CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 21051310405585522

Job options:

ID        	=	 21051310405585522
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 nsp10 / nsp16 hetero-oligomeric complex |  P0DTD1 PRO_0000449628,
TITLE    3 PRO_0000449633
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   20-MAY-20 1MOD    1       16:46
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.0.0
REMARK   3  OSTAT   hetero-1-1-mer
REMARK   3  OSRSN   TEMPLATE
REMARK   3  QSPRD   NA
REMARK   3  QMN4    -1.19
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    SAM
REMARK   3  BIND    A.43
REMARK   3  BIND 2  A.47
REMARK   3  BIND 3  A.71
REMARK   3  BIND 4  A.72
REMARK   3  BIND 5  A.73
REMARK   3  BIND 6  A.74
REMARK   3  BIND 7  A.80
REMARK   3  BIND 8  A.81
REMARK   3  BIND 9  A.99
REMARK   3  BIND 10  A.100
REMARK   3  BIND 11  A.101
REMARK   3  BIND 12  A.113
REMARK   3  BIND 13  A.114
REMARK   3  BIND 14  A.115
REMARK   3  BIND 15  A.130
REMARK   3  BIND 16  A.131
REMARK   3  BIND 17  A.132
REMARK   3  BIND 18  A.149
REMARK   3  BIND 19  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    ZN
REMARK   3  BIND    B.74
REMARK   3  BIND 2  B.77
REMARK   3  BIND 3  B.83
REMARK   3  BIND 4  B.90
REMARK   3  BIND 5  _.12
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    ZN
REMARK   3  BIND    B.117
REMARK   3  BIND 2  B.120
REMARK   3  BIND 3  B.128
REMARK   3  BIND 4  B.130
REMARK   3  BIND 5  _.13
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   6w75
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2020-05-15
REMARK   3  SMTLE   6w75.1
REMARK   3  SMTLV   2020-05-20
REMARK   3  MTHD    X-RAY DIFFRACTION 1.95 A
REMARK   3  FOUND   HHblits
REMARK   3  SIM     0.62
REMARK   3  SID     100.00
REMARK   3  OSTAT   hetero-1-1-mer
REMARK   3  LIGND   SAM
REMARK   3  LIGND 2 ZN
REMARK   3  LIGND 3 ZN
REMARK   3  ALN A TRG SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLT
REMARK   3  ALN A TRG LAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCA
REMARK   3  ALN A TRG TVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEH
REMARK   3  ALN A TRG SWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWR
REMARK   3  ALN A TRG NTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVI
REMARK   3  ALN A TRG SSDVLVNN
REMARK   3  ALN A TPL -SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLT
REMARK   3  ALN A TPL LAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCA
REMARK   3  ALN A TPL TVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEH
REMARK   3  ALN A TPL SWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWR
REMARK   3  ALN A TPL NTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVI
REMARK   3  ALN A TPL SSDVLVNN
REMARK   3  ALN A OFF 4
REMARK   3  ALN B TRG AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVT
REMARK   3  ALN B TRG PEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV
REMARK   3  ALN B TRG CTVCGMWKGYGCSCDQLREPMLQ
REMARK   3  ALN B TPL AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVT
REMARK   3  ALN B TPL PEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV
REMARK   3  ALN B TPL CTVCGMWKGYGCSCDQLREPMLQ
REMARK   3  ALN B OFF 3
ATOM      1  N   ALA B  18      58.979 -10.488 -20.193  1.00  0.27           N  
ATOM      2  CA  ALA B  18      58.238  -9.280 -20.688  1.00  0.27           C  
ATOM      3  C   ALA B  18      57.914  -8.206 -19.659  1.00  0.27           C  
ATOM      4  O   ALA B  18      57.715  -7.062 -20.034  1.00  0.27           O  
ATOM      5  CB  ALA B  18      56.940  -9.738 -21.384  1.00  0.27           C  
ATOM      6  N   PHE B  19      57.864  -8.528 -18.342  1.00  0.33           N  
ATOM      7  CA  PHE B  19      57.697  -7.537 -17.290  1.00  0.33           C  
ATOM      8  C   PHE B  19      58.796  -6.481 -17.307  1.00  0.33           C  
ATOM      9  O   PHE B  19      59.975  -6.798 -17.449  1.00  0.33           O  
ATOM     10  CB  PHE B  19      57.663  -8.266 -15.916  1.00  0.33           C  
ATOM     11  CG  PHE B  19      57.516  -7.323 -14.753  1.00  0.33           C  
ATOM     12  CD1 PHE B  19      56.311  -6.641 -14.537  1.00  0.33           C  
ATOM     13  CD2 PHE B  19      58.610  -7.056 -13.912  1.00  0.33           C  
ATOM     14  CE1 PHE B  19      56.199  -5.707 -13.501  1.00  0.33           C  
ATOM     15  CE2 PHE B  19      58.499  -6.123 -12.875  1.00  0.33           C  
ATOM     16  CZ  PHE B  19      57.292  -5.449 -12.667  1.00  0.33           C  
ATOM     17  N   ALA B  20      58.394  -5.210 -17.166  1.00  0.43           N  
ATOM     18  CA  ALA B  20      59.301  -4.104 -17.124  1.00  0.43           C  
ATOM     19  C   ALA B  20      58.677  -3.077 -16.201  1.00  0.43           C  
ATOM     20  O   ALA B  20      57.492  -2.771 -16.302  1.00  0.43           O  
ATOM     21  CB  ALA B  20      59.503  -3.555 -18.551  1.00  0.43           C  
ATOM     22  N   VAL B  21      59.454  -2.552 -15.235  1.00  0.67           N  
ATOM     23  CA  VAL B  21      59.034  -1.466 -14.361  1.00  0.67           C  
ATOM     24  C   VAL B  21      58.948  -0.143 -15.118  1.00  0.67           C  
ATOM     25  O   VAL B  21      59.935   0.324 -15.683  1.00  0.67           O  
ATOM     26  CB  VAL B  21      59.995  -1.334 -13.180  1.00  0.67           C  
ATOM     27  CG1 VAL B  21      59.662  -0.119 -12.291  1.00  0.67           C  
ATOM     28  CG2 VAL B  21      59.956  -2.621 -12.332  1.00  0.67           C  
ATOM     29  N   ASP B  22      57.764   0.512 -15.124  1.00  0.85           N  
ATOM     30  CA  ASP B  22      57.555   1.792 -15.776  1.00  0.85           C  
ATOM     31  C   ASP B  22      57.606   2.889 -14.716  1.00  0.85           C  
ATOM     32  O   ASP B  22      56.605   3.322 -14.143  1.00  0.85           O  
ATOM     33  CB  ASP B  22      56.239   1.778 -16.596  1.00  0.85           C  
ATOM     34  CG  ASP B  22      56.072   3.009 -17.485  1.00  0.85           C  
ATOM     35  OD1 ASP B  22      56.798   4.022 -17.280  1.00  0.85           O  
ATOM     36  OD2 ASP B  22      55.156   2.971 -18.344  1.00  0.85           O  
ATOM     37  N   ALA B  23      58.834   3.347 -14.405  1.00  0.93           N  
ATOM     38  CA  ALA B  23      59.077   4.412 -13.457  1.00  0.93           C  
ATOM     39  C   ALA B  23      58.507   5.764 -13.876  1.00  0.93           C  
ATOM     40  O   ALA B  23      58.024   6.534 -13.049  1.00  0.93           O  
ATOM     41  CB  ALA B  23      60.585   4.535 -13.187  1.00  0.93           C  
ATOM     42  N   ALA B  24      58.563   6.089 -15.184  1.00  0.93           N  
ATOM     43  CA  ALA B  24      58.036   7.313 -15.738  1.00  0.93           C  
ATOM     44  C   ALA B  24      56.543   7.456 -15.584  1.00  0.93           C  
ATOM     45  O   ALA B  24      56.060   8.513 -15.188  1.00  0.93           O  
ATOM     46  CB  ALA B  24      58.343   7.379 -17.239  1.00  0.93           C  
ATOM     47  N   LYS B  25      55.772   6.392 -15.876  1.00  0.87           N  
ATOM     48  CA  LYS B  25      54.350   6.364 -15.607  1.00  0.87           C  
ATOM     49  C   LYS B  25      54.030   6.472 -14.124  1.00  0.87           C  
ATOM     50  O   LYS B  25      53.200   7.281 -13.723  1.00  0.87           O  
ATOM     51  CB  LYS B  25      53.746   5.070 -16.185  1.00  0.87           C  
ATOM     52  CG  LYS B  25      52.251   4.887 -15.911  1.00  0.87           C  
ATOM     53  CD  LYS B  25      51.713   3.558 -16.460  1.00  0.87           C  
ATOM     54  CE  LYS B  25      50.315   3.227 -15.936  1.00  0.87           C  
ATOM     55  NZ  LYS B  25      49.402   4.358 -16.200  1.00  0.87           N  
ATOM     56  N   ALA B  26      54.746   5.714 -13.266  1.00  0.89           N  
ATOM     57  CA  ALA B  26      54.539   5.715 -11.831  1.00  0.89           C  
ATOM     58  C   ALA B  26      54.744   7.074 -11.167  1.00  0.89           C  
ATOM     59  O   ALA B  26      53.963   7.487 -10.311  1.00  0.89           O  
ATOM     60  CB  ALA B  26      55.482   4.681 -11.190  1.00  0.89           C  
ATOM     61  N   TYR B  27      55.790   7.825 -11.574  1.00  0.90           N  
ATOM     62  CA  TYR B  27      56.007   9.192 -11.132  1.00  0.90           C  
ATOM     63  C   TYR B  27      54.888  10.133 -11.574  1.00  0.90           C  
ATOM     64  O   TYR B  27      54.400  10.942 -10.793  1.00  0.90           O  
ATOM     65  CB  TYR B  27      57.394   9.705 -11.608  1.00  0.90           C  
ATOM     66  CG  TYR B  27      57.773  11.031 -10.978  1.00  0.90           C  
ATOM     67  CD1 TYR B  27      57.974  11.134  -9.594  1.00  0.90           C  
ATOM     68  CD2 TYR B  27      57.896  12.194 -11.755  1.00  0.90           C  
ATOM     69  CE1 TYR B  27      58.292  12.366  -9.002  1.00  0.90           C  
ATOM     70  CE2 TYR B  27      58.267  13.412 -11.169  1.00  0.90           C  
ATOM     71  CZ  TYR B  27      58.469  13.504  -9.794  1.00  0.90           C  
ATOM     72  OH  TYR B  27      58.833  14.735  -9.209  1.00  0.90           O  
ATOM     73  N   LYS B  28      54.418  10.027 -12.833  1.00  0.89           N  
ATOM     74  CA  LYS B  28      53.311  10.831 -13.329  1.00  0.89           C  
ATOM     75  C   LYS B  28      51.983  10.579 -12.621  1.00  0.89           C  
ATOM     76  O   LYS B  28      51.290  11.534 -12.268  1.00  0.89           O  
ATOM     77  CB  LYS B  28      53.141  10.643 -14.853  1.00  0.89           C  
ATOM     78  CG  LYS B  28      54.359  11.129 -15.658  1.00  0.89           C  
ATOM     79  CD  LYS B  28      54.320  10.696 -17.137  1.00  0.89           C  
ATOM     80  CE  LYS B  28      55.620  11.027 -17.886  1.00  0.89           C  
ATOM     81  NZ  LYS B  28      55.603  10.526 -19.282  1.00  0.89           N  
ATOM     82  N   ASP B  29      51.633   9.300 -12.363  1.00  0.88           N  
ATOM     83  CA  ASP B  29      50.482   8.896 -11.572  1.00  0.88           C  
ATOM     84  C   ASP B  29      50.595   9.392 -10.115  1.00  0.88           C  
ATOM     85  O   ASP B  29      49.646   9.922  -9.544  1.00  0.88           O  
ATOM     86  CB  ASP B  29      50.263   7.347 -11.664  1.00  0.88           C  
ATOM     87  CG  ASP B  29      49.896   6.835 -13.068  1.00  0.88           C  
ATOM     88  OD1 ASP B  29      49.434   7.634 -13.918  1.00  0.88           O  
ATOM     89  OD2 ASP B  29      50.041   5.605 -13.330  1.00  0.88           O  
ATOM     90  N   TYR B  30      51.794   9.310  -9.487  1.00  0.91           N  
ATOM     91  CA  TYR B  30      52.074   9.873  -8.169  1.00  0.91           C  
ATOM     92  C   TYR B  30      51.837  11.384  -8.097  1.00  0.91           C  
ATOM     93  O   TYR B  30      51.174  11.868  -7.180  1.00  0.91           O  
ATOM     94  CB  TYR B  30      53.537   9.492  -7.783  1.00  0.91           C  
ATOM     95  CG  TYR B  30      54.128  10.221  -6.602  1.00  0.91           C  
ATOM     96  CD1 TYR B  30      53.908   9.803  -5.281  1.00  0.91           C  
ATOM     97  CD2 TYR B  30      54.933  11.348  -6.830  1.00  0.91           C  
ATOM     98  CE1 TYR B  30      54.503  10.490  -4.212  1.00  0.91           C  
ATOM     99  CE2 TYR B  30      55.527  12.031  -5.764  1.00  0.91           C  
ATOM    100  CZ  TYR B  30      55.323  11.595  -4.452  1.00  0.91           C  
ATOM    101  OH  TYR B  30      55.906  12.283  -3.370  1.00  0.91           O  
ATOM    102  N   LEU B  31      52.325  12.158  -9.087  1.00  0.91           N  
ATOM    103  CA  LEU B  31      52.079  13.590  -9.189  1.00  0.91           C  
ATOM    104  C   LEU B  31      50.612  13.953  -9.375  1.00  0.91           C  
ATOM    105  O   LEU B  31      50.105  14.888  -8.762  1.00  0.91           O  
ATOM    106  CB  LEU B  31      52.847  14.197 -10.381  1.00  0.91           C  
ATOM    107  CG  LEU B  31      54.378  14.175 -10.257  1.00  0.91           C  
ATOM    108  CD1 LEU B  31      54.986  14.659 -11.579  1.00  0.91           C  
ATOM    109  CD2 LEU B  31      54.896  15.011  -9.079  1.00  0.91           C  
ATOM    110  N   ALA B  32      49.886  13.198 -10.224  1.00  0.90           N  
ATOM    111  CA  ALA B  32      48.462  13.355 -10.456  1.00  0.90           C  
ATOM    112  C   ALA B  32      47.617  13.100  -9.213  1.00  0.90           C  
ATOM    113  O   ALA B  32      46.572  13.715  -9.020  1.00  0.90           O  
ATOM    114  CB  ALA B  32      48.019  12.419 -11.592  1.00  0.90           C  
ATOM    115  N   SER B  33      48.095  12.222  -8.310  1.00  0.85           N  
ATOM    116  CA  SER B  33      47.434  11.931  -7.044  1.00  0.85           C  
ATOM    117  C   SER B  33      47.803  12.910  -5.944  1.00  0.85           C  
ATOM    118  O   SER B  33      47.341  12.783  -4.813  1.00  0.85           O  
ATOM    119  CB  SER B  33      47.828  10.534  -6.503  1.00  0.85           C  
ATOM    120  OG  SER B  33      47.311   9.498  -7.335  1.00  0.85           O  
ATOM    121  N   GLY B  34      48.632  13.933  -6.243  1.00  0.92           N  
ATOM    122  CA  GLY B  34      48.980  14.983  -5.289  1.00  0.92           C  
ATOM    123  C   GLY B  34      50.281  14.760  -4.582  1.00  0.92           C  
ATOM    124  O   GLY B  34      50.590  15.434  -3.604  1.00  0.92           O  
ATOM    125  N   GLY B  35      51.084  13.791  -5.057  1.00  0.94           N  
ATOM    126  CA  GLY B  35      52.425  13.524  -4.562  1.00  0.94           C  
ATOM    127  C   GLY B  35      53.372  14.688  -4.616  1.00  0.94           C  
ATOM    128  O   GLY B  35      53.402  15.458  -5.571  1.00  0.94           O  
ATOM    129  N   GLN B  36      54.224  14.819  -3.585  1.00  0.87           N  
ATOM    130  CA  GLN B  36      55.212  15.875  -3.521  1.00  0.87           C  
ATOM    131  C   GLN B  36      56.323  15.638  -4.548  1.00  0.87           C  
ATOM    132  O   GLN B  36      56.953  14.581  -4.450  1.00  0.87           O  
ATOM    133  CB  GLN B  36      55.849  15.936  -2.115  1.00  0.87           C  
ATOM    134  CG  GLN B  36      56.844  17.106  -1.941  1.00  0.87           C  
ATOM    135  CD  GLN B  36      57.419  17.139  -0.526  1.00  0.87           C  
ATOM    136  OE1 GLN B  36      57.186  16.269   0.308  1.00  0.87           O  
ATOM    137  NE2 GLN B  36      58.204  18.203  -0.229  1.00  0.87           N  
ATOM    138  N   PRO B  37      56.606  16.504  -5.528  1.00  0.95           N  
ATOM    139  CA  PRO B  37      57.727  16.364  -6.459  1.00  0.95           C  
ATOM    140  C   PRO B  37      59.072  16.006  -5.851  1.00  0.95           C  
ATOM    141  O   PRO B  37      59.342  16.374  -4.706  1.00  0.95           O  
ATOM    142  CB  PRO B  37      57.798  17.712  -7.190  1.00  0.95           C  
ATOM    143  CG  PRO B  37      56.390  18.294  -7.067  1.00  0.95           C  
ATOM    144  CD  PRO B  37      55.921  17.783  -5.709  1.00  0.95           C  
ATOM    145  N   ILE B  38      59.945  15.305  -6.602  1.00  0.91           N  
ATOM    146  CA  ILE B  38      61.319  15.033  -6.198  1.00  0.91           C  
ATOM    147  C   ILE B  38      62.089  16.322  -5.960  1.00  0.91           C  
ATOM    148  O   ILE B  38      62.128  17.234  -6.782  1.00  0.91           O  
ATOM    149  CB  ILE B  38      62.059  14.142  -7.202  1.00  0.91           C  
ATOM    150  CG1 ILE B  38      61.468  12.716  -7.196  1.00  0.91           C  
ATOM    151  CG2 ILE B  38      63.583  14.083  -6.934  1.00  0.91           C  
ATOM    152  CD1 ILE B  38      61.916  11.863  -8.389  1.00  0.91           C  
ATOM    153  N   THR B  39      62.741  16.414  -4.787  1.00  0.89           N  
ATOM    154  CA  THR B  39      63.383  17.621  -4.313  1.00  0.89           C  
ATOM    155  C   THR B  39      64.875  17.490  -4.438  1.00  0.89           C  
ATOM    156  O   THR B  39      65.420  16.464  -4.854  1.00  0.89           O  
ATOM    157  CB  THR B  39      63.040  17.974  -2.870  1.00  0.89           C  
ATOM    158  OG1 THR B  39      63.420  16.943  -1.968  1.00  0.89           O  
ATOM    159  CG2 THR B  39      61.526  18.155  -2.740  1.00  0.89           C  
ATOM    160  N   ASN B  40      65.589  18.586  -4.114  1.00  0.87           N  
ATOM    161  CA  ASN B  40      67.036  18.658  -4.090  1.00  0.87           C  
ATOM    162  C   ASN B  40      67.656  18.485  -5.460  1.00  0.87           C  
ATOM    163  O   ASN B  40      68.780  18.020  -5.609  1.00  0.87           O  
ATOM    164  CB  ASN B  40      67.689  17.702  -3.054  1.00  0.87           C  
ATOM    165  CG  ASN B  40      67.366  18.134  -1.628  1.00  0.87           C  
ATOM    166  OD1 ASN B  40      67.546  19.293  -1.247  1.00  0.87           O  
ATOM    167  ND2 ASN B  40      66.951  17.164  -0.777  1.00  0.87           N  
ATOM    168  N   CYS B  41      66.927  18.916  -6.503  1.00  0.91           N  
ATOM    169  CA  CYS B  41      67.498  19.213  -7.794  1.00  0.91           C  
ATOM    170  C   CYS B  41      68.412  20.421  -7.675  1.00  0.91           C  
ATOM    171  O   CYS B  41      68.097  21.414  -7.027  1.00  0.91           O  
ATOM    172  CB  CYS B  41      66.415  19.404  -8.878  1.00  0.91           C  
ATOM    173  SG  CYS B  41      65.278  17.981  -8.983  1.00  0.91           S  
ATOM    174  N   VAL B  42      69.610  20.321  -8.260  1.00  0.91           N  
ATOM    175  CA  VAL B  42      70.730  21.194  -7.991  1.00  0.91           C  
ATOM    176  C   VAL B  42      70.669  22.356  -8.937  1.00  0.91           C  
ATOM    177  O   VAL B  42      71.085  22.266 -10.090  1.00  0.91           O  
ATOM    178  CB  VAL B  42      72.095  20.518  -8.116  1.00  0.91           C  
ATOM    179  CG1 VAL B  42      73.219  21.536  -7.837  1.00  0.91           C  
ATOM    180  CG2 VAL B  42      72.197  19.361  -7.105  1.00  0.91           C  
ATOM    181  N   LYS B  43      70.123  23.485  -8.466  1.00  0.86           N  
ATOM    182  CA  LYS B  43      70.041  24.680  -9.262  1.00  0.86           C  
ATOM    183  C   LYS B  43      71.349  25.443  -9.301  1.00  0.86           C  
ATOM    184  O   LYS B  43      72.004  25.649  -8.280  1.00  0.86           O  
ATOM    185  CB  LYS B  43      68.915  25.594  -8.764  1.00  0.86           C  
ATOM    186  CG  LYS B  43      68.624  26.695  -9.779  1.00  0.86           C  
ATOM    187  CD  LYS B  43      67.295  27.390  -9.542  1.00  0.86           C  
ATOM    188  CE  LYS B  43      67.327  28.323  -8.348  1.00  0.86           C  
ATOM    189  NZ  LYS B  43      66.161  29.202  -8.410  1.00  0.86           N  
ATOM    190  N   MET B  44      71.762  25.873 -10.505  1.00  0.84           N  
ATOM    191  CA  MET B  44      73.034  26.517 -10.709  1.00  0.84           C  
ATOM    192  C   MET B  44      72.898  28.021 -10.723  1.00  0.84           C  
ATOM    193  O   MET B  44      71.872  28.584 -11.095  1.00  0.84           O  
ATOM    194  CB  MET B  44      73.691  26.086 -12.043  1.00  0.84           C  
ATOM    195  CG  MET B  44      73.692  24.565 -12.288  1.00  0.84           C  
ATOM    196  SD  MET B  44      74.300  23.538 -10.917  1.00  0.84           S  
ATOM    197  CE  MET B  44      75.962  24.240 -10.787  1.00  0.84           C  
ATOM    198  N   LEU B  45      73.974  28.724 -10.336  1.00  0.84           N  
ATOM    199  CA  LEU B  45      74.070  30.154 -10.531  1.00  0.84           C  
ATOM    200  C   LEU B  45      74.536  30.426 -11.943  1.00  0.84           C  
ATOM    201  O   LEU B  45      75.457  29.786 -12.445  1.00  0.84           O  
ATOM    202  CB  LEU B  45      75.067  30.773  -9.534  1.00  0.84           C  
ATOM    203  CG  LEU B  45      74.551  30.782  -8.088  1.00  0.84           C  
ATOM    204  CD1 LEU B  45      75.715  30.931  -7.106  1.00  0.84           C  
ATOM    205  CD2 LEU B  45      73.538  31.913  -7.882  1.00  0.84           C  
ATOM    206  N   CYS B  46      73.906  31.377 -12.640  1.00  0.85           N  
ATOM    207  CA  CYS B  46      74.250  31.665 -14.011  1.00  0.85           C  
ATOM    208  C   CYS B  46      73.795  33.071 -14.303  1.00  0.85           C  
ATOM    209  O   CYS B  46      73.190  33.723 -13.459  1.00  0.85           O  
ATOM    210  CB  CYS B  46      73.680  30.631 -15.032  1.00  0.85           C  
ATOM    211  SG  CYS B  46      71.872  30.394 -14.954  1.00  0.85           S  
ATOM    212  N   THR B  47      74.135  33.602 -15.491  1.00  0.84           N  
ATOM    213  CA  THR B  47      73.802  34.958 -15.891  1.00  0.84           C  
ATOM    214  C   THR B  47      72.369  35.142 -16.348  1.00  0.84           C  
ATOM    215  O   THR B  47      71.862  36.257 -16.361  1.00  0.84           O  
ATOM    216  CB  THR B  47      74.672  35.397 -17.060  1.00  0.84           C  
ATOM    217  OG1 THR B  47      74.649  34.432 -18.104  1.00  0.84           O  
ATOM    218  CG2 THR B  47      76.131  35.534 -16.592  1.00  0.84           C  
ATOM    219  N   HIS B  48      71.697  34.044 -16.755  1.00  0.82           N  
ATOM    220  CA  HIS B  48      70.362  34.051 -17.335  1.00  0.82           C  
ATOM    221  C   HIS B  48      70.284  34.798 -18.665  1.00  0.82           C  
ATOM    222  O   HIS B  48      69.269  35.370 -19.055  1.00  0.82           O  
ATOM    223  CB  HIS B  48      69.282  34.460 -16.322  1.00  0.82           C  
ATOM    224  CG  HIS B  48      69.192  33.468 -15.205  1.00  0.82           C  
ATOM    225  ND1 HIS B  48      68.251  32.479 -15.330  1.00  0.82           N  
ATOM    226  CD2 HIS B  48      69.868  33.325 -14.036  1.00  0.82           C  
ATOM    227  CE1 HIS B  48      68.344  31.756 -14.237  1.00  0.82           C  
ATOM    228  NE2 HIS B  48      69.318  32.220 -13.417  1.00  0.82           N  
ATOM    229  N   THR B  49      71.401  34.753 -19.419  1.00  0.89           N  
ATOM    230  CA  THR B  49      71.578  35.395 -20.715  1.00  0.89           C  
ATOM    231  C   THR B  49      72.011  34.383 -21.752  1.00  0.89           C  
ATOM    232  O   THR B  49      72.548  34.736 -22.797  1.00  0.89           O  
ATOM    233  CB  THR B  49      72.563  36.572 -20.705  1.00  0.89           C  
ATOM    234  OG1 THR B  49      73.860  36.252 -20.216  1.00  0.89           O  
ATOM    235  CG2 THR B  49      72.028  37.666 -19.774  1.00  0.89           C  
ATOM    236  N   GLY B  50      71.782  33.083 -21.469  1.00  0.95           N  
ATOM    237  CA  GLY B  50      72.174  31.971 -22.325  1.00  0.95           C  
ATOM    238  C   GLY B  50      71.284  31.723 -23.510  1.00  0.95           C  
ATOM    239  O   GLY B  50      70.315  32.435 -23.776  1.00  0.95           O  
ATOM    240  N   THR B  51      71.593  30.644 -24.253  1.00  0.95           N  
ATOM    241  CA  THR B  51      70.899  30.251 -25.482  1.00  0.95           C  
ATOM    242  C   THR B  51      69.449  29.864 -25.311  1.00  0.95           C  
ATOM    243  O   THR B  51      68.633  30.009 -26.218  1.00  0.95           O  
ATOM    244  CB  THR B  51      71.562  29.124 -26.274  1.00  0.95           C  
ATOM    245  OG1 THR B  51      71.603  27.885 -25.579  1.00  0.95           O  
ATOM    246  CG2 THR B  51      73.005  29.517 -26.589  1.00  0.95           C  
ATOM    247  N   GLY B  52      69.103  29.325 -24.131  1.00  0.98           N  
ATOM    248  CA  GLY B  52      67.801  28.774 -23.818  1.00  0.98           C  
ATOM    249  C   GLY B  52      67.590  27.353 -24.266  1.00  0.98           C  
ATOM    250  O   GLY B  52      66.502  26.806 -24.102  1.00  0.98           O  
ATOM    251  N   GLN B  53      68.623  26.707 -24.847  1.00  0.93           N  
ATOM    252  CA  GLN B  53      68.570  25.313 -25.259  1.00  0.93           C  
ATOM    253  C   GLN B  53      68.339  24.348 -24.114  1.00  0.93           C  
ATOM    254  O   GLN B  53      68.710  24.596 -22.972  1.00  0.93           O  
ATOM    255  CB  GLN B  53      69.793  24.879 -26.094  1.00  0.93           C  
ATOM    256  CG  GLN B  53      69.852  25.582 -27.467  1.00  0.93           C  
ATOM    257  CD  GLN B  53      70.962  24.998 -28.339  1.00  0.93           C  
ATOM    258  OE1 GLN B  53      72.107  24.848 -27.914  1.00  0.93           O  
ATOM    259  NE2 GLN B  53      70.637  24.656 -29.608  1.00  0.93           N  
ATOM    260  N   ALA B  54      67.657  23.222 -24.383  1.00  0.99           N  
ATOM    261  CA  ALA B  54      67.171  22.360 -23.334  1.00  0.99           C  
ATOM    262  C   ALA B  54      68.219  21.658 -22.484  1.00  0.99           C  
ATOM    263  O   ALA B  54      68.158  21.709 -21.259  1.00  0.99           O  
ATOM    264  CB  ALA B  54      66.289  21.291 -23.986  1.00  0.99           C  
ATOM    265  N   ILE B  55      69.208  21.004 -23.120  1.00  0.94           N  
ATOM    266  CA  ILE B  55      70.232  20.236 -22.431  1.00  0.94           C  
ATOM    267  C   ILE B  55      71.567  20.628 -23.019  1.00  0.94           C  
ATOM    268  O   ILE B  55      71.804  20.498 -24.220  1.00  0.94           O  
ATOM    269  CB  ILE B  55      70.052  18.724 -22.556  1.00  0.94           C  
ATOM    270  CG1 ILE B  55      68.652  18.271 -22.076  1.00  0.94           C  
ATOM    271  CG2 ILE B  55      71.160  18.026 -21.739  1.00  0.94           C  
ATOM    272  CD1 ILE B  55      68.348  16.794 -22.356  1.00  0.94           C  
ATOM    273  N   THR B  56      72.478  21.150 -22.184  1.00  0.92           N  
ATOM    274  CA  THR B  56      73.669  21.841 -22.651  1.00  0.92           C  
ATOM    275  C   THR B  56      74.877  21.443 -21.830  1.00  0.92           C  
ATOM    276  O   THR B  56      74.770  20.861 -20.756  1.00  0.92           O  
ATOM    277  CB  THR B  56      73.496  23.355 -22.612  1.00  0.92           C  
ATOM    278  OG1 THR B  56      72.991  23.781 -21.358  1.00  0.92           O  
ATOM    279  CG2 THR B  56      72.471  23.775 -23.680  1.00  0.92           C  
ATOM    280  N   VAL B  57      76.107  21.703 -22.331  1.00  0.89           N  
ATOM    281  CA  VAL B  57      77.340  21.333 -21.641  1.00  0.89           C  
ATOM    282  C   VAL B  57      77.707  22.253 -20.483  1.00  0.89           C  
ATOM    283  O   VAL B  57      78.547  21.915 -19.660  1.00  0.89           O  
ATOM    284  CB  VAL B  57      78.537  21.268 -22.589  1.00  0.89           C  
ATOM    285  CG1 VAL B  57      78.311  20.185 -23.661  1.00  0.89           C  
ATOM    286  CG2 VAL B  57      78.818  22.640 -23.235  1.00  0.89           C  
ATOM    287  N   THR B  58      77.076  23.436 -20.393  1.00  0.86           N  
ATOM    288  CA  THR B  58      77.303  24.429 -19.357  1.00  0.86           C  
ATOM    289  C   THR B  58      75.944  25.091 -19.174  1.00  0.86           C  
ATOM    290  O   THR B  58      75.158  24.997 -20.118  1.00  0.86           O  
ATOM    291  CB  THR B  58      78.399  25.433 -19.731  1.00  0.86           C  
ATOM    292  OG1 THR B  58      78.787  26.251 -18.640  1.00  0.86           O  
ATOM    293  CG2 THR B  58      77.994  26.361 -20.881  1.00  0.86           C  
ATOM    294  N   PRO B  59      75.545  25.705 -18.058  1.00  0.92           N  
ATOM    295  CA  PRO B  59      74.270  26.406 -17.909  1.00  0.92           C  
ATOM    296  C   PRO B  59      73.944  27.460 -18.952  1.00  0.92           C  
ATOM    297  O   PRO B  59      74.699  28.418 -19.082  1.00  0.92           O  
ATOM    298  CB  PRO B  59      74.413  27.077 -16.533  1.00  0.92           C  
ATOM    299  CG  PRO B  59      75.269  26.101 -15.740  1.00  0.92           C  
ATOM    300  CD  PRO B  59      76.279  25.659 -16.796  1.00  0.92           C  
ATOM    301  N   GLU B  60      72.789  27.335 -19.634  1.00  0.89           N  
ATOM    302  CA  GLU B  60      72.403  28.177 -20.752  1.00  0.89           C  
ATOM    303  C   GLU B  60      71.004  28.738 -20.563  1.00  0.89           C  
ATOM    304  O   GLU B  60      70.288  29.009 -21.524  1.00  0.89           O  
ATOM    305  CB  GLU B  60      72.455  27.374 -22.075  1.00  0.89           C  
ATOM    306  CG  GLU B  60      73.893  27.118 -22.585  1.00  0.89           C  
ATOM    307  CD  GLU B  60      74.567  28.381 -23.118  1.00  0.89           C  
ATOM    308  OE1 GLU B  60      73.881  29.432 -23.237  1.00  0.89           O  
ATOM    309  OE2 GLU B  60      75.774  28.280 -23.451  1.00  0.89           O  
ATOM    310  N   ALA B  61      70.548  28.924 -19.303  1.00  0.96           N  
ATOM    311  CA  ALA B  61      69.267  29.545 -19.024  1.00  0.96           C  
ATOM    312  C   ALA B  61      69.144  30.942 -19.591  1.00  0.96           C  
ATOM    313  O   ALA B  61      70.089  31.731 -19.577  1.00  0.96           O  
ATOM    314  CB  ALA B  61      68.950  29.599 -17.516  1.00  0.96           C  
ATOM    315  N   ASN B  62      67.952  31.258 -20.122  1.00  0.90           N  
ATOM    316  CA  ASN B  62      67.591  32.596 -20.520  1.00  0.90           C  
ATOM    317  C   ASN B  62      66.842  33.231 -19.357  1.00  0.90           C  
ATOM    318  O   ASN B  62      66.817  32.679 -18.265  1.00  0.90           O  
ATOM    319  CB  ASN B  62      66.856  32.585 -21.891  1.00  0.90           C  
ATOM    320  CG  ASN B  62      65.525  31.841 -21.872  1.00  0.90           C  
ATOM    321  OD1 ASN B  62      64.883  31.674 -20.841  1.00  0.90           O  
ATOM    322  ND2 ASN B  62      65.051  31.413 -23.066  1.00  0.90           N  
ATOM    323  N   MET B  63      66.204  34.401 -19.538  1.00  0.86           N  
ATOM    324  CA  MET B  63      65.515  35.071 -18.446  1.00  0.86           C  
ATOM    325  C   MET B  63      64.308  34.303 -17.883  1.00  0.86           C  
ATOM    326  O   MET B  63      63.920  34.486 -16.732  1.00  0.86           O  
ATOM    327  CB  MET B  63      65.104  36.486 -18.918  1.00  0.86           C  
ATOM    328  CG  MET B  63      64.590  37.413 -17.799  1.00  0.86           C  
ATOM    329  SD  MET B  63      64.173  39.101 -18.341  1.00  0.86           S  
ATOM    330  CE  MET B  63      62.678  38.649 -19.269  1.00  0.86           C  
ATOM    331  N   ASP B  64      63.729  33.384 -18.683  1.00  0.89           N  
ATOM    332  CA  ASP B  64      62.518  32.663 -18.365  1.00  0.89           C  
ATOM    333  C   ASP B  64      62.819  31.213 -17.978  1.00  0.89           C  
ATOM    334  O   ASP B  64      61.931  30.356 -17.941  1.00  0.89           O  
ATOM    335  CB  ASP B  64      61.548  32.696 -19.574  1.00  0.89           C  
ATOM    336  CG  ASP B  64      61.171  34.124 -19.944  1.00  0.89           C  
ATOM    337  OD1 ASP B  64      60.851  34.920 -19.025  1.00  0.89           O  
ATOM    338  OD2 ASP B  64      61.182  34.421 -21.169  1.00  0.89           O  
ATOM    339  N   GLN B  65      64.086  30.876 -17.644  1.00  0.89           N  
ATOM    340  CA  GLN B  65      64.458  29.520 -17.290  1.00  0.89           C  
ATOM    341  C   GLN B  65      65.348  29.484 -16.070  1.00  0.89           C  
ATOM    342  O   GLN B  65      65.923  30.475 -15.653  1.00  0.89           O  
ATOM    343  CB  GLN B  65      65.230  28.823 -18.435  1.00  0.89           C  
ATOM    344  CG  GLN B  65      64.394  28.610 -19.714  1.00  0.89           C  
ATOM    345  CD  GLN B  65      65.320  28.237 -20.863  1.00  0.89           C  
ATOM    346  OE1 GLN B  65      66.497  28.593 -20.856  1.00  0.89           O  
ATOM    347  NE2 GLN B  65      64.805  27.505 -21.877  1.00  0.89           N  
ATOM    348  N   GLU B  66      65.479  28.295 -15.467  1.00  0.89           N  
ATOM    349  CA  GLU B  66      66.459  28.021 -14.441  1.00  0.89           C  
ATOM    350  C   GLU B  66      67.315  26.876 -14.932  1.00  0.89           C  
ATOM    351  O   GLU B  66      66.823  25.952 -15.581  1.00  0.89           O  
ATOM    352  CB  GLU B  66      65.791  27.587 -13.122  1.00  0.89           C  
ATOM    353  CG  GLU B  66      64.974  28.693 -12.421  1.00  0.89           C  
ATOM    354  CD  GLU B  66      65.784  29.702 -11.612  1.00  0.89           C  
ATOM    355  OE1 GLU B  66      65.175  30.178 -10.611  1.00  0.89           O  
ATOM    356  OE2 GLU B  66      66.992  29.926 -11.859  1.00  0.89           O  
ATOM    357  N   SER B  67      68.630  26.913 -14.643  1.00  0.93           N  
ATOM    358  CA  SER B  67      69.561  25.876 -15.063  1.00  0.93           C  
ATOM    359  C   SER B  67      69.867  24.971 -13.901  1.00  0.93           C  
ATOM    360  O   SER B  67      70.209  25.427 -12.813  1.00  0.93           O  
ATOM    361  CB  SER B  67      70.961  26.383 -15.494  1.00  0.93           C  
ATOM    362  OG  SER B  67      70.948  27.258 -16.620  1.00  0.93           O  
ATOM    363  N   PHE B  68      69.794  23.650 -14.108  1.00  0.89           N  
ATOM    364  CA  PHE B  68      70.055  22.679 -13.071  1.00  0.89           C  
ATOM    365  C   PHE B  68      71.107  21.700 -13.547  1.00  0.89           C  
ATOM    366  O   PHE B  68      71.222  21.440 -14.743  1.00  0.89           O  
ATOM    367  CB  PHE B  68      68.803  21.840 -12.740  1.00  0.89           C  
ATOM    368  CG  PHE B  68      67.691  22.635 -12.119  1.00  0.89           C  
ATOM    369  CD1 PHE B  68      66.788  23.365 -12.909  1.00  0.89           C  
ATOM    370  CD2 PHE B  68      67.488  22.591 -10.733  1.00  0.89           C  
ATOM    371  CE1 PHE B  68      65.716  24.047 -12.320  1.00  0.89           C  
ATOM    372  CE2 PHE B  68      66.426  23.281 -10.139  1.00  0.89           C  
ATOM    373  CZ  PHE B  68      65.540  24.015 -10.934  1.00  0.89           C  
ATOM    374  N   GLY B  69      71.898  21.120 -12.614  1.00  0.93           N  
ATOM    375  CA  GLY B  69      72.717  19.927 -12.868  1.00  0.93           C  
ATOM    376  C   GLY B  69      71.874  18.772 -13.328  1.00  0.93           C  
