CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  eco_pabb  ***

elNémo ID: 23010418095518853

Job options:

ID        	=	 23010418095518853
JOBID     	=	 eco_pabb
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 25
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER eco_pabb

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   19-DEC-22 1MOD    1       20:35
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   MONOMER (USER)
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.94
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.89
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    TRP
REMARK   3  BIND    A.34
REMARK   3  BIND 2  A.35
REMARK   3  BIND 3  A.36
REMARK   3  BIND 4  A.43
REMARK   3  BIND 5  A.44
REMARK   3  BIND 6  A.45
REMARK   3  BIND 7  A.46
REMARK   3  BIND 8  A.240
REMARK   3  BIND 9  A.241
REMARK   3  BIND 10  A.242
REMARK   3  BIND 11  A.394
REMARK   3  BIND 12  A.404
REMARK   3  BIND 13  A.406
REMARK   3  BIND 14  _.1
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   1k0e
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-12-09
REMARK   3  SMTLE   1k0e.1.A
REMARK   3  SMTLV   2022-12-14
REMARK   3  MTHD    X-RAY DIFFRACTION 2.00 A
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.96
REMARK   3  SIM     0.61
REMARK   3  SID     100.00
REMARK   3  OSTAT   monomer
REMARK   3  LIGND   TRP
REMARK   3  ALN A TRG MKTLSPAVITLLWRQDAAEFYFSRLSHLPWAMLLHSGYADHPYSRFDIVVAEPICTLT
REMARK   3  ALN A TRG TFGKETVVSESEKRTTTTDDPLQVLQQVLDRADIRPTHNEDLPFQGGALGLFGYDLGR
REMARK   3  ALN A TRG RFESLPEIAEQDIVLPDMAVGIYDWALIVDHQRHTVSLLSHNDVNARRAWLESQQFSP
REMARK   3  ALN A TRG QEDFTLTSDWQSNMTREQYGEKFRQVQEYLHSGDCYQVNLAQRFHATYSGDEWQAFLQ
REMARK   3  ALN A TRG LNQANRAPFSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLPDPQEDSKQA
REMARK   3  ALN A TRG VKLANSAKDRAENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHLVSTITAQL
REMARK   3  ALN A TRG PEQLHASDLLRAAFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTS
REMARK   3  ALN A TRG ITIRTLTAINGQIFCSAGGGIVADSQEEAEYQETFDKVNRILKQLEK
REMARK   3  ALN A TPL MKTLSPAVITLLWRQDAAEFYFSRLSHLPWAMLLHSGYADHPYSRFDIVVAEPICTLT
REMARK   3  ALN A TPL TFGKETVVSESEKRTTTTDDPLQVLQQVLDRADIRPTHNEDLPFQGGALGLFGYDLGR
REMARK   3  ALN A TPL RFESLPEIAEQDIVLPDMAVGIYDWALIVDHQRHTVSLLSHNDVNARRAWLESQQFSP
REMARK   3  ALN A TPL QEDFTLTSDWQSNMTREQYGEKFRQVQEYLHSGDCYQVNLAQRFHATYSGDEWQAFLQ
REMARK   3  ALN A TPL LNQANRAPFSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLPDPQEDSKQA
REMARK   3  ALN A TPL VKLANSAKDRAENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHLVSTITAQL
REMARK   3  ALN A TPL PEQLHASDLLRAAFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTS
REMARK   3  ALN A TPL ITIRTLTAINGQIFCSAGGGIVADSQEEAEYQETFDKVNRILKQLEK
REMARK   3  ALN A OFF 0
ATOM      1  N   THR A   3      -0.500  33.328  17.311  1.00  0.81           N  
ATOM      2  CA  THR A   3      -0.388  34.466  16.321  1.00  0.81           C  
ATOM      3  C   THR A   3      -0.799  33.981  14.966  1.00  0.81           C  
ATOM      4  O   THR A   3      -0.876  32.778  14.744  1.00  0.81           O  
ATOM      5  CB  THR A   3       1.034  35.052  16.334  1.00  0.81           C  
ATOM      6  OG1 THR A   3       1.316  35.534  17.644  1.00  0.81           O  
ATOM      7  CG2 THR A   3       1.315  36.205  15.363  1.00  0.81           C  
ATOM      8  N   LEU A   4      -1.133  34.907  14.054  1.00  0.77           N  
ATOM      9  CA  LEU A   4      -1.481  34.676  12.677  1.00  0.77           C  
ATOM     10  C   LEU A   4      -0.258  34.104  11.950  1.00  0.77           C  
ATOM     11  O   LEU A   4       0.812  34.705  11.972  1.00  0.77           O  
ATOM     12  CB  LEU A   4      -1.991  36.023  12.063  1.00  0.77           C  
ATOM     13  CG  LEU A   4      -2.534  37.073  13.084  1.00  0.77           C  
ATOM     14  CD1 LEU A   4      -1.446  38.103  13.441  1.00  0.77           C  
ATOM     15  CD2 LEU A   4      -3.792  37.802  12.583  1.00  0.77           C  
ATOM     16  N   SER A   5      -0.364  32.883  11.386  1.00  0.91           N  
ATOM     17  CA  SER A   5       0.730  32.169  10.731  1.00  0.91           C  
ATOM     18  C   SER A   5       1.273  32.895   9.506  1.00  0.91           C  
ATOM     19  O   SER A   5       0.494  33.563   8.826  1.00  0.91           O  
ATOM     20  CB  SER A   5       0.300  30.733  10.324  1.00  0.91           C  
ATOM     21  OG  SER A   5       0.138  29.924  11.491  1.00  0.91           O  
ATOM     22  N   PRO A   6       2.570  32.822   9.180  1.00  0.96           N  
ATOM     23  CA  PRO A   6       3.175  33.657   8.147  1.00  0.96           C  
ATOM     24  C   PRO A   6       2.634  33.328   6.769  1.00  0.96           C  
ATOM     25  O   PRO A   6       2.331  32.170   6.484  1.00  0.96           O  
ATOM     26  CB  PRO A   6       4.677  33.324   8.251  1.00  0.96           C  
ATOM     27  CG  PRO A   6       4.703  31.880   8.752  1.00  0.96           C  
ATOM     28  CD  PRO A   6       3.527  31.858   9.728  1.00  0.96           C  
ATOM     29  N   ALA A   7       2.495  34.337   5.887  1.00  0.94           N  
ATOM     30  CA  ALA A   7       2.162  34.117   4.501  1.00  0.94           C  
ATOM     31  C   ALA A   7       3.292  33.380   3.789  1.00  0.94           C  
ATOM     32  O   ALA A   7       4.469  33.701   3.956  1.00  0.94           O  
ATOM     33  CB  ALA A   7       1.830  35.458   3.815  1.00  0.94           C  
ATOM     34  N   VAL A   8       2.949  32.344   3.003  1.00  0.95           N  
ATOM     35  CA  VAL A   8       3.914  31.480   2.353  1.00  0.95           C  
ATOM     36  C   VAL A   8       3.676  31.523   0.861  1.00  0.95           C  
ATOM     37  O   VAL A   8       2.556  31.352   0.385  1.00  0.95           O  
ATOM     38  CB  VAL A   8       3.850  30.029   2.847  1.00  0.95           C  
ATOM     39  CG1 VAL A   8       4.864  29.138   2.098  1.00  0.95           C  
ATOM     40  CG2 VAL A   8       4.165  29.996   4.355  1.00  0.95           C  
ATOM     41  N   ILE A   9       4.753  31.728   0.079  1.00  0.94           N  
ATOM     42  CA  ILE A   9       4.759  31.458  -1.346  1.00  0.94           C  
ATOM     43  C   ILE A   9       5.655  30.255  -1.548  1.00  0.94           C  
ATOM     44  O   ILE A   9       6.802  30.213  -1.105  1.00  0.94           O  
ATOM     45  CB  ILE A   9       5.242  32.624  -2.214  1.00  0.94           C  
ATOM     46  CG1 ILE A   9       4.316  33.846  -1.999  1.00  0.94           C  
ATOM     47  CG2 ILE A   9       5.283  32.195  -3.704  1.00  0.94           C  
ATOM     48  CD1 ILE A   9       4.721  35.093  -2.794  1.00  0.94           C  
ATOM     49  N   THR A  10       5.128  29.223  -2.232  1.00  0.94           N  
ATOM     50  CA  THR A  10       5.906  28.076  -2.679  1.00  0.94           C  
ATOM     51  C   THR A  10       6.599  28.434  -3.983  1.00  0.94           C  
ATOM     52  O   THR A  10       6.003  28.946  -4.930  1.00  0.94           O  
ATOM     53  CB  THR A  10       5.099  26.779  -2.767  1.00  0.94           C  
ATOM     54  OG1 THR A  10       5.916  25.653  -3.061  1.00  0.94           O  
ATOM     55  CG2 THR A  10       3.962  26.845  -3.802  1.00  0.94           C  
ATOM     56  N   LEU A  11       7.922  28.241  -4.015  1.00  0.93           N  
ATOM     57  CA  LEU A  11       8.814  28.642  -5.079  1.00  0.93           C  
ATOM     58  C   LEU A  11       9.177  27.420  -5.896  1.00  0.93           C  
ATOM     59  O   LEU A  11       8.954  26.279  -5.494  1.00  0.93           O  
ATOM     60  CB  LEU A  11      10.097  29.295  -4.475  1.00  0.93           C  
ATOM     61  CG  LEU A  11      10.317  30.812  -4.697  1.00  0.93           C  
ATOM     62  CD1 LEU A  11       9.024  31.639  -4.701  1.00  0.93           C  
ATOM     63  CD2 LEU A  11      11.261  31.345  -3.605  1.00  0.93           C  
ATOM     64  N   LEU A  12       9.750  27.640  -7.099  1.00  0.93           N  
ATOM     65  CA  LEU A  12      10.220  26.577  -7.972  1.00  0.93           C  
ATOM     66  C   LEU A  12      11.211  25.636  -7.297  1.00  0.93           C  
ATOM     67  O   LEU A  12      12.270  26.043  -6.814  1.00  0.93           O  
ATOM     68  CB  LEU A  12      10.843  27.133  -9.289  1.00  0.93           C  
ATOM     69  CG  LEU A  12       9.904  27.170 -10.519  1.00  0.93           C  
ATOM     70  CD1 LEU A  12       9.416  25.766 -10.919  1.00  0.93           C  
ATOM     71  CD2 LEU A  12       8.743  28.165 -10.364  1.00  0.93           C  
ATOM     72  N   TRP A  13      10.859  24.329  -7.262  1.00  0.91           N  
ATOM     73  CA  TRP A  13      11.748  23.286  -6.801  1.00  0.91           C  
ATOM     74  C   TRP A  13      12.979  23.173  -7.674  1.00  0.91           C  
ATOM     75  O   TRP A  13      12.923  23.151  -8.902  1.00  0.91           O  
ATOM     76  CB  TRP A  13      11.097  21.873  -6.650  1.00  0.91           C  
ATOM     77  CG  TRP A  13      12.075  20.792  -6.148  1.00  0.91           C  
ATOM     78  CD1 TRP A  13      12.680  19.787  -6.854  1.00  0.91           C  
ATOM     79  CD2 TRP A  13      12.711  20.832  -4.863  1.00  0.91           C  
ATOM     80  NE1 TRP A  13      13.656  19.194  -6.082  1.00  0.91           N  
ATOM     81  CE2 TRP A  13      13.705  19.811  -4.857  1.00  0.91           C  
ATOM     82  CE3 TRP A  13      12.526  21.641  -3.756  1.00  0.91           C  
ATOM     83  CZ2 TRP A  13      14.496  19.608  -3.737  1.00  0.91           C  
ATOM     84  CZ3 TRP A  13      13.306  21.414  -2.618  1.00  0.91           C  
ATOM     85  CH2 TRP A  13      14.286  20.410  -2.609  1.00  0.91           C  
ATOM     86  N   ARG A  14      14.122  23.055  -6.995  1.00  0.89           N  
ATOM     87  CA  ARG A  14      15.351  22.596  -7.558  1.00  0.89           C  
ATOM     88  C   ARG A  14      16.182  22.150  -6.370  1.00  0.89           C  
ATOM     89  O   ARG A  14      16.023  22.665  -5.265  1.00  0.89           O  
ATOM     90  CB  ARG A  14      16.019  23.694  -8.425  1.00  0.89           C  
ATOM     91  CG  ARG A  14      16.042  25.101  -7.789  1.00  0.89           C  
ATOM     92  CD  ARG A  14      16.357  26.222  -8.784  1.00  0.89           C  
ATOM     93  NE  ARG A  14      17.786  26.069  -9.193  1.00  0.89           N  
ATOM     94  CZ  ARG A  14      18.352  26.662 -10.247  1.00  0.89           C  
ATOM     95  NH1 ARG A  14      17.703  27.536 -11.013  1.00  0.89           N  
ATOM     96  NH2 ARG A  14      19.625  26.408 -10.528  1.00  0.89           N  
ATOM     97  N   GLN A  15      17.073  21.152  -6.555  1.00  0.89           N  
ATOM     98  CA  GLN A  15      17.912  20.575  -5.507  1.00  0.89           C  
ATOM     99  C   GLN A  15      18.881  21.594  -4.925  1.00  0.89           C  
ATOM    100  O   GLN A  15      19.145  21.606  -3.728  1.00  0.89           O  
ATOM    101  CB  GLN A  15      18.681  19.347  -6.076  1.00  0.89           C  
ATOM    102  CG  GLN A  15      19.714  18.649  -5.138  1.00  0.89           C  
ATOM    103  CD  GLN A  15      19.190  17.720  -4.031  1.00  0.89           C  
ATOM    104  OE1 GLN A  15      19.950  17.354  -3.135  1.00  0.89           O  
ATOM    105  NE2 GLN A  15      17.917  17.277  -4.097  1.00  0.89           N  
ATOM    106  N   ASP A  16      19.389  22.509  -5.772  1.00  0.93           N  
ATOM    107  CA  ASP A  16      20.413  23.478  -5.471  1.00  0.93           C  
ATOM    108  C   ASP A  16      19.820  24.795  -4.973  1.00  0.93           C  
ATOM    109  O   ASP A  16      20.517  25.802  -4.866  1.00  0.93           O  
ATOM    110  CB  ASP A  16      21.274  23.719  -6.755  1.00  0.93           C  
ATOM    111  CG  ASP A  16      20.504  24.312  -7.934  1.00  0.93           C  
ATOM    112  OD1 ASP A  16      19.282  24.039  -8.076  1.00  0.93           O  
ATOM    113  OD2 ASP A  16      21.087  25.093  -8.727  1.00  0.93           O  
ATOM    114  N   ALA A  17      18.505  24.830  -4.638  1.00  0.97           N  
ATOM    115  CA  ALA A  17      17.751  26.044  -4.362  1.00  0.97           C  
ATOM    116  C   ALA A  17      18.354  26.940  -3.288  1.00  0.97           C  
ATOM    117  O   ALA A  17      18.397  28.160  -3.436  1.00  0.97           O  
ATOM    118  CB  ALA A  17      16.290  25.715  -3.985  1.00  0.97           C  
ATOM    119  N   ALA A  18      18.880  26.353  -2.200  1.00  0.98           N  
ATOM    120  CA  ALA A  18      19.549  27.084  -1.150  1.00  0.98           C  
ATOM    121  C   ALA A  18      20.776  27.846  -1.618  1.00  0.98           C  
ATOM    122  O   ALA A  18      20.872  29.050  -1.415  1.00  0.98           O  
ATOM    123  CB  ALA A  18      19.962  26.056  -0.098  1.00  0.98           C  
ATOM    124  N   GLU A  19      21.700  27.186  -2.336  1.00  0.92           N  
ATOM    125  CA  GLU A  19      22.860  27.818  -2.933  1.00  0.92           C  
ATOM    126  C   GLU A  19      22.499  28.769  -4.076  1.00  0.92           C  
ATOM    127  O   GLU A  19      23.046  29.865  -4.176  1.00  0.92           O  
ATOM    128  CB  GLU A  19      23.913  26.747  -3.312  1.00  0.92           C  
ATOM    129  CG  GLU A  19      24.573  26.121  -2.048  1.00  0.92           C  
ATOM    130  CD  GLU A  19      25.495  24.936  -2.326  1.00  0.92           C  
ATOM    131  OE1 GLU A  19      26.349  24.635  -1.453  1.00  0.92           O  
ATOM    132  OE2 GLU A  19      25.321  24.278  -3.382  1.00  0.92           O  
ATOM    133  N   PHE A  20      21.519  28.424  -4.938  1.00  0.93           N  
ATOM    134  CA  PHE A  20      21.015  29.289  -6.000  1.00  0.93           C  
ATOM    135  C   PHE A  20      20.439  30.630  -5.505  1.00  0.93           C  
ATOM    136  O   PHE A  20      20.810  31.699  -5.995  1.00  0.93           O  
ATOM    137  CB  PHE A  20      19.930  28.483  -6.783  1.00  0.93           C  
ATOM    138  CG  PHE A  20      19.208  29.282  -7.841  1.00  0.93           C  
ATOM    139  CD1 PHE A  20      19.844  29.618  -9.045  1.00  0.93           C  
ATOM    140  CD2 PHE A  20      17.904  29.751  -7.604  1.00  0.93           C  
ATOM    141  CE1 PHE A  20      19.189  30.410  -9.999  1.00  0.93           C  
ATOM    142  CE2 PHE A  20      17.243  30.537  -8.556  1.00  0.93           C  
ATOM    143  CZ  PHE A  20      17.886  30.866  -9.756  1.00  0.93           C  
ATOM    144  N   TYR A  21      19.533  30.613  -4.500  1.00  0.95           N  
ATOM    145  CA  TYR A  21      18.992  31.830  -3.906  1.00  0.95           C  
ATOM    146  C   TYR A  21      19.988  32.524  -2.979  1.00  0.95           C  
ATOM    147  O   TYR A  21      20.054  33.750  -2.947  1.00  0.95           O  
ATOM    148  CB  TYR A  21      17.636  31.622  -3.168  1.00  0.95           C  
ATOM    149  CG  TYR A  21      16.516  31.255  -4.117  1.00  0.95           C  
ATOM    150  CD1 TYR A  21      16.005  32.189  -5.040  1.00  0.95           C  
ATOM    151  CD2 TYR A  21      15.925  29.982  -4.058  1.00  0.95           C  
ATOM    152  CE1 TYR A  21      14.949  31.842  -5.901  1.00  0.95           C  
ATOM    153  CE2 TYR A  21      14.896  29.620  -4.936  1.00  0.95           C  
ATOM    154  CZ  TYR A  21      14.413  30.548  -5.860  1.00  0.95           C  
ATOM    155  OH  TYR A  21      13.387  30.155  -6.742  1.00  0.95           O  
ATOM    156  N   PHE A  22      20.812  31.781  -2.203  1.00  0.95           N  
ATOM    157  CA  PHE A  22      21.793  32.383  -1.310  1.00  0.95           C  
ATOM    158  C   PHE A  22      22.954  33.061  -2.027  1.00  0.95           C  
ATOM    159  O   PHE A  22      23.519  34.024  -1.519  1.00  0.95           O  
ATOM    160  CB  PHE A  22      22.358  31.365  -0.287  1.00  0.95           C  
ATOM    161  CG  PHE A  22      23.039  32.089   0.834  1.00  0.95           C  
ATOM    162  CD1 PHE A  22      22.266  32.750   1.794  1.00  0.95           C  
ATOM    163  CD2 PHE A  22      24.434  32.211   0.877  1.00  0.95           C  
ATOM    164  CE1 PHE A  22      22.874  33.498   2.806  1.00  0.95           C  
ATOM    165  CE2 PHE A  22      25.052  32.940   1.897  1.00  0.95           C  
ATOM    166  CZ  PHE A  22      24.272  33.577   2.871  1.00  0.95           C  
ATOM    167  N   SER A  23      23.327  32.616  -3.243  1.00  0.92           N  
ATOM    168  CA  SER A  23      24.440  33.175  -4.012  1.00  0.92           C  
ATOM    169  C   SER A  23      24.379  34.684  -4.193  1.00  0.92           C  
ATOM    170  O   SER A  23      25.382  35.376  -4.072  1.00  0.92           O  
ATOM    171  CB  SER A  23      24.553  32.505  -5.411  1.00  0.92           C  
ATOM    172  OG  SER A  23      25.357  31.327  -5.342  1.00  0.92           O  
ATOM    173  N   ARG A  24      23.179  35.249  -4.421  1.00  0.85           N  
ATOM    174  CA  ARG A  24      22.965  36.683  -4.526  1.00  0.85           C  
ATOM    175  C   ARG A  24      22.893  37.419  -3.188  1.00  0.85           C  
ATOM    176  O   ARG A  24      22.952  38.644  -3.136  1.00  0.85           O  
ATOM    177  CB  ARG A  24      21.744  36.984  -5.438  1.00  0.85           C  
ATOM    178  CG  ARG A  24      20.410  36.242  -5.192  1.00  0.85           C  
ATOM    179  CD  ARG A  24      19.711  35.843  -6.510  1.00  0.85           C  
ATOM    180  NE  ARG A  24      18.226  36.000  -6.357  1.00  0.85           N  
ATOM    181  CZ  ARG A  24      17.311  35.367  -7.110  1.00  0.85           C  
ATOM    182  NH1 ARG A  24      17.625  34.348  -7.895  1.00  0.85           N  
