544 -32.759  1.00  0.91           N  
ATOM    794  N   GLY B 125      57.263  23.076 -27.405  1.00  0.97           N  
ATOM    795  CA  GLY B 125      56.274  23.863 -26.669  1.00  0.97           C  
ATOM    796  C   GLY B 125      56.841  24.863 -25.688  1.00  0.97           C  
ATOM    797  O   GLY B 125      56.096  25.621 -25.082  1.00  0.97           O  
ATOM    798  N   TYR B 126      58.182  24.931 -25.547  1.00  0.92           N  
ATOM    799  CA  TYR B 126      58.833  25.802 -24.582  1.00  0.92           C  
ATOM    800  C   TYR B 126      60.130  26.332 -25.168  1.00  0.92           C  
ATOM    801  O   TYR B 126      61.179  26.332 -24.526  1.00  0.92           O  
ATOM    802  CB  TYR B 126      59.172  25.090 -23.248  1.00  0.92           C  
ATOM    803  CG  TYR B 126      57.957  24.632 -22.507  1.00  0.92           C  
ATOM    804  CD1 TYR B 126      57.295  25.498 -21.625  1.00  0.92           C  
ATOM    805  CD2 TYR B 126      57.501  23.310 -22.633  1.00  0.92           C  
ATOM    806  CE1 TYR B 126      56.212  25.043 -20.861  1.00  0.92           C  
ATOM    807  CE2 TYR B 126      56.408  22.860 -21.885  1.00  0.92           C  
ATOM    808  CZ  TYR B 126      55.775  23.722 -20.986  1.00  0.92           C  
ATOM    809  OH  TYR B 126      54.715  23.247 -20.196  1.00  0.92           O  
ATOM    810  N   GLY B 127      60.094  26.796 -26.433  1.00  0.97           N  
ATOM    811  CA  GLY B 127      61.269  27.389 -27.057  1.00  0.97           C  
ATOM    812  C   GLY B 127      61.409  27.029 -28.502  1.00  0.97           C  
ATOM    813  O   GLY B 127      61.846  27.839 -29.308  1.00  0.97           O  
ATOM    814  N   CYS B 128      61.055  25.789 -28.894  1.00  0.96           N  
ATOM    815  CA  CYS B 128      61.078  25.401 -30.298  1.00  0.96           C  
ATOM    816  C   CYS B 128      60.080  26.170 -31.158  1.00  0.96           C  
ATOM    817  O   CYS B 128      58.874  26.134 -30.927  1.00  0.96           O  
ATOM    818  CB  CYS B 128      60.848  23.868 -30.460  1.00  0.96           C  
ATOM    819  SG  CYS B 128      60.809  23.243 -32.179  1.00  0.96           S  
ATOM    820  N   SER B 129      60.584  26.852 -32.205  1.00  0.93           N  
ATOM    821  CA  SER B 129      59.787  27.640 -33.126  1.00  0.93           C  
ATOM    822  C   SER B 129      59.790  27.057 -34.529  1.00  0.93           C  
ATOM    823  O   SER B 129      59.349  27.690 -35.479  1.00  0.93           O  
ATOM    824  CB  SER B 129      60.263  29.117 -33.151  1.00  0.93           C  
ATOM    825  OG  SER B 129      61.668  29.221 -33.386  1.00  0.93           O  
ATOM    826  N   CYS B 130      60.213  25.781 -34.685  1.00  0.94           N  
ATOM    827  CA  CYS B 130      60.296  25.087 -35.968  1.00  0.94           C  
ATOM    828  C   CYS B 130      58.954  24.872 -36.665  1.00  0.94           C  
ATOM    829  O   CYS B 130      58.897  24.786 -37.886  1.00  0.94           O  
ATOM    830  CB  CYS B 130      61.004  23.710 -35.823  1.00  0.94           C  
ATOM    831  SG  CYS B 130      62.733  23.837 -35.251  1.00  0.94           S  
ATOM    832  N   ASP B 131      57.856  24.795 -35.885  1.00  0.81           N  
ATOM    833  CA  ASP B 131      56.519  24.544 -36.379  1.00  0.81           C  
ATOM    834  C   ASP B 131      55.699  25.824 -36.501  1.00  0.81           C  
ATOM    835  O   ASP B 131      54.520  25.806 -36.850  1.00  0.81           O  
ATOM    836  CB  ASP B 131      55.806  23.579 -35.417  1.00  0.81           C  
ATOM    837  CG  ASP B 131      56.573  22.270 -35.304  1.00  0.81           C  
ATOM    838  OD1 ASP B 131      56.823  21.553 -36.301  1.00  0.81           O  
ATOM    839  OD2 ASP B 131      56.921  21.978 -34.123  1.00  0.81           O  
ATOM    840  N   GLN B 132      56.293  27.007 -36.218  1.00  0.77           N  
ATOM    841  CA  GLN B 132      55.597  28.271 -36.391  1.00  0.77           C  
ATOM    842  C   GLN B 132      55.436  28.621 -37.865  1.00  0.77           C  
ATOM    843  O   GLN B 132      56.225  28.211 -38.714  1.00  0.77           O  
ATOM    844  CB  GLN B 132      56.249  29.428 -35.590  1.00  0.77           C  
ATOM    845  CG  GLN B 132      56.284  29.135 -34.068  1.00  0.77           C  
ATOM    846  CD  GLN B 132      56.877  30.285 -33.250  1.00  0.77           C  
ATOM    847  OE1 GLN B 132      57.212  31.353 -33.744  1.00  0.77           O  
ATOM    848  NE2 GLN B 132      57.023  30.061 -31.919  1.00  0.77           N  
ATOM    849  N   LEU B 133      54.370  29.377 -38.217  1.00  0.82           N  
ATOM    850  CA  LEU B 133      54.151  29.889 -39.567  1.00  0.82           C  
ATOM    851  C   LEU B 133      55.360  30.629 -40.125  1.00  0.82           C  
ATOM    852  O   LEU B 133      56.104  31.275 -39.394  1.00  0.82           O  
ATOM    853  CB  LEU B 133      52.927  30.844 -39.593  1.00  0.82           C  
ATOM    854  CG  LEU B 133      52.491  31.376 -40.979  1.00  0.82           C  
ATOM    855  CD1 LEU B 133      52.067  30.252 -41.937  1.00  0.82           C  
ATOM    856  CD2 LEU B 133      51.358  32.403 -40.835  1.00  0.82           C  
ATOM    857  N   ARG B 134      55.601  30.524 -41.450  1.00  0.79           N  
ATOM    858  CA  ARG B 134      56.738  31.135 -42.107  1.00  0.79           C  
ATOM    859  C   ARG B 134      56.808  32.640 -41.887  1.00  0.79           C  
ATOM    860  O   ARG B 134      55.884  33.368 -42.246  1.00  0.79           O  
ATOM    861  CB  ARG B 134      56.665  30.889 -43.639  1.00  0.79           C  
ATOM    862  CG  ARG B 134      56.619  29.410 -44.086  1.00  0.79           C  
ATOM    863  CD  ARG B 134      57.952  28.654 -44.038  1.00  0.79           C  
ATOM    864  NE  ARG B 134      58.886  29.293 -45.031  1.00  0.79           N  
ATOM    865  CZ  ARG B 134      58.884  29.068 -46.355  1.00  0.79           C  
ATOM    866  NH1 ARG B 134      59.737  29.729 -47.136  1.00  0.79           N  
ATOM    867  NH2 ARG B 134      58.042  28.210 -46.922  1.00  0.79           N  
ATOM    868  N   GLU B 135      57.910  33.145 -41.295  1.00  0.70           N  
ATOM    869  CA  GLU B 135      58.117  34.570 -41.172  1.00  0.70           C  
ATOM    870  C   GLU B 135      58.294  35.212 -42.549  1.00  0.70           C  
ATOM    871  O   GLU B 135      58.829  34.567 -43.460  1.00  0.70           O  
ATOM    872  CB  GLU B 135      59.307  34.919 -40.246  1.00  0.70           C  
ATOM    873  CG  GLU B 135      59.098  34.516 -38.764  1.00  0.70           C  
ATOM    874  CD  GLU B 135      60.239  35.000 -37.862  1.00  0.70           C  
ATOM    875  OE1 GLU B 135      61.015  35.889 -38.298  1.00  0.70           O  
ATOM    876  OE2 GLU B 135      60.331  34.483 -36.720  1.00  0.70           O  
ATOM    877  N   PRO B 136      57.867  36.446 -42.798  1.00  0.76           N  
ATOM    878  CA  PRO B 136      58.370  37.204 -43.930  1.00  0.76           C  
ATOM    879  C   PRO B 136      59.852  37.485 -43.780  1.00  0.76           C  
ATOM    880  O   PRO B 136      60.348  37.629 -42.667  1.00  0.76           O  
ATOM    881  CB  PRO B 136      57.536  38.486 -43.904  1.00  0.76           C  
ATOM    882  CG  PRO B 136      57.213  38.699 -42.423  1.00  0.76           C  
ATOM    883  CD  PRO B 136      57.108  37.280 -41.861  1.00  0.76           C  
ATOM    884  N   MET B 137      60.599  37.502 -44.894  1.00  0.72           N  
ATOM    885  CA  MET B 137      62.030  37.701 -44.862  1.00  0.72           C  
ATOM    886  C   MET B 137      62.428  39.082 -44.358  1.00  0.72           C  
ATOM    887  O   MET B 137      61.806  40.091 -44.686  1.00  0.72           O  
ATOM    888  CB  MET B 137      62.637  37.424 -46.255  1.00  0.72           C  
ATOM    889  CG  MET B 137      62.360  35.997 -46.775  1.00  0.72           C  
ATOM    890  SD  MET B 137      62.547  35.807 -48.576  1.00  0.72           S  
ATOM    891  CE  MET B 137      64.300  36.257 -48.696  1.00  0.72           C  
ATOM    892  N   LEU B 138      63.497  39.148 -43.549  1.00  0.56           N  
ATOM    893  CA  LEU B 138      63.932  40.370 -42.915  1.00  0.56           C  
ATOM    894  C   LEU B 138      65.275  40.729 -43.516  1.00  0.56           C  
ATOM    895  O   LEU B 138      66.073  39.847 -43.825  1.00  0.56           O  
ATOM    896  CB  LEU B 138      64.037  40.195 -41.379  1.00  0.56           C  
ATOM    897  CG  LEU B 138      62.710  39.799 -40.688  1.00  0.56           C  
ATOM    898  CD1 LEU B 138      62.944  39.409 -39.220  1.00  0.56           C  
ATOM    899  CD2 LEU B 138      61.642  40.900 -40.790  1.00  0.56           C  
ATOM    900  N   GLN B 139      65.493  42.036 -43.765  1.00  0.50           N  
ATOM    901  CA  GLN B 139      66.781  42.567 -44.173  1.00  0.50           C  
ATOM    902  C   GLN B 139      67.822  42.615 -43.014  1.00  0.50           C  
ATOM    903  O   GLN B 139      67.438  42.397 -41.832  1.00  0.50           O  
ATOM    904  CB  GLN B 139      66.666  44.020 -44.725  1.00  0.50           C  
ATOM    905  CG  GLN B 139      65.501  44.303 -45.707  1.00  0.50           C  
ATOM    906  CD  GLN B 139      65.669  45.652 -46.418  1.00  0.50           C  
ATOM    907  OE1 GLN B 139      66.736  46.255 -46.484  1.00  0.50           O  
ATOM    908  NE2 GLN B 139      64.559  46.163 -47.011  1.00  0.50           N  
ATOM    909  OXT GLN B 139      69.011  42.908 -43.317  1.00  0.50           O  
TER     910      GLN B 139                                                      
ATOM    911  N   SER A   2      85.968  47.525   1.221  1.00  0.74           N  
ATOM    912  CA  SER A   2      85.152  46.388   1.797  1.00  0.74           C  
ATOM    913  C   SER A   2      85.421  45.117   1.028  1.00  0.74           C  
ATOM    914  O   SER A   2      85.684  45.183  -0.167  1.00  0.74           O  
ATOM    915  CB  SER A   2      83.619  46.695   1.758  1.00  0.74           C  
ATOM    916  OG  SER A   2      82.831  45.599   2.232  1.00  0.74           O  
ATOM    917  N   GLN A   3      85.375  43.946   1.691  1.00  0.82           N  
ATOM    918  CA  GLN A   3      85.624  42.659   1.077  1.00  0.82           C  
ATOM    919  C   GLN A   3      84.316  41.955   0.755  1.00  0.82           C  
ATOM    920  O   GLN A   3      84.301  40.861   0.209  1.00  0.82           O  
ATOM    921  CB  GLN A   3      86.494  41.819   2.038  1.00  0.82           C  
ATOM    922  CG  GLN A   3      87.915  42.419   2.191  1.00  0.82           C  
ATOM    923  CD  GLN A   3      88.667  41.878   3.410  1.00  0.82           C  
ATOM    924  OE1 GLN A   3      88.102  41.695   4.484  1.00  0.82           O  
ATOM    925  NE2 GLN A   3      90.001  41.691   3.267  1.00  0.82           N  
ATOM    926  N   ALA A   4      83.162  42.611   1.010  1.00  0.89           N  
ATOM    927  CA  ALA A   4      81.842  42.044   0.811  1.00  0.89           C  
ATOM    928  C   ALA A   4      81.463  41.747  -0.642  1.00  0.89           C  
ATOM    929  O   ALA A   4      80.598  40.918  -0.900  1.00  0.89           O  
ATOM    930  CB  ALA A   4      80.793  42.985   1.436  1.00  0.89           C  
ATOM    931  N   TRP A   5      82.114  42.388  -1.632  1.00  0.74           N  
ATOM    932  CA  TRP A   5      81.868  42.111  -3.040  1.00  0.74           C  
ATOM    933  C   TRP A   5      82.882  41.132  -3.613  1.00  0.74           C  
ATOM    934  O   TRP A   5      82.809  40.748  -4.777  1.00  0.74           O  
ATOM    935  CB  TRP A   5      81.845  43.422  -3.864  1.00  0.74           C  
ATOM    936  CG  TRP A   5      80.580  44.233  -3.634  1.00  0.74           C  
ATOM    937  CD1 TRP A   5      79.382  44.099  -4.274  1.00  0.74           C  
ATOM    938  CD2 TRP A   5      80.389  45.260  -2.642  1.00  0.74           C  
ATOM    939  NE1 TRP A   5      78.448  44.958  -3.742  1.00  0.74           N  
ATOM    940  CE2 TRP A   5      79.048  45.681  -2.741  1.00  0.74           C  
ATOM    941  CE3 TRP A   5      81.253  45.821  -1.707  1.00  0.74           C  
ATOM    942  CZ2 TRP A   5      78.544  46.670  -1.906  1.00  0.74           C  
ATOM    943  CZ3 TRP A   5      80.745  46.829  -0.877  1.00  0.74           C  
ATOM    944  CH2 TRP A   5      79.413  47.246  -0.971  1.00  0.74           C  
ATOM    945  N   GLN A   6      83.835  40.653  -2.789  1.00  0.86           N  
ATOM    946  CA  GLN A   6      84.740  39.591  -3.170  1.00  0.86           C  
ATOM    947  C   GLN A   6      84.025  38.254  -3.010  1.00  0.86           C  
ATOM    948  O   GLN A   6      82.981  38.192  -2.355  1.00  0.86           O  
ATOM    949  CB  GLN A   6      86.024  39.629  -2.297  1.00  0.86           C  
ATOM    950  CG  GLN A   6      86.808  40.957  -2.425  1.00  0.86           C  
ATOM    951  CD  GLN A   6      88.001  41.029  -1.467  1.00  0.86           C  
ATOM    952  OE1 GLN A   6      88.323  40.128  -0.704  1.00  0.86           O  
ATOM    953  NE2 GLN A   6      88.706  42.189  -1.490  1.00  0.86           N  
ATOM    954  N   PRO A   7      84.512  37.153  -3.566  1.00  0.92           N  
ATOM    955  CA  PRO A   7      83.992  35.830  -3.245  1.00  0.92           C  
ATOM    956  C   PRO A   7      84.310  35.405  -1.835  1.00  0.92           C  
ATOM    957  O   PRO A   7      83.648  34.526  -1.291  1.00  0.92           O  
ATOM    958  CB  PRO A   7      84.624  34.927  -4.309  1.00  0.92           C  
ATOM    959  CG  PRO A   7      85.897  35.650  -4.747  1.00  0.92           C  
ATOM    960  CD  PRO A   7      85.499  37.117  -4.651  1.00  0.92           C  
ATOM    961  N   GLY A   8      85.326  35.981  -1.208  1.00  0.94           N  
ATOM    962  CA  GLY A   8      85.699  35.570   0.115  1.00  0.94           C  
ATOM    963  C   GLY A   8      86.958  36.268   0.423  1.00  0.94           C  
ATOM    964  O   GLY A   8      87.369  37.165  -0.308  1.00  0.94           O  
ATOM    965  N   VAL A   9      87.610  35.843   1.503  1.00  0.92           N  
ATOM    966  CA  VAL A   9      88.807  36.478   1.998  1.00  0.92           C  
ATOM    967  C   VAL A   9      89.870  35.413   2.156  1.00  0.92           C  
ATOM    968  O   VAL A   9      89.644  34.345   2.726  1.00  0.92           O  
ATOM    969  CB  VAL A   9      88.577  37.213   3.313  1.00  0.92           C  
ATOM    970  CG1 VAL A   9      89.823  38.032   3.695  1.00  0.92           C  
ATOM    971  CG2 VAL A   9      87.384  38.174   3.160  1.00  0.92           C  
ATOM    972  N   ALA A  10      91.074  35.673   1.617  1.00  0.93           N  
ATOM    973  CA  ALA A  10      92.235  34.840   1.807  1.00  0.93           C  
ATOM    974  C   ALA A  10      93.029  35.342   2.996  1.00  0.93           C  
ATOM    975  O   ALA A  10      93.106  36.546   3.234  1.00  0.93           O  
ATOM    976  CB  ALA A  10      93.106  34.878   0.542  1.00  0.93           C  
ATOM    977  N   MET A  11      93.634  34.429   3.780  1.00  0.89           N  
ATOM    978  CA  MET A  11      94.493  34.768   4.903  1.00  0.89           C  
ATOM    979  C   MET A  11      95.690  35.641   4.506  1.00  0.89           C  
ATOM    980  O   MET A  11      96.494  35.200   3.679  1.00  0.89           O  
ATOM    981  CB  MET A  11      95.017  33.481   5.581  1.00  0.89           C  
ATOM    982  CG  MET A  11      95.793  33.720   6.891  1.00  0.89           C  
ATOM    983  SD  MET A  11      96.210  32.203   7.800  1.00  0.89           S  
ATOM    984  CE  MET A  11      97.433  31.608   6.605  1.00  0.89           C  
ATOM    985  N   PRO A  12      95.875  36.863   5.014  1.00  0.92           N  
ATOM    986  CA  PRO A  12      97.062  37.672   4.753  1.00  0.92           C  
ATOM    987  C   PRO A  12      98.385  36.970   5.016  1.00  0.92           C  
ATOM    988  O   PRO A  12      98.513  36.267   6.018  1.00  0.92           O  
ATOM    989  CB  PRO A  12      96.861  38.931   5.614  1.00  0.92           C  
ATOM    990  CG  PRO A  12      95.339  39.054   5.724  1.00  0.92           C  
ATOM    991  CD  PRO A  12      94.883  37.599   5.801  1.00  0.92           C  
ATOM    992  N   ASN A  13      99.409  37.168   4.153  1.00  0.78           N  
ATOM    993  CA  ASN A  13     100.698  36.488   4.262  1.00  0.78           C  
ATOM    994  C   ASN A  13     101.413  36.693   5.596  1.00  0.78           C  
ATOM    995  O   ASN A  13     102.141  35.817   6.050  1.00  0.78           O  
ATOM    996  CB  ASN A  13     101.694  36.915   3.152  1.00  0.78           C  
ATOM    997  CG  ASN A  13     101.414  36.242   1.812  1.00  0.78           C  
ATOM    998  OD1 ASN A  13     100.912  35.121   1.716  1.00  0.78           O  
ATOM    999  ND2 ASN A  13     101.847  36.916   0.720  1.00  0.78           N  
ATOM   1000  N   LEU A  14     101.210  37.850   6.258  1.00  0.80           N  
ATOM   1001  CA  LEU A  14     101.782  38.160   7.560  1.00  0.80           C  
ATOM   1002  C   LEU A  14     101.438  37.156   8.654  1.00  0.80           C  
ATOM   1003  O   LEU A  14     102.288  36.844   9.481  1.00  0.80           O  
ATOM   1004  CB  LEU A  14     101.414  39.591   8.025  1.00  0.80           C  
ATOM   1005  CG  LEU A  14     102.269  40.709   7.391  1.00  0.80           C  
ATOM   1006  CD1 LEU A  14     101.648  42.091   7.631  1.00  0.80           C  
ATOM   1007  CD2 LEU A  14     103.690  40.721   7.971  1.00  0.80           C  
ATOM   1008  N   TYR A  15     100.211  36.585   8.660  1.00  0.77           N  
ATOM   1009  CA  TYR A  15      99.798  35.548   9.598  1.00  0.77           C  
ATOM   1010  C   TYR A  15     100.637  34.289   9.508  1.00  0.77           C  
ATOM   1011  O   TYR A  15     100.904  33.635  10.510  1.00  0.77           O  
ATOM   1012  CB  TYR A  15      98.314  35.162   9.411  1.00  0.77           C  
ATOM   1013  CG  TYR A  15      97.438  36.289   9.864  1.00  0.77           C  
ATOM   1014  CD1 TYR A  15      97.212  36.477  11.231  1.00  0.77           C  
ATOM   1015  CD2 TYR A  15      96.831  37.163   8.954  1.00  0.77           C  
ATOM   1016  CE1 TYR A  15      96.412  37.531  11.683  1.00  0.77           C  
ATOM   1017  CE2 TYR A  15      96.040  38.236   9.404  1.00  0.77           C  
ATOM   1018  CZ  TYR A  15      95.835  38.424  10.780  1.00  0.77           C  
ATOM   1019  OH  TYR A  15      95.070  39.473  11.337  1.00  0.77           O  
ATOM   1020  N   LYS A  16     101.114  33.938   8.299  1.00  0.69           N  
ATOM   1021  CA  LYS A  16     101.955  32.779   8.077  1.00  0.69           C  
ATOM   1022  C   LYS A  16     103.293  32.842   8.795  1.00  0.69           C  
ATOM   1023  O   LYS A  16     103.884  31.822   9.120  1.00  0.69           O  
ATOM   1024  CB  LYS A  16     102.258  32.563   6.577  1.00  0.69           C  
ATOM   1025  CG  LYS A  16     101.029  32.467   5.664  1.00  0.69           C  
ATOM   1026  CD  LYS A  16     101.457  32.347   4.193  1.00  0.69           C  
ATOM   1027  CE  LYS A  16     100.282  32.296   3.216  1.00  0.69           C  
ATOM   1028  NZ  LYS A  16     100.787  32.380   1.834  1.00  0.69           N  
ATOM   1029  N   MET A  17     103.802  34.055   9.065  1.00  0.71           N  
ATOM   1030  CA  MET A  17     105.117  34.232   9.639  1.00  0.71           C  
ATOM   1031  C   MET A  17     105.059  34.425  11.143  1.00  0.71           C  
ATOM   1032  O   MET A  17     106.076  34.659  11.790  1.00  0.71           O  
ATOM   1033  CB  MET A  17     105.785  35.458   8.982  1.00  0.71           C  
ATOM   1034  CG  MET A  17     105.982  35.270   7.463  1.00  0.71           C  
ATOM   1035  SD  MET A  17     106.889  36.606   6.632  1.00  0.71           S  
ATOM   1036  CE  MET A  17     105.511  37.766   6.771  1.00  0.71           C  
ATOM   1037  N   GLN A  18     103.860  34.317  11.750  1.00  0.74           N  
ATOM   1038  CA  GLN A  18     103.700  34.463  13.183  1.00  0.74           C  
ATOM   1039  C   GLN A  18     103.869  33.137  13.899  1.00  0.74           C  
ATOM   1040  O   GLN A  18     103.997  32.075  13.290  1.00  0.74           O  
ATOM   1041  CB  GLN A  18     102.354  35.134  13.557  1.00  0.74           C  
ATOM   1042  CG  GLN A  18     102.087  36.458  12.800  1.00  0.74           C  
ATOM   1043  CD  GLN A  18     103.273  37.422  12.872  1.00  0.74           C  
ATOM   1044  OE1 GLN A  18     103.815  37.699  13.941  1.00  0.74           O  
ATOM   1045  NE2 GLN A  18     103.698  37.950  11.699  1.00  0.74           N  
ATOM   1046  N   ARG A  19     103.906  33.165  15.242  1.00  0.71           N  
ATOM   1047  CA  ARG A  19     104.056  31.954  16.024  1.00  0.71           C  
ATOM   1048  C   ARG A  19     103.057  31.952  17.148  1.00  0.71           C  
ATOM   1049  O   ARG A  19     103.391  32.032  18.328  1.00  0.71           O  
ATOM   1050  CB  ARG A  19     105.510  31.754  16.515  1.00  0.71           C  
ATOM   1051  CG  ARG A  19     105.838  30.283  16.851  1.00  0.71           C  
ATOM   1052  CD  ARG A  19     107.340  29.980  16.913  1.00  0.71           C  
ATOM   1053  NE  ARG A  19     107.541  28.499  16.688  1.00  0.71           N  
ATOM   1054  CZ  ARG A  19     107.667  27.911  15.486  1.00  0.71           C  
ATOM   1055  NH1 ARG A  19     107.839  26.590  15.409  1.00  0.71           N  
ATOM   1056  NH2 ARG A  19     107.585  28.603  14.354  1.00  0.71           N  
ATOM   1057  N   MET A  20     101.767  31.914  16.780  1.00  0.84           N  
ATOM   1058  CA  MET A  20     100.687  31.951  17.731  1.00  0.84           C  
ATOM   1059  C   MET A  20     100.518  30.679  18.531  1.00  0.84           C  
ATOM   1060  O   MET A  20     100.816  29.572  18.086  1.00  0.84           O  
ATOM   1061  CB  MET A  20      99.361  32.320  17.039  1.00  0.84           C  
ATOM   1062  CG  MET A  20      99.430  33.656  16.272  1.00  0.84           C  
ATOM   1063  SD  MET A  20     100.053  35.091  17.204  1.00  0.84           S  
ATOM   1064  CE  MET A  20      98.795  35.094  18.510  1.00  0.84           C  
ATOM   1065  N   LEU A  21     100.008  30.821  19.766  1.00  0.83           N  
ATOM   1066  CA  LEU A  21      99.595  29.695  20.569  1.00  0.83           C  
ATOM   1067  C   LEU A  21      98.165  29.348  20.187  1.00  0.83           C  
ATOM   1068  O   LEU A  21      97.363  30.225  19.880  1.00  0.83           O  
ATOM   1069  CB  LEU A  21      99.714  30.044  22.068  1.00  0.83           C  
ATOM   1070  CG  LEU A  21      99.541  28.871  23.051  1.00  0.83           C  
ATOM   1071  CD1 LEU A  21     100.631  27.802  22.876  1.00  0.83           C  
ATOM   1072  CD2 LEU A  21      99.545  29.400  24.493  1.00  0.83           C  
ATOM   1073  N   LEU A  22      97.829  28.046  20.107  1.00  0.83           N  
ATOM   1074  CA  LEU A  22      96.480  27.604  19.798  1.00  0.83           C  
ATOM   1075  C   LEU A  22      95.484  27.893  20.911  1.00  0.83           C  
ATOM   1076  O   LEU A  22      95.763  27.667  22.085  1.00  0.83           O  
ATOM   1077  CB  LEU A  22      96.456  26.089  19.493  1.00  0.83           C  
ATOM   1078  CG  LEU A  22      95.110  25.519  18.993  1.00  0.83           C  
ATOM   1079  CD1 LEU A  22      94.712  26.062  17.612  1.00  0.83           C  
ATOM   1080  CD2 LEU A  22      95.162  23.986  18.981  1.00  0.83           C  
ATOM   1081  N   GLU A  23      94.271  28.333  20.544  1.00  0.77           N  
ATOM   1082  CA  GLU A  23      93.190  28.531  21.471  1.00  0.77           C  
ATOM   1083  C   GLU A  23      91.918  28.426  20.666  1.00  0.77           C  
ATOM   1084  O   GLU A  23      91.965  28.143  19.470  1.00  0.77           O  
ATOM   1085  CB  GLU A  23      93.273  29.855  22.272  1.00  0.77           C  
ATOM   1086  CG  GLU A  23      93.192  31.161  21.448  1.00  0.77           C  
ATOM   1087  CD  GLU A  23      93.367  32.389  22.341  1.00  0.77           C  
ATOM   1088  OE1 GLU A  23      94.397  32.457  23.060  1.00  0.77           O  
ATOM   1089  OE2 GLU A  23      92.477  33.275  22.295  1.00  0.77           O  
ATOM   1090  N   LYS A  24      90.751  28.564  21.322  1.00  0.82           N  
ATOM   1091  CA  LYS A  24      89.446  28.441  20.698  1.00  0.82           C  
ATOM   1092  C   LYS A  24      89.185  29.429  19.563  1.00  0.82           C  
ATOM   1093  O   LYS A  24      89.520  30.607  19.648  1.00  0.82           O  
ATOM   1094  CB  LYS A  24      88.338  28.627  21.773  1.00  0.82           C  
ATOM   1095  CG  LYS A  24      86.911  28.478  21.222  1.00  0.82           C  
ATOM   1096  CD  LYS A  24      85.789  28.629  22.253  1.00  0.82           C  
ATOM   1097  CE  LYS A  24      84.400  28.335  21.666  1.00  0.82           C  
ATOM   1098  NZ  LYS A  24      84.096  29.224  20.519  1.00  0.82           N  
ATOM   1099  N   CYS A  25      88.517  28.987  18.479  1.00  0.87           N  
ATOM   1100  CA  CYS A  25      87.943  29.903  17.513  1.00  0.87           C  
ATOM   1101  C   CYS A  25      86.639  30.475  18.022  1.00  0.87           C  
ATOM   1102  O   CYS A  25      85.694  29.762  18.373  1.00  0.87           O  
ATOM   1103  CB  CYS A  25      87.782  29.253  16.122  1.00  0.87           C  
ATOM   1104  SG  CYS A  25      87.564  30.419  14.734  1.00  0.87           S  