ATOM    377  O   GLY B  69      70.850  18.459 -12.725  1.00  0.93           O  
ATOM    378  N   GLY B  70      72.262  18.106 -14.424  1.00  0.96           N  
ATOM    379  CA  GLY B  70      71.357  17.221 -15.132  1.00  0.96           C  
ATOM    380  C   GLY B  70      71.086  15.910 -14.450  1.00  0.96           C  
ATOM    381  O   GLY B  70      69.968  15.400 -14.476  1.00  0.96           O  
ATOM    382  N   ALA B  71      72.085  15.322 -13.768  1.00  0.93           N  
ATOM    383  CA  ALA B  71      71.925  14.084 -13.035  1.00  0.93           C  
ATOM    384  C   ALA B  71      70.906  14.184 -11.913  1.00  0.93           C  
ATOM    385  O   ALA B  71      70.180  13.231 -11.627  1.00  0.93           O  
ATOM    386  CB  ALA B  71      73.274  13.646 -12.450  1.00  0.93           C  
ATOM    387  N   SER B  72      70.818  15.370 -11.267  1.00  0.92           N  
ATOM    388  CA  SER B  72      69.905  15.613 -10.171  1.00  0.92           C  
ATOM    389  C   SER B  72      68.442  15.717 -10.587  1.00  0.92           C  
ATOM    390  O   SER B  72      67.543  15.487  -9.775  1.00  0.92           O  
ATOM    391  CB  SER B  72      70.307  16.801  -9.254  1.00  0.92           C  
ATOM    392  OG  SER B  72      70.125  18.078  -9.838  1.00  0.92           O  
ATOM    393  N   CYS B  73      68.193  15.971 -11.893  1.00  0.95           N  
ATOM    394  CA  CYS B  73      66.887  16.126 -12.517  1.00  0.95           C  
ATOM    395  C   CYS B  73      66.498  14.936 -13.375  1.00  0.95           C  
ATOM    396  O   CYS B  73      65.500  14.966 -14.092  1.00  0.95           O  
ATOM    397  CB  CYS B  73      66.875  17.357 -13.449  1.00  0.95           C  
ATOM    398  SG  CYS B  73      67.268  18.874 -12.547  1.00  0.95           S  
ATOM    399  N   CYS B  74      67.264  13.835 -13.329  1.00  0.94           N  
ATOM    400  CA  CYS B  74      66.905  12.619 -14.029  1.00  0.94           C  
ATOM    401  C   CYS B  74      66.247  11.657 -13.064  1.00  0.94           C  
ATOM    402  O   CYS B  74      66.834  11.277 -12.055  1.00  0.94           O  
ATOM    403  CB  CYS B  74      68.155  11.968 -14.680  1.00  0.94           C  
ATOM    404  SG  CYS B  74      67.833  10.401 -15.565  1.00  0.94           S  
ATOM    405  N   LEU B  75      65.016  11.194 -13.379  1.00  0.94           N  
ATOM    406  CA  LEU B  75      64.284  10.218 -12.582  1.00  0.94           C  
ATOM    407  C   LEU B  75      65.053   8.926 -12.376  1.00  0.94           C  
ATOM    408  O   LEU B  75      65.167   8.414 -11.270  1.00  0.94           O  
ATOM    409  CB  LEU B  75      62.952   9.864 -13.297  1.00  0.94           C  
ATOM    410  CG  LEU B  75      62.044   8.859 -12.553  1.00  0.94           C  
ATOM    411  CD1 LEU B  75      61.437   9.477 -11.288  1.00  0.94           C  
ATOM    412  CD2 LEU B  75      60.946   8.275 -13.451  1.00  0.94           C  
ATOM    413  N   TYR B  76      65.642   8.390 -13.457  1.00  0.87           N  
ATOM    414  CA  TYR B  76      66.374   7.138 -13.444  1.00  0.87           C  
ATOM    415  C   TYR B  76      67.633   7.197 -12.593  1.00  0.87           C  
ATOM    416  O   TYR B  76      67.902   6.310 -11.791  1.00  0.87           O  
ATOM    417  CB  TYR B  76      66.696   6.698 -14.892  1.00  0.87           C  
ATOM    418  CG  TYR B  76      65.439   6.704 -15.713  1.00  0.87           C  
ATOM    419  CD1 TYR B  76      64.498   5.678 -15.556  1.00  0.87           C  
ATOM    420  CD2 TYR B  76      65.156   7.758 -16.598  1.00  0.87           C  
ATOM    421  CE1 TYR B  76      63.275   5.724 -16.238  1.00  0.87           C  
ATOM    422  CE2 TYR B  76      63.932   7.809 -17.277  1.00  0.87           C  
ATOM    423  CZ  TYR B  76      62.991   6.795 -17.088  1.00  0.87           C  
ATOM    424  OH  TYR B  76      61.782   6.823 -17.798  1.00  0.87           O  
ATOM    425  N   CYS B  77      68.399   8.304 -12.700  1.00  0.90           N  
ATOM    426  CA  CYS B  77      69.541   8.559 -11.839  1.00  0.90           C  
ATOM    427  C   CYS B  77      69.143   8.752 -10.382  1.00  0.90           C  
ATOM    428  O   CYS B  77      69.741   8.170  -9.491  1.00  0.90           O  
ATOM    429  CB  CYS B  77      70.322   9.830 -12.272  1.00  0.90           C  
ATOM    430  SG  CYS B  77      71.187   9.732 -13.871  1.00  0.90           S  
ATOM    431  N   ARG B  78      68.105   9.564 -10.097  1.00  0.81           N  
ATOM    432  CA  ARG B  78      67.634   9.813  -8.743  1.00  0.81           C  
ATOM    433  C   ARG B  78      67.014   8.641  -8.021  1.00  0.81           C  
ATOM    434  O   ARG B  78      67.179   8.502  -6.812  1.00  0.81           O  
ATOM    435  CB  ARG B  78      66.634  10.984  -8.715  1.00  0.81           C  
ATOM    436  CG  ARG B  78      67.288  12.339  -9.030  1.00  0.81           C  
ATOM    437  CD  ARG B  78      68.391  12.783  -8.064  1.00  0.81           C  
ATOM    438  NE  ARG B  78      67.816  12.901  -6.693  1.00  0.81           N  
ATOM    439  CZ  ARG B  78      67.186  13.991  -6.238  1.00  0.81           C  
ATOM    440  NH1 ARG B  78      66.975  15.081  -6.969  1.00  0.81           N  
ATOM    441  NH2 ARG B  78      66.704  14.004  -4.998  1.00  0.81           N  
ATOM    442  N   CYS B  79      66.273   7.785  -8.737  1.00  0.89           N  
ATOM    443  CA  CYS B  79      65.617   6.644  -8.137  1.00  0.89           C  
ATOM    444  C   CYS B  79      66.472   5.392  -8.222  1.00  0.89           C  
ATOM    445  O   CYS B  79      66.072   4.343  -7.727  1.00  0.89           O  
ATOM    446  CB  CYS B  79      64.275   6.367  -8.857  1.00  0.89           C  
ATOM    447  SG  CYS B  79      63.044   7.686  -8.606  1.00  0.89           S  
ATOM    448  N   HIS B  80      67.679   5.482  -8.827  1.00  0.78           N  
ATOM    449  CA  HIS B  80      68.621   4.381  -8.960  1.00  0.78           C  
ATOM    450  C   HIS B  80      68.073   3.219  -9.775  1.00  0.78           C  
ATOM    451  O   HIS B  80      68.103   2.061  -9.370  1.00  0.78           O  
ATOM    452  CB  HIS B  80      69.195   3.961  -7.596  1.00  0.78           C  
ATOM    453  CG  HIS B  80      69.813   5.126  -6.895  1.00  0.78           C  
ATOM    454  ND1 HIS B  80      71.151   5.367  -7.105  1.00  0.78           N  
ATOM    455  CD2 HIS B  80      69.296   6.041  -6.034  1.00  0.78           C  
ATOM    456  CE1 HIS B  80      71.436   6.411  -6.357  1.00  0.78           C  
ATOM    457  NE2 HIS B  80      70.345   6.867  -5.690  1.00  0.78           N  
ATOM    458  N   ILE B  81      67.538   3.551 -10.966  1.00  0.82           N  
ATOM    459  CA  ILE B  81      66.835   2.653 -11.869  1.00  0.82           C  
ATOM    460  C   ILE B  81      67.580   2.711 -13.190  1.00  0.82           C  
ATOM    461  O   ILE B  81      68.146   3.746 -13.534  1.00  0.82           O  
ATOM    462  CB  ILE B  81      65.368   3.087 -12.066  1.00  0.82           C  
ATOM    463  CG1 ILE B  81      64.589   2.996 -10.733  1.00  0.82           C  
ATOM    464  CG2 ILE B  81      64.649   2.258 -13.156  1.00  0.82           C  
ATOM    465  CD1 ILE B  81      63.161   3.556 -10.795  1.00  0.82           C  
ATOM    466  N   ASP B  82      67.602   1.608 -13.972  1.00  0.84           N  
ATOM    467  CA  ASP B  82      68.149   1.581 -15.316  1.00  0.84           C  
ATOM    468  C   ASP B  82      67.521   2.616 -16.241  1.00  0.84           C  
ATOM    469  O   ASP B  82      66.318   2.882 -16.218  1.00  0.84           O  
ATOM    470  CB  ASP B  82      67.948   0.198 -15.985  1.00  0.84           C  
ATOM    471  CG  ASP B  82      68.653  -0.919 -15.236  1.00  0.84           C  
ATOM    472  OD1 ASP B  82      69.626  -0.631 -14.498  1.00  0.84           O  
ATOM    473  OD2 ASP B  82      68.203  -2.081 -15.399  1.00  0.84           O  
ATOM    474  N   HIS B  83      68.335   3.260 -17.094  1.00  0.83           N  
ATOM    475  CA  HIS B  83      67.822   4.186 -18.083  1.00  0.83           C  
ATOM    476  C   HIS B  83      67.078   3.457 -19.203  1.00  0.83           C  
ATOM    477  O   HIS B  83      67.517   2.376 -19.593  1.00  0.83           O  
ATOM    478  CB  HIS B  83      68.941   5.079 -18.655  1.00  0.83           C  
ATOM    479  CG  HIS B  83      69.498   6.010 -17.627  1.00  0.83           C  
ATOM    480  ND1 HIS B  83      70.385   5.531 -16.685  1.00  0.83           N  
ATOM    481  CD2 HIS B  83      69.185   7.302 -17.356  1.00  0.83           C  
ATOM    482  CE1 HIS B  83      70.593   6.526 -15.860  1.00  0.83           C  
ATOM    483  NE2 HIS B  83      69.891   7.627 -16.217  1.00  0.83           N  
ATOM    484  N   PRO B  84      65.982   3.959 -19.779  1.00  0.86           N  
ATOM    485  CA  PRO B  84      65.099   3.148 -20.615  1.00  0.86           C  
ATOM    486  C   PRO B  84      65.603   3.115 -22.045  1.00  0.86           C  
ATOM    487  O   PRO B  84      64.925   3.579 -22.960  1.00  0.86           O  
ATOM    488  CB  PRO B  84      63.738   3.873 -20.520  1.00  0.86           C  
ATOM    489  CG  PRO B  84      64.117   5.324 -20.246  1.00  0.86           C  
ATOM    490  CD  PRO B  84      65.305   5.158 -19.309  1.00  0.86           C  
ATOM    491  N   ASN B  85      66.794   2.545 -22.275  1.00  0.75           N  
ATOM    492  CA  ASN B  85      67.340   2.368 -23.593  1.00  0.75           C  
ATOM    493  C   ASN B  85      68.363   1.230 -23.528  1.00  0.75           C  
ATOM    494  O   ASN B  85      68.835   0.939 -22.431  1.00  0.75           O  
ATOM    495  CB  ASN B  85      67.883   3.713 -24.198  1.00  0.75           C  
ATOM    496  CG  ASN B  85      69.033   4.360 -23.417  1.00  0.75           C  
ATOM    497  OD1 ASN B  85      70.140   3.827 -23.391  1.00  0.75           O  
ATOM    498  ND2 ASN B  85      68.812   5.575 -22.856  1.00  0.75           N  
ATOM    499  N   PRO B  86      68.736   0.544 -24.616  1.00  0.85           N  
ATOM    500  CA  PRO B  86      69.635  -0.614 -24.586  1.00  0.85           C  
ATOM    501  C   PRO B  86      71.000  -0.383 -23.977  1.00  0.85           C  
ATOM    502  O   PRO B  86      71.531  -1.277 -23.330  1.00  0.85           O  
ATOM    503  CB  PRO B  86      69.793  -0.987 -26.067  1.00  0.85           C  
ATOM    504  CG  PRO B  86      68.459  -0.592 -26.697  1.00  0.85           C  
ATOM    505  CD  PRO B  86      68.026   0.634 -25.892  1.00  0.85           C  
ATOM    506  N   LYS B  87      71.606   0.792 -24.224  1.00  0.86           N  
ATOM    507  CA  LYS B  87      72.932   1.128 -23.743  1.00  0.86           C  
ATOM    508  C   LYS B  87      72.945   1.570 -22.286  1.00  0.86           C  
ATOM    509  O   LYS B  87      73.997   1.625 -21.658  1.00  0.86           O  
ATOM    510  CB  LYS B  87      73.517   2.290 -24.589  1.00  0.86           C  
ATOM    511  CG  LYS B  87      73.713   1.955 -26.078  1.00  0.86           C  
ATOM    512  CD  LYS B  87      74.286   3.145 -26.871  1.00  0.86           C  
ATOM    513  CE  LYS B  87      74.508   2.838 -28.357  1.00  0.86           C  
ATOM    514  NZ  LYS B  87      75.043   4.026 -29.064  1.00  0.86           N  
ATOM    515  N   GLY B  88      71.769   1.930 -21.730  1.00  0.88           N  
ATOM    516  CA  GLY B  88      71.622   2.534 -20.409  1.00  0.88           C  
ATOM    517  C   GLY B  88      72.220   3.913 -20.303  1.00  0.88           C  
ATOM    518  O   GLY B  88      72.630   4.361 -19.240  1.00  0.88           O  
ATOM    519  N   PHE B  89      72.288   4.633 -21.436  1.00  0.75           N  
ATOM    520  CA  PHE B  89      72.857   5.964 -21.512  1.00  0.75           C  
ATOM    521  C   PHE B  89      71.885   7.001 -20.939  1.00  0.75           C  
ATOM    522  O   PHE B  89      70.669   6.883 -21.087  1.00  0.75           O  
ATOM    523  CB  PHE B  89      73.284   6.258 -22.984  1.00  0.75           C  
ATOM    524  CG  PHE B  89      73.704   7.684 -23.251  1.00  0.75           C  
ATOM    525  CD1 PHE B  89      74.969   8.166 -22.875  1.00  0.75           C  
ATOM    526  CD2 PHE B  89      72.799   8.570 -23.860  1.00  0.75           C  
ATOM    527  CE1 PHE B  89      75.320   9.503 -23.107  1.00  0.75           C  
ATOM    528  CE2 PHE B  89      73.148   9.905 -24.092  1.00  0.75           C  
ATOM    529  CZ  PHE B  89      74.411  10.372 -23.719  1.00  0.75           C  
ATOM    530  N   CYS B  90      72.417   8.056 -20.285  1.00  0.86           N  
ATOM    531  CA  CYS B  90      71.632   9.160 -19.759  1.00  0.86           C  
ATOM    532  C   CYS B  90      71.993  10.410 -20.532  1.00  0.86           C  
ATOM    533  O   CYS B  90      73.169  10.728 -20.696  1.00  0.86           O  
ATOM    534  CB  CYS B  90      71.954   9.418 -18.258  1.00  0.86           C  
ATOM    535  SG  CYS B  90      70.854  10.628 -17.435  1.00  0.86           S  
ATOM    536  N   ASP B  91      70.992  11.167 -21.002  1.00  0.86           N  
ATOM    537  CA  ASP B  91      71.165  12.383 -21.759  1.00  0.86           C  
ATOM    538  C   ASP B  91      71.323  13.614 -20.867  1.00  0.86           C  
ATOM    539  O   ASP B  91      71.775  14.669 -21.312  1.00  0.86           O  
ATOM    540  CB  ASP B  91      69.980  12.518 -22.761  1.00  0.86           C  
ATOM    541  CG  ASP B  91      68.598  12.275 -22.154  1.00  0.86           C  
ATOM    542  OD1 ASP B  91      68.486  12.159 -20.903  1.00  0.86           O  
ATOM    543  OD2 ASP B  91      67.647  12.146 -22.962  1.00  0.86           O  
ATOM    544  N   LEU B  92      71.016  13.484 -19.560  1.00  0.90           N  
ATOM    545  CA  LEU B  92      71.089  14.573 -18.608  1.00  0.90           C  
ATOM    546  C   LEU B  92      72.361  14.587 -17.776  1.00  0.90           C  
ATOM    547  O   LEU B  92      72.932  15.639 -17.517  1.00  0.90           O  
ATOM    548  CB  LEU B  92      69.872  14.497 -17.658  1.00  0.90           C  
ATOM    549  CG  LEU B  92      68.524  14.830 -18.321  1.00  0.90           C  
ATOM    550  CD1 LEU B  92      67.354  14.418 -17.416  1.00  0.90           C  
ATOM    551  CD2 LEU B  92      68.436  16.329 -18.634  1.00  0.90           C  
ATOM    552  N   LYS B  93      72.853  13.418 -17.325  1.00  0.86           N  
ATOM    553  CA  LYS B  93      74.020  13.314 -16.458  1.00  0.86           C  
ATOM    554  C   LYS B  93      75.279  13.933 -17.048  1.00  0.86           C  
ATOM    555  O   LYS B  93      75.690  13.612 -18.163  1.00  0.86           O  
ATOM    556  CB  LYS B  93      74.289  11.819 -16.146  1.00  0.86           C  
ATOM    557  CG  LYS B  93      75.508  11.522 -15.253  1.00  0.86           C  
ATOM    558  CD  LYS B  93      75.807  10.014 -15.162  1.00  0.86           C  
ATOM    559  CE  LYS B  93      77.130   9.654 -14.463  1.00  0.86           C  
ATOM    560  NZ  LYS B  93      77.088  10.000 -13.029  1.00  0.86           N  
ATOM    561  N   GLY B  94      75.941  14.841 -16.297  1.00  0.91           N  
ATOM    562  CA  GLY B  94      77.143  15.503 -16.789  1.00  0.91           C  
ATOM    563  C   GLY B  94      76.863  16.685 -17.668  1.00  0.91           C  
ATOM    564  O   GLY B  94      77.767  17.249 -18.276  1.00  0.91           O  
ATOM    565  N   LYS B  95      75.590  17.077 -17.765  1.00  0.86           N  
ATOM    566  CA  LYS B  95      75.140  18.206 -18.536  1.00  0.86           C  
ATOM    567  C   LYS B  95      74.220  19.026 -17.680  1.00  0.86           C  
ATOM    568  O   LYS B  95      73.976  18.712 -16.520  1.00  0.86           O  
ATOM    569  CB  LYS B  95      74.422  17.760 -19.830  1.00  0.86           C  
ATOM    570  CG  LYS B  95      75.412  17.139 -20.821  1.00  0.86           C  
ATOM    571  CD  LYS B  95      74.777  16.826 -22.182  1.00  0.86           C  
ATOM    572  CE  LYS B  95      75.787  16.529 -23.289  1.00  0.86           C  
ATOM    573  NZ  LYS B  95      76.688  15.448 -22.846  1.00  0.86           N  
ATOM    574  N   TYR B  96      73.729  20.147 -18.223  1.00  0.90           N  
ATOM    575  CA  TYR B  96      72.876  21.063 -17.508  1.00  0.90           C  
ATOM    576  C   TYR B  96      71.576  21.155 -18.245  1.00  0.90           C  
ATOM    577  O   TYR B  96      71.548  21.246 -19.471  1.00  0.90           O  
ATOM    578  CB  TYR B  96      73.502  22.468 -17.405  1.00  0.90           C  
ATOM    579  CG  TYR B  96      74.743  22.347 -16.582  1.00  0.90           C  
ATOM    580  CD1 TYR B  96      75.963  22.015 -17.186  1.00  0.90           C  
ATOM    581  CD2 TYR B  96      74.670  22.417 -15.185  1.00  0.90           C  
ATOM    582  CE1 TYR B  96      77.084  21.713 -16.412  1.00  0.90           C  
ATOM    583  CE2 TYR B  96      75.790  22.126 -14.401  1.00  0.90           C  
ATOM    584  CZ  TYR B  96      76.982  21.749 -15.019  1.00  0.90           C  
ATOM    585  OH  TYR B  96      78.059  21.326 -14.244  1.00  0.90           O  
ATOM    586  N   VAL B  97      70.458  21.104 -17.504  1.00  0.97           N  
ATOM    587  CA  VAL B  97      69.134  21.147 -18.081  1.00  0.97           C  
ATOM    588  C   VAL B  97      68.482  22.456 -17.732  1.00  0.97           C  
ATOM    589  O   VAL B  97      68.502  22.916 -16.588  1.00  0.97           O  
ATOM    590  CB  VAL B  97      68.256  19.961 -17.686  1.00  0.97           C  
ATOM    591  CG1 VAL B  97      68.021  19.860 -16.165  1.00  0.97           C  
ATOM    592  CG2 VAL B  97      66.928  19.993 -18.463  1.00  0.97           C  
ATOM    593  N   GLN B  98      67.903  23.110 -18.750  1.00  0.94           N  
ATOM    594  CA  GLN B  98      67.209  24.363 -18.611  1.00  0.94           C  
ATOM    595  C   GLN B  98      65.734  24.073 -18.484  1.00  0.94           C  
ATOM    596  O   GLN B  98      65.128  23.427 -19.337  1.00  0.94           O  
ATOM    597  CB  GLN B  98      67.467  25.282 -19.822  1.00  0.94           C  
ATOM    598  CG  GLN B  98      68.830  26.015 -19.785  1.00  0.94           C  
ATOM    599  CD  GLN B  98      70.083  25.136 -19.757  1.00  0.94           C  
ATOM    600  OE1 GLN B  98      70.979  25.347 -18.935  1.00  0.94           O  
ATOM    601  NE2 GLN B  98      70.191  24.183 -20.701  1.00  0.94           N  
ATOM    602  N   ILE B  99      65.114  24.536 -17.392  1.00  0.96           N  
ATOM    603  CA  ILE B  99      63.728  24.245 -17.077  1.00  0.96           C  
ATOM    604  C   ILE B  99      63.017  25.588 -17.089  1.00  0.96           C  
ATOM    605  O   ILE B  99      63.545  26.506 -16.462  1.00  0.96           O  
ATOM    606  CB  ILE B  99      63.604  23.596 -15.701  1.00  0.96           C  
ATOM    607  CG1 ILE B  99      64.491  22.333 -15.582  1.00  0.96           C  
ATOM    608  CG2 ILE B  99      62.135  23.273 -15.361  1.00  0.96           C  
ATOM    609  CD1 ILE B  99      64.076  21.173 -16.492  1.00  0.96           C  
ATOM    610  N   PRO B 100      61.892  25.834 -17.768  1.00  0.97           N  
ATOM    611  CA  PRO B 100      61.073  27.036 -17.569  1.00  0.97           C  
ATOM    612  C   PRO B 100      60.815  27.383 -16.109  1.00  0.97           C  
ATOM    613  O   PRO B 100      60.549  26.474 -15.324  1.00  0.97           O  
ATOM    614  CB  PRO B 100      59.760  26.752 -18.324  1.00  0.97           C  
ATOM    615  CG  PRO B 100      60.072  25.580 -19.258  1.00  0.97           C  
ATOM    616  CD  PRO B 100      61.168  24.816 -18.523  1.00  0.97           C  
ATOM    617  N   THR B 101      60.852  28.669 -15.708  1.00  0.89           N  
ATOM    618  CA  THR B 101      60.706  29.091 -14.305  1.00  0.89           C  
ATOM    619  C   THR B 101      59.408  28.656 -13.655  1.00  0.89           C  
ATOM    620  O   THR B 101      59.364  28.329 -12.473  1.00  0.89           O  
ATOM    621  CB  THR B 101      60.835  30.591 -14.080  1.00  0.89           C  
ATOM    622  OG1 THR B 101      59.947  31.324 -14.913  1.00  0.89           O  
ATOM    623  CG2 THR B 101      62.252  31.027 -14.438  1.00  0.89           C  
ATOM    624  N   THR B 102      58.332  28.607 -14.461  1.00  0.88           N  
ATOM    625  CA  THR B 102      57.002  28.118 -14.126  1.00  0.88           C  
ATOM    626  C   THR B 102      56.948  26.645 -13.750  1.00  0.88           C  
ATOM    627  O   THR B 102      56.024  26.220 -13.066  1.00  0.88           O  
ATOM    628  CB  THR B 102      55.992  28.338 -15.255  1.00  0.88           C  
ATOM    629  OG1 THR B 102      56.430  27.795 -16.492  1.00  0.88           O  
ATOM    630  CG2 THR B 102      55.790  29.838 -15.506  1.00  0.88           C  
ATOM    631  N   CYS B 103      57.941  25.844 -14.190  1.00  0.92           N  
ATOM    632  CA  CYS B 103      58.007  24.412 -13.959  1.00  0.92           C  
ATOM    633  C   CYS B 103      59.246  24.023 -13.157  1.00  0.92           C  
ATOM    634  O   CYS B 103      59.555  22.846 -12.983  1.00  0.92           O  
ATOM    635  CB  CYS B 103      58.054  23.659 -15.314  1.00  0.92           C  
ATOM    636  SG  CYS B 103      56.634  24.021 -16.405  1.00  0.92           S  
ATOM    637  N   ALA B 104      59.994  25.006 -12.606  1.00  0.95           N  
ATOM    638  CA  ALA B 104      61.225  24.787 -11.862  1.00  0.95           C  
ATOM    639  C   ALA B 104      61.036  24.124 -10.494  1.00  0.95           C  
ATOM    640  O   ALA B 104      62.001  23.730  -9.843  1.00  0.95           O  
ATOM    641  CB  ALA B 104      61.985  26.122 -11.706  1.00  0.95           C  
ATOM    642  N   ASN B 105      59.776  23.980 -10.031  1.00  0.90           N  
ATOM    643  CA  ASN B 105      59.404  23.255  -8.828  1.00  0.90           C  
ATOM    644  C   ASN B 105      59.439  21.731  -8.982  1.00  0.90           C  
ATOM    645  O   ASN B 105      59.537  21.017  -7.990  1.00  0.90           O  
ATOM    646  CB  ASN B 105      58.002  23.714  -8.324  1.00  0.90           C  
ATOM    647  CG  ASN B 105      56.903  23.388  -9.334  1.00  0.90           C  
ATOM    648  OD1 ASN B 105      56.962  23.808 -10.486  1.00  0.90           O  
ATOM    649  ND2 ASN B 105      55.886  22.607  -8.901  1.00  0.90           N  
ATOM    650  N   ASP B 106      59.389  21.216 -10.229  1.00  0.96           N  
ATOM    651  CA  ASP B 106      59.480  19.795 -10.515  1.00  0.96           C  
ATOM    652  C   ASP B 106      60.340  19.611 -11.771  1.00  0.96           C  
ATOM    653  O   ASP B 106      59.812  19.356 -12.859  1.00  0.96           O  
ATOM    654  CB  ASP B 106      58.049  19.203 -10.690  1.00  0.96           C  
ATOM    655  CG  ASP B 106      57.988  17.702 -10.947  1.00  0.96           C  
ATOM    656  OD1 ASP B 106      59.005  16.981 -10.747  1.00  0.96           O  
ATOM    657  OD2 ASP B 106      56.896  17.240 -11.371  1.00  0.96           O  
ATOM    658  N   PRO B 107      61.675  19.727 -11.712  1.00  0.99           N  
ATOM    659  CA  PRO B 107      62.518  19.512 -12.880  1.00  0.99           C  
ATOM    660  C   PRO B 107      62.475  18.087 -13.385  1.00  0.99           C  
ATOM    661  O   PRO B 107      62.551  17.894 -14.596  1.00  0.99           O  
ATOM    662  CB  PRO B 107      63.930  19.888 -12.412  1.00  0.99           C  
ATOM    663  CG  PRO B 107      63.704  20.831 -11.234  1.00  0.99           C  
ATOM    664  CD  PRO B 107      62.440  20.272 -10.586  1.00  0.99           C  
ATOM    665  N   VAL B 108      62.365  17.083 -12.485  1.00  0.98           N  
ATOM    666  CA  VAL B 108      62.264  15.670 -12.835  1.00  0.98           C  
ATOM    667  C   VAL B 108      61.000  15.391 -13.626  1.00  0.98           C  
ATOM    668  O   VAL B 108      61.000  14.692 -14.636  1.00  0.98           O  
ATOM    669  CB  VAL B 108      62.300  14.751 -11.611  1.00  0.98           C  
ATOM    670  CG1 VAL B 108      62.167  13.284 -12.063  1.00  0.98           C  
ATOM    671  CG2 VAL B 108      63.625  14.917 -10.844  1.00  0.98           C  
ATOM    672  N   GLY B 109      59.860  15.968 -13.200  1.00  1.00           N  
ATOM    673  CA  GLY B 109      58.615  15.832 -13.932  1.00  1.00           C  
ATOM    674  C   GLY B 109      58.588  16.554 -15.238  1.00  1.00           C  
ATOM    675  O   GLY B 109      57.976  16.082 -16.192  1.00  1.00           O  
ATOM    676  N   PHE B 110      59.261  17.715 -15.338  1.00  0.94           N  
ATOM    677  CA  PHE B 110      59.395  18.432 -16.589  1.00  0.94           C  
ATOM    678  C   PHE B 110      60.180  17.652 -17.642  1.00  0.94           C  
ATOM    679  O   PHE B 110      59.727  17.532 -18.777  1.00  0.94           O  
ATOM    680  CB  PHE B 110      60.045  19.822 -16.354  1.00  0.94           C  
ATOM    681  CG  PHE B 110      60.007  20.663 -17.607  1.00  0.94           C  
ATOM    682  CD1 PHE B 110      58.881  21.440 -17.914  1.00  0.94           C  
ATOM    683  CD2 PHE B 110      61.057  20.601 -18.537  1.00  0.94           C  
ATOM    684  CE1 PHE B 110      58.803  22.140 -19.125  1.00  0.94           C  
ATOM    685  CE2 PHE B 110      60.970  21.282 -19.755  1.00  0.94           C  
ATOM    686  CZ  PHE B 110      59.846  22.054 -20.051  1.00  0.94           C  
ATOM    687  N   THR B 111      61.348  17.075 -17.288  1.00  0.96           N  
ATOM    688  CA  THR B 111      62.192  16.331 -18.228  1.00  0.96           C  
ATOM    689  C   THR B 111      61.519  15.087 -18.775  1.00  0.96           C  
ATOM    690  O   THR B 111      61.632  14.766 -19.950  1.00  0.96           O  
ATOM    691  CB  THR B 111      63.575  15.964 -17.686  1.00  0.96           C  
ATOM    692  OG1 THR B 111      63.497  15.176 -16.506  1.00  0.96           O  
ATOM    693  CG2 THR B 111      64.343  17.242 -17.326  1.00  0.96           C  
ATOM    694  N   LEU B 112      60.764  14.368 -17.926  1.00  0.95           N  
ATOM    695  CA  LEU B 112      59.959  13.220 -18.301  1.00  0.95           C  
ATOM    696  C   LEU B 112      58.753  13.479 -19.185  1.00  0.95           C  
ATOM    697  O   LEU B 112      58.315  12.604 -19.928  1.00  0.95           O  
ATOM    698  CB  LEU B 112      59.359  12.564 -17.050  1.00  0.95           C  
ATOM    699  CG  LEU B 112      60.369  11.803 -16.193  1.00  0.95           C  
ATOM    700  CD1 LEU B 112      59.705  11.512 -14.846  1.00  0.95           C  
ATOM    701  CD2 LEU B 112      60.850  10.518 -16.882  1.00  0.95           C  
ATOM    702  N   LYS B 113      58.093  14.639 -19.031  1.00  0.91           N  
ATOM    703  CA  LYS B 113      56.880  14.934 -19.763  1.00  0.91           C  
ATOM    704  C   LYS B 113      57.133  15.700 -21.051  1.00  0.91           C  
ATOM    705  O   LYS B 113      56.195  15.946 -21.802  1.00  0.91           O  
ATOM    706  CB  LYS B 113      55.934  15.802 -18.898  1.00  0.91           C  
ATOM    707  CG  LYS B 113      55.379  15.100 -17.649  1.00  0.91           C  
ATOM    708  CD  LYS B 113      54.646  16.085 -16.717  1.00  0.91           C  
ATOM    709  CE  LYS B 113      54.133  15.430 -15.430  1.00  0.91           C  
ATOM    710  NZ  LYS B 113      53.511  16.425 -14.524  1.00  0.91           N  
ATOM    711  N   ASN B 114      58.391  16.073 -21.343  1.00  0.93           N  
ATOM    712  CA  ASN B 114      58.707  16.948 -22.453  1.00  0.93           C  
ATOM    713  C   ASN B 114      59.827  16.379 -23.287  1.00  0.93           C  
ATOM    714  O   ASN B 114      60.576  15.501 -22.875  1.00  0.93           O  
ATOM    715  CB  ASN B 114      59.119  18.354 -21.965  1.00  0.93           C  
ATOM    716  CG  ASN B 114      57.885  19.054 -21.421  1.00  0.93           C  
ATOM    717  OD1 ASN B 114      57.048  19.531 -22.184  1.00  0.93           O  
ATOM    718  ND2 ASN B 114      57.760  19.144 -20.081  1.00  0.93           N  
ATOM    719  N   THR B 115      59.949  16.898 -24.520  1.00  0.92           N  
ATOM    720  CA  THR B 115      60.810  16.329 -25.545  1.00  0.92           C  
ATOM    721  C   THR B 115      61.657  17.442 -26.110  1.00  0.92           C  
ATOM    722  O   THR B 115      61.165  18.534 -26.402  1.00  0.92           O  
ATOM    723  CB  THR B 115      60.006  15.682 -26.668  1.00  0.92           C  
ATOM    724  OG1 THR B 115      59.262  14.587 -26.162  1.00  0.92           O  
ATOM    725  CG2 THR B 115      60.883  15.102 -27.782  1.00  0.92           C  
ATOM    726  N   VAL B 116      62.978  17.220 -26.257  1.00  0.95           N  
ATOM    727  CA  VAL B 116      63.882  18.168 -26.893  1.00  0.95           C  
ATOM    728  C   VAL B 116      63.716  18.088 -28.404  1.00  0.95           C  
ATOM    729  O   VAL B 116      63.658  17.006 -28.982  1.00  0.95           O  
ATOM    730  CB  VAL B 116      65.338  17.909 -26.516  1.00  0.95           C  
ATOM    731  CG1 VAL B 116      66.285  18.946 -27.155  1.00  0.95           C  
ATOM    732  CG2 VAL B 116      65.470  17.963 -24.985  1.00  0.95           C  
ATOM    733  N   CYS B 117      63.599  19.229 -29.114  1.00  0.97           N  
ATOM    734  CA  CYS B 117      63.615  19.219 -30.565  1.00  0.97           C  
ATOM    735  C   CYS B 117      64.982  18.831 -31.101  1.00  0.97           C  
ATOM    736  O   CYS B 117      65.991  19.445 -30.768  1.00  0.97           O  
ATOM    737  CB  CYS B 117      63.217  20.600 -31.141  1.00  0.97           C  
ATOM    738  SG  CYS B 117      62.975  20.651 -32.954  1.00  0.97           S  
ATOM    739  N   THR B 118      65.027  17.825 -31.989  1.00  0.94           N  
ATOM    740  CA  THR B 118      66.244  17.282 -32.574  1.00  0.94           C  
ATOM    741  C   THR B 118      66.887  18.212 -33.589  1.00  0.94           C  
ATOM    742  O   THR B 118      68.037  18.027 -33.970  1.00  0.94           O  
ATOM    743  CB  THR B 118      65.979  15.937 -33.244  1.00  0.94           C  
ATOM    744  OG1 THR B 118      64.900  16.016 -34.167  1.00  0.94           O  
ATOM    745  CG2 THR B 118      65.556  14.903 -32.190  1.00  0.94           C  
ATOM    746  N   VAL B 119      66.144  19.246 -34.039  1.00  0.96           N  
ATOM    747  CA  VAL B 119      66.608  20.248 -34.988  1.00  0.96           C  
ATOM    748  C   VAL B 119      67.226  21.460 -34.303  1.00  0.96           C  
ATOM    749  O   VAL B 119      68.369  21.819 -34.568  1.00  0.96           O  
ATOM    750  CB  VAL B 119      65.462  20.693 -35.897  1.00  0.96           C  
ATOM    751  CG1 VAL B 119      65.936  21.748 -36.918  1.00  0.96           C  
ATOM    752  CG2 VAL B 119      64.905  19.461 -36.637  1.00  0.96           C  
ATOM    753  N   CYS B 120      66.489  22.137 -33.389  1.00  0.98           N  
ATOM    754  CA  CYS B 120      66.958  23.384 -32.795  1.00  0.98           C  
ATOM    755  C   CYS B 120      67.506  23.241 -31.382  1.00  0.98           C  
ATOM    756  O   CYS B 120      68.087  24.175 -30.836  1.00  0.98           O  
ATOM    757  CB  CYS B 120      65.825  24.449 -32.779  1.00  0.98           C  
ATOM    758  SG  CYS B 120      64.323  23.939 -31.890  1.00  0.98           S  
ATOM    759  N   GLY B 121      67.334  22.070 -30.732  1.00  0.99           N  
ATOM    760  CA  GLY B 121      67.817  21.823 -29.374  1.00  0.99           C  
ATOM    761  C   GLY B 121      66.998  22.447 -28.271  1.00  0.99           C  
ATOM    762  O   GLY B 121      67.344  22.366 -27.097  1.00  0.99           O  
ATOM    763  N   MET B 122      65.872  23.088 -28.617  1.00  0.93           N  
ATOM    764  CA  MET B 122      64.975  23.707 -27.667  1.00  0.93           C  
ATOM    765  C   MET B 122      63.887  22.722 -27.283  1.00  0.93           C  
ATOM    766  O   MET B 122      63.568  21.802 -28.035  1.00  0.93           O  
ATOM    767  CB  MET B 122      64.284  24.949 -28.275  1.00  0.93           C  
ATOM    768  CG  MET B 122      65.211  26.000 -28.919  1.00  0.93           C  
ATOM    769  SD  MET B 122      66.363  26.829 -27.794  1.00  0.93           S  
ATOM    770  CE  MET B 122      65.135  27.776 -26.857  1.00  0.93           C  
ATOM    771  N   TRP B 123      63.263  22.877 -26.100  1.00  0.93           N  
ATOM    772  CA  TRP B 123      62.110  22.075 -25.732  1.00  0.93           C  
ATOM    773  C   TRP B 123      60.916  22.292 -26.655  1.00  0.93           C  
ATOM    774  O   TRP B 123      60.610  23.412 -27.079  1.00  0.93           O  
ATOM    775  CB  TRP B 123      61.678  22.359 -24.278  1.00  0.93           C  
ATOM    776  CG  TRP B 123      62.673  21.959 -23.209  1.00  0.93           C  
ATOM    777  CD1 TRP B 123      63.410  22.765 -22.389  1.00  0.93           C  
ATOM    778  CD2 TRP B 123      62.937  20.609 -22.783  1.00  0.93           C  
ATOM    779  NE1 TRP B 123      64.123  22.010 -21.487  1.00  0.93           N  
ATOM    780  CE2 TRP B 123      63.857  20.682 -21.720  1.00  0.93           C  
ATOM    781  CE3 TRP B 123      62.436  19.388 -23.213  1.00  0.93           C  
ATOM    782  CZ2 TRP B 123      64.306  19.534 -21.082  1.00  0.93           C  
ATOM    783  CZ3 TRP B 123      62.894  18.229 -22.571  1.00  0.93           C  
ATOM    784  CH2 TRP B 123      63.820  18.299 -21.528  1.00  0.93           C  
ATOM    785  N   LYS B 124      60.195  21.209 -27.008  1.00  0.91           N  
ATOM    786  CA  LYS B 124      58.943  21.313 -27.734  1.00  0.91           C  
ATOM    787  C   LYS B 124      57.875  21.990 -26.884  1.00  0.91           C  
ATOM    788  O   LYS B 124      57.617  21.592 -25.757  1.00  0.91           O  
ATOM    789  CB  LYS B 124      58.437  19.932 -28.216  1.00  0.91           C  
ATOM    790  CG  LYS B 124      59.368  19.198 -29.202  1.00  0.91           C  
ATOM    791  CD  LYS B 124      59.541  19.863 -30.584  1.00  0.91           C  