ATOM    183  NH2 ARG A  24      16.054  35.797  -7.069  1.00  0.85           N  
ATOM    184  N   LEU A  25      22.808  36.696  -2.056  1.00  0.94           N  
ATOM    185  CA  LEU A  25      22.758  37.295  -0.736  1.00  0.94           C  
ATOM    186  C   LEU A  25      24.088  37.169  -0.011  1.00  0.94           C  
ATOM    187  O   LEU A  25      24.293  37.765   1.041  1.00  0.94           O  
ATOM    188  CB  LEU A  25      21.673  36.593   0.126  1.00  0.94           C  
ATOM    189  CG  LEU A  25      20.266  36.562  -0.510  1.00  0.94           C  
ATOM    190  CD1 LEU A  25      19.254  35.928   0.457  1.00  0.94           C  
ATOM    191  CD2 LEU A  25      19.805  37.964  -0.924  1.00  0.94           C  
ATOM    192  N   SER A  26      25.066  36.431  -0.574  1.00  0.94           N  
ATOM    193  CA  SER A  26      26.261  35.968   0.128  1.00  0.94           C  
ATOM    194  C   SER A  26      27.223  37.058   0.576  1.00  0.94           C  
ATOM    195  O   SER A  26      28.041  36.858   1.476  1.00  0.94           O  
ATOM    196  CB  SER A  26      27.058  34.954  -0.736  1.00  0.94           C  
ATOM    197  OG  SER A  26      27.592  35.579  -1.904  1.00  0.94           O  
ATOM    198  N   HIS A  27      27.142  38.249  -0.048  1.00  0.87           N  
ATOM    199  CA  HIS A  27      27.963  39.404   0.272  1.00  0.87           C  
ATOM    200  C   HIS A  27      27.259  40.401   1.184  1.00  0.87           C  
ATOM    201  O   HIS A  27      27.865  41.358   1.654  1.00  0.87           O  
ATOM    202  CB  HIS A  27      28.410  40.119  -1.030  1.00  0.87           C  
ATOM    203  CG  HIS A  27      29.847  40.529  -0.985  1.00  0.87           C  
ATOM    204  ND1 HIS A  27      30.232  41.853  -0.933  1.00  0.87           N  
ATOM    205  CD2 HIS A  27      30.932  39.721  -0.958  1.00  0.87           C  
ATOM    206  CE1 HIS A  27      31.552  41.820  -0.871  1.00  0.87           C  
ATOM    207  NE2 HIS A  27      32.025  40.551  -0.883  1.00  0.87           N  
ATOM    208  N   LEU A  28      25.967  40.189   1.518  1.00  0.93           N  
ATOM    209  CA  LEU A  28      25.230  41.085   2.393  1.00  0.93           C  
ATOM    210  C   LEU A  28      25.557  40.806   3.863  1.00  0.93           C  
ATOM    211  O   LEU A  28      25.413  39.660   4.294  1.00  0.93           O  
ATOM    212  CB  LEU A  28      23.693  40.947   2.207  1.00  0.93           C  
ATOM    213  CG  LEU A  28      23.145  41.320   0.811  1.00  0.93           C  
ATOM    214  CD1 LEU A  28      21.639  41.013   0.744  1.00  0.93           C  
ATOM    215  CD2 LEU A  28      23.394  42.794   0.454  1.00  0.93           C  
ATOM    216  N   PRO A  29      25.992  41.756   4.696  1.00  0.96           N  
ATOM    217  CA  PRO A  29      26.045  41.588   6.146  1.00  0.96           C  
ATOM    218  C   PRO A  29      24.720  41.166   6.751  1.00  0.96           C  
ATOM    219  O   PRO A  29      23.697  41.781   6.453  1.00  0.96           O  
ATOM    220  CB  PRO A  29      26.532  42.946   6.673  1.00  0.96           C  
ATOM    221  CG  PRO A  29      27.342  43.509   5.504  1.00  0.96           C  
ATOM    222  CD  PRO A  29      26.535  43.050   4.290  1.00  0.96           C  
ATOM    223  N   TRP A  30      24.737  40.081   7.545  1.00  0.94           N  
ATOM    224  CA  TRP A  30      23.596  39.467   8.196  1.00  0.94           C  
ATOM    225  C   TRP A  30      22.833  38.555   7.247  1.00  0.94           C  
ATOM    226  O   TRP A  30      21.698  38.167   7.505  1.00  0.94           O  
ATOM    227  CB  TRP A  30      22.648  40.441   8.948  1.00  0.94           C  
ATOM    228  CG  TRP A  30      23.332  41.402   9.913  1.00  0.94           C  
ATOM    229  CD1 TRP A  30      23.733  42.695   9.694  1.00  0.94           C  
ATOM    230  CD2 TRP A  30      23.712  41.085  11.264  1.00  0.94           C  
ATOM    231  NE1 TRP A  30      24.359  43.194  10.817  1.00  0.94           N  
ATOM    232  CE2 TRP A  30      24.368  42.224  11.784  1.00  0.94           C  
ATOM    233  CE3 TRP A  30      23.548  39.939  12.036  1.00  0.94           C  
ATOM    234  CZ2 TRP A  30      24.884  42.226  13.071  1.00  0.94           C  
ATOM    235  CZ3 TRP A  30      24.076  39.943  13.335  1.00  0.94           C  
ATOM    236  CH2 TRP A  30      24.736  41.069  13.848  1.00  0.94           C  
ATOM    237  N   ALA A  31      23.461  38.138   6.132  1.00  0.98           N  
ATOM    238  CA  ALA A  31      22.969  37.051   5.321  1.00  0.98           C  
ATOM    239  C   ALA A  31      23.561  35.746   5.806  1.00  0.98           C  
ATOM    240  O   ALA A  31      24.772  35.598   5.996  1.00  0.98           O  
ATOM    241  CB  ALA A  31      23.292  37.266   3.840  1.00  0.98           C  
ATOM    242  N   MET A  32      22.685  34.763   6.060  1.00  0.96           N  
ATOM    243  CA  MET A  32      23.056  33.537   6.715  1.00  0.96           C  
ATOM    244  C   MET A  32      22.366  32.368   6.045  1.00  0.96           C  
ATOM    245  O   MET A  32      21.165  32.385   5.772  1.00  0.96           O  
ATOM    246  CB  MET A  32      22.660  33.560   8.208  1.00  0.96           C  
ATOM    247  CG  MET A  32      23.213  34.762   8.996  1.00  0.96           C  
ATOM    248  SD  MET A  32      22.658  34.763  10.714  1.00  0.96           S  
ATOM    249  CE  MET A  32      23.603  36.212  11.248  1.00  0.96           C  
ATOM    250  N   LEU A  33      23.146  31.317   5.767  1.00  0.98           N  
ATOM    251  CA  LEU A  33      22.688  30.073   5.201  1.00  0.98           C  
ATOM    252  C   LEU A  33      23.007  28.988   6.202  1.00  0.98           C  
ATOM    253  O   LEU A  33      24.134  28.887   6.687  1.00  0.98           O  
ATOM    254  CB  LEU A  33      23.432  29.782   3.867  1.00  0.98           C  
ATOM    255  CG  LEU A  33      23.314  28.355   3.282  1.00  0.98           C  
ATOM    256  CD1 LEU A  33      21.880  27.985   2.880  1.00  0.98           C  
ATOM    257  CD2 LEU A  33      24.251  28.187   2.077  1.00  0.98           C  
ATOM    258  N   LEU A  34      22.020  28.131   6.510  1.00  0.98           N  
ATOM    259  CA  LEU A  34      22.226  26.856   7.162  1.00  0.98           C  
ATOM    260  C   LEU A  34      21.935  25.819   6.102  1.00  0.98           C  
ATOM    261  O   LEU A  34      20.881  25.867   5.474  1.00  0.98           O  
ATOM    262  CB  LEU A  34      21.251  26.628   8.341  1.00  0.98           C  
ATOM    263  CG  LEU A  34      21.254  27.757   9.387  1.00  0.98           C  
ATOM    264  CD1 LEU A  34      20.227  27.463  10.485  1.00  0.98           C  
ATOM    265  CD2 LEU A  34      22.638  27.976  10.010  1.00  0.98           C  
ATOM    266  N   HIS A  35      22.869  24.890   5.844  1.00  0.96           N  
ATOM    267  CA  HIS A  35      22.803  24.010   4.692  1.00  0.96           C  
ATOM    268  C   HIS A  35      23.087  22.595   5.151  1.00  0.96           C  
ATOM    269  O   HIS A  35      24.008  22.349   5.922  1.00  0.96           O  
ATOM    270  CB  HIS A  35      23.843  24.426   3.615  1.00  0.96           C  
ATOM    271  CG  HIS A  35      23.562  23.919   2.229  1.00  0.96           C  
ATOM    272  ND1 HIS A  35      22.875  24.721   1.341  1.00  0.96           N  
ATOM    273  CD2 HIS A  35      23.879  22.737   1.642  1.00  0.96           C  
ATOM    274  CE1 HIS A  35      22.778  24.003   0.237  1.00  0.96           C  
ATOM    275  NE2 HIS A  35      23.371  22.797   0.366  1.00  0.96           N  
ATOM    276  N   SER A  36      22.322  21.607   4.670  1.00  0.97           N  
ATOM    277  CA  SER A  36      22.345  20.231   5.163  1.00  0.97           C  
ATOM    278  C   SER A  36      23.319  19.362   4.381  1.00  0.97           C  
ATOM    279  O   SER A  36      23.290  18.131   4.402  1.00  0.97           O  
ATOM    280  CB  SER A  36      20.935  19.606   5.048  1.00  0.97           C  
ATOM    281  OG  SER A  36      20.118  19.876   6.189  1.00  0.97           O  
ATOM    282  N   GLY A  37      24.226  20.017   3.641  1.00  0.97           N  
ATOM    283  CA  GLY A  37      25.407  19.442   3.007  1.00  0.97           C  
ATOM    284  C   GLY A  37      25.150  18.656   1.754  1.00  0.97           C  
ATOM    285  O   GLY A  37      26.059  18.035   1.216  1.00  0.97           O  
ATOM    286  N   TYR A  38      23.884  18.602   1.297  1.00  0.93           N  
ATOM    287  CA  TYR A  38      23.386  17.603   0.355  1.00  0.93           C  
ATOM    288  C   TYR A  38      23.597  16.186   0.886  1.00  0.93           C  
ATOM    289  O   TYR A  38      23.945  15.248   0.166  1.00  0.93           O  
ATOM    290  CB  TYR A  38      23.997  17.735  -1.066  1.00  0.93           C  
ATOM    291  CG  TYR A  38      23.755  19.104  -1.620  1.00  0.93           C  
ATOM    292  CD1 TYR A  38      22.454  19.526  -1.935  1.00  0.93           C  
ATOM    293  CD2 TYR A  38      24.832  19.977  -1.840  1.00  0.93           C  
ATOM    294  CE1 TYR A  38      22.238  20.805  -2.464  1.00  0.93           C  
ATOM    295  CE2 TYR A  38      24.617  21.247  -2.389  1.00  0.93           C  
ATOM    296  CZ  TYR A  38      23.318  21.663  -2.695  1.00  0.93           C  
ATOM    297  OH  TYR A  38      23.097  22.961  -3.189  1.00  0.93           O  
ATOM    298  N   ALA A  39      23.431  16.009   2.211  1.00  0.92           N  
ATOM    299  CA  ALA A  39      23.883  14.816   2.874  1.00  0.92           C  
ATOM    300  C   ALA A  39      22.868  13.692   2.857  1.00  0.92           C  
ATOM    301  O   ALA A  39      21.664  13.875   3.017  1.00  0.92           O  
ATOM    302  CB  ALA A  39      24.302  15.124   4.326  1.00  0.92           C  
ATOM    303  N   ASP A  40      23.385  12.465   2.720  1.00  0.78           N  
ATOM    304  CA  ASP A  40      22.667  11.248   3.001  1.00  0.78           C  
ATOM    305  C   ASP A  40      22.803  11.054   4.511  1.00  0.78           C  
ATOM    306  O   ASP A  40      23.895  10.778   5.014  1.00  0.78           O  
ATOM    307  CB  ASP A  40      23.342  10.117   2.188  1.00  0.78           C  
ATOM    308  CG  ASP A  40      22.580   8.809   2.257  1.00  0.78           C  
ATOM    309  OD1 ASP A  40      21.453   8.799   2.804  1.00  0.78           O  
ATOM    310  OD2 ASP A  40      23.153   7.817   1.744  1.00  0.78           O  
ATOM    311  N   HIS A  41      21.733  11.343   5.277  1.00  0.74           N  
ATOM    312  CA  HIS A  41      21.798  11.382   6.721  1.00  0.74           C  
ATOM    313  C   HIS A  41      20.367  11.359   7.242  1.00  0.74           C  
ATOM    314  O   HIS A  41      19.467  11.745   6.497  1.00  0.74           O  
ATOM    315  CB  HIS A  41      22.526  12.678   7.196  1.00  0.74           C  
ATOM    316  CG  HIS A  41      23.138  12.627   8.563  1.00  0.74           C  
ATOM    317  ND1 HIS A  41      22.457  13.101   9.671  1.00  0.74           N  
ATOM    318  CD2 HIS A  41      24.346  12.123   8.929  1.00  0.74           C  
ATOM    319  CE1 HIS A  41      23.272  12.870  10.688  1.00  0.74           C  
ATOM    320  NE2 HIS A  41      24.426  12.278  10.294  1.00  0.74           N  
ATOM    321  N   PRO A  42      20.047  10.956   8.466  1.00  0.74           N  
ATOM    322  CA  PRO A  42      18.702  11.115   9.022  1.00  0.74           C  
ATOM    323  C   PRO A  42      18.309  12.571   9.258  1.00  0.74           C  
ATOM    324  O   PRO A  42      17.117  12.863   9.332  1.00  0.74           O  
ATOM    325  CB  PRO A  42      18.752  10.308  10.338  1.00  0.74           C  
ATOM    326  CG  PRO A  42      20.244  10.219  10.681  1.00  0.74           C  
ATOM    327  CD  PRO A  42      20.897  10.114   9.308  1.00  0.74           C  
ATOM    328  N   TYR A  43      19.271  13.500   9.438  1.00  0.88           N  
ATOM    329  CA  TYR A  43      18.977  14.840   9.923  1.00  0.88           C  
ATOM    330  C   TYR A  43      19.305  15.939   8.924  1.00  0.88           C  
ATOM    331  O   TYR A  43      19.455  17.099   9.293  1.00  0.88           O  
ATOM    332  CB  TYR A  43      19.658  15.078  11.300  1.00  0.88           C  
ATOM    333  CG  TYR A  43      19.092  14.114  12.323  1.00  0.88           C  
ATOM    334  CD1 TYR A  43      17.705  14.060  12.567  1.00  0.88           C  
ATOM    335  CD2 TYR A  43      19.931  13.227  13.023  1.00  0.88           C  
ATOM    336  CE1 TYR A  43      17.172  13.137  13.477  1.00  0.88           C  
ATOM    337  CE2 TYR A  43      19.396  12.307  13.939  1.00  0.88           C  
ATOM    338  CZ  TYR A  43      18.018  12.272  14.172  1.00  0.88           C  
ATOM    339  OH  TYR A  43      17.470  11.376  15.108  1.00  0.88           O  
ATOM    340  N   SER A  44      19.360  15.607   7.624  1.00  0.94           N  
ATOM    341  CA  SER A  44      19.749  16.494   6.533  1.00  0.94           C  
ATOM    342  C   SER A  44      18.579  16.978   5.679  1.00  0.94           C  
ATOM    343  O   SER A  44      18.720  17.301   4.503  1.00  0.94           O  
ATOM    344  CB  SER A  44      20.754  15.771   5.611  1.00  0.94           C  
ATOM    345  OG  SER A  44      20.257  14.486   5.234  1.00  0.94           O  
ATOM    346  N   ARG A  45      17.362  17.038   6.249  1.00  0.85           N  
ATOM    347  CA  ARG A  45      16.149  17.424   5.539  1.00  0.85           C  
ATOM    348  C   ARG A  45      16.102  18.855   4.982  1.00  0.85           C  
ATOM    349  O   ARG A  45      15.542  19.079   3.907  1.00  0.85           O  
ATOM    350  CB  ARG A  45      14.906  17.144   6.433  1.00  0.85           C  
ATOM    351  CG  ARG A  45      13.544  17.524   5.808  1.00  0.85           C  
ATOM    352  CD  ARG A  45      12.328  17.005   6.583  1.00  0.85           C  
ATOM    353  NE  ARG A  45      11.129  17.604   5.931  1.00  0.85           N  
ATOM    354  CZ  ARG A  45       9.912  17.668   6.484  1.00  0.85           C  
ATOM    355  NH1 ARG A  45       9.625  17.162   7.675  1.00  0.85           N  
ATOM    356  NH2 ARG A  45       8.954  18.294   5.823  1.00  0.85           N  
ATOM    357  N   PHE A  46      16.647  19.859   5.704  1.00  0.94           N  
ATOM    358  CA  PHE A  46      16.353  21.261   5.438  1.00  0.94           C  
ATOM    359  C   PHE A  46      17.573  22.117   5.203  1.00  0.94           C  
ATOM    360  O   PHE A  46      18.532  22.059   5.971  1.00  0.94           O  
ATOM    361  CB  PHE A  46      15.632  21.952   6.626  1.00  0.94           C  
ATOM    362  CG  PHE A  46      14.271  21.385   6.862  1.00  0.94           C  
ATOM    363  CD1 PHE A  46      13.214  21.699   5.993  1.00  0.94           C  
ATOM    364  CD2 PHE A  46      14.019  20.610   8.003  1.00  0.94           C  
ATOM    365  CE1 PHE A  46      11.911  21.279   6.284  1.00  0.94           C  
ATOM    366  CE2 PHE A  46      12.718  20.184   8.296  1.00  0.94           C  
ATOM    367  CZ  PHE A  46      11.663  20.532   7.442  1.00  0.94           C  
ATOM    368  N   ASP A  47      17.507  23.004   4.193  1.00  0.96           N  
ATOM    369  CA  ASP A  47      18.376  24.159   4.088  1.00  0.96           C  
ATOM    370  C   ASP A  47      17.549  25.411   4.399  1.00  0.96           C  
ATOM    371  O   ASP A  47      16.369  25.513   4.053  1.00  0.96           O  
ATOM    372  CB  ASP A  47      19.042  24.318   2.701  1.00  0.96           C  
ATOM    373  CG  ASP A  47      19.673  23.035   2.189  1.00  0.96           C  
ATOM    374  OD1 ASP A  47      20.391  22.351   2.960  1.00  0.96           O  
ATOM    375  OD2 ASP A  47      19.446  22.729   0.989  1.00  0.96           O  
ATOM    376  N   ILE A  48      18.145  26.383   5.114  1.00  0.98           N  
ATOM    377  CA  ILE A  48      17.467  27.569   5.620  1.00  0.98           C  
ATOM    378  C   ILE A  48      18.277  28.792   5.230  1.00  0.98           C  
ATOM    379  O   ILE A  48      19.468  28.889   5.521  1.00  0.98           O  
ATOM    380  CB  ILE A  48      17.261  27.536   7.143  1.00  0.98           C  
ATOM    381  CG1 ILE A  48      16.340  26.354   7.548  1.00  0.98           C  
ATOM    382  CG2 ILE A  48      16.685  28.889   7.637  1.00  0.98           C  
ATOM    383  CD1 ILE A  48      16.335  26.058   9.053  1.00  0.98           C  
ATOM    384  N   VAL A  49      17.634  29.769   4.560  1.00  0.99           N  
ATOM    385  CA  VAL A  49      18.248  31.020   4.138  1.00  0.99           C  
ATOM    386  C   VAL A  49      17.532  32.194   4.783  1.00  0.99           C  
ATOM    387  O   VAL A  49      16.303  32.295   4.753  1.00  0.99           O  
ATOM    388  CB  VAL A  49      18.228  31.169   2.612  1.00  0.99           C  
ATOM    389  CG1 VAL A  49      18.438  32.627   2.140  1.00  0.99           C  
ATOM    390  CG2 VAL A  49      19.314  30.252   2.027  1.00  0.99           C  
ATOM    391  N   VAL A  50      18.316  33.127   5.367  1.00  0.99           N  
ATOM    392  CA  VAL A  50      17.836  34.406   5.863  1.00  0.99           C  
ATOM    393  C   VAL A  50      18.817  35.508   5.472  1.00  0.99           C  
ATOM    394  O   VAL A  50      19.996  35.273   5.211  1.00  0.99           O  
ATOM    395  CB  VAL A  50      17.636  34.451   7.378  1.00  0.99           C  
ATOM    396  CG1 VAL A  50      16.504  33.500   7.801  1.00  0.99           C  
ATOM    397  CG2 VAL A  50      18.940  34.114   8.124  1.00  0.99           C  