ATOM   1105  N   ASP A  26      86.582  31.807  18.121  1.00  0.82           N  
ATOM   1106  CA  ASP A  26      85.436  32.512  18.607  1.00  0.82           C  
ATOM   1107  C   ASP A  26      85.118  33.585  17.584  1.00  0.82           C  
ATOM   1108  O   ASP A  26      85.772  34.619  17.484  1.00  0.82           O  
ATOM   1109  CB  ASP A  26      85.747  33.053  20.021  1.00  0.82           C  
ATOM   1110  CG  ASP A  26      84.459  33.368  20.759  1.00  0.82           C  
ATOM   1111  OD1 ASP A  26      83.425  32.735  20.397  1.00  0.82           O  
ATOM   1112  OD2 ASP A  26      84.511  34.144  21.740  1.00  0.82           O  
ATOM   1113  N   LEU A  27      84.104  33.330  16.734  1.00  0.77           N  
ATOM   1114  CA  LEU A  27      83.787  34.224  15.641  1.00  0.77           C  
ATOM   1115  C   LEU A  27      82.744  35.236  16.045  1.00  0.77           C  
ATOM   1116  O   LEU A  27      81.657  34.895  16.495  1.00  0.77           O  
ATOM   1117  CB  LEU A  27      83.289  33.460  14.392  1.00  0.77           C  
ATOM   1118  CG  LEU A  27      84.329  32.494  13.805  1.00  0.77           C  
ATOM   1119  CD1 LEU A  27      83.735  31.708  12.638  1.00  0.77           C  
ATOM   1120  CD2 LEU A  27      85.604  33.206  13.343  1.00  0.77           C  
ATOM   1121  N   GLN A  28      83.032  36.537  15.846  1.00  0.72           N  
ATOM   1122  CA  GLN A  28      82.090  37.602  16.151  1.00  0.72           C  
ATOM   1123  C   GLN A  28      80.789  37.516  15.369  1.00  0.72           C  
ATOM   1124  O   GLN A  28      79.706  37.733  15.900  1.00  0.72           O  
ATOM   1125  CB  GLN A  28      82.739  38.980  15.898  1.00  0.72           C  
ATOM   1126  CG  GLN A  28      81.833  40.153  16.340  1.00  0.72           C  
ATOM   1127  CD  GLN A  28      82.501  41.509  16.133  1.00  0.72           C  
ATOM   1128  OE1 GLN A  28      83.595  41.643  15.592  1.00  0.72           O  
ATOM   1129  NE2 GLN A  28      81.810  42.577  16.600  1.00  0.72           N  
ATOM   1130  N   ASN A  29      80.897  37.140  14.083  1.00  0.69           N  
ATOM   1131  CA  ASN A  29      79.786  37.033  13.162  1.00  0.69           C  
ATOM   1132  C   ASN A  29      79.311  35.585  13.105  1.00  0.69           C  
ATOM   1133  O   ASN A  29      78.819  35.113  12.090  1.00  0.69           O  
ATOM   1134  CB  ASN A  29      80.199  37.500  11.741  1.00  0.69           C  
ATOM   1135  CG  ASN A  29      80.709  38.941  11.727  1.00  0.69           C  
ATOM   1136  OD1 ASN A  29      80.782  39.672  12.711  1.00  0.69           O  
ATOM   1137  ND2 ASN A  29      81.166  39.380  10.526  1.00  0.69           N  
ATOM   1138  N   TYR A  30      79.507  34.809  14.194  1.00  0.69           N  
ATOM   1139  CA  TYR A  30      78.923  33.492  14.386  1.00  0.69           C  
ATOM   1140  C   TYR A  30      77.400  33.557  14.420  1.00  0.69           C  
ATOM   1141  O   TYR A  30      76.814  34.445  15.026  1.00  0.69           O  
ATOM   1142  CB  TYR A  30      79.462  32.885  15.707  1.00  0.69           C  
ATOM   1143  CG  TYR A  30      78.877  31.553  16.079  1.00  0.69           C  
ATOM   1144  CD1 TYR A  30      79.413  30.358  15.583  1.00  0.69           C  
ATOM   1145  CD2 TYR A  30      77.770  31.500  16.940  1.00  0.69           C  
ATOM   1146  CE1 TYR A  30      78.862  29.126  15.962  1.00  0.69           C  
ATOM   1147  CE2 TYR A  30      77.210  30.270  17.308  1.00  0.69           C  
ATOM   1148  CZ  TYR A  30      77.764  29.081  16.825  1.00  0.69           C  
ATOM   1149  OH  TYR A  30      77.225  27.836  17.202  1.00  0.69           O  
ATOM   1150  N   GLY A  31      76.711  32.589  13.782  1.00  0.69           N  
ATOM   1151  CA  GLY A  31      75.252  32.566  13.746  1.00  0.69           C  
ATOM   1152  C   GLY A  31      74.620  33.423  12.665  1.00  0.69           C  
ATOM   1153  O   GLY A  31      73.522  33.106  12.215  1.00  0.69           O  
ATOM   1154  N   ASP A  32      75.299  34.501  12.208  1.00  0.69           N  
ATOM   1155  CA  ASP A  32      74.958  35.271  11.018  1.00  0.69           C  
ATOM   1156  C   ASP A  32      74.884  34.433   9.753  1.00  0.69           C  
ATOM   1157  O   ASP A  32      75.556  33.415   9.588  1.00  0.69           O  
ATOM   1158  CB  ASP A  32      75.958  36.409  10.676  1.00  0.69           C  
ATOM   1159  CG  ASP A  32      75.907  37.613  11.596  1.00  0.69           C  
ATOM   1160  OD1 ASP A  32      75.082  37.630  12.538  1.00  0.69           O  
ATOM   1161  OD2 ASP A  32      76.695  38.554  11.307  1.00  0.69           O  
ATOM   1162  N   SER A  33      74.077  34.908   8.788  1.00  0.71           N  
ATOM   1163  CA  SER A  33      73.833  34.187   7.559  1.00  0.71           C  
ATOM   1164  C   SER A  33      73.755  35.165   6.424  1.00  0.71           C  
ATOM   1165  O   SER A  33      73.242  36.272   6.553  1.00  0.71           O  
ATOM   1166  CB  SER A  33      72.515  33.374   7.566  1.00  0.71           C  
ATOM   1167  OG  SER A  33      72.654  32.194   8.354  1.00  0.71           O  
ATOM   1168  N   ALA A  34      74.302  34.766   5.262  1.00  0.73           N  
ATOM   1169  CA  ALA A  34      74.214  35.529   4.040  1.00  0.73           C  
ATOM   1170  C   ALA A  34      72.871  35.328   3.356  1.00  0.73           C  
ATOM   1171  O   ALA A  34      72.170  34.345   3.589  1.00  0.73           O  
ATOM   1172  CB  ALA A  34      75.346  35.121   3.078  1.00  0.73           C  
ATOM   1173  N   THR A  35      72.475  36.261   2.469  1.00  0.75           N  
ATOM   1174  CA  THR A  35      71.198  36.169   1.764  1.00  0.75           C  
ATOM   1175  C   THR A  35      71.367  35.320   0.532  1.00  0.75           C  
ATOM   1176  O   THR A  35      71.762  35.809  -0.525  1.00  0.75           O  
ATOM   1177  CB  THR A  35      70.649  37.516   1.319  1.00  0.75           C  
ATOM   1178  OG1 THR A  35      70.526  38.379   2.438  1.00  0.75           O  
ATOM   1179  CG2 THR A  35      69.241  37.375   0.724  1.00  0.75           C  
ATOM   1180  N   LEU A  36      71.116  33.999   0.625  1.00  0.79           N  
ATOM   1181  CA  LEU A  36      71.262  33.110  -0.516  1.00  0.79           C  
ATOM   1182  C   LEU A  36      70.311  33.483  -1.658  1.00  0.79           C  
ATOM   1183  O   LEU A  36      69.154  33.813  -1.388  1.00  0.79           O  
ATOM   1184  CB  LEU A  36      71.099  31.616  -0.138  1.00  0.79           C  
ATOM   1185  CG  LEU A  36      72.212  31.054   0.775  1.00  0.79           C  
ATOM   1186  CD1 LEU A  36      71.876  29.612   1.188  1.00  0.79           C  
ATOM   1187  CD2 LEU A  36      73.597  31.085   0.109  1.00  0.79           C  
ATOM   1188  N   PRO A  37      70.706  33.492  -2.932  1.00  0.84           N  
ATOM   1189  CA  PRO A  37      69.777  33.635  -4.043  1.00  0.84           C  
ATOM   1190  C   PRO A  37      68.687  32.579  -4.038  1.00  0.84           C  
ATOM   1191  O   PRO A  37      68.909  31.460  -3.577  1.00  0.84           O  
ATOM   1192  CB  PRO A  37      70.657  33.571  -5.302  1.00  0.84           C  
ATOM   1193  CG  PRO A  37      72.072  33.882  -4.807  1.00  0.84           C  
ATOM   1194  CD  PRO A  37      72.078  33.313  -3.392  1.00  0.84           C  
ATOM   1195  N   LYS A  38      67.484  32.913  -4.532  1.00  0.74           N  
ATOM   1196  CA  LYS A  38      66.318  32.053  -4.448  1.00  0.74           C  
ATOM   1197  C   LYS A  38      66.500  30.635  -4.960  1.00  0.74           C  
ATOM   1198  O   LYS A  38      66.714  30.433  -6.143  1.00  0.74           O  
ATOM   1199  CB  LYS A  38      65.164  32.669  -5.267  1.00  0.74           C  
ATOM   1200  CG  LYS A  38      63.857  31.855  -5.230  1.00  0.74           C  
ATOM   1201  CD  LYS A  38      62.804  32.426  -6.188  1.00  0.74           C  
ATOM   1202  CE  LYS A  38      61.425  31.767  -6.085  1.00  0.74           C  
ATOM   1203  NZ  LYS A  38      61.513  30.325  -6.407  1.00  0.74           N  
ATOM   1204  N   GLY A  39      66.352  29.599  -4.100  1.00  0.76           N  
ATOM   1205  CA  GLY A  39      66.484  28.199  -4.502  1.00  0.76           C  
ATOM   1206  C   GLY A  39      67.900  27.706  -4.642  1.00  0.76           C  
ATOM   1207  O   GLY A  39      68.114  26.591  -5.103  1.00  0.76           O  
ATOM   1208  N   ILE A  40      68.906  28.517  -4.276  1.00  0.77           N  
ATOM   1209  CA  ILE A  40      70.301  28.122  -4.371  1.00  0.77           C  
ATOM   1210  C   ILE A  40      70.737  27.492  -3.068  1.00  0.77           C  
ATOM   1211  O   ILE A  40      70.623  28.053  -1.981  1.00  0.77           O  
ATOM   1212  CB  ILE A  40      71.204  29.285  -4.762  1.00  0.77           C  
ATOM   1213  CG1 ILE A  40      70.825  29.820  -6.164  1.00  0.77           C  
ATOM   1214  CG2 ILE A  40      72.704  28.922  -4.700  1.00  0.77           C  
ATOM   1215  CD1 ILE A  40      70.997  28.831  -7.323  1.00  0.77           C  
ATOM   1216  N   MET A  41      71.240  26.249  -3.155  1.00  0.76           N  
ATOM   1217  CA  MET A  41      71.824  25.547  -2.038  1.00  0.76           C  
ATOM   1218  C   MET A  41      73.089  26.221  -1.509  1.00  0.76           C  
ATOM   1219  O   MET A  41      73.881  26.774  -2.271  1.00  0.76           O  
ATOM   1220  CB  MET A  41      72.199  24.101  -2.441  1.00  0.76           C  
ATOM   1221  CG  MET A  41      71.036  23.227  -2.945  1.00  0.76           C  
ATOM   1222  SD  MET A  41      71.621  21.600  -3.503  1.00  0.76           S  
ATOM   1223  CE  MET A  41      69.999  20.911  -3.916  1.00  0.76           C  
ATOM   1224  N   MET A  42      73.362  26.122  -0.187  1.00  0.79           N  
ATOM   1225  CA  MET A  42      74.579  26.659   0.417  1.00  0.79           C  
ATOM   1226  C   MET A  42      75.855  26.150  -0.234  1.00  0.79           C  
ATOM   1227  O   MET A  42      76.775  26.906  -0.521  1.00  0.79           O  
ATOM   1228  CB  MET A  42      74.639  26.302   1.928  1.00  0.79           C  
ATOM   1229  CG  MET A  42      75.974  26.627   2.644  1.00  0.79           C  
ATOM   1230  SD  MET A  42      76.523  28.358   2.511  1.00  0.79           S  
ATOM   1231  CE  MET A  42      75.326  29.014   3.703  1.00  0.79           C  
ATOM   1232  N   ASN A  43      75.929  24.839  -0.531  1.00  0.82           N  
ATOM   1233  CA  ASN A  43      77.109  24.278  -1.159  1.00  0.82           C  
ATOM   1234  C   ASN A  43      77.277  24.674  -2.626  1.00  0.82           C  
ATOM   1235  O   ASN A  43      78.400  24.764  -3.103  1.00  0.82           O  
ATOM   1236  CB  ASN A  43      77.178  22.750  -0.945  1.00  0.82           C  
ATOM   1237  CG  ASN A  43      77.474  22.463   0.529  1.00  0.82           C  
ATOM   1238  OD1 ASN A  43      78.046  23.272   1.262  1.00  0.82           O  
ATOM   1239  ND2 ASN A  43      77.076  21.255   0.996  1.00  0.82           N  
ATOM   1240  N   VAL A  44      76.197  25.001  -3.376  1.00  0.83           N  
ATOM   1241  CA  VAL A  44      76.352  25.635  -4.690  1.00  0.83           C  
ATOM   1242  C   VAL A  44      76.987  27.007  -4.539  1.00  0.83           C  
ATOM   1243  O   VAL A  44      77.971  27.335  -5.192  1.00  0.83           O  
ATOM   1244  CB  VAL A  44      75.036  25.752  -5.461  1.00  0.83           C  
ATOM   1245  CG1 VAL A  44      75.155  26.657  -6.708  1.00  0.83           C  
ATOM   1246  CG2 VAL A  44      74.599  24.351  -5.914  1.00  0.83           C  
ATOM   1247  N   ALA A  45      76.487  27.818  -3.587  1.00  0.87           N  
ATOM   1248  CA  ALA A  45      77.036  29.126  -3.305  1.00  0.87           C  
ATOM   1249  C   ALA A  45      78.491  29.121  -2.841  1.00  0.87           C  
ATOM   1250  O   ALA A  45      79.320  29.896  -3.317  1.00  0.87           O  
ATOM   1251  CB  ALA A  45      76.158  29.794  -2.236  1.00  0.87           C  
ATOM   1252  N   LYS A  46      78.839  28.208  -1.916  1.00  0.86           N  
ATOM   1253  CA  LYS A  46      80.181  28.028  -1.399  1.00  0.86           C  
ATOM   1254  C   LYS A  46      81.214  27.594  -2.429  1.00  0.86           C  
ATOM   1255  O   LYS A  46      82.302  28.164  -2.513  1.00  0.86           O  
ATOM   1256  CB  LYS A  46      80.125  26.968  -0.279  1.00  0.86           C  
ATOM   1257  CG  LYS A  46      81.460  26.681   0.420  1.00  0.86           C  
ATOM   1258  CD  LYS A  46      81.392  25.463   1.348  1.00  0.86           C  
ATOM   1259  CE  LYS A  46      80.334  25.591   2.438  1.00  0.86           C  
ATOM   1260  NZ  LYS A  46      80.500  24.471   3.375  1.00  0.86           N  
ATOM   1261  N   TYR A  47      80.890  26.582  -3.263  1.00  0.89           N  
ATOM   1262  CA  TYR A  47      81.751  26.141  -4.350  1.00  0.89           C  
ATOM   1263  C   TYR A  47      81.910  27.204  -5.406  1.00  0.89           C  
ATOM   1264  O   TYR A  47      83.003  27.415  -5.925  1.00  0.89           O  
ATOM   1265  CB  TYR A  47      81.251  24.853  -5.026  1.00  0.89           C  
ATOM   1266  CG  TYR A  47      81.725  23.656  -4.270  1.00  0.89           C  
ATOM   1267  CD1 TYR A  47      81.201  23.316  -3.015  1.00  0.89           C  
ATOM   1268  CD2 TYR A  47      82.693  22.823  -4.851  1.00  0.89           C  
ATOM   1269  CE1 TYR A  47      81.562  22.124  -2.391  1.00  0.89           C  
ATOM   1270  CE2 TYR A  47      83.086  21.643  -4.217  1.00  0.89           C  
ATOM   1271  CZ  TYR A  47      82.503  21.294  -2.998  1.00  0.89           C  
ATOM   1272  OH  TYR A  47      82.869  20.109  -2.372  1.00  0.89           O  
ATOM   1273  N   THR A  48      80.825  27.931  -5.733  1.00  0.89           N  
ATOM   1274  CA  THR A  48      80.884  29.040  -6.683  1.00  0.89           C  
ATOM   1275  C   THR A  48      81.836  30.122  -6.226  1.00  0.89           C  
ATOM   1276  O   THR A  48      82.690  30.566  -6.985  1.00  0.89           O  
ATOM   1277  CB  THR A  48      79.515  29.634  -6.976  1.00  0.89           C  
ATOM   1278  OG1 THR A  48      78.734  28.686  -7.686  1.00  0.89           O  
ATOM   1279  CG2 THR A  48      79.562  30.872  -7.880  1.00  0.89           C  
ATOM   1280  N   GLN A  49      81.794  30.527  -4.943  1.00  0.88           N  
ATOM   1281  CA  GLN A  49      82.779  31.446  -4.400  1.00  0.88           C  
ATOM   1282  C   GLN A  49      84.201  30.925  -4.347  1.00  0.88           C  
ATOM   1283  O   GLN A  49      85.149  31.655  -4.631  1.00  0.88           O  
ATOM   1284  CB  GLN A  49      82.357  31.966  -3.023  1.00  0.88           C  
ATOM   1285  CG  GLN A  49      81.189  32.954  -3.188  1.00  0.88           C  
ATOM   1286  CD  GLN A  49      80.795  33.626  -1.880  1.00  0.88           C  
ATOM   1287  OE1 GLN A  49      81.019  33.112  -0.787  1.00  0.88           O  
ATOM   1288  NE2 GLN A  49      80.157  34.817  -1.982  1.00  0.88           N  
ATOM   1289  N   LEU A  50      84.404  29.638  -4.012  1.00  0.92           N  
ATOM   1290  CA  LEU A  50      85.720  29.024  -4.087  1.00  0.92           C  
ATOM   1291  C   LEU A  50      86.310  29.077  -5.491  1.00  0.92           C  
ATOM   1292  O   LEU A  50      87.427  29.539  -5.692  1.00  0.92           O  
ATOM   1293  CB  LEU A  50      85.633  27.551  -3.620  1.00  0.92           C  
ATOM   1294  CG  LEU A  50      86.930  26.722  -3.742  1.00  0.92           C  
ATOM   1295  CD1 LEU A  50      88.088  27.326  -2.935  1.00  0.92           C  
ATOM   1296  CD2 LEU A  50      86.674  25.264  -3.333  1.00  0.92           C  
ATOM   1297  N   CYS A  51      85.528  28.681  -6.509  1.00  0.93           N  
ATOM   1298  CA  CYS A  51      85.918  28.735  -7.905  1.00  0.93           C  
ATOM   1299  C   CYS A  51      86.159  30.149  -8.436  1.00  0.93           C  
ATOM   1300  O   CYS A  51      87.106  30.396  -9.178  1.00  0.93           O  
ATOM   1301  CB  CYS A  51      84.875  27.985  -8.754  1.00  0.93           C  
ATOM   1302  SG  CYS A  51      84.827  26.202  -8.390  1.00  0.93           S  
ATOM   1303  N   GLN A  52      85.346  31.141  -8.015  1.00  0.87           N  
ATOM   1304  CA  GLN A  52      85.588  32.551  -8.292  1.00  0.87           C  
ATOM   1305  C   GLN A  52      86.916  33.069  -7.750  1.00  0.87           C  
ATOM   1306  O   GLN A  52      87.596  33.857  -8.401  1.00  0.87           O  
ATOM   1307  CB  GLN A  52      84.460  33.434  -7.706  1.00  0.87           C  
ATOM   1308  CG  GLN A  52      83.127  33.380  -8.484  1.00  0.87           C  
ATOM   1309  CD  GLN A  52      82.032  34.200  -7.790  1.00  0.87           C  
ATOM   1310  OE1 GLN A  52      81.996  34.371  -6.568  1.00  0.87           O  
ATOM   1311  NE2 GLN A  52      81.097  34.745  -8.601  1.00  0.87           N  
ATOM   1312  N   TYR A  53      87.319  32.645  -6.538  1.00  0.90           N  
ATOM   1313  CA  TYR A  53      88.653  32.887  -6.029  1.00  0.90           C  
ATOM   1314  C   TYR A  53      89.745  32.110  -6.770  1.00  0.90           C  
ATOM   1315  O   TYR A  53      90.788  32.657  -7.098  1.00  0.90           O  
ATOM   1316  CB  TYR A  53      88.672  32.615  -4.514  1.00  0.90           C  
ATOM   1317  CG  TYR A  53      90.009  32.927  -3.922  1.00  0.90           C  
ATOM   1318  CD1 TYR A  53      90.446  34.254  -3.808  1.00  0.90           C  
ATOM   1319  CD2 TYR A  53      90.865  31.884  -3.544  1.00  0.90           C  
ATOM   1320  CE1 TYR A  53      91.718  34.535  -3.299  1.00  0.90           C  
ATOM   1321  CE2 TYR A  53      92.139  32.164  -3.040  1.00  0.90           C  
ATOM   1322  CZ  TYR A  53      92.554  33.491  -2.913  1.00  0.90           C  
ATOM   1323  OH  TYR A  53      93.822  33.783  -2.405  1.00  0.90           O  
ATOM   1324  N   LEU A  54      89.548  30.821  -7.096  1.00  0.90           N  
ATOM   1325  CA  LEU A  54      90.549  30.045  -7.820  1.00  0.90           C  
ATOM   1326  C   LEU A  54      90.893  30.581  -9.212  1.00  0.90           C  
ATOM   1327  O   LEU A  54      92.015  30.419  -9.685  1.00  0.90           O  
ATOM   1328  CB  LEU A  54      90.138  28.565  -7.941  1.00  0.90           C  
ATOM   1329  CG  LEU A  54      90.089  27.769  -6.621  1.00  0.90           C  
ATOM   1330  CD1 LEU A  54      89.490  26.379  -6.878  1.00  0.90           C  
ATOM   1331  CD2 LEU A  54      91.459  27.654  -5.936  1.00  0.90           C  
ATOM   1332  N   ASN A  55      89.943  31.280  -9.868  1.00  0.85           N  
ATOM   1333  CA  ASN A  55      90.153  32.050 -11.087  1.00  0.85           C  
ATOM   1334  C   ASN A  55      91.205  33.154 -10.984  1.00  0.85           C  
ATOM   1335  O   ASN A  55      91.761  33.573 -11.996  1.00  0.85           O  
ATOM   1336  CB  ASN A  55      88.845  32.754 -11.528  1.00  0.85           C  
ATOM   1337  CG  ASN A  55      87.864  31.769 -12.143  1.00  0.85           C  
ATOM   1338  OD1 ASN A  55      88.234  30.697 -12.617  1.00  0.85           O  
ATOM   1339  ND2 ASN A  55      86.573  32.174 -12.211  1.00  0.85           N  
ATOM   1340  N   THR A  56      91.492  33.674  -9.770  1.00  0.86           N  
ATOM   1341  CA  THR A  56      92.435  34.773  -9.582  1.00  0.86           C  
ATOM   1342  C   THR A  56      93.851  34.261  -9.411  1.00  0.86           C  
ATOM   1343  O   THR A  56      94.810  35.031  -9.388  1.00  0.86           O  
ATOM   1344  CB  THR A  56      92.102  35.690  -8.394  1.00  0.86           C  
ATOM   1345  OG1 THR A  56      92.286  35.078  -7.127  1.00  0.86           O  
ATOM   1346  CG2 THR A  56      90.626  36.104  -8.450  1.00  0.86           C  
ATOM   1347  N   LEU A  57      94.012  32.928  -9.309  1.00  0.86           N  
ATOM   1348  CA  LEU A  57      95.276  32.286  -9.038  1.00  0.86           C  
ATOM   1349  C   LEU A  57      95.913  31.732 -10.291  1.00  0.86           C  
ATOM   1350  O   LEU A  57      95.305  31.572 -11.347  1.00  0.86           O  
ATOM   1351  CB  LEU A  57      95.140  31.138  -8.009  1.00  0.86           C  
ATOM   1352  CG  LEU A  57      94.455  31.530  -6.686  1.00  0.86           C  
ATOM   1353  CD1 LEU A  57      94.399  30.310  -5.758  1.00  0.86           C  
ATOM   1354  CD2 LEU A  57      95.128  32.717  -5.980  1.00  0.86           C  
ATOM   1355  N   THR A  58      97.207  31.384 -10.202  1.00  0.89           N  
ATOM   1356  CA  THR A  58      97.989  30.887 -11.314  1.00  0.89           C  
ATOM   1357  C   THR A  58      97.797  29.399 -11.537  1.00  0.89           C  
ATOM   1358  O   THR A  58      98.743  28.647 -11.755  1.00  0.89           O  
ATOM   1359  CB  THR A  58      99.471  31.200 -11.126  1.00  0.89           C  
ATOM   1360  OG1 THR A  58      99.920  30.818  -9.836  1.00  0.89           O  
ATOM   1361  CG2 THR A  58      99.661  32.724 -11.209  1.00  0.89           C  
ATOM   1362  N   LEU A  59      96.535  28.909 -11.543  1.00  0.90           N  
ATOM   1363  CA  LEU A  59      96.236  27.516 -11.822  1.00  0.90           C  
ATOM   1364  C   LEU A  59      96.727  27.082 -13.192  1.00  0.90           C  
ATOM   1365  O   LEU A  59      96.583  27.779 -14.200  1.00  0.90           O  
ATOM   1366  CB  LEU A  59      94.729  27.154 -11.719  1.00  0.90           C  
ATOM   1367  CG  LEU A  59      94.069  27.273 -10.329  1.00  0.90           C  
ATOM   1368  CD1 LEU A  59      92.704  26.574 -10.364  1.00  0.90           C  
ATOM   1369  CD2 LEU A  59      94.903  26.648  -9.209  1.00  0.90           C  
ATOM   1370  N   ALA A  60      97.341  25.892 -13.258  1.00  0.92           N  
ATOM   1371  CA  ALA A  60      97.615  25.238 -14.505  1.00  0.92           C  
ATOM   1372  C   ALA A  60      96.333  24.620 -15.044  1.00  0.92           C  
ATOM   1373  O   ALA A  60      95.619  23.921 -14.332  1.00  0.92           O  
ATOM   1374  CB  ALA A  60      98.687  24.167 -14.295  1.00  0.92           C  
ATOM   1375  N   VAL A  61      95.996  24.895 -16.316  1.00  0.95           N  
ATOM   1376  CA  VAL A  61      94.777  24.416 -16.937  1.00  0.95           C  
ATOM   1377  C   VAL A  61      95.182  23.779 -18.262  1.00  0.95           C  
ATOM   1378  O   VAL A  61      95.092  24.428 -19.310  1.00  0.95           O  
ATOM   1379  CB  VAL A  61      93.785  25.552 -17.167  1.00  0.95           C  
ATOM   1380  CG1 VAL A  61      92.443  24.989 -17.665  1.00  0.95           C  
ATOM   1381  CG2 VAL A  61      93.558  26.323 -15.853  1.00  0.95           C  
ATOM   1382  N   PRO A  62      95.711  22.555 -18.289  1.00  0.93           N  
ATOM   1383  CA  PRO A  62      96.016  21.864 -19.533  1.00  0.93           C  
ATOM   1384  C   PRO A  62      94.773  21.478 -20.316  1.00  0.93           C  
ATOM   1385  O   PRO A  62      93.667  21.454 -19.778  1.00  0.93           O  
ATOM   1386  CB  PRO A  62      96.840  20.652 -19.076  1.00  0.93           C  
ATOM   1387  CG  PRO A  62      96.368  20.342 -17.656  1.00  0.93           C  
ATOM   1388  CD  PRO A  62      95.947  21.707 -17.111  1.00  0.93           C  
ATOM   1389  N   TYR A  63      94.922  21.171 -21.622  1.00  0.88           N  
ATOM   1390  CA  TYR A  63      93.938  20.383 -22.351  1.00  0.88           C  
ATOM   1391  C   TYR A  63      93.937  18.976 -21.777  1.00  0.88           C  
ATOM   1392  O   TYR A  63      94.998  18.463 -21.430  1.00  0.88           O  
ATOM   1393  CB  TYR A  63      94.258  20.246 -23.858  1.00  0.88           C  
ATOM   1394  CG  TYR A  63      94.523  21.566 -24.511  1.00  0.88           C  
ATOM   1395  CD1 TYR A  63      93.468  22.436 -24.808  1.00  0.88           C  
ATOM   1396  CD2 TYR A  63      95.830  21.933 -24.872  1.00  0.88           C  
ATOM   1397  CE1 TYR A  63      93.709  23.649 -25.466  1.00  0.88           C  
ATOM   1398  CE2 TYR A  63      96.074  23.145 -25.533  1.00  0.88           C  
ATOM   1399  CZ  TYR A  63      95.008  23.998 -25.837  1.00  0.88           C  
ATOM   1400  OH  TYR A  63      95.232  25.212 -26.510  1.00  0.88           O  
ATOM   1401  N   ASN A  64      92.765  18.323 -21.656  1.00  0.90           N  
ATOM   1402  CA  ASN A  64      92.636  17.021 -21.007  1.00  0.90           C  
ATOM   1403  C   ASN A  64      93.006  17.054 -19.524  1.00  0.90           C  
ATOM   1404  O   ASN A  64      93.649  16.145 -18.994  1.00  0.90           O  
ATOM   1405  CB  ASN A  64      93.432  15.890 -21.710  1.00  0.90           C  
ATOM   1406  CG  ASN A  64      93.136  15.886 -23.200  1.00  0.90           C  
ATOM   1407  OD1 ASN A  64      91.987  15.920 -23.630  1.00  0.90           O  
ATOM   1408  ND2 ASN A  64      94.205  15.843 -24.032  1.00  0.90           N  
ATOM   1409  N   MET A  65      92.599  18.137 -18.832  1.00  0.93           N  
ATOM   1410  CA  MET A  65      92.823  18.355 -17.417  1.00  0.93           C  
ATOM   1411  C   MET A  65      92.170  17.291 -16.563  1.00  0.93           C  
ATOM   1412  O   MET A  65      91.093  16.788 -16.877  1.00  0.93           O  
ATOM   1413  CB  MET A  65      92.310  19.768 -17.037  1.00  0.93           C  
ATOM   1414  CG  MET A  65      92.546  20.259 -15.593  1.00  0.93           C  
ATOM   1415  SD  MET A  65      91.861  21.924 -15.303  1.00  0.93           S  