ATOM    792  CE  LYS B 124      58.268  19.903 -31.454  1.00  0.91           C  
ATOM    793  NZ  LYS B 124      58.516  20.544 -32.759  1.00  0.91           N  
ATOM    794  N   GLY B 125      57.263  23.076 -27.405  1.00  0.97           N  
ATOM    795  CA  GLY B 125      56.274  23.863 -26.669  1.00  0.97           C  
ATOM    796  C   GLY B 125      56.841  24.863 -25.688  1.00  0.97           C  
ATOM    797  O   GLY B 125      56.096  25.621 -25.082  1.00  0.97           O  
ATOM    798  N   TYR B 126      58.182  24.931 -25.547  1.00  0.92           N  
ATOM    799  CA  TYR B 126      58.833  25.802 -24.582  1.00  0.92           C  
ATOM    800  C   TYR B 126      60.130  26.332 -25.168  1.00  0.92           C  
ATOM    801  O   TYR B 126      61.179  26.332 -24.526  1.00  0.92           O  
ATOM    802  CB  TYR B 126      59.172  25.090 -23.248  1.00  0.92           C  
ATOM    803  CG  TYR B 126      57.957  24.632 -22.507  1.00  0.92           C  
ATOM    804  CD1 TYR B 126      57.295  25.498 -21.625  1.00  0.92           C  
ATOM    805  CD2 TYR B 126      57.501  23.310 -22.633  1.00  0.92           C  
ATOM    806  CE1 TYR B 126      56.212  25.043 -20.861  1.00  0.92           C  
ATOM    807  CE2 TYR B 126      56.408  22.860 -21.885  1.00  0.92           C  
ATOM    808  CZ  TYR B 126      55.775  23.722 -20.986  1.00  0.92           C  
ATOM    809  OH  TYR B 126      54.715  23.247 -20.196  1.00  0.92           O  
ATOM    810  N   GLY B 127      60.094  26.796 -26.433  1.00  0.97           N  
ATOM    811  CA  GLY B 127      61.269  27.389 -27.057  1.00  0.97           C  
ATOM    812  C   GLY B 127      61.409  27.029 -28.502  1.00  0.97           C  
ATOM    813  O   GLY B 127      61.846  27.839 -29.308  1.00  0.97           O  
ATOM    814  N   CYS B 128      61.055  25.789 -28.894  1.00  0.96           N  
ATOM    815  CA  CYS B 128      61.078  25.401 -30.298  1.00  0.96           C  
ATOM    816  C   CYS B 128      60.080  26.170 -31.158  1.00  0.96           C  
ATOM    817  O   CYS B 128      58.874  26.134 -30.927  1.00  0.96           O  
ATOM    818  CB  CYS B 128      60.848  23.868 -30.460  1.00  0.96           C  
ATOM    819  SG  CYS B 128      60.809  23.243 -32.179  1.00  0.96           S  
ATOM    820  N   SER B 129      60.584  26.852 -32.205  1.00  0.93           N  
ATOM    821  CA  SER B 129      59.787  27.640 -33.126  1.00  0.93           C  
ATOM    822  C   SER B 129      59.790  27.057 -34.529  1.00  0.93           C  
ATOM    823  O   SER B 129      59.349  27.690 -35.479  1.00  0.93           O  
ATOM    824  CB  SER B 129      60.263  29.117 -33.151  1.00  0.93           C  
ATOM    825  OG  SER B 129      61.668  29.221 -33.386  1.00  0.93           O  
ATOM    826  N   CYS B 130      60.213  25.781 -34.685  1.00  0.94           N  
ATOM    827  CA  CYS B 130      60.296  25.087 -35.968  1.00  0.94           C  
ATOM    828  C   CYS B 130      58.954  24.872 -36.665  1.00  0.94           C  
ATOM    829  O   CYS B 130      58.897  24.786 -37.886  1.00  0.94           O  
ATOM    830  CB  CYS B 130      61.004  23.710 -35.823  1.00  0.94           C  
ATOM    831  SG  CYS B 130      62.733  23.837 -35.251  1.00  0.94           S  
ATOM    832  N   ASP B 131      57.856  24.795 -35.885  1.00  0.81           N  
ATOM    833  CA  ASP B 131      56.519  24.544 -36.379  1.00  0.81           C  
ATOM    834  C   ASP B 131      55.699  25.824 -36.501  1.00  0.81           C  
ATOM    835  O   ASP B 131      54.520  25.806 -36.850  1.00  0.81           O  
ATOM    836  CB  ASP B 131      55.806  23.579 -35.417  1.00  0.81           C  
ATOM    837  CG  ASP B 131      56.573  22.270 -35.304  1.00  0.81           C  
ATOM    838  OD1 ASP B 131      56.823  21.553 -36.301  1.00  0.81           O  
ATOM    839  OD2 ASP B 131      56.921  21.978 -34.123  1.00  0.81           O  
ATOM    840  N   GLN B 132      56.293  27.007 -36.218  1.00  0.77           N  
ATOM    841  CA  GLN B 132      55.597  28.271 -36.391  1.00  0.77           C  
ATOM    842  C   GLN B 132      55.436  28.621 -37.865  1.00  0.77           C  
ATOM    843  O   GLN B 132      56.225  28.211 -38.714  1.00  0.77           O  
ATOM    844  CB  GLN B 132      56.249  29.428 -35.590  1.00  0.77           C  
ATOM    845  CG  GLN B 132      56.284  29.135 -34.068  1.00  0.77           C  
ATOM    846  CD  GLN B 132      56.877  30.285 -33.250  1.00  0.77           C  
ATOM    847  OE1 GLN B 132      57.212  31.353 -33.744  1.00  0.77           O  
ATOM    848  NE2 GLN B 132      57.023  30.061 -31.919  1.00  0.77           N  
ATOM    849  N   LEU B 133      54.370  29.377 -38.217  1.00  0.82           N  
ATOM    850  CA  LEU B 133      54.151  29.889 -39.567  1.00  0.82           C  
ATOM    851  C   LEU B 133      55.360  30.629 -40.125  1.00  0.82           C  
ATOM    852  O   LEU B 133      56.104  31.275 -39.394  1.00  0.82           O  
ATOM    853  CB  LEU B 133      52.927  30.844 -39.593  1.00  0.82           C  
ATOM    854  CG  LEU B 133      52.491  31.376 -40.979  1.00  0.82           C  
ATOM    855  CD1 LEU B 133      52.067  30.252 -41.937  1.00  0.82           C  
ATOM    856  CD2 LEU B 133      51.358  32.403 -40.835  1.00  0.82           C  
ATOM    857  N   ARG B 134      55.601  30.524 -41.450  1.00  0.79           N  
ATOM    858  CA  ARG B 134      56.738  31.135 -42.107  1.00  0.79           C  
ATOM    859  C   ARG B 134      56.808  32.640 -41.887  1.00  0.79           C  
ATOM    860  O   ARG B 134      55.884  33.368 -42.246  1.00  0.79           O  
ATOM    861  CB  ARG B 134      56.665  30.889 -43.639  1.00  0.79           C  
ATOM    862  CG  ARG B 134      56.619  29.410 -44.086  1.00  0.79           C  
ATOM    863  CD  ARG B 134      57.952  28.654 -44.038  1.00  0.79           C  
ATOM    864  NE  ARG B 134      58.886  29.293 -45.031  1.00  0.79           N  
ATOM    865  CZ  ARG B 134      58.884  29.068 -46.355  1.00  0.79           C  
ATOM    866  NH1 ARG B 134      59.737  29.729 -47.136  1.00  0.79           N  
ATOM    867  NH2 ARG B 134      58.042  28.210 -46.922  1.00  0.79           N  
ATOM    868  N   GLU B 135      57.910  33.145 -41.295  1.00  0.70           N  
ATOM    869  CA  GLU B 135      58.117  34.570 -41.172  1.00  0.70           C  
ATOM    870  C   GLU B 135      58.294  35.212 -42.549  1.00  0.70           C  
ATOM    871  O   GLU B 135      58.829  34.567 -43.460  1.00  0.70           O  
ATOM    872  CB  GLU B 135      59.307  34.919 -40.246  1.00  0.70           C  
ATOM    873  CG  GLU B 135      59.098  34.516 -38.764  1.00  0.70           C  
ATOM    874  CD  GLU B 135      60.239  35.000 -37.862  1.00  0.70           C  
ATOM    875  OE1 GLU B 135      61.015  35.889 -38.298  1.00  0.70           O  
ATOM    876  OE2 GLU B 135      60.331  34.483 -36.720  1.00  0.70           O  
ATOM    877  N   PRO B 136      57.867  36.446 -42.798  1.00  0.76           N  
ATOM    878  CA  PRO B 136      58.370  37.204 -43.930  1.00  0.76           C  
ATOM    879  C   PRO B 136      59.852  37.485 -43.780  1.00  0.76           C  
ATOM    880  O   PRO B 136      60.348  37.629 -42.667  1.00  0.76           O  
ATOM    881  CB  PRO B 136      57.536  38.486 -43.904  1.00  0.76           C  
ATOM    882  CG  PRO B 136      57.213  38.699 -42.423  1.00  0.76           C  
ATOM    883  CD  PRO B 136      57.108  37.280 -41.861  1.00  0.76           C  
ATOM    884  N   MET B 137      60.599  37.502 -44.894  1.00  0.72           N  
ATOM    885  CA  MET B 137      62.030  37.701 -44.862  1.00  0.72           C  
ATOM    886  C   MET B 137      62.428  39.082 -44.358  1.00  0.72           C  
ATOM    887  O   MET B 137      61.806  40.091 -44.686  1.00  0.72           O  
ATOM    888  CB  MET B 137      62.637  37.424 -46.255  1.00  0.72           C  
ATOM    889  CG  MET B 137      62.360  35.997 -46.775  1.00  0.72           C  
ATOM    890  SD  MET B 137      62.547  35.807 -48.576  1.00  0.72           S  
ATOM    891  CE  MET B 137      64.300  36.257 -48.696  1.00  0.72           C  
ATOM    892  N   LEU B 138      63.497  39.148 -43.549  1.00  0.56           N  
ATOM    893  CA  LEU B 138      63.932  40.370 -42.915  1.00  0.56           C  
ATOM    894  C   LEU B 138      65.275  40.729 -43.516  1.00  0.56           C  
ATOM    895  O   LEU B 138      66.073  39.847 -43.825  1.00  0.56           O  
ATOM    896  CB  LEU B 138      64.037  40.195 -41.379  1.00  0.56           C  
ATOM    897  CG  LEU B 138      62.710  39.799 -40.688  1.00  0.56           C  
ATOM    898  CD1 LEU B 138      62.944  39.409 -39.220  1.00  0.56           C  
ATOM    899  CD2 LEU B 138      61.642  40.900 -40.790  1.00  0.56           C  
ATOM    900  N   GLN B 139      65.493  42.036 -43.765  1.00  0.50           N  
ATOM    901  CA  GLN B 139      66.781  42.567 -44.173  1.00  0.50           C  
ATOM    902  C   GLN B 139      67.822  42.615 -43.014  1.00  0.50           C  
ATOM    903  O   GLN B 139      67.438  42.397 -41.832  1.00  0.50           O  
ATOM    904  CB  GLN B 139      66.666  44.020 -44.725  1.00  0.50           C  
ATOM    905  CG  GLN B 139      65.501  44.303 -45.707  1.00  0.50           C  
ATOM    906  CD  GLN B 139      65.669  45.652 -46.418  1.00  0.50           C  
ATOM    907  OE1 GLN B 139      66.736  46.255 -46.484  1.00  0.50           O  
ATOM    908  NE2 GLN B 139      64.559  46.163 -47.011  1.00  0.50           N  
ATOM    909  OXT GLN B 139      69.011  42.908 -43.317  1.00  0.50           O  
TER     910      GLN B 139                                                      
ATOM    911  N   SER A   2      85.968  47.525   1.221  1.00  0.74           N  
ATOM    912  CA  SER A   2      85.152  46.388   1.797  1.00  0.74           C  
ATOM    913  C   SER A   2      85.421  45.117   1.028  1.00  0.74           C  
ATOM    914  O   SER A   2      85.684  45.183  -0.167  1.00  0.74           O  
ATOM    915  CB  SER A   2      83.619  46.695   1.758  1.00  0.74           C  
ATOM    916  OG  SER A   2      82.831  45.599   2.232  1.00  0.74           O  
ATOM    917  N   GLN A   3      85.375  43.946   1.691  1.00  0.82           N  
ATOM    918  CA  GLN A   3      85.624  42.659   1.077  1.00  0.82           C  
ATOM    919  C   GLN A   3      84.316  41.955   0.755  1.00  0.82           C  
ATOM    920  O   GLN A   3      84.301  40.861   0.209  1.00  0.82           O  
ATOM    921  CB  GLN A   3      86.494  41.819   2.038  1.00  0.82           C  
ATOM    922  CG  GLN A   3      87.915  42.419   2.191  1.00  0.82           C  
ATOM    923  CD  GLN A   3      88.667  41.878   3.410  1.00  0.82           C  
ATOM    924  OE1 GLN A   3      88.102  41.695   4.484  1.00  0.82           O  
ATOM    925  NE2 GLN A   3      90.001  41.691   3.267  1.00  0.82           N  
ATOM    926  N   ALA A   4      83.162  42.611   1.010  1.00  0.89           N  
ATOM    927  CA  ALA A   4      81.842  42.044   0.811  1.00  0.89           C  
ATOM    928  C   ALA A   4      81.463  41.747  -0.642  1.00  0.89           C  
ATOM    929  O   ALA A   4      80.598  40.918  -0.900  1.00  0.89           O  
ATOM    930  CB  ALA A   4      80.793  42.985   1.436  1.00  0.89           C  
ATOM    931  N   TRP A   5      82.114  42.388  -1.632  1.00  0.74           N  
ATOM    932  CA  TRP A   5      81.868  42.111  -3.040  1.00  0.74           C  
ATOM    933  C   TRP A   5      82.882  41.132  -3.613  1.00  0.74           C  
ATOM    934  O   TRP A   5      82.809  40.748  -4.777  1.00  0.74           O  
ATOM    935  CB  TRP A   5      81.845  43.422  -3.864  1.00  0.74           C  
ATOM    936  CG  TRP A   5      80.580  44.233  -3.634  1.00  0.74           C  
ATOM    937  CD1 TRP A   5      79.382  44.099  -4.274  1.00  0.74           C  
ATOM    938  CD2 TRP A   5      80.389  45.260  -2.642  1.00  0.74           C  
ATOM    939  NE1 TRP A   5      78.448  44.958  -3.742  1.00  0.74           N  
ATOM    940  CE2 TRP A   5      79.048  45.681  -2.741  1.00  0.74           C  
ATOM    941  CE3 TRP A   5      81.253  45.821  -1.707  1.00  0.74           C  
ATOM    942  CZ2 TRP A   5      78.544  46.670  -1.906  1.00  0.74           C  
ATOM    943  CZ3 TRP A   5      80.745  46.829  -0.877  1.00  0.74           C  
ATOM    944  CH2 TRP A   5      79.413  47.246  -0.971  1.00  0.74           C  
ATOM    945  N   GLN A   6      83.835  40.653  -2.789  1.00  0.86           N  
ATOM    946  CA  GLN A   6      84.740  39.591  -3.170  1.00  0.86           C  
ATOM    947  C   GLN A   6      84.025  38.254  -3.010  1.00  0.86           C  
ATOM    948  O   GLN A   6      82.981  38.192  -2.355  1.00  0.86           O  
ATOM    949  CB  GLN A   6      86.024  39.629  -2.297  1.00  0.86           C  
ATOM    950  CG  GLN A   6      86.808  40.957  -2.425  1.00  0.86           C  
ATOM    951  CD  GLN A   6      88.001  41.029  -1.467  1.00  0.86           C  
ATOM    952  OE1 GLN A   6      88.323  40.128  -0.704  1.00  0.86           O  
ATOM    953  NE2 GLN A   6      88.706  42.189  -1.490  1.00  0.86           N  
ATOM    954  N   PRO A   7      84.512  37.153  -3.566  1.00  0.92           N  
ATOM    955  CA  PRO A   7      83.992  35.830  -3.245  1.00  0.92           C  
ATOM    956  C   PRO A   7      84.310  35.405  -1.835  1.00  0.92           C  
ATOM    957  O   PRO A   7      83.648  34.526  -1.291  1.00  0.92           O  
ATOM    958  CB  PRO A   7      84.624  34.927  -4.309  1.00  0.92           C  
ATOM    959  CG  PRO A   7      85.897  35.650  -4.747  1.00  0.92           C  
ATOM    960  CD  PRO A   7      85.499  37.117  -4.651  1.00  0.92           C  
ATOM    961  N   GLY A   8      85.326  35.981  -1.208  1.00  0.94           N  
ATOM    962  CA  GLY A   8      85.699  35.570   0.115  1.00  0.94           C  
ATOM    963  C   GLY A   8      86.958  36.268   0.423  1.00  0.94           C  
ATOM    964  O   GLY A   8      87.369  37.165  -0.308  1.00  0.94           O  
ATOM    965  N   VAL A   9      87.610  35.843   1.503  1.00  0.92           N  
ATOM    966  CA  VAL A   9      88.807  36.478   1.998  1.00  0.92           C  
ATOM    967  C   VAL A   9      89.870  35.413   2.156  1.00  0.92           C  
ATOM    968  O   VAL A   9      89.644  34.345   2.726  1.00  0.92           O  
ATOM    969  CB  VAL A   9      88.577  37.213   3.313  1.00  0.92           C  
ATOM    970  CG1 VAL A   9      89.823  38.032   3.695  1.00  0.92           C  
ATOM    971  CG2 VAL A   9      87.384  38.174   3.160  1.00  0.92           C  
ATOM    972  N   ALA A  10      91.074  35.673   1.617  1.00  0.93           N  
ATOM    973  CA  ALA A  10      92.235  34.840   1.807  1.00  0.93           C  
ATOM    974  C   ALA A  10      93.029  35.342   2.996  1.00  0.93           C  
ATOM    975  O   ALA A  10      93.106  36.546   3.234  1.00  0.93           O  
ATOM    976  CB  ALA A  10      93.106  34.878   0.542  1.00  0.93           C  
ATOM    977  N   MET A  11      93.634  34.429   3.780  1.00  0.89           N  
ATOM    978  CA  MET A  11      94.493  34.768   4.903  1.00  0.89           C  
ATOM    979  C   MET A  11      95.690  35.641   4.506  1.00  0.89           C  
ATOM    980  O   MET A  11      96.494  35.200   3.679  1.00  0.89           O  
ATOM    981  CB  MET A  11      95.017  33.481   5.581  1.00  0.89           C  
ATOM    982  CG  MET A  11      95.793  33.720   6.891  1.00  0.89           C  
ATOM    983  SD  MET A  11      96.210  32.203   7.800  1.00  0.89           S  
ATOM    984  CE  MET A  11      97.433  31.608   6.605  1.00  0.89           C  
ATOM    985  N   PRO A  12      95.875  36.863   5.014  1.00  0.92           N  
ATOM    986  CA  PRO A  12      97.062  37.672   4.753  1.00  0.92           C  
ATOM    987  C   PRO A  12      98.385  36.970   5.016  1.00  0.92           C  
ATOM    988  O   PRO A  12      98.513  36.267   6.018  1.00  0.92           O  
ATOM    989  CB  PRO A  12      96.861  38.931   5.614  1.00  0.92           C  
ATOM    990  CG  PRO A  12      95.339  39.054   5.724  1.00  0.92           C  
ATOM    991  CD  PRO A  12      94.883  37.599   5.801  1.00  0.92           C  
ATOM    992  N   ASN A  13      99.409  37.168   4.153  1.00  0.78           N  
ATOM    993  CA  ASN A  13     100.698  36.488   4.262  1.00  0.78           C  
ATOM    994  C   ASN A  13     101.413  36.693   5.596  1.00  0.78           C  
ATOM    995  O   ASN A  13     102.141  35.817   6.050  1.00  0.78           O  
ATOM    996  CB  ASN A  13     101.694  36.915   3.152  1.00  0.78           C  
ATOM    997  CG  ASN A  13     101.414  36.242   1.812  1.00  0.78           C  
ATOM    998  OD1 ASN A  13     100.912  35.121   1.716  1.00  0.78           O  
ATOM    999  ND2 ASN A  13     101.847  36.916   0.720  1.00  0.78           N  
ATOM   1000  N   LEU A  14     101.210  37.850   6.258  1.00  0.80           N  
ATOM   1001  CA  LEU A  14     101.782  38.160   7.560  1.00  0.80           C  
ATOM   1002  C   LEU A  14     101.438  37.156   8.654  1.00  0.80           C  
ATOM   1003  O   LEU A  14     102.288  36.844   9.481  1.00  0.80           O  
ATOM   1004  CB  LEU A  14     101.414  39.591   8.025  1.00  0.80           C  
ATOM   1005  CG  LEU A  14     102.269  40.709   7.391  1.00  0.80           C  
ATOM   1006  CD1 LEU A  14     101.648  42.091   7.631  1.00  0.80           C  
ATOM   1007  CD2 LEU A  14     103.690  40.721   7.971  1.00  0.80           C  
ATOM   1008  N   TYR A  15     100.211  36.585   8.660  1.00  0.77           N  
ATOM   1009  CA  TYR A  15      99.798  35.548   9.598  1.00  0.77           C  
ATOM   1010  C   TYR A  15     100.637  34.289   9.508  1.00  0.77           C  
ATOM   1011  O   TYR A  15     100.904  33.635  10.510  1.00  0.77           O  
ATOM   1012  CB  TYR A  15      98.314  35.162   9.411  1.00  0.77           C  
ATOM   1013  CG  TYR A  15      97.438  36.289   9.864  1.00  0.77           C  
ATOM   1014  CD1 TYR A  15      97.212  36.477  11.231  1.00  0.77           C  
ATOM   1015  CD2 TYR A  15      96.831  37.163   8.954  1.00  0.77           C  
ATOM   1016  CE1 TYR A  15      96.412  37.531  11.683  1.00  0.77           C  
ATOM   1017  CE2 TYR A  15      96.040  38.236   9.404  1.00  0.77           C  
ATOM   1018  CZ  TYR A  15      95.835  38.424  10.780  1.00  0.77           C  
ATOM   1019  OH  TYR A  15      95.070  39.473  11.337  1.00  0.77           O  
ATOM   1020  N   LYS A  16     101.114  33.938   8.299  1.00  0.69           N  
ATOM   1021  CA  LYS A  16     101.955  32.779   8.077  1.00  0.69           C  
ATOM   1022  C   LYS A  16     103.293  32.842   8.795  1.00  0.69           C  
ATOM   1023  O   LYS A  16     103.884  31.822   9.120  1.00  0.69           O  
ATOM   1024  CB  LYS A  16     102.258  32.563   6.577  1.00  0.69           C  
ATOM   1025  CG  LYS A  16     101.029  32.467   5.664  1.00  0.69           C  
ATOM   1026  CD  LYS A  16     101.457  32.347   4.193  1.00  0.69           C  
ATOM   1027  CE  LYS A  16     100.282  32.296   3.216  1.00  0.69           C  
ATOM   1028  NZ  LYS A  16     100.787  32.380   1.834  1.00  0.69           N  
ATOM   1029  N   MET A  17     103.802  34.055   9.065  1.00  0.71           N  
ATOM   1030  CA  MET A  17     105.117  34.232   9.639  1.00  0.71           C  
ATOM   1031  C   MET A  17     105.059  34.425  11.143  1.00  0.71           C  
ATOM   1032  O   MET A  17     106.076  34.659  11.790  1.00  0.71           O  
ATOM   1033  CB  MET A  17     105.785  35.458   8.982  1.00  0.71           C  
ATOM   1034  CG  MET A  17     105.982  35.270   7.463  1.00  0.71           C  
ATOM   1035  SD  MET A  17     106.889  36.606   6.632  1.00  0.71           S  
ATOM   1036  CE  MET A  17     105.511  37.766   6.771  1.00  0.71           C  
ATOM   1037  N   GLN A  18     103.860  34.317  11.750  1.00  0.74           N  
ATOM   1038  CA  GLN A  18     103.700  34.463  13.183  1.00  0.74           C  
ATOM   1039  C   GLN A  18     103.869  33.137  13.899  1.00  0.74           C  
ATOM   1040  O   GLN A  18     103.997  32.075  13.290  1.00  0.74           O  
ATOM   1041  CB  GLN A  18     102.354  35.134  13.557  1.00  0.74           C  
ATOM   1042  CG  GLN A  18     102.087  36.458  12.800  1.00  0.74           C  
ATOM   1043  CD  GLN A  18     103.273  37.422  12.872  1.00  0.74           C  
ATOM   1044  OE1 GLN A  18     103.815  37.699  13.941  1.00  0.74           O  
ATOM   1045  NE2 GLN A  18     103.698  37.950  11.699  1.00  0.74           N  
ATOM   1046  N   ARG A  19     103.906  33.165  15.242  1.00  0.71           N  
ATOM   1047  CA  ARG A  19     104.056  31.954  16.024  1.00  0.71           C  
ATOM   1048  C   ARG A  19     103.057  31.952  17.148  1.00  0.71           C  
ATOM   1049  O   ARG A  19     103.391  32.032  18.328  1.00  0.71           O  
ATOM   1050  CB  ARG A  19     105.510  31.754  16.515  1.00  0.71           C  
ATOM   1051  CG  ARG A  19     105.838  30.283  16.851  1.00  0.71           C  
ATOM   1052  CD  ARG A  19     107.340  29.980  16.913  1.00  0.71           C  
ATOM   1053  NE  ARG A  19     107.541  28.499  16.688  1.00  0.71           N  
ATOM   1054  CZ  ARG A  19     107.667  27.911  15.486  1.00  0.71           C  
ATOM   1055  NH1 ARG A  19     107.839  26.590  15.409  1.00  0.71           N  
ATOM   1056  NH2 ARG A  19     107.585  28.603  14.354  1.00  0.71           N  
ATOM   1057  N   MET A  20     101.767  31.914  16.780  1.00  0.84           N  
ATOM   1058  CA  MET A  20     100.687  31.951  17.731  1.00  0.84           C  
ATOM   1059  C   MET A  20     100.518  30.679  18.531  1.00  0.84           C  
ATOM   1060  O   MET A  20     100.816  29.572  18.086  1.00  0.84           O  
ATOM   1061  CB  MET A  20      99.361  32.320  17.039  1.00  0.84           C  
ATOM   1062  CG  MET A  20      99.430  33.656  16.272  1.00  0.84           C  
ATOM   1063  SD  MET A  20     100.053  35.091  17.204  1.00  0.84           S  
ATOM   1064  CE  MET A  20      98.795  35.094  18.510  1.00  0.84           C  
ATOM   1065  N   LEU A  21     100.008  30.821  19.766  1.00  0.83           N  
ATOM   1066  CA  LEU A  21      99.595  29.695  20.569  1.00  0.83           C  
ATOM   1067  C   LEU A  21      98.165  29.348  20.187  1.00  0.83           C  
ATOM   1068  O   LEU A  21      97.363  30.225  19.880  1.00  0.83           O  
ATOM   1069  CB  LEU A  21      99.714  30.044  22.068  1.00  0.83           C  
ATOM   1070  CG  LEU A  21      99.541  28.871  23.051  1.00  0.83           C  
ATOM   1071  CD1 LEU A  21     100.631  27.802  22.876  1.00  0.83           C  
ATOM   1072  CD2 LEU A  21      99.545  29.400  24.493  1.00  0.83           C  
ATOM   1073  N   LEU A  22      97.829  28.046  20.107  1.00  0.83           N  
ATOM   1074  CA  LEU A  22      96.480  27.604  19.798  1.00  0.83           C  
ATOM   1075  C   LEU A  22      95.484  27.893  20.911  1.00  0.83           C  
ATOM   1076  O   LEU A  22      95.763  27.667  22.085  1.00  0.83           O  
ATOM   1077  CB  LEU A  22      96.456  26.089  19.493  1.00  0.83           C  
ATOM   1078  CG  LEU A  22      95.110  25.519  18.993  1.00  0.83           C  
ATOM   1079  CD1 LEU A  22      94.712  26.062  17.612  1.00  0.83           C  
ATOM   1080  CD2 LEU A  22      95.162  23.986  18.981  1.00  0.83           C  
ATOM   1081  N   GLU A  23      94.271  28.333  20.544  1.00  0.77           N  
ATOM   1082  CA  GLU A  23      93.190  28.531  21.471  1.00  0.77           C  
ATOM   1083  C   GLU A  23      91.918  28.426  20.666  1.00  0.77           C  
ATOM   1084  O   GLU A  23      91.965  28.143  19.470  1.00  0.77           O  
ATOM   1085  CB  GLU A  23      93.273  29.855  22.272  1.00  0.77           C  
ATOM   1086  CG  GLU A  23      93.192  31.161  21.448  1.00  0.77           C  
ATOM   1087  CD  GLU A  23      93.367  32.389  22.341  1.00  0.77           C  
ATOM   1088  OE1 GLU A  23      94.397  32.457  23.060  1.00  0.77           O  
ATOM   1089  OE2 GLU A  23      92.477  33.275  22.295  1.00  0.77           O  
ATOM   1090  N   LYS A  24      90.751  28.564  21.322  1.00  0.82           N  
ATOM   1091  CA  LYS A  24      89.446  28.441  20.698  1.00  0.82           C  
ATOM   1092  C   LYS A  24      89.185  29.429  19.563  1.00  0.82           C  
ATOM   1093  O   LYS A  24      89.520  30.607  19.648  1.00  0.82           O  
ATOM   1094  CB  LYS A  24      88.338  28.627  21.773  1.00  0.82           C  
ATOM   1095  CG  LYS A  24      86.911  28.478  21.222  1.00  0.82           C  
ATOM   1096  CD  LYS A  24      85.789  28.629  22.253  1.00  0.82           C  
ATOM   1097  CE  LYS A  24      84.400  28.335  21.666  1.00  0.82           C  
ATOM   1098  NZ  LYS A  24      84.096  29.224  20.519  1.00  0.82           N  
ATOM   1099  N   CYS A  25      88.517  28.987  18.479  1.00  0.87           N  
ATOM   1100  CA  CYS A  25      87.943  29.903  17.513  1.00  0.87           C  
ATOM   1101  C   CYS A  25      86.639  30.475  18.022  1.00  0.87           C  
ATOM   1102  O   CYS A  25      85.694  29.762  18.373  1.00  0.87           O  
ATOM   1103  CB  CYS A  25      87.782  29.253  16.122  1.00  0.87           C  
ATOM   1104  SG  CYS A  25      87.564  30.419  14.734  1.00  0.87           S  
ATOM   1105  N   ASP A  26      86.582  31.807  18.121  1.00  0.82           N  
ATOM   1106  CA  ASP A  26      85.436  32.512  18.607  1.00  0.82           C  
ATOM   1107  C   ASP A  26      85.118  33.585  17.584  1.00  0.82           C  
ATOM   1108  O   ASP A  26      85.772  34.619  17.484  1.00  0.82           O  
ATOM   1109  CB  ASP A  26      85.747  33.053  20.021  1.00  0.82           C  
ATOM   1110  CG  ASP A  26      84.459  33.368  20.759  1.00  0.82           C  
ATOM   1111  OD1 ASP A  26      83.425  32.735  20.397  1.00  0.82           O  
ATOM   1112  OD2 ASP A  26      84.511  34.144  21.740  1.00  0.82           O  
ATOM   1113  N   LEU A  27      84.104  33.330  16.734  1.00  0.77           N  
ATOM   1114  CA  LEU A  27      83.787  34.224  15.641  1.00  0.77           C  
ATOM   1115  C   LEU A  27      82.744  35.236  16.045  1.00  0.77           C  
ATOM   1116  O   LEU A  27      81.657  34.895  16.495  1.00  0.77           O  
ATOM   1117  CB  LEU A  27      83.289  33.460  14.392  1.00  0.77           C  
ATOM   1118  CG  LEU A  27      84.329  32.494  13.805  1.00  0.77           C  
ATOM   1119  CD1 LEU A  27      83.735  31.708  12.638  1.00  0.77           C  
ATOM   1120  CD2 LEU A  27      85.604  33.206  13.343  1.00  0.77           C  
ATOM   1121  N   GLN A  28      83.032  36.537  15.846  1.00  0.72           N  
ATOM   1122  CA  GLN A  28      82.090  37.602  16.151  1.00  0.72           C  
ATOM   1123  C   GLN A  28      80.789  37.516  15.369  1.00  0.72           C  
ATOM   1124  O   GLN A  28      79.706  37.733  15.900  1.00  0.72           O  
ATOM   1125  CB  GLN A  28      82.739  38.980  15.898  1.00  0.72           C  
ATOM   1126  CG  GLN A  28      81.833  40.153  16.340  1.00  0.72           C  
ATOM   1127  CD  GLN A  28      82.501  41.509  16.133  1.00  0.72           C  
ATOM   1128  OE1 GLN A  28      83.595  41.643  15.592  1.00  0.72           O  
ATOM   1129  NE2 GLN A  28      81.810  42.577  16.600  1.00  0.72           N  
ATOM   1130  N   ASN A  29      80.897  37.140  14.083  1.00  0.69           N  
ATOM   1131  CA  ASN A  29      79.786  37.033  13.162  1.00  0.69           C  
ATOM   1132  C   ASN A  29      79.311  35.585  13.105  1.00  0.69           C  
ATOM   1133  O   ASN A  29      78.819  35.113  12.090  1.00  0.69           O  
ATOM   1134  CB  ASN A  29      80.199  37.500  11.741  1.00  0.69           C  
ATOM   1135  CG  ASN A  29      80.709  38.941  11.727  1.00  0.69           C  
ATOM   1136  OD1 ASN A  29      80.782  39.672  12.711  1.00  0.69           O  
ATOM   1137  ND2 ASN A  29      81.166  39.380  10.526  1.00  0.69           N  
ATOM   1138  N   TYR A  30      79.507  34.809  14.194  1.00  0.69           N  
ATOM   1139  CA  TYR A  30      78.923  33.492  14.386  1.00  0.69           C  
ATOM   1140  C   TYR A  30      77.400  33.557  14.420  1.00  0.69           C  
ATOM   1141  O   TYR A  30      76.814  34.445  15.026  1.00  0.69           O  
ATOM   1142  CB  TYR A  30      79.462  32.885  15.707  1.00  0.69           C  
ATOM   1143  CG  TYR A  30      78.877  31.553  16.079  1.00  0.69           C  
ATOM   1144  CD1 TYR A  30      79.413  30.358  15.583  1.00  0.69           C  
ATOM   1145  CD2 TYR A  30      77.770  31.500  16.940  1.00  0.69           C  
ATOM   1146  CE1 TYR A  30      78.862  29.126  15.962  1.00  0.69           C  
ATOM   1147  CE2 TYR A  30      77.210  30.270  17.308  1.00  0.69           C  
ATOM   1148  CZ  TYR A  30      77.764  29.081  16.825  1.00  0.69           C  
ATOM   1149  OH  TYR A  30      77.225  27.836  17.202  1.00  0.69           O  
ATOM   1150  N   GLY A  31      76.711  32.589  13.782  1.00  0.69           N  
ATOM   1151  CA  GLY A  31      75.252  32.566  13.746  1.00  0.69           C  
ATOM   1152  C   GLY A  31      74.620  33.423  12.665  1.00  0.69           C  
ATOM   1153  O   GLY A  31      73.522  33.106  12.215  1.00  0.69           O  
ATOM   1154  N   ASP A  32      75.299  34.501  12.208  1.00  0.69           N  
ATOM   1155  CA  ASP A  32      74.958  35.271  11.018  1.00  0.69           C  
ATOM   1156  C   ASP A  32      74.884  34.433   9.753  1.00  0.69           C  
ATOM   1157  O   ASP A  32      75.556  33.415   9.588  1.00  0.69           O  
ATOM   1158  CB  ASP A  32      75.958  36.409  10.676  1.00  0.69           C  
ATOM   1159  CG  ASP A  32      75.907  37.613  11.596  1.00  0.69           C  
ATOM   1160  OD1 ASP A  32      75.082  37.630  12.538  1.00  0.69           O  
ATOM   1161  OD2 ASP A  32      76.695  38.554  11.307  1.00  0.69           O  
ATOM   1162  N   SER A  33      74.077  34.908   8.788  1.00  0.71           N  
ATOM   1163  CA  SER A  33      73.833  34.187   7.559  1.00  0.71           C  
ATOM   1164  C   SER A  33      73.755  35.165   6.424  1.00  0.71           C  
ATOM   1165  O   SER A  33      73.242  36.272   6.553  1.00  0.71           O  
ATOM   1166  CB  SER A  33      72.515  33.374   7.566  1.00  0.71           C  
ATOM   1167  OG  SER A  33      72.654  32.194   8.354  1.00  0.71           O  
ATOM   1168  N   ALA A  34      74.302  34.766   5.262  1.00  0.73           N  
ATOM   1169  CA  ALA A  34      74.214  35.529   4.040  1.00  0.73           C  
ATOM   1170  C   ALA A  34      72.871  35.328   3.356  1.00  0.73           C  
ATOM   1171  O   ALA A  34      72.170  34.345   3.589  1.00  0.73           O  
ATOM   1172  CB  ALA A  34      75.346  35.121   3.078  1.00  0.73           C  
ATOM   1173  N   THR A  35      72.475  36.261   2.469  1.00  0.75           N  
ATOM   1174  CA  THR A  35      71.198  36.169   1.764  1.00  0.75           C  
ATOM   1175  C   THR A  35      71.367  35.320   0.532  1.00  0.75           C  
ATOM   1176  O   THR A  35      71.762  35.809  -0.525  1.00  0.75           O  
ATOM   1177  CB  THR A  35      70.649  37.516   1.319  1.00  0.75           C  
ATOM   1178  OG1 THR A  35      70.526  38.379   2.438  1.00  0.75           O  
ATOM   1179  CG2 THR A  35      69.241  37.375   0.724  1.00  0.75           C  
ATOM   1180  N   LEU A  36      71.116  33.999   0.625  1.00  0.79           N  
ATOM   1181  CA  LEU A  36      71.262  33.110  -0.516  1.00  0.79           C  
ATOM   1182  C   LEU A  36      70.311  33.483  -1.658  1.00  0.79           C  
ATOM   1183  O   LEU A  36      69.154  33.813  -1.388  1.00  0.79           O  
ATOM   1184  CB  LEU A  36      71.099  31.616  -0.138  1.00  0.79           C  
ATOM   1185  CG  LEU A  36      72.212  31.054   0.775  1.00  0.79           C  
ATOM   1186  CD1 LEU A  36      71.876  29.612   1.188  1.00  0.79           C  
ATOM   1187  CD2 LEU A  36      73.597  31.085   0.109  1.00  0.79           C  
ATOM   1188  N   PRO A  37      70.706  33.492  -2.932  1.00  0.84           N  
ATOM   1189  CA  PRO A  37      69.777  33.635  -4.043  1.00  0.84           C  
ATOM   1190  C   PRO A  37      68.687  32.579  -4.038  1.00  0.84           C  
ATOM   1191  O   PRO A  37      68.909  31.460  -3.577  1.00  0.84           O  
ATOM   1192  CB  PRO A  37      70.657  33.571  -5.302  1.00  0.84           C  
ATOM   1193  CG  PRO A  37      72.072  33.882  -4.807  1.00  0.84           C  
ATOM   1194  CD  PRO A  37      72.078  33.313  -3.392  1.00  0.84           C  
ATOM   1195  N   LYS A  38      67.484  32.913  -4.532  1.00  0.74           N  
ATOM   1196  CA  LYS A  38      66.318  32.053  -4.448  1.00  0.74           C  
ATOM   1197  C   LYS A  38      66.500  30.635  -4.960  1.00  0.74           C  
ATOM   1198  O   LYS A  38      66.714  30.433  -6.143  1.00  0.74           O  
ATOM   1199  CB  LYS A  38      65.164  32.669  -5.267  1.00  0.74           C  
ATOM   1200  CG  LYS A  38      63.857  31.855  -5.230  1.00  0.74           C  
ATOM   1201  CD  LYS A  38      62.804  32.426  -6.188  1.00  0.74           C  
ATOM   1202  CE  LYS A  38      61.425  31.767  -6.085  1.00  0.74           C  
ATOM   1203  NZ  LYS A  38      61.513  30.325  -6.407  1.00  0.74           N  
ATOM   1204  N   GLY A  39      66.352  29.599  -4.100  1.00  0.76           N  
ATOM   1205  CA  GLY A  39      66.484  28.199  -4.502  1.00  0.76           C  
ATOM   1206  C   GLY A  39      67.900  27.706  -4.642  1.00  0.76           C  