ATOM    398  N   ALA A  51      18.328  36.758   5.407  1.00  0.99           N  
ATOM    399  CA  ALA A  51      19.099  37.961   5.191  1.00  0.99           C  
ATOM    400  C   ALA A  51      18.162  39.062   5.638  1.00  0.99           C  
ATOM    401  O   ALA A  51      17.025  38.750   5.975  1.00  0.99           O  
ATOM    402  CB  ALA A  51      19.532  38.149   3.721  1.00  0.99           C  
ATOM    403  N   GLU A  52      18.574  40.346   5.684  1.00  0.94           N  
ATOM    404  CA  GLU A  52      17.678  41.438   6.080  1.00  0.94           C  
ATOM    405  C   GLU A  52      16.989  41.291   7.449  1.00  0.94           C  
ATOM    406  O   GLU A  52      15.769  41.124   7.515  1.00  0.94           O  
ATOM    407  CB  GLU A  52      16.646  41.818   4.983  1.00  0.94           C  
ATOM    408  CG  GLU A  52      17.183  42.827   3.940  1.00  0.94           C  
ATOM    409  CD  GLU A  52      16.126  43.868   3.578  1.00  0.94           C  
ATOM    410  OE1 GLU A  52      14.965  43.457   3.313  1.00  0.94           O  
ATOM    411  OE2 GLU A  52      16.458  45.074   3.574  1.00  0.94           O  
ATOM    412  N   PRO A  53      17.702  41.298   8.567  1.00  0.99           N  
ATOM    413  CA  PRO A  53      17.074  41.255   9.877  1.00  0.99           C  
ATOM    414  C   PRO A  53      16.386  42.566  10.250  1.00  0.99           C  
ATOM    415  O   PRO A  53      16.865  43.645   9.911  1.00  0.99           O  
ATOM    416  CB  PRO A  53      18.263  40.974  10.803  1.00  0.99           C  
ATOM    417  CG  PRO A  53      19.427  41.709  10.140  1.00  0.99           C  
ATOM    418  CD  PRO A  53      19.146  41.533   8.648  1.00  0.99           C  
ATOM    419  N   ILE A  54      15.253  42.491  10.974  1.00  0.96           N  
ATOM    420  CA  ILE A  54      14.546  43.650  11.504  1.00  0.96           C  
ATOM    421  C   ILE A  54      15.191  44.173  12.784  1.00  0.96           C  
ATOM    422  O   ILE A  54      15.018  45.328  13.171  1.00  0.96           O  
ATOM    423  CB  ILE A  54      13.065  43.335  11.742  1.00  0.96           C  
ATOM    424  CG1 ILE A  54      12.837  42.138  12.706  1.00  0.96           C  
ATOM    425  CG2 ILE A  54      12.424  43.097  10.355  1.00  0.96           C  
ATOM    426  CD1 ILE A  54      11.360  41.885  13.035  1.00  0.96           C  
ATOM    427  N   CYS A  55      15.995  43.321  13.449  1.00  0.98           N  
ATOM    428  CA  CYS A  55      16.743  43.658  14.643  1.00  0.98           C  
ATOM    429  C   CYS A  55      17.994  42.797  14.659  1.00  0.98           C  
ATOM    430  O   CYS A  55      17.970  41.650  14.217  1.00  0.98           O  
ATOM    431  CB  CYS A  55      15.882  43.428  15.924  1.00  0.98           C  
ATOM    432  SG  CYS A  55      16.682  43.796  17.526  1.00  0.98           S  
ATOM    433  N   THR A  56      19.126  43.328  15.151  1.00  0.96           N  
ATOM    434  CA  THR A  56      20.381  42.593  15.307  1.00  0.96           C  
ATOM    435  C   THR A  56      20.859  42.638  16.740  1.00  0.96           C  
ATOM    436  O   THR A  56      20.619  43.598  17.472  1.00  0.96           O  
ATOM    437  CB  THR A  56      21.530  43.014  14.386  1.00  0.96           C  
ATOM    438  OG1 THR A  56      21.938  44.365  14.548  1.00  0.96           O  
ATOM    439  CG2 THR A  56      21.071  42.869  12.935  1.00  0.96           C  
ATOM    440  N   LEU A  57      21.528  41.552  17.187  1.00  0.96           N  
ATOM    441  CA  LEU A  57      22.147  41.474  18.498  1.00  0.96           C  
ATOM    442  C   LEU A  57      23.611  41.096  18.358  1.00  0.96           C  
ATOM    443  O   LEU A  57      23.954  40.045  17.812  1.00  0.96           O  
ATOM    444  CB  LEU A  57      21.488  40.447  19.455  1.00  0.96           C  
ATOM    445  CG  LEU A  57      20.071  40.813  19.938  1.00  0.96           C  
ATOM    446  CD1 LEU A  57      18.974  40.371  18.958  1.00  0.96           C  
ATOM    447  CD2 LEU A  57      19.815  40.195  21.320  1.00  0.96           C  
ATOM    448  N   THR A  58      24.497  41.964  18.886  1.00  0.97           N  
ATOM    449  CA  THR A  58      25.948  41.840  18.788  1.00  0.97           C  
ATOM    450  C   THR A  58      26.532  41.912  20.180  1.00  0.97           C  
ATOM    451  O   THR A  58      26.420  42.933  20.855  1.00  0.97           O  
ATOM    452  CB  THR A  58      26.592  42.953  17.955  1.00  0.97           C  
ATOM    453  OG1 THR A  58      26.135  42.877  16.613  1.00  0.97           O  
ATOM    454  CG2 THR A  58      28.120  42.803  17.894  1.00  0.97           C  
ATOM    455  N   THR A  59      27.197  40.838  20.644  1.00  0.96           N  
ATOM    456  CA  THR A  59      27.808  40.766  21.974  1.00  0.96           C  
ATOM    457  C   THR A  59      29.309  40.723  21.841  1.00  0.96           C  
ATOM    458  O   THR A  59      29.847  39.853  21.161  1.00  0.96           O  
ATOM    459  CB  THR A  59      27.416  39.527  22.783  1.00  0.96           C  
ATOM    460  OG1 THR A  59      26.011  39.469  22.946  1.00  0.96           O  
ATOM    461  CG2 THR A  59      27.996  39.534  24.205  1.00  0.96           C  
ATOM    462  N   PHE A  60      30.021  41.650  22.515  1.00  0.94           N  
ATOM    463  CA  PHE A  60      31.462  41.578  22.699  1.00  0.94           C  
ATOM    464  C   PHE A  60      31.739  41.574  24.193  1.00  0.94           C  
ATOM    465  O   PHE A  60      31.690  42.589  24.898  1.00  0.94           O  
ATOM    466  CB  PHE A  60      32.196  42.795  22.081  1.00  0.94           C  
ATOM    467  CG  PHE A  60      32.440  42.600  20.615  1.00  0.94           C  
ATOM    468  CD1 PHE A  60      33.510  41.794  20.196  1.00  0.94           C  
ATOM    469  CD2 PHE A  60      31.679  43.280  19.651  1.00  0.94           C  
ATOM    470  CE1 PHE A  60      33.842  41.698  18.841  1.00  0.94           C  
ATOM    471  CE2 PHE A  60      32.004  43.181  18.291  1.00  0.94           C  
ATOM    472  CZ  PHE A  60      33.092  42.395  17.887  1.00  0.94           C  
ATOM    473  N   GLY A  61      32.066  40.390  24.738  1.00  0.92           N  
ATOM    474  CA  GLY A  61      32.117  40.098  26.156  1.00  0.92           C  
ATOM    475  C   GLY A  61      30.909  40.574  26.936  1.00  0.92           C  
ATOM    476  O   GLY A  61      29.779  40.136  26.749  1.00  0.92           O  
ATOM    477  N   LYS A  62      31.148  41.490  27.884  1.00  0.86           N  
ATOM    478  CA  LYS A  62      30.201  42.045  28.825  1.00  0.86           C  
ATOM    479  C   LYS A  62      29.021  42.819  28.234  1.00  0.86           C  
ATOM    480  O   LYS A  62      27.969  42.860  28.861  1.00  0.86           O  
ATOM    481  CB  LYS A  62      30.937  42.943  29.858  1.00  0.86           C  
ATOM    482  CG  LYS A  62      32.073  42.258  30.655  1.00  0.86           C  
ATOM    483  CD  LYS A  62      33.449  42.041  29.976  1.00  0.86           C  
ATOM    484  CE  LYS A  62      34.147  43.305  29.436  1.00  0.86           C  
ATOM    485  NZ  LYS A  62      34.017  43.458  27.959  1.00  0.86           N  
ATOM    486  N   GLU A  63      29.144  43.433  27.038  1.00  0.88           N  
ATOM    487  CA  GLU A  63      28.099  44.289  26.493  1.00  0.88           C  
ATOM    488  C   GLU A  63      27.442  43.625  25.296  1.00  0.88           C  
ATOM    489  O   GLU A  63      28.110  43.069  24.423  1.00  0.88           O  
ATOM    490  CB  GLU A  63      28.619  45.696  26.077  1.00  0.88           C  
ATOM    491  CG  GLU A  63      27.478  46.667  25.664  1.00  0.88           C  
ATOM    492  CD  GLU A  63      27.937  48.071  25.262  1.00  0.88           C  
ATOM    493  OE1 GLU A  63      28.542  48.211  24.169  1.00  0.88           O  
ATOM    494  OE2 GLU A  63      27.592  49.030  26.004  1.00  0.88           O  
ATOM    495  N   THR A  64      26.096  43.677  25.255  1.00  0.94           N  
ATOM    496  CA  THR A  64      25.271  43.280  24.123  1.00  0.94           C  
ATOM    497  C   THR A  64      24.673  44.542  23.533  1.00  0.94           C  
ATOM    498  O   THR A  64      23.963  45.288  24.208  1.00  0.94           O  
ATOM    499  CB  THR A  64      24.085  42.387  24.494  1.00  0.94           C  
ATOM    500  OG1 THR A  64      24.506  41.205  25.163  1.00  0.94           O  
ATOM    501  CG2 THR A  64      23.320  41.936  23.235  1.00  0.94           C  
ATOM    502  N   VAL A  65      24.924  44.811  22.239  1.00  0.94           N  
ATOM    503  CA  VAL A  65      24.279  45.873  21.485  1.00  0.94           C  
ATOM    504  C   VAL A  65      23.047  45.290  20.821  1.00  0.94           C  
ATOM    505  O   VAL A  65      23.132  44.270  20.139  1.00  0.94           O  
ATOM    506  CB  VAL A  65      25.188  46.467  20.406  1.00  0.94           C  
ATOM    507  CG1 VAL A  65      24.459  47.596  19.641  1.00  0.94           C  
ATOM    508  CG2 VAL A  65      26.465  47.002  21.081  1.00  0.94           C  
ATOM    509  N   VAL A  66      21.874  45.925  21.002  1.00  0.94           N  
ATOM    510  CA  VAL A  66      20.629  45.537  20.359  1.00  0.94           C  
ATOM    511  C   VAL A  66      20.282  46.667  19.412  1.00  0.94           C  
ATOM    512  O   VAL A  66      20.226  47.828  19.814  1.00  0.94           O  
ATOM    513  CB  VAL A  66      19.487  45.351  21.356  1.00  0.94           C  
ATOM    514  CG1 VAL A  66      18.198  44.894  20.641  1.00  0.94           C  
ATOM    515  CG2 VAL A  66      19.897  44.316  22.423  1.00  0.94           C  
ATOM    516  N   SER A  67      20.100  46.372  18.113  1.00  0.92           N  
ATOM    517  CA  SER A  67      20.006  47.409  17.094  1.00  0.92           C  
ATOM    518  C   SER A  67      18.824  47.182  16.176  1.00  0.92           C  
ATOM    519  O   SER A  67      18.699  46.123  15.565  1.00  0.92           O  
ATOM    520  CB  SER A  67      21.297  47.433  16.236  1.00  0.92           C  
ATOM    521  OG  SER A  67      21.532  48.719  15.660  1.00  0.92           O  
ATOM    522  N   GLU A  68      17.927  48.178  16.054  1.00  0.85           N  
ATOM    523  CA  GLU A  68      16.781  48.167  15.164  1.00  0.85           C  
ATOM    524  C   GLU A  68      16.868  49.380  14.250  1.00  0.85           C  
ATOM    525  O   GLU A  68      17.791  50.184  14.330  1.00  0.85           O  
ATOM    526  CB  GLU A  68      15.425  48.306  15.918  1.00  0.85           C  
ATOM    527  CG  GLU A  68      15.127  47.248  17.004  1.00  0.85           C  
ATOM    528  CD  GLU A  68      13.780  47.543  17.646  1.00  0.85           C  
ATOM    529  OE1 GLU A  68      13.709  48.436  18.532  1.00  0.85           O  
ATOM    530  OE2 GLU A  68      12.752  46.974  17.210  1.00  0.85           O  
ATOM    531  N   SER A  69      15.856  49.554  13.374  1.00  0.82           N  
ATOM    532  CA  SER A  69      15.589  50.735  12.549  1.00  0.82           C  
ATOM    533  C   SER A  69      15.909  52.104  13.156  1.00  0.82           C  
ATOM    534  O   SER A  69      16.772  52.827  12.667  1.00  0.82           O  
ATOM    535  CB  SER A  69      14.082  50.749  12.138  1.00  0.82           C  
ATOM    536  OG  SER A  69      13.211  50.564  13.265  1.00  0.82           O  
ATOM    537  N   GLU A  70      15.192  52.484  14.228  1.00  0.71           N  
ATOM    538  CA  GLU A  70      15.225  53.812  14.820  1.00  0.71           C  
ATOM    539  C   GLU A  70      15.592  53.785  16.297  1.00  0.71           C  
ATOM    540  O   GLU A  70      15.435  54.765  17.022  1.00  0.71           O  
ATOM    541  CB  GLU A  70      13.832  54.455  14.643  1.00  0.71           C  
ATOM    542  CG  GLU A  70      13.503  54.759  13.160  1.00  0.71           C  
ATOM    543  CD  GLU A  70      12.061  55.207  12.947  1.00  0.71           C  
ATOM    544  OE1 GLU A  70      11.247  55.086  13.899  1.00  0.71           O  
ATOM    545  OE2 GLU A  70      11.763  55.622  11.799  1.00  0.71           O  
ATOM    546  N   LYS A  71      16.108  52.651  16.804  1.00  0.78           N  
ATOM    547  CA  LYS A  71      16.599  52.582  18.166  1.00  0.78           C  
ATOM    548  C   LYS A  71      17.748  51.598  18.249  1.00  0.78           C  
ATOM    549  O   LYS A  71      17.764  50.546  17.618  1.00  0.78           O  
ATOM    550  CB  LYS A  71      15.534  52.275  19.270  1.00  0.78           C  
ATOM    551  CG  LYS A  71      14.331  51.411  18.854  1.00  0.78           C  
ATOM    552  CD  LYS A  71      13.108  52.227  18.389  1.00  0.78           C  
ATOM    553  CE  LYS A  71      11.810  51.422  18.206  1.00  0.78           C  
ATOM    554  NZ  LYS A  71      12.046  50.173  17.452  1.00  0.78           N  
ATOM    555  N   ARG A  72      18.756  51.963  19.056  1.00  0.81           N  
ATOM    556  CA  ARG A  72      19.898  51.146  19.380  1.00  0.81           C  
ATOM    557  C   ARG A  72      20.056  51.245  20.874  1.00  0.81           C  
ATOM    558  O   ARG A  72      20.143  52.338  21.429  1.00  0.81           O  
ATOM    559  CB  ARG A  72      21.181  51.680  18.685  1.00  0.81           C  
ATOM    560  CG  ARG A  72      22.516  51.021  19.106  1.00  0.81           C  
ATOM    561  CD  ARG A  72      23.739  51.684  18.453  1.00  0.81           C  
ATOM    562  NE  ARG A  72      24.984  51.008  18.968  1.00  0.81           N  
ATOM    563  CZ  ARG A  72      25.593  51.272  20.136  1.00  0.81           C  
ATOM    564  NH1 ARG A  72      25.090  52.124  21.020  1.00  0.81           N  
ATOM    565  NH2 ARG A  72      26.735  50.650  20.433  1.00  0.81           N  
ATOM    566  N   THR A  73      20.093  50.099  21.564  1.00  0.91           N  
ATOM    567  CA  THR A  73      20.304  50.044  22.998  1.00  0.91           C  
ATOM    568  C   THR A  73      21.512  49.192  23.270  1.00  0.91           C  
ATOM    569  O   THR A  73      21.926  48.354  22.469  1.00  0.91           O  
ATOM    570  CB  THR A  73      19.121  49.535  23.825  1.00  0.91           C  
ATOM    571  OG1 THR A  73      18.712  48.228  23.451  1.00  0.91           O  
ATOM    572  CG2 THR A  73      17.910  50.454  23.609  1.00  0.91           C  
ATOM    573  N   THR A  74      22.143  49.425  24.427  1.00  0.94           N  
ATOM    574  CA  THR A  74      23.219  48.597  24.934  1.00  0.94           C  
ATOM    575  C   THR A  74      22.788  48.071  26.274  1.00  0.94           C  
ATOM    576  O   THR A  74      21.997  48.693  26.982  1.00  0.94           O  
ATOM    577  CB  THR A  74      24.599  49.241  25.037  1.00  0.94           C  
ATOM    578  OG1 THR A  74      24.706  50.323  25.950  1.00  0.94           O  
ATOM    579  CG2 THR A  74      24.993  49.790  23.663  1.00  0.94           C  
ATOM    580  N   THR A  75      23.247  46.861  26.622  1.00  0.94           N  
ATOM    581  CA  THR A  75      22.943  46.240  27.903  1.00  0.94           C  
ATOM    582  C   THR A  75      24.081  45.318  28.310  1.00  0.94           C  
ATOM    583  O   THR A  75      24.811  44.780  27.478  1.00  0.94           O  
ATOM    584  CB  THR A  75      21.592  45.501  27.951  1.00  0.94           C  
ATOM    585  OG1 THR A  75      21.431  44.822  29.195  1.00  0.94           O  
ATOM    586  CG2 THR A  75      21.478  44.472  26.813  1.00  0.94           C  
ATOM    587  N   THR A  76      24.249  45.125  29.634  1.00  0.91           N  
ATOM    588  CA  THR A  76      25.185  44.209  30.265  1.00  0.91           C  
ATOM    589  C   THR A  76      24.517  42.933  30.750  1.00  0.91           C  
ATOM    590  O   THR A  76      25.210  42.032  31.222  1.00  0.91           O  
ATOM    591  CB  THR A  76      25.865  44.827  31.484  1.00  0.91           C  
ATOM    592  OG1 THR A  76      24.921  45.486  32.322  1.00  0.91           O  
ATOM    593  CG2 THR A  76      26.856  45.889  30.992  1.00  0.91           C  
ATOM    594  N   ASP A  77      23.173  42.798  30.633  1.00  0.92           N  
ATOM    595  CA  ASP A  77      22.402  41.594  30.945  1.00  0.92           C  
ATOM    596  C   ASP A  77      22.916  40.290  30.288  1.00  0.92           C  
ATOM    597  O   ASP A  77      23.766  40.295  29.392  1.00  0.92           O  
ATOM    598  CB  ASP A  77      20.888  41.761  30.625  1.00  0.92           C  
ATOM    599  CG  ASP A  77      20.207  42.890  31.381  1.00  0.92           C  
ATOM    600  OD1 ASP A  77      20.360  42.950  32.622  1.00  0.92           O  
ATOM    601  OD2 ASP A  77      19.487  43.670  30.696  1.00  0.92           O  
ATOM    602  N   ASP A  78      22.405  39.109  30.722  1.00  0.93           N  
ATOM    603  CA  ASP A  78      22.656  37.809  30.109  1.00  0.93           C  
ATOM    604  C   ASP A  78      22.283  37.800  28.608  1.00  0.93           C  
ATOM    605  O   ASP A  78      21.142  38.135  28.283  1.00  0.93           O  
ATOM    606  CB  ASP A  78      21.840  36.737  30.891  1.00  0.93           C  
ATOM    607  CG  ASP A  78      21.851  35.356  30.260  1.00  0.93           C  
ATOM    608  OD1 ASP A  78      20.846  35.000  29.585  1.00  0.93           O  
ATOM    609  OD2 ASP A  78      22.841  34.612  30.407  1.00  0.93           O  
ATOM    610  N   PRO A  79      23.135  37.434  27.644  1.00  0.97           N  
ATOM    611  CA  PRO A  79      22.824  37.645  26.232  1.00  0.97           C  
ATOM    612  C   PRO A  79      21.659  36.819  25.728  1.00  0.97           C  
ATOM    613  O   PRO A  79      20.947  37.266  24.832  1.00  0.97           O  