ATOM   1416  CE  MET A  65      92.447  22.127 -13.596  1.00  0.93           C  
ATOM   1417  N   ARG A  66      92.825  16.895 -15.464  1.00  0.91           N  
ATOM   1418  CA  ARG A  66      92.317  15.854 -14.607  1.00  0.91           C  
ATOM   1419  C   ARG A  66      92.025  16.381 -13.222  1.00  0.91           C  
ATOM   1420  O   ARG A  66      92.921  16.810 -12.492  1.00  0.91           O  
ATOM   1421  CB  ARG A  66      93.378  14.756 -14.478  1.00  0.91           C  
ATOM   1422  CG  ARG A  66      93.805  14.111 -15.805  1.00  0.91           C  
ATOM   1423  CD  ARG A  66      95.010  13.231 -15.531  1.00  0.91           C  
ATOM   1424  NE  ARG A  66      95.385  12.558 -16.800  1.00  0.91           N  
ATOM   1425  CZ  ARG A  66      96.387  11.678 -16.860  1.00  0.91           C  
ATOM   1426  NH1 ARG A  66      97.139  11.412 -15.795  1.00  0.91           N  
ATOM   1427  NH2 ARG A  66      96.629  11.046 -18.005  1.00  0.91           N  
ATOM   1428  N   VAL A  67      90.747  16.332 -12.811  1.00  1.00           N  
ATOM   1429  CA  VAL A  67      90.310  16.854 -11.533  1.00  1.00           C  
ATOM   1430  C   VAL A  67      89.678  15.744 -10.716  1.00  1.00           C  
ATOM   1431  O   VAL A  67      88.849  14.979 -11.208  1.00  1.00           O  
ATOM   1432  CB  VAL A  67      89.317  17.992 -11.718  1.00  1.00           C  
ATOM   1433  CG1 VAL A  67      88.929  18.598 -10.355  1.00  1.00           C  
ATOM   1434  CG2 VAL A  67      89.953  19.058 -12.630  1.00  1.00           C  
ATOM   1435  N   ILE A  68      90.066  15.619  -9.431  1.00  0.99           N  
ATOM   1436  CA  ILE A  68      89.455  14.662  -8.523  1.00  0.99           C  
ATOM   1437  C   ILE A  68      88.844  15.389  -7.347  1.00  0.99           C  
ATOM   1438  O   ILE A  68      89.432  16.297  -6.761  1.00  0.99           O  
ATOM   1439  CB  ILE A  68      90.385  13.530  -8.093  1.00  0.99           C  
ATOM   1440  CG1 ILE A  68      89.639  12.431  -7.294  1.00  0.99           C  
ATOM   1441  CG2 ILE A  68      91.626  14.079  -7.359  1.00  0.99           C  
ATOM   1442  CD1 ILE A  68      90.415  11.112  -7.221  1.00  0.99           C  
ATOM   1443  N   HIS A  69      87.592  15.034  -7.007  1.00  0.97           N  
ATOM   1444  CA  HIS A  69      86.835  15.719  -5.985  1.00  0.97           C  
ATOM   1445  C   HIS A  69      86.400  14.767  -4.872  1.00  0.97           C  
ATOM   1446  O   HIS A  69      85.564  13.890  -5.052  1.00  0.97           O  
ATOM   1447  CB  HIS A  69      85.638  16.403  -6.658  1.00  0.97           C  
ATOM   1448  CG  HIS A  69      84.798  17.209  -5.756  1.00  0.97           C  
ATOM   1449  ND1 HIS A  69      83.496  17.393  -6.159  1.00  0.97           N  
ATOM   1450  CD2 HIS A  69      84.959  17.589  -4.468  1.00  0.97           C  
ATOM   1451  CE1 HIS A  69      82.872  17.859  -5.108  1.00  0.97           C  
ATOM   1452  NE2 HIS A  69      83.712  17.997  -4.052  1.00  0.97           N  
ATOM   1453  N   PHE A  70      86.970  14.920  -3.662  1.00  0.98           N  
ATOM   1454  CA  PHE A  70      86.677  14.078  -2.514  1.00  0.98           C  
ATOM   1455  C   PHE A  70      85.661  14.740  -1.596  1.00  0.98           C  
ATOM   1456  O   PHE A  70      85.681  15.952  -1.389  1.00  0.98           O  
ATOM   1457  CB  PHE A  70      87.945  13.799  -1.672  1.00  0.98           C  
ATOM   1458  CG  PHE A  70      88.967  12.993  -2.417  1.00  0.98           C  
ATOM   1459  CD1 PHE A  70      88.853  11.595  -2.477  1.00  0.98           C  
ATOM   1460  CD2 PHE A  70      90.083  13.609  -3.007  1.00  0.98           C  
ATOM   1461  CE1 PHE A  70      89.832  10.826  -3.119  1.00  0.98           C  
ATOM   1462  CE2 PHE A  70      91.066  12.841  -3.644  1.00  0.98           C  
ATOM   1463  CZ  PHE A  70      90.939  11.450  -3.704  1.00  0.98           C  
ATOM   1464  N   GLY A  71      84.736  13.955  -1.000  1.00  1.00           N  
ATOM   1465  CA  GLY A  71      83.683  14.503  -0.145  1.00  1.00           C  
ATOM   1466  C   GLY A  71      82.626  15.187  -0.952  1.00  1.00           C  
ATOM   1467  O   GLY A  71      82.177  16.275  -0.619  1.00  1.00           O  
ATOM   1468  N   ALA A  72      82.254  14.581  -2.089  1.00  1.00           N  
ATOM   1469  CA  ALA A  72      81.370  15.214  -3.034  1.00  1.00           C  
ATOM   1470  C   ALA A  72      79.907  14.866  -2.827  1.00  1.00           C  
ATOM   1471  O   ALA A  72      79.024  15.449  -3.458  1.00  1.00           O  
ATOM   1472  CB  ALA A  72      81.793  14.750  -4.430  1.00  1.00           C  
ATOM   1473  N   GLY A  73      79.620  13.915  -1.917  1.00  0.98           N  
ATOM   1474  CA  GLY A  73      78.269  13.487  -1.611  1.00  0.98           C  
ATOM   1475  C   GLY A  73      77.606  14.401  -0.629  1.00  0.98           C  
ATOM   1476  O   GLY A  73      78.157  15.391  -0.158  1.00  0.98           O  
ATOM   1477  N   SER A  74      76.362  14.078  -0.264  1.00  0.93           N  
ATOM   1478  CA  SER A  74      75.655  14.848   0.731  1.00  0.93           C  
ATOM   1479  C   SER A  74      74.541  13.990   1.262  1.00  0.93           C  
ATOM   1480  O   SER A  74      74.237  12.936   0.706  1.00  0.93           O  
ATOM   1481  CB  SER A  74      75.097  16.204   0.203  1.00  0.93           C  
ATOM   1482  OG  SER A  74      74.004  16.057  -0.704  1.00  0.93           O  
ATOM   1483  N   ASP A  75      73.867  14.433   2.338  1.00  0.88           N  
ATOM   1484  CA  ASP A  75      72.682  13.799   2.878  1.00  0.88           C  
ATOM   1485  C   ASP A  75      71.464  13.916   1.954  1.00  0.88           C  
ATOM   1486  O   ASP A  75      70.495  13.170   2.062  1.00  0.88           O  
ATOM   1487  CB  ASP A  75      72.395  14.381   4.291  1.00  0.88           C  
ATOM   1488  CG  ASP A  75      72.239  15.901   4.345  1.00  0.88           C  
ATOM   1489  OD1 ASP A  75      72.395  16.587   3.295  1.00  0.88           O  
ATOM   1490  OD2 ASP A  75      71.988  16.398   5.469  1.00  0.88           O  
ATOM   1491  N   LYS A  76      71.529  14.830   0.965  1.00  0.86           N  
ATOM   1492  CA  LYS A  76      70.532  14.998  -0.068  1.00  0.86           C  
ATOM   1493  C   LYS A  76      70.606  13.936  -1.159  1.00  0.86           C  
ATOM   1494  O   LYS A  76      69.678  13.790  -1.955  1.00  0.86           O  
ATOM   1495  CB  LYS A  76      70.708  16.361  -0.781  1.00  0.86           C  
ATOM   1496  CG  LYS A  76      70.724  17.588   0.139  1.00  0.86           C  
ATOM   1497  CD  LYS A  76      70.994  18.873  -0.664  1.00  0.86           C  
ATOM   1498  CE  LYS A  76      71.221  20.117   0.193  1.00  0.86           C  
ATOM   1499  NZ  LYS A  76      70.023  20.353   1.019  1.00  0.86           N  
ATOM   1500  N   GLY A  77      71.730  13.188  -1.247  1.00  0.87           N  
ATOM   1501  CA  GLY A  77      71.923  12.159  -2.265  1.00  0.87           C  
ATOM   1502  C   GLY A  77      72.346  12.671  -3.619  1.00  0.87           C  
ATOM   1503  O   GLY A  77      72.316  11.940  -4.603  1.00  0.87           O  
ATOM   1504  N   VAL A  78      72.748  13.949  -3.706  1.00  0.85           N  
ATOM   1505  CA  VAL A  78      73.152  14.616  -4.936  1.00  0.85           C  
ATOM   1506  C   VAL A  78      74.482  15.283  -4.677  1.00  0.85           C  
ATOM   1507  O   VAL A  78      74.940  15.336  -3.540  1.00  0.85           O  
ATOM   1508  CB  VAL A  78      72.146  15.650  -5.460  1.00  0.85           C  
ATOM   1509  CG1 VAL A  78      70.858  14.924  -5.887  1.00  0.85           C  
ATOM   1510  CG2 VAL A  78      71.836  16.739  -4.414  1.00  0.85           C  
ATOM   1511  N   ALA A  79      75.144  15.821  -5.721  1.00  0.89           N  
ATOM   1512  CA  ALA A  79      76.458  16.418  -5.588  1.00  0.89           C  
ATOM   1513  C   ALA A  79      76.481  17.885  -6.025  1.00  0.89           C  
ATOM   1514  O   ALA A  79      76.850  18.186  -7.163  1.00  0.89           O  
ATOM   1515  CB  ALA A  79      77.451  15.602  -6.423  1.00  0.89           C  
ATOM   1516  N   PRO A  80      76.111  18.856  -5.179  1.00  0.90           N  
ATOM   1517  CA  PRO A  80      76.062  20.268  -5.552  1.00  0.90           C  
ATOM   1518  C   PRO A  80      77.399  20.842  -5.944  1.00  0.90           C  
ATOM   1519  O   PRO A  80      77.476  21.605  -6.903  1.00  0.90           O  
ATOM   1520  CB  PRO A  80      75.527  20.988  -4.302  1.00  0.90           C  
ATOM   1521  CG  PRO A  80      74.823  19.899  -3.495  1.00  0.90           C  
ATOM   1522  CD  PRO A  80      75.606  18.633  -3.827  1.00  0.90           C  
ATOM   1523  N   GLY A  81      78.467  20.481  -5.207  1.00  0.95           N  
ATOM   1524  CA  GLY A  81      79.813  20.960  -5.473  1.00  0.95           C  
ATOM   1525  C   GLY A  81      80.402  20.440  -6.756  1.00  0.95           C  
ATOM   1526  O   GLY A  81      81.048  21.179  -7.488  1.00  0.95           O  
ATOM   1527  N   THR A  82      80.127  19.163  -7.097  1.00  0.94           N  
ATOM   1528  CA  THR A  82      80.497  18.550  -8.378  1.00  0.94           C  
ATOM   1529  C   THR A  82      79.856  19.239  -9.554  1.00  0.94           C  
ATOM   1530  O   THR A  82      80.503  19.521 -10.562  1.00  0.94           O  
ATOM   1531  CB  THR A  82      80.100  17.088  -8.467  1.00  0.94           C  
ATOM   1532  OG1 THR A  82      80.795  16.378  -7.468  1.00  0.94           O  
ATOM   1533  CG2 THR A  82      80.472  16.449  -9.810  1.00  0.94           C  
ATOM   1534  N   ALA A  83      78.554  19.578  -9.440  1.00  0.94           N  
ATOM   1535  CA  ALA A  83      77.839  20.338 -10.446  1.00  0.94           C  
ATOM   1536  C   ALA A  83      78.429  21.731 -10.684  1.00  0.94           C  
ATOM   1537  O   ALA A  83      78.533  22.189 -11.818  1.00  0.94           O  
ATOM   1538  CB  ALA A  83      76.345  20.434 -10.086  1.00  0.94           C  
ATOM   1539  N   VAL A  84      78.863  22.440  -9.621  1.00  0.94           N  
ATOM   1540  CA  VAL A  84      79.603  23.693  -9.757  1.00  0.94           C  
ATOM   1541  C   VAL A  84      80.970  23.518 -10.401  1.00  0.94           C  
ATOM   1542  O   VAL A  84      81.362  24.280 -11.284  1.00  0.94           O  
ATOM   1543  CB  VAL A  84      79.780  24.403  -8.428  1.00  0.94           C  
ATOM   1544  CG1 VAL A  84      80.593  25.699  -8.608  1.00  0.94           C  
ATOM   1545  CG2 VAL A  84      78.398  24.774  -7.872  1.00  0.94           C  
ATOM   1546  N   LEU A  85      81.743  22.486 -10.003  1.00  0.94           N  
ATOM   1547  CA  LEU A  85      83.046  22.213 -10.591  1.00  0.94           C  
ATOM   1548  C   LEU A  85      82.973  21.905 -12.072  1.00  0.94           C  
ATOM   1549  O   LEU A  85      83.754  22.421 -12.859  1.00  0.94           O  
ATOM   1550  CB  LEU A  85      83.776  21.039  -9.899  1.00  0.94           C  
ATOM   1551  CG  LEU A  85      84.224  21.304  -8.450  1.00  0.94           C  
ATOM   1552  CD1 LEU A  85      84.803  20.019  -7.850  1.00  0.94           C  
ATOM   1553  CD2 LEU A  85      85.233  22.452  -8.339  1.00  0.94           C  
ATOM   1554  N   ARG A  86      81.998  21.090 -12.502  1.00  0.86           N  
ATOM   1555  CA  ARG A  86      81.756  20.819 -13.904  1.00  0.86           C  
ATOM   1556  C   ARG A  86      81.325  22.035 -14.721  1.00  0.86           C  
ATOM   1557  O   ARG A  86      81.684  22.157 -15.885  1.00  0.86           O  
ATOM   1558  CB  ARG A  86      80.778  19.633 -14.021  1.00  0.86           C  
ATOM   1559  CG  ARG A  86      80.316  19.304 -15.456  1.00  0.86           C  
ATOM   1560  CD  ARG A  86      80.125  17.819 -15.734  1.00  0.86           C  
ATOM   1561  NE  ARG A  86      81.520  17.301 -15.687  1.00  0.86           N  
ATOM   1562  CZ  ARG A  86      81.943  16.161 -16.233  1.00  0.86           C  
ATOM   1563  NH1 ARG A  86      81.124  15.228 -16.689  1.00  0.86           N  
ATOM   1564  NH2 ARG A  86      83.249  15.942 -16.335  1.00  0.86           N  
ATOM   1565  N   GLN A  87      80.571  22.979 -14.123  1.00  0.85           N  
ATOM   1566  CA  GLN A  87      80.249  24.255 -14.738  1.00  0.85           C  
ATOM   1567  C   GLN A  87      81.465  25.154 -14.908  1.00  0.85           C  
ATOM   1568  O   GLN A  87      81.633  25.837 -15.915  1.00  0.85           O  
ATOM   1569  CB  GLN A  87      79.213  24.986 -13.847  1.00  0.85           C  
ATOM   1570  CG  GLN A  87      78.910  26.446 -14.255  1.00  0.85           C  
ATOM   1571  CD  GLN A  87      77.970  27.140 -13.271  1.00  0.85           C  
ATOM   1572  OE1 GLN A  87      77.663  26.664 -12.181  1.00  0.85           O  
ATOM   1573  NE2 GLN A  87      77.484  28.332 -13.691  1.00  0.85           N  
ATOM   1574  N   TRP A  88      82.312  25.205 -13.866  1.00  0.90           N  
ATOM   1575  CA  TRP A  88      83.515  26.004 -13.824  1.00  0.90           C  
ATOM   1576  C   TRP A  88      84.634  25.530 -14.734  1.00  0.90           C  
ATOM   1577  O   TRP A  88      85.261  26.326 -15.427  1.00  0.90           O  
ATOM   1578  CB  TRP A  88      84.031  25.977 -12.366  1.00  0.90           C  
ATOM   1579  CG  TRP A  88      85.281  26.785 -12.091  1.00  0.90           C  
ATOM   1580  CD1 TRP A  88      85.505  28.103 -12.355  1.00  0.90           C  
ATOM   1581  CD2 TRP A  88      86.500  26.274 -11.527  1.00  0.90           C  
ATOM   1582  NE1 TRP A  88      86.774  28.455 -11.968  1.00  0.90           N  
ATOM   1583  CE2 TRP A  88      87.401  27.353 -11.454  1.00  0.90           C  
ATOM   1584  CE3 TRP A  88      86.863  25.006 -11.093  1.00  0.90           C  
ATOM   1585  CZ2 TRP A  88      88.678  27.188 -10.938  1.00  0.90           C  
ATOM   1586  CZ3 TRP A  88      88.150  24.839 -10.570  1.00  0.90           C  
ATOM   1587  CH2 TRP A  88      89.044  25.913 -10.488  1.00  0.90           C  
ATOM   1588  N   LEU A  89      84.935  24.221 -14.708  1.00  0.92           N  
ATOM   1589  CA  LEU A  89      86.004  23.620 -15.477  1.00  0.92           C  
ATOM   1590  C   LEU A  89      85.736  23.688 -16.979  1.00  0.92           C  
ATOM   1591  O   LEU A  89      84.578  23.619 -17.388  1.00  0.92           O  
ATOM   1592  CB  LEU A  89      86.245  22.156 -15.030  1.00  0.92           C  
ATOM   1593  CG  LEU A  89      86.803  22.035 -13.596  1.00  0.92           C  
ATOM   1594  CD1 LEU A  89      86.576  20.627 -13.021  1.00  0.92           C  
ATOM   1595  CD2 LEU A  89      88.278  22.457 -13.508  1.00  0.92           C  
ATOM   1596  N   PRO A  90      86.723  23.825 -17.863  1.00  0.94           N  
ATOM   1597  CA  PRO A  90      86.551  23.555 -19.289  1.00  0.94           C  
ATOM   1598  C   PRO A  90      85.832  22.252 -19.607  1.00  0.94           C  
ATOM   1599  O   PRO A  90      86.065  21.251 -18.934  1.00  0.94           O  
ATOM   1600  CB  PRO A  90      87.980  23.566 -19.860  1.00  0.94           C  
ATOM   1601  CG  PRO A  90      88.806  24.352 -18.839  1.00  0.94           C  
ATOM   1602  CD  PRO A  90      88.125  24.032 -17.513  1.00  0.94           C  
ATOM   1603  N   THR A  91      84.989  22.222 -20.652  1.00  0.90           N  
ATOM   1604  CA  THR A  91      84.139  21.086 -21.008  1.00  0.90           C  
ATOM   1605  C   THR A  91      84.870  19.787 -21.293  1.00  0.90           C  
ATOM   1606  O   THR A  91      84.328  18.705 -21.107  1.00  0.90           O  
ATOM   1607  CB  THR A  91      83.263  21.381 -22.217  1.00  0.90           C  
ATOM   1608  OG1 THR A  91      84.009  21.980 -23.270  1.00  0.90           O  
ATOM   1609  CG2 THR A  91      82.184  22.391 -21.824  1.00  0.90           C  
ATOM   1610  N   GLY A  92      86.123  19.882 -21.779  1.00  0.83           N  
ATOM   1611  CA  GLY A  92      87.007  18.748 -22.031  1.00  0.83           C  
ATOM   1612  C   GLY A  92      87.754  18.199 -20.832  1.00  0.83           C  
ATOM   1613  O   GLY A  92      88.527  17.257 -20.965  1.00  0.83           O  
ATOM   1614  N   THR A  93      87.603  18.805 -19.641  1.00  0.92           N  
ATOM   1615  CA  THR A  93      88.219  18.337 -18.396  1.00  0.92           C  
ATOM   1616  C   THR A  93      87.591  17.078 -17.840  1.00  0.92           C  
ATOM   1617  O   THR A  93      86.373  16.964 -17.732  1.00  0.92           O  
ATOM   1618  CB  THR A  93      88.147  19.395 -17.308  1.00  0.92           C  
ATOM   1619  OG1 THR A  93      88.915  20.524 -17.691  1.00  0.92           O  
ATOM   1620  CG2 THR A  93      88.712  18.957 -15.951  1.00  0.92           C  
ATOM   1621  N   LEU A  94      88.427  16.115 -17.394  1.00  0.94           N  
ATOM   1622  CA  LEU A  94      87.962  14.898 -16.764  1.00  0.94           C  
ATOM   1623  C   LEU A  94      87.750  15.123 -15.282  1.00  0.94           C  
ATOM   1624  O   LEU A  94      88.644  15.580 -14.567  1.00  0.94           O  
ATOM   1625  CB  LEU A  94      88.954  13.725 -16.939  1.00  0.94           C  
ATOM   1626  CG  LEU A  94      89.236  13.335 -18.402  1.00  0.94           C  
ATOM   1627  CD1 LEU A  94      90.245  12.179 -18.460  1.00  0.94           C  
ATOM   1628  CD2 LEU A  94      87.955  12.966 -19.166  1.00  0.94           C  
ATOM   1629  N   LEU A  95      86.545  14.803 -14.786  1.00  0.96           N  
ATOM   1630  CA  LEU A  95      86.176  15.031 -13.405  1.00  0.96           C  
ATOM   1631  C   LEU A  95      85.720  13.741 -12.765  1.00  0.96           C  
ATOM   1632  O   LEU A  95      84.761  13.107 -13.199  1.00  0.96           O  
ATOM   1633  CB  LEU A  95      85.052  16.089 -13.326  1.00  0.96           C  
ATOM   1634  CG  LEU A  95      84.548  16.486 -11.923  1.00  0.96           C  
ATOM   1635  CD1 LEU A  95      85.656  17.008 -10.998  1.00  0.96           C  
ATOM   1636  CD2 LEU A  95      83.436  17.536 -12.063  1.00  0.96           C  
ATOM   1637  N   VAL A  96      86.411  13.326 -11.691  1.00  0.98           N  
ATOM   1638  CA  VAL A  96      86.076  12.137 -10.930  1.00  0.98           C  
ATOM   1639  C   VAL A  96      85.726  12.580  -9.534  1.00  0.98           C  
ATOM   1640  O   VAL A  96      86.421  13.416  -8.960  1.00  0.98           O  
ATOM   1641  CB  VAL A  96      87.240  11.151 -10.886  1.00  0.98           C  
ATOM   1642  CG1 VAL A  96      87.003   9.998  -9.888  1.00  0.98           C  
ATOM   1643  CG2 VAL A  96      87.426  10.587 -12.304  1.00  0.98           C  
ATOM   1644  N   ASP A  97      84.648  12.046  -8.933  1.00  0.97           N  
ATOM   1645  CA  ASP A  97      84.311  12.392  -7.573  1.00  0.97           C  
ATOM   1646  C   ASP A  97      84.154  11.176  -6.680  1.00  0.97           C  
ATOM   1647  O   ASP A  97      84.205  10.026  -7.119  1.00  0.97           O  
ATOM   1648  CB  ASP A  97      83.165  13.436  -7.500  1.00  0.97           C  
ATOM   1649  CG  ASP A  97      81.788  12.958  -7.917  1.00  0.97           C  
ATOM   1650  OD1 ASP A  97      81.584  11.760  -8.223  1.00  0.97           O  
ATOM   1651  OD2 ASP A  97      80.873  13.821  -7.947  1.00  0.97           O  
ATOM   1652  N   SER A  98      84.089  11.411  -5.356  1.00  0.98           N  
ATOM   1653  CA  SER A  98      84.094  10.329  -4.393  1.00  0.98           C  
ATOM   1654  C   SER A  98      83.478  10.745  -3.083  1.00  0.98           C  
ATOM   1655  O   SER A  98      83.581  11.902  -2.673  1.00  0.98           O  
ATOM   1656  CB  SER A  98      85.541   9.825  -4.132  1.00  0.98           C  
ATOM   1657  OG  SER A  98      85.603   8.733  -3.212  1.00  0.98           O  
ATOM   1658  N   ASP A  99      82.854   9.782  -2.381  1.00  0.95           N  
ATOM   1659  CA  ASP A  99      82.304   9.986  -1.065  1.00  0.95           C  
ATOM   1660  C   ASP A  99      82.170   8.635  -0.389  1.00  0.95           C  
ATOM   1661  O   ASP A  99      82.179   7.591  -1.034  1.00  0.95           O  
ATOM   1662  CB  ASP A  99      80.940  10.716  -1.110  1.00  0.95           C  
ATOM   1663  CG  ASP A  99      80.605  11.318   0.240  1.00  0.95           C  
ATOM   1664  OD1 ASP A  99      80.036  10.600   1.105  1.00  0.95           O  
ATOM   1665  OD2 ASP A  99      80.980  12.500   0.432  1.00  0.95           O  
ATOM   1666  N   LEU A 100      82.032   8.646   0.948  1.00  0.90           N  
ATOM   1667  CA  LEU A 100      81.758   7.501   1.786  1.00  0.90           C  
ATOM   1668  C   LEU A 100      80.404   6.878   1.493  1.00  0.90           C  
ATOM   1669  O   LEU A 100      80.259   5.657   1.472  1.00  0.90           O  
ATOM   1670  CB  LEU A 100      81.862   7.946   3.262  1.00  0.90           C  
ATOM   1671  CG  LEU A 100      81.574   6.872   4.330  1.00  0.90           C  
ATOM   1672  CD1 LEU A 100      82.539   5.679   4.240  1.00  0.90           C  
ATOM   1673  CD2 LEU A 100      81.623   7.502   5.730  1.00  0.90           C  
ATOM   1674  N   ASN A 101      79.383   7.721   1.242  1.00  0.88           N  
ATOM   1675  CA  ASN A 101      78.013   7.283   1.064  1.00  0.88           C  
ATOM   1676  C   ASN A 101      77.618   7.428  -0.395  1.00  0.88           C  
ATOM   1677  O   ASN A 101      78.171   8.255  -1.104  1.00  0.88           O  
ATOM   1678  CB  ASN A 101      77.051   8.144   1.912  1.00  0.88           C  
ATOM   1679  CG  ASN A 101      77.476   8.070   3.372  1.00  0.88           C  
ATOM   1680  OD1 ASN A 101      77.589   6.995   3.958  1.00  0.88           O  
ATOM   1681  ND2 ASN A 101      77.709   9.246   4.002  1.00  0.88           N  
ATOM   1682  N   ASP A 102      76.662   6.614  -0.894  1.00  0.90           N  
ATOM   1683  CA  ASP A 102      76.153   6.712  -2.254  1.00  0.90           C  
ATOM   1684  C   ASP A 102      75.463   8.039  -2.606  1.00  0.90           C  
ATOM   1685  O   ASP A 102      74.811   8.677  -1.777  1.00  0.90           O  
ATOM   1686  CB  ASP A 102      75.259   5.488  -2.564  1.00  0.90           C  
ATOM   1687  CG  ASP A 102      75.056   5.296  -4.061  1.00  0.90           C  
ATOM   1688  OD1 ASP A 102      75.840   5.884  -4.850  1.00  0.90           O  
ATOM   1689  OD2 ASP A 102      74.108   4.559  -4.414  1.00  0.90           O  
ATOM   1690  N   PHE A 103      75.611   8.481  -3.869  1.00  0.91           N  
ATOM   1691  CA  PHE A 103      75.089   9.749  -4.326  1.00  0.91           C  
ATOM   1692  C   PHE A 103      75.018   9.832  -5.837  1.00  0.91           C  
ATOM   1693  O   PHE A 103      75.738   9.169  -6.576  1.00  0.91           O  
ATOM   1694  CB  PHE A 103      75.847  10.986  -3.751  1.00  0.91           C  
ATOM   1695  CG  PHE A 103      77.265  11.112  -4.247  1.00  0.91           C  
ATOM   1696  CD1 PHE A 103      78.280  10.283  -3.758  1.00  0.91           C  
ATOM   1697  CD2 PHE A 103      77.600  12.078  -5.206  1.00  0.91           C  
ATOM   1698  CE1 PHE A 103      79.595  10.404  -4.215  1.00  0.91           C  
ATOM   1699  CE2 PHE A 103      78.927  12.240  -5.625  1.00  0.91           C  
ATOM   1700  CZ  PHE A 103      79.923  11.394  -5.140  1.00  0.91           C  
ATOM   1701  N   VAL A 104      74.130  10.701  -6.346  1.00  0.92           N  
ATOM   1702  CA  VAL A 104      73.953  10.914  -7.766  1.00  0.92           C  
ATOM   1703  C   VAL A 104      74.798  12.102  -8.197  1.00  0.92           C  
ATOM   1704  O   VAL A 104      74.755  13.175  -7.598  1.00  0.92           O  
ATOM   1705  CB  VAL A 104      72.484  11.140  -8.079  1.00  0.92           C  
ATOM   1706  CG1 VAL A 104      72.269  11.534  -9.547  1.00  0.92           C  
ATOM   1707  CG2 VAL A 104      71.707   9.853  -7.754  1.00  0.92           C  
ATOM   1708  N   SER A 105      75.603  11.934  -9.265  1.00  0.93           N  
ATOM   1709  CA  SER A 105      76.600  12.917  -9.647  1.00  0.93           C  
ATOM   1710  C   SER A 105      76.631  13.179 -11.144  1.00  0.93           C  
ATOM   1711  O   SER A 105      76.224  12.338 -11.950  1.00  0.93           O  
ATOM   1712  CB  SER A 105      77.985  12.428  -9.167  1.00  0.93           C  
ATOM   1713  OG  SER A 105      79.057  13.212  -9.670  1.00  0.93           O  
ATOM   1714  N   ASP A 106      77.147  14.371 -11.525  1.00  0.91           N  
ATOM   1715  CA  ASP A 106      77.404  14.815 -12.877  1.00  0.91           C  
ATOM   1716  C   ASP A 106      78.865  14.610 -13.279  1.00  0.91           C  
ATOM   1717  O   ASP A 106      79.258  14.913 -14.404  1.00  0.91           O  
ATOM   1718  CB  ASP A 106      77.048  16.316 -12.998  1.00  0.91           C  
ATOM   1719  CG  ASP A 106      75.537  16.457 -12.976  1.00  0.91           C  
ATOM   1720  OD1 ASP A 106      74.895  15.846 -13.875  1.00  0.91           O  
ATOM   1721  OD2 ASP A 106      75.001  17.143 -12.072  1.00  0.91           O  
ATOM   1722  N   ALA A 107      79.709  14.062 -12.382  1.00  0.96           N  
ATOM   1723  CA  ALA A 107      81.062  13.637 -12.687  1.00  0.96           C  
ATOM   1724  C   ALA A 107      81.119  12.523 -13.724  1.00  0.96           C  
ATOM   1725  O   ALA A 107      80.157  11.769 -13.911  1.00  0.96           O  
ATOM   1726  CB  ALA A 107      81.808  13.208 -11.409  1.00  0.96           C  