ATOM   1207  O   GLY A  39      68.114  26.591  -5.103  1.00  0.76           O  
ATOM   1208  N   ILE A  40      68.906  28.517  -4.276  1.00  0.77           N  
ATOM   1209  CA  ILE A  40      70.301  28.122  -4.371  1.00  0.77           C  
ATOM   1210  C   ILE A  40      70.737  27.492  -3.068  1.00  0.77           C  
ATOM   1211  O   ILE A  40      70.623  28.053  -1.981  1.00  0.77           O  
ATOM   1212  CB  ILE A  40      71.204  29.285  -4.762  1.00  0.77           C  
ATOM   1213  CG1 ILE A  40      70.825  29.820  -6.164  1.00  0.77           C  
ATOM   1214  CG2 ILE A  40      72.704  28.922  -4.700  1.00  0.77           C  
ATOM   1215  CD1 ILE A  40      70.997  28.831  -7.323  1.00  0.77           C  
ATOM   1216  N   MET A  41      71.240  26.249  -3.155  1.00  0.76           N  
ATOM   1217  CA  MET A  41      71.824  25.547  -2.038  1.00  0.76           C  
ATOM   1218  C   MET A  41      73.089  26.221  -1.509  1.00  0.76           C  
ATOM   1219  O   MET A  41      73.881  26.774  -2.271  1.00  0.76           O  
ATOM   1220  CB  MET A  41      72.199  24.101  -2.441  1.00  0.76           C  
ATOM   1221  CG  MET A  41      71.036  23.227  -2.945  1.00  0.76           C  
ATOM   1222  SD  MET A  41      71.621  21.600  -3.503  1.00  0.76           S  
ATOM   1223  CE  MET A  41      69.999  20.911  -3.916  1.00  0.76           C  
ATOM   1224  N   MET A  42      73.362  26.122  -0.187  1.00  0.79           N  
ATOM   1225  CA  MET A  42      74.579  26.659   0.417  1.00  0.79           C  
ATOM   1226  C   MET A  42      75.855  26.150  -0.234  1.00  0.79           C  
ATOM   1227  O   MET A  42      76.775  26.906  -0.521  1.00  0.79           O  
ATOM   1228  CB  MET A  42      74.639  26.302   1.928  1.00  0.79           C  
ATOM   1229  CG  MET A  42      75.974  26.627   2.644  1.00  0.79           C  
ATOM   1230  SD  MET A  42      76.523  28.358   2.511  1.00  0.79           S  
ATOM   1231  CE  MET A  42      75.326  29.014   3.703  1.00  0.79           C  
ATOM   1232  N   ASN A  43      75.929  24.839  -0.531  1.00  0.82           N  
ATOM   1233  CA  ASN A  43      77.109  24.278  -1.159  1.00  0.82           C  
ATOM   1234  C   ASN A  43      77.277  24.674  -2.626  1.00  0.82           C  
ATOM   1235  O   ASN A  43      78.400  24.764  -3.103  1.00  0.82           O  
ATOM   1236  CB  ASN A  43      77.178  22.750  -0.945  1.00  0.82           C  
ATOM   1237  CG  ASN A  43      77.474  22.463   0.529  1.00  0.82           C  
ATOM   1238  OD1 ASN A  43      78.046  23.272   1.262  1.00  0.82           O  
ATOM   1239  ND2 ASN A  43      77.076  21.255   0.996  1.00  0.82           N  
ATOM   1240  N   VAL A  44      76.197  25.001  -3.376  1.00  0.83           N  
ATOM   1241  CA  VAL A  44      76.352  25.635  -4.690  1.00  0.83           C  
ATOM   1242  C   VAL A  44      76.987  27.007  -4.539  1.00  0.83           C  
ATOM   1243  O   VAL A  44      77.971  27.335  -5.192  1.00  0.83           O  
ATOM   1244  CB  VAL A  44      75.036  25.752  -5.461  1.00  0.83           C  
ATOM   1245  CG1 VAL A  44      75.155  26.657  -6.708  1.00  0.83           C  
ATOM   1246  CG2 VAL A  44      74.599  24.351  -5.914  1.00  0.83           C  
ATOM   1247  N   ALA A  45      76.487  27.818  -3.587  1.00  0.87           N  
ATOM   1248  CA  ALA A  45      77.036  29.126  -3.305  1.00  0.87           C  
ATOM   1249  C   ALA A  45      78.491  29.121  -2.841  1.00  0.87           C  
ATOM   1250  O   ALA A  45      79.320  29.896  -3.317  1.00  0.87           O  
ATOM   1251  CB  ALA A  45      76.158  29.794  -2.236  1.00  0.87           C  
ATOM   1252  N   LYS A  46      78.839  28.208  -1.916  1.00  0.86           N  
ATOM   1253  CA  LYS A  46      80.181  28.028  -1.399  1.00  0.86           C  
ATOM   1254  C   LYS A  46      81.214  27.594  -2.429  1.00  0.86           C  
ATOM   1255  O   LYS A  46      82.302  28.164  -2.513  1.00  0.86           O  
ATOM   1256  CB  LYS A  46      80.125  26.968  -0.279  1.00  0.86           C  
ATOM   1257  CG  LYS A  46      81.460  26.681   0.420  1.00  0.86           C  
ATOM   1258  CD  LYS A  46      81.392  25.463   1.348  1.00  0.86           C  
ATOM   1259  CE  LYS A  46      80.334  25.591   2.438  1.00  0.86           C  
ATOM   1260  NZ  LYS A  46      80.500  24.471   3.375  1.00  0.86           N  
ATOM   1261  N   TYR A  47      80.890  26.582  -3.263  1.00  0.89           N  
ATOM   1262  CA  TYR A  47      81.751  26.141  -4.350  1.00  0.89           C  
ATOM   1263  C   TYR A  47      81.910  27.204  -5.406  1.00  0.89           C  
ATOM   1264  O   TYR A  47      83.003  27.415  -5.925  1.00  0.89           O  
ATOM   1265  CB  TYR A  47      81.251  24.853  -5.026  1.00  0.89           C  
ATOM   1266  CG  TYR A  47      81.725  23.656  -4.270  1.00  0.89           C  
ATOM   1267  CD1 TYR A  47      81.201  23.316  -3.015  1.00  0.89           C  
ATOM   1268  CD2 TYR A  47      82.693  22.823  -4.851  1.00  0.89           C  
ATOM   1269  CE1 TYR A  47      81.562  22.124  -2.391  1.00  0.89           C  
ATOM   1270  CE2 TYR A  47      83.086  21.643  -4.217  1.00  0.89           C  
ATOM   1271  CZ  TYR A  47      82.503  21.294  -2.998  1.00  0.89           C  
ATOM   1272  OH  TYR A  47      82.869  20.109  -2.372  1.00  0.89           O  
ATOM   1273  N   THR A  48      80.825  27.931  -5.733  1.00  0.89           N  
ATOM   1274  CA  THR A  48      80.884  29.040  -6.683  1.00  0.89           C  
ATOM   1275  C   THR A  48      81.836  30.122  -6.226  1.00  0.89           C  
ATOM   1276  O   THR A  48      82.690  30.566  -6.985  1.00  0.89           O  
ATOM   1277  CB  THR A  48      79.515  29.634  -6.976  1.00  0.89           C  
ATOM   1278  OG1 THR A  48      78.734  28.686  -7.686  1.00  0.89           O  
ATOM   1279  CG2 THR A  48      79.562  30.872  -7.880  1.00  0.89           C  
ATOM   1280  N   GLN A  49      81.794  30.527  -4.943  1.00  0.88           N  
ATOM   1281  CA  GLN A  49      82.779  31.446  -4.400  1.00  0.88           C  
ATOM   1282  C   GLN A  49      84.201  30.925  -4.347  1.00  0.88           C  
ATOM   1283  O   GLN A  49      85.149  31.655  -4.631  1.00  0.88           O  
ATOM   1284  CB  GLN A  49      82.357  31.966  -3.023  1.00  0.88           C  
ATOM   1285  CG  GLN A  49      81.189  32.954  -3.188  1.00  0.88           C  
ATOM   1286  CD  GLN A  49      80.795  33.626  -1.880  1.00  0.88           C  
ATOM   1287  OE1 GLN A  49      81.019  33.112  -0.787  1.00  0.88           O  
ATOM   1288  NE2 GLN A  49      80.157  34.817  -1.982  1.00  0.88           N  
ATOM   1289  N   LEU A  50      84.404  29.638  -4.012  1.00  0.92           N  
ATOM   1290  CA  LEU A  50      85.720  29.024  -4.087  1.00  0.92           C  
ATOM   1291  C   LEU A  50      86.310  29.077  -5.491  1.00  0.92           C  
ATOM   1292  O   LEU A  50      87.427  29.539  -5.692  1.00  0.92           O  
ATOM   1293  CB  LEU A  50      85.633  27.551  -3.620  1.00  0.92           C  
ATOM   1294  CG  LEU A  50      86.930  26.722  -3.742  1.00  0.92           C  
ATOM   1295  CD1 LEU A  50      88.088  27.326  -2.935  1.00  0.92           C  
ATOM   1296  CD2 LEU A  50      86.674  25.264  -3.333  1.00  0.92           C  
ATOM   1297  N   CYS A  51      85.528  28.681  -6.509  1.00  0.93           N  
ATOM   1298  CA  CYS A  51      85.918  28.735  -7.905  1.00  0.93           C  
ATOM   1299  C   CYS A  51      86.159  30.149  -8.436  1.00  0.93           C  
ATOM   1300  O   CYS A  51      87.106  30.396  -9.178  1.00  0.93           O  
ATOM   1301  CB  CYS A  51      84.875  27.985  -8.754  1.00  0.93           C  
ATOM   1302  SG  CYS A  51      84.827  26.202  -8.390  1.00  0.93           S  
ATOM   1303  N   GLN A  52      85.346  31.141  -8.015  1.00  0.87           N  
ATOM   1304  CA  GLN A  52      85.588  32.551  -8.292  1.00  0.87           C  
ATOM   1305  C   GLN A  52      86.916  33.069  -7.750  1.00  0.87           C  
ATOM   1306  O   GLN A  52      87.596  33.857  -8.401  1.00  0.87           O  
ATOM   1307  CB  GLN A  52      84.460  33.434  -7.706  1.00  0.87           C  
ATOM   1308  CG  GLN A  52      83.127  33.380  -8.484  1.00  0.87           C  
ATOM   1309  CD  GLN A  52      82.032  34.200  -7.790  1.00  0.87           C  
ATOM   1310  OE1 GLN A  52      81.996  34.371  -6.568  1.00  0.87           O  
ATOM   1311  NE2 GLN A  52      81.097  34.745  -8.601  1.00  0.87           N  
ATOM   1312  N   TYR A  53      87.319  32.645  -6.538  1.00  0.90           N  
ATOM   1313  CA  TYR A  53      88.653  32.887  -6.029  1.00  0.90           C  
ATOM   1314  C   TYR A  53      89.745  32.110  -6.770  1.00  0.90           C  
ATOM   1315  O   TYR A  53      90.788  32.657  -7.098  1.00  0.90           O  
ATOM   1316  CB  TYR A  53      88.672  32.615  -4.514  1.00  0.90           C  
ATOM   1317  CG  TYR A  53      90.009  32.927  -3.922  1.00  0.90           C  
ATOM   1318  CD1 TYR A  53      90.446  34.254  -3.808  1.00  0.90           C  
ATOM   1319  CD2 TYR A  53      90.865  31.884  -3.544  1.00  0.90           C  
ATOM   1320  CE1 TYR A  53      91.718  34.535  -3.299  1.00  0.90           C  
ATOM   1321  CE2 TYR A  53      92.139  32.164  -3.040  1.00  0.90           C  
ATOM   1322  CZ  TYR A  53      92.554  33.491  -2.913  1.00  0.90           C  
ATOM   1323  OH  TYR A  53      93.822  33.783  -2.405  1.00  0.90           O  
ATOM   1324  N   LEU A  54      89.548  30.821  -7.096  1.00  0.90           N  
ATOM   1325  CA  LEU A  54      90.549  30.045  -7.820  1.00  0.90           C  
ATOM   1326  C   LEU A  54      90.893  30.581  -9.212  1.00  0.90           C  
ATOM   1327  O   LEU A  54      92.015  30.419  -9.685  1.00  0.90           O  
ATOM   1328  CB  LEU A  54      90.138  28.565  -7.941  1.00  0.90           C  
ATOM   1329  CG  LEU A  54      90.089  27.769  -6.621  1.00  0.90           C  
ATOM   1330  CD1 LEU A  54      89.490  26.379  -6.878  1.00  0.90           C  
ATOM   1331  CD2 LEU A  54      91.459  27.654  -5.936  1.00  0.90           C  
ATOM   1332  N   ASN A  55      89.943  31.280  -9.868  1.00  0.85           N  
ATOM   1333  CA  ASN A  55      90.153  32.050 -11.087  1.00  0.85           C  
ATOM   1334  C   ASN A  55      91.205  33.154 -10.984  1.00  0.85           C  
ATOM   1335  O   ASN A  55      91.761  33.573 -11.996  1.00  0.85           O  
ATOM   1336  CB  ASN A  55      88.845  32.754 -11.528  1.00  0.85           C  
ATOM   1337  CG  ASN A  55      87.864  31.769 -12.143  1.00  0.85           C  
ATOM   1338  OD1 ASN A  55      88.234  30.697 -12.617  1.00  0.85           O  
ATOM   1339  ND2 ASN A  55      86.573  32.174 -12.211  1.00  0.85           N  
ATOM   1340  N   THR A  56      91.492  33.674  -9.770  1.00  0.86           N  
ATOM   1341  CA  THR A  56      92.435  34.773  -9.582  1.00  0.86           C  
ATOM   1342  C   THR A  56      93.851  34.261  -9.411  1.00  0.86           C  
ATOM   1343  O   THR A  56      94.810  35.031  -9.388  1.00  0.86           O  
ATOM   1344  CB  THR A  56      92.102  35.690  -8.394  1.00  0.86           C  
ATOM   1345  OG1 THR A  56      92.286  35.078  -7.127  1.00  0.86           O  
ATOM   1346  CG2 THR A  56      90.626  36.104  -8.450  1.00  0.86           C  
ATOM   1347  N   LEU A  57      94.012  32.928  -9.309  1.00  0.86           N  
ATOM   1348  CA  LEU A  57      95.276  32.286  -9.038  1.00  0.86           C  
ATOM   1349  C   LEU A  57      95.913  31.732 -10.291  1.00  0.86           C  
ATOM   1350  O   LEU A  57      95.305  31.572 -11.347  1.00  0.86           O  
ATOM   1351  CB  LEU A  57      95.140  31.138  -8.009  1.00  0.86           C  
ATOM   1352  CG  LEU A  57      94.455  31.530  -6.686  1.00  0.86           C  
ATOM   1353  CD1 LEU A  57      94.399  30.310  -5.758  1.00  0.86           C  
ATOM   1354  CD2 LEU A  57      95.128  32.717  -5.980  1.00  0.86           C  
ATOM   1355  N   THR A  58      97.207  31.384 -10.202  1.00  0.89           N  
ATOM   1356  CA  THR A  58      97.989  30.887 -11.314  1.00  0.89           C  
ATOM   1357  C   THR A  58      97.797  29.399 -11.537  1.00  0.89           C  
ATOM   1358  O   THR A  58      98.743  28.647 -11.755  1.00  0.89           O  
ATOM   1359  CB  THR A  58      99.471  31.200 -11.126  1.00  0.89           C  
ATOM   1360  OG1 THR A  58      99.920  30.818  -9.836  1.00  0.89           O  
ATOM   1361  CG2 THR A  58      99.661  32.724 -11.209  1.00  0.89           C  
ATOM   1362  N   LEU A  59      96.535  28.909 -11.543  1.00  0.90           N  
ATOM   1363  CA  LEU A  59      96.236  27.516 -11.822  1.00  0.90           C  
ATOM   1364  C   LEU A  59      96.727  27.082 -13.192  1.00  0.90           C  
ATOM   1365  O   LEU A  59      96.583  27.779 -14.200  1.00  0.90           O  
ATOM   1366  CB  LEU A  59      94.729  27.154 -11.719  1.00  0.90           C  
ATOM   1367  CG  LEU A  59      94.069  27.273 -10.329  1.00  0.90           C  
ATOM   1368  CD1 LEU A  59      92.704  26.574 -10.364  1.00  0.90           C  
ATOM   1369  CD2 LEU A  59      94.903  26.648  -9.209  1.00  0.90           C  
ATOM   1370  N   ALA A  60      97.341  25.892 -13.258  1.00  0.92           N  
ATOM   1371  CA  ALA A  60      97.615  25.238 -14.505  1.00  0.92           C  
ATOM   1372  C   ALA A  60      96.333  24.620 -15.044  1.00  0.92           C  
ATOM   1373  O   ALA A  60      95.619  23.921 -14.332  1.00  0.92           O  
ATOM   1374  CB  ALA A  60      98.687  24.167 -14.295  1.00  0.92           C  
ATOM   1375  N   VAL A  61      95.996  24.895 -16.316  1.00  0.95           N  
ATOM   1376  CA  VAL A  61      94.777  24.416 -16.937  1.00  0.95           C  
ATOM   1377  C   VAL A  61      95.182  23.779 -18.262  1.00  0.95           C  
ATOM   1378  O   VAL A  61      95.092  24.428 -19.310  1.00  0.95           O  
ATOM   1379  CB  VAL A  61      93.785  25.552 -17.167  1.00  0.95           C  
ATOM   1380  CG1 VAL A  61      92.443  24.989 -17.665  1.00  0.95           C  
ATOM   1381  CG2 VAL A  61      93.558  26.323 -15.853  1.00  0.95           C  
ATOM   1382  N   PRO A  62      95.711  22.555 -18.289  1.00  0.93           N  
ATOM   1383  CA  PRO A  62      96.016  21.864 -19.533  1.00  0.93           C  
ATOM   1384  C   PRO A  62      94.773  21.478 -20.316  1.00  0.93           C  
ATOM   1385  O   PRO A  62      93.667  21.454 -19.778  1.00  0.93           O  
ATOM   1386  CB  PRO A  62      96.840  20.652 -19.076  1.00  0.93           C  
ATOM   1387  CG  PRO A  62      96.368  20.342 -17.656  1.00  0.93           C  
ATOM   1388  CD  PRO A  62      95.947  21.707 -17.111  1.00  0.93           C  
ATOM   1389  N   TYR A  63      94.922  21.171 -21.622  1.00  0.88           N  
ATOM   1390  CA  TYR A  63      93.938  20.383 -22.351  1.00  0.88           C  
ATOM   1391  C   TYR A  63      93.937  18.976 -21.777  1.00  0.88           C  
ATOM   1392  O   TYR A  63      94.998  18.463 -21.430  1.00  0.88           O  
ATOM   1393  CB  TYR A  63      94.258  20.246 -23.858  1.00  0.88           C  
ATOM   1394  CG  TYR A  63      94.523  21.566 -24.511  1.00  0.88           C  
ATOM   1395  CD1 TYR A  63      93.468  22.436 -24.808  1.00  0.88           C  
ATOM   1396  CD2 TYR A  63      95.830  21.933 -24.872  1.00  0.88           C  
ATOM   1397  CE1 TYR A  63      93.709  23.649 -25.466  1.00  0.88           C  
ATOM   1398  CE2 TYR A  63      96.074  23.145 -25.533  1.00  0.88           C  
ATOM   1399  CZ  TYR A  63      95.008  23.998 -25.837  1.00  0.88           C  
ATOM   1400  OH  TYR A  63      95.232  25.212 -26.510  1.00  0.88           O  
ATOM   1401  N   ASN A  64      92.765  18.323 -21.656  1.00  0.90           N  
ATOM   1402  CA  ASN A  64      92.636  17.021 -21.007  1.00  0.90           C  
ATOM   1403  C   ASN A  64      93.006  17.054 -19.524  1.00  0.90           C  
ATOM   1404  O   ASN A  64      93.649  16.145 -18.994  1.00  0.90           O  
ATOM   1405  CB  ASN A  64      93.432  15.890 -21.710  1.00  0.90           C  
ATOM   1406  CG  ASN A  64      93.136  15.886 -23.200  1.00  0.90           C  
ATOM   1407  OD1 ASN A  64      91.987  15.920 -23.630  1.00  0.90           O  
ATOM   1408  ND2 ASN A  64      94.205  15.843 -24.032  1.00  0.90           N  
ATOM   1409  N   MET A  65      92.599  18.137 -18.832  1.00  0.93           N  
ATOM   1410  CA  MET A  65      92.823  18.355 -17.417  1.00  0.93           C  
ATOM   1411  C   MET A  65      92.170  17.291 -16.563  1.00  0.93           C  
ATOM   1412  O   MET A  65      91.093  16.788 -16.877  1.00  0.93           O  
ATOM   1413  CB  MET A  65      92.310  19.768 -17.037  1.00  0.93           C  
ATOM   1414  CG  MET A  65      92.546  20.259 -15.593  1.00  0.93           C  
ATOM   1415  SD  MET A  65      91.861  21.924 -15.303  1.00  0.93           S  
ATOM   1416  CE  MET A  65      92.447  22.127 -13.596  1.00  0.93           C  
ATOM   1417  N   ARG A  66      92.825  16.895 -15.464  1.00  0.91           N  
ATOM   1418  CA  ARG A  66      92.317  15.854 -14.607  1.00  0.91           C  
ATOM   1419  C   ARG A  66      92.025  16.381 -13.222  1.00  0.91           C  
ATOM   1420  O   ARG A  66      92.921  16.810 -12.492  1.00  0.91           O  
ATOM   1421  CB  ARG A  66      93.378  14.756 -14.478  1.00  0.91           C  
ATOM   1422  CG  ARG A  66      93.805  14.111 -15.805  1.00  0.91           C  
ATOM   1423  CD  ARG A  66      95.010  13.231 -15.531  1.00  0.91           C  
ATOM   1424  NE  ARG A  66      95.385  12.558 -16.800  1.00  0.91           N  
ATOM   1425  CZ  ARG A  66      96.387  11.678 -16.860  1.00  0.91           C  
ATOM   1426  NH1 ARG A  66      97.139  11.412 -15.795  1.00  0.91           N  
ATOM   1427  NH2 ARG A  66      96.629  11.046 -18.005  1.00  0.91           N  
ATOM   1428  N   VAL A  67      90.747  16.332 -12.811  1.00  1.00           N  
ATOM   1429  CA  VAL A  67      90.310  16.854 -11.533  1.00  1.00           C  
ATOM   1430  C   VAL A  67      89.678  15.744 -10.716  1.00  1.00           C  
ATOM   1431  O   VAL A  67      88.849  14.979 -11.208  1.00  1.00           O  
ATOM   1432  CB  VAL A  67      89.317  17.992 -11.718  1.00  1.00           C  
ATOM   1433  CG1 VAL A  67      88.929  18.598 -10.355  1.00  1.00           C  
ATOM   1434  CG2 VAL A  67      89.953  19.058 -12.630  1.00  1.00           C  
ATOM   1435  N   ILE A  68      90.066  15.619  -9.431  1.00  0.99           N  
ATOM   1436  CA  ILE A  68      89.455  14.662  -8.523  1.00  0.99           C  
ATOM   1437  C   ILE A  68      88.844  15.389  -7.347  1.00  0.99           C  
ATOM   1438  O   ILE A  68      89.432  16.297  -6.761  1.00  0.99           O  
ATOM   1439  CB  ILE A  68      90.385  13.530  -8.093  1.00  0.99           C  
ATOM   1440  CG1 ILE A  68      89.639  12.431  -7.294  1.00  0.99           C  
ATOM   1441  CG2 ILE A  68      91.626  14.079  -7.359  1.00  0.99           C  
ATOM   1442  CD1 ILE A  68      90.415  11.112  -7.221  1.00  0.99           C  
ATOM   1443  N   HIS A  69      87.592  15.034  -7.007  1.00  0.97           N  
ATOM   1444  CA  HIS A  69      86.835  15.719  -5.985  1.00  0.97           C  
ATOM   1445  C   HIS A  69      86.400  14.767  -4.872  1.00  0.97           C  
ATOM   1446  O   HIS A  69      85.564  13.890  -5.052  1.00  0.97           O  
ATOM   1447  CB  HIS A  69      85.638  16.403  -6.658  1.00  0.97           C  
ATOM   1448  CG  HIS A  69      84.798  17.209  -5.756  1.00  0.97           C  
ATOM   1449  ND1 HIS A  69      83.496  17.393  -6.159  1.00  0.97           N  
ATOM   1450  CD2 HIS A  69      84.959  17.589  -4.468  1.00  0.97           C  
ATOM   1451  CE1 HIS A  69      82.872  17.859  -5.108  1.00  0.97           C  
ATOM   1452  NE2 HIS A  69      83.712  17.997  -4.052  1.00  0.97           N  
ATOM   1453  N   PHE A  70      86.970  14.920  -3.662  1.00  0.98           N  
ATOM   1454  CA  PHE A  70      86.677  14.078  -2.514  1.00  0.98           C  
ATOM   1455  C   PHE A  70      85.661  14.740  -1.596  1.00  0.98           C  
ATOM   1456  O   PHE A  70      85.681  15.952  -1.389  1.00  0.98           O  
ATOM   1457  CB  PHE A  70      87.945  13.799  -1.672  1.00  0.98           C  
ATOM   1458  CG  PHE A  70      88.967  12.993  -2.417  1.00  0.98           C  
ATOM   1459  CD1 PHE A  70      88.853  11.595  -2.477  1.00  0.98           C  
ATOM   1460  CD2 PHE A  70      90.083  13.609  -3.007  1.00  0.98           C  
ATOM   1461  CE1 PHE A  70      89.832  10.826  -3.119  1.00  0.98           C  
ATOM   1462  CE2 PHE A  70      91.066  12.841  -3.644  1.00  0.98           C  
ATOM   1463  CZ  PHE A  70      90.939  11.450  -3.704  1.00  0.98           C  
ATOM   1464  N   GLY A  71      84.736  13.955  -1.000  1.00  1.00           N  
ATOM   1465  CA  GLY A  71      83.683  14.503  -0.145  1.00  1.00           C  
ATOM   1466  C   GLY A  71      82.626  15.187  -0.952  1.00  1.00           C  
ATOM   1467  O   GLY A  71      82.177  16.275  -0.619  1.00  1.00           O  
ATOM   1468  N   ALA A  72      82.254  14.581  -2.089  1.00  1.00           N  
ATOM   1469  CA  ALA A  72      81.370  15.214  -3.034  1.00  1.00           C  
ATOM   1470  C   ALA A  72      79.907  14.866  -2.827  1.00  1.00           C  
ATOM   1471  O   ALA A  72      79.024  15.449  -3.458  1.00  1.00           O  
ATOM   1472  CB  ALA A  72      81.793  14.750  -4.430  1.00  1.00           C  
ATOM   1473  N   GLY A  73      79.620  13.915  -1.917  1.00  0.98           N  
ATOM   1474  CA  GLY A  73      78.269  13.487  -1.611  1.00  0.98           C  
ATOM   1475  C   GLY A  73      77.606  14.401  -0.629  1.00  0.98           C  
ATOM   1476  O   GLY A  73      78.157  15.391  -0.158  1.00  0.98           O  
ATOM   1477  N   SER A  74      76.362  14.078  -0.264  1.00  0.93           N  
ATOM   1478  CA  SER A  74      75.655  14.848   0.731  1.00  0.93           C  
ATOM   1479  C   SER A  74      74.541  13.990   1.262  1.00  0.93           C  
ATOM   1480  O   SER A  74      74.237  12.936   0.706  1.00  0.93           O  
ATOM   1481  CB  SER A  74      75.097  16.204   0.203  1.00  0.93           C  
ATOM   1482  OG  SER A  74      74.004  16.057  -0.704  1.00  0.93           O  
ATOM   1483  N   ASP A  75      73.867  14.433   2.338  1.00  0.88           N  
ATOM   1484  CA  ASP A  75      72.682  13.799   2.878  1.00  0.88           C  
ATOM   1485  C   ASP A  75      71.464  13.916   1.954  1.00  0.88           C  
ATOM   1486  O   ASP A  75      70.495  13.170   2.062  1.00  0.88           O  
ATOM   1487  CB  ASP A  75      72.395  14.381   4.291  1.00  0.88           C  
ATOM   1488  CG  ASP A  75      72.239  15.901   4.345  1.00  0.88           C  
ATOM   1489  OD1 ASP A  75      72.395  16.587   3.295  1.00  0.88           O  
ATOM   1490  OD2 ASP A  75      71.988  16.398   5.469  1.00  0.88           O  
ATOM   1491  N   LYS A  76      71.529  14.830   0.965  1.00  0.86           N  
ATOM   1492  CA  LYS A  76      70.532  14.998  -0.068  1.00  0.86           C  
ATOM   1493  C   LYS A  76      70.606  13.936  -1.159  1.00  0.86           C  
ATOM   1494  O   LYS A  76      69.678  13.790  -1.955  1.00  0.86           O  
ATOM   1495  CB  LYS A  76      70.708  16.361  -0.781  1.00  0.86           C  
ATOM   1496  CG  LYS A  76      70.724  17.588   0.139  1.00  0.86           C  
ATOM   1497  CD  LYS A  76      70.994  18.873  -0.664  1.00  0.86           C  
ATOM   1498  CE  LYS A  76      71.221  20.117   0.193  1.00  0.86           C  
ATOM   1499  NZ  LYS A  76      70.023  20.353   1.019  1.00  0.86           N  
ATOM   1500  N   GLY A  77      71.730  13.188  -1.247  1.00  0.87           N  
ATOM   1501  CA  GLY A  77      71.923  12.159  -2.265  1.00  0.87           C  
ATOM   1502  C   GLY A  77      72.346  12.671  -3.619  1.00  0.87           C  
ATOM   1503  O   GLY A  77      72.316  11.940  -4.603  1.00  0.87           O  
ATOM   1504  N   VAL A  78      72.748  13.949  -3.706  1.00  0.85           N  
ATOM   1505  CA  VAL A  78      73.152  14.616  -4.936  1.00  0.85           C  
ATOM   1506  C   VAL A  78      74.482  15.283  -4.677  1.00  0.85           C  
ATOM   1507  O   VAL A  78      74.940  15.336  -3.540  1.00  0.85           O  
ATOM   1508  CB  VAL A  78      72.146  15.650  -5.460  1.00  0.85           C  
ATOM   1509  CG1 VAL A  78      70.858  14.924  -5.887  1.00  0.85           C  
ATOM   1510  CG2 VAL A  78      71.836  16.739  -4.414  1.00  0.85           C  
ATOM   1511  N   ALA A  79      75.144  15.821  -5.721  1.00  0.89           N  
ATOM   1512  CA  ALA A  79      76.458  16.418  -5.588  1.00  0.89           C  
ATOM   1513  C   ALA A  79      76.481  17.885  -6.025  1.00  0.89           C  
ATOM   1514  O   ALA A  79      76.850  18.186  -7.163  1.00  0.89           O  
ATOM   1515  CB  ALA A  79      77.451  15.602  -6.423  1.00  0.89           C  
ATOM   1516  N   PRO A  80      76.111  18.856  -5.179  1.00  0.90           N  
ATOM   1517  CA  PRO A  80      76.062  20.268  -5.552  1.00  0.90           C  
ATOM   1518  C   PRO A  80      77.399  20.842  -5.944  1.00  0.90           C  
ATOM   1519  O   PRO A  80      77.476  21.605  -6.903  1.00  0.90           O  
ATOM   1520  CB  PRO A  80      75.527  20.988  -4.302  1.00  0.90           C  
ATOM   1521  CG  PRO A  80      74.823  19.899  -3.495  1.00  0.90           C  
ATOM   1522  CD  PRO A  80      75.606  18.633  -3.827  1.00  0.90           C  
ATOM   1523  N   GLY A  81      78.467  20.481  -5.207  1.00  0.95           N  
ATOM   1524  CA  GLY A  81      79.813  20.960  -5.473  1.00  0.95           C  
ATOM   1525  C   GLY A  81      80.402  20.440  -6.756  1.00  0.95           C  
ATOM   1526  O   GLY A  81      81.048  21.179  -7.488  1.00  0.95           O  
ATOM   1527  N   THR A  82      80.127  19.163  -7.097  1.00  0.94           N  
ATOM   1528  CA  THR A  82      80.497  18.550  -8.378  1.00  0.94           C  
ATOM   1529  C   THR A  82      79.856  19.239  -9.554  1.00  0.94           C  
ATOM   1530  O   THR A  82      80.503  19.521 -10.562  1.00  0.94           O  
ATOM   1531  CB  THR A  82      80.100  17.088  -8.467  1.00  0.94           C  
ATOM   1532  OG1 THR A  82      80.795  16.378  -7.468  1.00  0.94           O  
ATOM   1533  CG2 THR A  82      80.472  16.449  -9.810  1.00  0.94           C  
ATOM   1534  N   ALA A  83      78.554  19.578  -9.440  1.00  0.94           N  
ATOM   1535  CA  ALA A  83      77.839  20.338 -10.446  1.00  0.94           C  
ATOM   1536  C   ALA A  83      78.429  21.731 -10.684  1.00  0.94           C  
ATOM   1537  O   ALA A  83      78.533  22.189 -11.818  1.00  0.94           O  
ATOM   1538  CB  ALA A  83      76.345  20.434 -10.086  1.00  0.94           C  
ATOM   1539  N   VAL A  84      78.863  22.440  -9.621  1.00  0.94           N  
ATOM   1540  CA  VAL A  84      79.603  23.693  -9.757  1.00  0.94           C  
ATOM   1541  C   VAL A  84      80.970  23.518 -10.401  1.00  0.94           C  
ATOM   1542  O   VAL A  84      81.362  24.280 -11.284  1.00  0.94           O  
ATOM   1543  CB  VAL A  84      79.780  24.403  -8.428  1.00  0.94           C  
ATOM   1544  CG1 VAL A  84      80.593  25.699  -8.608  1.00  0.94           C  
ATOM   1545  CG2 VAL A  84      78.398  24.774  -7.872  1.00  0.94           C  
ATOM   1546  N   LEU A  85      81.743  22.486 -10.003  1.00  0.94           N  
ATOM   1547  CA  LEU A  85      83.046  22.213 -10.591  1.00  0.94           C  
ATOM   1548  C   LEU A  85      82.973  21.905 -12.072  1.00  0.94           C  
ATOM   1549  O   LEU A  85      83.754  22.421 -12.859  1.00  0.94           O  
ATOM   1550  CB  LEU A  85      83.776  21.039  -9.899  1.00  0.94           C  
ATOM   1551  CG  LEU A  85      84.224  21.304  -8.450  1.00  0.94           C  
ATOM   1552  CD1 LEU A  85      84.803  20.019  -7.850  1.00  0.94           C  
ATOM   1553  CD2 LEU A  85      85.233  22.452  -8.339  1.00  0.94           C  
ATOM   1554  N   ARG A  86      81.998  21.090 -12.502  1.00  0.86           N  
ATOM   1555  CA  ARG A  86      81.756  20.819 -13.904  1.00  0.86           C  
ATOM   1556  C   ARG A  86      81.325  22.035 -14.721  1.00  0.86           C  
ATOM   1557  O   ARG A  86      81.684  22.157 -15.885  1.00  0.86           O  
ATOM   1558  CB  ARG A  86      80.778  19.633 -14.021  1.00  0.86           C  
ATOM   1559  CG  ARG A  86      80.316  19.304 -15.456  1.00  0.86           C  
ATOM   1560  CD  ARG A  86      80.125  17.819 -15.734  1.00  0.86           C  
ATOM   1561  NE  ARG A  86      81.520  17.301 -15.687  1.00  0.86           N  
ATOM   1562  CZ  ARG A  86      81.943  16.161 -16.233  1.00  0.86           C  
ATOM   1563  NH1 ARG A  86      81.124  15.228 -16.689  1.00  0.86           N  
ATOM   1564  NH2 ARG A  86      83.249  15.942 -16.335  1.00  0.86           N  
ATOM   1565  N   GLN A  87      80.571  22.979 -14.123  1.00  0.85           N  
ATOM   1566  CA  GLN A  87      80.249  24.255 -14.738  1.00  0.85           C  
ATOM   1567  C   GLN A  87      81.465  25.154 -14.908  1.00  0.85           C  
ATOM   1568  O   GLN A  87      81.633  25.837 -15.915  1.00  0.85           O  
ATOM   1569  CB  GLN A  87      79.213  24.986 -13.847  1.00  0.85           C  
ATOM   1570  CG  GLN A  87      78.910  26.446 -14.255  1.00  0.85           C  
ATOM   1571  CD  GLN A  87      77.970  27.140 -13.271  1.00  0.85           C  
ATOM   1572  OE1 GLN A  87      77.663  26.664 -12.181  1.00  0.85           O  
ATOM   1573  NE2 GLN A  87      77.484  28.332 -13.691  1.00  0.85           N  
ATOM   1574  N   TRP A  88      82.312  25.205 -13.866  1.00  0.90           N  
ATOM   1575  CA  TRP A  88      83.515  26.004 -13.824  1.00  0.90           C  
ATOM   1576  C   TRP A  88      84.634  25.530 -14.734  1.00  0.90           C  
ATOM   1577  O   TRP A  88      85.261  26.326 -15.427  1.00  0.90           O  
ATOM   1578  CB  TRP A  88      84.031  25.977 -12.366  1.00  0.90           C  
ATOM   1579  CG  TRP A  88      85.281  26.785 -12.091  1.00  0.90           C  
ATOM   1580  CD1 TRP A  88      85.505  28.103 -12.355  1.00  0.90           C  
ATOM   1581  CD2 TRP A  88      86.500  26.274 -11.527  1.00  0.90           C  
ATOM   1582  NE1 TRP A  88      86.774  28.455 -11.968  1.00  0.90           N  
ATOM   1583  CE2 TRP A  88      87.401  27.353 -11.454  1.00  0.90           C  
ATOM   1584  CE3 TRP A  88      86.863  25.006 -11.093  1.00  0.90           C  
ATOM   1585  CZ2 TRP A  88      88.678  27.188 -10.938  1.00  0.90           C  
ATOM   1586  CZ3 TRP A  88      88.150  24.839 -10.570  1.00  0.90           C  
ATOM   1587  CH2 TRP A  88      89.044  25.913 -10.488  1.00  0.90           C  
ATOM   1588  N   LEU A  89      84.935  24.221 -14.708  1.00  0.92           N  
ATOM   1589  CA  LEU A  89      86.004  23.620 -15.477  1.00  0.92           C  
ATOM   1590  C   LEU A  89      85.736  23.688 -16.979  1.00  0.92           C  
ATOM   1591  O   LEU A  89      84.578  23.619 -17.388  1.00  0.92           O  
ATOM   1592  CB  LEU A  89      86.245  22.156 -15.030  1.00  0.92           C  
ATOM   1593  CG  LEU A  89      86.803  22.035 -13.596  1.00  0.92           C  
ATOM   1594  CD1 LEU A  89      86.576  20.627 -13.021  1.00  0.92           C  
ATOM   1595  CD2 LEU A  89      88.278  22.457 -13.508  1.00  0.92           C  
ATOM   1596  N   PRO A  90      86.723  23.825 -17.863  1.00  0.94           N  
ATOM   1597  CA  PRO A  90      86.551  23.555 -19.289  1.00  0.94           C  
ATOM   1598  C   PRO A  90      85.832  22.252 -19.607  1.00  0.94           C  
ATOM   1599  O   PRO A  90      86.065  21.251 -18.934  1.00  0.94           O  
ATOM   1600  CB  PRO A  90      87.980  23.566 -19.860  1.00  0.94           C  
ATOM   1601  CG  PRO A  90      88.806  24.352 -18.839  1.00  0.94           C  
ATOM   1602  CD  PRO A  90      88.125  24.032 -17.513  1.00  0.94           C  
ATOM   1603  N   THR A  91      84.989  22.222 -20.652  1.00  0.90           N  
ATOM   1604  CA  THR A  91      84.139  21.086 -21.008  1.00  0.90           C  
ATOM   1605  C   THR A  91      84.870  19.787 -21.293  1.00  0.90           C  
ATOM   1606  O   THR A  91      84.328  18.705 -21.107  1.00  0.90           O  
ATOM   1607  CB  THR A  91      83.263  21.381 -22.217  1.00  0.90           C  
ATOM   1608  OG1 THR A  91      84.009  21.980 -23.270  1.00  0.90           O  
ATOM   1609  CG2 THR A  91      82.184  22.391 -21.824  1.00  0.90           C  
ATOM   1610  N   GLY A  92      86.123  19.882 -21.779  1.00  0.83           N  
ATOM   1611  CA  GLY A  92      87.007  18.748 -22.031  1.00  0.83           C  
ATOM   1612  C   GLY A  92      87.754  18.199 -20.832  1.00  0.83           C  
ATOM   1613  O   GLY A  92      88.527  17.257 -20.965  1.00  0.83           O  
ATOM   1614  N   THR A  93      87.603  18.805 -19.641  1.00  0.92           N  
ATOM   1615  CA  THR A  93      88.219  18.337 -18.396  1.00  0.92           C  
ATOM   1616  C   THR A  93      87.591  17.078 -17.840  1.00  0.92           C  
ATOM   1617  O   THR A  93      86.373  16.964 -17.732  1.00  0.92           O  
ATOM   1618  CB  THR A  93      88.147  19.395 -17.308  1.00  0.92           C  
ATOM   1619  OG1 THR A  93      88.915  20.524 -17.691  1.00  0.92           O  
ATOM   1620  CG2 THR A  93      88.712  18.957 -15.951  1.00  0.92           C  
ATOM   1621  N   LEU A  94      88.427  16.115 -17.394  1.00  0.94           N  