ATOM    614  CB  PRO A  79      24.134  37.301  25.507  1.00  0.97           C  
ATOM    615  CG  PRO A  79      25.204  37.669  26.531  1.00  0.97           C  
ATOM    616  CD  PRO A  79      24.571  37.229  27.849  1.00  0.97           C  
ATOM    617  N   LEU A  80      21.447  35.610  26.279  1.00  0.95           N  
ATOM    618  CA  LEU A  80      20.360  34.737  25.883  1.00  0.95           C  
ATOM    619  C   LEU A  80      19.029  35.168  26.489  1.00  0.95           C  
ATOM    620  O   LEU A  80      17.977  35.020  25.872  1.00  0.95           O  
ATOM    621  CB  LEU A  80      20.700  33.256  26.184  1.00  0.95           C  
ATOM    622  CG  LEU A  80      21.941  32.741  25.412  1.00  0.95           C  
ATOM    623  CD1 LEU A  80      22.263  31.293  25.797  1.00  0.95           C  
ATOM    624  CD2 LEU A  80      21.784  32.848  23.887  1.00  0.95           C  
ATOM    625  N   GLN A  81      19.047  35.781  27.692  1.00  0.92           N  
ATOM    626  CA  GLN A  81      17.915  36.480  28.279  1.00  0.92           C  
ATOM    627  C   GLN A  81      17.520  37.695  27.460  1.00  0.92           C  
ATOM    628  O   GLN A  81      16.353  37.885  27.127  1.00  0.92           O  
ATOM    629  CB  GLN A  81      18.266  36.950  29.712  1.00  0.92           C  
ATOM    630  CG  GLN A  81      17.114  37.630  30.483  1.00  0.92           C  
ATOM    631  CD  GLN A  81      17.629  38.188  31.811  1.00  0.92           C  
ATOM    632  OE1 GLN A  81      18.377  37.530  32.534  1.00  0.92           O  
ATOM    633  NE2 GLN A  81      17.236  39.440  32.138  1.00  0.92           N  
ATOM    634  N   VAL A  82      18.510  38.517  27.045  1.00  0.97           N  
ATOM    635  CA  VAL A  82      18.301  39.660  26.163  1.00  0.97           C  
ATOM    636  C   VAL A  82      17.734  39.231  24.828  1.00  0.97           C  
ATOM    637  O   VAL A  82      16.772  39.819  24.341  1.00  0.97           O  
ATOM    638  CB  VAL A  82      19.582  40.460  25.945  1.00  0.97           C  
ATOM    639  CG1 VAL A  82      19.379  41.619  24.946  1.00  0.97           C  
ATOM    640  CG2 VAL A  82      19.992  41.058  27.294  1.00  0.97           C  
ATOM    641  N   LEU A  83      18.270  38.144  24.237  1.00  0.95           N  
ATOM    642  CA  LEU A  83      17.755  37.563  23.015  1.00  0.95           C  
ATOM    643  C   LEU A  83      16.315  37.080  23.125  1.00  0.95           C  
ATOM    644  O   LEU A  83      15.493  37.395  22.268  1.00  0.95           O  
ATOM    645  CB  LEU A  83      18.669  36.402  22.548  1.00  0.95           C  
ATOM    646  CG  LEU A  83      18.271  35.742  21.210  1.00  0.95           C  
ATOM    647  CD1 LEU A  83      18.134  36.774  20.083  1.00  0.95           C  
ATOM    648  CD2 LEU A  83      19.289  34.661  20.814  1.00  0.95           C  
ATOM    649  N   GLN A  84      15.940  36.361  24.205  1.00  0.92           N  
ATOM    650  CA  GLN A  84      14.554  35.964  24.415  1.00  0.92           C  
ATOM    651  C   GLN A  84      13.599  37.150  24.609  1.00  0.92           C  
ATOM    652  O   GLN A  84      12.550  37.228  23.985  1.00  0.92           O  
ATOM    653  CB  GLN A  84      14.419  34.919  25.553  1.00  0.92           C  
ATOM    654  CG  GLN A  84      13.065  34.155  25.534  1.00  0.92           C  
ATOM    655  CD  GLN A  84      12.821  33.399  24.224  1.00  0.92           C  
ATOM    656  OE1 GLN A  84      12.031  33.761  23.359  1.00  0.92           O  
ATOM    657  NE2 GLN A  84      13.562  32.287  24.014  1.00  0.92           N  
ATOM    658  N   GLN A  85      13.993  38.181  25.390  1.00  0.91           N  
ATOM    659  CA  GLN A  85      13.242  39.425  25.545  1.00  0.91           C  
ATOM    660  C   GLN A  85      13.080  40.220  24.244  1.00  0.91           C  
ATOM    661  O   GLN A  85      12.132  40.992  24.065  1.00  0.91           O  
ATOM    662  CB  GLN A  85      13.953  40.348  26.571  1.00  0.91           C  
ATOM    663  CG  GLN A  85      13.962  39.799  28.024  1.00  0.91           C  
ATOM    664  CD  GLN A  85      14.890  40.550  28.992  1.00  0.91           C  
ATOM    665  OE1 GLN A  85      14.971  40.220  30.176  1.00  0.91           O  
ATOM    666  NE2 GLN A  85      15.629  41.571  28.503  1.00  0.91           N  
ATOM    667  N   VAL A  86      14.039  40.100  23.305  1.00  0.96           N  
ATOM    668  CA  VAL A  86      13.870  40.538  21.927  1.00  0.96           C  
ATOM    669  C   VAL A  86      12.878  39.690  21.135  1.00  0.96           C  
ATOM    670  O   VAL A  86      12.018  40.239  20.447  1.00  0.96           O  
ATOM    671  CB  VAL A  86      15.196  40.700  21.193  1.00  0.96           C  
ATOM    672  CG1 VAL A  86      14.968  41.101  19.723  1.00  0.96           C  
ATOM    673  CG2 VAL A  86      16.009  41.822  21.869  1.00  0.96           C  
ATOM    674  N   LEU A  87      12.933  38.344  21.232  1.00  0.95           N  
ATOM    675  CA  LEU A  87      11.988  37.451  20.578  1.00  0.95           C  
ATOM    676  C   LEU A  87      10.544  37.606  21.044  1.00  0.95           C  
ATOM    677  O   LEU A  87       9.648  37.740  20.210  1.00  0.95           O  
ATOM    678  CB  LEU A  87      12.398  35.968  20.779  1.00  0.95           C  
ATOM    679  CG  LEU A  87      13.651  35.505  20.008  1.00  0.95           C  
ATOM    680  CD1 LEU A  87      13.990  34.052  20.381  1.00  0.95           C  
ATOM    681  CD2 LEU A  87      13.436  35.614  18.492  1.00  0.95           C  
ATOM    682  N   ASP A  88      10.290  37.661  22.373  1.00  0.92           N  
ATOM    683  CA  ASP A  88       8.959  37.837  22.936  1.00  0.92           C  
ATOM    684  C   ASP A  88       8.295  39.147  22.493  1.00  0.92           C  
ATOM    685  O   ASP A  88       7.133  39.150  22.099  1.00  0.92           O  
ATOM    686  CB  ASP A  88       8.963  37.763  24.492  1.00  0.92           C  
ATOM    687  CG  ASP A  88       9.177  36.342  24.996  1.00  0.92           C  
ATOM    688  OD1 ASP A  88       8.402  35.439  24.578  1.00  0.92           O  
ATOM    689  OD2 ASP A  88      10.067  36.159  25.864  1.00  0.92           O  
ATOM    690  N   ARG A  89       9.042  40.284  22.474  1.00  0.84           N  
ATOM    691  CA  ARG A  89       8.496  41.613  22.167  1.00  0.84           C  
ATOM    692  C   ARG A  89       8.195  41.857  20.695  1.00  0.84           C  
ATOM    693  O   ARG A  89       7.615  42.868  20.309  1.00  0.84           O  
ATOM    694  CB  ARG A  89       9.302  42.790  22.824  1.00  0.84           C  
ATOM    695  CG  ARG A  89       9.972  43.893  21.946  1.00  0.84           C  
ATOM    696  CD  ARG A  89      11.374  43.618  21.404  1.00  0.84           C  
ATOM    697  NE  ARG A  89      12.226  43.534  22.632  1.00  0.84           N  
ATOM    698  CZ  ARG A  89      13.206  44.381  22.969  1.00  0.84           C  
ATOM    699  NH1 ARG A  89      13.726  45.249  22.109  1.00  0.84           N  
ATOM    700  NH2 ARG A  89      13.661  44.352  24.220  1.00  0.84           N  
ATOM    701  N   ALA A  90       8.564  40.921  19.804  1.00  0.93           N  
ATOM    702  CA  ALA A  90       8.112  40.987  18.431  1.00  0.93           C  
ATOM    703  C   ALA A  90       6.627  40.634  18.289  1.00  0.93           C  
ATOM    704  O   ALA A  90       6.017  40.945  17.269  1.00  0.93           O  
ATOM    705  CB  ALA A  90       8.966  40.029  17.572  1.00  0.93           C  
ATOM    706  N   ASP A  91       6.037  39.957  19.306  1.00  0.88           N  
ATOM    707  CA  ASP A  91       4.644  39.532  19.386  1.00  0.88           C  
ATOM    708  C   ASP A  91       4.291  38.445  18.357  1.00  0.88           C  
ATOM    709  O   ASP A  91       3.136  38.105  18.072  1.00  0.88           O  
ATOM    710  CB  ASP A  91       3.655  40.733  19.426  1.00  0.88           C  
ATOM    711  CG  ASP A  91       3.779  41.540  20.716  1.00  0.88           C  
ATOM    712  OD1 ASP A  91       4.571  41.154  21.612  1.00  0.88           O  
ATOM    713  OD2 ASP A  91       3.023  42.539  20.828  1.00  0.88           O  
ATOM    714  N   ILE A  92       5.335  37.786  17.818  1.00  0.93           N  
ATOM    715  CA  ILE A  92       5.231  36.783  16.780  1.00  0.93           C  
ATOM    716  C   ILE A  92       5.404  35.415  17.410  1.00  0.93           C  
ATOM    717  O   ILE A  92       6.454  35.069  17.937  1.00  0.93           O  
ATOM    718  CB  ILE A  92       6.245  36.980  15.652  1.00  0.93           C  
ATOM    719  CG1 ILE A  92       6.079  38.369  14.992  1.00  0.93           C  
ATOM    720  CG2 ILE A  92       6.088  35.873  14.588  1.00  0.93           C  
ATOM    721  CD1 ILE A  92       7.183  38.716  13.985  1.00  0.93           C  
ATOM    722  N   ARG A  93       4.338  34.598  17.363  1.00  0.87           N  
ATOM    723  CA  ARG A  93       4.285  33.247  17.889  1.00  0.87           C  
ATOM    724  C   ARG A  93       3.346  32.443  16.983  1.00  0.87           C  
ATOM    725  O   ARG A  93       2.170  32.256  17.335  1.00  0.87           O  
ATOM    726  CB  ARG A  93       3.743  33.256  19.345  1.00  0.87           C  
ATOM    727  CG  ARG A  93       4.837  33.483  20.422  1.00  0.87           C  
ATOM    728  CD  ARG A  93       4.438  34.219  21.717  1.00  0.87           C  
ATOM    729  NE  ARG A  93       2.969  34.004  21.957  1.00  0.87           N  
ATOM    730  CZ  ARG A  93       2.425  33.081  22.760  1.00  0.87           C  
ATOM    731  NH1 ARG A  93       3.145  32.361  23.609  1.00  0.87           N  
ATOM    732  NH2 ARG A  93       1.106  32.888  22.708  1.00  0.87           N  
ATOM    733  N   PRO A  94       3.746  32.024  15.771  1.00  0.94           N  
ATOM    734  CA  PRO A  94       3.012  31.035  14.978  1.00  0.94           C  
ATOM    735  C   PRO A  94       2.791  29.728  15.723  1.00  0.94           C  
ATOM    736  O   PRO A  94       3.490  29.436  16.691  1.00  0.94           O  
ATOM    737  CB  PRO A  94       3.895  30.841  13.729  1.00  0.94           C  
ATOM    738  CG  PRO A  94       5.308  31.112  14.237  1.00  0.94           C  
ATOM    739  CD  PRO A  94       5.084  32.258  15.215  1.00  0.94           C  
ATOM    740  N   THR A  95       1.799  28.924  15.299  1.00  0.91           N  
ATOM    741  CA  THR A  95       1.679  27.538  15.745  1.00  0.91           C  
ATOM    742  C   THR A  95       2.796  26.691  15.133  1.00  0.91           C  
ATOM    743  O   THR A  95       3.273  26.983  14.038  1.00  0.91           O  
ATOM    744  CB  THR A  95       0.270  26.919  15.603  1.00  0.91           C  
ATOM    745  OG1 THR A  95       0.065  26.176  14.410  1.00  0.91           O  
ATOM    746  CG2 THR A  95      -0.802  28.022  15.582  1.00  0.91           C  
ATOM    747  N   HIS A  96       3.274  25.650  15.853  1.00  0.91           N  
ATOM    748  CA  HIS A  96       4.306  24.735  15.375  1.00  0.91           C  
ATOM    749  C   HIS A  96       3.922  24.000  14.088  1.00  0.91           C  
ATOM    750  O   HIS A  96       2.757  23.702  13.827  1.00  0.91           O  
ATOM    751  CB  HIS A  96       4.746  23.757  16.506  1.00  0.91           C  
ATOM    752  CG  HIS A  96       5.724  22.682  16.122  1.00  0.91           C  
ATOM    753  ND1 HIS A  96       5.216  21.534  15.574  1.00  0.91           N  
ATOM    754  CD2 HIS A  96       7.078  22.607  16.189  1.00  0.91           C  
ATOM    755  CE1 HIS A  96       6.260  20.770  15.308  1.00  0.91           C  
ATOM    756  NE2 HIS A  96       7.423  21.376  15.662  1.00  0.91           N  
ATOM    757  N   ASN A  97       4.924  23.756  13.223  1.00  0.90           N  
ATOM    758  CA  ASN A  97       4.740  23.077  11.968  1.00  0.90           C  
ATOM    759  C   ASN A  97       5.992  22.233  11.697  1.00  0.90           C  
ATOM    760  O   ASN A  97       7.083  22.783  11.540  1.00  0.90           O  
ATOM    761  CB  ASN A  97       4.507  24.196  10.900  1.00  0.90           C  
ATOM    762  CG  ASN A  97       4.109  23.664   9.532  1.00  0.90           C  
ATOM    763  OD1 ASN A  97       4.487  22.575   9.111  1.00  0.90           O  
ATOM    764  ND2 ASN A  97       3.336  24.471   8.766  1.00  0.90           N  
ATOM    765  N   GLU A  98       5.866  20.888  11.575  1.00  0.86           N  
ATOM    766  CA  GLU A  98       6.919  19.956  11.171  1.00  0.86           C  
ATOM    767  C   GLU A  98       7.619  20.307   9.860  1.00  0.86           C  
ATOM    768  O   GLU A  98       8.809  20.045   9.674  1.00  0.86           O  
ATOM    769  CB  GLU A  98       6.344  18.514  11.026  1.00  0.86           C  
ATOM    770  CG  GLU A  98       6.336  17.701  12.346  1.00  0.86           C  
ATOM    771  CD  GLU A  98       5.271  18.146  13.343  1.00  0.86           C  
ATOM    772  OE1 GLU A  98       5.349  17.681  14.508  1.00  0.86           O  
ATOM    773  OE2 GLU A  98       4.381  18.947  12.954  1.00  0.86           O  
ATOM    774  N   ASP A  99       6.896  20.914   8.903  1.00  0.94           N  
ATOM    775  CA  ASP A  99       7.402  21.168   7.575  1.00  0.94           C  
ATOM    776  C   ASP A  99       8.038  22.546   7.442  1.00  0.94           C  
ATOM    777  O   ASP A  99       8.648  22.854   6.418  1.00  0.94           O  
ATOM    778  CB  ASP A  99       6.234  21.062   6.565  1.00  0.94           C  
ATOM    779  CG  ASP A  99       5.778  19.629   6.354  1.00  0.94           C  
ATOM    780  OD1 ASP A  99       6.543  18.688   6.691  1.00  0.94           O  
ATOM    781  OD2 ASP A  99       4.703  19.467   5.726  1.00  0.94           O  
ATOM    782  N   LEU A 100       7.957  23.393   8.487  1.00  0.96           N  
ATOM    783  CA  LEU A 100       8.620  24.687   8.520  1.00  0.96           C  
ATOM    784  C   LEU A 100       9.253  24.887   9.897  1.00  0.96           C  
ATOM    785  O   LEU A 100       8.650  25.544  10.746  1.00  0.96           O  
ATOM    786  CB  LEU A 100       7.645  25.879   8.282  1.00  0.96           C  
ATOM    787  CG  LEU A 100       6.865  25.881   6.950  1.00  0.96           C  
ATOM    788  CD1 LEU A 100       5.846  27.031   6.941  1.00  0.96           C  
ATOM    789  CD2 LEU A 100       7.765  25.993   5.709  1.00  0.96           C  
ATOM    790  N   PRO A 101      10.448  24.384  10.204  1.00  0.96           N  
ATOM    791  CA  PRO A 101      10.909  24.281  11.591  1.00  0.96           C  
ATOM    792  C   PRO A 101      11.394  25.627  12.103  1.00  0.96           C  
ATOM    793  O   PRO A 101      11.415  25.861  13.312  1.00  0.96           O  
ATOM    794  CB  PRO A 101      12.047  23.250  11.503  1.00  0.96           C  
ATOM    795  CG  PRO A 101      12.569  23.378  10.068  1.00  0.96           C  
ATOM    796  CD  PRO A 101      11.278  23.602   9.286  1.00  0.96           C  
ATOM    797  N   PHE A 102      11.770  26.523  11.179  1.00  0.97           N  
ATOM    798  CA  PHE A 102      12.099  27.903  11.430  1.00  0.97           C  
ATOM    799  C   PHE A 102      11.042  28.718  10.711  1.00  0.97           C  
ATOM    800  O   PHE A 102      10.792  28.540   9.521  1.00  0.97           O  
ATOM    801  CB  PHE A 102      13.521  28.247  10.906  1.00  0.97           C  
ATOM    802  CG  PHE A 102      13.921  29.673  11.198  1.00  0.97           C  
ATOM    803  CD1 PHE A 102      14.182  30.090  12.512  1.00  0.97           C  
ATOM    804  CD2 PHE A 102      14.047  30.607  10.158  1.00  0.97           C  
ATOM    805  CE1 PHE A 102      14.620  31.394  12.780  1.00  0.97           C  
ATOM    806  CE2 PHE A 102      14.458  31.921  10.422  1.00  0.97           C  
ATOM    807  CZ  PHE A 102      14.769  32.308  11.731  1.00  0.97           C  
ATOM    808  N   GLN A 103      10.379  29.633  11.433  1.00  0.95           N  
ATOM    809  CA  GLN A 103       9.291  30.425  10.898  1.00  0.95           C  
ATOM    810  C   GLN A 103       9.574  31.853  11.263  1.00  0.95           C  
ATOM    811  O   GLN A 103       8.749  32.547  11.851  1.00  0.95           O  
ATOM    812  CB  GLN A 103       7.917  30.015  11.480  1.00  0.95           C  
ATOM    813  CG  GLN A 103       7.552  28.547  11.186  1.00  0.95           C  
ATOM    814  CD  GLN A 103       6.163  28.200  11.703  1.00  0.95           C  
ATOM    815  OE1 GLN A 103       6.016  27.518  12.714  1.00  0.95           O  
ATOM    816  NE2 GLN A 103       5.112  28.694  11.007  1.00  0.95           N  
ATOM    817  N   GLY A 104      10.802  32.307  10.957  1.00  0.99           N  
ATOM    818  CA  GLY A 104      11.355  33.530  11.508  1.00  0.99           C  
ATOM    819  C   GLY A 104      11.774  33.356  12.945  1.00  0.99           C  
ATOM    820  O   GLY A 104      11.479  32.358  13.602  1.00  0.99           O  
ATOM    821  N   GLY A 105      12.488  34.354  13.473  1.00  1.00           N  
ATOM    822  CA  GLY A 105      13.054  34.320  14.809  1.00  1.00           C  
ATOM    823  C   GLY A 105      14.497  34.694  14.756  1.00  1.00           C  
ATOM    824  O   GLY A 105      14.934  35.435  13.880  1.00  1.00           O  
ATOM    825  N   ALA A 106      15.287  34.185  15.707  1.00  1.00           N  
ATOM    826  CA  ALA A 106      16.692  34.473  15.819  1.00  1.00           C  
ATOM    827  C   ALA A 106      17.494  33.451  15.043  1.00  1.00           C  
ATOM    828  O   ALA A 106      17.211  32.257  15.099  1.00  1.00           O  
ATOM    829  CB  ALA A 106      17.122  34.425  17.295  1.00  1.00           C  