ATOM   1727  N   ASP A 108      82.258  12.412 -14.441  1.00  0.92           N  
ATOM   1728  CA  ASP A 108      82.513  11.373 -15.427  1.00  0.92           C  
ATOM   1729  C   ASP A 108      82.513  10.001 -14.789  1.00  0.92           C  
ATOM   1730  O   ASP A 108      81.942   9.047 -15.310  1.00  0.92           O  
ATOM   1731  CB  ASP A 108      83.863  11.612 -16.137  1.00  0.92           C  
ATOM   1732  CG  ASP A 108      83.819  12.970 -16.784  1.00  0.92           C  
ATOM   1733  OD1 ASP A 108      82.759  13.326 -17.360  1.00  0.92           O  
ATOM   1734  OD2 ASP A 108      84.801  13.741 -16.645  1.00  0.92           O  
ATOM   1735  N   SER A 109      83.109   9.919 -13.584  1.00  0.95           N  
ATOM   1736  CA  SER A 109      83.129   8.695 -12.813  1.00  0.95           C  
ATOM   1737  C   SER A 109      83.022   9.022 -11.350  1.00  0.95           C  
ATOM   1738  O   SER A 109      83.551  10.023 -10.876  1.00  0.95           O  
ATOM   1739  CB  SER A 109      84.411   7.843 -12.972  1.00  0.95           C  
ATOM   1740  OG  SER A 109      84.569   7.384 -14.312  1.00  0.95           O  
ATOM   1741  N   THR A 110      82.310   8.159 -10.595  1.00  0.95           N  
ATOM   1742  CA  THR A 110      81.962   8.379  -9.197  1.00  0.95           C  
ATOM   1743  C   THR A 110      82.406   7.171  -8.409  1.00  0.95           C  
ATOM   1744  O   THR A 110      82.084   6.044  -8.776  1.00  0.95           O  
ATOM   1745  CB  THR A 110      80.434   8.442  -8.943  1.00  0.95           C  
ATOM   1746  OG1 THR A 110      79.720   9.441  -9.628  1.00  0.95           O  
ATOM   1747  CG2 THR A 110      80.154   8.776  -7.481  1.00  0.95           C  
ATOM   1748  N   LEU A 111      83.158   7.339  -7.306  1.00  0.96           N  
ATOM   1749  CA  LEU A 111      83.605   6.227  -6.469  1.00  0.96           C  
ATOM   1750  C   LEU A 111      82.977   6.292  -5.090  1.00  0.96           C  
ATOM   1751  O   LEU A 111      82.977   7.330  -4.439  1.00  0.96           O  
ATOM   1752  CB  LEU A 111      85.141   6.230  -6.294  1.00  0.96           C  
ATOM   1753  CG  LEU A 111      85.916   6.122  -7.617  1.00  0.96           C  
ATOM   1754  CD1 LEU A 111      87.410   6.298  -7.367  1.00  0.96           C  
ATOM   1755  CD2 LEU A 111      85.680   4.803  -8.368  1.00  0.96           C  
ATOM   1756  N   ILE A 112      82.419   5.170  -4.600  1.00  0.93           N  
ATOM   1757  CA  ILE A 112      81.756   5.145  -3.307  1.00  0.93           C  
ATOM   1758  C   ILE A 112      82.601   4.324  -2.350  1.00  0.93           C  
ATOM   1759  O   ILE A 112      83.097   3.246  -2.687  1.00  0.93           O  
ATOM   1760  CB  ILE A 112      80.325   4.625  -3.410  1.00  0.93           C  
ATOM   1761  CG1 ILE A 112      79.510   5.423  -4.461  1.00  0.93           C  
ATOM   1762  CG2 ILE A 112      79.623   4.662  -2.035  1.00  0.93           C  
ATOM   1763  CD1 ILE A 112      79.433   6.933  -4.215  1.00  0.93           C  
ATOM   1764  N   GLY A 113      82.825   4.857  -1.134  1.00  0.96           N  
ATOM   1765  CA  GLY A 113      83.578   4.207  -0.074  1.00  0.96           C  
ATOM   1766  C   GLY A 113      84.453   5.199   0.631  1.00  0.96           C  
ATOM   1767  O   GLY A 113      84.522   6.368   0.268  1.00  0.96           O  
ATOM   1768  N   ASP A 114      85.161   4.762   1.691  1.00  0.93           N  
ATOM   1769  CA  ASP A 114      86.159   5.574   2.368  1.00  0.93           C  
ATOM   1770  C   ASP A 114      87.237   6.021   1.372  1.00  0.93           C  
ATOM   1771  O   ASP A 114      87.638   5.274   0.492  1.00  0.93           O  
ATOM   1772  CB  ASP A 114      86.742   4.738   3.543  1.00  0.93           C  
ATOM   1773  CG  ASP A 114      87.702   5.478   4.472  1.00  0.93           C  
ATOM   1774  OD1 ASP A 114      88.334   6.477   4.044  1.00  0.93           O  
ATOM   1775  OD2 ASP A 114      87.833   5.011   5.628  1.00  0.93           O  
ATOM   1776  N   CYS A 115      87.763   7.258   1.460  1.00  0.95           N  
ATOM   1777  CA  CYS A 115      88.793   7.721   0.545  1.00  0.95           C  
ATOM   1778  C   CYS A 115      90.064   6.883   0.585  1.00  0.95           C  
ATOM   1779  O   CYS A 115      90.760   6.770  -0.414  1.00  0.95           O  
ATOM   1780  CB  CYS A 115      89.128   9.210   0.760  1.00  0.95           C  
ATOM   1781  SG  CYS A 115      89.788   9.543   2.419  1.00  0.95           S  
ATOM   1782  N   ALA A 116      90.333   6.223   1.729  1.00  0.95           N  
ATOM   1783  CA  ALA A 116      91.423   5.288   1.908  1.00  0.95           C  
ATOM   1784  C   ALA A 116      91.344   4.033   1.034  1.00  0.95           C  
ATOM   1785  O   ALA A 116      92.344   3.341   0.863  1.00  0.95           O  
ATOM   1786  CB  ALA A 116      91.481   4.892   3.394  1.00  0.95           C  
ATOM   1787  N   THR A 117      90.163   3.735   0.440  1.00  0.94           N  
ATOM   1788  CA  THR A 117      89.955   2.622  -0.478  1.00  0.94           C  
ATOM   1789  C   THR A 117      90.131   3.035  -1.926  1.00  0.94           C  
ATOM   1790  O   THR A 117      90.062   2.205  -2.829  1.00  0.94           O  
ATOM   1791  CB  THR A 117      88.560   1.981  -0.360  1.00  0.94           C  
ATOM   1792  OG1 THR A 117      87.486   2.830  -0.724  1.00  0.94           O  
ATOM   1793  CG2 THR A 117      88.286   1.572   1.089  1.00  0.94           C  
ATOM   1794  N   VAL A 118      90.375   4.333  -2.205  1.00  0.95           N  
ATOM   1795  CA  VAL A 118      90.527   4.836  -3.562  1.00  0.95           C  
ATOM   1796  C   VAL A 118      91.947   4.600  -4.072  1.00  0.95           C  
ATOM   1797  O   VAL A 118      92.926   5.012  -3.458  1.00  0.95           O  
ATOM   1798  CB  VAL A 118      90.144   6.317  -3.668  1.00  0.95           C  
ATOM   1799  CG1 VAL A 118      90.476   6.915  -5.051  1.00  0.95           C  
ATOM   1800  CG2 VAL A 118      88.636   6.478  -3.383  1.00  0.95           C  
ATOM   1801  N   HIS A 119      92.096   3.938  -5.243  1.00  0.90           N  
ATOM   1802  CA  HIS A 119      93.393   3.695  -5.863  1.00  0.90           C  
ATOM   1803  C   HIS A 119      93.444   4.260  -7.264  1.00  0.90           C  
ATOM   1804  O   HIS A 119      92.497   4.122  -8.024  1.00  0.90           O  
ATOM   1805  CB  HIS A 119      93.699   2.201  -6.060  1.00  0.90           C  
ATOM   1806  CG  HIS A 119      93.668   1.426  -4.807  1.00  0.90           C  
ATOM   1807  ND1 HIS A 119      94.653   1.611  -3.859  1.00  0.90           N  
ATOM   1808  CD2 HIS A 119      92.744   0.535  -4.385  1.00  0.90           C  
ATOM   1809  CE1 HIS A 119      94.291   0.825  -2.860  1.00  0.90           C  
ATOM   1810  NE2 HIS A 119      93.149   0.153  -3.132  1.00  0.90           N  
ATOM   1811  N   THR A 120      94.572   4.872  -7.672  1.00  0.90           N  
ATOM   1812  CA  THR A 120      94.753   5.373  -9.034  1.00  0.90           C  
ATOM   1813  C   THR A 120      96.185   5.165  -9.441  1.00  0.90           C  
ATOM   1814  O   THR A 120      97.111   5.249  -8.630  1.00  0.90           O  
ATOM   1815  CB  THR A 120      94.361   6.852  -9.243  1.00  0.90           C  
ATOM   1816  OG1 THR A 120      94.642   7.377 -10.533  1.00  0.90           O  
ATOM   1817  CG2 THR A 120      95.041   7.790  -8.241  1.00  0.90           C  
ATOM   1818  N   ALA A 121      96.421   4.865 -10.733  1.00  0.91           N  
ATOM   1819  CA  ALA A 121      97.758   4.701 -11.259  1.00  0.91           C  
ATOM   1820  C   ALA A 121      98.244   6.008 -11.866  1.00  0.91           C  
ATOM   1821  O   ALA A 121      99.388   6.127 -12.296  1.00  0.91           O  
ATOM   1822  CB  ALA A 121      97.783   3.572 -12.305  1.00  0.91           C  
ATOM   1823  N   ASN A 122      97.397   7.055 -11.858  1.00  0.90           N  
ATOM   1824  CA  ASN A 122      97.668   8.285 -12.561  1.00  0.90           C  
ATOM   1825  C   ASN A 122      97.865   9.458 -11.625  1.00  0.90           C  
ATOM   1826  O   ASN A 122      97.491   9.450 -10.455  1.00  0.90           O  
ATOM   1827  CB  ASN A 122      96.533   8.646 -13.547  1.00  0.90           C  
ATOM   1828  CG  ASN A 122      96.169   7.440 -14.398  1.00  0.90           C  
ATOM   1829  OD1 ASN A 122      95.452   6.545 -13.960  1.00  0.90           O  
ATOM   1830  ND2 ASN A 122      96.605   7.425 -15.677  1.00  0.90           N  
ATOM   1831  N   LYS A 123      98.500  10.520 -12.156  1.00  0.91           N  
ATOM   1832  CA  LYS A 123      98.588  11.802 -11.497  1.00  0.91           C  
ATOM   1833  C   LYS A 123      97.511  12.739 -12.004  1.00  0.91           C  
ATOM   1834  O   LYS A 123      97.071  12.640 -13.155  1.00  0.91           O  
ATOM   1835  CB  LYS A 123      99.975  12.446 -11.692  1.00  0.91           C  
ATOM   1836  CG  LYS A 123     101.098  11.631 -11.032  1.00  0.91           C  
ATOM   1837  CD  LYS A 123     102.466  12.329 -11.108  1.00  0.91           C  
ATOM   1838  CE  LYS A 123     103.636  11.525 -10.521  1.00  0.91           C  
ATOM   1839  NZ  LYS A 123     103.514  11.390  -9.055  1.00  0.91           N  
ATOM   1840  N   TRP A 124      97.090  13.659 -11.120  1.00  0.94           N  
ATOM   1841  CA  TRP A 124      95.968  14.557 -11.284  1.00  0.94           C  
ATOM   1842  C   TRP A 124      96.472  15.983 -11.250  1.00  0.94           C  
ATOM   1843  O   TRP A 124      97.554  16.252 -10.731  1.00  0.94           O  
ATOM   1844  CB  TRP A 124      94.929  14.321 -10.155  1.00  0.94           C  
ATOM   1845  CG  TRP A 124      94.387  12.901 -10.164  1.00  0.94           C  
ATOM   1846  CD1 TRP A 124      95.000  11.756  -9.742  1.00  0.94           C  
ATOM   1847  CD2 TRP A 124      93.164  12.486 -10.793  1.00  0.94           C  
ATOM   1848  NE1 TRP A 124      94.277  10.648 -10.118  1.00  0.94           N  
ATOM   1849  CE2 TRP A 124      93.136  11.079 -10.759  1.00  0.94           C  
ATOM   1850  CE3 TRP A 124      92.145  13.215 -11.386  1.00  0.94           C  
ATOM   1851  CZ2 TRP A 124      92.084  10.375 -11.335  1.00  0.94           C  
ATOM   1852  CZ3 TRP A 124      91.087  12.509 -11.969  1.00  0.94           C  
ATOM   1853  CH2 TRP A 124      91.061  11.112 -11.951  1.00  0.94           C  
ATOM   1854  N   ASP A 125      95.707  16.925 -11.837  1.00  0.98           N  
ATOM   1855  CA  ASP A 125      96.145  18.291 -12.027  1.00  0.98           C  
ATOM   1856  C   ASP A 125      95.499  19.192 -10.973  1.00  0.98           C  
ATOM   1857  O   ASP A 125      96.024  20.244 -10.609  1.00  0.98           O  
ATOM   1858  CB  ASP A 125      95.734  18.749 -13.455  1.00  0.98           C  
ATOM   1859  CG  ASP A 125      96.292  17.833 -14.528  1.00  0.98           C  
ATOM   1860  OD1 ASP A 125      97.464  17.398 -14.429  1.00  0.98           O  
ATOM   1861  OD2 ASP A 125      95.551  17.520 -15.499  1.00  0.98           O  
ATOM   1862  N   LEU A 126      94.354  18.763 -10.406  1.00  0.99           N  
ATOM   1863  CA  LEU A 126      93.669  19.500  -9.364  1.00  0.99           C  
ATOM   1864  C   LEU A 126      92.973  18.540  -8.413  1.00  0.99           C  
ATOM   1865  O   LEU A 126      92.322  17.584  -8.834  1.00  0.99           O  
ATOM   1866  CB  LEU A 126      92.649  20.472 -10.004  1.00  0.99           C  
ATOM   1867  CG  LEU A 126      91.811  21.369  -9.070  1.00  0.99           C  
ATOM   1868  CD1 LEU A 126      92.670  22.353  -8.266  1.00  0.99           C  
ATOM   1869  CD2 LEU A 126      90.762  22.138  -9.887  1.00  0.99           C  
ATOM   1870  N   ILE A 127      93.096  18.777  -7.090  1.00  0.99           N  
ATOM   1871  CA  ILE A 127      92.419  17.985  -6.070  1.00  0.99           C  
ATOM   1872  C   ILE A 127      91.529  18.898  -5.254  1.00  0.99           C  
ATOM   1873  O   ILE A 127      91.983  19.876  -4.662  1.00  0.99           O  
ATOM   1874  CB  ILE A 127      93.384  17.282  -5.115  1.00  0.99           C  
ATOM   1875  CG1 ILE A 127      94.367  16.372  -5.886  1.00  0.99           C  
ATOM   1876  CG2 ILE A 127      92.605  16.482  -4.038  1.00  0.99           C  
ATOM   1877  CD1 ILE A 127      95.564  15.939  -5.036  1.00  0.99           C  
ATOM   1878  N   ILE A 128      90.225  18.588  -5.176  1.00  0.99           N  
ATOM   1879  CA  ILE A 128      89.289  19.336  -4.356  1.00  0.99           C  
ATOM   1880  C   ILE A 128      88.815  18.387  -3.270  1.00  0.99           C  
ATOM   1881  O   ILE A 128      88.504  17.229  -3.536  1.00  0.99           O  
ATOM   1882  CB  ILE A 128      88.108  19.882  -5.161  1.00  0.99           C  
ATOM   1883  CG1 ILE A 128      88.557  20.707  -6.398  1.00  0.99           C  
ATOM   1884  CG2 ILE A 128      87.170  20.708  -4.252  1.00  0.99           C  
ATOM   1885  CD1 ILE A 128      89.341  21.985  -6.082  1.00  0.99           C  
ATOM   1886  N   SER A 129      88.775  18.823  -1.998  1.00  1.00           N  
ATOM   1887  CA  SER A 129      88.222  18.004  -0.930  1.00  1.00           C  
ATOM   1888  C   SER A 129      87.305  18.830  -0.051  1.00  1.00           C  
ATOM   1889  O   SER A 129      87.705  19.888   0.428  1.00  1.00           O  
ATOM   1890  CB  SER A 129      89.315  17.350  -0.043  1.00  1.00           C  
ATOM   1891  OG  SER A 129      88.776  16.486   0.962  1.00  1.00           O  
ATOM   1892  N   ASP A 130      86.061  18.354   0.182  1.00  0.98           N  
ATOM   1893  CA  ASP A 130      85.139  18.892   1.177  1.00  0.98           C  
ATOM   1894  C   ASP A 130      84.867  17.841   2.252  1.00  0.98           C  
ATOM   1895  O   ASP A 130      83.905  17.925   3.012  1.00  0.98           O  
ATOM   1896  CB  ASP A 130      83.830  19.422   0.515  1.00  0.98           C  
ATOM   1897  CG  ASP A 130      83.024  20.391   1.370  1.00  0.98           C  
ATOM   1898  OD1 ASP A 130      83.676  21.127   2.155  1.00  0.98           O  
ATOM   1899  OD2 ASP A 130      81.777  20.487   1.248  1.00  0.98           O  
ATOM   1900  N   MET A 131      85.737  16.805   2.375  1.00  0.94           N  
ATOM   1901  CA  MET A 131      85.562  15.778   3.389  1.00  0.94           C  
ATOM   1902  C   MET A 131      85.535  16.312   4.812  1.00  0.94           C  
ATOM   1903  O   MET A 131      86.338  17.146   5.228  1.00  0.94           O  
ATOM   1904  CB  MET A 131      86.624  14.659   3.300  1.00  0.94           C  
ATOM   1905  CG  MET A 131      86.487  13.784   2.046  1.00  0.94           C  
ATOM   1906  SD  MET A 131      87.575  12.335   2.031  1.00  0.94           S  
ATOM   1907  CE  MET A 131      89.140  13.219   1.794  1.00  0.94           C  
ATOM   1908  N   TYR A 132      84.557  15.841   5.598  1.00  0.92           N  
ATOM   1909  CA  TYR A 132      84.378  16.301   6.943  1.00  0.92           C  
ATOM   1910  C   TYR A 132      83.703  15.177   7.695  1.00  0.92           C  
ATOM   1911  O   TYR A 132      82.719  14.621   7.218  1.00  0.92           O  
ATOM   1912  CB  TYR A 132      83.531  17.594   6.890  1.00  0.92           C  
ATOM   1913  CG  TYR A 132      83.305  18.199   8.233  1.00  0.92           C  
ATOM   1914  CD1 TYR A 132      84.281  19.010   8.824  1.00  0.92           C  
ATOM   1915  CD2 TYR A 132      82.104  17.957   8.914  1.00  0.92           C  
ATOM   1916  CE1 TYR A 132      84.050  19.584  10.077  1.00  0.92           C  
ATOM   1917  CE2 TYR A 132      81.872  18.535  10.167  1.00  0.92           C  
ATOM   1918  CZ  TYR A 132      82.841  19.363  10.736  1.00  0.92           C  
ATOM   1919  OH  TYR A 132      82.605  19.975  11.973  1.00  0.92           O  
ATOM   1920  N   ASP A 133      84.208  14.803   8.888  1.00  0.84           N  
ATOM   1921  CA  ASP A 133      83.571  13.782   9.691  1.00  0.84           C  
ATOM   1922  C   ASP A 133      82.444  14.459  10.498  1.00  0.84           C  
ATOM   1923  O   ASP A 133      82.700  15.495  11.124  1.00  0.84           O  
ATOM   1924  CB  ASP A 133      84.647  13.049  10.545  1.00  0.84           C  
ATOM   1925  CG  ASP A 133      84.134  11.827  11.304  1.00  0.84           C  
ATOM   1926  OD1 ASP A 133      82.914  11.762  11.606  1.00  0.84           O  
ATOM   1927  OD2 ASP A 133      84.969  10.942  11.611  1.00  0.84           O  
ATOM   1928  N   PRO A 134      81.189  13.989  10.510  1.00  0.70           N  
ATOM   1929  CA  PRO A 134      80.128  14.506  11.371  1.00  0.70           C  
ATOM   1930  C   PRO A 134      80.444  14.354  12.848  1.00  0.70           C  
ATOM   1931  O   PRO A 134      79.950  15.144  13.655  1.00  0.70           O  
ATOM   1932  CB  PRO A 134      78.864  13.743  10.930  1.00  0.70           C  
ATOM   1933  CG  PRO A 134      79.390  12.470  10.264  1.00  0.70           C  
ATOM   1934  CD  PRO A 134      80.712  12.911   9.645  1.00  0.70           C  
ATOM   1935  N   LYS A 135      81.283  13.380  13.247  1.00  0.69           N  
ATOM   1936  CA  LYS A 135      81.627  13.142  14.634  1.00  0.69           C  
ATOM   1937  C   LYS A 135      82.523  14.221  15.225  1.00  0.69           C  
ATOM   1938  O   LYS A 135      82.646  14.330  16.440  1.00  0.69           O  
ATOM   1939  CB  LYS A 135      82.278  11.758  14.818  1.00  0.69           C  
ATOM   1940  CG  LYS A 135      81.339  10.608  14.427  1.00  0.69           C  
ATOM   1941  CD  LYS A 135      82.014   9.243  14.608  1.00  0.69           C  
ATOM   1942  CE  LYS A 135      81.103   8.080  14.221  1.00  0.69           C  
ATOM   1943  NZ  LYS A 135      81.802   6.796  14.440  1.00  0.69           N  
ATOM   1944  N   THR A 136      83.098  15.091  14.369  1.00  0.77           N  
ATOM   1945  CA  THR A 136      83.908  16.249  14.745  1.00  0.77           C  
ATOM   1946  C   THR A 136      83.150  17.265  15.592  1.00  0.77           C  
ATOM   1947  O   THR A 136      83.747  17.971  16.398  1.00  0.77           O  
ATOM   1948  CB  THR A 136      84.514  16.937  13.519  1.00  0.77           C  
ATOM   1949  OG1 THR A 136      85.383  16.055  12.826  1.00  0.77           O  
ATOM   1950  CG2 THR A 136      85.388  18.151  13.859  1.00  0.77           C  
ATOM   1951  N   LYS A 137      81.807  17.385  15.437  1.00  0.64           N  
ATOM   1952  CA  LYS A 137      81.006  18.244  16.309  1.00  0.64           C  
ATOM   1953  C   LYS A 137      80.123  17.497  17.287  1.00  0.64           C  
ATOM   1954  O   LYS A 137      79.659  18.082  18.261  1.00  0.64           O  
ATOM   1955  CB  LYS A 137      80.065  19.160  15.498  1.00  0.64           C  
ATOM   1956  CG  LYS A 137      80.816  20.293  14.793  1.00  0.64           C  
ATOM   1957  CD  LYS A 137      79.866  21.189  13.981  1.00  0.64           C  
ATOM   1958  CE  LYS A 137      80.548  22.388  13.314  1.00  0.64           C  
ATOM   1959  NZ  LYS A 137      79.555  23.201  12.573  1.00  0.64           N  
ATOM   1960  N   ASN A 138      79.877  16.188  17.079  1.00  0.43           N  
ATOM   1961  CA  ASN A 138      79.074  15.391  17.995  1.00  0.43           C  
ATOM   1962  C   ASN A 138      79.724  15.255  19.361  1.00  0.43           C  
ATOM   1963  O   ASN A 138      79.052  15.194  20.386  1.00  0.43           O  
ATOM   1964  CB  ASN A 138      78.806  13.967  17.453  1.00  0.43           C  
ATOM   1965  CG  ASN A 138      77.919  14.005  16.214  1.00  0.43           C  
ATOM   1966  OD1 ASN A 138      77.352  15.018  15.821  1.00  0.43           O  
ATOM   1967  ND2 ASN A 138      77.762  12.819  15.574  1.00  0.43           N  
ATOM   1968  N   VAL A 139      81.064  15.188  19.390  1.00  0.41           N  
ATOM   1969  CA  VAL A 139      81.809  15.181  20.625  1.00  0.41           C  
ATOM   1970  C   VAL A 139      83.005  16.095  20.457  1.00  0.41           C  
ATOM   1971  O   VAL A 139      83.840  15.905  19.579  1.00  0.41           O  
ATOM   1972  CB  VAL A 139      82.198  13.758  21.037  1.00  0.41           C  
ATOM   1973  CG1 VAL A 139      82.908  12.993  19.897  1.00  0.41           C  
ATOM   1974  CG2 VAL A 139      83.013  13.764  22.345  1.00  0.41           C  
ATOM   1975  N   THR A 140      83.127  17.145  21.299  1.00  0.55           N  
ATOM   1976  CA  THR A 140      84.286  18.036  21.243  1.00  0.55           C  
ATOM   1977  C   THR A 140      85.435  17.431  22.021  1.00  0.55           C  
ATOM   1978  O   THR A 140      85.257  16.832  23.083  1.00  0.55           O  
ATOM   1979  CB  THR A 140      83.996  19.479  21.659  1.00  0.55           C  
ATOM   1980  OG1 THR A 140      85.097  20.346  21.422  1.00  0.55           O  
ATOM   1981  CG2 THR A 140      83.619  19.615  23.138  1.00  0.55           C  
ATOM   1982  N   LYS A 141      86.656  17.522  21.468  1.00  0.59           N  
ATOM   1983  CA  LYS A 141      87.837  16.893  22.009  1.00  0.59           C  
ATOM   1984  C   LYS A 141      88.920  17.943  22.011  1.00  0.59           C  
ATOM   1985  O   LYS A 141      88.790  18.983  21.370  1.00  0.59           O  
ATOM   1986  CB  LYS A 141      88.324  15.694  21.142  1.00  0.59           C  
ATOM   1987  CG  LYS A 141      87.261  14.626  20.820  1.00  0.59           C  
ATOM   1988  CD  LYS A 141      86.769  13.815  22.030  1.00  0.59           C  
ATOM   1989  CE  LYS A 141      87.838  12.901  22.628  1.00  0.59           C  
ATOM   1990  NZ  LYS A 141      87.268  12.118  23.746  1.00  0.59           N  
ATOM   1991  N   GLU A 142      90.033  17.705  22.730  1.00  0.71           N  
ATOM   1992  CA  GLU A 142      91.208  18.552  22.656  1.00  0.71           C  
ATOM   1993  C   GLU A 142      91.714  18.663  21.226  1.00  0.71           C  
ATOM   1994  O   GLU A 142      91.735  17.692  20.466  1.00  0.71           O  
ATOM   1995  CB  GLU A 142      92.282  18.025  23.634  1.00  0.71           C  
ATOM   1996  CG  GLU A 142      91.800  18.073  25.109  1.00  0.71           C  
ATOM   1997  CD  GLU A 142      92.538  17.116  26.051  1.00  0.71           C  
ATOM   1998  OE1 GLU A 142      91.818  16.377  26.777  1.00  0.71           O  
ATOM   1999  OE2 GLU A 142      93.792  17.133  26.071  1.00  0.71           O  
ATOM   2000  N   ASN A 143      92.008  19.905  20.784  1.00  0.83           N  
ATOM   2001  CA  ASN A 143      92.149  20.203  19.375  1.00  0.83           C  
ATOM   2002  C   ASN A 143      93.513  19.821  18.802  1.00  0.83           C  
ATOM   2003  O   ASN A 143      94.279  20.669  18.351  1.00  0.83           O  
ATOM   2004  CB  ASN A 143      91.772  21.676  19.073  1.00  0.83           C  
ATOM   2005  CG  ASN A 143      91.499  21.838  17.582  1.00  0.83           C  
ATOM   2006  OD1 ASN A 143      91.381  20.853  16.844  1.00  0.83           O  
ATOM   2007  ND2 ASN A 143      91.390  23.102  17.120  1.00  0.83           N  
ATOM   2008  N   ASP A 144      93.804  18.511  18.770  1.00  0.87           N  
ATOM   2009  CA  ASP A 144      94.949  17.944  18.105  1.00  0.87           C  
ATOM   2010  C   ASP A 144      94.718  17.765  16.622  1.00  0.87           C  
ATOM   2011  O   ASP A 144      93.591  17.831  16.124  1.00  0.87           O  
ATOM   2012  CB  ASP A 144      95.323  16.575  18.705  1.00  0.87           C  
ATOM   2013  CG  ASP A 144      95.957  16.808  20.059  1.00  0.87           C  
ATOM   2014  OD1 ASP A 144      96.846  17.705  20.114  1.00  0.87           O  
ATOM   2015  OD2 ASP A 144      95.597  16.076  21.010  1.00  0.87           O  
ATOM   2016  N   SER A 145      95.824  17.525  15.890  1.00  0.93           N  
ATOM   2017  CA  SER A 145      95.842  17.179  14.476  1.00  0.93           C  
ATOM   2018  C   SER A 145      95.028  15.922  14.208  1.00  0.93           C  
ATOM   2019  O   SER A 145      95.112  14.947  14.946  1.00  0.93           O  
ATOM   2020  CB  SER A 145      97.314  16.951  14.032  1.00  0.93           C  
ATOM   2021  OG  SER A 145      97.487  16.705  12.636  1.00  0.93           O  
ATOM   2022  N   LYS A 146      94.162  15.918  13.173  1.00  0.87           N  
ATOM   2023  CA  LYS A 146      93.251  14.810  12.940  1.00  0.87           C  
ATOM   2024  C   LYS A 146      93.773  13.889  11.852  1.00  0.87           C  
ATOM   2025  O   LYS A 146      94.202  14.326  10.785  1.00  0.87           O  
ATOM   2026  CB  LYS A 146      91.840  15.319  12.563  1.00  0.87           C  
ATOM   2027  CG  LYS A 146      91.201  16.294  13.576  1.00  0.87           C  
ATOM   2028  CD  LYS A 146      91.035  15.725  14.999  1.00  0.87           C  
ATOM   2029  CE  LYS A 146      90.223  16.604  15.967  1.00  0.87           C  
ATOM   2030  NZ  LYS A 146      90.865  17.922  16.140  1.00  0.87           N  
ATOM   2031  N   GLU A 147      93.742  12.563  12.096  1.00  0.86           N  
ATOM   2032  CA  GLU A 147      94.477  11.590  11.307  1.00  0.86           C  
ATOM   2033  C   GLU A 147      93.598  10.556  10.605  1.00  0.86           C  
ATOM   2034  O   GLU A 147      93.988   9.412  10.401  1.00  0.86           O  
ATOM   2035  CB  GLU A 147      95.514  10.870  12.187  1.00  0.86           C  
ATOM   2036  CG  GLU A 147      96.550  11.806  12.856  1.00  0.86           C  
ATOM   2037  CD  GLU A 147      97.510  11.020  13.751  1.00  0.86           C  