ATOM   1622  CA  LEU A  94      87.962  14.898 -16.764  1.00  0.94           C  
ATOM   1623  C   LEU A  94      87.750  15.123 -15.282  1.00  0.94           C  
ATOM   1624  O   LEU A  94      88.644  15.580 -14.567  1.00  0.94           O  
ATOM   1625  CB  LEU A  94      88.954  13.725 -16.939  1.00  0.94           C  
ATOM   1626  CG  LEU A  94      89.236  13.335 -18.402  1.00  0.94           C  
ATOM   1627  CD1 LEU A  94      90.245  12.179 -18.460  1.00  0.94           C  
ATOM   1628  CD2 LEU A  94      87.955  12.966 -19.166  1.00  0.94           C  
ATOM   1629  N   LEU A  95      86.545  14.803 -14.786  1.00  0.96           N  
ATOM   1630  CA  LEU A  95      86.176  15.031 -13.405  1.00  0.96           C  
ATOM   1631  C   LEU A  95      85.720  13.741 -12.765  1.00  0.96           C  
ATOM   1632  O   LEU A  95      84.761  13.107 -13.199  1.00  0.96           O  
ATOM   1633  CB  LEU A  95      85.052  16.089 -13.326  1.00  0.96           C  
ATOM   1634  CG  LEU A  95      84.548  16.486 -11.923  1.00  0.96           C  
ATOM   1635  CD1 LEU A  95      85.656  17.008 -10.998  1.00  0.96           C  
ATOM   1636  CD2 LEU A  95      83.436  17.536 -12.063  1.00  0.96           C  
ATOM   1637  N   VAL A  96      86.411  13.326 -11.691  1.00  0.98           N  
ATOM   1638  CA  VAL A  96      86.076  12.137 -10.930  1.00  0.98           C  
ATOM   1639  C   VAL A  96      85.726  12.580  -9.534  1.00  0.98           C  
ATOM   1640  O   VAL A  96      86.421  13.416  -8.960  1.00  0.98           O  
ATOM   1641  CB  VAL A  96      87.240  11.151 -10.886  1.00  0.98           C  
ATOM   1642  CG1 VAL A  96      87.003   9.998  -9.888  1.00  0.98           C  
ATOM   1643  CG2 VAL A  96      87.426  10.587 -12.304  1.00  0.98           C  
ATOM   1644  N   ASP A  97      84.648  12.046  -8.933  1.00  0.97           N  
ATOM   1645  CA  ASP A  97      84.311  12.392  -7.573  1.00  0.97           C  
ATOM   1646  C   ASP A  97      84.154  11.176  -6.680  1.00  0.97           C  
ATOM   1647  O   ASP A  97      84.205  10.026  -7.119  1.00  0.97           O  
ATOM   1648  CB  ASP A  97      83.165  13.436  -7.500  1.00  0.97           C  
ATOM   1649  CG  ASP A  97      81.788  12.958  -7.917  1.00  0.97           C  
ATOM   1650  OD1 ASP A  97      81.584  11.760  -8.223  1.00  0.97           O  
ATOM   1651  OD2 ASP A  97      80.873  13.821  -7.947  1.00  0.97           O  
ATOM   1652  N   SER A  98      84.089  11.411  -5.356  1.00  0.98           N  
ATOM   1653  CA  SER A  98      84.094  10.329  -4.393  1.00  0.98           C  
ATOM   1654  C   SER A  98      83.478  10.745  -3.083  1.00  0.98           C  
ATOM   1655  O   SER A  98      83.581  11.902  -2.673  1.00  0.98           O  
ATOM   1656  CB  SER A  98      85.541   9.825  -4.132  1.00  0.98           C  
ATOM   1657  OG  SER A  98      85.603   8.733  -3.212  1.00  0.98           O  
ATOM   1658  N   ASP A  99      82.854   9.782  -2.381  1.00  0.95           N  
ATOM   1659  CA  ASP A  99      82.304   9.986  -1.065  1.00  0.95           C  
ATOM   1660  C   ASP A  99      82.170   8.635  -0.389  1.00  0.95           C  
ATOM   1661  O   ASP A  99      82.179   7.591  -1.034  1.00  0.95           O  
ATOM   1662  CB  ASP A  99      80.940  10.716  -1.110  1.00  0.95           C  
ATOM   1663  CG  ASP A  99      80.605  11.318   0.240  1.00  0.95           C  
ATOM   1664  OD1 ASP A  99      80.036  10.600   1.105  1.00  0.95           O  
ATOM   1665  OD2 ASP A  99      80.980  12.500   0.432  1.00  0.95           O  
ATOM   1666  N   LEU A 100      82.032   8.646   0.948  1.00  0.90           N  
ATOM   1667  CA  LEU A 100      81.758   7.501   1.786  1.00  0.90           C  
ATOM   1668  C   LEU A 100      80.404   6.878   1.493  1.00  0.90           C  
ATOM   1669  O   LEU A 100      80.259   5.657   1.472  1.00  0.90           O  
ATOM   1670  CB  LEU A 100      81.862   7.946   3.262  1.00  0.90           C  
ATOM   1671  CG  LEU A 100      81.574   6.872   4.330  1.00  0.90           C  
ATOM   1672  CD1 LEU A 100      82.539   5.679   4.240  1.00  0.90           C  
ATOM   1673  CD2 LEU A 100      81.623   7.502   5.730  1.00  0.90           C  
ATOM   1674  N   ASN A 101      79.383   7.721   1.242  1.00  0.88           N  
ATOM   1675  CA  ASN A 101      78.013   7.283   1.064  1.00  0.88           C  
ATOM   1676  C   ASN A 101      77.618   7.428  -0.395  1.00  0.88           C  
ATOM   1677  O   ASN A 101      78.171   8.255  -1.104  1.00  0.88           O  
ATOM   1678  CB  ASN A 101      77.051   8.144   1.912  1.00  0.88           C  
ATOM   1679  CG  ASN A 101      77.476   8.070   3.372  1.00  0.88           C  
ATOM   1680  OD1 ASN A 101      77.589   6.995   3.958  1.00  0.88           O  
ATOM   1681  ND2 ASN A 101      77.709   9.246   4.002  1.00  0.88           N  
ATOM   1682  N   ASP A 102      76.662   6.614  -0.894  1.00  0.90           N  
ATOM   1683  CA  ASP A 102      76.153   6.712  -2.254  1.00  0.90           C  
ATOM   1684  C   ASP A 102      75.463   8.039  -2.606  1.00  0.90           C  
ATOM   1685  O   ASP A 102      74.811   8.677  -1.777  1.00  0.90           O  
ATOM   1686  CB  ASP A 102      75.259   5.488  -2.564  1.00  0.90           C  
ATOM   1687  CG  ASP A 102      75.056   5.296  -4.061  1.00  0.90           C  
ATOM   1688  OD1 ASP A 102      75.840   5.884  -4.850  1.00  0.90           O  
ATOM   1689  OD2 ASP A 102      74.108   4.559  -4.414  1.00  0.90           O  
ATOM   1690  N   PHE A 103      75.611   8.481  -3.869  1.00  0.91           N  
ATOM   1691  CA  PHE A 103      75.089   9.749  -4.326  1.00  0.91           C  
ATOM   1692  C   PHE A 103      75.018   9.832  -5.837  1.00  0.91           C  
ATOM   1693  O   PHE A 103      75.738   9.169  -6.576  1.00  0.91           O  
ATOM   1694  CB  PHE A 103      75.847  10.986  -3.751  1.00  0.91           C  
ATOM   1695  CG  PHE A 103      77.265  11.112  -4.247  1.00  0.91           C  
ATOM   1696  CD1 PHE A 103      78.280  10.283  -3.758  1.00  0.91           C  
ATOM   1697  CD2 PHE A 103      77.600  12.078  -5.206  1.00  0.91           C  
ATOM   1698  CE1 PHE A 103      79.595  10.404  -4.215  1.00  0.91           C  
ATOM   1699  CE2 PHE A 103      78.927  12.240  -5.625  1.00  0.91           C  
ATOM   1700  CZ  PHE A 103      79.923  11.394  -5.140  1.00  0.91           C  
ATOM   1701  N   VAL A 104      74.130  10.701  -6.346  1.00  0.92           N  
ATOM   1702  CA  VAL A 104      73.953  10.914  -7.766  1.00  0.92           C  
ATOM   1703  C   VAL A 104      74.798  12.102  -8.197  1.00  0.92           C  
ATOM   1704  O   VAL A 104      74.755  13.175  -7.598  1.00  0.92           O  
ATOM   1705  CB  VAL A 104      72.484  11.140  -8.079  1.00  0.92           C  
ATOM   1706  CG1 VAL A 104      72.269  11.534  -9.547  1.00  0.92           C  
ATOM   1707  CG2 VAL A 104      71.707   9.853  -7.754  1.00  0.92           C  
ATOM   1708  N   SER A 105      75.603  11.934  -9.265  1.00  0.93           N  
ATOM   1709  CA  SER A 105      76.600  12.917  -9.647  1.00  0.93           C  
ATOM   1710  C   SER A 105      76.631  13.179 -11.144  1.00  0.93           C  
ATOM   1711  O   SER A 105      76.224  12.338 -11.950  1.00  0.93           O  
ATOM   1712  CB  SER A 105      77.985  12.428  -9.167  1.00  0.93           C  
ATOM   1713  OG  SER A 105      79.057  13.212  -9.670  1.00  0.93           O  
ATOM   1714  N   ASP A 106      77.147  14.371 -11.525  1.00  0.91           N  
ATOM   1715  CA  ASP A 106      77.404  14.815 -12.877  1.00  0.91           C  
ATOM   1716  C   ASP A 106      78.865  14.610 -13.279  1.00  0.91           C  
ATOM   1717  O   ASP A 106      79.258  14.913 -14.404  1.00  0.91           O  
ATOM   1718  CB  ASP A 106      77.048  16.316 -12.998  1.00  0.91           C  
ATOM   1719  CG  ASP A 106      75.537  16.457 -12.976  1.00  0.91           C  
ATOM   1720  OD1 ASP A 106      74.895  15.846 -13.875  1.00  0.91           O  
ATOM   1721  OD2 ASP A 106      75.001  17.143 -12.072  1.00  0.91           O  
ATOM   1722  N   ALA A 107      79.709  14.062 -12.382  1.00  0.96           N  
ATOM   1723  CA  ALA A 107      81.062  13.637 -12.687  1.00  0.96           C  
ATOM   1724  C   ALA A 107      81.119  12.523 -13.724  1.00  0.96           C  
ATOM   1725  O   ALA A 107      80.157  11.769 -13.911  1.00  0.96           O  
ATOM   1726  CB  ALA A 107      81.808  13.208 -11.409  1.00  0.96           C  
ATOM   1727  N   ASP A 108      82.258  12.412 -14.441  1.00  0.92           N  
ATOM   1728  CA  ASP A 108      82.513  11.373 -15.427  1.00  0.92           C  
ATOM   1729  C   ASP A 108      82.513  10.001 -14.789  1.00  0.92           C  
ATOM   1730  O   ASP A 108      81.942   9.047 -15.310  1.00  0.92           O  
ATOM   1731  CB  ASP A 108      83.863  11.612 -16.137  1.00  0.92           C  
ATOM   1732  CG  ASP A 108      83.819  12.970 -16.784  1.00  0.92           C  
ATOM   1733  OD1 ASP A 108      82.759  13.326 -17.360  1.00  0.92           O  
ATOM   1734  OD2 ASP A 108      84.801  13.741 -16.645  1.00  0.92           O  
ATOM   1735  N   SER A 109      83.109   9.919 -13.584  1.00  0.95           N  
ATOM   1736  CA  SER A 109      83.129   8.695 -12.813  1.00  0.95           C  
ATOM   1737  C   SER A 109      83.022   9.022 -11.350  1.00  0.95           C  
ATOM   1738  O   SER A 109      83.551  10.023 -10.876  1.00  0.95           O  
ATOM   1739  CB  SER A 109      84.411   7.843 -12.972  1.00  0.95           C  
ATOM   1740  OG  SER A 109      84.569   7.384 -14.312  1.00  0.95           O  
ATOM   1741  N   THR A 110      82.310   8.159 -10.595  1.00  0.95           N  
ATOM   1742  CA  THR A 110      81.962   8.379  -9.197  1.00  0.95           C  
ATOM   1743  C   THR A 110      82.406   7.171  -8.409  1.00  0.95           C  
ATOM   1744  O   THR A 110      82.084   6.044  -8.776  1.00  0.95           O  
ATOM   1745  CB  THR A 110      80.434   8.442  -8.943  1.00  0.95           C  
ATOM   1746  OG1 THR A 110      79.720   9.441  -9.628  1.00  0.95           O  
ATOM   1747  CG2 THR A 110      80.154   8.776  -7.481  1.00  0.95           C  
ATOM   1748  N   LEU A 111      83.158   7.339  -7.306  1.00  0.96           N  
ATOM   1749  CA  LEU A 111      83.605   6.227  -6.469  1.00  0.96           C  
ATOM   1750  C   LEU A 111      82.977   6.292  -5.090  1.00  0.96           C  
ATOM   1751  O   LEU A 111      82.977   7.330  -4.439  1.00  0.96           O  
ATOM   1752  CB  LEU A 111      85.141   6.230  -6.294  1.00  0.96           C  
ATOM   1753  CG  LEU A 111      85.916   6.122  -7.617  1.00  0.96           C  
ATOM   1754  CD1 LEU A 111      87.410   6.298  -7.367  1.00  0.96           C  
ATOM   1755  CD2 LEU A 111      85.680   4.803  -8.368  1.00  0.96           C  
ATOM   1756  N   ILE A 112      82.419   5.170  -4.600  1.00  0.93           N  
ATOM   1757  CA  ILE A 112      81.756   5.145  -3.307  1.00  0.93           C  
ATOM   1758  C   ILE A 112      82.601   4.324  -2.350  1.00  0.93           C  
ATOM   1759  O   ILE A 112      83.097   3.246  -2.687  1.00  0.93           O  
ATOM   1760  CB  ILE A 112      80.325   4.625  -3.410  1.00  0.93           C  
ATOM   1761  CG1 ILE A 112      79.510   5.423  -4.461  1.00  0.93           C  
ATOM   1762  CG2 ILE A 112      79.623   4.662  -2.035  1.00  0.93           C  
ATOM   1763  CD1 ILE A 112      79.433   6.933  -4.215  1.00  0.93           C  
ATOM   1764  N   GLY A 113      82.825   4.857  -1.134  1.00  0.96           N  
ATOM   1765  CA  GLY A 113      83.578   4.207  -0.074  1.00  0.96           C  
ATOM   1766  C   GLY A 113      84.453   5.199   0.631  1.00  0.96           C  
ATOM   1767  O   GLY A 113      84.522   6.368   0.268  1.00  0.96           O  
ATOM   1768  N   ASP A 114      85.161   4.762   1.691  1.00  0.93           N  
ATOM   1769  CA  ASP A 114      86.159   5.574   2.368  1.00  0.93           C  
ATOM   1770  C   ASP A 114      87.237   6.021   1.372  1.00  0.93           C  
ATOM   1771  O   ASP A 114      87.638   5.274   0.492  1.00  0.93           O  
ATOM   1772  CB  ASP A 114      86.742   4.738   3.543  1.00  0.93           C  
ATOM   1773  CG  ASP A 114      87.702   5.478   4.472  1.00  0.93           C  
ATOM   1774  OD1 ASP A 114      88.334   6.477   4.044  1.00  0.93           O  
ATOM   1775  OD2 ASP A 114      87.833   5.011   5.628  1.00  0.93           O  
ATOM   1776  N   CYS A 115      87.763   7.258   1.460  1.00  0.95           N  
ATOM   1777  CA  CYS A 115      88.793   7.721   0.545  1.00  0.95           C  
ATOM   1778  C   CYS A 115      90.064   6.883   0.585  1.00  0.95           C  
ATOM   1779  O   CYS A 115      90.760   6.770  -0.414  1.00  0.95           O  
ATOM   1780  CB  CYS A 115      89.128   9.210   0.760  1.00  0.95           C  
ATOM   1781  SG  CYS A 115      89.788   9.543   2.419  1.00  0.95           S  
ATOM   1782  N   ALA A 116      90.333   6.223   1.729  1.00  0.95           N  
ATOM   1783  CA  ALA A 116      91.423   5.288   1.908  1.00  0.95           C  
ATOM   1784  C   ALA A 116      91.344   4.033   1.034  1.00  0.95           C  
ATOM   1785  O   ALA A 116      92.344   3.341   0.863  1.00  0.95           O  
ATOM   1786  CB  ALA A 116      91.481   4.892   3.394  1.00  0.95           C  
ATOM   1787  N   THR A 117      90.163   3.735   0.440  1.00  0.94           N  
ATOM   1788  CA  THR A 117      89.955   2.622  -0.478  1.00  0.94           C  
ATOM   1789  C   THR A 117      90.131   3.035  -1.926  1.00  0.94           C  
ATOM   1790  O   THR A 117      90.062   2.205  -2.829  1.00  0.94           O  
ATOM   1791  CB  THR A 117      88.560   1.981  -0.360  1.00  0.94           C  
ATOM   1792  OG1 THR A 117      87.486   2.830  -0.724  1.00  0.94           O  
ATOM   1793  CG2 THR A 117      88.286   1.572   1.089  1.00  0.94           C  
ATOM   1794  N   VAL A 118      90.375   4.333  -2.205  1.00  0.95           N  
ATOM   1795  CA  VAL A 118      90.527   4.836  -3.562  1.00  0.95           C  
ATOM   1796  C   VAL A 118      91.947   4.600  -4.072  1.00  0.95           C  
ATOM   1797  O   VAL A 118      92.926   5.012  -3.458  1.00  0.95           O  
ATOM   1798  CB  VAL A 118      90.144   6.317  -3.668  1.00  0.95           C  
ATOM   1799  CG1 VAL A 118      90.476   6.915  -5.051  1.00  0.95           C  
ATOM   1800  CG2 VAL A 118      88.636   6.478  -3.383  1.00  0.95           C  
ATOM   1801  N   HIS A 119      92.096   3.938  -5.243  1.00  0.90           N  
ATOM   1802  CA  HIS A 119      93.393   3.695  -5.863  1.00  0.90           C  
ATOM   1803  C   HIS A 119      93.444   4.260  -7.264  1.00  0.90           C  
ATOM   1804  O   HIS A 119      92.497   4.122  -8.024  1.00  0.90           O  
ATOM   1805  CB  HIS A 119      93.699   2.201  -6.060  1.00  0.90           C  
ATOM   1806  CG  HIS A 119      93.668   1.426  -4.807  1.00  0.90           C  
ATOM   1807  ND1 HIS A 119      94.653   1.611  -3.859  1.00  0.90           N  
ATOM   1808  CD2 HIS A 119      92.744   0.535  -4.385  1.00  0.90           C  
ATOM   1809  CE1 HIS A 119      94.291   0.825  -2.860  1.00  0.90           C  
ATOM   1810  NE2 HIS A 119      93.149   0.153  -3.132  1.00  0.90           N  
ATOM   1811  N   THR A 120      94.572   4.872  -7.672  1.00  0.90           N  
ATOM   1812  CA  THR A 120      94.753   5.373  -9.034  1.00  0.90           C  
ATOM   1813  C   THR A 120      96.185   5.165  -9.441  1.00  0.90           C  
ATOM   1814  O   THR A 120      97.111   5.249  -8.630  1.00  0.90           O  
ATOM   1815  CB  THR A 120      94.361   6.852  -9.243  1.00  0.90           C  
ATOM   1816  OG1 THR A 120      94.642   7.377 -10.533  1.00  0.90           O  
ATOM   1817  CG2 THR A 120      95.041   7.790  -8.241  1.00  0.90           C  
ATOM   1818  N   ALA A 121      96.421   4.865 -10.733  1.00  0.91           N  
ATOM   1819  CA  ALA A 121      97.758   4.701 -11.259  1.00  0.91           C  
ATOM   1820  C   ALA A 121      98.244   6.008 -11.866  1.00  0.91           C  
ATOM   1821  O   ALA A 121      99.388   6.127 -12.296  1.00  0.91           O  
ATOM   1822  CB  ALA A 121      97.783   3.572 -12.305  1.00  0.91           C  
ATOM   1823  N   ASN A 122      97.397   7.055 -11.858  1.00  0.90           N  
ATOM   1824  CA  ASN A 122      97.668   8.285 -12.561  1.00  0.90           C  
ATOM   1825  C   ASN A 122      97.865   9.458 -11.625  1.00  0.90           C  
ATOM   1826  O   ASN A 122      97.491   9.450 -10.455  1.00  0.90           O  
ATOM   1827  CB  ASN A 122      96.533   8.646 -13.547  1.00  0.90           C  
ATOM   1828  CG  ASN A 122      96.169   7.440 -14.398  1.00  0.90           C  
ATOM   1829  OD1 ASN A 122      95.452   6.545 -13.960  1.00  0.90           O  
ATOM   1830  ND2 ASN A 122      96.605   7.425 -15.677  1.00  0.90           N  
ATOM   1831  N   LYS A 123      98.500  10.520 -12.156  1.00  0.91           N  
ATOM   1832  CA  LYS A 123      98.588  11.802 -11.497  1.00  0.91           C  
ATOM   1833  C   LYS A 123      97.511  12.739 -12.004  1.00  0.91           C  
ATOM   1834  O   LYS A 123      97.071  12.640 -13.155  1.00  0.91           O  
ATOM   1835  CB  LYS A 123      99.975  12.446 -11.692  1.00  0.91           C  
ATOM   1836  CG  LYS A 123     101.098  11.631 -11.032  1.00  0.91           C  
ATOM   1837  CD  LYS A 123     102.466  12.329 -11.108  1.00  0.91           C  
ATOM   1838  CE  LYS A 123     103.636  11.525 -10.521  1.00  0.91           C  
ATOM   1839  NZ  LYS A 123     103.514  11.390  -9.055  1.00  0.91           N  
ATOM   1840  N   TRP A 124      97.090  13.659 -11.120  1.00  0.94           N  
ATOM   1841  CA  TRP A 124      95.968  14.557 -11.284  1.00  0.94           C  
ATOM   1842  C   TRP A 124      96.472  15.983 -11.250  1.00  0.94           C  
ATOM   1843  O   TRP A 124      97.554  16.252 -10.731  1.00  0.94           O  
ATOM   1844  CB  TRP A 124      94.929  14.321 -10.155  1.00  0.94           C  
ATOM   1845  CG  TRP A 124      94.387  12.901 -10.164  1.00  0.94           C  
ATOM   1846  CD1 TRP A 124      95.000  11.756  -9.742  1.00  0.94           C  
ATOM   1847  CD2 TRP A 124      93.164  12.486 -10.793  1.00  0.94           C  
ATOM   1848  NE1 TRP A 124      94.277  10.648 -10.118  1.00  0.94           N  
ATOM   1849  CE2 TRP A 124      93.136  11.079 -10.759  1.00  0.94           C  
ATOM   1850  CE3 TRP A 124      92.145  13.215 -11.386  1.00  0.94           C  
ATOM   1851  CZ2 TRP A 124      92.084  10.375 -11.335  1.00  0.94           C  
ATOM   1852  CZ3 TRP A 124      91.087  12.509 -11.969  1.00  0.94           C  
ATOM   1853  CH2 TRP A 124      91.061  11.112 -11.951  1.00  0.94           C  
ATOM   1854  N   ASP A 125      95.707  16.925 -11.837  1.00  0.98           N  
ATOM   1855  CA  ASP A 125      96.145  18.291 -12.027  1.00  0.98           C  
ATOM   1856  C   ASP A 125      95.499  19.192 -10.973  1.00  0.98           C  
ATOM   1857  O   ASP A 125      96.024  20.244 -10.609  1.00  0.98           O  
ATOM   1858  CB  ASP A 125      95.734  18.749 -13.455  1.00  0.98           C  
ATOM   1859  CG  ASP A 125      96.292  17.833 -14.528  1.00  0.98           C  
ATOM   1860  OD1 ASP A 125      97.464  17.398 -14.429  1.00  0.98           O  
ATOM   1861  OD2 ASP A 125      95.551  17.520 -15.499  1.00  0.98           O  
ATOM   1862  N   LEU A 126      94.354  18.763 -10.406  1.00  0.99           N  
ATOM   1863  CA  LEU A 126      93.669  19.500  -9.364  1.00  0.99           C  
ATOM   1864  C   LEU A 126      92.973  18.540  -8.413  1.00  0.99           C  
ATOM   1865  O   LEU A 126      92.322  17.584  -8.834  1.00  0.99           O  
ATOM   1866  CB  LEU A 126      92.649  20.472 -10.004  1.00  0.99           C  
ATOM   1867  CG  LEU A 126      91.811  21.369  -9.070  1.00  0.99           C  
ATOM   1868  CD1 LEU A 126      92.670  22.353  -8.266  1.00  0.99           C  
ATOM   1869  CD2 LEU A 126      90.762  22.138  -9.887  1.00  0.99           C  
ATOM   1870  N   ILE A 127      93.096  18.777  -7.090  1.00  0.99           N  
ATOM   1871  CA  ILE A 127      92.419  17.985  -6.070  1.00  0.99           C  
ATOM   1872  C   ILE A 127      91.529  18.898  -5.254  1.00  0.99           C  
ATOM   1873  O   ILE A 127      91.983  19.876  -4.662  1.00  0.99           O  
ATOM   1874  CB  ILE A 127      93.384  17.282  -5.115  1.00  0.99           C  
ATOM   1875  CG1 ILE A 127      94.367  16.372  -5.886  1.00  0.99           C  
ATOM   1876  CG2 ILE A 127      92.605  16.482  -4.038  1.00  0.99           C  
ATOM   1877  CD1 ILE A 127      95.564  15.939  -5.036  1.00  0.99           C  
ATOM   1878  N   ILE A 128      90.225  18.588  -5.176  1.00  0.99           N  
ATOM   1879  CA  ILE A 128      89.289  19.336  -4.356  1.00  0.99           C  
ATOM   1880  C   ILE A 128      88.815  18.387  -3.270  1.00  0.99           C  
ATOM   1881  O   ILE A 128      88.504  17.229  -3.536  1.00  0.99           O  
ATOM   1882  CB  ILE A 128      88.108  19.882  -5.161  1.00  0.99           C  
ATOM   1883  CG1 ILE A 128      88.557  20.707  -6.398  1.00  0.99           C  
ATOM   1884  CG2 ILE A 128      87.170  20.708  -4.252  1.00  0.99           C  
ATOM   1885  CD1 ILE A 128      89.341  21.985  -6.082  1.00  0.99           C  
ATOM   1886  N   SER A 129      88.775  18.823  -1.998  1.00  1.00           N  
ATOM   1887  CA  SER A 129      88.222  18.004  -0.930  1.00  1.00           C  
ATOM   1888  C   SER A 129      87.305  18.830  -0.051  1.00  1.00           C  
ATOM   1889  O   SER A 129      87.705  19.888   0.428  1.00  1.00           O  
ATOM   1890  CB  SER A 129      89.315  17.350  -0.043  1.00  1.00           C  
ATOM   1891  OG  SER A 129      88.776  16.486   0.962  1.00  1.00           O  
ATOM   1892  N   ASP A 130      86.061  18.354   0.182  1.00  0.98           N  
ATOM   1893  CA  ASP A 130      85.139  18.892   1.177  1.00  0.98           C  
ATOM   1894  C   ASP A 130      84.867  17.841   2.252  1.00  0.98           C  
ATOM   1895  O   ASP A 130      83.905  17.925   3.012  1.00  0.98           O  
ATOM   1896  CB  ASP A 130      83.830  19.422   0.515  1.00  0.98           C  
ATOM   1897  CG  ASP A 130      83.024  20.391   1.370  1.00  0.98           C  
ATOM   1898  OD1 ASP A 130      83.676  21.127   2.155  1.00  0.98           O  
ATOM   1899  OD2 ASP A 130      81.777  20.487   1.248  1.00  0.98           O  
ATOM   1900  N   MET A 131      85.737  16.805   2.375  1.00  0.94           N  
ATOM   1901  CA  MET A 131      85.562  15.778   3.389  1.00  0.94           C  
ATOM   1902  C   MET A 131      85.535  16.312   4.812  1.00  0.94           C  
ATOM   1903  O   MET A 131      86.338  17.146   5.228  1.00  0.94           O  
ATOM   1904  CB  MET A 131      86.624  14.659   3.300  1.00  0.94           C  
ATOM   1905  CG  MET A 131      86.487  13.784   2.046  1.00  0.94           C  
ATOM   1906  SD  MET A 131      87.575  12.335   2.031  1.00  0.94           S  
ATOM   1907  CE  MET A 131      89.140  13.219   1.794  1.00  0.94           C  
ATOM   1908  N   TYR A 132      84.557  15.841   5.598  1.00  0.92           N  
ATOM   1909  CA  TYR A 132      84.378  16.301   6.943  1.00  0.92           C  
ATOM   1910  C   TYR A 132      83.703  15.177   7.695  1.00  0.92           C  
ATOM   1911  O   TYR A 132      82.719  14.621   7.218  1.00  0.92           O  
ATOM   1912  CB  TYR A 132      83.531  17.594   6.890  1.00  0.92           C  
ATOM   1913  CG  TYR A 132      83.305  18.199   8.233  1.00  0.92           C  
ATOM   1914  CD1 TYR A 132      84.281  19.010   8.824  1.00  0.92           C  
ATOM   1915  CD2 TYR A 132      82.104  17.957   8.914  1.00  0.92           C  
ATOM   1916  CE1 TYR A 132      84.050  19.584  10.077  1.00  0.92           C  
ATOM   1917  CE2 TYR A 132      81.872  18.535  10.167  1.00  0.92           C  
ATOM   1918  CZ  TYR A 132      82.841  19.363  10.736  1.00  0.92           C  
ATOM   1919  OH  TYR A 132      82.605  19.975  11.973  1.00  0.92           O  
ATOM   1920  N   ASP A 133      84.208  14.803   8.888  1.00  0.84           N  
ATOM   1921  CA  ASP A 133      83.571  13.782   9.691  1.00  0.84           C  
ATOM   1922  C   ASP A 133      82.444  14.459  10.498  1.00  0.84           C  
ATOM   1923  O   ASP A 133      82.700  15.495  11.124  1.00  0.84           O  
ATOM   1924  CB  ASP A 133      84.647  13.049  10.545  1.00  0.84           C  
ATOM   1925  CG  ASP A 133      84.134  11.827  11.304  1.00  0.84           C  
ATOM   1926  OD1 ASP A 133      82.914  11.762  11.606  1.00  0.84           O  
ATOM   1927  OD2 ASP A 133      84.969  10.942  11.611  1.00  0.84           O  
ATOM   1928  N   PRO A 134      81.189  13.989  10.510  1.00  0.70           N  
ATOM   1929  CA  PRO A 134      80.128  14.506  11.371  1.00  0.70           C  
ATOM   1930  C   PRO A 134      80.444  14.354  12.848  1.00  0.70           C  
ATOM   1931  O   PRO A 134      79.950  15.144  13.655  1.00  0.70           O  
ATOM   1932  CB  PRO A 134      78.864  13.743  10.930  1.00  0.70           C  
ATOM   1933  CG  PRO A 134      79.390  12.470  10.264  1.00  0.70           C  
ATOM   1934  CD  PRO A 134      80.712  12.911   9.645  1.00  0.70           C  
ATOM   1935  N   LYS A 135      81.283  13.380  13.247  1.00  0.69           N  
ATOM   1936  CA  LYS A 135      81.627  13.142  14.634  1.00  0.69           C  
ATOM   1937  C   LYS A 135      82.523  14.221  15.225  1.00  0.69           C  
ATOM   1938  O   LYS A 135      82.646  14.330  16.440  1.00  0.69           O  
ATOM   1939  CB  LYS A 135      82.278  11.758  14.818  1.00  0.69           C  
ATOM   1940  CG  LYS A 135      81.339  10.608  14.427  1.00  0.69           C  
ATOM   1941  CD  LYS A 135      82.014   9.243  14.608  1.00  0.69           C  
ATOM   1942  CE  LYS A 135      81.103   8.080  14.221  1.00  0.69           C  
ATOM   1943  NZ  LYS A 135      81.802   6.796  14.440  1.00  0.69           N  
ATOM   1944  N   THR A 136      83.098  15.091  14.369  1.00  0.77           N  
ATOM   1945  CA  THR A 136      83.908  16.249  14.745  1.00  0.77           C  
ATOM   1946  C   THR A 136      83.150  17.265  15.592  1.00  0.77           C  
ATOM   1947  O   THR A 136      83.747  17.971  16.398  1.00  0.77           O  
ATOM   1948  CB  THR A 136      84.514  16.937  13.519  1.00  0.77           C  
ATOM   1949  OG1 THR A 136      85.383  16.055  12.826  1.00  0.77           O  
ATOM   1950  CG2 THR A 136      85.388  18.151  13.859  1.00  0.77           C  
ATOM   1951  N   LYS A 137      81.807  17.385  15.437  1.00  0.64           N  
ATOM   1952  CA  LYS A 137      81.006  18.244  16.309  1.00  0.64           C  
ATOM   1953  C   LYS A 137      80.123  17.497  17.287  1.00  0.64           C  
ATOM   1954  O   LYS A 137      79.659  18.082  18.261  1.00  0.64           O  
ATOM   1955  CB  LYS A 137      80.065  19.160  15.498  1.00  0.64           C  
ATOM   1956  CG  LYS A 137      80.816  20.293  14.793  1.00  0.64           C  
ATOM   1957  CD  LYS A 137      79.866  21.189  13.981  1.00  0.64           C  
ATOM   1958  CE  LYS A 137      80.548  22.388  13.314  1.00  0.64           C  
ATOM   1959  NZ  LYS A 137      79.555  23.201  12.573  1.00  0.64           N  
ATOM   1960  N   ASN A 138      79.877  16.188  17.079  1.00  0.43           N  
ATOM   1961  CA  ASN A 138      79.074  15.391  17.995  1.00  0.43           C  
ATOM   1962  C   ASN A 138      79.724  15.255  19.361  1.00  0.43           C  
ATOM   1963  O   ASN A 138      79.052  15.194  20.386  1.00  0.43           O  
ATOM   1964  CB  ASN A 138      78.806  13.967  17.453  1.00  0.43           C  
ATOM   1965  CG  ASN A 138      77.919  14.005  16.214  1.00  0.43           C  
ATOM   1966  OD1 ASN A 138      77.352  15.018  15.821  1.00  0.43           O  
ATOM   1967  ND2 ASN A 138      77.762  12.819  15.574  1.00  0.43           N  
ATOM   1968  N   VAL A 139      81.064  15.188  19.390  1.00  0.41           N  
ATOM   1969  CA  VAL A 139      81.809  15.181  20.625  1.00  0.41           C  
ATOM   1970  C   VAL A 139      83.005  16.095  20.457  1.00  0.41           C  
ATOM   1971  O   VAL A 139      83.840  15.905  19.579  1.00  0.41           O  
ATOM   1972  CB  VAL A 139      82.198  13.758  21.037  1.00  0.41           C  
ATOM   1973  CG1 VAL A 139      82.908  12.993  19.897  1.00  0.41           C  
ATOM   1974  CG2 VAL A 139      83.013  13.764  22.345  1.00  0.41           C  
ATOM   1975  N   THR A 140      83.127  17.145  21.299  1.00  0.55           N  
ATOM   1976  CA  THR A 140      84.286  18.036  21.243  1.00  0.55           C  
ATOM   1977  C   THR A 140      85.435  17.431  22.021  1.00  0.55           C  
ATOM   1978  O   THR A 140      85.257  16.832  23.083  1.00  0.55           O  
ATOM   1979  CB  THR A 140      83.996  19.479  21.659  1.00  0.55           C  
ATOM   1980  OG1 THR A 140      85.097  20.346  21.422  1.00  0.55           O  
ATOM   1981  CG2 THR A 140      83.619  19.615  23.138  1.00  0.55           C  
ATOM   1982  N   LYS A 141      86.656  17.522  21.468  1.00  0.59           N  
ATOM   1983  CA  LYS A 141      87.837  16.893  22.009  1.00  0.59           C  
ATOM   1984  C   LYS A 141      88.920  17.943  22.011  1.00  0.59           C  
ATOM   1985  O   LYS A 141      88.790  18.983  21.370  1.00  0.59           O  
ATOM   1986  CB  LYS A 141      88.324  15.694  21.142  1.00  0.59           C  
ATOM   1987  CG  LYS A 141      87.261  14.626  20.820  1.00  0.59           C  
ATOM   1988  CD  LYS A 141      86.769  13.815  22.030  1.00  0.59           C  
ATOM   1989  CE  LYS A 141      87.838  12.901  22.628  1.00  0.59           C  
ATOM   1990  NZ  LYS A 141      87.268  12.118  23.746  1.00  0.59           N  
ATOM   1991  N   GLU A 142      90.033  17.705  22.730  1.00  0.71           N  
ATOM   1992  CA  GLU A 142      91.208  18.552  22.656  1.00  0.71           C  
ATOM   1993  C   GLU A 142      91.714  18.663  21.226  1.00  0.71           C  
ATOM   1994  O   GLU A 142      91.735  17.692  20.466  1.00  0.71           O  
ATOM   1995  CB  GLU A 142      92.282  18.025  23.634  1.00  0.71           C  
ATOM   1996  CG  GLU A 142      91.800  18.073  25.109  1.00  0.71           C  
ATOM   1997  CD  GLU A 142      92.538  17.116  26.051  1.00  0.71           C  
ATOM   1998  OE1 GLU A 142      91.818  16.377  26.777  1.00  0.71           O  
ATOM   1999  OE2 GLU A 142      93.792  17.133  26.071  1.00  0.71           O  
ATOM   2000  N   ASN A 143      92.008  19.905  20.784  1.00  0.83           N  
ATOM   2001  CA  ASN A 143      92.149  20.203  19.375  1.00  0.83           C  
ATOM   2002  C   ASN A 143      93.513  19.821  18.802  1.00  0.83           C  
ATOM   2003  O   ASN A 143      94.279  20.669  18.351  1.00  0.83           O  
ATOM   2004  CB  ASN A 143      91.772  21.676  19.073  1.00  0.83           C  
ATOM   2005  CG  ASN A 143      91.499  21.838  17.582  1.00  0.83           C  
ATOM   2006  OD1 ASN A 143      91.381  20.853  16.844  1.00  0.83           O  
ATOM   2007  ND2 ASN A 143      91.390  23.102  17.120  1.00  0.83           N  
ATOM   2008  N   ASP A 144      93.804  18.511  18.770  1.00  0.87           N  
ATOM   2009  CA  ASP A 144      94.949  17.944  18.105  1.00  0.87           C  
ATOM   2010  C   ASP A 144      94.718  17.765  16.622  1.00  0.87           C  
ATOM   2011  O   ASP A 144      93.591  17.831  16.124  1.00  0.87           O  
ATOM   2012  CB  ASP A 144      95.323  16.575  18.705  1.00  0.87           C  
ATOM   2013  CG  ASP A 144      95.957  16.808  20.059  1.00  0.87           C  
ATOM   2014  OD1 ASP A 144      96.846  17.705  20.114  1.00  0.87           O  
ATOM   2015  OD2 ASP A 144      95.597  16.076  21.010  1.00  0.87           O  
ATOM   2016  N   SER A 145      95.824  17.525  15.890  1.00  0.93           N  
ATOM   2017  CA  SER A 145      95.842  17.179  14.476  1.00  0.93           C  
ATOM   2018  C   SER A 145      95.028  15.922  14.208  1.00  0.93           C  
ATOM   2019  O   SER A 145      95.112  14.947  14.946  1.00  0.93           O  
ATOM   2020  CB  SER A 145      97.314  16.951  14.032  1.00  0.93           C  
ATOM   2021  OG  SER A 145      97.487  16.705  12.636  1.00  0.93           O  
ATOM   2022  N   LYS A 146      94.162  15.918  13.173  1.00  0.87           N  
ATOM   2023  CA  LYS A 146      93.251  14.810  12.940  1.00  0.87           C  
ATOM   2024  C   LYS A 146      93.773  13.889  11.852  1.00  0.87           C  
ATOM   2025  O   LYS A 146      94.202  14.326  10.785  1.00  0.87           O  
ATOM   2026  CB  LYS A 146      91.840  15.319  12.563  1.00  0.87           C  
ATOM   2027  CG  LYS A 146      91.201  16.294  13.576  1.00  0.87           C  
ATOM   2028  CD  LYS A 146      91.035  15.725  14.999  1.00  0.87           C  
ATOM   2029  CE  LYS A 146      90.223  16.604  15.967  1.00  0.87           C  
ATOM   2030  NZ  LYS A 146      90.865  17.922  16.140  1.00  0.87           N  
ATOM   2031  N   GLU A 147      93.742  12.563  12.096  1.00  0.86           N  
ATOM   2032  CA  GLU A 147      94.477  11.590  11.307  1.00  0.86           C  
ATOM   2033  C   GLU A 147      93.598  10.556  10.605  1.00  0.86           C  
ATOM   2034  O   GLU A 147      93.988   9.412  10.401  1.00  0.86           O  
ATOM   2035  CB  GLU A 147      95.514  10.870  12.187  1.00  0.86           C  
ATOM   2036  CG  GLU A 147      96.550  11.806  12.856  1.00  0.86           C  
ATOM   2037  CD  GLU A 147      97.510  11.020  13.751  1.00  0.86           C  