ATOM    830  N   LEU A 107      18.526  33.885  14.306  1.00  0.98           N  
ATOM    831  CA  LEU A 107      19.418  32.964  13.633  1.00  0.98           C  
ATOM    832  C   LEU A 107      20.809  33.570  13.644  1.00  0.98           C  
ATOM    833  O   LEU A 107      20.963  34.777  13.443  1.00  0.98           O  
ATOM    834  CB  LEU A 107      18.889  32.680  12.201  1.00  0.98           C  
ATOM    835  CG  LEU A 107      19.427  31.416  11.500  1.00  0.98           C  
ATOM    836  CD1 LEU A 107      18.386  30.889  10.499  1.00  0.98           C  
ATOM    837  CD2 LEU A 107      20.751  31.637  10.760  1.00  0.98           C  
ATOM    838  N   GLY A 108      21.862  32.768  13.925  1.00  0.99           N  
ATOM    839  CA  GLY A 108      23.226  33.286  13.931  1.00  0.99           C  
ATOM    840  C   GLY A 108      24.222  32.467  14.700  1.00  0.99           C  
ATOM    841  O   GLY A 108      24.102  31.249  14.821  1.00  0.99           O  
ATOM    842  N   LEU A 109      25.265  33.150  15.209  1.00  0.98           N  
ATOM    843  CA  LEU A 109      26.438  32.573  15.834  1.00  0.98           C  
ATOM    844  C   LEU A 109      26.399  32.807  17.331  1.00  0.98           C  
ATOM    845  O   LEU A 109      26.162  33.920  17.802  1.00  0.98           O  
ATOM    846  CB  LEU A 109      27.729  33.263  15.288  1.00  0.98           C  
ATOM    847  CG  LEU A 109      29.078  32.879  15.951  1.00  0.98           C  
ATOM    848  CD1 LEU A 109      29.449  31.405  15.720  1.00  0.98           C  
ATOM    849  CD2 LEU A 109      30.213  33.811  15.488  1.00  0.98           C  
ATOM    850  N   PHE A 110      26.688  31.748  18.106  1.00  0.98           N  
ATOM    851  CA  PHE A 110      27.034  31.819  19.506  1.00  0.98           C  
ATOM    852  C   PHE A 110      28.470  31.302  19.585  1.00  0.98           C  
ATOM    853  O   PHE A 110      28.725  30.112  19.421  1.00  0.98           O  
ATOM    854  CB  PHE A 110      26.106  30.891  20.345  1.00  0.98           C  
ATOM    855  CG  PHE A 110      24.653  31.171  20.051  1.00  0.98           C  
ATOM    856  CD1 PHE A 110      23.979  32.198  20.727  1.00  0.98           C  
ATOM    857  CD2 PHE A 110      23.959  30.436  19.070  1.00  0.98           C  
ATOM    858  CE1 PHE A 110      22.642  32.494  20.427  1.00  0.98           C  
ATOM    859  CE2 PHE A 110      22.625  30.733  18.761  1.00  0.98           C  
ATOM    860  CZ  PHE A 110      21.966  31.763  19.443  1.00  0.98           C  
ATOM    861  N   GLY A 111      29.471  32.179  19.791  1.00  1.00           N  
ATOM    862  CA  GLY A 111      30.885  31.817  19.857  1.00  1.00           C  
ATOM    863  C   GLY A 111      31.252  31.142  21.153  1.00  1.00           C  
ATOM    864  O   GLY A 111      30.566  31.285  22.157  1.00  1.00           O  
ATOM    865  N   TYR A 112      32.386  30.421  21.205  1.00  0.97           N  
ATOM    866  CA  TYR A 112      32.844  29.668  22.365  1.00  0.97           C  
ATOM    867  C   TYR A 112      33.048  30.555  23.593  1.00  0.97           C  
ATOM    868  O   TYR A 112      32.650  30.235  24.714  1.00  0.97           O  
ATOM    869  CB  TYR A 112      34.174  28.967  21.968  1.00  0.97           C  
ATOM    870  CG  TYR A 112      34.799  28.189  23.096  1.00  0.97           C  
ATOM    871  CD1 TYR A 112      34.404  26.870  23.364  1.00  0.97           C  
ATOM    872  CD2 TYR A 112      35.774  28.787  23.912  1.00  0.97           C  
ATOM    873  CE1 TYR A 112      35.004  26.141  24.397  1.00  0.97           C  
ATOM    874  CE2 TYR A 112      36.373  28.064  24.953  1.00  0.97           C  
ATOM    875  CZ  TYR A 112      36.001  26.733  25.176  1.00  0.97           C  
ATOM    876  OH  TYR A 112      36.645  25.967  26.160  1.00  0.97           O  
ATOM    877  N   ASP A 113      33.640  31.738  23.369  1.00  0.97           N  
ATOM    878  CA  ASP A 113      33.947  32.727  24.373  1.00  0.97           C  
ATOM    879  C   ASP A 113      32.700  33.439  24.937  1.00  0.97           C  
ATOM    880  O   ASP A 113      32.769  34.089  25.980  1.00  0.97           O  
ATOM    881  CB  ASP A 113      35.041  33.668  23.811  1.00  0.97           C  
ATOM    882  CG  ASP A 113      36.350  32.905  23.697  1.00  0.97           C  
ATOM    883  OD1 ASP A 113      37.007  32.700  24.755  1.00  0.97           O  
ATOM    884  OD2 ASP A 113      36.733  32.502  22.571  1.00  0.97           O  
ATOM    885  N   LEU A 114      31.488  33.213  24.359  1.00  0.96           N  
ATOM    886  CA  LEU A 114      30.208  33.543  24.983  1.00  0.96           C  
ATOM    887  C   LEU A 114      29.990  32.789  26.292  1.00  0.96           C  
ATOM    888  O   LEU A 114      29.313  33.258  27.205  1.00  0.96           O  
ATOM    889  CB  LEU A 114      29.019  33.250  24.030  1.00  0.96           C  
ATOM    890  CG  LEU A 114      27.661  33.853  24.457  1.00  0.96           C  
ATOM    891  CD1 LEU A 114      27.679  35.387  24.396  1.00  0.96           C  
ATOM    892  CD2 LEU A 114      26.527  33.301  23.580  1.00  0.96           C  
ATOM    893  N   GLY A 115      30.647  31.617  26.452  1.00  0.98           N  
ATOM    894  CA  GLY A 115      30.666  30.839  27.690  1.00  0.98           C  
ATOM    895  C   GLY A 115      31.247  31.562  28.887  1.00  0.98           C  
ATOM    896  O   GLY A 115      30.941  31.235  30.027  1.00  0.98           O  
ATOM    897  N   ARG A 116      32.055  32.618  28.660  1.00  0.87           N  
ATOM    898  CA  ARG A 116      32.559  33.529  29.680  1.00  0.87           C  
ATOM    899  C   ARG A 116      31.491  34.450  30.260  1.00  0.87           C  
ATOM    900  O   ARG A 116      31.745  35.217  31.184  1.00  0.87           O  
ATOM    901  CB  ARG A 116      33.668  34.434  29.091  1.00  0.87           C  
ATOM    902  CG  ARG A 116      34.879  33.671  28.523  1.00  0.87           C  
ATOM    903  CD  ARG A 116      35.827  34.577  27.729  1.00  0.87           C  
ATOM    904  NE  ARG A 116      36.905  33.717  27.173  1.00  0.87           N  
ATOM    905  CZ  ARG A 116      38.003  33.301  27.810  1.00  0.87           C  
ATOM    906  NH1 ARG A 116      38.330  33.703  29.028  1.00  0.87           N  
ATOM    907  NH2 ARG A 116      38.782  32.454  27.153  1.00  0.87           N  
ATOM    908  N   ARG A 117      30.257  34.425  29.724  1.00  0.88           N  
ATOM    909  CA  ARG A 117      29.137  35.090  30.354  1.00  0.88           C  
ATOM    910  C   ARG A 117      28.360  34.178  31.272  1.00  0.88           C  
ATOM    911  O   ARG A 117      27.529  34.655  32.040  1.00  0.88           O  
ATOM    912  CB  ARG A 117      28.158  35.604  29.271  1.00  0.88           C  
ATOM    913  CG  ARG A 117      28.791  36.650  28.334  1.00  0.88           C  
ATOM    914  CD  ARG A 117      29.408  37.852  29.058  1.00  0.88           C  
ATOM    915  NE  ARG A 117      28.336  38.520  29.869  1.00  0.88           N  
ATOM    916  CZ  ARG A 117      27.400  39.357  29.401  1.00  0.88           C  
ATOM    917  NH1 ARG A 117      27.411  39.874  28.180  1.00  0.88           N  
ATOM    918  NH2 ARG A 117      26.402  39.702  30.209  1.00  0.88           N  
ATOM    919  N   PHE A 118      28.622  32.859  31.230  1.00  0.94           N  
ATOM    920  CA  PHE A 118      27.847  31.897  31.991  1.00  0.94           C  
ATOM    921  C   PHE A 118      28.689  31.302  33.106  1.00  0.94           C  
ATOM    922  O   PHE A 118      28.154  30.790  34.082  1.00  0.94           O  
ATOM    923  CB  PHE A 118      27.329  30.760  31.059  1.00  0.94           C  
ATOM    924  CG  PHE A 118      26.612  31.296  29.836  1.00  0.94           C  
ATOM    925  CD1 PHE A 118      25.717  32.384  29.900  1.00  0.94           C  
ATOM    926  CD2 PHE A 118      26.852  30.703  28.584  1.00  0.94           C  
ATOM    927  CE1 PHE A 118      25.130  32.898  28.737  1.00  0.94           C  
ATOM    928  CE2 PHE A 118      26.262  31.213  27.420  1.00  0.94           C  
ATOM    929  CZ  PHE A 118      25.407  32.316  27.496  1.00  0.94           C  
ATOM    930  N   GLU A 119      30.027  31.431  33.002  1.00  0.89           N  
ATOM    931  CA  GLU A 119      30.983  30.901  33.952  1.00  0.89           C  
ATOM    932  C   GLU A 119      32.065  31.944  34.161  1.00  0.89           C  
ATOM    933  O   GLU A 119      32.374  32.737  33.271  1.00  0.89           O  
ATOM    934  CB  GLU A 119      31.695  29.622  33.428  1.00  0.89           C  
ATOM    935  CG  GLU A 119      30.777  28.386  33.230  1.00  0.89           C  
ATOM    936  CD  GLU A 119      30.317  27.697  34.518  1.00  0.89           C  
ATOM    937  OE1 GLU A 119      30.692  28.152  35.628  1.00  0.89           O  
ATOM    938  OE2 GLU A 119      29.631  26.646  34.376  1.00  0.89           O  
ATOM    939  N   SER A 120      32.702  31.957  35.351  1.00  0.91           N  
ATOM    940  CA  SER A 120      33.864  32.807  35.608  1.00  0.91           C  
ATOM    941  C   SER A 120      35.115  32.038  35.232  1.00  0.91           C  
ATOM    942  O   SER A 120      35.355  30.950  35.746  1.00  0.91           O  
ATOM    943  CB  SER A 120      34.001  33.261  37.086  1.00  0.91           C  
ATOM    944  OG  SER A 120      35.009  34.268  37.224  1.00  0.91           O  
ATOM    945  N   LEU A 121      35.929  32.565  34.298  1.00  0.92           N  
ATOM    946  CA  LEU A 121      36.989  31.808  33.661  1.00  0.92           C  
ATOM    947  C   LEU A 121      38.249  32.659  33.599  1.00  0.92           C  
ATOM    948  O   LEU A 121      38.138  33.886  33.567  1.00  0.92           O  
ATOM    949  CB  LEU A 121      36.572  31.430  32.211  1.00  0.92           C  
ATOM    950  CG  LEU A 121      35.520  30.305  32.147  1.00  0.92           C  
ATOM    951  CD1 LEU A 121      34.755  30.329  30.817  1.00  0.92           C  
ATOM    952  CD2 LEU A 121      36.144  28.922  32.395  1.00  0.92           C  
ATOM    953  N   PRO A 122      39.459  32.088  33.596  1.00  0.91           N  
ATOM    954  CA  PRO A 122      40.693  32.831  33.367  1.00  0.91           C  
ATOM    955  C   PRO A 122      40.770  33.489  31.999  1.00  0.91           C  
ATOM    956  O   PRO A 122      39.953  33.208  31.124  1.00  0.91           O  
ATOM    957  CB  PRO A 122      41.812  31.799  33.603  1.00  0.91           C  
ATOM    958  CG  PRO A 122      41.175  30.426  33.370  1.00  0.91           C  
ATOM    959  CD  PRO A 122      39.686  30.640  33.649  1.00  0.91           C  
ATOM    960  N   GLU A 123      41.740  34.403  31.820  1.00  0.86           N  
ATOM    961  CA  GLU A 123      41.932  35.156  30.596  1.00  0.86           C  
ATOM    962  C   GLU A 123      43.399  35.092  30.185  1.00  0.86           C  
ATOM    963  O   GLU A 123      44.033  36.105  29.901  1.00  0.86           O  
ATOM    964  CB  GLU A 123      41.462  36.634  30.756  1.00  0.86           C  
ATOM    965  CG  GLU A 123      39.937  36.772  31.039  1.00  0.86           C  
ATOM    966  CD  GLU A 123      39.305  38.030  30.444  1.00  0.86           C  
ATOM    967  OE1 GLU A 123      39.641  39.154  30.872  1.00  0.86           O  
ATOM    968  OE2 GLU A 123      38.507  37.861  29.472  1.00  0.86           O  
ATOM    969  N   ILE A 124      43.979  33.875  30.157  1.00  0.93           N  
ATOM    970  CA  ILE A 124      45.353  33.619  29.743  1.00  0.93           C  
ATOM    971  C   ILE A 124      45.465  33.606  28.231  1.00  0.93           C  
ATOM    972  O   ILE A 124      46.353  34.229  27.650  1.00  0.93           O  
ATOM    973  CB  ILE A 124      45.866  32.284  30.292  1.00  0.93           C  
ATOM    974  CG1 ILE A 124      45.689  32.185  31.829  1.00  0.93           C  
ATOM    975  CG2 ILE A 124      47.338  32.039  29.878  1.00  0.93           C  
ATOM    976  CD1 ILE A 124      46.375  33.296  32.637  1.00  0.93           C  
ATOM    977  N   ALA A 125      44.535  32.903  27.550  1.00  0.94           N  
ATOM    978  CA  ALA A 125      44.512  32.793  26.106  1.00  0.94           C  
ATOM    979  C   ALA A 125      44.297  34.124  25.390  1.00  0.94           C  
ATOM    980  O   ALA A 125      43.336  34.861  25.647  1.00  0.94           O  
ATOM    981  CB  ALA A 125      43.445  31.778  25.659  1.00  0.94           C  
ATOM    982  N   GLU A 126      45.209  34.459  24.449  1.00  0.88           N  
ATOM    983  CA  GLU A 126      45.212  35.713  23.721  1.00  0.88           C  
ATOM    984  C   GLU A 126      43.953  35.932  22.884  1.00  0.88           C  
ATOM    985  O   GLU A 126      43.411  35.030  22.252  1.00  0.88           O  
ATOM    986  CB  GLU A 126      46.484  35.826  22.848  1.00  0.88           C  
ATOM    987  CG  GLU A 126      46.560  37.055  21.911  1.00  0.88           C  
ATOM    988  CD  GLU A 126      47.845  37.030  21.086  1.00  0.88           C  
ATOM    989  OE1 GLU A 126      48.134  35.969  20.468  1.00  0.88           O  
ATOM    990  OE2 GLU A 126      48.536  38.079  21.069  1.00  0.88           O  
ATOM    991  N   GLN A 127      43.423  37.166  22.873  1.00  0.90           N  
ATOM    992  CA  GLN A 127      42.204  37.503  22.168  1.00  0.90           C  
ATOM    993  C   GLN A 127      42.549  38.206  20.860  1.00  0.90           C  
ATOM    994  O   GLN A 127      42.407  39.420  20.732  1.00  0.90           O  
ATOM    995  CB  GLN A 127      41.335  38.387  23.104  1.00  0.90           C  
ATOM    996  CG  GLN A 127      39.911  38.732  22.594  1.00  0.90           C  
ATOM    997  CD  GLN A 127      39.086  39.578  23.576  1.00  0.90           C  
ATOM    998  OE1 GLN A 127      37.880  39.751  23.411  1.00  0.90           O  
ATOM    999  NE2 GLN A 127      39.719  40.118  24.641  1.00  0.90           N  
ATOM   1000  N   ASP A 128      43.050  37.455  19.856  1.00  0.93           N  
ATOM   1001  CA  ASP A 128      43.596  38.035  18.643  1.00  0.93           C  
ATOM   1002  C   ASP A 128      42.558  38.233  17.534  1.00  0.93           C  
ATOM   1003  O   ASP A 128      42.770  38.960  16.565  1.00  0.93           O  
ATOM   1004  CB  ASP A 128      44.817  37.194  18.177  1.00  0.93           C  
ATOM   1005  CG  ASP A 128      44.512  35.791  17.709  1.00  0.93           C  
ATOM   1006  OD1 ASP A 128      43.568  35.122  18.203  1.00  0.93           O  
ATOM   1007  OD2 ASP A 128      45.256  35.313  16.816  1.00  0.93           O  
ATOM   1008  N   ILE A 129      41.365  37.631  17.688  1.00  0.95           N  
ATOM   1009  CA  ILE A 129      40.307  37.680  16.697  1.00  0.95           C  
ATOM   1010  C   ILE A 129      39.176  38.543  17.214  1.00  0.95           C  
ATOM   1011  O   ILE A 129      38.514  38.238  18.205  1.00  0.95           O  
ATOM   1012  CB  ILE A 129      39.794  36.294  16.308  1.00  0.95           C  
ATOM   1013  CG1 ILE A 129      40.959  35.476  15.697  1.00  0.95           C  
ATOM   1014  CG2 ILE A 129      38.613  36.428  15.315  1.00  0.95           C  
ATOM   1015  CD1 ILE A 129      40.588  34.038  15.314  1.00  0.95           C  
ATOM   1016  N   VAL A 130      38.927  39.670  16.522  1.00  0.96           N  
ATOM   1017  CA  VAL A 130      37.866  40.606  16.839  1.00  0.96           C  
ATOM   1018  C   VAL A 130      36.620  40.253  16.041  1.00  0.96           C  
ATOM   1019  O   VAL A 130      36.366  40.765  14.952  1.00  0.96           O  
ATOM   1020  CB  VAL A 130      38.301  42.042  16.555  1.00  0.96           C  
ATOM   1021  CG1 VAL A 130      37.201  43.051  16.949  1.00  0.96           C  
ATOM   1022  CG2 VAL A 130      39.582  42.353  17.355  1.00  0.96           C  
ATOM   1023  N   LEU A 131      35.795  39.345  16.582  1.00  0.97           N  
ATOM   1024  CA  LEU A 131      34.559  38.918  15.963  1.00  0.97           C  
ATOM   1025  C   LEU A 131      33.619  38.565  17.112  1.00  0.97           C  
ATOM   1026  O   LEU A 131      34.140  38.106  18.128  1.00  0.97           O  
ATOM   1027  CB  LEU A 131      34.845  37.724  15.013  1.00  0.97           C  
ATOM   1028  CG  LEU A 131      33.689  37.257  14.104  1.00  0.97           C  
ATOM   1029  CD1 LEU A 131      34.214  36.832  12.724  1.00  0.97           C  
ATOM   1030  CD2 LEU A 131      32.892  36.104  14.734  1.00  0.97           C  
ATOM   1031  N   PRO A 132      32.300  38.783  17.087  1.00  1.00           N  
ATOM   1032  CA  PRO A 132      31.480  38.764  18.296  1.00  1.00           C  
ATOM   1033  C   PRO A 132      31.295  37.408  18.944  1.00  1.00           C  
ATOM   1034  O   PRO A 132      31.176  36.398  18.250  1.00  1.00           O  
ATOM   1035  CB  PRO A 132      30.108  39.291  17.833  1.00  1.00           C  
ATOM   1036  CG  PRO A 132      30.420  40.126  16.596  1.00  1.00           C  
ATOM   1037  CD  PRO A 132      31.562  39.349  15.958  1.00  1.00           C  
ATOM   1038  N   ASP A 133      31.193  37.390  20.286  1.00  0.98           N  
ATOM   1039  CA  ASP A 133      30.797  36.248  21.080  1.00  0.98           C  
ATOM   1040  C   ASP A 133      29.369  35.814  20.759  1.00  0.98           C  
ATOM   1041  O   ASP A 133      29.031  34.637  20.759  1.00  0.98           O  
ATOM   1042  CB  ASP A 133      30.886  36.587  22.583  1.00  0.98           C  
ATOM   1043  CG  ASP A 133      32.296  37.004  22.942  1.00  0.98           C  
ATOM   1044  OD1 ASP A 133      33.218  36.162  22.834  1.00  0.98           O  