ATOM   2038  OE1 GLU A 147      98.280  11.687  14.486  1.00  0.86           O  
ATOM   2039  OE2 GLU A 147      97.481   9.764  13.705  1.00  0.86           O  
ATOM   2040  N   GLY A 148      92.367  10.935  10.192  1.00  0.91           N  
ATOM   2041  CA  GLY A 148      91.501  10.048   9.412  1.00  0.91           C  
ATOM   2042  C   GLY A 148      91.756  10.231   7.942  1.00  0.91           C  
ATOM   2043  O   GLY A 148      92.803   9.879   7.415  1.00  0.91           O  
ATOM   2044  N   PHE A 149      90.815  10.851   7.211  1.00  0.91           N  
ATOM   2045  CA  PHE A 149      90.968  11.069   5.782  1.00  0.91           C  
ATOM   2046  C   PHE A 149      92.109  12.005   5.385  1.00  0.91           C  
ATOM   2047  O   PHE A 149      92.603  11.974   4.260  1.00  0.91           O  
ATOM   2048  CB  PHE A 149      89.637  11.567   5.161  1.00  0.91           C  
ATOM   2049  CG  PHE A 149      89.132  12.857   5.742  1.00  0.91           C  
ATOM   2050  CD1 PHE A 149      89.693  14.087   5.355  1.00  0.91           C  
ATOM   2051  CD2 PHE A 149      88.064  12.858   6.651  1.00  0.91           C  
ATOM   2052  CE1 PHE A 149      89.226  15.285   5.898  1.00  0.91           C  
ATOM   2053  CE2 PHE A 149      87.595  14.059   7.195  1.00  0.91           C  
ATOM   2054  CZ  PHE A 149      88.186  15.271   6.829  1.00  0.91           C  
ATOM   2055  N   PHE A 150      92.562  12.872   6.313  1.00  0.92           N  
ATOM   2056  CA  PHE A 150      93.692  13.757   6.104  1.00  0.92           C  
ATOM   2057  C   PHE A 150      95.003  13.029   5.833  1.00  0.92           C  
ATOM   2058  O   PHE A 150      95.798  13.486   5.017  1.00  0.92           O  
ATOM   2059  CB  PHE A 150      93.893  14.747   7.269  1.00  0.92           C  
ATOM   2060  CG  PHE A 150      92.859  15.838   7.294  1.00  0.92           C  
ATOM   2061  CD1 PHE A 150      92.828  16.797   6.268  1.00  0.92           C  
ATOM   2062  CD2 PHE A 150      91.983  15.984   8.381  1.00  0.92           C  
ATOM   2063  CE1 PHE A 150      91.932  17.872   6.320  1.00  0.92           C  
ATOM   2064  CE2 PHE A 150      91.073  17.046   8.423  1.00  0.92           C  
ATOM   2065  CZ  PHE A 150      91.043  17.990   7.391  1.00  0.92           C  
ATOM   2066  N   THR A 151      95.261  11.864   6.471  1.00  0.93           N  
ATOM   2067  CA  THR A 151      96.457  11.063   6.188  1.00  0.93           C  
ATOM   2068  C   THR A 151      96.477  10.554   4.753  1.00  0.93           C  
ATOM   2069  O   THR A 151      97.496  10.605   4.069  1.00  0.93           O  
ATOM   2070  CB  THR A 151      96.688   9.877   7.126  1.00  0.93           C  
ATOM   2071  OG1 THR A 151      95.653   8.910   7.035  1.00  0.93           O  
ATOM   2072  CG2 THR A 151      96.714  10.346   8.582  1.00  0.93           C  
ATOM   2073  N   TYR A 152      95.302  10.102   4.252  1.00  0.92           N  
ATOM   2074  CA  TYR A 152      95.100   9.738   2.861  1.00  0.92           C  
ATOM   2075  C   TYR A 152      95.343  10.914   1.921  1.00  0.92           C  
ATOM   2076  O   TYR A 152      96.054  10.778   0.931  1.00  0.92           O  
ATOM   2077  CB  TYR A 152      93.673   9.159   2.632  1.00  0.92           C  
ATOM   2078  CG  TYR A 152      93.453   8.776   1.188  1.00  0.92           C  
ATOM   2079  CD1 TYR A 152      93.963   7.577   0.671  1.00  0.92           C  
ATOM   2080  CD2 TYR A 152      92.827   9.680   0.312  1.00  0.92           C  
ATOM   2081  CE1 TYR A 152      93.841   7.280  -0.695  1.00  0.92           C  
ATOM   2082  CE2 TYR A 152      92.731   9.399  -1.054  1.00  0.92           C  
ATOM   2083  CZ  TYR A 152      93.234   8.198  -1.554  1.00  0.92           C  
ATOM   2084  OH  TYR A 152      93.113   7.926  -2.926  1.00  0.92           O  
ATOM   2085  N   ILE A 153      94.792  12.110   2.224  1.00  0.95           N  
ATOM   2086  CA  ILE A 153      94.990  13.307   1.406  1.00  0.95           C  
ATOM   2087  C   ILE A 153      96.448  13.704   1.308  1.00  0.95           C  
ATOM   2088  O   ILE A 153      96.948  13.981   0.220  1.00  0.95           O  
ATOM   2089  CB  ILE A 153      94.147  14.484   1.900  1.00  0.95           C  
ATOM   2090  CG1 ILE A 153      92.641  14.239   1.644  1.00  0.95           C  
ATOM   2091  CG2 ILE A 153      94.588  15.845   1.307  1.00  0.95           C  
ATOM   2092  CD1 ILE A 153      92.244  14.169   0.163  1.00  0.95           C  
ATOM   2093  N   CYS A 154      97.192  13.679   2.429  1.00  0.95           N  
ATOM   2094  CA  CYS A 154      98.616  13.961   2.432  1.00  0.95           C  
ATOM   2095  C   CYS A 154      99.420  12.992   1.573  1.00  0.95           C  
ATOM   2096  O   CYS A 154     100.269  13.398   0.782  1.00  0.95           O  
ATOM   2097  CB  CYS A 154      99.159  13.982   3.882  1.00  0.95           C  
ATOM   2098  SG  CYS A 154      98.455  15.350   4.858  1.00  0.95           S  
ATOM   2099  N   GLY A 155      99.105  11.679   1.645  1.00  0.96           N  
ATOM   2100  CA  GLY A 155      99.724  10.681   0.778  1.00  0.96           C  
ATOM   2101  C   GLY A 155      99.336  10.801  -0.676  1.00  0.96           C  
ATOM   2102  O   GLY A 155     100.161  10.625  -1.566  1.00  0.96           O  
ATOM   2103  N   PHE A 156      98.066  11.137  -0.966  1.00  0.92           N  
ATOM   2104  CA  PHE A 156      97.574  11.392  -2.308  1.00  0.92           C  
ATOM   2105  C   PHE A 156      98.244  12.599  -2.966  1.00  0.92           C  
ATOM   2106  O   PHE A 156      98.644  12.534  -4.124  1.00  0.92           O  
ATOM   2107  CB  PHE A 156      96.033  11.542  -2.287  1.00  0.92           C  
ATOM   2108  CG  PHE A 156      95.426  11.364  -3.653  1.00  0.92           C  
ATOM   2109  CD1 PHE A 156      95.304  12.450  -4.527  1.00  0.92           C  
ATOM   2110  CD2 PHE A 156      94.979  10.109  -4.081  1.00  0.92           C  
ATOM   2111  CE1 PHE A 156      94.720  12.298  -5.790  1.00  0.92           C  
ATOM   2112  CE2 PHE A 156      94.364   9.951  -5.330  1.00  0.92           C  
ATOM   2113  CZ  PHE A 156      94.235  11.048  -6.186  1.00  0.92           C  
ATOM   2114  N   ILE A 157      98.442  13.715  -2.227  1.00  0.93           N  
ATOM   2115  CA  ILE A 157      99.195  14.879  -2.699  1.00  0.93           C  
ATOM   2116  C   ILE A 157     100.630  14.510  -3.038  1.00  0.93           C  
ATOM   2117  O   ILE A 157     101.143  14.840  -4.105  1.00  0.93           O  
ATOM   2118  CB  ILE A 157      99.171  16.021  -1.673  1.00  0.93           C  
ATOM   2119  CG1 ILE A 157      97.739  16.595  -1.545  1.00  0.93           C  
ATOM   2120  CG2 ILE A 157     100.175  17.145  -2.040  1.00  0.93           C  
ATOM   2121  CD1 ILE A 157      97.569  17.592  -0.391  1.00  0.93           C  
ATOM   2122  N   GLN A 158     101.308  13.742  -2.166  1.00  0.89           N  
ATOM   2123  CA  GLN A 158     102.701  13.410  -2.383  1.00  0.89           C  
ATOM   2124  C   GLN A 158     102.965  12.384  -3.482  1.00  0.89           C  
ATOM   2125  O   GLN A 158     104.069  12.311  -4.018  1.00  0.89           O  
ATOM   2126  CB  GLN A 158     103.345  12.965  -1.056  1.00  0.89           C  
ATOM   2127  CG  GLN A 158     103.509  14.146  -0.076  1.00  0.89           C  
ATOM   2128  CD  GLN A 158     104.144  13.677   1.230  1.00  0.89           C  
ATOM   2129  OE1 GLN A 158     103.568  12.895   1.983  1.00  0.89           O  
ATOM   2130  NE2 GLN A 158     105.370  14.169   1.530  1.00  0.89           N  
ATOM   2131  N   GLN A 159     101.956  11.583  -3.880  1.00  0.88           N  
ATOM   2132  CA  GLN A 159     102.147  10.509  -4.839  1.00  0.88           C  
ATOM   2133  C   GLN A 159     101.370  10.701  -6.141  1.00  0.88           C  
ATOM   2134  O   GLN A 159     101.819  10.291  -7.216  1.00  0.88           O  
ATOM   2135  CB  GLN A 159     101.694   9.185  -4.185  1.00  0.88           C  
ATOM   2136  CG  GLN A 159     102.459   8.851  -2.881  1.00  0.88           C  
ATOM   2137  CD  GLN A 159     101.795   7.672  -2.170  1.00  0.88           C  
ATOM   2138  OE1 GLN A 159     101.304   6.740  -2.807  1.00  0.88           O  
ATOM   2139  NE2 GLN A 159     101.775   7.712  -0.817  1.00  0.88           N  
ATOM   2140  N   LYS A 160     100.186  11.342  -6.105  1.00  0.90           N  
ATOM   2141  CA  LYS A 160      99.262  11.387  -7.226  1.00  0.90           C  
ATOM   2142  C   LYS A 160      98.943  12.798  -7.681  1.00  0.90           C  
ATOM   2143  O   LYS A 160      98.098  13.003  -8.546  1.00  0.90           O  
ATOM   2144  CB  LYS A 160      97.933  10.676  -6.878  1.00  0.90           C  
ATOM   2145  CG  LYS A 160      98.084   9.255  -6.311  1.00  0.90           C  
ATOM   2146  CD  LYS A 160      98.789   8.268  -7.254  1.00  0.90           C  
ATOM   2147  CE  LYS A 160      98.965   6.895  -6.604  1.00  0.90           C  
ATOM   2148  NZ  LYS A 160      99.560   5.947  -7.566  1.00  0.90           N  
ATOM   2149  N   LEU A 161      99.644  13.823  -7.176  1.00  0.95           N  
ATOM   2150  CA  LEU A 161      99.496  15.160  -7.708  1.00  0.95           C  
ATOM   2151  C   LEU A 161     100.622  15.395  -8.698  1.00  0.95           C  
ATOM   2152  O   LEU A 161     101.787  15.071  -8.454  1.00  0.95           O  
ATOM   2153  CB  LEU A 161      99.462  16.198  -6.569  1.00  0.95           C  
ATOM   2154  CG  LEU A 161      99.155  17.651  -6.971  1.00  0.95           C  
ATOM   2155  CD1 LEU A 161      97.789  17.825  -7.647  1.00  0.95           C  
ATOM   2156  CD2 LEU A 161      99.220  18.545  -5.730  1.00  0.95           C  
ATOM   2157  N   ALA A 162     100.286  15.891  -9.905  1.00  0.98           N  
ATOM   2158  CA  ALA A 162     101.255  16.346 -10.875  1.00  0.98           C  
ATOM   2159  C   ALA A 162     102.003  17.567 -10.381  1.00  0.98           C  
ATOM   2160  O   ALA A 162     101.448  18.414  -9.682  1.00  0.98           O  
ATOM   2161  CB  ALA A 162     100.570  16.664 -12.212  1.00  0.98           C  
ATOM   2162  N   LEU A 163     103.299  17.711 -10.722  1.00  0.95           N  
ATOM   2163  CA  LEU A 163     103.995  18.948 -10.426  1.00  0.95           C  
ATOM   2164  C   LEU A 163     103.396  20.086 -11.218  1.00  0.95           C  
ATOM   2165  O   LEU A 163     103.103  19.931 -12.399  1.00  0.95           O  
ATOM   2166  CB  LEU A 163     105.500  18.897 -10.729  1.00  0.95           C  
ATOM   2167  CG  LEU A 163     106.265  17.751 -10.058  1.00  0.95           C  
ATOM   2168  CD1 LEU A 163     107.699  17.698 -10.587  1.00  0.95           C  
ATOM   2169  CD2 LEU A 163     106.294  17.937  -8.542  1.00  0.95           C  
ATOM   2170  N   GLY A 164     103.171  21.238 -10.567  1.00  0.99           N  
ATOM   2171  CA  GLY A 164     102.423  22.355 -11.128  1.00  0.99           C  
ATOM   2172  C   GLY A 164     100.949  22.282 -10.838  1.00  0.99           C  
ATOM   2173  O   GLY A 164     100.233  23.264 -11.030  1.00  0.99           O  
ATOM   2174  N   GLY A 165     100.463  21.126 -10.332  1.00  1.00           N  
ATOM   2175  CA  GLY A 165      99.085  20.927  -9.902  1.00  1.00           C  
ATOM   2176  C   GLY A 165      98.731  21.676  -8.651  1.00  1.00           C  
ATOM   2177  O   GLY A 165      99.591  22.181  -7.934  1.00  1.00           O  
ATOM   2178  N   SER A 166      97.437  21.734  -8.321  1.00  0.99           N  
ATOM   2179  CA  SER A 166      96.983  22.550  -7.208  1.00  0.99           C  
ATOM   2180  C   SER A 166      95.956  21.808  -6.397  1.00  0.99           C  
ATOM   2181  O   SER A 166      95.416  20.786  -6.817  1.00  0.99           O  
ATOM   2182  CB  SER A 166      96.385  23.898  -7.667  1.00  0.99           C  
ATOM   2183  OG  SER A 166      97.390  24.712  -8.283  1.00  0.99           O  
ATOM   2184  N   VAL A 167      95.664  22.290  -5.175  1.00  1.00           N  
ATOM   2185  CA  VAL A 167      94.704  21.637  -4.304  1.00  1.00           C  
ATOM   2186  C   VAL A 167      93.842  22.666  -3.615  1.00  1.00           C  
ATOM   2187  O   VAL A 167      94.264  23.799  -3.406  1.00  1.00           O  
ATOM   2188  CB  VAL A 167      95.330  20.715  -3.246  1.00  1.00           C  
ATOM   2189  CG1 VAL A 167      96.277  19.705  -3.916  1.00  1.00           C  
ATOM   2190  CG2 VAL A 167      96.102  21.482  -2.154  1.00  1.00           C  
ATOM   2191  N   ALA A 168      92.601  22.291  -3.247  1.00  1.00           N  
ATOM   2192  CA  ALA A 168      91.784  23.055  -2.329  1.00  1.00           C  
ATOM   2193  C   ALA A 168      91.163  22.086  -1.335  1.00  1.00           C  
ATOM   2194  O   ALA A 168      90.301  21.282  -1.687  1.00  1.00           O  
ATOM   2195  CB  ALA A 168      90.684  23.840  -3.072  1.00  1.00           C  
ATOM   2196  N   ILE A 169      91.598  22.118  -0.060  1.00  0.98           N  
ATOM   2197  CA  ILE A 169      91.217  21.110   0.918  1.00  0.98           C  
ATOM   2198  C   ILE A 169      90.487  21.786   2.051  1.00  0.98           C  
ATOM   2199  O   ILE A 169      91.019  22.665   2.726  1.00  0.98           O  
ATOM   2200  CB  ILE A 169      92.421  20.353   1.479  1.00  0.98           C  
ATOM   2201  CG1 ILE A 169      93.339  19.792   0.362  1.00  0.98           C  
ATOM   2202  CG2 ILE A 169      91.970  19.244   2.459  1.00  0.98           C  
ATOM   2203  CD1 ILE A 169      92.675  18.798  -0.597  1.00  0.98           C  
ATOM   2204  N   LYS A 170      89.219  21.416   2.280  1.00  0.96           N  
ATOM   2205  CA  LYS A 170      88.449  21.960   3.371  1.00  0.96           C  
ATOM   2206  C   LYS A 170      88.960  21.592   4.755  1.00  0.96           C  
ATOM   2207  O   LYS A 170      89.233  20.433   5.068  1.00  0.96           O  
ATOM   2208  CB  LYS A 170      86.959  21.606   3.213  1.00  0.96           C  
ATOM   2209  CG  LYS A 170      86.024  22.531   3.999  1.00  0.96           C  
ATOM   2210  CD  LYS A 170      85.591  21.971   5.364  1.00  0.96           C  
ATOM   2211  CE  LYS A 170      84.454  20.955   5.296  1.00  0.96           C  
ATOM   2212  NZ  LYS A 170      83.287  21.547   4.633  1.00  0.96           N  
ATOM   2213  N   ILE A 171      89.073  22.604   5.628  1.00  0.98           N  
ATOM   2214  CA  ILE A 171      89.440  22.447   7.012  1.00  0.98           C  
ATOM   2215  C   ILE A 171      88.449  23.240   7.827  1.00  0.98           C  
ATOM   2216  O   ILE A 171      87.681  24.046   7.302  1.00  0.98           O  
ATOM   2217  CB  ILE A 171      90.858  22.914   7.339  1.00  0.98           C  
ATOM   2218  CG1 ILE A 171      91.078  24.420   7.060  1.00  0.98           C  
ATOM   2219  CG2 ILE A 171      91.859  22.020   6.573  1.00  0.98           C  
ATOM   2220  CD1 ILE A 171      92.317  24.966   7.770  1.00  0.98           C  
ATOM   2221  N   THR A 172      88.431  23.019   9.149  1.00  0.95           N  
ATOM   2222  CA  THR A 172      87.666  23.802  10.108  1.00  0.95           C  
ATOM   2223  C   THR A 172      88.579  24.045  11.290  1.00  0.95           C  
ATOM   2224  O   THR A 172      89.758  23.702  11.258  1.00  0.95           O  
ATOM   2225  CB  THR A 172      86.317  23.219  10.577  1.00  0.95           C  
ATOM   2226  OG1 THR A 172      86.418  22.022  11.339  1.00  0.95           O  
ATOM   2227  CG2 THR A 172      85.429  22.899   9.368  1.00  0.95           C  
ATOM   2228  N   GLU A 173      88.070  24.646  12.389  1.00  0.89           N  
ATOM   2229  CA  GLU A 173      88.792  24.699  13.660  1.00  0.89           C  
ATOM   2230  C   GLU A 173      89.209  23.330  14.163  1.00  0.89           C  
ATOM   2231  O   GLU A 173      90.359  23.135  14.537  1.00  0.89           O  
ATOM   2232  CB  GLU A 173      87.942  25.345  14.787  1.00  0.89           C  
ATOM   2233  CG  GLU A 173      88.587  25.355  16.202  1.00  0.89           C  
ATOM   2234  CD  GLU A 173      87.668  25.959  17.263  1.00  0.89           C  
ATOM   2235  OE1 GLU A 173      86.451  26.123  16.990  1.00  0.89           O  
ATOM   2236  OE2 GLU A 173      88.185  26.286  18.362  1.00  0.89           O  
ATOM   2237  N   HIS A 174      88.294  22.340  14.134  1.00  0.86           N  
ATOM   2238  CA  HIS A 174      88.565  21.031  14.688  1.00  0.86           C  
ATOM   2239  C   HIS A 174      88.903  19.993  13.638  1.00  0.86           C  
ATOM   2240  O   HIS A 174      89.530  18.984  13.951  1.00  0.86           O  
ATOM   2241  CB  HIS A 174      87.339  20.535  15.473  1.00  0.86           C  
ATOM   2242  CG  HIS A 174      87.091  21.334  16.700  1.00  0.86           C  
ATOM   2243  ND1 HIS A 174      87.826  21.034  17.826  1.00  0.86           N  
ATOM   2244  CD2 HIS A 174      86.240  22.362  16.941  1.00  0.86           C  
ATOM   2245  CE1 HIS A 174      87.403  21.885  18.740  1.00  0.86           C  
ATOM   2246  NE2 HIS A 174      86.447  22.718  18.255  1.00  0.86           N  
ATOM   2247  N   SER A 175      88.547  20.213  12.358  1.00  0.92           N  
ATOM   2248  CA  SER A 175      88.892  19.292  11.283  1.00  0.92           C  
ATOM   2249  C   SER A 175      90.086  19.857  10.548  1.00  0.92           C  
ATOM   2250  O   SER A 175      89.945  20.711   9.680  1.00  0.92           O  
ATOM   2251  CB  SER A 175      87.714  19.077  10.292  1.00  0.92           C  
ATOM   2252  OG  SER A 175      87.921  17.967   9.418  1.00  0.92           O  
ATOM   2253  N   TRP A 176      91.304  19.416  10.900  1.00  0.93           N  
ATOM   2254  CA  TRP A 176      92.517  19.935  10.311  1.00  0.93           C  
ATOM   2255  C   TRP A 176      93.603  18.912  10.522  1.00  0.93           C  
ATOM   2256  O   TRP A 176      93.434  17.967  11.291  1.00  0.93           O  
ATOM   2257  CB  TRP A 176      92.962  21.283  10.949  1.00  0.93           C  
ATOM   2258  CG  TRP A 176      93.339  21.197  12.425  1.00  0.93           C  
ATOM   2259  CD1 TRP A 176      92.511  21.057  13.499  1.00  0.93           C  
ATOM   2260  CD2 TRP A 176      94.679  21.170  12.950  1.00  0.93           C  
ATOM   2261  NE1 TRP A 176      93.238  20.944  14.660  1.00  0.93           N  
ATOM   2262  CE2 TRP A 176      94.572  21.012  14.346  1.00  0.93           C  
ATOM   2263  CE3 TRP A 176      95.919  21.271  12.333  1.00  0.93           C  
ATOM   2264  CZ2 TRP A 176      95.704  20.955  15.149  1.00  0.93           C  
ATOM   2265  CZ3 TRP A 176      97.059  21.211  13.143  1.00  0.93           C  
ATOM   2266  CH2 TRP A 176      96.955  21.049  14.527  1.00  0.93           C  
ATOM   2267  N   ASN A 177      94.754  19.083   9.853  1.00  0.94           N  
ATOM   2268  CA  ASN A 177      95.872  18.196  10.044  1.00  0.94           C  
ATOM   2269  C   ASN A 177      97.165  18.987   9.880  1.00  0.94           C  
ATOM   2270  O   ASN A 177      97.301  19.818   8.984  1.00  0.94           O  
ATOM   2271  CB  ASN A 177      95.696  17.010   9.069  1.00  0.94           C  
ATOM   2272  CG  ASN A 177      96.869  16.045   9.017  1.00  0.94           C  
ATOM   2273  OD1 ASN A 177      97.858  16.383   8.373  1.00  0.94           O  
ATOM   2274  ND2 ASN A 177      96.779  14.850   9.634  1.00  0.94           N  
ATOM   2275  N   ALA A 178      98.133  18.755  10.791  1.00  0.97           N  
ATOM   2276  CA  ALA A 178      99.447  19.366  10.829  1.00  0.97           C  
ATOM   2277  C   ALA A 178     100.347  19.049   9.636  1.00  0.97           C  
ATOM   2278  O   ALA A 178     101.016  19.938   9.107  1.00  0.97           O  
ATOM   2279  CB  ALA A 178     100.161  18.997  12.147  1.00  0.97           C  
ATOM   2280  N   ASP A 179     100.362  17.786   9.165  1.00  0.94           N  
ATOM   2281  CA  ASP A 179     101.082  17.349   7.980  1.00  0.94           C  
ATOM   2282  C   ASP A 179     100.556  18.031   6.729  1.00  0.94           C  
ATOM   2283  O   ASP A 179     101.315  18.438   5.855  1.00  0.94           O  
ATOM   2284  CB  ASP A 179     101.048  15.810   7.840  1.00  0.94           C  
ATOM   2285  CG  ASP A 179     101.859  15.163   8.952  1.00  0.94           C  
ATOM   2286  OD1 ASP A 179     102.780  15.835   9.489  1.00  0.94           O  
ATOM   2287  OD2 ASP A 179     101.554  13.988   9.267  1.00  0.94           O  
ATOM   2288  N   LEU A 180      99.229  18.240   6.635  1.00  0.95           N  
ATOM   2289  CA  LEU A 180      98.632  18.990   5.541  1.00  0.95           C  
ATOM   2290  C   LEU A 180      99.099  20.443   5.451  1.00  0.95           C  
ATOM   2291  O   LEU A 180      99.447  20.930   4.378  1.00  0.95           O  
ATOM   2292  CB  LEU A 180      97.089  18.939   5.585  1.00  0.95           C  
ATOM   2293  CG  LEU A 180      96.394  19.653   4.407  1.00  0.95           C  
ATOM   2294  CD1 LEU A 180      96.810  19.086   3.039  1.00  0.95           C  
ATOM   2295  CD2 LEU A 180      94.874  19.600   4.575  1.00  0.95           C  
ATOM   2296  N   TYR A 181      99.176  21.167   6.590  1.00  0.95           N  
ATOM   2297  CA  TYR A 181      99.799  22.485   6.653  1.00  0.95           C  
ATOM   2298  C   TYR A 181     101.275  22.458   6.299  1.00  0.95           C  
ATOM   2299  O   TYR A 181     101.784  23.355   5.635  1.00  0.95           O  
ATOM   2300  CB  TYR A 181      99.690  23.124   8.051  1.00  0.95           C  
ATOM   2301  CG  TYR A 181      98.372  23.791   8.273  1.00  0.95           C  
ATOM   2302  CD1 TYR A 181      98.117  25.040   7.688  1.00  0.95           C  
ATOM   2303  CD2 TYR A 181      97.424  23.241   9.146  1.00  0.95           C  
ATOM   2304  CE1 TYR A 181      96.952  25.746   8.003  1.00  0.95           C  
ATOM   2305  CE2 TYR A 181      96.241  23.932   9.435  1.00  0.95           C  
ATOM   2306  CZ  TYR A 181      96.020  25.200   8.885  1.00  0.95           C  
ATOM   2307  OH  TYR A 181      94.902  25.967   9.253  1.00  0.95           O  
ATOM   2308  N   LYS A 182     102.007  21.413   6.727  1.00  0.90           N  
ATOM   2309  CA  LYS A 182     103.384  21.206   6.318  1.00  0.90           C  
ATOM   2310  C   LYS A 182     103.549  21.023   4.811  1.00  0.90           C  
ATOM   2311  O   LYS A 182     104.457  21.582   4.200  1.00  0.90           O  
ATOM   2312  CB  LYS A 182     104.018  20.024   7.079  1.00  0.90           C  
ATOM   2313  CG  LYS A 182     105.519  19.849   6.799  1.00  0.90           C  
ATOM   2314  CD  LYS A 182     106.161  18.713   7.613  1.00  0.90           C  
ATOM   2315  CE  LYS A 182     106.173  18.905   9.132  1.00  0.90           C  
ATOM   2316  NZ  LYS A 182     106.904  20.139   9.483  1.00  0.90           N  
ATOM   2317  N   LEU A 183     102.633  20.273   4.170  1.00  0.94           N  
ATOM   2318  CA  LEU A 183     102.587  20.092   2.731  1.00  0.94           C  
ATOM   2319  C   LEU A 183     102.220  21.329   1.936  1.00  0.94           C  
ATOM   2320  O   LEU A 183     102.557  21.420   0.760  1.00  0.94           O  
ATOM   2321  CB  LEU A 183     101.617  18.966   2.324  1.00  0.94           C  
ATOM   2322  CG  LEU A 183     102.146  17.547   2.574  1.00  0.94           C  
ATOM   2323  CD1 LEU A 183     101.076  16.538   2.150  1.00  0.94           C  
ATOM   2324  CD2 LEU A 183     103.444  17.268   1.807  1.00  0.94           C  
ATOM   2325  N   MET A 184     101.596  22.357   2.543  1.00  0.93           N  
ATOM   2326  CA  MET A 184     101.390  23.646   1.898  1.00  0.93           C  
ATOM   2327  C   MET A 184     102.702  24.356   1.567  1.00  0.93           C  
ATOM   2328  O   MET A 184     102.791  25.169   0.650  1.00  0.93           O  
ATOM   2329  CB  MET A 184     100.531  24.586   2.767  1.00  0.93           C  
ATOM   2330  CG  MET A 184      99.054  24.185   2.949  1.00  0.93           C  
ATOM   2331  SD  MET A 184      98.096  24.140   1.402  1.00  0.93           S  
ATOM   2332  CE  MET A 184      98.117  22.336   1.216  1.00  0.93           C  
ATOM   2333  N   GLY A 185     103.789  23.997   2.284  1.00  0.95           N  
ATOM   2334  CA  GLY A 185     105.135  24.473   2.009  1.00  0.95           C  
ATOM   2335  C   GLY A 185     105.785  23.802   0.829  1.00  0.95           C  
ATOM   2336  O   GLY A 185     106.883  24.179   0.440  1.00  0.95           O  
ATOM   2337  N   HIS A 186     105.117  22.803   0.215  1.00  0.91           N  
ATOM   2338  CA  HIS A 186     105.595  22.091  -0.961  1.00  0.91           C  
ATOM   2339  C   HIS A 186     104.959  22.598  -2.245  1.00  0.91           C  
ATOM   2340  O   HIS A 186     105.111  22.016  -3.318  1.00  0.91           O  
ATOM   2341  CB  HIS A 186     105.336  20.575  -0.860  1.00  0.91           C  
ATOM   2342  CG  HIS A 186     106.090  19.903   0.246  1.00  0.91           C  
ATOM   2343  ND1 HIS A 186     106.710  18.700  -0.029  1.00  0.91           N  
ATOM   2344  CD2 HIS A 186     106.277  20.236   1.550  1.00  0.91           C  
ATOM   2345  CE1 HIS A 186     107.262  18.328   1.101  1.00  0.91           C  
ATOM   2346  NE2 HIS A 186     107.033  19.220   2.094  1.00  0.91           N  
ATOM   2347  N   PHE A 187     104.239  23.724  -2.159  1.00  0.94           N  
ATOM   2348  CA  PHE A 187     103.645  24.409  -3.282  1.00  0.94           C  
ATOM   2349  C   PHE A 187     104.357  25.734  -3.418  1.00  0.94           C  