ATOM   2038  OE1 GLU A 147      98.280  11.687  14.486  1.00  0.86           O  
ATOM   2039  OE2 GLU A 147      97.481   9.764  13.705  1.00  0.86           O  
ATOM   2040  N   GLY A 148      92.367  10.935  10.192  1.00  0.91           N  
ATOM   2041  CA  GLY A 148      91.501  10.048   9.412  1.00  0.91           C  
ATOM   2042  C   GLY A 148      91.756  10.231   7.942  1.00  0.91           C  
ATOM   2043  O   GLY A 148      92.803   9.879   7.415  1.00  0.91           O  
ATOM   2044  N   PHE A 149      90.815  10.851   7.211  1.00  0.91           N  
ATOM   2045  CA  PHE A 149      90.968  11.069   5.782  1.00  0.91           C  
ATOM   2046  C   PHE A 149      92.109  12.005   5.385  1.00  0.91           C  
ATOM   2047  O   PHE A 149      92.603  11.974   4.260  1.00  0.91           O  
ATOM   2048  CB  PHE A 149      89.637  11.567   5.161  1.00  0.91           C  
ATOM   2049  CG  PHE A 149      89.132  12.857   5.742  1.00  0.91           C  
ATOM   2050  CD1 PHE A 149      89.693  14.087   5.355  1.00  0.91           C  
ATOM   2051  CD2 PHE A 149      88.064  12.858   6.651  1.00  0.91           C  
ATOM   2052  CE1 PHE A 149      89.226  15.285   5.898  1.00  0.91           C  
ATOM   2053  CE2 PHE A 149      87.595  14.059   7.195  1.00  0.91           C  
ATOM   2054  CZ  PHE A 149      88.186  15.271   6.829  1.00  0.91           C  
ATOM   2055  N   PHE A 150      92.562  12.872   6.313  1.00  0.92           N  
ATOM   2056  CA  PHE A 150      93.692  13.757   6.104  1.00  0.92           C  
ATOM   2057  C   PHE A 150      95.003  13.029   5.833  1.00  0.92           C  
ATOM   2058  O   PHE A 150      95.798  13.486   5.017  1.00  0.92           O  
ATOM   2059  CB  PHE A 150      93.893  14.747   7.269  1.00  0.92           C  
ATOM   2060  CG  PHE A 150      92.859  15.838   7.294  1.00  0.92           C  
ATOM   2061  CD1 PHE A 150      92.828  16.797   6.268  1.00  0.92           C  
ATOM   2062  CD2 PHE A 150      91.983  15.984   8.381  1.00  0.92           C  
ATOM   2063  CE1 PHE A 150      91.932  17.872   6.320  1.00  0.92           C  
ATOM   2064  CE2 PHE A 150      91.073  17.046   8.423  1.00  0.92           C  
ATOM   2065  CZ  PHE A 150      91.043  17.990   7.391  1.00  0.92           C  
ATOM   2066  N   THR A 151      95.261  11.864   6.471  1.00  0.93           N  
ATOM   2067  CA  THR A 151      96.457  11.063   6.188  1.00  0.93           C  
ATOM   2068  C   THR A 151      96.477  10.554   4.753  1.00  0.93           C  
ATOM   2069  O   THR A 151      97.496  10.605   4.069  1.00  0.93           O  
ATOM   2070  CB  THR A 151      96.688   9.877   7.126  1.00  0.93           C  
ATOM   2071  OG1 THR A 151      95.653   8.910   7.035  1.00  0.93           O  
ATOM   2072  CG2 THR A 151      96.714  10.346   8.582  1.00  0.93           C  
ATOM   2073  N   TYR A 152      95.302  10.102   4.252  1.00  0.92           N  
ATOM   2074  CA  TYR A 152      95.100   9.738   2.861  1.00  0.92           C  
ATOM   2075  C   TYR A 152      95.343  10.914   1.921  1.00  0.92           C  
ATOM   2076  O   TYR A 152      96.054  10.778   0.931  1.00  0.92           O  
ATOM   2077  CB  TYR A 152      93.673   9.159   2.632  1.00  0.92           C  
ATOM   2078  CG  TYR A 152      93.453   8.776   1.188  1.00  0.92           C  
ATOM   2079  CD1 TYR A 152      93.963   7.577   0.671  1.00  0.92           C  
ATOM   2080  CD2 TYR A 152      92.827   9.680   0.312  1.00  0.92           C  
ATOM   2081  CE1 TYR A 152      93.841   7.280  -0.695  1.00  0.92           C  
ATOM   2082  CE2 TYR A 152      92.731   9.399  -1.054  1.00  0.92           C  
ATOM   2083  CZ  TYR A 152      93.234   8.198  -1.554  1.00  0.92           C  
ATOM   2084  OH  TYR A 152      93.113   7.926  -2.926  1.00  0.92           O  
ATOM   2085  N   ILE A 153      94.792  12.110   2.224  1.00  0.95           N  
ATOM   2086  CA  ILE A 153      94.990  13.307   1.406  1.00  0.95           C  
ATOM   2087  C   ILE A 153      96.448  13.704   1.308  1.00  0.95           C  
ATOM   2088  O   ILE A 153      96.948  13.981   0.220  1.00  0.95           O  
ATOM   2089  CB  ILE A 153      94.147  14.484   1.900  1.00  0.95           C  
ATOM   2090  CG1 ILE A 153      92.641  14.239   1.644  1.00  0.95           C  
ATOM   2091  CG2 ILE A 153      94.588  15.845   1.307  1.00  0.95           C  
ATOM   2092  CD1 ILE A 153      92.244  14.169   0.163  1.00  0.95           C  
ATOM   2093  N   CYS A 154      97.192  13.679   2.429  1.00  0.95           N  
ATOM   2094  CA  CYS A 154      98.616  13.961   2.432  1.00  0.95           C  
ATOM   2095  C   CYS A 154      99.420  12.992   1.573  1.00  0.95           C  
ATOM   2096  O   CYS A 154     100.269  13.398   0.782  1.00  0.95           O  
ATOM   2097  CB  CYS A 154      99.159  13.982   3.882  1.00  0.95           C  
ATOM   2098  SG  CYS A 154      98.455  15.350   4.858  1.00  0.95           S  
ATOM   2099  N   GLY A 155      99.105  11.679   1.645  1.00  0.96           N  
ATOM   2100  CA  GLY A 155      99.724  10.681   0.778  1.00  0.96           C  
ATOM   2101  C   GLY A 155      99.336  10.801  -0.676  1.00  0.96           C  
ATOM   2102  O   GLY A 155     100.161  10.625  -1.566  1.00  0.96           O  
ATOM   2103  N   PHE A 156      98.066  11.137  -0.966  1.00  0.92           N  
ATOM   2104  CA  PHE A 156      97.574  11.392  -2.308  1.00  0.92           C  
ATOM   2105  C   PHE A 156      98.244  12.599  -2.966  1.00  0.92           C  
ATOM   2106  O   PHE A 156      98.644  12.534  -4.124  1.00  0.92           O  
ATOM   2107  CB  PHE A 156      96.033  11.542  -2.287  1.00  0.92           C  
ATOM   2108  CG  PHE A 156      95.426  11.364  -3.653  1.00  0.92           C  
ATOM   2109  CD1 PHE A 156      95.304  12.450  -4.527  1.00  0.92           C  
ATOM   2110  CD2 PHE A 156      94.979  10.109  -4.081  1.00  0.92           C  
ATOM   2111  CE1 PHE A 156      94.720  12.298  -5.790  1.00  0.92           C  
ATOM   2112  CE2 PHE A 156      94.364   9.951  -5.330  1.00  0.92           C  
ATOM   2113  CZ  PHE A 156      94.235  11.048  -6.186  1.00  0.92           C  
ATOM   2114  N   ILE A 157      98.442  13.715  -2.227  1.00  0.93           N  
ATOM   2115  CA  ILE A 157      99.195  14.879  -2.699  1.00  0.93           C  
ATOM   2116  C   ILE A 157     100.630  14.510  -3.038  1.00  0.93           C  
ATOM   2117  O   ILE A 157     101.143  14.840  -4.105  1.00  0.93           O  
ATOM   2118  CB  ILE A 157      99.171  16.021  -1.673  1.00  0.93           C  
ATOM   2119  CG1 ILE A 157      97.739  16.595  -1.545  1.00  0.93           C  
ATOM   2120  CG2 ILE A 157     100.175  17.145  -2.040  1.00  0.93           C  
ATOM   2121  CD1 ILE A 157      97.569  17.592  -0.391  1.00  0.93           C  
ATOM   2122  N   GLN A 158     101.308  13.742  -2.166  1.00  0.89           N  
ATOM   2123  CA  GLN A 158     102.701  13.410  -2.383  1.00  0.89           C  
ATOM   2124  C   GLN A 158     102.965  12.384  -3.482  1.00  0.89           C  
ATOM   2125  O   GLN A 158     104.069  12.311  -4.018  1.00  0.89           O  
ATOM   2126  CB  GLN A 158     103.345  12.965  -1.056  1.00  0.89           C  
ATOM   2127  CG  GLN A 158     103.509  14.146  -0.076  1.00  0.89           C  
ATOM   2128  CD  GLN A 158     104.144  13.677   1.230  1.00  0.89           C  
ATOM   2129  OE1 GLN A 158     103.568  12.895   1.983  1.00  0.89           O  
ATOM   2130  NE2 GLN A 158     105.370  14.169   1.530  1.00  0.89           N  
ATOM   2131  N   GLN A 159     101.956  11.583  -3.880  1.00  0.88           N  
ATOM   2132  CA  GLN A 159     102.147  10.509  -4.839  1.00  0.88           C  
ATOM   2133  C   GLN A 159     101.370  10.701  -6.141  1.00  0.88           C  
ATOM   2134  O   GLN A 159     101.819  10.291  -7.216  1.00  0.88           O  
ATOM   2135  CB  GLN A 159     101.694   9.185  -4.185  1.00  0.88           C  
ATOM   2136  CG  GLN A 159     102.459   8.851  -2.881  1.00  0.88           C  
ATOM   2137  CD  GLN A 159     101.795   7.672  -2.170  1.00  0.88           C  
ATOM   2138  OE1 GLN A 159     101.304   6.740  -2.807  1.00  0.88           O  
ATOM   2139  NE2 GLN A 159     101.775   7.712  -0.817  1.00  0.88           N  
ATOM   2140  N   LYS A 160     100.186  11.342  -6.105  1.00  0.90           N  
ATOM   2141  CA  LYS A 160      99.262  11.387  -7.226  1.00  0.90           C  
ATOM   2142  C   LYS A 160      98.943  12.798  -7.681  1.00  0.90           C  
ATOM   2143  O   LYS A 160      98.098  13.003  -8.546  1.00  0.90           O  
ATOM   2144  CB  LYS A 160      97.933  10.676  -6.878  1.00  0.90           C  
ATOM   2145  CG  LYS A 160      98.084   9.255  -6.311  1.00  0.90           C  
ATOM   2146  CD  LYS A 160      98.789   8.268  -7.254  1.00  0.90           C  
ATOM   2147  CE  LYS A 160      98.965   6.895  -6.604  1.00  0.90           C  
ATOM   2148  NZ  LYS A 160      99.560   5.947  -7.566  1.00  0.90           N  
ATOM   2149  N   LEU A 161      99.644  13.823  -7.176  1.00  0.95           N  
ATOM   2150  CA  LEU A 161      99.496  15.160  -7.708  1.00  0.95           C  
ATOM   2151  C   LEU A 161     100.622  15.395  -8.698  1.00  0.95           C  
ATOM   2152  O   LEU A 161     101.787  15.071  -8.454  1.00  0.95           O  
ATOM   2153  CB  LEU A 161      99.462  16.198  -6.569  1.00  0.95           C  
ATOM   2154  CG  LEU A 161      99.155  17.651  -6.971  1.00  0.95           C  
ATOM   2155  CD1 LEU A 161      97.789  17.825  -7.647  1.00  0.95           C  
ATOM   2156  CD2 LEU A 161      99.220  18.545  -5.730  1.00  0.95           C  
ATOM   2157  N   ALA A 162     100.286  15.891  -9.905  1.00  0.98           N  
ATOM   2158  CA  ALA A 162     101.255  16.346 -10.875  1.00  0.98           C  
ATOM   2159  C   ALA A 162     102.003  17.567 -10.381  1.00  0.98           C  
ATOM   2160  O   ALA A 162     101.448  18.414  -9.682  1.00  0.98           O  
ATOM   2161  CB  ALA A 162     100.570  16.664 -12.212  1.00  0.98           C  
ATOM   2162  N   LEU A 163     103.299  17.711 -10.722  1.00  0.95           N  
ATOM   2163  CA  LEU A 163     103.995  18.948 -10.426  1.00  0.95           C  
ATOM   2164  C   LEU A 163     103.396  20.086 -11.218  1.00  0.95           C  
ATOM   2165  O   LEU A 163     103.103  19.931 -12.399  1.00  0.95           O  
ATOM   2166  CB  LEU A 163     105.500  18.897 -10.729  1.00  0.95           C  
ATOM   2167  CG  LEU A 163     106.265  17.751 -10.058  1.00  0.95           C  
ATOM   2168  CD1 LEU A 163     107.699  17.698 -10.587  1.00  0.95           C  
ATOM   2169  CD2 LEU A 163     106.294  17.937  -8.542  1.00  0.95           C  
ATOM   2170  N   GLY A 164     103.171  21.238 -10.567  1.00  0.99           N  
ATOM   2171  CA  GLY A 164     102.423  22.355 -11.128  1.00  0.99           C  
ATOM   2172  C   GLY A 164     100.949  22.282 -10.838  1.00  0.99           C  
ATOM   2173  O   GLY A 164     100.233  23.264 -11.030  1.00  0.99           O  
ATOM   2174  N   GLY A 165     100.463  21.126 -10.332  1.00  1.00           N  
ATOM   2175  CA  GLY A 165      99.085  20.927  -9.902  1.00  1.00           C  
ATOM   2176  C   GLY A 165      98.731  21.676  -8.651  1.00  1.00           C  
ATOM   2177  O   GLY A 165      99.591  22.181  -7.934  1.00  1.00           O  
ATOM   2178  N   SER A 166      97.437  21.734  -8.321  1.00  0.99           N  
ATOM   2179  CA  SER A 166      96.983  22.550  -7.208  1.00  0.99           C  
ATOM   2180  C   SER A 166      95.956  21.808  -6.397  1.00  0.99           C  
ATOM   2181  O   SER A 166      95.416  20.786  -6.817  1.00  0.99           O  
ATOM   2182  CB  SER A 166      96.385  23.898  -7.667  1.00  0.99           C  
ATOM   2183  OG  SER A 166      97.390  24.712  -8.283  1.00  0.99           O  
ATOM   2184  N   VAL A 167      95.664  22.290  -5.175  1.00  1.00           N  
ATOM   2185  CA  VAL A 167      94.704  21.637  -4.304  1.00  1.00           C  
ATOM   2186  C   VAL A 167      93.842  22.666  -3.615  1.00  1.00           C  
ATOM   2187  O   VAL A 167      94.264  23.799  -3.406  1.00  1.00           O  
ATOM   2188  CB  VAL A 167      95.330  20.715  -3.246  1.00  1.00           C  
ATOM   2189  CG1 VAL A 167      96.277  19.705  -3.916  1.00  1.00           C  
ATOM   2190  CG2 VAL A 167      96.102  21.482  -2.154  1.00  1.00           C  
ATOM   2191  N   ALA A 168      92.601  22.291  -3.247  1.00  1.00           N  
ATOM   2192  CA  ALA A 168      91.784  23.055  -2.329  1.00  1.00           C  
ATOM   2193  C   ALA A 168      91.163  22.086  -1.335  1.00  1.00           C  
ATOM   2194  O   ALA A 168      90.301  21.282  -1.687  1.00  1.00           O  
ATOM   2195  CB  ALA A 168      90.684  23.840  -3.072  1.00  1.00           C  
ATOM   2196  N   ILE A 169      91.598  22.118  -0.060  1.00  0.98           N  
ATOM   2197  CA  ILE A 169      91.217  21.110   0.918  1.00  0.98           C  
ATOM   2198  C   ILE A 169      90.487  21.786   2.051  1.00  0.98           C  
ATOM   2199  O   ILE A 169      91.019  22.665   2.726  1.00  0.98           O  
ATOM   2200  CB  ILE A 169      92.421  20.353   1.479  1.00  0.98           C  
ATOM   2201  CG1 ILE A 169      93.339  19.792   0.362  1.00  0.98           C  
ATOM   2202  CG2 ILE A 169      91.970  19.244   2.459  1.00  0.98           C  
ATOM   2203  CD1 ILE A 169      92.675  18.798  -0.597  1.00  0.98           C  
ATOM   2204  N   LYS A 170      89.219  21.416   2.280  1.00  0.96           N  
ATOM   2205  CA  LYS A 170      88.449  21.960   3.371  1.00  0.96           C  
ATOM   2206  C   LYS A 170      88.960  21.592   4.755  1.00  0.96           C  
ATOM   2207  O   LYS A 170      89.233  20.433   5.068  1.00  0.96           O  
ATOM   2208  CB  LYS A 170      86.959  21.606   3.213  1.00  0.96           C  
ATOM   2209  CG  LYS A 170      86.024  22.531   3.999  1.00  0.96           C  
ATOM   2210  CD  LYS A 170      85.591  21.971   5.364  1.00  0.96           C  
ATOM   2211  CE  LYS A 170      84.454  20.955   5.296  1.00  0.96           C  
ATOM   2212  NZ  LYS A 170      83.287  21.547   4.633  1.00  0.96           N  
ATOM   2213  N   ILE A 171      89.073  22.604   5.628  1.00  0.98           N  
ATOM   2214  CA  ILE A 171      89.440  22.447   7.012  1.00  0.98           C  
ATOM   2215  C   ILE A 171      88.449  23.240   7.827  1.00  0.98           C  
ATOM   2216  O   ILE A 171      87.681  24.046   7.302  1.00  0.98           O  
ATOM   2217  CB  ILE A 171      90.858  22.914   7.339  1.00  0.98           C  
ATOM   2218  CG1 ILE A 171      91.078  24.420   7.060  1.00  0.98           C  
ATOM   2219  CG2 ILE A 171      91.859  22.020   6.573  1.00  0.98           C  
ATOM   2220  CD1 ILE A 171      92.317  24.966   7.770  1.00  0.98           C  
ATOM   2221  N   THR A 172      88.431  23.019   9.149  1.00  0.95           N  
ATOM   2222  CA  THR A 172      87.666  23.802  10.108  1.00  0.95           C  
ATOM   2223  C   THR A 172      88.579  24.045  11.290  1.00  0.95           C  
ATOM   2224  O   THR A 172      89.758  23.702  11.258  1.00  0.95           O  
ATOM   2225  CB  THR A 172      86.317  23.219  10.577  1.00  0.95           C  
ATOM   2226  OG1 THR A 172      86.418  22.022  11.339  1.00  0.95           O  
ATOM   2227  CG2 THR A 172      85.429  22.899   9.368  1.00  0.95           C  
ATOM   2228  N   GLU A 173      88.070  24.646  12.389  1.00  0.89           N  
ATOM   2229  CA  GLU A 173      88.792  24.699  13.660  1.00  0.89           C  
ATOM   2230  C   GLU A 173      89.209  23.330  14.163  1.00  0.89           C  
ATOM   2231  O   GLU A 173      90.359  23.135  14.537  1.00  0.89           O  
ATOM   2232  CB  GLU A 173      87.942  25.345  14.787  1.00  0.89           C  
ATOM   2233  CG  GLU A 173      88.587  25.355  16.202  1.00  0.89           C  
ATOM   2234  CD  GLU A 173      87.668  25.959  17.263  1.00  0.89           C  
ATOM   2235  OE1 GLU A 173      86.451  26.123  16.990  1.00  0.89           O  
ATOM   2236  OE2 GLU A 173      88.185  26.286  18.362  1.00  0.89           O  
ATOM   2237  N   HIS A 174      88.294  22.340  14.134  1.00  0.86           N  
ATOM   2238  CA  HIS A 174      88.565  21.031  14.688  1.00  0.86           C  
ATOM   2239  C   HIS A 174      88.903  19.993  13.638  1.00  0.86           C  
ATOM   2240  O   HIS A 174      89.530  18.984  13.951  1.00  0.86           O  
ATOM   2241  CB  HIS A 174      87.339  20.535  15.473  1.00  0.86           C  
ATOM   2242  CG  HIS A 174      87.091  21.334  16.700  1.00  0.86           C  
ATOM   2243  ND1 HIS A 174      87.826  21.034  17.826  1.00  0.86           N  
ATOM   2244  CD2 HIS A 174      86.240  22.362  16.941  1.00  0.86           C  
ATOM   2245  CE1 HIS A 174      87.403  21.885  18.740  1.00  0.86           C  
ATOM   2246  NE2 HIS A 174      86.447  22.718  18.255  1.00  0.86           N  
ATOM   2247  N   SER A 175      88.547  20.213  12.358  1.00  0.92           N  
ATOM   2248  CA  SER A 175      88.892  19.292  11.283  1.00  0.92           C  
ATOM   2249  C   SER A 175      90.086  19.857  10.548  1.00  0.92           C  
ATOM   2250  O   SER A 175      89.945  20.711   9.680  1.00  0.92           O  
ATOM   2251  CB  SER A 175      87.714  19.077  10.292  1.00  0.92           C  
ATOM   2252  OG  SER A 175      87.921  17.967   9.418  1.00  0.92           O  
ATOM   2253  N   TRP A 176      91.304  19.416  10.900  1.00  0.93           N  
ATOM   2254  CA  TRP A 176      92.517  19.935  10.311  1.00  0.93           C  
ATOM   2255  C   TRP A 176      93.603  18.912  10.522  1.00  0.93           C  
ATOM   2256  O   TRP A 176      93.434  17.967  11.291  1.00  0.93           O  
ATOM   2257  CB  TRP A 176      92.962  21.283  10.949  1.00  0.93           C  
ATOM   2258  CG  TRP A 176      93.339  21.197  12.425  1.00  0.93           C  
ATOM   2259  CD1 TRP A 176      92.511  21.057  13.499  1.00  0.93           C  
ATOM   2260  CD2 TRP A 176      94.679  21.170  12.950  1.00  0.93           C  
ATOM   2261  NE1 TRP A 176      93.238  20.944  14.660  1.00  0.93           N  
ATOM   2262  CE2 TRP A 176      94.572  21.012  14.346  1.00  0.93           C  
ATOM   2263  CE3 TRP A 176      95.919  21.271  12.333  1.00  0.93           C  
ATOM   2264  CZ2 TRP A 176      95.704  20.955  15.149  1.00  0.93           C  
ATOM   2265  CZ3 TRP A 176      97.059  21.211  13.143  1.00  0.93           C  
ATOM   2266  CH2 TRP A 176      96.955  21.049  14.527  1.00  0.93           C  
ATOM   2267  N   ASN A 177      94.754  19.083   9.853  1.00  0.94           N  
ATOM   2268  CA  ASN A 177      95.872  18.196  10.044  1.00  0.94           C  
ATOM   2269  C   ASN A 177      97.165  18.987   9.880  1.00  0.94           C  
ATOM   2270  O   ASN A 177      97.301  19.818   8.984  1.00  0.94           O  
ATOM   2271  CB  ASN A 177      95.696  17.010   9.069  1.00  0.94           C  
ATOM   2272  CG  ASN A 177      96.869  16.045   9.017  1.00  0.94           C  
ATOM   2273  OD1 ASN A 177      97.858  16.383   8.373  1.00  0.94           O  
ATOM   2274  ND2 ASN A 177      96.779  14.850   9.634  1.00  0.94           N  
ATOM   2275  N   ALA A 178      98.133  18.755  10.791  1.00  0.97           N  
ATOM   2276  CA  ALA A 178      99.447  19.366  10.829  1.00  0.97           C  
ATOM   2277  C   ALA A 178     100.347  19.049   9.636  1.00  0.97           C  
ATOM   2278  O   ALA A 178     101.016  19.938   9.107  1.00  0.97           O  
ATOM   2279  CB  ALA A 178     100.161  18.997  12.147  1.00  0.97           C  
ATOM   2280  N   ASP A 179     100.362  17.786   9.165  1.00  0.94           N  
ATOM   2281  CA  ASP A 179     101.082  17.349   7.980  1.00  0.94           C  
ATOM   2282  C   ASP A 179     100.556  18.031   6.729  1.00  0.94           C  
ATOM   2283  O   ASP A 179     101.315  18.438   5.855  1.00  0.94           O  
ATOM   2284  CB  ASP A 179     101.048  15.810   7.840  1.00  0.94           C  
ATOM   2285  CG  ASP A 179     101.859  15.163   8.952  1.00  0.94           C  
ATOM   2286  OD1 ASP A 179     102.780  15.835   9.489  1.00  0.94           O  
ATOM   2287  OD2 ASP A 179     101.554  13.988   9.267  1.00  0.94           O  
ATOM   2288  N   LEU A 180      99.229  18.240   6.635  1.00  0.95           N  
ATOM   2289  CA  LEU A 180      98.632  18.990   5.541  1.00  0.95           C  
ATOM   2290  C   LEU A 180      99.099  20.443   5.451  1.00  0.95           C  
ATOM   2291  O   LEU A 180      99.447  20.930   4.378  1.00  0.95           O  
ATOM   2292  CB  LEU A 180      97.089  18.939   5.585  1.00  0.95           C  
ATOM   2293  CG  LEU A 180      96.394  19.653   4.407  1.00  0.95           C  
ATOM   2294  CD1 LEU A 180      96.810  19.086   3.039  1.00  0.95           C  
ATOM   2295  CD2 LEU A 180      94.874  19.600   4.575  1.00  0.95           C  
ATOM   2296  N   TYR A 181      99.176  21.167   6.590  1.00  0.95           N  
ATOM   2297  CA  TYR A 181      99.799  22.485   6.653  1.00  0.95           C  
ATOM   2298  C   TYR A 181     101.275  22.458   6.299  1.00  0.95           C  
ATOM   2299  O   TYR A 181     101.784  23.355   5.635  1.00  0.95           O  
ATOM   2300  CB  TYR A 181      99.690  23.124   8.051  1.00  0.95           C  
ATOM   2301  CG  TYR A 181      98.372  23.791   8.273  1.00  0.95           C  
ATOM   2302  CD1 TYR A 181      98.117  25.040   7.688  1.00  0.95           C  
ATOM   2303  CD2 TYR A 181      97.424  23.241   9.146  1.00  0.95           C  
ATOM   2304  CE1 TYR A 181      96.952  25.746   8.003  1.00  0.95           C  
ATOM   2305  CE2 TYR A 181      96.241  23.932   9.435  1.00  0.95           C  
ATOM   2306  CZ  TYR A 181      96.020  25.200   8.885  1.00  0.95           C  
ATOM   2307  OH  TYR A 181      94.902  25.967   9.253  1.00  0.95           O  
ATOM   2308  N   LYS A 182     102.007  21.413   6.727  1.00  0.90           N  
ATOM   2309  CA  LYS A 182     103.384  21.206   6.318  1.00  0.90           C  
ATOM   2310  C   LYS A 182     103.549  21.023   4.811  1.00  0.90           C  
ATOM   2311  O   LYS A 182     104.457  21.582   4.200  1.00  0.90           O  
ATOM   2312  CB  LYS A 182     104.018  20.024   7.079  1.00  0.90           C  
ATOM   2313  CG  LYS A 182     105.519  19.849   6.799  1.00  0.90           C  
ATOM   2314  CD  LYS A 182     106.161  18.713   7.613  1.00  0.90           C  
ATOM   2315  CE  LYS A 182     106.173  18.905   9.132  1.00  0.90           C  
ATOM   2316  NZ  LYS A 182     106.904  20.139   9.483  1.00  0.90           N  
ATOM   2317  N   LEU A 183     102.633  20.273   4.170  1.00  0.94           N  
ATOM   2318  CA  LEU A 183     102.587  20.092   2.731  1.00  0.94           C  
ATOM   2319  C   LEU A 183     102.220  21.329   1.936  1.00  0.94           C  
ATOM   2320  O   LEU A 183     102.557  21.420   0.760  1.00  0.94           O  
ATOM   2321  CB  LEU A 183     101.617  18.966   2.324  1.00  0.94           C  
ATOM   2322  CG  LEU A 183     102.146  17.547   2.574  1.00  0.94           C  
ATOM   2323  CD1 LEU A 183     101.076  16.538   2.150  1.00  0.94           C  
ATOM   2324  CD2 LEU A 183     103.444  17.268   1.807  1.00  0.94           C  
ATOM   2325  N   MET A 184     101.596  22.357   2.543  1.00  0.93           N  
ATOM   2326  CA  MET A 184     101.390  23.646   1.898  1.00  0.93           C  
ATOM   2327  C   MET A 184     102.702  24.356   1.567  1.00  0.93           C  
ATOM   2328  O   MET A 184     102.791  25.169   0.650  1.00  0.93           O  
ATOM   2329  CB  MET A 184     100.531  24.586   2.767  1.00  0.93           C  
ATOM   2330  CG  MET A 184      99.054  24.185   2.949  1.00  0.93           C  
ATOM   2331  SD  MET A 184      98.096  24.140   1.402  1.00  0.93           S  
ATOM   2332  CE  MET A 184      98.117  22.336   1.216  1.00  0.93           C  
ATOM   2333  N   GLY A 185     103.789  23.997   2.284  1.00  0.95           N  
ATOM   2334  CA  GLY A 185     105.135  24.473   2.009  1.00  0.95           C  
ATOM   2335  C   GLY A 185     105.785  23.802   0.829  1.00  0.95           C  
ATOM   2336  O   GLY A 185     106.883  24.179   0.440  1.00  0.95           O  
ATOM   2337  N   HIS A 186     105.117  22.803   0.215  1.00  0.91           N  
ATOM   2338  CA  HIS A 186     105.595  22.091  -0.961  1.00  0.91           C  
ATOM   2339  C   HIS A 186     104.959  22.598  -2.245  1.00  0.91           C  
ATOM   2340  O   HIS A 186     105.111  22.016  -3.318  1.00  0.91           O  
ATOM   2341  CB  HIS A 186     105.336  20.575  -0.860  1.00  0.91           C  
ATOM   2342  CG  HIS A 186     106.090  19.903   0.246  1.00  0.91           C  
ATOM   2343  ND1 HIS A 186     106.710  18.700  -0.029  1.00  0.91           N  
ATOM   2344  CD2 HIS A 186     106.277  20.236   1.550  1.00  0.91           C  
ATOM   2345  CE1 HIS A 186     107.262  18.328   1.101  1.00  0.91           C  
ATOM   2346  NE2 HIS A 186     107.033  19.220   2.094  1.00  0.91           N  
ATOM   2347  N   PHE A 187     104.239  23.724  -2.159  1.00  0.94           N  
ATOM   2348  CA  PHE A 187     103.645  24.409  -3.282  1.00  0.94           C  
ATOM   2349  C   PHE A 187     104.357  25.734  -3.418  1.00  0.94           C  
ATOM   2350  O   PHE A 187     104.954  26.224  -2.460  1.00  0.94           O  
ATOM   2351  CB  PHE A 187     102.142  24.687  -3.051  1.00  0.94           C  
ATOM   2352  CG  PHE A 187     101.343  23.419  -3.052  1.00  0.94           C  
ATOM   2353  CD1 PHE A 187     101.284  22.607  -1.912  1.00  0.94           C  
ATOM   2354  CD2 PHE A 187     100.613  23.037  -4.185  1.00  0.94           C  
ATOM   2355  CE1 PHE A 187     100.539  21.423  -1.910  1.00  0.94           C  
ATOM   2356  CE2 PHE A 187      99.842  21.870  -4.181  1.00  0.94           C  
ATOM   2357  CZ  PHE A 187      99.818  21.052  -3.048  1.00  0.94           C  
ATOM   2358  N   ALA A 188     104.312  26.363  -4.611  1.00  0.95           N  
ATOM   2359  CA  ALA A 188     104.882  27.676  -4.854  1.00  0.95           C  
ATOM   2360  C   ALA A 188     104.258  28.746  -3.979  1.00  0.95           C  
ATOM   2361  O   ALA A 188     104.935  29.619  -3.438  1.00  0.95           O  
ATOM   2362  CB  ALA A 188     104.726  28.057  -6.334  1.00  0.95           C  
ATOM   2363  N   TRP A 189     102.940  28.643  -3.771  1.00  0.87           N  
ATOM   2364  CA  TRP A 189     102.232  29.539  -2.904  1.00  0.87           C  
ATOM   2365  C   TRP A 189     101.063  28.789  -2.298  1.00  0.87           C  
ATOM   2366  O   TRP A 189     100.656  27.733  -2.775  1.00  0.87           O  
ATOM   2367  CB  TRP A 189     101.777  30.778  -3.705  1.00  0.87           C  
ATOM   2368  CG  TRP A 189     101.071  31.840  -2.896  1.00  0.87           C  
ATOM   2369  CD1 TRP A 189     101.590  32.831  -2.115  1.00  0.87           C  
ATOM   2370  CD2 TRP A 189      99.645  31.957  -2.808  1.00  0.87           C  
ATOM   2371  NE1 TRP A 189     100.576  33.564  -1.538  1.00  0.87           N  
ATOM   2372  CE2 TRP A 189      99.377  33.055  -1.974  1.00  0.87           C  
ATOM   2373  CE3 TRP A 189      98.619  31.217  -3.386  1.00  0.87           C  
ATOM   2374  CZ2 TRP A 189      98.080  33.462  -1.728  1.00  0.87           C  
ATOM   2375  CZ3 TRP A 189      97.304  31.614  -3.122  1.00  0.87           C  
ATOM   2376  CH2 TRP A 189      97.047  32.728  -2.318  1.00  0.87           C  
ATOM   2377  N   TRP A 190     100.497  29.322  -1.202  1.00  0.92           N  
ATOM   2378  CA  TRP A 190      99.362  28.710  -0.558  1.00  0.92           C  
ATOM   2379  C   TRP A 190      98.580  29.761   0.201  1.00  0.92           C  
ATOM   2380  O   TRP A 190      99.083  30.859   0.438  1.00  0.92           O  
ATOM   2381  CB  TRP A 190      99.779  27.571   0.418  1.00  0.92           C  
ATOM   2382  CG  TRP A 190     100.452  28.018   1.708  1.00  0.92           C  
ATOM   2383  CD1 TRP A 190     101.750  28.369   1.937  1.00  0.92           C  
ATOM   2384  CD2 TRP A 190      99.775  28.134   2.973  1.00  0.92           C  
ATOM   2385  NE1 TRP A 190     101.922  28.742   3.255  1.00  0.92           N  
ATOM   2386  CE2 TRP A 190     100.719  28.593   3.905  1.00  0.92           C  
ATOM   2387  CE3 TRP A 190      98.464  27.867   3.349  1.00  0.92           C  
ATOM   2388  CZ2 TRP A 190     100.371  28.802   5.233  1.00  0.92           C  
ATOM   2389  CZ3 TRP A 190      98.105  28.105   4.680  1.00  0.92           C  
ATOM   2390  CH2 TRP A 190      99.045  28.555   5.609  1.00  0.92           C  
ATOM   2391  N   THR A 191      97.342  29.443   0.623  1.00  0.96           N  
ATOM   2392  CA  THR A 191      96.580  30.290   1.534  1.00  0.96           C  
ATOM   2393  C   THR A 191      95.480  29.491   2.192  1.00  0.96           C  
ATOM   2394  O   THR A 191      95.215  28.351   1.818  1.00  0.96           O  
ATOM   2395  CB  THR A 191      95.977  31.540   0.887  1.00  0.96           C  
ATOM   2396  OG1 THR A 191      95.512  32.480   1.848  1.00  0.96           O  
ATOM   2397  CG2 THR A 191      94.822  31.196  -0.068  1.00  0.96           C  
ATOM   2398  N   ALA A 192      94.804  30.096   3.186  1.00  0.97           N  
ATOM   2399  CA  ALA A 192      93.563  29.620   3.743  1.00  0.97           C  
ATOM   2400  C   ALA A 192      92.489  30.591   3.276  1.00  0.97           C  
ATOM   2401  O   ALA A 192      92.563  31.787   3.549  1.00  0.97           O  
ATOM   2402  CB  ALA A 192      93.623  29.587   5.284  1.00  0.97           C  
ATOM   2403  N   PHE A 193      91.482  30.103   2.527  1.00  0.95           N  
ATOM   2404  CA  PHE A 193      90.454  30.935   1.930  1.00  0.95           C  
ATOM   2405  C   PHE A 193      89.117  30.666   2.600  1.00  0.95           C  
ATOM   2406  O   PHE A 193      88.685  29.523   2.732  1.00  0.95           O  
ATOM   2407  CB  PHE A 193      90.370  30.662   0.402  1.00  0.95           C  
ATOM   2408  CG  PHE A 193      89.265  31.423  -0.282  1.00  0.95           C  
ATOM   2409  CD1 PHE A 193      89.378  32.802  -0.511  1.00  0.95           C  
ATOM   2410  CD2 PHE A 193      88.085  30.765  -0.669  1.00  0.95           C  
ATOM   2411  CE1 PHE A 193      88.337  33.508  -1.125  1.00  0.95           C  
ATOM   2412  CE2 PHE A 193      87.047  31.470  -1.287  1.00  0.95           C  
ATOM   2413  CZ  PHE A 193      87.173  32.840  -1.515  1.00  0.95           C  
ATOM   2414  N   VAL A 194      88.429  31.741   3.019  1.00  0.93           N  
ATOM   2415  CA  VAL A 194      87.125  31.693   3.647  1.00  0.93           C  
ATOM   2416  C   VAL A 194      86.133  32.253   2.657  1.00  0.93           C  
ATOM   2417  O   VAL A 194      86.281  33.384   2.204  1.00  0.93           O  
ATOM   2418  CB  VAL A 194      87.101  32.559   4.900  1.00  0.93           C  
ATOM   2419  CG1 VAL A 194      85.690  32.661   5.512  1.00  0.93           C  
ATOM   2420  CG2 VAL A 194      88.080  31.953   5.918  1.00  0.93           C  
ATOM   2421  N   THR A 195      85.101  31.472   2.270  1.00  0.93           N  
ATOM   2422  CA  THR A 195      83.999  31.960   1.446  1.00  0.93           C  
ATOM   2423  C   THR A 195      83.177  33.007   2.179  1.00  0.93           C  
ATOM   2424  O   THR A 195      82.907  32.879   3.372  1.00  0.93           O  
ATOM   2425  CB  THR A 195      83.066  30.865   0.912  1.00  0.93           C  
ATOM   2426  OG1 THR A 195      82.348  30.181   1.928  1.00  0.93           O  
ATOM   2427  CG2 THR A 195      83.872  29.787   0.178  1.00  0.93           C  
ATOM   2428  N   ASN A 196      82.730  34.082   1.498  1.00  0.87           N  
ATOM   2429  CA  ASN A 196      81.913  35.102   2.139  1.00  0.87           C  
ATOM   2430  C   ASN A 196      80.531  34.599   2.553  1.00  0.87           C  
ATOM   2431  O   ASN A 196      79.956  35.079   3.528  1.00  0.87           O  
ATOM   2432  CB  ASN A 196      81.764  36.358   1.248  1.00  0.87           C  
ATOM   2433  CG  ASN A 196      82.909  37.342   1.470  1.00  0.87           C  
ATOM   2434  OD1 ASN A 196      83.686  37.272   2.418  1.00  0.87           O  
ATOM   2435  ND2 ASN A 196      83.015  38.329   0.550  1.00  0.87           N  
ATOM   2436  N   VAL A 197      79.951  33.608   1.845  1.00  0.89           N  
ATOM   2437  CA  VAL A 197      78.665  33.034   2.229  1.00  0.89           C  
ATOM   2438  C   VAL A 197      78.677  32.231   3.521  1.00  0.89           C  
ATOM   2439  O   VAL A 197      77.647  32.112   4.179  1.00  0.89           O  
ATOM   2440  CB  VAL A 197      78.003  32.177   1.152  1.00  0.89           C  
ATOM   2441  CG1 VAL A 197      77.628  33.071  -0.037  1.00  0.89           C  
ATOM   2442  CG2 VAL A 197      78.874  30.980   0.724  1.00  0.89           C  
ATOM   2443  N   ASN A 198      79.842  31.669   3.911  1.00  0.86           N  
ATOM   2444  CA  ASN A 198      79.974  30.795   5.060  1.00  0.86           C  
ATOM   2445  C   ASN A 198      80.971  31.373   6.059  1.00  0.86           C  
ATOM   2446  O   ASN A 198      81.582  30.664   6.856  1.00  0.86           O  
ATOM   2447  CB  ASN A 198      80.393  29.373   4.604  1.00  0.86           C  
ATOM   2448  CG  ASN A 198      79.986  28.341   5.650  1.00  0.86           C  
ATOM   2449  OD1 ASN A 198      79.013  28.486   6.386  1.00  0.86           O  
ATOM   2450  ND2 ASN A 198      80.725  27.215   5.737  1.00  0.86           N  
ATOM   2451  N   ALA A 199      81.156  32.709   6.062  1.00  0.89           N  
ATOM   2452  CA  ALA A 199      82.110  33.393   6.910  1.00  0.89           C  