ATOM   1045  OD2 ASP A 133      32.452  38.184  23.348  1.00  0.98           O  
ATOM   1046  N   MET A 134      28.476  36.770  20.458  1.00  0.97           N  
ATOM   1047  CA  MET A 134      27.164  36.455  19.932  1.00  0.97           C  
ATOM   1048  C   MET A 134      26.881  37.388  18.780  1.00  0.97           C  
ATOM   1049  O   MET A 134      27.016  38.603  18.909  1.00  0.97           O  
ATOM   1050  CB  MET A 134      26.053  36.580  21.005  1.00  0.97           C  
ATOM   1051  CG  MET A 134      24.701  35.972  20.593  1.00  0.97           C  
ATOM   1052  SD  MET A 134      23.458  35.923  21.924  1.00  0.97           S  
ATOM   1053  CE  MET A 134      22.989  37.676  21.862  1.00  0.97           C  
ATOM   1054  N   ALA A 135      26.506  36.837  17.614  1.00  0.99           N  
ATOM   1055  CA  ALA A 135      26.071  37.628  16.486  1.00  0.99           C  
ATOM   1056  C   ALA A 135      24.852  36.965  15.880  1.00  0.99           C  
ATOM   1057  O   ALA A 135      24.963  35.999  15.123  1.00  0.99           O  
ATOM   1058  CB  ALA A 135      27.183  37.749  15.424  1.00  0.99           C  
ATOM   1059  N   VAL A 136      23.644  37.468  16.203  1.00  0.98           N  
ATOM   1060  CA  VAL A 136      22.405  36.919  15.672  1.00  0.98           C  
ATOM   1061  C   VAL A 136      21.573  38.035  15.084  1.00  0.98           C  
ATOM   1062  O   VAL A 136      21.595  39.178  15.543  1.00  0.98           O  
ATOM   1063  CB  VAL A 136      21.590  36.019  16.628  1.00  0.98           C  
ATOM   1064  CG1 VAL A 136      22.480  35.436  17.738  1.00  0.98           C  
ATOM   1065  CG2 VAL A 136      20.367  36.702  17.275  1.00  0.98           C  
ATOM   1066  N   GLY A 137      20.817  37.724  14.017  1.00  0.99           N  
ATOM   1067  CA  GLY A 137      19.789  38.618  13.507  1.00  0.99           C  
ATOM   1068  C   GLY A 137      18.442  38.079  13.882  1.00  0.99           C  
ATOM   1069  O   GLY A 137      18.276  36.878  14.088  1.00  0.99           O  
ATOM   1070  N   ILE A 138      17.438  38.962  13.951  1.00  0.99           N  
ATOM   1071  CA  ILE A 138      16.044  38.608  14.130  1.00  0.99           C  
ATOM   1072  C   ILE A 138      15.364  38.801  12.796  1.00  0.99           C  
ATOM   1073  O   ILE A 138      15.360  39.892  12.231  1.00  0.99           O  
ATOM   1074  CB  ILE A 138      15.338  39.483  15.157  1.00  0.99           C  
ATOM   1075  CG1 ILE A 138      16.114  39.541  16.494  1.00  0.99           C  
ATOM   1076  CG2 ILE A 138      13.880  39.016  15.374  1.00  0.99           C  
ATOM   1077  CD1 ILE A 138      16.303  38.196  17.206  1.00  0.99           C  
ATOM   1078  N   TYR A 139      14.783  37.729  12.250  1.00  0.97           N  
ATOM   1079  CA  TYR A 139      14.251  37.705  10.906  1.00  0.97           C  
ATOM   1080  C   TYR A 139      12.764  37.432  10.986  1.00  0.97           C  
ATOM   1081  O   TYR A 139      12.326  36.541  11.711  1.00  0.97           O  
ATOM   1082  CB  TYR A 139      14.922  36.577  10.076  1.00  0.97           C  
ATOM   1083  CG  TYR A 139      16.416  36.753  10.066  1.00  0.97           C  
ATOM   1084  CD1 TYR A 139      17.023  37.637   9.158  1.00  0.97           C  
ATOM   1085  CD2 TYR A 139      17.226  36.053  10.979  1.00  0.97           C  
ATOM   1086  CE1 TYR A 139      18.415  37.818   9.166  1.00  0.97           C  
ATOM   1087  CE2 TYR A 139      18.612  36.255  11.001  1.00  0.97           C  
ATOM   1088  CZ  TYR A 139      19.201  37.145  10.104  1.00  0.97           C  
ATOM   1089  OH  TYR A 139      20.585  37.375  10.178  1.00  0.97           O  
ATOM   1090  N   ASP A 140      11.936  38.185  10.241  1.00  0.97           N  
ATOM   1091  CA  ASP A 140      10.502  37.983  10.172  1.00  0.97           C  
ATOM   1092  C   ASP A 140      10.116  37.153   8.950  1.00  0.97           C  
ATOM   1093  O   ASP A 140       8.944  36.872   8.694  1.00  0.97           O  
ATOM   1094  CB  ASP A 140       9.770  39.354  10.177  1.00  0.97           C  
ATOM   1095  CG  ASP A 140      10.177  40.311   9.061  1.00  0.97           C  
ATOM   1096  OD1 ASP A 140      11.155  40.020   8.326  1.00  0.97           O  
ATOM   1097  OD2 ASP A 140       9.493  41.357   8.945  1.00  0.97           O  
ATOM   1098  N   TRP A 141      11.125  36.698   8.193  1.00  0.95           N  
ATOM   1099  CA  TRP A 141      10.955  35.931   6.992  1.00  0.95           C  
ATOM   1100  C   TRP A 141      12.004  34.840   6.954  1.00  0.95           C  
ATOM   1101  O   TRP A 141      12.983  34.863   7.700  1.00  0.95           O  
ATOM   1102  CB  TRP A 141      11.030  36.838   5.726  1.00  0.95           C  
ATOM   1103  CG  TRP A 141      12.399  37.402   5.382  1.00  0.95           C  
ATOM   1104  CD1 TRP A 141      13.063  38.458   5.940  1.00  0.95           C  
ATOM   1105  CD2 TRP A 141      13.277  36.855   4.379  1.00  0.95           C  
ATOM   1106  NE1 TRP A 141      14.283  38.630   5.326  1.00  0.95           N  
ATOM   1107  CE2 TRP A 141      14.433  37.659   4.364  1.00  0.95           C  
ATOM   1108  CE3 TRP A 141      13.146  35.766   3.516  1.00  0.95           C  
ATOM   1109  CZ2 TRP A 141      15.472  37.401   3.477  1.00  0.95           C  
ATOM   1110  CZ3 TRP A 141      14.203  35.496   2.632  1.00  0.95           C  
ATOM   1111  CH2 TRP A 141      15.349  36.306   2.607  1.00  0.95           C  
ATOM   1112  N   ALA A 142      11.809  33.847   6.075  1.00  1.00           N  
ATOM   1113  CA  ALA A 142      12.823  32.861   5.797  1.00  1.00           C  
ATOM   1114  C   ALA A 142      12.543  32.210   4.459  1.00  1.00           C  
ATOM   1115  O   ALA A 142      11.418  32.226   3.960  1.00  1.00           O  
ATOM   1116  CB  ALA A 142      12.864  31.765   6.883  1.00  1.00           C  
ATOM   1117  N   LEU A 143      13.576  31.595   3.861  1.00  0.98           N  
ATOM   1118  CA  LEU A 143      13.420  30.656   2.770  1.00  0.98           C  
ATOM   1119  C   LEU A 143      13.827  29.286   3.283  1.00  0.98           C  
ATOM   1120  O   LEU A 143      14.906  29.102   3.846  1.00  0.98           O  
ATOM   1121  CB  LEU A 143      14.257  31.081   1.536  1.00  0.98           C  
ATOM   1122  CG  LEU A 143      14.238  30.107   0.332  1.00  0.98           C  
ATOM   1123  CD1 LEU A 143      13.777  30.807  -0.958  1.00  0.98           C  
ATOM   1124  CD2 LEU A 143      15.598  29.413   0.132  1.00  0.98           C  
ATOM   1125  N   ILE A 144      12.928  28.299   3.121  1.00  0.98           N  
ATOM   1126  CA  ILE A 144      13.099  26.932   3.576  1.00  0.98           C  
ATOM   1127  C   ILE A 144      13.157  26.047   2.348  1.00  0.98           C  
ATOM   1128  O   ILE A 144      12.284  26.104   1.485  1.00  0.98           O  
ATOM   1129  CB  ILE A 144      11.924  26.466   4.448  1.00  0.98           C  
ATOM   1130  CG1 ILE A 144      11.632  27.424   5.634  1.00  0.98           C  
ATOM   1131  CG2 ILE A 144      12.147  25.017   4.940  1.00  0.98           C  
ATOM   1132  CD1 ILE A 144      12.746  27.548   6.681  1.00  0.98           C  
ATOM   1133  N   VAL A 145      14.185  25.191   2.240  1.00  0.98           N  
ATOM   1134  CA  VAL A 145      14.273  24.169   1.214  1.00  0.98           C  
ATOM   1135  C   VAL A 145      14.041  22.840   1.898  1.00  0.98           C  
ATOM   1136  O   VAL A 145      14.790  22.452   2.789  1.00  0.98           O  
ATOM   1137  CB  VAL A 145      15.634  24.171   0.526  1.00  0.98           C  
ATOM   1138  CG1 VAL A 145      15.686  23.114  -0.593  1.00  0.98           C  
ATOM   1139  CG2 VAL A 145      15.911  25.573  -0.056  1.00  0.98           C  
ATOM   1140  N   ASP A 146      12.967  22.121   1.522  1.00  0.93           N  
ATOM   1141  CA  ASP A 146      12.615  20.843   2.095  1.00  0.93           C  
ATOM   1142  C   ASP A 146      13.005  19.748   1.107  1.00  0.93           C  
ATOM   1143  O   ASP A 146      12.389  19.582   0.055  1.00  0.93           O  
ATOM   1144  CB  ASP A 146      11.091  20.856   2.395  1.00  0.93           C  
ATOM   1145  CG  ASP A 146      10.623  19.682   3.223  1.00  0.93           C  
ATOM   1146  OD1 ASP A 146      11.339  18.653   3.356  1.00  0.93           O  
ATOM   1147  OD2 ASP A 146       9.492  19.787   3.764  1.00  0.93           O  
ATOM   1148  N   HIS A 147      14.047  18.956   1.434  1.00  0.89           N  
ATOM   1149  CA  HIS A 147      14.528  17.883   0.575  1.00  0.89           C  
ATOM   1150  C   HIS A 147      13.744  16.593   0.741  1.00  0.89           C  
ATOM   1151  O   HIS A 147      13.899  15.663  -0.045  1.00  0.89           O  
ATOM   1152  CB  HIS A 147      16.017  17.579   0.845  1.00  0.89           C  
ATOM   1153  CG  HIS A 147      16.903  18.707   0.431  1.00  0.89           C  
ATOM   1154  ND1 HIS A 147      17.163  18.902  -0.915  1.00  0.89           N  
ATOM   1155  CD2 HIS A 147      17.546  19.638   1.180  1.00  0.89           C  
ATOM   1156  CE1 HIS A 147      17.973  19.948  -0.951  1.00  0.89           C  
ATOM   1157  NE2 HIS A 147      18.230  20.430   0.287  1.00  0.89           N  
ATOM   1158  N   GLN A 148      12.870  16.498   1.766  1.00  0.84           N  
ATOM   1159  CA  GLN A 148      11.953  15.379   1.917  1.00  0.84           C  
ATOM   1160  C   GLN A 148      10.679  15.571   1.125  1.00  0.84           C  
ATOM   1161  O   GLN A 148      10.188  14.633   0.504  1.00  0.84           O  
ATOM   1162  CB  GLN A 148      11.616  15.151   3.410  1.00  0.84           C  
ATOM   1163  CG  GLN A 148      10.363  14.285   3.705  1.00  0.84           C  
ATOM   1164  CD  GLN A 148      10.417  13.690   5.110  1.00  0.84           C  
ATOM   1165  OE1 GLN A 148       9.947  14.248   6.100  1.00  0.84           O  
ATOM   1166  NE2 GLN A 148      11.046  12.496   5.209  1.00  0.84           N  
ATOM   1167  N   ARG A 149      10.096  16.786   1.126  1.00  0.86           N  
ATOM   1168  CA  ARG A 149       8.848  16.993   0.409  1.00  0.86           C  
ATOM   1169  C   ARG A 149       9.039  17.603  -0.968  1.00  0.86           C  
ATOM   1170  O   ARG A 149       8.069  17.780  -1.702  1.00  0.86           O  
ATOM   1171  CB  ARG A 149       7.911  17.936   1.192  1.00  0.86           C  
ATOM   1172  CG  ARG A 149       7.445  17.379   2.551  1.00  0.86           C  
ATOM   1173  CD  ARG A 149       6.235  18.119   3.133  1.00  0.86           C  
ATOM   1174  NE  ARG A 149       6.635  19.560   3.242  1.00  0.86           N  
ATOM   1175  CZ  ARG A 149       5.992  20.598   2.704  1.00  0.86           C  
ATOM   1176  NH1 ARG A 149       5.083  20.442   1.748  1.00  0.86           N  
ATOM   1177  NH2 ARG A 149       6.310  21.835   3.074  1.00  0.86           N  
ATOM   1178  N   HIS A 150      10.287  17.952  -1.337  1.00  0.92           N  
ATOM   1179  CA  HIS A 150      10.650  18.608  -2.585  1.00  0.92           C  
ATOM   1180  C   HIS A 150       9.948  19.939  -2.837  1.00  0.92           C  
ATOM   1181  O   HIS A 150       9.398  20.196  -3.906  1.00  0.92           O  
ATOM   1182  CB  HIS A 150      10.570  17.681  -3.821  1.00  0.92           C  
ATOM   1183  CG  HIS A 150      11.477  16.496  -3.693  1.00  0.92           C  
ATOM   1184  ND1 HIS A 150      10.987  15.308  -3.196  1.00  0.92           N  
ATOM   1185  CD2 HIS A 150      12.818  16.403  -3.888  1.00  0.92           C  
ATOM   1186  CE1 HIS A 150      12.032  14.517  -3.090  1.00  0.92           C  
ATOM   1187  NE2 HIS A 150      13.170  15.130  -3.496  1.00  0.92           N  
ATOM   1188  N   THR A 151       9.985  20.859  -1.850  1.00  0.95           N  
ATOM   1189  CA  THR A 151       9.359  22.177  -1.971  1.00  0.95           C  
ATOM   1190  C   THR A 151      10.272  23.226  -1.374  1.00  0.95           C  
ATOM   1191  O   THR A 151      10.998  23.002  -0.406  1.00  0.95           O  
ATOM   1192  CB  THR A 151       7.873  22.287  -1.517  1.00  0.95           C  
ATOM   1193  OG1 THR A 151       7.521  23.417  -0.713  1.00  0.95           O  
ATOM   1194  CG2 THR A 151       7.442  21.052  -0.721  1.00  0.95           C  
ATOM   1195  N   VAL A 152      10.282  24.413  -2.010  1.00  0.97           N  
ATOM   1196  CA  VAL A 152      11.012  25.577  -1.561  1.00  0.97           C  
ATOM   1197  C   VAL A 152       9.946  26.535  -1.087  1.00  0.97           C  
ATOM   1198  O   VAL A 152       9.110  26.979  -1.868  1.00  0.97           O  
ATOM   1199  CB  VAL A 152      11.817  26.237  -2.679  1.00  0.97           C  
ATOM   1200  CG1 VAL A 152      12.506  27.521  -2.175  1.00  0.97           C  
ATOM   1201  CG2 VAL A 152      12.882  25.253  -3.188  1.00  0.97           C  
ATOM   1202  N   SER A 153       9.922  26.869   0.210  1.00  0.97           N  
ATOM   1203  CA  SER A 153       8.889  27.728   0.771  1.00  0.97           C  
ATOM   1204  C   SER A 153       9.511  29.033   1.185  1.00  0.97           C  
ATOM   1205  O   SER A 153      10.445  29.066   1.984  1.00  0.97           O  
ATOM   1206  CB  SER A 153       8.210  27.172   2.052  1.00  0.97           C  
ATOM   1207  OG  SER A 153       7.357  26.064   1.770  1.00  0.97           O  
ATOM   1208  N   LEU A 154       8.981  30.156   0.676  1.00  0.96           N  
ATOM   1209  CA  LEU A 154       9.351  31.480   1.120  1.00  0.96           C  
ATOM   1210  C   LEU A 154       8.261  31.971   2.048  1.00  0.96           C  
ATOM   1211  O   LEU A 154       7.111  32.120   1.639  1.00  0.96           O  
ATOM   1212  CB  LEU A 154       9.459  32.440  -0.086  1.00  0.96           C  
ATOM   1213  CG  LEU A 154       9.895  33.879   0.256  1.00  0.96           C  
ATOM   1214  CD1 LEU A 154      11.356  33.942   0.722  1.00  0.96           C  
ATOM   1215  CD2 LEU A 154       9.691  34.787  -0.961  1.00  0.96           C  
ATOM   1216  N   LEU A 155       8.587  32.223   3.326  1.00  0.96           N  
ATOM   1217  CA  LEU A 155       7.613  32.612   4.325  1.00  0.96           C  
ATOM   1218  C   LEU A 155       7.929  34.006   4.808  1.00  0.96           C  
ATOM   1219  O   LEU A 155       9.090  34.403   4.884  1.00  0.96           O  
ATOM   1220  CB  LEU A 155       7.539  31.594   5.499  1.00  0.96           C  
ATOM   1221  CG  LEU A 155       8.756  31.527   6.450  1.00  0.96           C  
ATOM   1222  CD1 LEU A 155       8.615  32.446   7.677  1.00  0.96           C  
ATOM   1223  CD2 LEU A 155       8.980  30.082   6.920  1.00  0.96           C  
ATOM   1224  N   SER A 156       6.898  34.804   5.132  1.00  0.96           N  
ATOM   1225  CA  SER A 156       7.086  36.118   5.725  1.00  0.96           C  
ATOM   1226  C   SER A 156       5.936  36.399   6.672  1.00  0.96           C  
ATOM   1227  O   SER A 156       4.784  36.111   6.364  1.00  0.96           O  
ATOM   1228  CB  SER A 156       7.134  37.232   4.641  1.00  0.96           C  
ATOM   1229  OG  SER A 156       7.563  38.496   5.149  1.00  0.96           O  
ATOM   1230  N   HIS A 157       6.220  36.986   7.854  1.00  0.93           N  
ATOM   1231  CA  HIS A 157       5.204  37.532   8.751  1.00  0.93           C  
ATOM   1232  C   HIS A 157       4.901  38.977   8.389  1.00  0.93           C  
ATOM   1233  O   HIS A 157       3.984  39.599   8.917  1.00  0.93           O  
ATOM   1234  CB  HIS A 157       5.701  37.546  10.215  1.00  0.93           C  
ATOM   1235  CG  HIS A 157       5.929  36.182  10.777  1.00  0.93           C  
ATOM   1236  ND1 HIS A 157       4.849  35.455  11.239  1.00  0.93           N  
ATOM   1237  CD2 HIS A 157       7.073  35.472  10.936  1.00  0.93           C  
ATOM   1238  CE1 HIS A 157       5.356  34.321  11.668  1.00  0.93           C  
ATOM   1239  NE2 HIS A 157       6.696  34.279  11.506  1.00  0.93           N  
ATOM   1240  N   ASN A 158       5.686  39.538   7.454  1.00  0.94           N  
ATOM   1241  CA  ASN A 158       5.451  40.820   6.842  1.00  0.94           C  
ATOM   1242  C   ASN A 158       4.835  40.586   5.461  1.00  0.94           C  
ATOM   1243  O   ASN A 158       4.111  39.618   5.239  1.00  0.94           O  
ATOM   1244  CB  ASN A 158       6.808  41.568   6.800  1.00  0.94           C  
ATOM   1245  CG  ASN A 158       6.591  43.070   6.795  1.00  0.94           C  
ATOM   1246  OD1 ASN A 158       6.620  43.713   5.747  1.00  0.94           O  
ATOM   1247  ND2 ASN A 158       6.306  43.636   7.989  1.00  0.94           N  
ATOM   1248  N   ASP A 159       5.107  41.449   4.465  1.00  0.93           N  
ATOM   1249  CA  ASP A 159       4.670  41.201   3.108  1.00  0.93           C  
ATOM   1250  C   ASP A 159       5.564  40.125   2.458  1.00  0.93           C  
ATOM   1251  O   ASP A 159       6.795  40.213   2.426  1.00  0.93           O  
ATOM   1252  CB  ASP A 159       4.577  42.552   2.348  1.00  0.93           C  
ATOM   1253  CG  ASP A 159       4.018  42.428   0.939  1.00  0.93           C  
ATOM   1254  OD1 ASP A 159       3.828  41.281   0.457  1.00  0.93           O  
ATOM   1255  OD2 ASP A 159       3.832  43.482   0.290  1.00  0.93           O  
ATOM   1256  N   VAL A 160       4.942  39.029   1.969  1.00  0.95           N  
ATOM   1257  CA  VAL A 160       5.621  37.946   1.277  1.00  0.95           C  
ATOM   1258  C   VAL A 160       5.762  38.207  -0.221  1.00  0.95           C  
ATOM   1259  O   VAL A 160       6.690  37.713  -0.865  1.00  0.95           O  
ATOM   1260  CB  VAL A 160       4.959  36.596   1.573  1.00  0.95           C  