ATOM   2350  O   PHE A 187     104.954  26.224  -2.460  1.00  0.94           O  
ATOM   2351  CB  PHE A 187     102.142  24.687  -3.051  1.00  0.94           C  
ATOM   2352  CG  PHE A 187     101.343  23.419  -3.052  1.00  0.94           C  
ATOM   2353  CD1 PHE A 187     101.284  22.607  -1.912  1.00  0.94           C  
ATOM   2354  CD2 PHE A 187     100.613  23.037  -4.185  1.00  0.94           C  
ATOM   2355  CE1 PHE A 187     100.539  21.423  -1.910  1.00  0.94           C  
ATOM   2356  CE2 PHE A 187      99.842  21.870  -4.181  1.00  0.94           C  
ATOM   2357  CZ  PHE A 187      99.818  21.052  -3.048  1.00  0.94           C  
ATOM   2358  N   ALA A 188     104.312  26.363  -4.611  1.00  0.95           N  
ATOM   2359  CA  ALA A 188     104.882  27.676  -4.854  1.00  0.95           C  
ATOM   2360  C   ALA A 188     104.258  28.746  -3.979  1.00  0.95           C  
ATOM   2361  O   ALA A 188     104.935  29.619  -3.438  1.00  0.95           O  
ATOM   2362  CB  ALA A 188     104.726  28.057  -6.334  1.00  0.95           C  
ATOM   2363  N   TRP A 189     102.940  28.643  -3.771  1.00  0.87           N  
ATOM   2364  CA  TRP A 189     102.232  29.539  -2.904  1.00  0.87           C  
ATOM   2365  C   TRP A 189     101.063  28.789  -2.298  1.00  0.87           C  
ATOM   2366  O   TRP A 189     100.656  27.733  -2.775  1.00  0.87           O  
ATOM   2367  CB  TRP A 189     101.777  30.778  -3.705  1.00  0.87           C  
ATOM   2368  CG  TRP A 189     101.071  31.840  -2.896  1.00  0.87           C  
ATOM   2369  CD1 TRP A 189     101.590  32.831  -2.115  1.00  0.87           C  
ATOM   2370  CD2 TRP A 189      99.645  31.957  -2.808  1.00  0.87           C  
ATOM   2371  NE1 TRP A 189     100.576  33.564  -1.538  1.00  0.87           N  
ATOM   2372  CE2 TRP A 189      99.377  33.055  -1.974  1.00  0.87           C  
ATOM   2373  CE3 TRP A 189      98.619  31.217  -3.386  1.00  0.87           C  
ATOM   2374  CZ2 TRP A 189      98.080  33.462  -1.728  1.00  0.87           C  
ATOM   2375  CZ3 TRP A 189      97.304  31.614  -3.122  1.00  0.87           C  
ATOM   2376  CH2 TRP A 189      97.047  32.728  -2.318  1.00  0.87           C  
ATOM   2377  N   TRP A 190     100.497  29.322  -1.202  1.00  0.92           N  
ATOM   2378  CA  TRP A 190      99.362  28.710  -0.558  1.00  0.92           C  
ATOM   2379  C   TRP A 190      98.580  29.761   0.201  1.00  0.92           C  
ATOM   2380  O   TRP A 190      99.083  30.859   0.438  1.00  0.92           O  
ATOM   2381  CB  TRP A 190      99.779  27.571   0.418  1.00  0.92           C  
ATOM   2382  CG  TRP A 190     100.452  28.018   1.708  1.00  0.92           C  
ATOM   2383  CD1 TRP A 190     101.750  28.369   1.937  1.00  0.92           C  
ATOM   2384  CD2 TRP A 190      99.775  28.134   2.973  1.00  0.92           C  
ATOM   2385  NE1 TRP A 190     101.922  28.742   3.255  1.00  0.92           N  
ATOM   2386  CE2 TRP A 190     100.719  28.593   3.905  1.00  0.92           C  
ATOM   2387  CE3 TRP A 190      98.464  27.867   3.349  1.00  0.92           C  
ATOM   2388  CZ2 TRP A 190     100.371  28.802   5.233  1.00  0.92           C  
ATOM   2389  CZ3 TRP A 190      98.105  28.105   4.680  1.00  0.92           C  
ATOM   2390  CH2 TRP A 190      99.045  28.555   5.609  1.00  0.92           C  
ATOM   2391  N   THR A 191      97.342  29.443   0.623  1.00  0.96           N  
ATOM   2392  CA  THR A 191      96.580  30.290   1.534  1.00  0.96           C  
ATOM   2393  C   THR A 191      95.480  29.491   2.192  1.00  0.96           C  
ATOM   2394  O   THR A 191      95.215  28.351   1.818  1.00  0.96           O  
ATOM   2395  CB  THR A 191      95.977  31.540   0.887  1.00  0.96           C  
ATOM   2396  OG1 THR A 191      95.512  32.480   1.848  1.00  0.96           O  
ATOM   2397  CG2 THR A 191      94.822  31.196  -0.068  1.00  0.96           C  
ATOM   2398  N   ALA A 192      94.804  30.096   3.186  1.00  0.97           N  
ATOM   2399  CA  ALA A 192      93.563  29.620   3.743  1.00  0.97           C  
ATOM   2400  C   ALA A 192      92.489  30.591   3.276  1.00  0.97           C  
ATOM   2401  O   ALA A 192      92.563  31.787   3.549  1.00  0.97           O  
ATOM   2402  CB  ALA A 192      93.623  29.587   5.284  1.00  0.97           C  
ATOM   2403  N   PHE A 193      91.482  30.103   2.527  1.00  0.95           N  
ATOM   2404  CA  PHE A 193      90.454  30.935   1.930  1.00  0.95           C  
ATOM   2405  C   PHE A 193      89.117  30.666   2.600  1.00  0.95           C  
ATOM   2406  O   PHE A 193      88.685  29.523   2.732  1.00  0.95           O  
ATOM   2407  CB  PHE A 193      90.370  30.662   0.402  1.00  0.95           C  
ATOM   2408  CG  PHE A 193      89.265  31.423  -0.282  1.00  0.95           C  
ATOM   2409  CD1 PHE A 193      89.378  32.802  -0.511  1.00  0.95           C  
ATOM   2410  CD2 PHE A 193      88.085  30.765  -0.669  1.00  0.95           C  
ATOM   2411  CE1 PHE A 193      88.337  33.508  -1.125  1.00  0.95           C  
ATOM   2412  CE2 PHE A 193      87.047  31.470  -1.287  1.00  0.95           C  
ATOM   2413  CZ  PHE A 193      87.173  32.840  -1.515  1.00  0.95           C  
ATOM   2414  N   VAL A 194      88.429  31.741   3.019  1.00  0.93           N  
ATOM   2415  CA  VAL A 194      87.125  31.693   3.647  1.00  0.93           C  
ATOM   2416  C   VAL A 194      86.133  32.253   2.657  1.00  0.93           C  
ATOM   2417  O   VAL A 194      86.281  33.384   2.204  1.00  0.93           O  
ATOM   2418  CB  VAL A 194      87.101  32.559   4.900  1.00  0.93           C  
ATOM   2419  CG1 VAL A 194      85.690  32.661   5.512  1.00  0.93           C  
ATOM   2420  CG2 VAL A 194      88.080  31.953   5.918  1.00  0.93           C  
ATOM   2421  N   THR A 195      85.101  31.472   2.270  1.00  0.93           N  
ATOM   2422  CA  THR A 195      83.999  31.960   1.446  1.00  0.93           C  
ATOM   2423  C   THR A 195      83.177  33.007   2.179  1.00  0.93           C  
ATOM   2424  O   THR A 195      82.907  32.879   3.372  1.00  0.93           O  
ATOM   2425  CB  THR A 195      83.066  30.865   0.912  1.00  0.93           C  
ATOM   2426  OG1 THR A 195      82.348  30.181   1.928  1.00  0.93           O  
ATOM   2427  CG2 THR A 195      83.872  29.787   0.178  1.00  0.93           C  
ATOM   2428  N   ASN A 196      82.730  34.082   1.498  1.00  0.87           N  
ATOM   2429  CA  ASN A 196      81.913  35.102   2.139  1.00  0.87           C  
ATOM   2430  C   ASN A 196      80.531  34.599   2.553  1.00  0.87           C  
ATOM   2431  O   ASN A 196      79.956  35.079   3.528  1.00  0.87           O  
ATOM   2432  CB  ASN A 196      81.764  36.358   1.248  1.00  0.87           C  
ATOM   2433  CG  ASN A 196      82.909  37.342   1.470  1.00  0.87           C  
ATOM   2434  OD1 ASN A 196      83.686  37.272   2.418  1.00  0.87           O  
ATOM   2435  ND2 ASN A 196      83.015  38.329   0.550  1.00  0.87           N  
ATOM   2436  N   VAL A 197      79.951  33.608   1.845  1.00  0.89           N  
ATOM   2437  CA  VAL A 197      78.665  33.034   2.229  1.00  0.89           C  
ATOM   2438  C   VAL A 197      78.677  32.231   3.521  1.00  0.89           C  
ATOM   2439  O   VAL A 197      77.647  32.112   4.179  1.00  0.89           O  
ATOM   2440  CB  VAL A 197      78.003  32.177   1.152  1.00  0.89           C  
ATOM   2441  CG1 VAL A 197      77.628  33.071  -0.037  1.00  0.89           C  
ATOM   2442  CG2 VAL A 197      78.874  30.980   0.724  1.00  0.89           C  
ATOM   2443  N   ASN A 198      79.842  31.669   3.911  1.00  0.86           N  
ATOM   2444  CA  ASN A 198      79.974  30.795   5.060  1.00  0.86           C  
ATOM   2445  C   ASN A 198      80.971  31.373   6.059  1.00  0.86           C  
ATOM   2446  O   ASN A 198      81.582  30.664   6.856  1.00  0.86           O  
ATOM   2447  CB  ASN A 198      80.393  29.373   4.604  1.00  0.86           C  
ATOM   2448  CG  ASN A 198      79.986  28.341   5.650  1.00  0.86           C  
ATOM   2449  OD1 ASN A 198      79.013  28.486   6.386  1.00  0.86           O  
ATOM   2450  ND2 ASN A 198      80.725  27.215   5.737  1.00  0.86           N  
ATOM   2451  N   ALA A 199      81.156  32.709   6.062  1.00  0.89           N  
ATOM   2452  CA  ALA A 199      82.110  33.393   6.910  1.00  0.89           C  
ATOM   2453  C   ALA A 199      81.827  33.340   8.419  1.00  0.89           C  
ATOM   2454  O   ALA A 199      82.685  33.675   9.235  1.00  0.89           O  
ATOM   2455  CB  ALA A 199      82.231  34.850   6.446  1.00  0.89           C  
ATOM   2456  N   SER A 200      80.632  32.853   8.816  1.00  0.84           N  
ATOM   2457  CA  SER A 200      80.203  32.620  10.189  1.00  0.84           C  
ATOM   2458  C   SER A 200      80.693  31.281  10.711  1.00  0.84           C  
ATOM   2459  O   SER A 200      80.550  30.962  11.891  1.00  0.84           O  
ATOM   2460  CB  SER A 200      78.651  32.654  10.315  1.00  0.84           C  
ATOM   2461  OG  SER A 200      78.002  31.735   9.437  1.00  0.84           O  
ATOM   2462  N   SER A 201      81.334  30.473   9.842  1.00  0.88           N  
ATOM   2463  CA  SER A 201      81.949  29.211  10.204  1.00  0.88           C  
ATOM   2464  C   SER A 201      83.459  29.345  10.259  1.00  0.88           C  
ATOM   2465  O   SER A 201      84.068  30.221   9.642  1.00  0.88           O  
ATOM   2466  CB  SER A 201      81.550  28.095   9.198  1.00  0.88           C  
ATOM   2467  OG  SER A 201      82.114  26.807   9.485  1.00  0.88           O  
ATOM   2468  N   SER A 202      84.115  28.431  11.017  1.00  0.90           N  
ATOM   2469  CA  SER A 202      85.565  28.323  11.157  1.00  0.90           C  
ATOM   2470  C   SER A 202      86.164  27.558   9.985  1.00  0.90           C  
ATOM   2471  O   SER A 202      87.375  27.355   9.904  1.00  0.90           O  
ATOM   2472  CB  SER A 202      86.006  27.611  12.477  1.00  0.90           C  
ATOM   2473  OG  SER A 202      85.532  26.262  12.584  1.00  0.90           O  
ATOM   2474  N   GLU A 203      85.310  27.154   9.023  1.00  0.91           N  
ATOM   2475  CA  GLU A 203      85.667  26.595   7.734  1.00  0.91           C  
ATOM   2476  C   GLU A 203      86.581  27.488   6.920  1.00  0.91           C  
ATOM   2477  O   GLU A 203      86.456  28.714   6.904  1.00  0.91           O  
ATOM   2478  CB  GLU A 203      84.384  26.241   6.924  1.00  0.91           C  
ATOM   2479  CG  GLU A 203      84.560  25.733   5.469  1.00  0.91           C  
ATOM   2480  CD  GLU A 203      83.237  25.376   4.825  1.00  0.91           C  
ATOM   2481  OE1 GLU A 203      82.749  24.212   4.930  1.00  0.91           O  
ATOM   2482  OE2 GLU A 203      82.645  26.280   4.189  1.00  0.91           O  
ATOM   2483  N   ALA A 204      87.538  26.852   6.235  1.00  0.98           N  
ATOM   2484  CA  ALA A 204      88.338  27.486   5.233  1.00  0.98           C  
ATOM   2485  C   ALA A 204      88.792  26.401   4.296  1.00  0.98           C  
ATOM   2486  O   ALA A 204      88.780  25.219   4.632  1.00  0.98           O  
ATOM   2487  CB  ALA A 204      89.569  28.197   5.825  1.00  0.98           C  
ATOM   2488  N   PHE A 205      89.201  26.787   3.084  1.00  0.99           N  
ATOM   2489  CA  PHE A 205      89.819  25.889   2.140  1.00  0.99           C  
ATOM   2490  C   PHE A 205      91.297  26.197   2.140  1.00  0.99           C  
ATOM   2491  O   PHE A 205      91.713  27.317   1.844  1.00  0.99           O  
ATOM   2492  CB  PHE A 205      89.265  26.061   0.705  1.00  0.99           C  
ATOM   2493  CG  PHE A 205      87.870  25.512   0.624  1.00  0.99           C  
ATOM   2494  CD1 PHE A 205      86.756  26.310   0.936  1.00  0.99           C  
ATOM   2495  CD2 PHE A 205      87.662  24.170   0.268  1.00  0.99           C  
ATOM   2496  CE1 PHE A 205      85.463  25.773   0.909  1.00  0.99           C  
ATOM   2497  CE2 PHE A 205      86.369  23.634   0.230  1.00  0.99           C  
ATOM   2498  CZ  PHE A 205      85.268  24.434   0.552  1.00  0.99           C  
ATOM   2499  N   LEU A 206      92.135  25.200   2.488  1.00  0.98           N  
ATOM   2500  CA  LEU A 206      93.572  25.287   2.333  1.00  0.98           C  
ATOM   2501  C   LEU A 206      93.906  25.068   0.882  1.00  0.98           C  
ATOM   2502  O   LEU A 206      93.676  23.998   0.322  1.00  0.98           O  
ATOM   2503  CB  LEU A 206      94.367  24.256   3.170  1.00  0.98           C  
ATOM   2504  CG  LEU A 206      94.363  24.495   4.689  1.00  0.98           C  
ATOM   2505  CD1 LEU A 206      95.278  23.475   5.383  1.00  0.98           C  
ATOM   2506  CD2 LEU A 206      94.800  25.915   5.072  1.00  0.98           C  
ATOM   2507  N   ILE A 207      94.438  26.113   0.241  1.00  0.98           N  
ATOM   2508  CA  ILE A 207      94.680  26.127  -1.180  1.00  0.98           C  
ATOM   2509  C   ILE A 207      96.164  26.107  -1.367  1.00  0.98           C  
ATOM   2510  O   ILE A 207      96.858  27.026  -0.949  1.00  0.98           O  
ATOM   2511  CB  ILE A 207      94.074  27.341  -1.871  1.00  0.98           C  
ATOM   2512  CG1 ILE A 207      92.536  27.278  -1.741  1.00  0.98           C  
ATOM   2513  CG2 ILE A 207      94.505  27.383  -3.356  1.00  0.98           C  
ATOM   2514  CD1 ILE A 207      91.816  28.549  -2.193  1.00  0.98           C  
ATOM   2515  N   GLY A 208      96.681  25.046  -2.006  1.00  1.00           N  
ATOM   2516  CA  GLY A 208      98.075  24.951  -2.398  1.00  1.00           C  
ATOM   2517  C   GLY A 208      98.097  25.192  -3.870  1.00  1.00           C  
ATOM   2518  O   GLY A 208      97.394  24.512  -4.612  1.00  1.00           O  
ATOM   2519  N   CYS A 209      98.888  26.167  -4.344  1.00  0.97           N  
ATOM   2520  CA  CYS A 209      98.916  26.514  -5.749  1.00  0.97           C  
ATOM   2521  C   CYS A 209     100.280  26.190  -6.310  1.00  0.97           C  
ATOM   2522  O   CYS A 209     101.302  26.676  -5.827  1.00  0.97           O  
ATOM   2523  CB  CYS A 209      98.576  28.008  -5.994  1.00  0.97           C  
ATOM   2524  SG  CYS A 209      98.090  28.378  -7.716  1.00  0.97           S  
ATOM   2525  N   ASN A 210     100.299  25.310  -7.330  1.00  0.93           N  
ATOM   2526  CA  ASN A 210     101.480  24.910  -8.065  1.00  0.93           C  
ATOM   2527  C   ASN A 210     102.454  24.040  -7.283  1.00  0.93           C  
ATOM   2528  O   ASN A 210     103.441  24.502  -6.716  1.00  0.93           O  
ATOM   2529  CB  ASN A 210     102.204  26.070  -8.782  1.00  0.93           C  
ATOM   2530  CG  ASN A 210     101.264  26.929  -9.624  1.00  0.93           C  
ATOM   2531  OD1 ASN A 210     101.261  28.152  -9.496  1.00  0.93           O  
ATOM   2532  ND2 ASN A 210     100.451  26.318 -10.517  1.00  0.93           N  
ATOM   2533  N   TYR A 211     102.174  22.727  -7.217  1.00  0.93           N  
ATOM   2534  CA  TYR A 211     102.973  21.745  -6.506  1.00  0.93           C  
ATOM   2535  C   TYR A 211     104.403  21.603  -7.021  1.00  0.93           C  
ATOM   2536  O   TYR A 211     104.637  21.412  -8.213  1.00  0.93           O  
ATOM   2537  CB  TYR A 211     102.217  20.393  -6.544  1.00  0.93           C  
ATOM   2538  CG  TYR A 211     102.845  19.288  -5.737  1.00  0.93           C  
ATOM   2539  CD1 TYR A 211     103.123  19.436  -4.368  1.00  0.93           C  
ATOM   2540  CD2 TYR A 211     103.125  18.059  -6.353  1.00  0.93           C  
ATOM   2541  CE1 TYR A 211     103.676  18.375  -3.637  1.00  0.93           C  
ATOM   2542  CE2 TYR A 211     103.687  17.002  -5.626  1.00  0.93           C  
ATOM   2543  CZ  TYR A 211     103.963  17.163  -4.265  1.00  0.93           C  
ATOM   2544  OH  TYR A 211     104.589  16.138  -3.533  1.00  0.93           O  
ATOM   2545  N   LEU A 212     105.398  21.679  -6.115  1.00  0.89           N  
ATOM   2546  CA  LEU A 212     106.799  21.646  -6.496  1.00  0.89           C  
ATOM   2547  C   LEU A 212     107.471  20.335  -6.149  1.00  0.89           C  
ATOM   2548  O   LEU A 212     108.600  20.080  -6.561  1.00  0.89           O  
ATOM   2549  CB  LEU A 212     107.562  22.770  -5.763  1.00  0.89           C  
ATOM   2550  CG  LEU A 212     107.050  24.189  -6.073  1.00  0.89           C  
ATOM   2551  CD1 LEU A 212     107.827  25.221  -5.244  1.00  0.89           C  
ATOM   2552  CD2 LEU A 212     107.119  24.532  -7.569  1.00  0.89           C  
ATOM   2553  N   GLY A 213     106.786  19.452  -5.392  1.00  0.90           N  
ATOM   2554  CA  GLY A 213     107.302  18.126  -5.059  1.00  0.90           C  
ATOM   2555  C   GLY A 213     108.335  18.101  -3.976  1.00  0.90           C  
ATOM   2556  O   GLY A 213     108.914  17.062  -3.684  1.00  0.90           O  
ATOM   2557  N   LYS A 214     108.607  19.256  -3.358  1.00  0.83           N  
ATOM   2558  CA  LYS A 214     109.624  19.366  -2.353  1.00  0.83           C  
ATOM   2559  C   LYS A 214     109.337  20.620  -1.564  1.00  0.83           C  
ATOM   2560  O   LYS A 214     108.599  21.471  -2.067  1.00  0.83           O  
ATOM   2561  CB  LYS A 214     111.037  19.437  -3.002  1.00  0.83           C  
ATOM   2562  CG  LYS A 214     111.333  20.716  -3.806  1.00  0.83           C  
ATOM   2563  CD  LYS A 214     112.765  20.702  -4.365  1.00  0.83           C  
ATOM   2564  CE  LYS A 214     113.145  21.990  -5.102  1.00  0.83           C  
ATOM   2565  NZ  LYS A 214     114.545  21.929  -5.598  1.00  0.83           N  
ATOM   2566  N   PRO A 215     109.888  20.826  -0.374  1.00  0.87           N  
ATOM   2567  CA  PRO A 215     109.483  21.948   0.445  1.00  0.87           C  
ATOM   2568  C   PRO A 215     110.267  23.176   0.032  1.00  0.87           C  
ATOM   2569  O   PRO A 215     111.498  23.139  -0.021  1.00  0.87           O  
ATOM   2570  CB  PRO A 215     109.837  21.520   1.884  1.00  0.87           C  
ATOM   2571  CG  PRO A 215     110.968  20.504   1.710  1.00  0.87           C  
ATOM   2572  CD  PRO A 215     110.641  19.830   0.381  1.00  0.87           C  
ATOM   2573  N   ARG A 216     109.574  24.301  -0.234  1.00  0.74           N  
ATOM   2574  CA  ARG A 216     110.207  25.592  -0.392  1.00  0.74           C  
ATOM   2575  C   ARG A 216     110.232  26.327   0.931  1.00  0.74           C  
ATOM   2576  O   ARG A 216     110.965  27.296   1.083  1.00  0.74           O  
ATOM   2577  CB  ARG A 216     109.477  26.496  -1.428  1.00  0.74           C  
ATOM   2578  CG  ARG A 216     107.973  26.737  -1.166  1.00  0.74           C  
ATOM   2579  CD  ARG A 216     107.425  28.050  -1.748  1.00  0.74           C  
ATOM   2580  NE  ARG A 216     107.846  29.178  -0.847  1.00  0.74           N  
ATOM   2581  CZ  ARG A 216     107.182  29.551   0.256  1.00  0.74           C  
ATOM   2582  NH1 ARG A 216     106.067  28.934   0.636  1.00  0.74           N  
ATOM   2583  NH2 ARG A 216     107.672  30.523   1.025  1.00  0.74           N  
ATOM   2584  N   GLU A 217     109.435  25.857   1.910  1.00  0.78           N  
ATOM   2585  CA  GLU A 217     109.411  26.413   3.242  1.00  0.78           C  
ATOM   2586  C   GLU A 217     109.069  25.311   4.215  1.00  0.78           C  
ATOM   2587  O   GLU A 217     108.236  24.449   3.930  1.00  0.78           O  
ATOM   2588  CB  GLU A 217     108.362  27.551   3.351  1.00  0.78           C  
ATOM   2589  CG  GLU A 217     108.165  28.175   4.757  1.00  0.78           C  
ATOM   2590  CD  GLU A 217     109.416  28.877   5.287  1.00  0.78           C  
ATOM   2591  OE1 GLU A 217     110.405  28.997   4.523  1.00  0.78           O  
ATOM   2592  OE2 GLU A 217     109.368  29.309   6.462  1.00  0.78           O  
ATOM   2593  N   GLN A 218     109.717  25.300   5.397  1.00  0.79           N  
ATOM   2594  CA  GLN A 218     109.428  24.336   6.438  1.00  0.79           C  
ATOM   2595  C   GLN A 218     108.341  24.856   7.360  1.00  0.79           C  
ATOM   2596  O   GLN A 218     108.545  25.767   8.153  1.00  0.79           O  
ATOM   2597  CB  GLN A 218     110.679  24.022   7.295  1.00  0.79           C  
ATOM   2598  CG  GLN A 218     111.881  23.467   6.499  1.00  0.79           C  
ATOM   2599  CD  GLN A 218     111.552  22.124   5.852  1.00  0.79           C  
ATOM   2600  OE1 GLN A 218     110.777  21.316   6.366  1.00  0.79           O  
ATOM   2601  NE2 GLN A 218     112.169  21.869   4.674  1.00  0.79           N  
ATOM   2602  N   ILE A 219     107.139  24.255   7.306  1.00  0.81           N  
ATOM   2603  CA  ILE A 219     106.002  24.740   8.068  1.00  0.81           C  
ATOM   2604  C   ILE A 219     105.748  23.800   9.233  1.00  0.81           C  
ATOM   2605  O   ILE A 219     105.731  22.573   9.096  1.00  0.81           O  
ATOM   2606  CB  ILE A 219     104.769  24.919   7.176  1.00  0.81           C  
ATOM   2607  CG1 ILE A 219     105.010  26.066   6.163  1.00  0.81           C  
ATOM   2608  CG2 ILE A 219     103.487  25.166   8.003  1.00  0.81           C  
ATOM   2609  CD1 ILE A 219     103.894  26.216   5.123  1.00  0.81           C  
ATOM   2610  N   ASP A 220     105.566  24.371  10.442  1.00  0.82           N  
ATOM   2611  CA  ASP A 220     105.033  23.686  11.597  1.00  0.82           C  
ATOM   2612  C   ASP A 220     103.520  23.814  11.520  1.00  0.82           C  
ATOM   2613  O   ASP A 220     102.954  24.906  11.556  1.00  0.82           O  
ATOM   2614  CB  ASP A 220     105.649  24.301  12.877  1.00  0.82           C  
ATOM   2615  CG  ASP A 220     105.212  23.645  14.181  1.00  0.82           C  
ATOM   2616  OD1 ASP A 220     104.066  23.131  14.258  1.00  0.82           O  
ATOM   2617  OD2 ASP A 220     106.033  23.736  15.129  1.00  0.82           O  
ATOM   2618  N   GLY A 221     102.830  22.669  11.341  1.00  0.86           N  
ATOM   2619  CA  GLY A 221     101.393  22.648  11.165  1.00  0.86           C  
ATOM   2620  C   GLY A 221     100.558  22.971  12.373  1.00  0.86           C  
ATOM   2621  O   GLY A 221      99.454  23.489  12.231  1.00  0.86           O  
ATOM   2622  N   TYR A 222     101.052  22.683  13.597  1.00  0.80           N  
ATOM   2623  CA  TYR A 222     100.374  23.051  14.834  1.00  0.80           C  
ATOM   2624  C   TYR A 222     100.400  24.555  15.026  1.00  0.80           C  
ATOM   2625  O   TYR A 222      99.381  25.179  15.324  1.00  0.80           O  
ATOM   2626  CB  TYR A 222     101.016  22.361  16.070  1.00  0.80           C  
ATOM   2627  CG  TYR A 222     100.391  21.021  16.373  1.00  0.80           C  
ATOM   2628  CD1 TYR A 222     100.786  19.843  15.718  1.00  0.80           C  
ATOM   2629  CD2 TYR A 222      99.391  20.936  17.357  1.00  0.80           C  
ATOM   2630  CE1 TYR A 222     100.168  18.617  16.012  1.00  0.80           C  
ATOM   2631  CE2 TYR A 222      98.780  19.715  17.662  1.00  0.80           C  
ATOM   2632  CZ  TYR A 222      99.160  18.556  16.987  1.00  0.80           C  
ATOM   2633  OH  TYR A 222      98.525  17.343  17.317  1.00  0.80           O  
ATOM   2634  N   VAL A 223     101.574  25.176  14.788  1.00  0.81           N  
ATOM   2635  CA  VAL A 223     101.716  26.627  14.801  1.00  0.81           C  
ATOM   2636  C   VAL A 223     100.883  27.298  13.721  1.00  0.81           C  
ATOM   2637  O   VAL A 223     100.180  28.277  13.962  1.00  0.81           O  
ATOM   2638  CB  VAL A 223     103.171  27.053  14.647  1.00  0.81           C  
ATOM   2639  CG1 VAL A 223     103.294  28.586  14.536  1.00  0.81           C  
ATOM   2640  CG2 VAL A 223     103.957  26.561  15.874  1.00  0.81           C  
ATOM   2641  N   MET A 224     100.907  26.771  12.483  1.00  0.82           N  
ATOM   2642  CA  MET A 224     100.167  27.360  11.386  1.00  0.82           C  
ATOM   2643  C   MET A 224      98.657  27.351  11.552  1.00  0.82           C  
ATOM   2644  O   MET A 224      97.980  28.326  11.227  1.00  0.82           O  
ATOM   2645  CB  MET A 224     100.552  26.729  10.038  1.00  0.82           C  
ATOM   2646  CG  MET A 224     100.159  27.608   8.838  1.00  0.82           C  
ATOM   2647  SD  MET A 224     100.856  29.288   8.868  1.00  0.82           S  
ATOM   2648  CE  MET A 224     102.577  28.783   8.605  1.00  0.82           C  
ATOM   2649  N   HIS A 225      98.084  26.262  12.106  1.00  0.84           N  
ATOM   2650  CA  HIS A 225      96.675  26.244  12.466  1.00  0.84           C  
ATOM   2651  C   HIS A 225      96.323  27.277  13.530  1.00  0.84           C  
ATOM   2652  O   HIS A 225      95.333  27.987  13.415  1.00  0.84           O  
ATOM   2653  CB  HIS A 225      96.187  24.846  12.891  1.00  0.84           C  
ATOM   2654  CG  HIS A 225      94.691  24.718  12.894  1.00  0.84           C  
ATOM   2655  ND1 HIS A 225      93.983  24.964  11.728  1.00  0.84           N  
ATOM   2656  CD2 HIS A 225      93.846  24.344  13.886  1.00  0.84           C  
ATOM   2657  CE1 HIS A 225      92.723  24.727  12.038  1.00  0.84           C  
ATOM   2658  NE2 HIS A 225      92.587  24.349  13.330  1.00  0.84           N  
ATOM   2659  N   ALA A 226      97.177  27.457  14.561  1.00  0.84           N  
ATOM   2660  CA  ALA A 226      97.021  28.519  15.539  1.00  0.84           C  