ATOM   2453  C   ALA A 199      81.827  33.340   8.419  1.00  0.89           C  
ATOM   2454  O   ALA A 199      82.685  33.675   9.235  1.00  0.89           O  
ATOM   2455  CB  ALA A 199      82.231  34.850   6.446  1.00  0.89           C  
ATOM   2456  N   SER A 200      80.632  32.853   8.816  1.00  0.84           N  
ATOM   2457  CA  SER A 200      80.203  32.620  10.189  1.00  0.84           C  
ATOM   2458  C   SER A 200      80.693  31.281  10.711  1.00  0.84           C  
ATOM   2459  O   SER A 200      80.550  30.962  11.891  1.00  0.84           O  
ATOM   2460  CB  SER A 200      78.651  32.654  10.315  1.00  0.84           C  
ATOM   2461  OG  SER A 200      78.002  31.735   9.437  1.00  0.84           O  
ATOM   2462  N   SER A 201      81.334  30.473   9.842  1.00  0.88           N  
ATOM   2463  CA  SER A 201      81.949  29.211  10.204  1.00  0.88           C  
ATOM   2464  C   SER A 201      83.459  29.345  10.259  1.00  0.88           C  
ATOM   2465  O   SER A 201      84.068  30.221   9.642  1.00  0.88           O  
ATOM   2466  CB  SER A 201      81.550  28.095   9.198  1.00  0.88           C  
ATOM   2467  OG  SER A 201      82.114  26.807   9.485  1.00  0.88           O  
ATOM   2468  N   SER A 202      84.115  28.431  11.017  1.00  0.90           N  
ATOM   2469  CA  SER A 202      85.565  28.323  11.157  1.00  0.90           C  
ATOM   2470  C   SER A 202      86.164  27.558   9.985  1.00  0.90           C  
ATOM   2471  O   SER A 202      87.375  27.355   9.904  1.00  0.90           O  
ATOM   2472  CB  SER A 202      86.006  27.611  12.477  1.00  0.90           C  
ATOM   2473  OG  SER A 202      85.532  26.262  12.584  1.00  0.90           O  
ATOM   2474  N   GLU A 203      85.310  27.154   9.023  1.00  0.91           N  
ATOM   2475  CA  GLU A 203      85.667  26.595   7.734  1.00  0.91           C  
ATOM   2476  C   GLU A 203      86.581  27.488   6.920  1.00  0.91           C  
ATOM   2477  O   GLU A 203      86.456  28.714   6.904  1.00  0.91           O  
ATOM   2478  CB  GLU A 203      84.384  26.241   6.924  1.00  0.91           C  
ATOM   2479  CG  GLU A 203      84.560  25.733   5.469  1.00  0.91           C  
ATOM   2480  CD  GLU A 203      83.237  25.376   4.825  1.00  0.91           C  
ATOM   2481  OE1 GLU A 203      82.749  24.212   4.930  1.00  0.91           O  
ATOM   2482  OE2 GLU A 203      82.645  26.280   4.189  1.00  0.91           O  
ATOM   2483  N   ALA A 204      87.538  26.852   6.235  1.00  0.98           N  
ATOM   2484  CA  ALA A 204      88.338  27.486   5.233  1.00  0.98           C  
ATOM   2485  C   ALA A 204      88.792  26.401   4.296  1.00  0.98           C  
ATOM   2486  O   ALA A 204      88.780  25.219   4.632  1.00  0.98           O  
ATOM   2487  CB  ALA A 204      89.569  28.197   5.825  1.00  0.98           C  
ATOM   2488  N   PHE A 205      89.201  26.787   3.084  1.00  0.99           N  
ATOM   2489  CA  PHE A 205      89.819  25.889   2.140  1.00  0.99           C  
ATOM   2490  C   PHE A 205      91.297  26.197   2.140  1.00  0.99           C  
ATOM   2491  O   PHE A 205      91.713  27.317   1.844  1.00  0.99           O  
ATOM   2492  CB  PHE A 205      89.265  26.061   0.705  1.00  0.99           C  
ATOM   2493  CG  PHE A 205      87.870  25.512   0.624  1.00  0.99           C  
ATOM   2494  CD1 PHE A 205      86.756  26.310   0.936  1.00  0.99           C  
ATOM   2495  CD2 PHE A 205      87.662  24.170   0.268  1.00  0.99           C  
ATOM   2496  CE1 PHE A 205      85.463  25.773   0.909  1.00  0.99           C  
ATOM   2497  CE2 PHE A 205      86.369  23.634   0.230  1.00  0.99           C  
ATOM   2498  CZ  PHE A 205      85.268  24.434   0.552  1.00  0.99           C  
ATOM   2499  N   LEU A 206      92.135  25.200   2.488  1.00  0.98           N  
ATOM   2500  CA  LEU A 206      93.572  25.287   2.333  1.00  0.98           C  
ATOM   2501  C   LEU A 206      93.906  25.068   0.882  1.00  0.98           C  
ATOM   2502  O   LEU A 206      93.676  23.998   0.322  1.00  0.98           O  
ATOM   2503  CB  LEU A 206      94.367  24.256   3.170  1.00  0.98           C  
ATOM   2504  CG  LEU A 206      94.363  24.495   4.689  1.00  0.98           C  
ATOM   2505  CD1 LEU A 206      95.278  23.475   5.383  1.00  0.98           C  
ATOM   2506  CD2 LEU A 206      94.800  25.915   5.072  1.00  0.98           C  
ATOM   2507  N   ILE A 207      94.438  26.113   0.241  1.00  0.98           N  
ATOM   2508  CA  ILE A 207      94.680  26.127  -1.180  1.00  0.98           C  
ATOM   2509  C   ILE A 207      96.164  26.107  -1.367  1.00  0.98           C  
ATOM   2510  O   ILE A 207      96.858  27.026  -0.949  1.00  0.98           O  
ATOM   2511  CB  ILE A 207      94.074  27.341  -1.871  1.00  0.98           C  
ATOM   2512  CG1 ILE A 207      92.536  27.278  -1.741  1.00  0.98           C  
ATOM   2513  CG2 ILE A 207      94.505  27.383  -3.356  1.00  0.98           C  
ATOM   2514  CD1 ILE A 207      91.816  28.549  -2.193  1.00  0.98           C  
ATOM   2515  N   GLY A 208      96.681  25.046  -2.006  1.00  1.00           N  
ATOM   2516  CA  GLY A 208      98.075  24.951  -2.398  1.00  1.00           C  
ATOM   2517  C   GLY A 208      98.097  25.192  -3.870  1.00  1.00           C  
ATOM   2518  O   GLY A 208      97.394  24.512  -4.612  1.00  1.00           O  
ATOM   2519  N   CYS A 209      98.888  26.167  -4.344  1.00  0.97           N  
ATOM   2520  CA  CYS A 209      98.916  26.514  -5.749  1.00  0.97           C  
ATOM   2521  C   CYS A 209     100.280  26.190  -6.310  1.00  0.97           C  
ATOM   2522  O   CYS A 209     101.302  26.676  -5.827  1.00  0.97           O  
ATOM   2523  CB  CYS A 209      98.576  28.008  -5.994  1.00  0.97           C  
ATOM   2524  SG  CYS A 209      98.090  28.378  -7.716  1.00  0.97           S  
ATOM   2525  N   ASN A 210     100.299  25.310  -7.330  1.00  0.93           N  
ATOM   2526  CA  ASN A 210     101.480  24.910  -8.065  1.00  0.93           C  
ATOM   2527  C   ASN A 210     102.454  24.040  -7.283  1.00  0.93           C  
ATOM   2528  O   ASN A 210     103.441  24.502  -6.716  1.00  0.93           O  
ATOM   2529  CB  ASN A 210     102.204  26.070  -8.782  1.00  0.93           C  
ATOM   2530  CG  ASN A 210     101.264  26.929  -9.624  1.00  0.93           C  
ATOM   2531  OD1 ASN A 210     101.261  28.152  -9.496  1.00  0.93           O  
ATOM   2532  ND2 ASN A 210     100.451  26.318 -10.517  1.00  0.93           N  
ATOM   2533  N   TYR A 211     102.174  22.727  -7.217  1.00  0.93           N  
ATOM   2534  CA  TYR A 211     102.973  21.745  -6.506  1.00  0.93           C  
ATOM   2535  C   TYR A 211     104.403  21.603  -7.021  1.00  0.93           C  
ATOM   2536  O   TYR A 211     104.637  21.412  -8.213  1.00  0.93           O  
ATOM   2537  CB  TYR A 211     102.217  20.393  -6.544  1.00  0.93           C  
ATOM   2538  CG  TYR A 211     102.845  19.288  -5.737  1.00  0.93           C  
ATOM   2539  CD1 TYR A 211     103.123  19.436  -4.368  1.00  0.93           C  
ATOM   2540  CD2 TYR A 211     103.125  18.059  -6.353  1.00  0.93           C  
ATOM   2541  CE1 TYR A 211     103.676  18.375  -3.637  1.00  0.93           C  
ATOM   2542  CE2 TYR A 211     103.687  17.002  -5.626  1.00  0.93           C  
ATOM   2543  CZ  TYR A 211     103.963  17.163  -4.265  1.00  0.93           C  
ATOM   2544  OH  TYR A 211     104.589  16.138  -3.533  1.00  0.93           O  
ATOM   2545  N   LEU A 212     105.398  21.679  -6.115  1.00  0.89           N  
ATOM   2546  CA  LEU A 212     106.799  21.646  -6.496  1.00  0.89           C  
ATOM   2547  C   LEU A 212     107.471  20.335  -6.149  1.00  0.89           C  
ATOM   2548  O   LEU A 212     108.600  20.080  -6.561  1.00  0.89           O  
ATOM   2549  CB  LEU A 212     107.562  22.770  -5.763  1.00  0.89           C  
ATOM   2550  CG  LEU A 212     107.050  24.189  -6.073  1.00  0.89           C  
ATOM   2551  CD1 LEU A 212     107.827  25.221  -5.244  1.00  0.89           C  
ATOM   2552  CD2 LEU A 212     107.119  24.532  -7.569  1.00  0.89           C  
ATOM   2553  N   GLY A 213     106.786  19.452  -5.392  1.00  0.90           N  
ATOM   2554  CA  GLY A 213     107.302  18.126  -5.059  1.00  0.90           C  
ATOM   2555  C   GLY A 213     108.335  18.101  -3.976  1.00  0.90           C  
ATOM   2556  O   GLY A 213     108.914  17.062  -3.684  1.00  0.90           O  
ATOM   2557  N   LYS A 214     108.607  19.256  -3.358  1.00  0.83           N  
ATOM   2558  CA  LYS A 214     109.624  19.366  -2.353  1.00  0.83           C  
ATOM   2559  C   LYS A 214     109.337  20.620  -1.564  1.00  0.83           C  
ATOM   2560  O   LYS A 214     108.599  21.471  -2.067  1.00  0.83           O  
ATOM   2561  CB  LYS A 214     111.037  19.437  -3.002  1.00  0.83           C  
ATOM   2562  CG  LYS A 214     111.333  20.716  -3.806  1.00  0.83           C  
ATOM   2563  CD  LYS A 214     112.765  20.702  -4.365  1.00  0.83           C  
ATOM   2564  CE  LYS A 214     113.145  21.990  -5.102  1.00  0.83           C  
ATOM   2565  NZ  LYS A 214     114.545  21.929  -5.598  1.00  0.83           N  
ATOM   2566  N   PRO A 215     109.888  20.826  -0.374  1.00  0.87           N  
ATOM   2567  CA  PRO A 215     109.483  21.948   0.445  1.00  0.87           C  
ATOM   2568  C   PRO A 215     110.267  23.176   0.032  1.00  0.87           C  
ATOM   2569  O   PRO A 215     111.498  23.139  -0.021  1.00  0.87           O  
ATOM   2570  CB  PRO A 215     109.837  21.520   1.884  1.00  0.87           C  
ATOM   2571  CG  PRO A 215     110.968  20.504   1.710  1.00  0.87           C  
ATOM   2572  CD  PRO A 215     110.641  19.830   0.381  1.00  0.87           C  
ATOM   2573  N   ARG A 216     109.574  24.301  -0.234  1.00  0.74           N  
ATOM   2574  CA  ARG A 216     110.207  25.592  -0.392  1.00  0.74           C  
ATOM   2575  C   ARG A 216     110.232  26.327   0.931  1.00  0.74           C  
ATOM   2576  O   ARG A 216     110.965  27.296   1.083  1.00  0.74           O  
ATOM   2577  CB  ARG A 216     109.477  26.496  -1.428  1.00  0.74           C  
ATOM   2578  CG  ARG A 216     107.973  26.737  -1.166  1.00  0.74           C  
ATOM   2579  CD  ARG A 216     107.425  28.050  -1.748  1.00  0.74           C  
ATOM   2580  NE  ARG A 216     107.846  29.178  -0.847  1.00  0.74           N  
ATOM   2581  CZ  ARG A 216     107.182  29.551   0.256  1.00  0.74           C  
ATOM   2582  NH1 ARG A 216     106.067  28.934   0.636  1.00  0.74           N  
ATOM   2583  NH2 ARG A 216     107.672  30.523   1.025  1.00  0.74           N  
ATOM   2584  N   GLU A 217     109.435  25.857   1.910  1.00  0.78           N  
ATOM   2585  CA  GLU A 217     109.411  26.413   3.242  1.00  0.78           C  
ATOM   2586  C   GLU A 217     109.069  25.311   4.215  1.00  0.78           C  
ATOM   2587  O   GLU A 217     108.236  24.449   3.930  1.00  0.78           O  
ATOM   2588  CB  GLU A 217     108.362  27.551   3.351  1.00  0.78           C  
ATOM   2589  CG  GLU A 217     108.165  28.175   4.757  1.00  0.78           C  
ATOM   2590  CD  GLU A 217     109.416  28.877   5.287  1.00  0.78           C  
ATOM   2591  OE1 GLU A 217     110.405  28.997   4.523  1.00  0.78           O  
ATOM   2592  OE2 GLU A 217     109.368  29.309   6.462  1.00  0.78           O  
ATOM   2593  N   GLN A 218     109.717  25.300   5.397  1.00  0.79           N  
ATOM   2594  CA  GLN A 218     109.428  24.336   6.438  1.00  0.79           C  
ATOM   2595  C   GLN A 218     108.341  24.856   7.360  1.00  0.79           C  
ATOM   2596  O   GLN A 218     108.545  25.767   8.153  1.00  0.79           O  
ATOM   2597  CB  GLN A 218     110.679  24.022   7.295  1.00  0.79           C  
ATOM   2598  CG  GLN A 218     111.881  23.467   6.499  1.00  0.79           C  
ATOM   2599  CD  GLN A 218     111.552  22.124   5.852  1.00  0.79           C  
ATOM   2600  OE1 GLN A 218     110.777  21.316   6.366  1.00  0.79           O  
ATOM   2601  NE2 GLN A 218     112.169  21.869   4.674  1.00  0.79           N  
ATOM   2602  N   ILE A 219     107.139  24.255   7.306  1.00  0.81           N  
ATOM   2603  CA  ILE A 219     106.002  24.740   8.068  1.00  0.81           C  
ATOM   2604  C   ILE A 219     105.748  23.800   9.233  1.00  0.81           C  
ATOM   2605  O   ILE A 219     105.731  22.573   9.096  1.00  0.81           O  
ATOM   2606  CB  ILE A 219     104.769  24.919   7.176  1.00  0.81           C  
ATOM   2607  CG1 ILE A 219     105.010  26.066   6.163  1.00  0.81           C  
ATOM   2608  CG2 ILE A 219     103.487  25.166   8.003  1.00  0.81           C  
ATOM   2609  CD1 ILE A 219     103.894  26.216   5.123  1.00  0.81           C  
ATOM   2610  N   ASP A 220     105.566  24.371  10.442  1.00  0.82           N  
ATOM   2611  CA  ASP A 220     105.033  23.686  11.597  1.00  0.82           C  
ATOM   2612  C   ASP A 220     103.520  23.814  11.520  1.00  0.82           C  
ATOM   2613  O   ASP A 220     102.954  24.906  11.556  1.00  0.82           O  
ATOM   2614  CB  ASP A 220     105.649  24.301  12.877  1.00  0.82           C  
ATOM   2615  CG  ASP A 220     105.212  23.645  14.181  1.00  0.82           C  
ATOM   2616  OD1 ASP A 220     104.066  23.131  14.258  1.00  0.82           O  
ATOM   2617  OD2 ASP A 220     106.033  23.736  15.129  1.00  0.82           O  
ATOM   2618  N   GLY A 221     102.830  22.669  11.341  1.00  0.86           N  
ATOM   2619  CA  GLY A 221     101.393  22.648  11.165  1.00  0.86           C  
ATOM   2620  C   GLY A 221     100.558  22.971  12.373  1.00  0.86           C  
ATOM   2621  O   GLY A 221      99.454  23.489  12.231  1.00  0.86           O  
ATOM   2622  N   TYR A 222     101.052  22.683  13.597  1.00  0.80           N  
ATOM   2623  CA  TYR A 222     100.374  23.051  14.834  1.00  0.80           C  
ATOM   2624  C   TYR A 222     100.400  24.555  15.026  1.00  0.80           C  
ATOM   2625  O   TYR A 222      99.381  25.179  15.324  1.00  0.80           O  
ATOM   2626  CB  TYR A 222     101.016  22.361  16.070  1.00  0.80           C  
ATOM   2627  CG  TYR A 222     100.391  21.021  16.373  1.00  0.80           C  
ATOM   2628  CD1 TYR A 222     100.786  19.843  15.718  1.00  0.80           C  
ATOM   2629  CD2 TYR A 222      99.391  20.936  17.357  1.00  0.80           C  
ATOM   2630  CE1 TYR A 222     100.168  18.617  16.012  1.00  0.80           C  
ATOM   2631  CE2 TYR A 222      98.780  19.715  17.662  1.00  0.80           C  
ATOM   2632  CZ  TYR A 222      99.160  18.556  16.987  1.00  0.80           C  
ATOM   2633  OH  TYR A 222      98.525  17.343  17.317  1.00  0.80           O  
ATOM   2634  N   VAL A 223     101.574  25.176  14.788  1.00  0.81           N  
ATOM   2635  CA  VAL A 223     101.716  26.627  14.801  1.00  0.81           C  
ATOM   2636  C   VAL A 223     100.883  27.298  13.721  1.00  0.81           C  
ATOM   2637  O   VAL A 223     100.180  28.277  13.962  1.00  0.81           O  
ATOM   2638  CB  VAL A 223     103.171  27.053  14.647  1.00  0.81           C  
ATOM   2639  CG1 VAL A 223     103.294  28.586  14.536  1.00  0.81           C  
ATOM   2640  CG2 VAL A 223     103.957  26.561  15.874  1.00  0.81           C  
ATOM   2641  N   MET A 224     100.907  26.771  12.483  1.00  0.82           N  
ATOM   2642  CA  MET A 224     100.167  27.360  11.386  1.00  0.82           C  
ATOM   2643  C   MET A 224      98.657  27.351  11.552  1.00  0.82           C  
ATOM   2644  O   MET A 224      97.980  28.326  11.227  1.00  0.82           O  
ATOM   2645  CB  MET A 224     100.552  26.729  10.038  1.00  0.82           C  
ATOM   2646  CG  MET A 224     100.159  27.608   8.838  1.00  0.82           C  
ATOM   2647  SD  MET A 224     100.856  29.288   8.868  1.00  0.82           S  
ATOM   2648  CE  MET A 224     102.577  28.783   8.605  1.00  0.82           C  
ATOM   2649  N   HIS A 225      98.084  26.262  12.106  1.00  0.84           N  
ATOM   2650  CA  HIS A 225      96.675  26.244  12.466  1.00  0.84           C  
ATOM   2651  C   HIS A 225      96.323  27.277  13.530  1.00  0.84           C  
ATOM   2652  O   HIS A 225      95.333  27.987  13.415  1.00  0.84           O  
ATOM   2653  CB  HIS A 225      96.187  24.846  12.891  1.00  0.84           C  
ATOM   2654  CG  HIS A 225      94.691  24.718  12.894  1.00  0.84           C  
ATOM   2655  ND1 HIS A 225      93.983  24.964  11.728  1.00  0.84           N  
ATOM   2656  CD2 HIS A 225      93.846  24.344  13.886  1.00  0.84           C  
ATOM   2657  CE1 HIS A 225      92.723  24.727  12.038  1.00  0.84           C  
ATOM   2658  NE2 HIS A 225      92.587  24.349  13.330  1.00  0.84           N  
ATOM   2659  N   ALA A 226      97.177  27.457  14.561  1.00  0.84           N  
ATOM   2660  CA  ALA A 226      97.021  28.519  15.539  1.00  0.84           C  
ATOM   2661  C   ALA A 226      97.056  29.922  14.929  1.00  0.84           C  
ATOM   2662  O   ALA A 226      96.252  30.787  15.273  1.00  0.84           O  
ATOM   2663  CB  ALA A 226      98.106  28.382  16.617  1.00  0.84           C  
ATOM   2664  N   ASN A 227      97.956  30.159  13.954  1.00  0.81           N  
ATOM   2665  CA  ASN A 227      98.001  31.376  13.155  1.00  0.81           C  
ATOM   2666  C   ASN A 227      96.721  31.632  12.350  1.00  0.81           C  
ATOM   2667  O   ASN A 227      96.225  32.757  12.295  1.00  0.81           O  
ATOM   2668  CB  ASN A 227      99.192  31.360  12.166  1.00  0.81           C  
ATOM   2669  CG  ASN A 227     100.548  31.324  12.868  1.00  0.81           C  
ATOM   2670  OD1 ASN A 227     100.700  31.605  14.056  1.00  0.81           O  
ATOM   2671  ND2 ASN A 227     101.609  31.016  12.082  1.00  0.81           N  
ATOM   2672  N   TYR A 228      96.141  30.579  11.730  1.00  0.87           N  
ATOM   2673  CA  TYR A 228      94.847  30.625  11.060  1.00  0.87           C  
ATOM   2674  C   TYR A 228      93.710  30.998  12.013  1.00  0.87           C  
ATOM   2675  O   TYR A 228      92.902  31.876  11.714  1.00  0.87           O  
ATOM   2676  CB  TYR A 228      94.577  29.250  10.360  1.00  0.87           C  
ATOM   2677  CG  TYR A 228      93.159  29.091   9.862  1.00  0.87           C  
ATOM   2678  CD1 TYR A 228      92.689  29.865   8.796  1.00  0.87           C  
ATOM   2679  CD2 TYR A 228      92.249  28.284  10.571  1.00  0.87           C  
ATOM   2680  CE1 TYR A 228      91.328  29.883   8.478  1.00  0.87           C  
ATOM   2681  CE2 TYR A 228      90.882  28.309  10.262  1.00  0.87           C  
ATOM   2682  CZ  TYR A 228      90.423  29.122   9.220  1.00  0.87           C  
ATOM   2683  OH  TYR A 228      89.048  29.249   8.937  1.00  0.87           O  
ATOM   2684  N   ILE A 229      93.645  30.369  13.203  1.00  0.86           N  
ATOM   2685  CA  ILE A 229      92.652  30.681  14.226  1.00  0.86           C  
ATOM   2686  C   ILE A 229      92.775  32.105  14.734  1.00  0.86           C  
ATOM   2687  O   ILE A 229      91.783  32.812  14.882  1.00  0.86           O  
ATOM   2688  CB  ILE A 229      92.703  29.702  15.390  1.00  0.86           C  
ATOM   2689  CG1 ILE A 229      92.429  28.247  14.942  1.00  0.86           C  
ATOM   2690  CG2 ILE A 229      91.734  30.119  16.516  1.00  0.86           C  
ATOM   2691  CD1 ILE A 229      91.114  28.014  14.196  1.00  0.86           C  
ATOM   2692  N   PHE A 230      94.012  32.591  14.957  1.00  0.84           N  
ATOM   2693  CA  PHE A 230      94.251  33.975  15.320  1.00  0.84           C  
ATOM   2694  C   PHE A 230      93.705  34.956  14.283  1.00  0.84           C  
ATOM   2695  O   PHE A 230      92.999  35.886  14.653  1.00  0.84           O  
ATOM   2696  CB  PHE A 230      95.767  34.176  15.563  1.00  0.84           C  
ATOM   2697  CG  PHE A 230      96.171  35.599  15.863  1.00  0.84           C  
ATOM   2698  CD1 PHE A 230      95.640  36.296  16.959  1.00  0.84           C  
ATOM   2699  CD2 PHE A 230      97.107  36.249  15.041  1.00  0.84           C  
ATOM   2700  CE1 PHE A 230      96.052  37.606  17.238  1.00  0.84           C  
ATOM   2701  CE2 PHE A 230      97.501  37.566  15.305  1.00  0.84           C  
ATOM   2702  CZ  PHE A 230      96.976  38.245  16.407  1.00  0.84           C  
ATOM   2703  N   TRP A 231      93.933  34.722  12.971  1.00  0.79           N  
ATOM   2704  CA  TRP A 231      93.345  35.532  11.911  1.00  0.79           C  
ATOM   2705  C   TRP A 231      91.817  35.538  11.933  1.00  0.79           C  
ATOM   2706  O   TRP A 231      91.180  36.585  11.831  1.00  0.79           O  
ATOM   2707  CB  TRP A 231      93.831  35.018  10.521  1.00  0.79           C  
ATOM   2708  CG  TRP A 231      93.171  35.664   9.305  1.00  0.79           C  
ATOM   2709  CD1 TRP A 231      92.931  36.990   9.090  1.00  0.79           C  
ATOM   2710  CD2 TRP A 231      92.486  34.962   8.248  1.00  0.79           C  
ATOM   2711  NE1 TRP A 231      92.183  37.171   7.950  1.00  0.79           N  
ATOM   2712  CE2 TRP A 231      91.891  35.937   7.427  1.00  0.79           C  
ATOM   2713  CE3 TRP A 231      92.336  33.605   7.976  1.00  0.79           C  
ATOM   2714  CZ2 TRP A 231      91.144  35.578   6.315  1.00  0.79           C  
ATOM   2715  CZ3 TRP A 231      91.620  33.249   6.823  1.00  0.79           C  
ATOM   2716  CH2 TRP A 231      91.026  34.218   6.009  1.00  0.79           C  
ATOM   2717  N   ARG A 232      91.187  34.360  12.090  1.00  0.80           N  
ATOM   2718  CA  ARG A 232      89.743  34.259  12.169  1.00  0.80           C  
ATOM   2719  C   ARG A 232      89.106  34.937  13.373  1.00  0.80           C  
ATOM   2720  O   ARG A 232      88.039  35.536  13.257  1.00  0.80           O  
ATOM   2721  CB  ARG A 232      89.285  32.789  12.130  1.00  0.80           C  
ATOM   2722  CG  ARG A 232      89.599  32.034  10.827  1.00  0.80           C  
ATOM   2723  CD  ARG A 232      89.173  32.712   9.517  1.00  0.80           C  
ATOM   2724  NE  ARG A 232      87.733  33.133   9.602  1.00  0.80           N  
ATOM   2725  CZ  ARG A 232      86.676  32.336   9.398  1.00  0.80           C  
ATOM   2726  NH1 ARG A 232      86.780  31.054   9.077  1.00  0.80           N  
ATOM   2727  NH2 ARG A 232      85.441  32.819   9.510  1.00  0.80           N  
ATOM   2728  N   ASN A 233      89.754  34.843  14.548  1.00  0.85           N  
ATOM   2729  CA  ASN A 233      89.367  35.520  15.771  1.00  0.85           C  
ATOM   2730  C   ASN A 233      89.473  37.045  15.696  1.00  0.85           C  
ATOM   2731  O   ASN A 233      88.684  37.759  16.311  1.00  0.85           O  
ATOM   2732  CB  ASN A 233      90.223  35.019  16.967  1.00  0.85           C  
ATOM   2733  CG  ASN A 233      89.826  33.602  17.375  1.00  0.85           C  
ATOM   2734  OD1 ASN A 233      88.838  33.040  16.908  1.00  0.85           O  
ATOM   2735  ND2 ASN A 233      90.593  33.009  18.323  1.00  0.85           N  
ATOM   2736  N   THR A 234      90.476  37.598  14.977  1.00  0.89           N  
ATOM   2737  CA  THR A 234      90.795  39.024  15.071  1.00  0.89           C  
ATOM   2738  C   THR A 234      90.423  39.861  13.877  1.00  0.89           C  
ATOM   2739  O   THR A 234      90.348  41.084  13.987  1.00  0.89           O  
ATOM   2740  CB  THR A 234      92.269  39.287  15.315  1.00  0.89           C  
ATOM   2741  OG1 THR A 234      93.085  38.705  14.309  1.00  0.89           O  
ATOM   2742  CG2 THR A 234      92.632  38.649  16.658  1.00  0.89           C  
ATOM   2743  N   ASN A 235      90.126  39.265  12.712  1.00  0.84           N  
ATOM   2744  CA  ASN A 235      89.606  40.031  11.599  1.00  0.84           C  
ATOM   2745  C   ASN A 235      88.270  39.420  11.181  1.00  0.84           C  
ATOM   2746  O   ASN A 235      88.240  38.442  10.431  1.00  0.84           O  
ATOM   2747  CB  ASN A 235      90.629  40.124  10.432  1.00  0.84           C  
ATOM   2748  CG  ASN A 235      91.697  41.199  10.677  1.00  0.84           C  
ATOM   2749  OD1 ASN A 235      92.879  41.001  10.391  1.00  0.84           O  
ATOM   2750  ND2 ASN A 235      91.274  42.390  11.169  1.00  0.84           N  
ATOM   2751  N   PRO A 236      87.132  39.976  11.632  1.00  0.88           N  
ATOM   2752  CA  PRO A 236      85.803  39.489  11.289  1.00  0.88           C  
ATOM   2753  C   PRO A 236      85.500  39.611   9.818  1.00  0.88           C  
ATOM   2754  O   PRO A 236      85.814  40.630   9.209  1.00  0.88           O  
ATOM   2755  CB  PRO A 236      84.820  40.361  12.096  1.00  0.88           C  
ATOM   2756  CG  PRO A 236      85.660  41.030  13.185  1.00  0.88           C  
ATOM   2757  CD  PRO A 236      87.065  41.070  12.602  1.00  0.88           C  
ATOM   2758  N   ILE A 237      84.860  38.593   9.229  1.00  0.87           N  
ATOM   2759  CA  ILE A 237      84.534  38.600   7.819  1.00  0.87           C  
ATOM   2760  C   ILE A 237      83.033  38.729   7.732  1.00  0.87           C  
ATOM   2761  O   ILE A 237      82.282  37.913   8.268  1.00  0.87           O  
ATOM   2762  CB  ILE A 237      85.042  37.347   7.122  1.00  0.87           C  
ATOM   2763  CG1 ILE A 237      86.587  37.284   7.206  1.00  0.87           C  
ATOM   2764  CG2 ILE A 237      84.552  37.326   5.658  1.00  0.87           C  
ATOM   2765  CD1 ILE A 237      87.179  35.945   6.755  1.00  0.87           C  
ATOM   2766  N   GLN A 238      82.549  39.821   7.109  1.00  0.81           N  
ATOM   2767  CA  GLN A 238      81.137  40.070   6.888  1.00  0.81           C  
ATOM   2768  C   GLN A 238      80.517  39.036   5.966  1.00  0.81           C  
ATOM   2769  O   GLN A 238      81.025  38.768   4.880  1.00  0.81           O  
ATOM   2770  CB  GLN A 238      80.923  41.497   6.318  1.00  0.81           C  
ATOM   2771  CG  GLN A 238      79.506  41.787   5.763  1.00  0.81           C  
ATOM   2772  CD  GLN A 238      79.380  43.223   5.254  1.00  0.81           C  
ATOM   2773  OE1 GLN A 238      80.065  44.145   5.690  1.00  0.81           O  
ATOM   2774  NE2 GLN A 238      78.464  43.433   4.277  1.00  0.81           N  
ATOM   2775  N   LEU A 239      79.382  38.436   6.383  1.00  0.84           N  
ATOM   2776  CA  LEU A 239      78.639  37.479   5.581  1.00  0.84           C  
ATOM   2777  C   LEU A 239      78.123  38.121   4.310  1.00  0.84           C  
ATOM   2778  O   LEU A 239      77.488  39.174   4.334  1.00  0.84           O  
ATOM   2779  CB  LEU A 239      77.448  36.871   6.363  1.00  0.84           C  
ATOM   2780  CG  LEU A 239      77.790  35.741   7.361  1.00  0.84           C  
ATOM   2781  CD1 LEU A 239      78.045  34.411   6.637  1.00  0.84           C  
ATOM   2782  CD2 LEU A 239      78.913  36.089   8.352  1.00  0.84           C  
ATOM   2783  N   SER A 240      78.407  37.513   3.148  1.00  0.85           N  
ATOM   2784  CA  SER A 240      77.987  38.128   1.910  1.00  0.85           C  
ATOM   2785  C   SER A 240      77.794  37.120   0.814  1.00  0.85           C  
ATOM   2786  O   SER A 240      78.552  36.171   0.641  1.00  0.85           O  
ATOM   2787  CB  SER A 240      78.960  39.228   1.426  1.00  0.85           C  
ATOM   2788  OG  SER A 240      78.465  39.878   0.257  1.00  0.85           O  
ATOM   2789  N   SER A 241      76.745  37.339   0.010  1.00  0.85           N  
ATOM   2790  CA  SER A 241      76.430  36.556  -1.157  1.00  0.85           C  
ATOM   2791  C   SER A 241      76.555  37.393  -2.414  1.00  0.85           C  
ATOM   2792  O   SER A 241      76.201  36.942  -3.498  1.00  0.85           O  
ATOM   2793  CB  SER A 241      74.979  36.031  -1.061  1.00  0.85           C  
ATOM   2794  OG  SER A 241      74.062  37.104  -0.834  1.00  0.85           O  
ATOM   2795  N   TYR A 242      77.095  38.631  -2.327  1.00  0.78           N  
ATOM   2796  CA  TYR A 242      77.064  39.601  -3.418  1.00  0.78           C  
ATOM   2797  C   TYR A 242      77.747  39.143  -4.696  1.00  0.78           C  
ATOM   2798  O   TYR A 242      77.272  39.397  -5.799  1.00  0.78           O  
ATOM   2799  CB  TYR A 242      77.699  40.952  -3.004  1.00  0.78           C  
ATOM   2800  CG  TYR A 242      76.988  41.682  -1.891  1.00  0.78           C  
ATOM   2801  CD1 TYR A 242      75.671  41.415  -1.472  1.00  0.78           C  
ATOM   2802  CD2 TYR A 242      77.692  42.713  -1.248  1.00  0.78           C  
ATOM   2803  CE1 TYR A 242      75.087  42.155  -0.435  1.00  0.78           C  
ATOM   2804  CE2 TYR A 242      77.110  43.456  -0.213  1.00  0.78           C  
ATOM   2805  CZ  TYR A 242      75.805  43.169   0.198  1.00  0.78           C  
ATOM   2806  OH  TYR A 242      75.200  43.883   1.250  1.00  0.78           O  
ATOM   2807  N   SER A 243      78.867  38.407  -4.567  1.00  0.82           N  
ATOM   2808  CA  SER A 243      79.613  37.890  -5.696  1.00  0.82           C  
ATOM   2809  C   SER A 243      78.888  36.810  -6.485  1.00  0.82           C  
ATOM   2810  O   SER A 243      79.220  36.554  -7.635  1.00  0.82           O  
ATOM   2811  CB  SER A 243      80.996  37.347  -5.274  1.00  0.82           C  
ATOM   2812  OG  SER A 243      80.886  36.181  -4.463  1.00  0.82           O  
ATOM   2813  N   LEU A 244      77.834  36.175  -5.920  1.00  0.81           N  
ATOM   2814  CA  LEU A 244      77.062  35.138  -6.590  1.00  0.81           C  
ATOM   2815  C   LEU A 244      76.162  35.672  -7.690  1.00  0.81           C  
ATOM   2816  O   LEU A 244      75.693  34.924  -8.543  1.00  0.81           O  
ATOM   2817  CB  LEU A 244      76.124  34.422  -5.594  1.00  0.81           C  
ATOM   2818  CG  LEU A 244      76.803  33.777  -4.377  1.00  0.81           C  
ATOM   2819  CD1 LEU A 244      75.728  33.118  -3.511  1.00  0.81           C  
ATOM   2820  CD2 LEU A 244      77.883  32.756  -4.744  1.00  0.81           C  
ATOM   2821  N   PHE A 245      75.893  36.991  -7.684  1.00  0.74           N  
ATOM   2822  CA  PHE A 245      74.968  37.607  -8.610  1.00  0.74           C  
ATOM   2823  C   PHE A 245      75.641  38.071  -9.894  1.00  0.74           C  
ATOM   2824  O   PHE A 245      74.951  38.408 -10.853  1.00  0.74           O  
ATOM   2825  CB  PHE A 245      74.257  38.808  -7.940  1.00  0.74           C  
ATOM   2826  CG  PHE A 245      73.254  38.337  -6.919  1.00  0.74           C  
ATOM   2827  CD1 PHE A 245      73.608  38.142  -5.574  1.00  0.74           C  
ATOM   2828  CD2 PHE A 245      71.926  38.097  -7.308  1.00  0.74           C  
ATOM   2829  CE1 PHE A 245      72.655  37.720  -4.638  1.00  0.74           C  
ATOM   2830  CE2 PHE A 245      70.971  37.676  -6.376  1.00  0.74           C  
ATOM   2831  CZ  PHE A 245      71.333  37.492  -5.038  1.00  0.74           C  
ATOM   2832  N   ASP A 246      76.990  38.043  -9.973  1.00  0.75           N  
ATOM   2833  CA  ASP A 246      77.688  38.290 -11.217  1.00  0.75           C  
ATOM   2834  C   ASP A 246      78.473  37.035 -11.570  1.00  0.75           C  
ATOM   2835  O   ASP A 246      79.482  36.675 -10.964  1.00  0.75           O  
ATOM   2836  CB  ASP A 246      78.566  39.566 -11.166  1.00  0.75           C  
ATOM   2837  CG  ASP A 246      79.019  40.001 -12.561  1.00  0.75           C  
ATOM   2838  OD1 ASP A 246      78.774  39.249 -13.551  1.00  0.75           O  
ATOM   2839  OD2 ASP A 246      79.641  41.086 -12.655  1.00  0.75           O  
ATOM   2840  N   MET A 247      77.974  36.320 -12.594  1.00  0.75           N  
ATOM   2841  CA  MET A 247      78.543  35.085 -13.073  1.00  0.75           C  
ATOM   2842  C   MET A 247      79.163  35.255 -14.453  1.00  0.75           C  
ATOM   2843  O   MET A 247      79.514  34.263 -15.092  1.00  0.75           O  
ATOM   2844  CB  MET A 247      77.457  33.977 -13.100  1.00  0.75           C  
ATOM   2845  CG  MET A 247      76.976  33.556 -11.695  1.00  0.75           C  
ATOM   2846  SD  MET A 247      78.273  32.846 -10.632  1.00  0.75           S  
ATOM   2847  CE  MET A 247      78.452  31.278 -11.525  1.00  0.75           C  
ATOM   2848  N   SER A 248      79.346  36.504 -14.959  1.00  0.76           N  
ATOM   2849  CA  SER A 248      79.812  36.735 -16.327  1.00  0.76           C  
ATOM   2850  C   SER A 248      81.190  36.192 -16.653  1.00  0.76           C  
ATOM   2851  O   SER A 248      81.430  35.627 -17.717  1.00  0.76           O  
ATOM   2852  CB  SER A 248      79.711  38.219 -16.808  1.00  0.76           C  
ATOM   2853  OG  SER A 248      80.621  39.141 -16.216  1.00  0.76           O  
ATOM   2854  N   LYS A 249      82.119  36.300 -15.689  1.00  0.77           N  
ATOM   2855  CA  LYS A 249      83.492  35.847 -15.811  1.00  0.77           C  
ATOM   2856  C   LYS A 249      83.768  34.631 -14.946  1.00  0.77           C  
ATOM   2857  O   LYS A 249      84.902  34.387 -14.547  1.00  0.77           O  
ATOM   2858  CB  LYS A 249      84.481  36.983 -15.463  1.00  0.77           C  
ATOM   2859  CG  LYS A 249      84.267  38.222 -16.341  1.00  0.77           C  
ATOM   2860  CD  LYS A 249      85.283  39.339 -16.067  1.00  0.77           C  
ATOM   2861  CE  LYS A 249      85.029  40.567 -16.946  1.00  0.77           C  
ATOM   2862  NZ  LYS A 249      86.021  41.628 -16.662  1.00  0.77           N  
ATOM   2863  N   PHE A 250      82.728  33.836 -14.621  1.00  0.82           N  
ATOM   2864  CA  PHE A 250      82.883  32.591 -13.885  1.00  0.82           C  
ATOM   2865  C   PHE A 250      83.709  31.465 -14.534  1.00  0.82           C  
ATOM   2866  O   PHE A 250      84.546  30.934 -13.805  1.00  0.82           O  
ATOM   2867  CB  PHE A 250      81.488  32.033 -13.482  1.00  0.82           C  