ATOM   1261  CG1 VAL A 160       3.656  36.379   0.775  1.00  0.95           C  
ATOM   1262  CG2 VAL A 160       5.978  35.456   1.361  1.00  0.95           C  
ATOM   1263  N   ASN A 161       4.903  39.070  -0.817  1.00  0.90           N  
ATOM   1264  CA  ASN A 161       5.050  39.522  -2.193  1.00  0.90           C  
ATOM   1265  C   ASN A 161       6.216  40.480  -2.299  1.00  0.90           C  
ATOM   1266  O   ASN A 161       7.058  40.347  -3.188  1.00  0.90           O  
ATOM   1267  CB  ASN A 161       3.790  40.261  -2.719  1.00  0.90           C  
ATOM   1268  CG  ASN A 161       2.716  39.277  -3.157  1.00  0.90           C  
ATOM   1269  OD1 ASN A 161       2.953  38.087  -3.360  1.00  0.90           O  
ATOM   1270  ND2 ASN A 161       1.495  39.809  -3.399  1.00  0.90           N  
ATOM   1271  N   ALA A 162       6.318  41.433  -1.348  1.00  0.93           N  
ATOM   1272  CA  ALA A 162       7.431  42.356  -1.236  1.00  0.93           C  
ATOM   1273  C   ALA A 162       8.753  41.643  -1.012  1.00  0.93           C  
ATOM   1274  O   ALA A 162       9.760  41.936  -1.653  1.00  0.93           O  
ATOM   1275  CB  ALA A 162       7.197  43.333  -0.072  1.00  0.93           C  
ATOM   1276  N   ARG A 163       8.772  40.630  -0.124  1.00  0.88           N  
ATOM   1277  CA  ARG A 163       9.950  39.819   0.099  1.00  0.88           C  
ATOM   1278  C   ARG A 163      10.373  38.993  -1.114  1.00  0.88           C  
ATOM   1279  O   ARG A 163      11.559  38.888  -1.424  1.00  0.88           O  
ATOM   1280  CB  ARG A 163       9.772  38.913   1.338  1.00  0.88           C  
ATOM   1281  CG  ARG A 163      11.040  38.122   1.731  1.00  0.88           C  
ATOM   1282  CD  ARG A 163      12.327  38.954   1.881  1.00  0.88           C  
ATOM   1283  NE  ARG A 163      12.142  39.947   2.992  1.00  0.88           N  
ATOM   1284  CZ  ARG A 163      12.925  41.020   3.153  1.00  0.88           C  
ATOM   1285  NH1 ARG A 163      13.884  41.342   2.297  1.00  0.88           N  
ATOM   1286  NH2 ARG A 163      12.796  41.839   4.194  1.00  0.88           N  
ATOM   1287  N   ARG A 164       9.416  38.397  -1.854  1.00  0.87           N  
ATOM   1288  CA  ARG A 164       9.697  37.710  -3.103  1.00  0.87           C  
ATOM   1289  C   ARG A 164      10.204  38.635  -4.214  1.00  0.87           C  
ATOM   1290  O   ARG A 164      11.153  38.317  -4.926  1.00  0.87           O  
ATOM   1291  CB  ARG A 164       8.457  36.925  -3.592  1.00  0.87           C  
ATOM   1292  CG  ARG A 164       8.833  35.805  -4.587  1.00  0.87           C  
ATOM   1293  CD  ARG A 164       7.660  35.167  -5.344  1.00  0.87           C  
ATOM   1294  NE  ARG A 164       6.895  36.256  -6.043  1.00  0.87           N  
ATOM   1295  CZ  ARG A 164       7.359  36.977  -7.075  1.00  0.87           C  
ATOM   1296  NH1 ARG A 164       8.506  36.696  -7.684  1.00  0.87           N  
ATOM   1297  NH2 ARG A 164       6.657  38.030  -7.491  1.00  0.87           N  
ATOM   1298  N   ALA A 165       9.605  39.835  -4.363  1.00  0.90           N  
ATOM   1299  CA  ALA A 165      10.053  40.879  -5.270  1.00  0.90           C  
ATOM   1300  C   ALA A 165      11.453  41.400  -4.945  1.00  0.90           C  
ATOM   1301  O   ALA A 165      12.277  41.644  -5.826  1.00  0.90           O  
ATOM   1302  CB  ALA A 165       9.043  42.043  -5.230  1.00  0.90           C  
ATOM   1303  N   TRP A 166      11.759  41.548  -3.642  1.00  0.90           N  
ATOM   1304  CA  TRP A 166      13.087  41.823  -3.129  1.00  0.90           C  
ATOM   1305  C   TRP A 166      14.094  40.724  -3.454  1.00  0.90           C  
ATOM   1306  O   TRP A 166      15.216  41.011  -3.854  1.00  0.90           O  
ATOM   1307  CB  TRP A 166      13.017  42.055  -1.593  1.00  0.90           C  
ATOM   1308  CG  TRP A 166      14.335  42.427  -0.928  1.00  0.90           C  
ATOM   1309  CD1 TRP A 166      14.864  43.667  -0.697  1.00  0.90           C  
ATOM   1310  CD2 TRP A 166      15.300  41.475  -0.444  1.00  0.90           C  
ATOM   1311  NE1 TRP A 166      16.108  43.550  -0.121  1.00  0.90           N  
ATOM   1312  CE2 TRP A 166      16.408  42.219   0.023  1.00  0.90           C  
ATOM   1313  CE3 TRP A 166      15.291  40.081  -0.372  1.00  0.90           C  
ATOM   1314  CZ2 TRP A 166      17.523  41.582   0.540  1.00  0.90           C  
ATOM   1315  CZ3 TRP A 166      16.410  39.441   0.178  1.00  0.90           C  
ATOM   1316  CH2 TRP A 166      17.509  40.184   0.637  1.00  0.90           C  
ATOM   1317  N   LEU A 167      13.718  39.432  -3.314  1.00  0.93           N  
ATOM   1318  CA  LEU A 167      14.587  38.304  -3.616  1.00  0.93           C  
ATOM   1319  C   LEU A 167      14.986  38.265  -5.086  1.00  0.93           C  
ATOM   1320  O   LEU A 167      16.143  38.009  -5.429  1.00  0.93           O  
ATOM   1321  CB  LEU A 167      13.917  36.957  -3.224  1.00  0.93           C  
ATOM   1322  CG  LEU A 167      14.791  35.961  -2.421  1.00  0.93           C  
ATOM   1323  CD1 LEU A 167      14.118  34.580  -2.421  1.00  0.93           C  
ATOM   1324  CD2 LEU A 167      16.237  35.819  -2.926  1.00  0.93           C  
ATOM   1325  N   GLU A 168      14.023  38.552  -5.988  1.00  0.85           N  
ATOM   1326  CA  GLU A 168      14.213  38.665  -7.426  1.00  0.85           C  
ATOM   1327  C   GLU A 168      15.218  39.719  -7.842  1.00  0.85           C  
ATOM   1328  O   GLU A 168      16.042  39.497  -8.725  1.00  0.85           O  
ATOM   1329  CB  GLU A 168      12.869  38.955  -8.157  1.00  0.85           C  
ATOM   1330  CG  GLU A 168      11.960  37.720  -8.404  1.00  0.85           C  
ATOM   1331  CD  GLU A 168      12.751  36.433  -8.635  1.00  0.85           C  
ATOM   1332  OE1 GLU A 168      13.388  36.296  -9.705  1.00  0.85           O  
ATOM   1333  OE2 GLU A 168      12.772  35.588  -7.702  1.00  0.85           O  
ATOM   1334  N   SER A 169      15.196  40.903  -7.210  1.00  0.91           N  
ATOM   1335  CA  SER A 169      16.060  41.995  -7.629  1.00  0.91           C  
ATOM   1336  C   SER A 169      17.496  41.874  -7.148  1.00  0.91           C  
ATOM   1337  O   SER A 169      18.391  42.486  -7.731  1.00  0.91           O  
ATOM   1338  CB  SER A 169      15.487  43.382  -7.239  1.00  0.91           C  
ATOM   1339  OG  SER A 169      15.247  43.495  -5.835  1.00  0.91           O  
ATOM   1340  N   GLN A 170      17.778  41.052  -6.109  1.00  0.88           N  
ATOM   1341  CA  GLN A 170      19.145  40.750  -5.704  1.00  0.88           C  
ATOM   1342  C   GLN A 170      19.917  39.971  -6.768  1.00  0.88           C  
ATOM   1343  O   GLN A 170      19.447  38.971  -7.308  1.00  0.88           O  
ATOM   1344  CB  GLN A 170      19.256  39.991  -4.352  1.00  0.88           C  
ATOM   1345  CG  GLN A 170      18.421  40.572  -3.187  1.00  0.88           C  
ATOM   1346  CD  GLN A 170      18.604  42.079  -3.005  1.00  0.88           C  
ATOM   1347  OE1 GLN A 170      19.688  42.565  -2.682  1.00  0.88           O  
ATOM   1348  NE2 GLN A 170      17.507  42.843  -3.201  1.00  0.88           N  
ATOM   1349  N   GLN A 171      21.154  40.397  -7.081  1.00  0.78           N  
ATOM   1350  CA  GLN A 171      21.905  39.872  -8.206  1.00  0.78           C  
ATOM   1351  C   GLN A 171      23.121  39.103  -7.760  1.00  0.78           C  
ATOM   1352  O   GLN A 171      23.728  39.394  -6.732  1.00  0.78           O  
ATOM   1353  CB  GLN A 171      22.354  41.006  -9.163  1.00  0.78           C  
ATOM   1354  CG  GLN A 171      21.210  41.525 -10.065  1.00  0.78           C  
ATOM   1355  CD  GLN A 171      20.705  40.406 -10.979  1.00  0.78           C  
ATOM   1356  OE1 GLN A 171      21.465  39.540 -11.413  1.00  0.78           O  
ATOM   1357  NE2 GLN A 171      19.387  40.394 -11.277  1.00  0.78           N  
ATOM   1358  N   PHE A 172      23.512  38.061  -8.530  1.00  0.70           N  
ATOM   1359  CA  PHE A 172      24.746  37.347  -8.258  1.00  0.70           C  
ATOM   1360  C   PHE A 172      25.940  38.258  -8.548  1.00  0.70           C  
ATOM   1361  O   PHE A 172      26.145  38.746  -9.657  1.00  0.70           O  
ATOM   1362  CB  PHE A 172      24.813  35.967  -8.980  1.00  0.70           C  
ATOM   1363  CG  PHE A 172      26.059  35.195  -8.609  1.00  0.70           C  
ATOM   1364  CD1 PHE A 172      26.434  35.044  -7.265  1.00  0.70           C  
ATOM   1365  CD2 PHE A 172      26.890  34.653  -9.603  1.00  0.70           C  
ATOM   1366  CE1 PHE A 172      27.600  34.357  -6.912  1.00  0.70           C  
ATOM   1367  CE2 PHE A 172      28.067  33.971  -9.258  1.00  0.70           C  
ATOM   1368  CZ  PHE A 172      28.416  33.814  -7.910  1.00  0.70           C  
ATOM   1369  N   SER A 173      26.695  38.588  -7.491  1.00  0.74           N  
ATOM   1370  CA  SER A 173      27.743  39.579  -7.498  1.00  0.74           C  
ATOM   1371  C   SER A 173      28.968  39.228  -8.351  1.00  0.74           C  
ATOM   1372  O   SER A 173      29.399  38.074  -8.372  1.00  0.74           O  
ATOM   1373  CB  SER A 173      28.159  39.907  -6.041  1.00  0.74           C  
ATOM   1374  OG  SER A 173      28.145  38.720  -5.243  1.00  0.74           O  
ATOM   1375  N   PRO A 174      29.577  40.157  -9.096  1.00  0.70           N  
ATOM   1376  CA  PRO A 174      30.901  39.966  -9.686  1.00  0.70           C  
ATOM   1377  C   PRO A 174      32.022  39.438  -8.775  1.00  0.70           C  
ATOM   1378  O   PRO A 174      32.624  40.218  -8.047  1.00  0.70           O  
ATOM   1379  CB  PRO A 174      31.229  41.333 -10.340  1.00  0.70           C  
ATOM   1380  CG  PRO A 174      29.951  42.190 -10.243  1.00  0.70           C  
ATOM   1381  CD  PRO A 174      28.859  41.236  -9.767  1.00  0.70           C  
ATOM   1382  N   GLN A 175      32.360  38.139  -8.921  1.00  0.69           N  
ATOM   1383  CA  GLN A 175      33.531  37.400  -8.456  1.00  0.69           C  
ATOM   1384  C   GLN A 175      34.466  37.923  -7.342  1.00  0.69           C  
ATOM   1385  O   GLN A 175      34.074  38.152  -6.202  1.00  0.69           O  
ATOM   1386  CB  GLN A 175      34.391  36.921  -9.657  1.00  0.69           C  
ATOM   1387  CG  GLN A 175      33.655  36.322 -10.873  1.00  0.69           C  
ATOM   1388  CD  GLN A 175      34.733  35.741 -11.789  1.00  0.69           C  
ATOM   1389  OE1 GLN A 175      35.889  36.156 -11.757  1.00  0.69           O  
ATOM   1390  NE2 GLN A 175      34.377  34.737 -12.615  1.00  0.69           N  
ATOM   1391  N   GLU A 176      35.770  37.975  -7.695  1.00  0.70           N  
ATOM   1392  CA  GLU A 176      36.959  38.107  -6.885  1.00  0.70           C  
ATOM   1393  C   GLU A 176      37.388  36.761  -6.296  1.00  0.70           C  
ATOM   1394  O   GLU A 176      36.821  36.243  -5.333  1.00  0.70           O  
ATOM   1395  CB  GLU A 176      37.047  39.375  -5.998  1.00  0.70           C  
ATOM   1396  CG  GLU A 176      38.412  39.602  -5.285  1.00  0.70           C  
ATOM   1397  CD  GLU A 176      39.718  39.440  -6.080  1.00  0.70           C  
ATOM   1398  OE1 GLU A 176      39.700  39.221  -7.316  1.00  0.70           O  
ATOM   1399  OE2 GLU A 176      40.773  39.537  -5.398  1.00  0.70           O  
ATOM   1400  N   ASP A 177      38.370  36.112  -6.964  1.00  0.82           N  
ATOM   1401  CA  ASP A 177      38.679  34.697  -6.817  1.00  0.82           C  
ATOM   1402  C   ASP A 177      39.393  34.350  -5.510  1.00  0.82           C  
ATOM   1403  O   ASP A 177      40.272  35.073  -5.047  1.00  0.82           O  
ATOM   1404  CB  ASP A 177      39.480  34.196  -8.051  1.00  0.82           C  
ATOM   1405  CG  ASP A 177      39.475  32.677  -8.166  1.00  0.82           C  
ATOM   1406  OD1 ASP A 177      38.553  32.046  -7.583  1.00  0.82           O  
ATOM   1407  OD2 ASP A 177      40.382  32.145  -8.851  1.00  0.82           O  
ATOM   1408  N   PHE A 178      39.040  33.206  -4.882  1.00  0.87           N  
ATOM   1409  CA  PHE A 178      39.592  32.799  -3.599  1.00  0.87           C  
ATOM   1410  C   PHE A 178      40.977  32.198  -3.764  1.00  0.87           C  
ATOM   1411  O   PHE A 178      41.168  31.160  -4.391  1.00  0.87           O  
ATOM   1412  CB  PHE A 178      38.663  31.818  -2.821  1.00  0.87           C  
ATOM   1413  CG  PHE A 178      39.205  31.523  -1.435  1.00  0.87           C  
ATOM   1414  CD1 PHE A 178      38.898  32.347  -0.339  1.00  0.87           C  
ATOM   1415  CD2 PHE A 178      40.092  30.447  -1.245  1.00  0.87           C  
ATOM   1416  CE1 PHE A 178      39.460  32.096   0.921  1.00  0.87           C  
ATOM   1417  CE2 PHE A 178      40.687  30.219   0.001  1.00  0.87           C  
ATOM   1418  CZ  PHE A 178      40.361  31.036   1.089  1.00  0.87           C  
ATOM   1419  N   THR A 179      41.983  32.830  -3.141  1.00  0.88           N  
ATOM   1420  CA  THR A 179      43.348  32.346  -3.180  1.00  0.88           C  
ATOM   1421  C   THR A 179      43.953  32.422  -1.792  1.00  0.88           C  
ATOM   1422  O   THR A 179      43.920  33.454  -1.118  1.00  0.88           O  
ATOM   1423  CB  THR A 179      44.182  33.077  -4.239  1.00  0.88           C  
ATOM   1424  OG1 THR A 179      45.527  32.630  -4.284  1.00  0.88           O  
ATOM   1425  CG2 THR A 179      44.206  34.600  -4.041  1.00  0.88           C  
ATOM   1426  N   LEU A 180      44.522  31.301  -1.289  1.00  0.89           N  
ATOM   1427  CA  LEU A 180      45.472  31.345  -0.192  1.00  0.89           C  
ATOM   1428  C   LEU A 180      46.759  32.023  -0.621  1.00  0.89           C  
ATOM   1429  O   LEU A 180      47.336  31.723  -1.663  1.00  0.89           O  
ATOM   1430  CB  LEU A 180      45.854  29.949   0.359  1.00  0.89           C  
ATOM   1431  CG  LEU A 180      44.853  29.282   1.322  1.00  0.89           C  
ATOM   1432  CD1 LEU A 180      45.586  28.149   2.049  1.00  0.89           C  
ATOM   1433  CD2 LEU A 180      44.229  30.225   2.360  1.00  0.89           C  
ATOM   1434  N   THR A 181      47.257  32.956   0.202  1.00  0.92           N  
ATOM   1435  CA  THR A 181      48.433  33.749  -0.129  1.00  0.92           C  
ATOM   1436  C   THR A 181      49.587  33.391   0.780  1.00  0.92           C  
ATOM   1437  O   THR A 181      50.629  34.043   0.776  1.00  0.92           O  
ATOM   1438  CB  THR A 181      48.171  35.253  -0.122  1.00  0.92           C  
ATOM   1439  OG1 THR A 181      47.640  35.717   1.109  1.00  0.92           O  
ATOM   1440  CG2 THR A 181      47.121  35.574  -1.196  1.00  0.92           C  
ATOM   1441  N   SER A 182      49.446  32.295   1.548  1.00  0.92           N  
ATOM   1442  CA  SER A 182      50.513  31.695   2.328  1.00  0.92           C  
ATOM   1443  C   SER A 182      50.151  30.249   2.595  1.00  0.92           C  
ATOM   1444  O   SER A 182      48.986  29.869   2.479  1.00  0.92           O  
ATOM   1445  CB  SER A 182      50.819  32.400   3.688  1.00  0.92           C  
ATOM   1446  OG  SER A 182      49.723  32.390   4.610  1.00  0.92           O  
ATOM   1447  N   ASP A 183      51.146  29.401   2.938  1.00  0.91           N  
ATOM   1448  CA  ASP A 183      50.937  28.059   3.453  1.00  0.91           C  
ATOM   1449  C   ASP A 183      50.238  28.064   4.811  1.00  0.91           C  
ATOM   1450  O   ASP A 183      50.379  28.996   5.605  1.00  0.91           O  
ATOM   1451  CB  ASP A 183      52.267  27.274   3.601  1.00  0.91           C  
ATOM   1452  CG  ASP A 183      53.138  27.462   2.375  1.00  0.91           C  
ATOM   1453  OD1 ASP A 183      52.690  27.107   1.261  1.00  0.91           O  
ATOM   1454  OD2 ASP A 183      54.257  28.012   2.550  1.00  0.91           O  
ATOM   1455  N   TRP A 184      49.470  27.005   5.141  1.00  0.88           N  
ATOM   1456  CA  TRP A 184      48.938  26.852   6.484  1.00  0.88           C  
ATOM   1457  C   TRP A 184      50.013  26.693   7.546  1.00  0.88           C  
ATOM   1458  O   TRP A 184      50.873  25.818   7.486  1.00  0.88           O  
ATOM   1459  CB  TRP A 184      47.993  25.638   6.614  1.00  0.88           C  
ATOM   1460  CG  TRP A 184      46.760  25.748   5.759  1.00  0.88           C  
ATOM   1461  CD1 TRP A 184      46.515  25.164   4.552  1.00  0.88           C  
ATOM   1462  CD2 TRP A 184      45.581  26.500   6.099  1.00  0.88           C  
ATOM   1463  NE1 TRP A 184      45.241  25.464   4.133  1.00  0.88           N  
ATOM   1464  CE2 TRP A 184      44.652  26.288   5.062  1.00  0.88           C  
ATOM   1465  CE3 TRP A 184      45.268  27.300   7.196  1.00  0.88           C  
ATOM   1466  CZ2 TRP A 184      43.394  26.867   5.106  1.00  0.88           C  
ATOM   1467  CZ3 TRP A 184      43.994  27.888   7.239  1.00  0.88           C  
ATOM   1468  CH2 TRP A 184      43.066  27.672   6.208  1.00  0.88           C  
ATOM   1469  N   GLN A 185      49.954  27.530   8.590  1.00  0.88           N  
ATOM   1470  CA  GLN A 185      50.867  27.440   9.701  1.00  0.88           C  
ATOM   1471  C   GLN A 185      50.069  27.203  10.962  1.00  0.88           C  
ATOM   1472  O   GLN A 185      48.996  27.766  11.142  1.00  0.88           O  
ATOM   1473  CB  GLN A 185      51.741  28.712   9.765  1.00  0.88           C  
ATOM   1474  CG  GLN A 185      52.829  28.689  10.860  1.00  0.88           C  
ATOM   1475  CD  GLN A 185      53.939  29.687  10.534  1.00  0.88           C  
ATOM   1476  OE1 GLN A 185      53.792  30.898  10.695  1.00  0.88           O  