ATOM   2661  C   ALA A 226      97.056  29.922  14.929  1.00  0.84           C  
ATOM   2662  O   ALA A 226      96.252  30.787  15.273  1.00  0.84           O  
ATOM   2663  CB  ALA A 226      98.106  28.382  16.617  1.00  0.84           C  
ATOM   2664  N   ASN A 227      97.956  30.159  13.954  1.00  0.81           N  
ATOM   2665  CA  ASN A 227      98.001  31.376  13.155  1.00  0.81           C  
ATOM   2666  C   ASN A 227      96.721  31.632  12.350  1.00  0.81           C  
ATOM   2667  O   ASN A 227      96.225  32.757  12.295  1.00  0.81           O  
ATOM   2668  CB  ASN A 227      99.192  31.360  12.166  1.00  0.81           C  
ATOM   2669  CG  ASN A 227     100.548  31.324  12.868  1.00  0.81           C  
ATOM   2670  OD1 ASN A 227     100.700  31.605  14.056  1.00  0.81           O  
ATOM   2671  ND2 ASN A 227     101.609  31.016  12.082  1.00  0.81           N  
ATOM   2672  N   TYR A 228      96.141  30.579  11.730  1.00  0.87           N  
ATOM   2673  CA  TYR A 228      94.847  30.625  11.060  1.00  0.87           C  
ATOM   2674  C   TYR A 228      93.710  30.998  12.013  1.00  0.87           C  
ATOM   2675  O   TYR A 228      92.902  31.876  11.714  1.00  0.87           O  
ATOM   2676  CB  TYR A 228      94.577  29.250  10.360  1.00  0.87           C  
ATOM   2677  CG  TYR A 228      93.159  29.091   9.862  1.00  0.87           C  
ATOM   2678  CD1 TYR A 228      92.689  29.865   8.796  1.00  0.87           C  
ATOM   2679  CD2 TYR A 228      92.249  28.284  10.571  1.00  0.87           C  
ATOM   2680  CE1 TYR A 228      91.328  29.883   8.478  1.00  0.87           C  
ATOM   2681  CE2 TYR A 228      90.882  28.309  10.262  1.00  0.87           C  
ATOM   2682  CZ  TYR A 228      90.423  29.122   9.220  1.00  0.87           C  
ATOM   2683  OH  TYR A 228      89.048  29.249   8.937  1.00  0.87           O  
ATOM   2684  N   ILE A 229      93.645  30.369  13.203  1.00  0.86           N  
ATOM   2685  CA  ILE A 229      92.652  30.681  14.226  1.00  0.86           C  
ATOM   2686  C   ILE A 229      92.775  32.105  14.734  1.00  0.86           C  
ATOM   2687  O   ILE A 229      91.783  32.812  14.882  1.00  0.86           O  
ATOM   2688  CB  ILE A 229      92.703  29.702  15.390  1.00  0.86           C  
ATOM   2689  CG1 ILE A 229      92.429  28.247  14.942  1.00  0.86           C  
ATOM   2690  CG2 ILE A 229      91.734  30.119  16.516  1.00  0.86           C  
ATOM   2691  CD1 ILE A 229      91.114  28.014  14.196  1.00  0.86           C  
ATOM   2692  N   PHE A 230      94.012  32.591  14.957  1.00  0.84           N  
ATOM   2693  CA  PHE A 230      94.251  33.975  15.320  1.00  0.84           C  
ATOM   2694  C   PHE A 230      93.705  34.956  14.283  1.00  0.84           C  
ATOM   2695  O   PHE A 230      92.999  35.886  14.653  1.00  0.84           O  
ATOM   2696  CB  PHE A 230      95.767  34.176  15.563  1.00  0.84           C  
ATOM   2697  CG  PHE A 230      96.171  35.599  15.863  1.00  0.84           C  
ATOM   2698  CD1 PHE A 230      95.640  36.296  16.959  1.00  0.84           C  
ATOM   2699  CD2 PHE A 230      97.107  36.249  15.041  1.00  0.84           C  
ATOM   2700  CE1 PHE A 230      96.052  37.606  17.238  1.00  0.84           C  
ATOM   2701  CE2 PHE A 230      97.501  37.566  15.305  1.00  0.84           C  
ATOM   2702  CZ  PHE A 230      96.976  38.245  16.407  1.00  0.84           C  
ATOM   2703  N   TRP A 231      93.933  34.722  12.971  1.00  0.79           N  
ATOM   2704  CA  TRP A 231      93.345  35.532  11.911  1.00  0.79           C  
ATOM   2705  C   TRP A 231      91.817  35.538  11.933  1.00  0.79           C  
ATOM   2706  O   TRP A 231      91.180  36.585  11.831  1.00  0.79           O  
ATOM   2707  CB  TRP A 231      93.831  35.018  10.521  1.00  0.79           C  
ATOM   2708  CG  TRP A 231      93.171  35.664   9.305  1.00  0.79           C  
ATOM   2709  CD1 TRP A 231      92.931  36.990   9.090  1.00  0.79           C  
ATOM   2710  CD2 TRP A 231      92.486  34.962   8.248  1.00  0.79           C  
ATOM   2711  NE1 TRP A 231      92.183  37.171   7.950  1.00  0.79           N  
ATOM   2712  CE2 TRP A 231      91.891  35.937   7.427  1.00  0.79           C  
ATOM   2713  CE3 TRP A 231      92.336  33.605   7.976  1.00  0.79           C  
ATOM   2714  CZ2 TRP A 231      91.144  35.578   6.315  1.00  0.79           C  
ATOM   2715  CZ3 TRP A 231      91.620  33.249   6.823  1.00  0.79           C  
ATOM   2716  CH2 TRP A 231      91.026  34.218   6.009  1.00  0.79           C  
ATOM   2717  N   ARG A 232      91.187  34.360  12.090  1.00  0.80           N  
ATOM   2718  CA  ARG A 232      89.743  34.259  12.169  1.00  0.80           C  
ATOM   2719  C   ARG A 232      89.106  34.937  13.373  1.00  0.80           C  
ATOM   2720  O   ARG A 232      88.039  35.536  13.257  1.00  0.80           O  
ATOM   2721  CB  ARG A 232      89.285  32.789  12.130  1.00  0.80           C  
ATOM   2722  CG  ARG A 232      89.599  32.034  10.827  1.00  0.80           C  
ATOM   2723  CD  ARG A 232      89.173  32.712   9.517  1.00  0.80           C  
ATOM   2724  NE  ARG A 232      87.733  33.133   9.602  1.00  0.80           N  
ATOM   2725  CZ  ARG A 232      86.676  32.336   9.398  1.00  0.80           C  
ATOM   2726  NH1 ARG A 232      86.780  31.054   9.077  1.00  0.80           N  
ATOM   2727  NH2 ARG A 232      85.441  32.819   9.510  1.00  0.80           N  
ATOM   2728  N   ASN A 233      89.754  34.843  14.548  1.00  0.85           N  
ATOM   2729  CA  ASN A 233      89.367  35.520  15.771  1.00  0.85           C  
ATOM   2730  C   ASN A 233      89.473  37.045  15.696  1.00  0.85           C  
ATOM   2731  O   ASN A 233      88.684  37.759  16.311  1.00  0.85           O  
ATOM   2732  CB  ASN A 233      90.223  35.019  16.967  1.00  0.85           C  
ATOM   2733  CG  ASN A 233      89.826  33.602  17.375  1.00  0.85           C  
ATOM   2734  OD1 ASN A 233      88.838  33.040  16.908  1.00  0.85           O  
ATOM   2735  ND2 ASN A 233      90.593  33.009  18.323  1.00  0.85           N  
ATOM   2736  N   THR A 234      90.476  37.598  14.977  1.00  0.89           N  
ATOM   2737  CA  THR A 234      90.795  39.024  15.071  1.00  0.89           C  
ATOM   2738  C   THR A 234      90.423  39.861  13.877  1.00  0.89           C  
ATOM   2739  O   THR A 234      90.348  41.084  13.987  1.00  0.89           O  
ATOM   2740  CB  THR A 234      92.269  39.287  15.315  1.00  0.89           C  
ATOM   2741  OG1 THR A 234      93.085  38.705  14.309  1.00  0.89           O  
ATOM   2742  CG2 THR A 234      92.632  38.649  16.658  1.00  0.89           C  
ATOM   2743  N   ASN A 235      90.126  39.265  12.712  1.00  0.84           N  
ATOM   2744  CA  ASN A 235      89.606  40.031  11.599  1.00  0.84           C  
ATOM   2745  C   ASN A 235      88.270  39.420  11.181  1.00  0.84           C  
ATOM   2746  O   ASN A 235      88.240  38.442  10.431  1.00  0.84           O  
ATOM   2747  CB  ASN A 235      90.629  40.124  10.432  1.00  0.84           C  
ATOM   2748  CG  ASN A 235      91.697  41.199  10.677  1.00  0.84           C  
ATOM   2749  OD1 ASN A 235      92.879  41.001  10.391  1.00  0.84           O  
ATOM   2750  ND2 ASN A 235      91.274  42.390  11.169  1.00  0.84           N  
ATOM   2751  N   PRO A 236      87.132  39.976  11.632  1.00  0.88           N  
ATOM   2752  CA  PRO A 236      85.803  39.489  11.289  1.00  0.88           C  
ATOM   2753  C   PRO A 236      85.500  39.611   9.818  1.00  0.88           C  
ATOM   2754  O   PRO A 236      85.814  40.630   9.209  1.00  0.88           O  
ATOM   2755  CB  PRO A 236      84.820  40.361  12.096  1.00  0.88           C  
ATOM   2756  CG  PRO A 236      85.660  41.030  13.185  1.00  0.88           C  
ATOM   2757  CD  PRO A 236      87.065  41.070  12.602  1.00  0.88           C  
ATOM   2758  N   ILE A 237      84.860  38.593   9.229  1.00  0.87           N  
ATOM   2759  CA  ILE A 237      84.534  38.600   7.819  1.00  0.87           C  
ATOM   2760  C   ILE A 237      83.033  38.729   7.732  1.00  0.87           C  
ATOM   2761  O   ILE A 237      82.282  37.913   8.268  1.00  0.87           O  
ATOM   2762  CB  ILE A 237      85.042  37.347   7.122  1.00  0.87           C  
ATOM   2763  CG1 ILE A 237      86.587  37.284   7.206  1.00  0.87           C  
ATOM   2764  CG2 ILE A 237      84.552  37.326   5.658  1.00  0.87           C  
ATOM   2765  CD1 ILE A 237      87.179  35.945   6.755  1.00  0.87           C  
ATOM   2766  N   GLN A 238      82.549  39.821   7.109  1.00  0.81           N  
ATOM   2767  CA  GLN A 238      81.137  40.070   6.888  1.00  0.81           C  
ATOM   2768  C   GLN A 238      80.517  39.036   5.966  1.00  0.81           C  
ATOM   2769  O   GLN A 238      81.025  38.768   4.880  1.00  0.81           O  
ATOM   2770  CB  GLN A 238      80.923  41.497   6.318  1.00  0.81           C  
ATOM   2771  CG  GLN A 238      79.506  41.787   5.763  1.00  0.81           C  
ATOM   2772  CD  GLN A 238      79.380  43.223   5.254  1.00  0.81           C  
ATOM   2773  OE1 GLN A 238      80.065  44.145   5.690  1.00  0.81           O  
ATOM   2774  NE2 GLN A 238      78.464  43.433   4.277  1.00  0.81           N  
ATOM   2775  N   LEU A 239      79.382  38.436   6.383  1.00  0.84           N  
ATOM   2776  CA  LEU A 239      78.639  37.479   5.581  1.00  0.84           C  
ATOM   2777  C   LEU A 239      78.123  38.121   4.310  1.00  0.84           C  
ATOM   2778  O   LEU A 239      77.488  39.174   4.334  1.00  0.84           O  
ATOM   2779  CB  LEU A 239      77.448  36.871   6.363  1.00  0.84           C  
ATOM   2780  CG  LEU A 239      77.790  35.741   7.361  1.00  0.84           C  
ATOM   2781  CD1 LEU A 239      78.045  34.411   6.637  1.00  0.84           C  
ATOM   2782  CD2 LEU A 239      78.913  36.089   8.352  1.00  0.84           C  
ATOM   2783  N   SER A 240      78.407  37.513   3.148  1.00  0.85           N  
ATOM   2784  CA  SER A 240      77.987  38.128   1.910  1.00  0.85           C  
ATOM   2785  C   SER A 240      77.794  37.120   0.814  1.00  0.85           C  
ATOM   2786  O   SER A 240      78.552  36.171   0.641  1.00  0.85           O  
ATOM   2787  CB  SER A 240      78.960  39.228   1.426  1.00  0.85           C  
ATOM   2788  OG  SER A 240      78.465  39.878   0.257  1.00  0.85           O  
ATOM   2789  N   SER A 241      76.745  37.339   0.010  1.00  0.85           N  
ATOM   2790  CA  SER A 241      76.430  36.556  -1.157  1.00  0.85           C  
ATOM   2791  C   SER A 241      76.555  37.393  -2.414  1.00  0.85           C  
ATOM   2792  O   SER A 241      76.201  36.942  -3.498  1.00  0.85           O  
ATOM   2793  CB  SER A 241      74.979  36.031  -1.061  1.00  0.85           C  
ATOM   2794  OG  SER A 241      74.062  37.104  -0.834  1.00  0.85           O  
ATOM   2795  N   TYR A 242      77.095  38.631  -2.327  1.00  0.78           N  
ATOM   2796  CA  TYR A 242      77.064  39.601  -3.418  1.00  0.78           C  
ATOM   2797  C   TYR A 242      77.747  39.143  -4.696  1.00  0.78           C  
ATOM   2798  O   TYR A 242      77.272  39.397  -5.799  1.00  0.78           O  
ATOM   2799  CB  TYR A 242      77.699  40.952  -3.004  1.00  0.78           C  
ATOM   2800  CG  TYR A 242      76.988  41.682  -1.891  1.00  0.78           C  
ATOM   2801  CD1 TYR A 242      75.671  41.415  -1.472  1.00  0.78           C  
ATOM   2802  CD2 TYR A 242      77.692  42.713  -1.248  1.00  0.78           C  
ATOM   2803  CE1 TYR A 242      75.087  42.155  -0.435  1.00  0.78           C  
ATOM   2804  CE2 TYR A 242      77.110  43.456  -0.213  1.00  0.78           C  
ATOM   2805  CZ  TYR A 242      75.805  43.169   0.198  1.00  0.78           C  
ATOM   2806  OH  TYR A 242      75.200  43.883   1.250  1.00  0.78           O  
ATOM   2807  N   SER A 243      78.867  38.407  -4.567  1.00  0.82           N  
ATOM   2808  CA  SER A 243      79.613  37.890  -5.696  1.00  0.82           C  
ATOM   2809  C   SER A 243      78.888  36.810  -6.485  1.00  0.82           C  
ATOM   2810  O   SER A 243      79.220  36.554  -7.635  1.00  0.82           O  
ATOM   2811  CB  SER A 243      80.996  37.347  -5.274  1.00  0.82           C  
ATOM   2812  OG  SER A 243      80.886  36.181  -4.463  1.00  0.82           O  
ATOM   2813  N   LEU A 244      77.834  36.175  -5.920  1.00  0.81           N  
ATOM   2814  CA  LEU A 244      77.062  35.138  -6.590  1.00  0.81           C  
ATOM   2815  C   LEU A 244      76.162  35.672  -7.690  1.00  0.81           C  
ATOM   2816  O   LEU A 244      75.693  34.924  -8.543  1.00  0.81           O  
ATOM   2817  CB  LEU A 244      76.124  34.422  -5.594  1.00  0.81           C  
ATOM   2818  CG  LEU A 244      76.803  33.777  -4.377  1.00  0.81           C  
ATOM   2819  CD1 LEU A 244      75.728  33.118  -3.511  1.00  0.81           C  
ATOM   2820  CD2 LEU A 244      77.883  32.756  -4.744  1.00  0.81           C  
ATOM   2821  N   PHE A 245      75.893  36.991  -7.684  1.00  0.74           N  
ATOM   2822  CA  PHE A 245      74.968  37.607  -8.610  1.00  0.74           C  
ATOM   2823  C   PHE A 245      75.641  38.071  -9.894  1.00  0.74           C  
ATOM   2824  O   PHE A 245      74.951  38.408 -10.853  1.00  0.74           O  
ATOM   2825  CB  PHE A 245      74.257  38.808  -7.940  1.00  0.74           C  
ATOM   2826  CG  PHE A 245      73.254  38.337  -6.919  1.00  0.74           C  
ATOM   2827  CD1 PHE A 245      73.608  38.142  -5.574  1.00  0.74           C  
ATOM   2828  CD2 PHE A 245      71.926  38.097  -7.308  1.00  0.74           C  
ATOM   2829  CE1 PHE A 245      72.655  37.720  -4.638  1.00  0.74           C  
ATOM   2830  CE2 PHE A 245      70.971  37.676  -6.376  1.00  0.74           C  
ATOM   2831  CZ  PHE A 245      71.333  37.492  -5.038  1.00  0.74           C  
ATOM   2832  N   ASP A 246      76.990  38.043  -9.973  1.00  0.75           N  
ATOM   2833  CA  ASP A 246      77.688  38.290 -11.217  1.00  0.75           C  
ATOM   2834  C   ASP A 246      78.473  37.035 -11.570  1.00  0.75           C  
ATOM   2835  O   ASP A 246      79.482  36.675 -10.964  1.00  0.75           O  
ATOM   2836  CB  ASP A 246      78.566  39.566 -11.166  1.00  0.75           C  
ATOM   2837  CG  ASP A 246      79.019  40.001 -12.561  1.00  0.75           C  
ATOM   2838  OD1 ASP A 246      78.774  39.249 -13.551  1.00  0.75           O  
ATOM   2839  OD2 ASP A 246      79.641  41.086 -12.655  1.00  0.75           O  
ATOM   2840  N   MET A 247      77.974  36.320 -12.594  1.00  0.75           N  
ATOM   2841  CA  MET A 247      78.543  35.085 -13.073  1.00  0.75           C  
ATOM   2842  C   MET A 247      79.163  35.255 -14.453  1.00  0.75           C  
ATOM   2843  O   MET A 247      79.514  34.263 -15.092  1.00  0.75           O  
ATOM   2844  CB  MET A 247      77.457  33.977 -13.100  1.00  0.75           C  
ATOM   2845  CG  MET A 247      76.976  33.556 -11.695  1.00  0.75           C  
ATOM   2846  SD  MET A 247      78.273  32.846 -10.632  1.00  0.75           S  
ATOM   2847  CE  MET A 247      78.452  31.278 -11.525  1.00  0.75           C  
ATOM   2848  N   SER A 248      79.346  36.504 -14.959  1.00  0.76           N  
ATOM   2849  CA  SER A 248      79.812  36.735 -16.327  1.00  0.76           C  
ATOM   2850  C   SER A 248      81.190  36.192 -16.653  1.00  0.76           C  
ATOM   2851  O   SER A 248      81.430  35.627 -17.717  1.00  0.76           O  
ATOM   2852  CB  SER A 248      79.711  38.219 -16.808  1.00  0.76           C  
ATOM   2853  OG  SER A 248      80.621  39.141 -16.216  1.00  0.76           O  
ATOM   2854  N   LYS A 249      82.119  36.300 -15.689  1.00  0.77           N  
ATOM   2855  CA  LYS A 249      83.492  35.847 -15.811  1.00  0.77           C  
ATOM   2856  C   LYS A 249      83.768  34.631 -14.946  1.00  0.77           C  
ATOM   2857  O   LYS A 249      84.902  34.387 -14.547  1.00  0.77           O  
ATOM   2858  CB  LYS A 249      84.481  36.983 -15.463  1.00  0.77           C  
ATOM   2859  CG  LYS A 249      84.267  38.222 -16.341  1.00  0.77           C  
ATOM   2860  CD  LYS A 249      85.283  39.339 -16.067  1.00  0.77           C  
ATOM   2861  CE  LYS A 249      85.029  40.567 -16.946  1.00  0.77           C  
ATOM   2862  NZ  LYS A 249      86.021  41.628 -16.662  1.00  0.77           N  
ATOM   2863  N   PHE A 250      82.728  33.836 -14.621  1.00  0.82           N  
ATOM   2864  CA  PHE A 250      82.883  32.591 -13.885  1.00  0.82           C  
ATOM   2865  C   PHE A 250      83.709  31.465 -14.534  1.00  0.82           C  
ATOM   2866  O   PHE A 250      84.546  30.934 -13.805  1.00  0.82           O  
ATOM   2867  CB  PHE A 250      81.488  32.033 -13.482  1.00  0.82           C  
ATOM   2868  CG  PHE A 250      81.592  30.847 -12.555  1.00  0.82           C  
ATOM   2869  CD1 PHE A 250      82.074  31.033 -11.254  1.00  0.82           C  
ATOM   2870  CD2 PHE A 250      81.250  29.547 -12.973  1.00  0.82           C  
ATOM   2871  CE1 PHE A 250      82.188  29.955 -10.374  1.00  0.82           C  
ATOM   2872  CE2 PHE A 250      81.351  28.468 -12.084  1.00  0.82           C  
ATOM   2873  CZ  PHE A 250      81.812  28.674 -10.782  1.00  0.82           C  
ATOM   2874  N   PRO A 251      83.566  31.020 -15.792  1.00  0.83           N  
ATOM   2875  CA  PRO A 251      84.291  29.865 -16.320  1.00  0.83           C  
ATOM   2876  C   PRO A 251      85.797  29.945 -16.203  1.00  0.83           C  
ATOM   2877  O   PRO A 251      86.377  30.978 -16.546  1.00  0.83           O  
ATOM   2878  CB  PRO A 251      83.867  29.752 -17.793  1.00  0.83           C  
ATOM   2879  CG  PRO A 251      82.551  30.527 -17.882  1.00  0.83           C  
ATOM   2880  CD  PRO A 251      82.694  31.607 -16.809  1.00  0.83           C  
ATOM   2881  N   LEU A 252      86.461  28.869 -15.744  1.00  0.85           N  
ATOM   2882  CA  LEU A 252      87.905  28.800 -15.722  1.00  0.85           C  
ATOM   2883  C   LEU A 252      88.475  28.893 -17.122  1.00  0.85           C  
ATOM   2884  O   LEU A 252      88.096  28.154 -18.030  1.00  0.85           O  
ATOM   2885  CB  LEU A 252      88.374  27.488 -15.063  1.00  0.85           C  
ATOM   2886  CG  LEU A 252      89.895  27.279 -14.941  1.00  0.85           C  
ATOM   2887  CD1 LEU A 252      90.569  28.374 -14.099  1.00  0.85           C  
ATOM   2888  CD2 LEU A 252      90.170  25.893 -14.341  1.00  0.85           C  
ATOM   2889  N   LYS A 253      89.397  29.844 -17.352  1.00  0.78           N  
ATOM   2890  CA  LYS A 253      89.953  30.037 -18.672  1.00  0.78           C  
ATOM   2891  C   LYS A 253      90.844  28.888 -19.088  1.00  0.78           C  
ATOM   2892  O   LYS A 253      91.796  28.527 -18.398  1.00  0.78           O  
ATOM   2893  CB  LYS A 253      90.704  31.377 -18.806  1.00  0.78           C  
ATOM   2894  CG  LYS A 253      89.789  32.577 -18.525  1.00  0.78           C  
ATOM   2895  CD  LYS A 253      90.486  33.924 -18.758  1.00  0.78           C  
ATOM   2896  CE  LYS A 253      89.561  35.109 -18.475  1.00  0.78           C  
ATOM   2897  NZ  LYS A 253      90.237  36.377 -18.827  1.00  0.78           N  
ATOM   2898  N   LEU A 254      90.547  28.278 -20.251  1.00  0.78           N  
ATOM   2899  CA  LEU A 254      91.345  27.194 -20.779  1.00  0.78           C  
ATOM   2900  C   LEU A 254      92.675  27.712 -21.298  1.00  0.78           C  
ATOM   2901  O   LEU A 254      92.793  28.203 -22.415  1.00  0.78           O  
ATOM   2902  CB  LEU A 254      90.568  26.405 -21.857  1.00  0.78           C  
ATOM   2903  CG  LEU A 254      91.312  25.216 -22.505  1.00  0.78           C  
ATOM   2904  CD1 LEU A 254      91.906  24.228 -21.488  1.00  0.78           C  
ATOM   2905  CD2 LEU A 254      90.372  24.484 -23.474  1.00  0.78           C  
ATOM   2906  N   ARG A 255      93.717  27.647 -20.445  1.00  0.77           N  
ATOM   2907  CA  ARG A 255      95.034  28.153 -20.773  1.00  0.77           C  
ATOM   2908  C   ARG A 255      95.781  27.277 -21.758  1.00  0.77           C  
ATOM   2909  O   ARG A 255      96.650  27.746 -22.487  1.00  0.77           O  
ATOM   2910  CB  ARG A 255      95.909  28.286 -19.498  1.00  0.77           C  
ATOM   2911  CG  ARG A 255      95.324  29.223 -18.421  1.00  0.77           C  
ATOM   2912  CD  ARG A 255      96.122  29.273 -17.111  1.00  0.77           C  
ATOM   2913  NE  ARG A 255      97.435  29.927 -17.408  1.00  0.77           N  
ATOM   2914  CZ  ARG A 255      98.391  30.118 -16.488  1.00  0.77           C  
ATOM   2915  NH1 ARG A 255      98.242  29.731 -15.228  1.00  0.77           N  
ATOM   2916  NH2 ARG A 255      99.547  30.690 -16.821  1.00  0.77           N  
ATOM   2917  N   GLY A 256      95.473  25.964 -21.775  1.00  0.88           N  
ATOM   2918  CA  GLY A 256      96.162  25.000 -22.616  1.00  0.88           C  
ATOM   2919  C   GLY A 256      97.564  24.741 -22.150  1.00  0.88           C  
ATOM   2920  O   GLY A 256      98.469  24.540 -22.954  1.00  0.88           O  
ATOM   2921  N   THR A 257      97.761  24.753 -20.812  1.00  0.89           N  
ATOM   2922  CA  THR A 257      99.046  24.591 -20.135  1.00  0.89           C  
ATOM   2923  C   THR A 257      99.810  23.363 -20.602  1.00  0.89           C  
ATOM   2924  O   THR A 257      99.253  22.275 -20.724  1.00  0.89           O  
ATOM   2925  CB  THR A 257      98.906  24.476 -18.613  1.00  0.89           C  
ATOM   2926  OG1 THR A 257      98.247  25.594 -18.043  1.00  0.89           O  
ATOM   2927  CG2 THR A 257     100.260  24.460 -17.903  1.00  0.89           C  
ATOM   2928  N   ALA A 258     101.120  23.507 -20.895  1.00  0.90           N  
ATOM   2929  CA  ALA A 258     101.954  22.406 -21.331  1.00  0.90           C  
ATOM   2930  C   ALA A 258     102.089  21.269 -20.319  1.00  0.90           C  
ATOM   2931  O   ALA A 258     102.237  21.491 -19.118  1.00  0.90           O  
ATOM   2932  CB  ALA A 258     103.346  22.930 -21.736  1.00  0.90           C  
ATOM   2933  N   VAL A 259     102.049  20.015 -20.808  1.00  0.88           N  
ATOM   2934  CA  VAL A 259     102.159  18.817 -19.993  1.00  0.88           C  
ATOM   2935  C   VAL A 259     103.381  18.075 -20.484  1.00  0.88           C  
ATOM   2936  O   VAL A 259     103.484  17.759 -21.668  1.00  0.88           O  
ATOM   2937  CB  VAL A 259     100.929  17.916 -20.102  1.00  0.88           C  
ATOM   2938  CG1 VAL A 259     101.125  16.601 -19.319  1.00  0.88           C  
ATOM   2939  CG2 VAL A 259      99.702  18.664 -19.551  1.00  0.88           C  
ATOM   2940  N   MET A 260     104.361  17.803 -19.598  1.00  0.85           N  
ATOM   2941  CA  MET A 260     105.577  17.101 -19.979  1.00  0.85           C  
ATOM   2942  C   MET A 260     105.871  15.956 -19.023  1.00  0.85           C  
ATOM   2943  O   MET A 260     105.587  16.022 -17.832  1.00  0.85           O  
ATOM   2944  CB  MET A 260     106.818  18.032 -19.994  1.00  0.85           C  
ATOM   2945  CG  MET A 260     106.721  19.227 -20.965  1.00  0.85           C  
ATOM   2946  SD  MET A 260     108.127  20.383 -20.871  1.00  0.85           S  
ATOM   2947  CE  MET A 260     109.403  19.261 -21.507  1.00  0.85           C  
ATOM   2948  N   SER A 261     106.483  14.860 -19.510  1.00  0.85           N  
ATOM   2949  CA  SER A 261     106.832  13.712 -18.686  1.00  0.85           C  
ATOM   2950  C   SER A 261     108.307  13.700 -18.335  1.00  0.85           C  
ATOM   2951  O   SER A 261     109.093  12.861 -18.770  1.00  0.85           O  
ATOM   2952  CB  SER A 261     106.394  12.377 -19.335  1.00  0.85           C  
ATOM   2953  OG  SER A 261     106.779  12.279 -20.708  1.00  0.85           O  
ATOM   2954  N   LEU A 262     108.728  14.673 -17.503  1.00  0.84           N  
ATOM   2955  CA  LEU A 262     110.105  14.806 -17.068  1.00  0.84           C  
ATOM   2956  C   LEU A 262     110.439  13.875 -15.916  1.00  0.84           C  
ATOM   2957  O   LEU A 262     109.606  13.553 -15.072  1.00  0.84           O  
ATOM   2958  CB  LEU A 262     110.443  16.263 -16.671  1.00  0.84           C  
ATOM   2959  CG  LEU A 262     110.295  17.278 -17.822  1.00  0.84           C  
ATOM   2960  CD1 LEU A 262     110.434  18.714 -17.300  1.00  0.84           C  
ATOM   2961  CD2 LEU A 262     111.317  17.025 -18.940  1.00  0.84           C  
ATOM   2962  N   LYS A 263     111.701  13.405 -15.861  1.00  0.78           N  
ATOM   2963  CA  LYS A 263     112.179  12.576 -14.767  1.00  0.78           C  
ATOM   2964  C   LYS A 263     112.542  13.424 -13.559  1.00  0.78           C  
ATOM   2965  O   LYS A 263     112.821  14.612 -13.691  1.00  0.78           O  
ATOM   2966  CB  LYS A 263     113.433  11.757 -15.164  1.00  0.78           C  
ATOM   2967  CG  LYS A 263     113.247  10.918 -16.438  1.00  0.78           C  
ATOM   2968  CD  LYS A 263     114.517  10.134 -16.813  1.00  0.78           C  
ATOM   2969  CE  LYS A 263     114.438   9.395 -18.155  1.00  0.78           C  
ATOM   2970  NZ  LYS A 263     113.338   8.406 -18.131  1.00  0.78           N  
ATOM   2971  N   GLU A 264     112.618  12.828 -12.346  1.00  0.81           N  