ATOM   2868  CG  PHE A 250      81.592  30.847 -12.555  1.00  0.82           C  
ATOM   2869  CD1 PHE A 250      82.074  31.033 -11.254  1.00  0.82           C  
ATOM   2870  CD2 PHE A 250      81.250  29.547 -12.973  1.00  0.82           C  
ATOM   2871  CE1 PHE A 250      82.188  29.955 -10.374  1.00  0.82           C  
ATOM   2872  CE2 PHE A 250      81.351  28.468 -12.084  1.00  0.82           C  
ATOM   2873  CZ  PHE A 250      81.812  28.674 -10.782  1.00  0.82           C  
ATOM   2874  N   PRO A 251      83.566  31.020 -15.792  1.00  0.83           N  
ATOM   2875  CA  PRO A 251      84.291  29.865 -16.320  1.00  0.83           C  
ATOM   2876  C   PRO A 251      85.797  29.945 -16.203  1.00  0.83           C  
ATOM   2877  O   PRO A 251      86.377  30.978 -16.546  1.00  0.83           O  
ATOM   2878  CB  PRO A 251      83.867  29.752 -17.793  1.00  0.83           C  
ATOM   2879  CG  PRO A 251      82.551  30.527 -17.882  1.00  0.83           C  
ATOM   2880  CD  PRO A 251      82.694  31.607 -16.809  1.00  0.83           C  
ATOM   2881  N   LEU A 252      86.461  28.869 -15.744  1.00  0.85           N  
ATOM   2882  CA  LEU A 252      87.905  28.800 -15.722  1.00  0.85           C  
ATOM   2883  C   LEU A 252      88.475  28.893 -17.122  1.00  0.85           C  
ATOM   2884  O   LEU A 252      88.096  28.154 -18.030  1.00  0.85           O  
ATOM   2885  CB  LEU A 252      88.374  27.488 -15.063  1.00  0.85           C  
ATOM   2886  CG  LEU A 252      89.895  27.279 -14.941  1.00  0.85           C  
ATOM   2887  CD1 LEU A 252      90.569  28.374 -14.099  1.00  0.85           C  
ATOM   2888  CD2 LEU A 252      90.170  25.893 -14.341  1.00  0.85           C  
ATOM   2889  N   LYS A 253      89.397  29.844 -17.352  1.00  0.78           N  
ATOM   2890  CA  LYS A 253      89.953  30.037 -18.672  1.00  0.78           C  
ATOM   2891  C   LYS A 253      90.844  28.888 -19.088  1.00  0.78           C  
ATOM   2892  O   LYS A 253      91.796  28.527 -18.398  1.00  0.78           O  
ATOM   2893  CB  LYS A 253      90.704  31.377 -18.806  1.00  0.78           C  
ATOM   2894  CG  LYS A 253      89.789  32.577 -18.525  1.00  0.78           C  
ATOM   2895  CD  LYS A 253      90.486  33.924 -18.758  1.00  0.78           C  
ATOM   2896  CE  LYS A 253      89.561  35.109 -18.475  1.00  0.78           C  
ATOM   2897  NZ  LYS A 253      90.237  36.377 -18.827  1.00  0.78           N  
ATOM   2898  N   LEU A 254      90.547  28.278 -20.251  1.00  0.78           N  
ATOM   2899  CA  LEU A 254      91.345  27.194 -20.779  1.00  0.78           C  
ATOM   2900  C   LEU A 254      92.675  27.712 -21.298  1.00  0.78           C  
ATOM   2901  O   LEU A 254      92.793  28.203 -22.415  1.00  0.78           O  
ATOM   2902  CB  LEU A 254      90.568  26.405 -21.857  1.00  0.78           C  
ATOM   2903  CG  LEU A 254      91.312  25.216 -22.505  1.00  0.78           C  
ATOM   2904  CD1 LEU A 254      91.906  24.228 -21.488  1.00  0.78           C  
ATOM   2905  CD2 LEU A 254      90.372  24.484 -23.474  1.00  0.78           C  
ATOM   2906  N   ARG A 255      93.717  27.647 -20.445  1.00  0.77           N  
ATOM   2907  CA  ARG A 255      95.034  28.153 -20.773  1.00  0.77           C  
ATOM   2908  C   ARG A 255      95.781  27.277 -21.758  1.00  0.77           C  
ATOM   2909  O   ARG A 255      96.650  27.746 -22.487  1.00  0.77           O  
ATOM   2910  CB  ARG A 255      95.909  28.286 -19.498  1.00  0.77           C  
ATOM   2911  CG  ARG A 255      95.324  29.223 -18.421  1.00  0.77           C  
ATOM   2912  CD  ARG A 255      96.122  29.273 -17.111  1.00  0.77           C  
ATOM   2913  NE  ARG A 255      97.435  29.927 -17.408  1.00  0.77           N  
ATOM   2914  CZ  ARG A 255      98.391  30.118 -16.488  1.00  0.77           C  
ATOM   2915  NH1 ARG A 255      98.242  29.731 -15.228  1.00  0.77           N  
ATOM   2916  NH2 ARG A 255      99.547  30.690 -16.821  1.00  0.77           N  
ATOM   2917  N   GLY A 256      95.473  25.964 -21.775  1.00  0.88           N  
ATOM   2918  CA  GLY A 256      96.162  25.000 -22.616  1.00  0.88           C  
ATOM   2919  C   GLY A 256      97.564  24.741 -22.150  1.00  0.88           C  
ATOM   2920  O   GLY A 256      98.469  24.540 -22.954  1.00  0.88           O  
ATOM   2921  N   THR A 257      97.761  24.753 -20.812  1.00  0.89           N  
ATOM   2922  CA  THR A 257      99.046  24.591 -20.135  1.00  0.89           C  
ATOM   2923  C   THR A 257      99.810  23.363 -20.602  1.00  0.89           C  
ATOM   2924  O   THR A 257      99.253  22.275 -20.724  1.00  0.89           O  
ATOM   2925  CB  THR A 257      98.906  24.476 -18.613  1.00  0.89           C  
ATOM   2926  OG1 THR A 257      98.247  25.594 -18.043  1.00  0.89           O  
ATOM   2927  CG2 THR A 257     100.260  24.460 -17.903  1.00  0.89           C  
ATOM   2928  N   ALA A 258     101.120  23.507 -20.895  1.00  0.90           N  
ATOM   2929  CA  ALA A 258     101.954  22.406 -21.331  1.00  0.90           C  
ATOM   2930  C   ALA A 258     102.089  21.269 -20.319  1.00  0.90           C  
ATOM   2931  O   ALA A 258     102.237  21.491 -19.118  1.00  0.90           O  
ATOM   2932  CB  ALA A 258     103.346  22.930 -21.736  1.00  0.90           C  
ATOM   2933  N   VAL A 259     102.049  20.015 -20.808  1.00  0.88           N  
ATOM   2934  CA  VAL A 259     102.159  18.817 -19.993  1.00  0.88           C  
ATOM   2935  C   VAL A 259     103.381  18.075 -20.484  1.00  0.88           C  
ATOM   2936  O   VAL A 259     103.484  17.759 -21.668  1.00  0.88           O  
ATOM   2937  CB  VAL A 259     100.929  17.916 -20.102  1.00  0.88           C  
ATOM   2938  CG1 VAL A 259     101.125  16.601 -19.319  1.00  0.88           C  
ATOM   2939  CG2 VAL A 259      99.702  18.664 -19.551  1.00  0.88           C  
ATOM   2940  N   MET A 260     104.361  17.803 -19.598  1.00  0.85           N  
ATOM   2941  CA  MET A 260     105.577  17.101 -19.979  1.00  0.85           C  
ATOM   2942  C   MET A 260     105.871  15.956 -19.023  1.00  0.85           C  
ATOM   2943  O   MET A 260     105.587  16.022 -17.832  1.00  0.85           O  
ATOM   2944  CB  MET A 260     106.818  18.032 -19.994  1.00  0.85           C  
ATOM   2945  CG  MET A 260     106.721  19.227 -20.965  1.00  0.85           C  
ATOM   2946  SD  MET A 260     108.127  20.383 -20.871  1.00  0.85           S  
ATOM   2947  CE  MET A 260     109.403  19.261 -21.507  1.00  0.85           C  
ATOM   2948  N   SER A 261     106.483  14.860 -19.510  1.00  0.85           N  
ATOM   2949  CA  SER A 261     106.832  13.712 -18.686  1.00  0.85           C  
ATOM   2950  C   SER A 261     108.307  13.700 -18.335  1.00  0.85           C  
ATOM   2951  O   SER A 261     109.093  12.861 -18.770  1.00  0.85           O  
ATOM   2952  CB  SER A 261     106.394  12.377 -19.335  1.00  0.85           C  
ATOM   2953  OG  SER A 261     106.779  12.279 -20.708  1.00  0.85           O  
ATOM   2954  N   LEU A 262     108.728  14.673 -17.503  1.00  0.84           N  
ATOM   2955  CA  LEU A 262     110.105  14.806 -17.068  1.00  0.84           C  
ATOM   2956  C   LEU A 262     110.439  13.875 -15.916  1.00  0.84           C  
ATOM   2957  O   LEU A 262     109.606  13.553 -15.072  1.00  0.84           O  
ATOM   2958  CB  LEU A 262     110.443  16.263 -16.671  1.00  0.84           C  
ATOM   2959  CG  LEU A 262     110.295  17.278 -17.822  1.00  0.84           C  
ATOM   2960  CD1 LEU A 262     110.434  18.714 -17.300  1.00  0.84           C  
ATOM   2961  CD2 LEU A 262     111.317  17.025 -18.940  1.00  0.84           C  
ATOM   2962  N   LYS A 263     111.701  13.405 -15.861  1.00  0.78           N  
ATOM   2963  CA  LYS A 263     112.179  12.576 -14.767  1.00  0.78           C  
ATOM   2964  C   LYS A 263     112.542  13.424 -13.559  1.00  0.78           C  
ATOM   2965  O   LYS A 263     112.821  14.612 -13.691  1.00  0.78           O  
ATOM   2966  CB  LYS A 263     113.433  11.757 -15.164  1.00  0.78           C  
ATOM   2967  CG  LYS A 263     113.247  10.918 -16.438  1.00  0.78           C  
ATOM   2968  CD  LYS A 263     114.517  10.134 -16.813  1.00  0.78           C  
ATOM   2969  CE  LYS A 263     114.438   9.395 -18.155  1.00  0.78           C  
ATOM   2970  NZ  LYS A 263     113.338   8.406 -18.131  1.00  0.78           N  
ATOM   2971  N   GLU A 264     112.618  12.828 -12.346  1.00  0.81           N  
ATOM   2972  CA  GLU A 264     112.972  13.541 -11.124  1.00  0.81           C  
ATOM   2973  C   GLU A 264     114.343  14.209 -11.174  1.00  0.81           C  
ATOM   2974  O   GLU A 264     114.566  15.283 -10.627  1.00  0.81           O  
ATOM   2975  CB  GLU A 264     112.864  12.610  -9.900  1.00  0.81           C  
ATOM   2976  CG  GLU A 264     111.417  12.129  -9.633  1.00  0.81           C  
ATOM   2977  CD  GLU A 264     111.311  11.221  -8.407  1.00  0.81           C  
ATOM   2978  OE1 GLU A 264     112.351  10.645  -7.998  1.00  0.81           O  
ATOM   2979  OE2 GLU A 264     110.168  11.087  -7.898  1.00  0.81           O  
ATOM   2980  N   GLY A 265     115.285  13.603 -11.927  1.00  0.79           N  
ATOM   2981  CA  GLY A 265     116.620  14.143 -12.157  1.00  0.79           C  
ATOM   2982  C   GLY A 265     116.707  15.250 -13.181  1.00  0.79           C  
ATOM   2983  O   GLY A 265     117.787  15.766 -13.433  1.00  0.79           O  
ATOM   2984  N   GLN A 266     115.586  15.627 -13.832  1.00  0.87           N  
ATOM   2985  CA  GLN A 266     115.577  16.674 -14.842  1.00  0.87           C  
ATOM   2986  C   GLN A 266     114.900  17.936 -14.329  1.00  0.87           C  
ATOM   2987  O   GLN A 266     114.826  18.952 -15.018  1.00  0.87           O  
ATOM   2988  CB  GLN A 266     114.839  16.170 -16.106  1.00  0.87           C  
ATOM   2989  CG  GLN A 266     115.540  14.950 -16.749  1.00  0.87           C  
ATOM   2990  CD  GLN A 266     114.711  14.331 -17.872  1.00  0.87           C  
ATOM   2991  OE1 GLN A 266     113.504  14.528 -17.998  1.00  0.87           O  
ATOM   2992  NE2 GLN A 266     115.371  13.480 -18.698  1.00  0.87           N  
ATOM   2993  N   ILE A 267     114.415  17.920 -13.073  1.00  0.87           N  
ATOM   2994  CA  ILE A 267     113.742  19.053 -12.463  1.00  0.87           C  
ATOM   2995  C   ILE A 267     114.766  20.063 -11.954  1.00  0.87           C  
ATOM   2996  O   ILE A 267     115.276  19.967 -10.840  1.00  0.87           O  
ATOM   2997  CB  ILE A 267     112.818  18.620 -11.327  1.00  0.87           C  
ATOM   2998  CG1 ILE A 267     111.851  17.501 -11.786  1.00  0.87           C  
ATOM   2999  CG2 ILE A 267     112.052  19.852 -10.788  1.00  0.87           C  
ATOM   3000  CD1 ILE A 267     111.020  16.918 -10.639  1.00  0.87           C  
ATOM   3001  N   ASN A 268     115.103  21.064 -12.795  1.00  0.87           N  
ATOM   3002  CA  ASN A 268     116.032  22.132 -12.464  1.00  0.87           C  
ATOM   3003  C   ASN A 268     115.298  23.389 -11.993  1.00  0.87           C  
ATOM   3004  O   ASN A 268     114.071  23.425 -11.921  1.00  0.87           O  
ATOM   3005  CB  ASN A 268     117.043  22.384 -13.630  1.00  0.87           C  
ATOM   3006  CG  ASN A 268     116.391  22.951 -14.889  1.00  0.87           C  
ATOM   3007  OD1 ASN A 268     115.423  23.701 -14.822  1.00  0.87           O  
ATOM   3008  ND2 ASN A 268     116.934  22.644 -16.089  1.00  0.87           N  
ATOM   3009  N   ASP A 269     116.040  24.470 -11.678  1.00  0.91           N  
ATOM   3010  CA  ASP A 269     115.484  25.747 -11.264  1.00  0.91           C  
ATOM   3011  C   ASP A 269     114.595  26.444 -12.300  1.00  0.91           C  
ATOM   3012  O   ASP A 269     113.588  27.068 -11.959  1.00  0.91           O  
ATOM   3013  CB  ASP A 269     116.619  26.675 -10.783  1.00  0.91           C  
ATOM   3014  CG  ASP A 269     117.287  26.113  -9.530  1.00  0.91           C  
ATOM   3015  OD1 ASP A 269     116.698  25.213  -8.873  1.00  0.91           O  
ATOM   3016  OD2 ASP A 269     118.411  26.582  -9.235  1.00  0.91           O  
ATOM   3017  N   MET A 270     114.911  26.331 -13.613  1.00  0.91           N  
ATOM   3018  CA  MET A 270     114.058  26.822 -14.690  1.00  0.91           C  
ATOM   3019  C   MET A 270     112.710  26.126 -14.688  1.00  0.91           C  
ATOM   3020  O   MET A 270     111.662  26.766 -14.772  1.00  0.91           O  
ATOM   3021  CB  MET A 270     114.708  26.631 -16.091  1.00  0.91           C  
ATOM   3022  CG  MET A 270     113.819  27.045 -17.287  1.00  0.91           C  
ATOM   3023  SD  MET A 270     114.558  26.760 -18.924  1.00  0.91           S  
ATOM   3024  CE  MET A 270     113.057  27.259 -19.821  1.00  0.91           C  
ATOM   3025  N   ILE A 271     112.709  24.787 -14.532  1.00  0.91           N  
ATOM   3026  CA  ILE A 271     111.490  23.999 -14.454  1.00  0.91           C  
ATOM   3027  C   ILE A 271     110.647  24.384 -13.254  1.00  0.91           C  
ATOM   3028  O   ILE A 271     109.454  24.643 -13.386  1.00  0.91           O  
ATOM   3029  CB  ILE A 271     111.784  22.506 -14.439  1.00  0.91           C  
ATOM   3030  CG1 ILE A 271     112.574  22.042 -15.686  1.00  0.91           C  
ATOM   3031  CG2 ILE A 271     110.483  21.699 -14.319  1.00  0.91           C  
ATOM   3032  CD1 ILE A 271     111.949  22.399 -17.040  1.00  0.91           C  
ATOM   3033  N   LEU A 272     111.266  24.536 -12.064  1.00  0.89           N  
ATOM   3034  CA  LEU A 272     110.586  25.018 -10.871  1.00  0.89           C  
ATOM   3035  C   LEU A 272     109.966  26.402 -11.057  1.00  0.89           C  
ATOM   3036  O   LEU A 272     108.833  26.654 -10.661  1.00  0.89           O  
ATOM   3037  CB  LEU A 272     111.548  25.048  -9.660  1.00  0.89           C  
ATOM   3038  CG  LEU A 272     112.054  23.670  -9.188  1.00  0.89           C  
ATOM   3039  CD1 LEU A 272     113.164  23.854  -8.143  1.00  0.89           C  
ATOM   3040  CD2 LEU A 272     110.931  22.775  -8.640  1.00  0.89           C  
ATOM   3041  N   SER A 273     110.675  27.325 -11.733  1.00  0.91           N  
ATOM   3042  CA  SER A 273     110.168  28.643 -12.100  1.00  0.91           C  
ATOM   3043  C   SER A 273     108.946  28.623 -13.012  1.00  0.91           C  
ATOM   3044  O   SER A 273     108.032  29.429 -12.846  1.00  0.91           O  
ATOM   3045  CB  SER A 273     111.294  29.469 -12.777  1.00  0.91           C  
ATOM   3046  OG  SER A 273     110.972  30.840 -13.048  1.00  0.91           O  
ATOM   3047  N   LEU A 274     108.897  27.715 -14.011  1.00  0.89           N  
ATOM   3048  CA  LEU A 274     107.732  27.499 -14.862  1.00  0.89           C  
ATOM   3049  C   LEU A 274     106.534  26.905 -14.145  1.00  0.89           C  
ATOM   3050  O   LEU A 274     105.400  27.350 -14.343  1.00  0.89           O  
ATOM   3051  CB  LEU A 274     108.058  26.596 -16.067  1.00  0.89           C  
ATOM   3052  CG  LEU A 274     109.027  27.217 -17.086  1.00  0.89           C  
ATOM   3053  CD1 LEU A 274     109.365  26.177 -18.161  1.00  0.89           C  
ATOM   3054  CD2 LEU A 274     108.452  28.490 -17.731  1.00  0.89           C  
ATOM   3055  N   LEU A 275     106.775  25.910 -13.264  1.00  0.90           N  
ATOM   3056  CA  LEU A 275     105.765  25.313 -12.406  1.00  0.90           C  
ATOM   3057  C   LEU A 275     105.118  26.360 -11.513  1.00  0.90           C  
ATOM   3058  O   LEU A 275     103.899  26.482 -11.464  1.00  0.90           O  
ATOM   3059  CB  LEU A 275     106.386  24.215 -11.503  1.00  0.90           C  
ATOM   3060  CG  LEU A 275     106.919  22.968 -12.237  1.00  0.90           C  
ATOM   3061  CD1 LEU A 275     107.684  22.063 -11.259  1.00  0.90           C  
ATOM   3062  CD2 LEU A 275     105.799  22.191 -12.928  1.00  0.90           C  
ATOM   3063  N   SER A 276     105.939  27.222 -10.880  1.00  0.89           N  
ATOM   3064  CA  SER A 276     105.500  28.280  -9.977  1.00  0.89           C  
ATOM   3065  C   SER A 276     104.689  29.395 -10.614  1.00  0.89           C  
ATOM   3066  O   SER A 276     104.045  30.174  -9.922  1.00  0.89           O  
ATOM   3067  CB  SER A 276     106.701  28.970  -9.284  1.00  0.89           C  
ATOM   3068  OG  SER A 276     107.381  28.074  -8.407  1.00  0.89           O  
ATOM   3069  N   LYS A 277     104.696  29.517 -11.956  1.00  0.86           N  
ATOM   3070  CA  LYS A 277     103.874  30.484 -12.667  1.00  0.86           C  
ATOM   3071  C   LYS A 277     102.617  29.855 -13.256  1.00  0.86           C  
ATOM   3072  O   LYS A 277     101.858  30.498 -13.988  1.00  0.86           O  
ATOM   3073  CB  LYS A 277     104.663  31.104 -13.843  1.00  0.86           C  
ATOM   3074  CG  LYS A 277     105.870  31.943 -13.406  1.00  0.86           C  
ATOM   3075  CD  LYS A 277     106.553  32.612 -14.609  1.00  0.86           C  
ATOM   3076  CE  LYS A 277     107.763  33.476 -14.249  1.00  0.86           C  
ATOM   3077  NZ  LYS A 277     108.818  32.628 -13.671  1.00  0.86           N  
ATOM   3078  N   GLY A 278     102.364  28.556 -12.990  1.00  0.91           N  
ATOM   3079  CA  GLY A 278     101.227  27.851 -13.571  1.00  0.91           C  
ATOM   3080  C   GLY A 278     101.341  27.572 -15.041  1.00  0.91           C  
ATOM   3081  O   GLY A 278     100.339  27.386 -15.727  1.00  0.91           O  
ATOM   3082  N   ARG A 279     102.576  27.571 -15.569  1.00  0.84           N  
ATOM   3083  CA  ARG A 279     102.843  27.461 -16.989  1.00  0.84           C  
ATOM   3084  C   ARG A 279     103.316  26.073 -17.365  1.00  0.84           C  
ATOM   3085  O   ARG A 279     103.633  25.824 -18.525  1.00  0.84           O  
ATOM   3086  CB  ARG A 279     103.927  28.483 -17.419  1.00  0.84           C  
ATOM   3087  CG  ARG A 279     103.429  29.941 -17.396  1.00  0.84           C  
ATOM   3088  CD  ARG A 279     104.520  30.998 -17.610  1.00  0.84           C  
ATOM   3089  NE  ARG A 279     105.160  30.747 -18.943  1.00  0.84           N  
ATOM   3090  CZ  ARG A 279     106.263  31.369 -19.382  1.00  0.84           C  
ATOM   3091  NH1 ARG A 279     106.842  32.325 -18.661  1.00  0.84           N  
ATOM   3092  NH2 ARG A 279     106.786  31.064 -20.567  1.00  0.84           N  
ATOM   3093  N   LEU A 280     103.350  25.129 -16.410  1.00  0.90           N  
ATOM   3094  CA  LEU A 280     103.791  23.787 -16.707  1.00  0.90           C  
ATOM   3095  C   LEU A 280     103.107  22.794 -15.785  1.00  0.90           C  
ATOM   3096  O   LEU A 280     102.854  23.089 -14.619  1.00  0.90           O  
ATOM   3097  CB  LEU A 280     105.332  23.727 -16.574  1.00  0.90           C  
ATOM   3098  CG  LEU A 280     106.006  22.384 -16.903  1.00  0.90           C  
ATOM   3099  CD1 LEU A 280     105.731  21.930 -18.342  1.00  0.90           C  
ATOM   3100  CD2 LEU A 280     107.516  22.497 -16.659  1.00  0.90           C  
ATOM   3101  N   ILE A 281     102.781  21.599 -16.314  1.00  0.91           N  
ATOM   3102  CA  ILE A 281     102.339  20.431 -15.571  1.00  0.91           C  
ATOM   3103  C   ILE A 281     103.325  19.316 -15.876  1.00  0.91           C  
ATOM   3104  O   ILE A 281     103.665  19.071 -17.033  1.00  0.91           O  
ATOM   3105  CB  ILE A 281     100.918  20.026 -15.972  1.00  0.91           C  
ATOM   3106  CG1 ILE A 281      99.878  20.966 -15.333  1.00  0.91           C  
ATOM   3107  CG2 ILE A 281     100.565  18.556 -15.665  1.00  0.91           C  
ATOM   3108  CD1 ILE A 281      99.682  20.748 -13.829  1.00  0.91           C  
ATOM   3109  N   ILE A 282     103.840  18.610 -14.844  1.00  0.89           N  
ATOM   3110  CA  ILE A 282     104.737  17.475 -15.057  1.00  0.89           C  
ATOM   3111  C   ILE A 282     104.083  16.200 -14.594  1.00  0.89           C  
ATOM   3112  O   ILE A 282     103.883  15.948 -13.402  1.00  0.89           O  
ATOM   3113  CB  ILE A 282     106.117  17.612 -14.428  1.00  0.89           C  
ATOM   3114  CG1 ILE A 282     106.825  18.838 -15.032  1.00  0.89           C  
ATOM   3115  CG2 ILE A 282     106.974  16.329 -14.589  1.00  0.89           C  
ATOM   3116  CD1 ILE A 282     108.093  19.232 -14.284  1.00  0.89           C  
ATOM   3117  N   ARG A 283     103.729  15.359 -15.578  1.00  0.81           N  
ATOM   3118  CA  ARG A 283     103.206  14.039 -15.361  1.00  0.81           C  
ATOM   3119  C   ARG A 283     103.215  13.288 -16.670  1.00  0.81           C  
ATOM   3120  O   ARG A 283     103.305  13.875 -17.743  1.00  0.81           O  
ATOM   3121  CB  ARG A 283     101.762  14.022 -14.791  1.00  0.81           C  
ATOM   3122  CG  ARG A 283     100.705  14.782 -15.620  1.00  0.81           C  
ATOM   3123  CD  ARG A 283      99.270  14.470 -15.188  1.00  0.81           C  
ATOM   3124  NE  ARG A 283      98.338  15.402 -15.873  1.00  0.81           N  
ATOM   3125  CZ  ARG A 283      97.795  15.262 -17.088  1.00  0.81           C  
ATOM   3126  NH1 ARG A 283      96.816  16.093 -17.440  1.00  0.81           N  
ATOM   3127  NH2 ARG A 283      98.194  14.301 -17.916  1.00  0.81           N  
ATOM   3128  N   GLU A 284     103.074  11.952 -16.626  1.00  0.83           N  
ATOM   3129  CA  GLU A 284     102.722  11.181 -17.798  1.00  0.83           C  
ATOM   3130  C   GLU A 284     101.257  11.331 -18.170  1.00  0.83           C  
ATOM   3131  O   GLU A 284     100.407  11.763 -17.382  1.00  0.83           O  
ATOM   3132  CB  GLU A 284     103.076   9.697 -17.620  1.00  0.83           C  
ATOM   3133  CG  GLU A 284     104.590   9.470 -17.404  1.00  0.83           C  
ATOM   3134  CD  GLU A 284     104.958   7.990 -17.308  1.00  0.83           C  
ATOM   3135  OE1 GLU A 284     104.027   7.154 -17.193  1.00  0.83           O  
ATOM   3136  OE2 GLU A 284     106.181   7.706 -17.342  1.00  0.83           O  
ATOM   3137  N   ASN A 285     100.915  10.973 -19.420  1.00  0.82           N  
ATOM   3138  CA  ASN A 285      99.574  11.117 -19.935  1.00  0.82           C  
ATOM   3139  C   ASN A 285      99.084   9.751 -20.377  1.00  0.82           C  
ATOM   3140  O   ASN A 285      98.628   9.540 -21.494  1.00  0.82           O  
ATOM   3141  CB  ASN A 285      99.464  12.231 -21.004  1.00  0.82           C  
ATOM   3142  CG  ASN A 285      97.993  12.575 -21.230  1.00  0.82           C  
ATOM   3143  OD1 ASN A 285      97.397  13.317 -20.447  1.00  0.82           O  
ATOM   3144  ND2 ASN A 285      97.379  11.972 -22.269  1.00  0.82           N  
ATOM   3145  N   ASN A 286      99.142   8.787 -19.439  1.00  0.83           N  
ATOM   3146  CA  ASN A 286      98.611   7.449 -19.629  1.00  0.83           C  
ATOM   3147  C   ASN A 286      97.103   7.454 -19.455  1.00  0.83           C  
ATOM   3148  O   ASN A 286      96.536   8.425 -18.950  1.00  0.83           O  
ATOM   3149  CB  ASN A 286      99.227   6.437 -18.629  1.00  0.83           C  
ATOM   3150  CG  ASN A 286     100.746   6.512 -18.762  1.00  0.83           C  
ATOM   3151  OD1 ASN A 286     101.252   6.757 -19.853  1.00  0.83           O  
ATOM   3152  ND2 ASN A 286     101.468   6.367 -17.632  1.00  0.83           N  
ATOM   3153  N   ARG A 287      96.416   6.362 -19.852  1.00  0.74           N  
ATOM   3154  CA  ARG A 287      94.987   6.173 -19.642  1.00  0.74           C  
ATOM   3155  C   ARG A 287      94.576   6.338 -18.180  1.00  0.74           C  
ATOM   3156  O   ARG A 287      95.161   5.711 -17.303  1.00  0.74           O  
ATOM   3157  CB  ARG A 287      94.536   4.783 -20.199  1.00  0.74           C  
ATOM   3158  CG  ARG A 287      95.231   3.542 -19.579  1.00  0.74           C  
ATOM   3159  CD  ARG A 287      95.126   2.235 -20.388  1.00  0.74           C  
ATOM   3160  NE  ARG A 287      93.679   1.858 -20.542  1.00  0.74           N  
ATOM   3161  CZ  ARG A 287      92.984   1.076 -19.700  1.00  0.74           C  
ATOM   3162  NH1 ARG A 287      91.713   0.785 -19.973  1.00  0.74           N  
ATOM   3163  NH2 ARG A 287      93.522   0.587 -18.588  1.00  0.74           N  
ATOM   3164  N   VAL A 288      93.602   7.231 -17.874  1.00  0.88           N  
ATOM   3165  CA  VAL A 288      93.145   7.485 -16.508  1.00  0.88           C  
ATOM   3166  C   VAL A 288      92.385   6.297 -15.931  1.00  0.88           C  
ATOM   3167  O   VAL A 288      91.304   5.945 -16.395  1.00  0.88           O  
ATOM   3168  CB  VAL A 288      92.367   8.795 -16.373  1.00  0.88           C  
ATOM   3169  CG1 VAL A 288      91.949   9.053 -14.912  1.00  0.88           C  
ATOM   3170  CG2 VAL A 288      93.263   9.962 -16.827  1.00  0.88           C  
ATOM   3171  N   VAL A 289      92.962   5.634 -14.909  1.00  0.87           N  
ATOM   3172  CA  VAL A 289      92.427   4.419 -14.320  1.00  0.87           C  
ATOM   3173  C   VAL A 289      92.322   4.621 -12.825  1.00  0.87           C  
ATOM   3174  O   VAL A 289      93.293   4.959 -12.149  1.00  0.87           O  
ATOM   3175  CB  VAL A 289      93.319   3.211 -14.593  1.00  0.87           C  
ATOM   3176  CG1 VAL A 289      92.783   1.943 -13.900  1.00  0.87           C  
ATOM   3177  CG2 VAL A 289      93.397   2.964 -16.108  1.00  0.87           C  
ATOM   3178  N   ILE A 290      91.119   4.407 -12.261  1.00  0.85           N  
ATOM   3179  CA  ILE A 290      90.878   4.603 -10.848  1.00  0.85           C  
ATOM   3180  C   ILE A 290      89.896   3.547 -10.380  1.00  0.85           C  
ATOM   3181  O   ILE A 290      89.121   3.013 -11.173  1.00  0.85           O  
ATOM   3182  CB  ILE A 290      90.386   6.029 -10.550  1.00  0.85           C  
ATOM   3183  CG1 ILE A 290      90.510   6.385  -9.048  1.00  0.85           C  
ATOM   3184  CG2 ILE A 290      88.971   6.268 -11.131  1.00  0.85           C  
ATOM   3185  CD1 ILE A 290      90.246   7.853  -8.701  1.00  0.85           C  
ATOM   3186  N   SER A 291      89.915   3.195  -9.082  1.00  0.86           N  
ATOM   3187  CA  SER A 291      89.029   2.194  -8.521  1.00  0.86           C  
ATOM   3188  C   SER A 291      88.824   2.472  -7.040  1.00  0.86           C  
ATOM   3189  O   SER A 291      89.506   3.313  -6.461  1.00  0.86           O  
ATOM   3190  CB  SER A 291      89.553   0.746  -8.747  1.00  0.86           C  
ATOM   3191  OG  SER A 291      90.843   0.543  -8.169  1.00  0.86           O  
ATOM   3192  N   SER A 292      87.829   1.808  -6.409  1.00  0.84           N  
ATOM   3193  CA  SER A 292      87.577   1.843  -4.970  1.00  0.84           C  
ATOM   3194  C   SER A 292      87.552   0.395  -4.521  1.00  0.84           C  
ATOM   3195  O   SER A 292      86.905  -0.425  -5.175  1.00  0.84           O  
ATOM   3196  CB  SER A 292      86.221   2.541  -4.610  1.00  0.84           C  
ATOM   3197  OG  SER A 292      85.850   2.459  -3.230  1.00  0.84           O  
ATOM   3198  N   ASP A 293      88.294   0.034  -3.446  1.00  0.73           N  
ATOM   3199  CA  ASP A 293      88.255  -1.290  -2.837  1.00  0.73           C  
ATOM   3200  C   ASP A 293      86.894  -1.705  -2.323  1.00  0.73           C  
ATOM   3201  O   ASP A 293      86.135  -0.941  -1.726  1.00  0.73           O  
ATOM   3202  CB  ASP A 293      89.225  -1.514  -1.644  1.00  0.73           C  
ATOM   3203  CG  ASP A 293      90.668  -1.478  -2.080  1.00  0.73           C  
ATOM   3204  OD1 ASP A 293      90.950  -1.944  -3.211  1.00  0.73           O  
ATOM   3205  OD2 ASP A 293      91.517  -1.021  -1.273  1.00  0.73           O  
ATOM   3206  N   VAL A 294      86.595  -2.998  -2.506  1.00  0.64           N  
ATOM   3207  CA  VAL A 294      85.396  -3.620  -1.998  1.00  0.64           C  
ATOM   3208  C   VAL A 294      85.849  -4.541  -0.893  1.00  0.64           C  
ATOM   3209  O   VAL A 294      86.591  -5.494  -1.116  1.00  0.64           O  
ATOM   3210  CB  VAL A 294      84.657  -4.401  -3.075  1.00  0.64           C  
ATOM   3211  CG1 VAL A 294      83.472  -5.189  -2.482  1.00  0.64           C  
ATOM   3212  CG2 VAL A 294      84.158  -3.411  -4.145  1.00  0.64           C  
ATOM   3213  N   LEU A 295      85.426  -4.270   0.357  1.00  0.61           N  
ATOM   3214  CA  LEU A 295      85.688  -5.173   1.461  1.00  0.61           C  
ATOM   3215  C   LEU A 295      84.748  -6.358   1.346  1.00  0.61           C  
ATOM   3216  O   LEU A 295      83.532  -6.188   1.308  1.00  0.61           O  
ATOM   3217  CB  LEU A 295      85.510  -4.477   2.834  1.00  0.61           C  
ATOM   3218  CG  LEU A 295      85.713  -5.375   4.076  1.00  0.61           C  
ATOM   3219  CD1 LEU A 295      87.125  -5.974   4.155  1.00  0.61           C  
ATOM   3220  CD2 LEU A 295      85.393  -4.599   5.364  1.00  0.61           C  
ATOM   3221  N   VAL A 296      85.297  -7.584   1.251  1.00  0.69           N  
ATOM   3222  CA  VAL A 296      84.510  -8.783   1.045  1.00  0.69           C  
ATOM   3223  C   VAL A 296      84.455  -9.587   2.327  1.00  0.69           C  
ATOM   3224  O   VAL A 296      85.460  -9.829   2.994  1.00  0.69           O  
ATOM   3225  CB  VAL A 296      85.006  -9.637  -0.128  1.00  0.69           C  
ATOM   3226  CG1 VAL A 296      84.928  -8.800  -1.420  1.00  0.69           C  
ATOM   3227  CG2 VAL A 296      86.437 -10.178   0.075  1.00  0.69           C  
ATOM   3228  N   ASN A 297      83.244  -9.995   2.732  1.00  0.61           N  
ATOM   3229  CA  ASN A 297      83.021 -10.737   3.945  1.00  0.61           C  
ATOM   3230  C   ASN A 297      81.682 -11.439   3.804  1.00  0.61           C  
ATOM   3231  O   ASN A 297      81.023 -11.300   2.777  1.00  0.61           O  
ATOM   3232  CB  ASN A 297      83.174  -9.867   5.232  1.00  0.61           C  
ATOM   3233  CG  ASN A 297      82.497  -8.498   5.148  1.00  0.61           C  
ATOM   3234  OD1 ASN A 297      81.578  -8.230   4.385  1.00  0.61           O  
ATOM   3235  ND2 ASN A 297      83.007  -7.544   5.974  1.00  0.61           N  
ATOM   3236  N   ASN A 298      81.323 -12.296   4.780  1.00  0.56           N  
ATOM   3237  CA  ASN A 298      80.027 -12.955   4.826  1.00  0.56           C  
ATOM   3238  C   ASN A 298      78.894 -12.089   5.440  1.00  0.56           C  
ATOM   3239  O   ASN A 298      79.187 -10.994   5.989  1.00  0.56           O  
ATOM   3240  CB  ASN A 298      80.080 -14.223   5.712  1.00  0.56           C  
ATOM   3241  CG  ASN A 298      81.109 -15.235   5.249  1.00  0.56           C  
ATOM   3242  OD1 ASN A 298      81.853 -15.810   6.042  1.00  0.56           O  
ATOM   3243  ND2 ASN A 298      81.169 -15.483   3.922  1.00  0.56           N  
ATOM   3244  OXT ASN A 298      77.727 -12.571   5.404  1.00  0.56           O  
TER    3245      ASN A 298                                                      
HETATM 3246  N   SAM _   2      80.765  18.666  -0.958  1.00 26.72           N  
HETATM 3247  CA  SAM _   2      79.381  18.217  -0.653  1.00 26.06           C  
HETATM 3248  C   SAM _   2      78.382  19.137  -1.376  1.00 28.20           C  
HETATM 3249  O   SAM _   2      78.728  19.568  -2.502  1.00 26.88           O  
HETATM 3250  OXT SAM _   2      77.286  19.359  -0.823  1.00 30.73           O  
HETATM 3251  CB  SAM _   2      79.148  18.200   0.864  1.00 29.14           C  
HETATM 3252  CG  SAM _   2      80.147  17.288   1.591  1.00 31.20           C  
HETATM 3253  SD  SAM _   2      79.788  17.039   3.346  1.00 35.19           S  
HETATM 3254  CE  SAM _   2      80.182  18.646   4.019  1.00 36.52           C  
HETATM 3255  C5' SAM _   2      81.261  16.068   3.810  1.00 32.79           C  
HETATM 3256  C4' SAM _   2      81.340  14.695   3.164  1.00 31.76           C  
HETATM 3257  O4' SAM _   2      82.585  14.048   3.519  1.00 33.31           O  
HETATM 3258  C3' SAM _   2      80.236  13.714   3.577  1.00 31.41           C  
HETATM 3259  O3' SAM _   2      79.429  13.402   2.449  1.00 31.40           O  
HETATM 3260  C2' SAM _   2      80.995  12.489   4.113  1.00 31.97           C  
HETATM 3261  O2' SAM _   2      80.398  11.263   3.747  1.00 31.12           O  
HETATM 3262  C1' SAM _   2      82.362  12.660   3.461  1.00 32.31           C  
HETATM 3263  N9  SAM _   2      83.442  11.933   4.130  1.00 31.61           N  
HETATM 3264  C8  SAM _   2      83.785  11.997   5.457  1.00 31.28           C  
HETATM 3265  N7  SAM _   2      84.779  11.207   5.780  1.00 30.47           N  
HETATM 3266  C5  SAM _   2      85.109  10.564   4.597  1.00 31.35           C  
HETATM 3267  C6  SAM _   2      86.083   9.592   4.283  1.00 32.43           C  
HETATM 3268  N6  SAM _   2      86.928   9.069   5.170  1.00 31.92           N  
HETATM 3269  N1  SAM _   2      86.140   9.156   3.003  1.00 31.14           N  
HETATM 3270  C2  SAM _   2      85.285   9.677   2.114  1.00 32.45           C  
HETATM 3271  N3  SAM _   2      84.330  10.586   2.294  1.00 31.66           N  
HETATM 3272  C4  SAM _   2      84.291  11.001   3.572  1.00 30.76           C  
HETATM 3273 ZN    ZN _  12      70.039   9.631 -15.601  1.00 34.15          ZN  
HETATM 3274 ZN    ZN _  13      62.986  23.046 -33.113  1.00 44.26          ZN  
CONECT 3246 3247
CONECT 3247 3246 3248 3251
CONECT 3248 3247 3249 3250
CONECT 3249 3248
CONECT 3250 3248
CONECT 3251 3247 3252
CONECT 3252 3251 3253
CONECT 3253 3252 3254 3255
CONECT 3254 3253
CONECT 3255 3253 3256
CONECT 3256 3255 3257 3258
CONECT 3257 3256 3262
CONECT 3258 3256 3259 3260
CONECT 3259 3258
CONECT 3260 3258 3261 3262
CONECT 3261 3260
CONECT 3262 3257 3260 3263
CONECT 3263 3262 3264 3272
CONECT 3264 3263 3265
CONECT 3265 3264 3266
CONECT 3266 3265 3267 3272
CONECT 3267 3266 3268 3269
CONECT 3268 3267
CONECT 3269 3267 3270
CONECT 3270 3269 3271
CONECT 3271 3270 3272
CONECT 3272 3263 3266 3271
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.