ATOM   2972  CA  GLU A 264     112.972  13.541 -11.124  1.00  0.81           C  
ATOM   2973  C   GLU A 264     114.343  14.209 -11.174  1.00  0.81           C  
ATOM   2974  O   GLU A 264     114.566  15.283 -10.627  1.00  0.81           O  
ATOM   2975  CB  GLU A 264     112.864  12.610  -9.900  1.00  0.81           C  
ATOM   2976  CG  GLU A 264     111.417  12.129  -9.633  1.00  0.81           C  
ATOM   2977  CD  GLU A 264     111.311  11.221  -8.407  1.00  0.81           C  
ATOM   2978  OE1 GLU A 264     112.351  10.645  -7.998  1.00  0.81           O  
ATOM   2979  OE2 GLU A 264     110.168  11.087  -7.898  1.00  0.81           O  
ATOM   2980  N   GLY A 265     115.285  13.603 -11.927  1.00  0.79           N  
ATOM   2981  CA  GLY A 265     116.620  14.143 -12.157  1.00  0.79           C  
ATOM   2982  C   GLY A 265     116.707  15.250 -13.181  1.00  0.79           C  
ATOM   2983  O   GLY A 265     117.787  15.766 -13.433  1.00  0.79           O  
ATOM   2984  N   GLN A 266     115.586  15.627 -13.832  1.00  0.87           N  
ATOM   2985  CA  GLN A 266     115.577  16.674 -14.842  1.00  0.87           C  
ATOM   2986  C   GLN A 266     114.900  17.936 -14.329  1.00  0.87           C  
ATOM   2987  O   GLN A 266     114.826  18.952 -15.018  1.00  0.87           O  
ATOM   2988  CB  GLN A 266     114.839  16.170 -16.106  1.00  0.87           C  
ATOM   2989  CG  GLN A 266     115.540  14.950 -16.749  1.00  0.87           C  
ATOM   2990  CD  GLN A 266     114.711  14.331 -17.872  1.00  0.87           C  
ATOM   2991  OE1 GLN A 266     113.504  14.528 -17.998  1.00  0.87           O  
ATOM   2992  NE2 GLN A 266     115.371  13.480 -18.698  1.00  0.87           N  
ATOM   2993  N   ILE A 267     114.415  17.920 -13.073  1.00  0.87           N  
ATOM   2994  CA  ILE A 267     113.742  19.053 -12.463  1.00  0.87           C  
ATOM   2995  C   ILE A 267     114.766  20.063 -11.954  1.00  0.87           C  
ATOM   2996  O   ILE A 267     115.276  19.967 -10.840  1.00  0.87           O  
ATOM   2997  CB  ILE A 267     112.818  18.620 -11.327  1.00  0.87           C  
ATOM   2998  CG1 ILE A 267     111.851  17.501 -11.786  1.00  0.87           C  
ATOM   2999  CG2 ILE A 267     112.052  19.852 -10.788  1.00  0.87           C  
ATOM   3000  CD1 ILE A 267     111.020  16.918 -10.639  1.00  0.87           C  
ATOM   3001  N   ASN A 268     115.103  21.064 -12.795  1.00  0.87           N  
ATOM   3002  CA  ASN A 268     116.032  22.132 -12.464  1.00  0.87           C  
ATOM   3003  C   ASN A 268     115.298  23.389 -11.993  1.00  0.87           C  
ATOM   3004  O   ASN A 268     114.071  23.425 -11.921  1.00  0.87           O  
ATOM   3005  CB  ASN A 268     117.043  22.384 -13.630  1.00  0.87           C  
ATOM   3006  CG  ASN A 268     116.391  22.951 -14.889  1.00  0.87           C  
ATOM   3007  OD1 ASN A 268     115.423  23.701 -14.822  1.00  0.87           O  
ATOM   3008  ND2 ASN A 268     116.934  22.644 -16.089  1.00  0.87           N  
ATOM   3009  N   ASP A 269     116.040  24.470 -11.678  1.00  0.91           N  
ATOM   3010  CA  ASP A 269     115.484  25.747 -11.264  1.00  0.91           C  
ATOM   3011  C   ASP A 269     114.595  26.444 -12.300  1.00  0.91           C  
ATOM   3012  O   ASP A 269     113.588  27.068 -11.959  1.00  0.91           O  
ATOM   3013  CB  ASP A 269     116.619  26.675 -10.783  1.00  0.91           C  
ATOM   3014  CG  ASP A 269     117.287  26.113  -9.530  1.00  0.91           C  
ATOM   3015  OD1 ASP A 269     116.698  25.213  -8.873  1.00  0.91           O  
ATOM   3016  OD2 ASP A 269     118.411  26.582  -9.235  1.00  0.91           O  
ATOM   3017  N   MET A 270     114.911  26.331 -13.613  1.00  0.91           N  
ATOM   3018  CA  MET A 270     114.058  26.822 -14.690  1.00  0.91           C  
ATOM   3019  C   MET A 270     112.710  26.126 -14.688  1.00  0.91           C  
ATOM   3020  O   MET A 270     111.662  26.766 -14.772  1.00  0.91           O  
ATOM   3021  CB  MET A 270     114.708  26.631 -16.091  1.00  0.91           C  
ATOM   3022  CG  MET A 270     113.819  27.045 -17.287  1.00  0.91           C  
ATOM   3023  SD  MET A 270     114.558  26.760 -18.924  1.00  0.91           S  
ATOM   3024  CE  MET A 270     113.057  27.259 -19.821  1.00  0.91           C  
ATOM   3025  N   ILE A 271     112.709  24.787 -14.532  1.00  0.91           N  
ATOM   3026  CA  ILE A 271     111.490  23.999 -14.454  1.00  0.91           C  
ATOM   3027  C   ILE A 271     110.647  24.384 -13.254  1.00  0.91           C  
ATOM   3028  O   ILE A 271     109.454  24.643 -13.386  1.00  0.91           O  
ATOM   3029  CB  ILE A 271     111.784  22.506 -14.439  1.00  0.91           C  
ATOM   3030  CG1 ILE A 271     112.574  22.042 -15.686  1.00  0.91           C  
ATOM   3031  CG2 ILE A 271     110.483  21.699 -14.319  1.00  0.91           C  
ATOM   3032  CD1 ILE A 271     111.949  22.399 -17.040  1.00  0.91           C  
ATOM   3033  N   LEU A 272     111.266  24.536 -12.064  1.00  0.89           N  
ATOM   3034  CA  LEU A 272     110.586  25.018 -10.871  1.00  0.89           C  
ATOM   3035  C   LEU A 272     109.966  26.402 -11.057  1.00  0.89           C  
ATOM   3036  O   LEU A 272     108.833  26.654 -10.661  1.00  0.89           O  
ATOM   3037  CB  LEU A 272     111.548  25.048  -9.660  1.00  0.89           C  
ATOM   3038  CG  LEU A 272     112.054  23.670  -9.188  1.00  0.89           C  
ATOM   3039  CD1 LEU A 272     113.164  23.854  -8.143  1.00  0.89           C  
ATOM   3040  CD2 LEU A 272     110.931  22.775  -8.640  1.00  0.89           C  
ATOM   3041  N   SER A 273     110.675  27.325 -11.733  1.00  0.91           N  
ATOM   3042  CA  SER A 273     110.168  28.643 -12.100  1.00  0.91           C  
ATOM   3043  C   SER A 273     108.946  28.623 -13.012  1.00  0.91           C  
ATOM   3044  O   SER A 273     108.032  29.429 -12.846  1.00  0.91           O  
ATOM   3045  CB  SER A 273     111.294  29.469 -12.777  1.00  0.91           C  
ATOM   3046  OG  SER A 273     110.972  30.840 -13.048  1.00  0.91           O  
ATOM   3047  N   LEU A 274     108.897  27.715 -14.011  1.00  0.89           N  
ATOM   3048  CA  LEU A 274     107.732  27.499 -14.862  1.00  0.89           C  
ATOM   3049  C   LEU A 274     106.534  26.905 -14.145  1.00  0.89           C  
ATOM   3050  O   LEU A 274     105.400  27.350 -14.343  1.00  0.89           O  
ATOM   3051  CB  LEU A 274     108.058  26.596 -16.067  1.00  0.89           C  
ATOM   3052  CG  LEU A 274     109.027  27.217 -17.086  1.00  0.89           C  
ATOM   3053  CD1 LEU A 274     109.365  26.177 -18.161  1.00  0.89           C  
ATOM   3054  CD2 LEU A 274     108.452  28.490 -17.731  1.00  0.89           C  
ATOM   3055  N   LEU A 275     106.775  25.910 -13.264  1.00  0.90           N  
ATOM   3056  CA  LEU A 275     105.765  25.313 -12.406  1.00  0.90           C  
ATOM   3057  C   LEU A 275     105.118  26.360 -11.513  1.00  0.90           C  
ATOM   3058  O   LEU A 275     103.899  26.482 -11.464  1.00  0.90           O  
ATOM   3059  CB  LEU A 275     106.386  24.215 -11.503  1.00  0.90           C  
ATOM   3060  CG  LEU A 275     106.919  22.968 -12.237  1.00  0.90           C  
ATOM   3061  CD1 LEU A 275     107.684  22.063 -11.259  1.00  0.90           C  
ATOM   3062  CD2 LEU A 275     105.799  22.191 -12.928  1.00  0.90           C  
ATOM   3063  N   SER A 276     105.939  27.222 -10.880  1.00  0.89           N  
ATOM   3064  CA  SER A 276     105.500  28.280  -9.977  1.00  0.89           C  
ATOM   3065  C   SER A 276     104.689  29.395 -10.614  1.00  0.89           C  
ATOM   3066  O   SER A 276     104.045  30.174  -9.922  1.00  0.89           O  
ATOM   3067  CB  SER A 276     106.701  28.970  -9.284  1.00  0.89           C  
ATOM   3068  OG  SER A 276     107.381  28.074  -8.407  1.00  0.89           O  
ATOM   3069  N   LYS A 277     104.696  29.517 -11.956  1.00  0.86           N  
ATOM   3070  CA  LYS A 277     103.874  30.484 -12.667  1.00  0.86           C  
ATOM   3071  C   LYS A 277     102.617  29.855 -13.256  1.00  0.86           C  
ATOM   3072  O   LYS A 277     101.858  30.498 -13.988  1.00  0.86           O  
ATOM   3073  CB  LYS A 277     104.663  31.104 -13.843  1.00  0.86           C  
ATOM   3074  CG  LYS A 277     105.870  31.943 -13.406  1.00  0.86           C  
ATOM   3075  CD  LYS A 277     106.553  32.612 -14.609  1.00  0.86           C  
ATOM   3076  CE  LYS A 277     107.763  33.476 -14.249  1.00  0.86           C  
ATOM   3077  NZ  LYS A 277     108.818  32.628 -13.671  1.00  0.86           N  
ATOM   3078  N   GLY A 278     102.364  28.556 -12.990  1.00  0.91           N  
ATOM   3079  CA  GLY A 278     101.227  27.851 -13.571  1.00  0.91           C  
ATOM   3080  C   GLY A 278     101.341  27.572 -15.041  1.00  0.91           C  
ATOM   3081  O   GLY A 278     100.339  27.386 -15.727  1.00  0.91           O  
ATOM   3082  N   ARG A 279     102.576  27.571 -15.569  1.00  0.84           N  
ATOM   3083  CA  ARG A 279     102.843  27.461 -16.989  1.00  0.84           C  
ATOM   3084  C   ARG A 279     103.316  26.073 -17.365  1.00  0.84           C  
ATOM   3085  O   ARG A 279     103.633  25.824 -18.525  1.00  0.84           O  
ATOM   3086  CB  ARG A 279     103.927  28.483 -17.419  1.00  0.84           C  
ATOM   3087  CG  ARG A 279     103.429  29.941 -17.396  1.00  0.84           C  
ATOM   3088  CD  ARG A 279     104.520  30.998 -17.610  1.00  0.84           C  
ATOM   3089  NE  ARG A 279     105.160  30.747 -18.943  1.00  0.84           N  
ATOM   3090  CZ  ARG A 279     106.263  31.369 -19.382  1.00  0.84           C  
ATOM   3091  NH1 ARG A 279     106.842  32.325 -18.661  1.00  0.84           N  
ATOM   3092  NH2 ARG A 279     106.786  31.064 -20.567  1.00  0.84           N  
ATOM   3093  N   LEU A 280     103.350  25.129 -16.410  1.00  0.90           N  
ATOM   3094  CA  LEU A 280     103.791  23.787 -16.707  1.00  0.90           C  
ATOM   3095  C   LEU A 280     103.107  22.794 -15.785  1.00  0.90           C  
ATOM   3096  O   LEU A 280     102.854  23.089 -14.619  1.00  0.90           O  
ATOM   3097  CB  LEU A 280     105.332  23.727 -16.574  1.00  0.90           C  
ATOM   3098  CG  LEU A 280     106.006  22.384 -16.903  1.00  0.90           C  
ATOM   3099  CD1 LEU A 280     105.731  21.930 -18.342  1.00  0.90           C  
ATOM   3100  CD2 LEU A 280     107.516  22.497 -16.659  1.00  0.90           C  
ATOM   3101  N   ILE A 281     102.781  21.599 -16.314  1.00  0.91           N  
ATOM   3102  CA  ILE A 281     102.339  20.431 -15.571  1.00  0.91           C  
ATOM   3103  C   ILE A 281     103.325  19.316 -15.876  1.00  0.91           C  
ATOM   3104  O   ILE A 281     103.665  19.071 -17.033  1.00  0.91           O  
ATOM   3105  CB  ILE A 281     100.918  20.026 -15.972  1.00  0.91           C  
ATOM   3106  CG1 ILE A 281      99.878  20.966 -15.333  1.00  0.91           C  
ATOM   3107  CG2 ILE A 281     100.565  18.556 -15.665  1.00  0.91           C  
ATOM   3108  CD1 ILE A 281      99.682  20.748 -13.829  1.00  0.91           C  
ATOM   3109  N   ILE A 282     103.840  18.610 -14.844  1.00  0.89           N  
ATOM   3110  CA  ILE A 282     104.737  17.475 -15.057  1.00  0.89           C  
ATOM   3111  C   ILE A 282     104.083  16.200 -14.594  1.00  0.89           C  
ATOM   3112  O   ILE A 282     103.883  15.948 -13.402  1.00  0.89           O  
ATOM   3113  CB  ILE A 282     106.117  17.612 -14.428  1.00  0.89           C  
ATOM   3114  CG1 ILE A 282     106.825  18.838 -15.032  1.00  0.89           C  
ATOM   3115  CG2 ILE A 282     106.974  16.329 -14.589  1.00  0.89           C  
ATOM   3116  CD1 ILE A 282     108.093  19.232 -14.284  1.00  0.89           C  
ATOM   3117  N   ARG A 283     103.729  15.359 -15.578  1.00  0.81           N  
ATOM   3118  CA  ARG A 283     103.206  14.039 -15.361  1.00  0.81           C  
ATOM   3119  C   ARG A 283     103.215  13.288 -16.670  1.00  0.81           C  
ATOM   3120  O   ARG A 283     103.305  13.875 -17.743  1.00  0.81           O  
ATOM   3121  CB  ARG A 283     101.762  14.022 -14.791  1.00  0.81           C  
ATOM   3122  CG  ARG A 283     100.705  14.782 -15.620  1.00  0.81           C  
ATOM   3123  CD  ARG A 283      99.270  14.470 -15.188  1.00  0.81           C  
ATOM   3124  NE  ARG A 283      98.338  15.402 -15.873  1.00  0.81           N  
ATOM   3125  CZ  ARG A 283      97.795  15.262 -17.088  1.00  0.81           C  
ATOM   3126  NH1 ARG A 283      96.816  16.093 -17.440  1.00  0.81           N  
ATOM   3127  NH2 ARG A 283      98.194  14.301 -17.916  1.00  0.81           N  
ATOM   3128  N   GLU A 284     103.074  11.952 -16.626  1.00  0.83           N  
ATOM   3129  CA  GLU A 284     102.722  11.181 -17.798  1.00  0.83           C  
ATOM   3130  C   GLU A 284     101.257  11.331 -18.170  1.00  0.83           C  
ATOM   3131  O   GLU A 284     100.407  11.763 -17.382  1.00  0.83           O  
ATOM   3132  CB  GLU A 284     103.076   9.697 -17.620  1.00  0.83           C  
ATOM   3133  CG  GLU A 284     104.590   9.470 -17.404  1.00  0.83           C  
ATOM   3134  CD  GLU A 284     104.958   7.990 -17.308  1.00  0.83           C  
ATOM   3135  OE1 GLU A 284     104.027   7.154 -17.193  1.00  0.83           O  
ATOM   3136  OE2 GLU A 284     106.181   7.706 -17.342  1.00  0.83           O  
ATOM   3137  N   ASN A 285     100.915  10.973 -19.420  1.00  0.82           N  
ATOM   3138  CA  ASN A 285      99.574  11.117 -19.935  1.00  0.82           C  
ATOM   3139  C   ASN A 285      99.084   9.751 -20.377  1.00  0.82           C  
ATOM   3140  O   ASN A 285      98.628   9.540 -21.494  1.00  0.82           O  
ATOM   3141  CB  ASN A 285      99.464  12.231 -21.004  1.00  0.82           C  
ATOM   3142  CG  ASN A 285      97.993  12.575 -21.230  1.00  0.82           C  
ATOM   3143  OD1 ASN A 285      97.397  13.317 -20.447  1.00  0.82           O  
ATOM   3144  ND2 ASN A 285      97.379  11.972 -22.269  1.00  0.82           N  
ATOM   3145  N   ASN A 286      99.142   8.787 -19.439  1.00  0.83           N  
ATOM   3146  CA  ASN A 286      98.611   7.449 -19.629  1.00  0.83           C  
ATOM   3147  C   ASN A 286      97.103   7.454 -19.455  1.00  0.83           C  
ATOM   3148  O   ASN A 286      96.536   8.425 -18.950  1.00  0.83           O  
ATOM   3149  CB  ASN A 286      99.227   6.437 -18.629  1.00  0.83           C  
ATOM   3150  CG  ASN A 286     100.746   6.512 -18.762  1.00  0.83           C  
ATOM   3151  OD1 ASN A 286     101.252   6.757 -19.853  1.00  0.83           O  
ATOM   3152  ND2 ASN A 286     101.468   6.367 -17.632  1.00  0.83           N  
ATOM   3153  N   ARG A 287      96.416   6.362 -19.852  1.00  0.74           N  
ATOM   3154  CA  ARG A 287      94.987   6.173 -19.642  1.00  0.74           C  
ATOM   3155  C   ARG A 287      94.576   6.338 -18.180  1.00  0.74           C  
ATOM   3156  O   ARG A 287      95.161   5.711 -17.303  1.00  0.74           O  
ATOM   3157  CB  ARG A 287      94.536   4.783 -20.199  1.00  0.74           C  
ATOM   3158  CG  ARG A 287      95.231   3.542 -19.579  1.00  0.74           C  
ATOM   3159  CD  ARG A 287      95.126   2.235 -20.388  1.00  0.74           C  
ATOM   3160  NE  ARG A 287      93.679   1.858 -20.542  1.00  0.74           N  
ATOM   3161  CZ  ARG A 287      92.984   1.076 -19.700  1.00  0.74           C  
ATOM   3162  NH1 ARG A 287      91.713   0.785 -19.973  1.00  0.74           N  
ATOM   3163  NH2 ARG A 287      93.522   0.587 -18.588  1.00  0.74           N  
ATOM   3164  N   VAL A 288      93.602   7.231 -17.874  1.00  0.88           N  
ATOM   3165  CA  VAL A 288      93.145   7.485 -16.508  1.00  0.88           C  
ATOM   3166  C   VAL A 288      92.385   6.297 -15.931  1.00  0.88           C  
ATOM   3167  O   VAL A 288      91.304   5.945 -16.395  1.00  0.88           O  
ATOM   3168  CB  VAL A 288      92.367   8.795 -16.373  1.00  0.88           C  
ATOM   3169  CG1 VAL A 288      91.949   9.053 -14.912  1.00  0.88           C  
ATOM   3170  CG2 VAL A 288      93.263   9.962 -16.827  1.00  0.88           C  
ATOM   3171  N   VAL A 289      92.962   5.634 -14.909  1.00  0.87           N  
ATOM   3172  CA  VAL A 289      92.427   4.419 -14.320  1.00  0.87           C  
ATOM   3173  C   VAL A 289      92.322   4.621 -12.825  1.00  0.87           C  
ATOM   3174  O   VAL A 289      93.293   4.959 -12.149  1.00  0.87           O  
ATOM   3175  CB  VAL A 289      93.319   3.211 -14.593  1.00  0.87           C  
ATOM   3176  CG1 VAL A 289      92.783   1.943 -13.900  1.00  0.87           C  
ATOM   3177  CG2 VAL A 289      93.397   2.964 -16.108  1.00  0.87           C  
ATOM   3178  N   ILE A 290      91.119   4.407 -12.261  1.00  0.85           N  
ATOM   3179  CA  ILE A 290      90.878   4.603 -10.848  1.00  0.85           C  
ATOM   3180  C   ILE A 290      89.896   3.547 -10.380  1.00  0.85           C  
ATOM   3181  O   ILE A 290      89.121   3.013 -11.173  1.00  0.85           O  
ATOM   3182  CB  ILE A 290      90.386   6.029 -10.550  1.00  0.85           C  
ATOM   3183  CG1 ILE A 290      90.510   6.385  -9.048  1.00  0.85           C  
ATOM   3184  CG2 ILE A 290      88.971   6.268 -11.131  1.00  0.85           C  
ATOM   3185  CD1 ILE A 290      90.246   7.853  -8.701  1.00  0.85           C  
ATOM   3186  N   SER A 291      89.915   3.195  -9.082  1.00  0.86           N  
ATOM   3187  CA  SER A 291      89.029   2.194  -8.521  1.00  0.86           C  
ATOM   3188  C   SER A 291      88.824   2.472  -7.040  1.00  0.86           C  
ATOM   3189  O   SER A 291      89.506   3.313  -6.461  1.00  0.86           O  
ATOM   3190  CB  SER A 291      89.553   0.746  -8.747  1.00  0.86           C  
ATOM   3191  OG  SER A 291      90.843   0.543  -8.169  1.00  0.86           O  
ATOM   3192  N   SER A 292      87.829   1.808  -6.409  1.00  0.84           N  
ATOM   3193  CA  SER A 292      87.577   1.843  -4.970  1.00  0.84           C  
ATOM   3194  C   SER A 292      87.552   0.395  -4.521  1.00  0.84           C  
ATOM   3195  O   SER A 292      86.905  -0.425  -5.175  1.00  0.84           O  
ATOM   3196  CB  SER A 292      86.221   2.541  -4.610  1.00  0.84           C  
ATOM   3197  OG  SER A 292      85.850   2.459  -3.230  1.00  0.84           O  
ATOM   3198  N   ASP A 293      88.294   0.034  -3.446  1.00  0.73           N  
ATOM   3199  CA  ASP A 293      88.255  -1.290  -2.837  1.00  0.73           C  
ATOM   3200  C   ASP A 293      86.894  -1.705  -2.323  1.00  0.73           C  
ATOM   3201  O   ASP A 293      86.135  -0.941  -1.726  1.00  0.73           O  
ATOM   3202  CB  ASP A 293      89.225  -1.514  -1.644  1.00  0.73           C  
ATOM   3203  CG  ASP A 293      90.668  -1.478  -2.080  1.00  0.73           C  
ATOM   3204  OD1 ASP A 293      90.950  -1.944  -3.211  1.00  0.73           O  
ATOM   3205  OD2 ASP A 293      91.517  -1.021  -1.273  1.00  0.73           O  
ATOM   3206  N   VAL A 294      86.595  -2.998  -2.506  1.00  0.64           N  
ATOM   3207  CA  VAL A 294      85.396  -3.620  -1.998  1.00  0.64           C  
ATOM   3208  C   VAL A 294      85.849  -4.541  -0.893  1.00  0.64           C  
ATOM   3209  O   VAL A 294      86.591  -5.494  -1.116  1.00  0.64           O  
ATOM   3210  CB  VAL A 294      84.657  -4.401  -3.075  1.00  0.64           C  
ATOM   3211  CG1 VAL A 294      83.472  -5.189  -2.482  1.00  0.64           C  
ATOM   3212  CG2 VAL A 294      84.158  -3.411  -4.145  1.00  0.64           C  
ATOM   3213  N   LEU A 295      85.426  -4.270   0.357  1.00  0.61           N  
ATOM   3214  CA  LEU A 295      85.688  -5.173   1.461  1.00  0.61           C  
ATOM   3215  C   LEU A 295      84.748  -6.358   1.346  1.00  0.61           C  
ATOM   3216  O   LEU A 295      83.532  -6.188   1.308  1.00  0.61           O  
ATOM   3217  CB  LEU A 295      85.510  -4.477   2.834  1.00  0.61           C  
ATOM   3218  CG  LEU A 295      85.713  -5.375   4.076  1.00  0.61           C  
ATOM   3219  CD1 LEU A 295      87.125  -5.974   4.155  1.00  0.61           C  
ATOM   3220  CD2 LEU A 295      85.393  -4.599   5.364  1.00  0.61           C  
ATOM   3221  N   VAL A 296      85.297  -7.584   1.251  1.00  0.69           N  
ATOM   3222  CA  VAL A 296      84.510  -8.783   1.045  1.00  0.69           C  
ATOM   3223  C   VAL A 296      84.455  -9.587   2.327  1.00  0.69           C  
ATOM   3224  O   VAL A 296      85.460  -9.829   2.994  1.00  0.69           O  
ATOM   3225  CB  VAL A 296      85.006  -9.637  -0.128  1.00  0.69           C  
ATOM   3226  CG1 VAL A 296      84.928  -8.800  -1.420  1.00  0.69           C  
ATOM   3227  CG2 VAL A 296      86.437 -10.178   0.075  1.00  0.69           C  
ATOM   3228  N   ASN A 297      83.244  -9.995   2.732  1.00  0.61           N  
ATOM   3229  CA  ASN A 297      83.021 -10.737   3.945  1.00  0.61           C  
ATOM   3230  C   ASN A 297      81.682 -11.439   3.804  1.00  0.61           C  
ATOM   3231  O   ASN A 297      81.023 -11.300   2.777  1.00  0.61           O  
ATOM   3232  CB  ASN A 297      83.174  -9.867   5.232  1.00  0.61           C  
ATOM   3233  CG  ASN A 297      82.497  -8.498   5.148  1.00  0.61           C  
ATOM   3234  OD1 ASN A 297      81.578  -8.230   4.385  1.00  0.61           O  
ATOM   3235  ND2 ASN A 297      83.007  -7.544   5.974  1.00  0.61           N  
ATOM   3236  N   ASN A 298      81.323 -12.296   4.780  1.00  0.56           N  
ATOM   3237  CA  ASN A 298      80.027 -12.955   4.826  1.00  0.56           C  
ATOM   3238  C   ASN A 298      78.894 -12.089   5.440  1.00  0.56           C  
ATOM   3239  O   ASN A 298      79.187 -10.994   5.989  1.00  0.56           O  
ATOM   3240  CB  ASN A 298      80.080 -14.223   5.712  1.00  0.56           C  
ATOM   3241  CG  ASN A 298      81.109 -15.235   5.249  1.00  0.56           C  
ATOM   3242  OD1 ASN A 298      81.853 -15.810   6.042  1.00  0.56           O  
ATOM   3243  ND2 ASN A 298      81.169 -15.483   3.922  1.00  0.56           N  
ATOM   3244  OXT ASN A 298      77.727 -12.571   5.404  1.00  0.56           O  
TER    3245      ASN A 298                                                      
HETATM 3246  N   SAM _   2      80.765  18.666  -0.958  1.00 26.72           N  
HETATM 3247  CA  SAM _   2      79.381  18.217  -0.653  1.00 26.06           C  
HETATM 3248  C   SAM _   2      78.382  19.137  -1.376  1.00 28.20           C  
HETATM 3249  O   SAM _   2      78.728  19.568  -2.502  1.00 26.88           O  
HETATM 3250  OXT SAM _   2      77.286  19.359  -0.823  1.00 30.73           O  
HETATM 3251  CB  SAM _   2      79.148  18.200   0.864  1.00 29.14           C  
HETATM 3252  CG  SAM _   2      80.147  17.288   1.591  1.00 31.20           C  
HETATM 3253  SD  SAM _   2      79.788  17.039   3.346  1.00 35.19           S  
HETATM 3254  CE  SAM _   2      80.182  18.646   4.019  1.00 36.52           C  
HETATM 3255  C5' SAM _   2      81.261  16.068   3.810  1.00 32.79           C  
HETATM 3256  C4' SAM _   2      81.340  14.695   3.164  1.00 31.76           C  
HETATM 3257  O4' SAM _   2      82.585  14.048   3.519  1.00 33.31           O  
HETATM 3258  C3' SAM _   2      80.236  13.714   3.577  1.00 31.41           C  
HETATM 3259  O3' SAM _   2      79.429  13.402   2.449  1.00 31.40           O  
HETATM 3260  C2' SAM _   2      80.995  12.489   4.113  1.00 31.97           C  
HETATM 3261  O2' SAM _   2      80.398  11.263   3.747  1.00 31.12           O  
HETATM 3262  C1' SAM _   2      82.362  12.660   3.461  1.00 32.31           C  
HETATM 3263  N9  SAM _   2      83.442  11.933   4.130  1.00 31.61           N  
HETATM 3264  C8  SAM _   2      83.785  11.997   5.457  1.00 31.28           C  
HETATM 3265  N7  SAM _   2      84.779  11.207   5.780  1.00 30.47           N  
HETATM 3266  C5  SAM _   2      85.109  10.564   4.597  1.00 31.35           C  
HETATM 3267  C6  SAM _   2      86.083   9.592   4.283  1.00 32.43           C  
HETATM 3268  N6  SAM _   2      86.928   9.069   5.170  1.00 31.92           N  
HETATM 3269  N1  SAM _   2      86.140   9.156   3.003  1.00 31.14           N  
HETATM 3270  C2  SAM _   2      85.285   9.677   2.114  1.00 32.45           C  
HETATM 3271  N3  SAM _   2      84.330  10.586   2.294  1.00 31.66           N  
HETATM 3272  C4  SAM _   2      84.291  11.001   3.572  1.00 30.76           C  
HETATM 3273 ZN    ZN _  12      70.039   9.631 -15.601  1.00 34.15          ZN  
HETATM 3274 ZN    ZN _  13      62.986  23.046 -33.113  1.00 44.26          ZN  
CONECT 3246 3247
CONECT 3247 3246 3248 3251
CONECT 3248 3247 3249 3250
CONECT 3249 3248
CONECT 3250 3248
CONECT 3251 3247 3252
CONECT 3252 3251 3253
CONECT 3253 3252 3254 3255
CONECT 3254 3253
CONECT 3255 3253 3256
CONECT 3256 3255 3257 3258
CONECT 3257 3256 3262
CONECT 3258 3256 3259 3260
CONECT 3259 3258
CONECT 3260 3258 3261 3262
CONECT 3261 3260
CONECT 3262 3257 3260 3263
CONECT 3263 3262 3264 3272
CONECT 3264 3263 3265
CONECT 3265 3264 3266
CONECT 3266 3265 3267 3272
CONECT 3267 3266 3268 3269
CONECT 3268 3267
CONECT 3269 3267 3270
CONECT 3270 3269 3271
CONECT 3271 3270 3272
CONECT 3272 3263 3266 3271
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.