ATOM   1477  NE2 GLN A 185      55.083  29.162  10.033  1.00  0.88           N  
ATOM   1478  N   SER A 186      50.551  26.320  11.857  1.00  0.94           N  
ATOM   1479  CA  SER A 186      49.953  26.110  13.171  1.00  0.94           C  
ATOM   1480  C   SER A 186      50.390  27.196  14.154  1.00  0.94           C  
ATOM   1481  O   SER A 186      51.341  27.937  13.916  1.00  0.94           O  
ATOM   1482  CB  SER A 186      50.255  24.694  13.746  1.00  0.94           C  
ATOM   1483  OG  SER A 186      49.515  24.441  14.943  1.00  0.94           O  
ATOM   1484  N   ASN A 187      49.695  27.301  15.302  1.00  0.94           N  
ATOM   1485  CA  ASN A 187      50.018  28.169  16.421  1.00  0.94           C  
ATOM   1486  C   ASN A 187      50.872  27.441  17.449  1.00  0.94           C  
ATOM   1487  O   ASN A 187      51.117  27.932  18.552  1.00  0.94           O  
ATOM   1488  CB  ASN A 187      48.727  28.747  17.077  1.00  0.94           C  
ATOM   1489  CG  ASN A 187      47.762  27.714  17.668  1.00  0.94           C  
ATOM   1490  OD1 ASN A 187      47.772  26.516  17.392  1.00  0.94           O  
ATOM   1491  ND2 ASN A 187      46.829  28.216  18.512  1.00  0.94           N  
ATOM   1492  N   MET A 188      51.343  26.243  17.079  1.00  0.92           N  
ATOM   1493  CA  MET A 188      52.205  25.419  17.877  1.00  0.92           C  
ATOM   1494  C   MET A 188      53.212  24.688  16.995  1.00  0.92           C  
ATOM   1495  O   MET A 188      52.963  24.378  15.831  1.00  0.92           O  
ATOM   1496  CB  MET A 188      51.388  24.293  18.543  1.00  0.92           C  
ATOM   1497  CG  MET A 188      50.256  24.693  19.511  1.00  0.92           C  
ATOM   1498  SD  MET A 188      49.496  23.253  20.335  1.00  0.92           S  
ATOM   1499  CE  MET A 188      49.422  22.210  18.847  1.00  0.92           C  
ATOM   1500  N   THR A 189      54.373  24.337  17.574  1.00  0.93           N  
ATOM   1501  CA  THR A 189      55.226  23.245  17.118  1.00  0.93           C  
ATOM   1502  C   THR A 189      54.744  21.899  17.650  1.00  0.93           C  
ATOM   1503  O   THR A 189      53.830  21.801  18.473  1.00  0.93           O  
ATOM   1504  CB  THR A 189      56.715  23.414  17.441  1.00  0.93           C  
ATOM   1505  OG1 THR A 189      57.033  23.291  18.825  1.00  0.93           O  
ATOM   1506  CG2 THR A 189      57.173  24.798  16.966  1.00  0.93           C  
ATOM   1507  N   ARG A 190      55.364  20.789  17.198  1.00  0.85           N  
ATOM   1508  CA  ARG A 190      55.111  19.451  17.700  1.00  0.85           C  
ATOM   1509  C   ARG A 190      55.437  19.319  19.187  1.00  0.85           C  
ATOM   1510  O   ARG A 190      54.717  18.683  19.960  1.00  0.85           O  
ATOM   1511  CB  ARG A 190      55.964  18.451  16.876  1.00  0.85           C  
ATOM   1512  CG  ARG A 190      56.035  17.016  17.435  1.00  0.85           C  
ATOM   1513  CD  ARG A 190      54.674  16.342  17.606  1.00  0.85           C  
ATOM   1514  NE  ARG A 190      54.905  15.059  18.301  1.00  0.85           N  
ATOM   1515  CZ  ARG A 190      54.998  14.890  19.619  1.00  0.85           C  
ATOM   1516  NH1 ARG A 190      54.918  15.874  20.505  1.00  0.85           N  
ATOM   1517  NH2 ARG A 190      55.191  13.670  20.100  1.00  0.85           N  
ATOM   1518  N   GLU A 191      56.544  19.937  19.612  1.00  0.85           N  
ATOM   1519  CA  GLU A 191      57.052  20.035  20.963  1.00  0.85           C  
ATOM   1520  C   GLU A 191      56.122  20.842  21.849  1.00  0.85           C  
ATOM   1521  O   GLU A 191      55.779  20.418  22.950  1.00  0.85           O  
ATOM   1522  CB  GLU A 191      58.473  20.670  20.972  1.00  0.85           C  
ATOM   1523  CG  GLU A 191      59.518  19.944  20.074  1.00  0.85           C  
ATOM   1524  CD  GLU A 191      59.190  20.051  18.587  1.00  0.85           C  
ATOM   1525  OE1 GLU A 191      58.633  21.114  18.193  1.00  0.85           O  
ATOM   1526  OE2 GLU A 191      59.352  19.043  17.864  1.00  0.85           O  
ATOM   1527  N   GLN A 192      55.620  21.997  21.351  1.00  0.88           N  
ATOM   1528  CA  GLN A 192      54.599  22.788  22.024  1.00  0.88           C  
ATOM   1529  C   GLN A 192      53.282  22.041  22.196  1.00  0.88           C  
ATOM   1530  O   GLN A 192      52.644  22.147  23.241  1.00  0.88           O  
ATOM   1531  CB  GLN A 192      54.360  24.143  21.312  1.00  0.88           C  
ATOM   1532  CG  GLN A 192      55.542  25.128  21.490  1.00  0.88           C  
ATOM   1533  CD  GLN A 192      55.334  26.394  20.662  1.00  0.88           C  
ATOM   1534  OE1 GLN A 192      54.897  26.336  19.516  1.00  0.88           O  
ATOM   1535  NE2 GLN A 192      55.654  27.581  21.226  1.00  0.88           N  
ATOM   1536  N   TYR A 193      52.838  21.225  21.209  1.00  0.92           N  
ATOM   1537  CA  TYR A 193      51.750  20.284  21.456  1.00  0.92           C  
ATOM   1538  C   TYR A 193      52.088  19.254  22.527  1.00  0.92           C  
ATOM   1539  O   TYR A 193      51.319  19.048  23.462  1.00  0.92           O  
ATOM   1540  CB  TYR A 193      51.379  19.471  20.186  1.00  0.92           C  
ATOM   1541  CG  TYR A 193      50.137  18.640  20.432  1.00  0.92           C  
ATOM   1542  CD1 TYR A 193      48.894  19.249  20.670  1.00  0.92           C  
ATOM   1543  CD2 TYR A 193      50.237  17.242  20.546  1.00  0.92           C  
ATOM   1544  CE1 TYR A 193      47.760  18.477  20.929  1.00  0.92           C  
ATOM   1545  CE2 TYR A 193      49.105  16.465  20.845  1.00  0.92           C  
ATOM   1546  CZ  TYR A 193      47.864  17.093  21.018  1.00  0.92           C  
ATOM   1547  OH  TYR A 193      46.686  16.400  21.331  1.00  0.92           O  
ATOM   1548  N   GLY A 194      53.261  18.599  22.400  1.00  0.93           N  
ATOM   1549  CA  GLY A 194      53.767  17.567  23.301  1.00  0.93           C  
ATOM   1550  C   GLY A 194      53.758  17.957  24.745  1.00  0.93           C  
ATOM   1551  O   GLY A 194      53.242  17.250  25.606  1.00  0.93           O  
ATOM   1552  N   GLU A 195      54.296  19.149  25.033  1.00  0.88           N  
ATOM   1553  CA  GLU A 195      54.279  19.764  26.340  1.00  0.88           C  
ATOM   1554  C   GLU A 195      52.868  19.983  26.884  1.00  0.88           C  
ATOM   1555  O   GLU A 195      52.552  19.598  28.008  1.00  0.88           O  
ATOM   1556  CB  GLU A 195      54.986  21.132  26.202  1.00  0.88           C  
ATOM   1557  CG  GLU A 195      55.031  21.988  27.487  1.00  0.88           C  
ATOM   1558  CD  GLU A 195      55.311  23.463  27.202  1.00  0.88           C  
ATOM   1559  OE1 GLU A 195      55.648  23.814  26.044  1.00  0.88           O  
ATOM   1560  OE2 GLU A 195      55.079  24.262  28.144  1.00  0.88           O  
ATOM   1561  N   LYS A 196      51.951  20.567  26.088  1.00  0.91           N  
ATOM   1562  CA  LYS A 196      50.572  20.804  26.488  1.00  0.91           C  
ATOM   1563  C   LYS A 196      49.761  19.536  26.676  1.00  0.91           C  
ATOM   1564  O   LYS A 196      48.975  19.426  27.612  1.00  0.91           O  
ATOM   1565  CB  LYS A 196      49.854  21.750  25.504  1.00  0.91           C  
ATOM   1566  CG  LYS A 196      50.508  23.138  25.452  1.00  0.91           C  
ATOM   1567  CD  LYS A 196      50.020  23.957  24.247  1.00  0.91           C  
ATOM   1568  CE  LYS A 196      50.880  25.188  23.950  1.00  0.91           C  
ATOM   1569  NZ  LYS A 196      50.804  26.124  25.089  1.00  0.91           N  
ATOM   1570  N   PHE A 197      49.967  18.520  25.820  1.00  0.92           N  
ATOM   1571  CA  PHE A 197      49.394  17.197  25.955  1.00  0.92           C  
ATOM   1572  C   PHE A 197      49.807  16.553  27.285  1.00  0.92           C  
ATOM   1573  O   PHE A 197      48.983  16.029  28.032  1.00  0.92           O  
ATOM   1574  CB  PHE A 197      49.852  16.373  24.716  1.00  0.92           C  
ATOM   1575  CG  PHE A 197      49.393  14.950  24.780  1.00  0.92           C  
ATOM   1576  CD1 PHE A 197      50.178  13.998  25.452  1.00  0.92           C  
ATOM   1577  CD2 PHE A 197      48.154  14.571  24.249  1.00  0.92           C  
ATOM   1578  CE1 PHE A 197      49.708  12.696  25.631  1.00  0.92           C  
ATOM   1579  CE2 PHE A 197      47.689  13.261  24.409  1.00  0.92           C  
ATOM   1580  CZ  PHE A 197      48.464  12.332  25.108  1.00  0.92           C  
ATOM   1581  N   ARG A 198      51.101  16.645  27.646  1.00  0.84           N  
ATOM   1582  CA  ARG A 198      51.600  16.220  28.942  1.00  0.84           C  
ATOM   1583  C   ARG A 198      51.044  17.002  30.121  1.00  0.84           C  
ATOM   1584  O   ARG A 198      50.699  16.415  31.141  1.00  0.84           O  
ATOM   1585  CB  ARG A 198      53.135  16.298  28.990  1.00  0.84           C  
ATOM   1586  CG  ARG A 198      53.808  15.288  28.053  1.00  0.84           C  
ATOM   1587  CD  ARG A 198      55.288  15.590  27.870  1.00  0.84           C  
ATOM   1588  NE  ARG A 198      55.814  14.475  27.038  1.00  0.84           N  
ATOM   1589  CZ  ARG A 198      56.584  13.469  27.459  1.00  0.84           C  
ATOM   1590  NH1 ARG A 198      56.904  13.289  28.737  1.00  0.84           N  
ATOM   1591  NH2 ARG A 198      57.007  12.604  26.545  1.00  0.84           N  
ATOM   1592  N   GLN A 199      50.910  18.341  30.011  1.00  0.86           N  
ATOM   1593  CA  GLN A 199      50.260  19.164  31.022  1.00  0.86           C  
ATOM   1594  C   GLN A 199      48.807  18.774  31.246  1.00  0.86           C  
ATOM   1595  O   GLN A 199      48.367  18.640  32.385  1.00  0.86           O  
ATOM   1596  CB  GLN A 199      50.341  20.671  30.672  1.00  0.86           C  
ATOM   1597  CG  GLN A 199      51.771  21.244  30.786  1.00  0.86           C  
ATOM   1598  CD  GLN A 199      51.802  22.742  30.479  1.00  0.86           C  
ATOM   1599  OE1 GLN A 199      51.511  23.573  31.335  1.00  0.86           O  
ATOM   1600  NE2 GLN A 199      52.189  23.111  29.238  1.00  0.86           N  
ATOM   1601  N   VAL A 200      48.038  18.494  30.166  1.00  0.94           N  
ATOM   1602  CA  VAL A 200      46.704  17.919  30.293  1.00  0.94           C  
ATOM   1603  C   VAL A 200      46.736  16.586  31.021  1.00  0.94           C  
ATOM   1604  O   VAL A 200      45.996  16.392  31.978  1.00  0.94           O  
ATOM   1605  CB  VAL A 200      46.004  17.722  28.946  1.00  0.94           C  
ATOM   1606  CG1 VAL A 200      44.675  16.960  29.121  1.00  0.94           C  
ATOM   1607  CG2 VAL A 200      45.712  19.091  28.311  1.00  0.94           C  
ATOM   1608  N   GLN A 201      47.628  15.650  30.643  1.00  0.88           N  
ATOM   1609  CA  GLN A 201      47.713  14.355  31.298  1.00  0.88           C  
ATOM   1610  C   GLN A 201      48.112  14.370  32.769  1.00  0.88           C  
ATOM   1611  O   GLN A 201      47.523  13.630  33.553  1.00  0.88           O  
ATOM   1612  CB  GLN A 201      48.539  13.334  30.492  1.00  0.88           C  
ATOM   1613  CG  GLN A 201      47.846  13.023  29.144  1.00  0.88           C  
ATOM   1614  CD  GLN A 201      48.220  11.683  28.515  1.00  0.88           C  
ATOM   1615  OE1 GLN A 201      47.415  11.107  27.789  1.00  0.88           O  
ATOM   1616  NE2 GLN A 201      49.439  11.164  28.777  1.00  0.88           N  
ATOM   1617  N   GLU A 202      49.057  15.234  33.200  1.00  0.85           N  
ATOM   1618  CA  GLU A 202      49.322  15.468  34.617  1.00  0.85           C  
ATOM   1619  C   GLU A 202      48.112  16.049  35.352  1.00  0.85           C  
ATOM   1620  O   GLU A 202      47.783  15.618  36.451  1.00  0.85           O  
ATOM   1621  CB  GLU A 202      50.579  16.344  34.872  1.00  0.85           C  
ATOM   1622  CG  GLU A 202      51.930  15.683  34.489  1.00  0.85           C  
ATOM   1623  CD  GLU A 202      52.178  14.369  35.230  1.00  0.85           C  
ATOM   1624  OE1 GLU A 202      52.688  14.437  36.376  1.00  0.85           O  
ATOM   1625  OE2 GLU A 202      51.901  13.299  34.627  1.00  0.85           O  
ATOM   1626  N   TYR A 203      47.349  16.991  34.747  1.00  0.91           N  
ATOM   1627  CA  TYR A 203      46.061  17.432  35.288  1.00  0.91           C  
ATOM   1628  C   TYR A 203      45.012  16.322  35.415  1.00  0.91           C  
ATOM   1629  O   TYR A 203      44.227  16.291  36.361  1.00  0.91           O  
ATOM   1630  CB  TYR A 203      45.441  18.603  34.466  1.00  0.91           C  
ATOM   1631  CG  TYR A 203      46.131  19.918  34.720  1.00  0.91           C  
ATOM   1632  CD1 TYR A 203      46.348  20.364  36.035  1.00  0.91           C  
ATOM   1633  CD2 TYR A 203      46.496  20.763  33.653  1.00  0.91           C  
ATOM   1634  CE1 TYR A 203      46.952  21.602  36.280  1.00  0.91           C  
ATOM   1635  CE2 TYR A 203      47.081  22.016  33.898  1.00  0.91           C  
ATOM   1636  CZ  TYR A 203      47.303  22.434  35.217  1.00  0.91           C  
ATOM   1637  OH  TYR A 203      47.834  23.700  35.523  1.00  0.91           O  
ATOM   1638  N   LEU A 204      44.954  15.370  34.463  1.00  0.92           N  
ATOM   1639  CA  LEU A 204      44.146  14.166  34.604  1.00  0.92           C  
ATOM   1640  C   LEU A 204      44.627  13.227  35.708  1.00  0.92           C  
ATOM   1641  O   LEU A 204      43.837  12.711  36.493  1.00  0.92           O  
ATOM   1642  CB  LEU A 204      44.082  13.343  33.295  1.00  0.92           C  
ATOM   1643  CG  LEU A 204      43.621  14.101  32.038  1.00  0.92           C  
ATOM   1644  CD1 LEU A 204      43.541  13.122  30.873  1.00  0.92           C  
ATOM   1645  CD2 LEU A 204      42.279  14.815  32.213  1.00  0.92           C  
ATOM   1646  N   HIS A 205      45.953  12.994  35.805  1.00  0.86           N  
ATOM   1647  CA  HIS A 205      46.577  12.188  36.848  1.00  0.86           C  
ATOM   1648  C   HIS A 205      46.344  12.742  38.250  1.00  0.86           C  
ATOM   1649  O   HIS A 205      46.062  11.990  39.182  1.00  0.86           O  
ATOM   1650  CB  HIS A 205      48.100  12.005  36.574  1.00  0.86           C  
ATOM   1651  CG  HIS A 205      48.966  11.828  37.791  1.00  0.86           C  
ATOM   1652  ND1 HIS A 205      49.515  12.957  38.359  1.00  0.86           N  
ATOM   1653  CD2 HIS A 205      49.265  10.734  38.540  1.00  0.86           C  
ATOM   1654  CE1 HIS A 205      50.150  12.540  39.426  1.00  0.86           C  
ATOM   1655  NE2 HIS A 205      50.028  11.200  39.591  1.00  0.86           N  
ATOM   1656  N   SER A 206      46.432  14.076  38.422  1.00  0.87           N  
ATOM   1657  CA  SER A 206      46.350  14.732  39.719  1.00  0.87           C  
ATOM   1658  C   SER A 206      44.918  14.963  40.168  1.00  0.87           C  
ATOM   1659  O   SER A 206      44.662  15.332  41.312  1.00  0.87           O  
ATOM   1660  CB  SER A 206      47.169  16.055  39.756  1.00  0.87           C  
ATOM   1661  OG  SER A 206      46.630  17.069  38.905  1.00  0.87           O  
ATOM   1662  N   GLY A 207      43.950  14.640  39.283  1.00  0.90           N  
ATOM   1663  CA  GLY A 207      42.552  14.409  39.626  1.00  0.90           C  
ATOM   1664  C   GLY A 207      41.609  15.533  39.316  1.00  0.90           C  
ATOM   1665  O   GLY A 207      40.415  15.422  39.581  1.00  0.90           O  
ATOM   1666  N   ASP A 208      42.103  16.630  38.717  1.00  0.91           N  
ATOM   1667  CA  ASP A 208      41.309  17.786  38.334  1.00  0.91           C  
ATOM   1668  C   ASP A 208      40.217  17.497  37.304  1.00  0.91           C  
ATOM   1669  O   ASP A 208      39.090  17.989  37.385  1.00  0.91           O  
ATOM   1670  CB  ASP A 208      42.232  18.835  37.665  1.00  0.91           C  
ATOM   1671  CG  ASP A 208      43.011  19.672  38.653  1.00  0.91           C  
ATOM   1672  OD1 ASP A 208      42.779  19.606  39.876  1.00  0.91           O  
ATOM   1673  OD2 ASP A 208      43.782  20.521  38.130  1.00  0.91           O  
ATOM   1674  N   CYS A 209      40.564  16.706  36.275  1.00  0.96           N  
ATOM   1675  CA  CYS A 209      39.719  16.437  35.131  1.00  0.96           C  
ATOM   1676  C   CYS A 209      39.819  14.972  34.778  1.00  0.96           C  
ATOM   1677  O   CYS A 209      40.752  14.287  35.183  1.00  0.96           O  
ATOM   1678  CB  CYS A 209      40.122  17.278  33.882  1.00  0.96           C  
ATOM   1679  SG  CYS A 209      39.397  18.939  33.876  1.00  0.96           S  
ATOM   1680  N   TYR A 210      38.857  14.440  33.993  1.00  0.91           N  
ATOM   1681  CA  TYR A 210      38.983  13.100  33.444  1.00  0.91           C  
ATOM   1682  C   TYR A 210      38.888  13.093  31.921  1.00  0.91           C  
ATOM   1683  O   TYR A 210      39.136  12.071  31.289  1.00  0.91           O  
ATOM   1684  CB  TYR A 210      38.051  12.078  34.160  1.00  0.91           C  
ATOM   1685  CG  TYR A 210      36.574  12.362  34.064  1.00  0.91           C  
ATOM   1686  CD1 TYR A 210      35.933  13.269  34.929  1.00  0.91           C  
ATOM   1687  CD2 TYR A 210      35.791  11.611  33.175  1.00  0.91           C  
ATOM   1688  CE1 TYR A 210      34.538  13.424  34.893  1.00  0.91           C  
ATOM   1689  CE2 TYR A 210      34.396  11.752  33.148  1.00  0.91           C  
ATOM   1690  CZ  TYR A 210      33.771  12.657  34.009  1.00  0.91           C  
ATOM   1691  OH  TYR A 210      32.369  12.793  33.996  1.00  0.91           O  
ATOM   1692  N   GLN A 211      38.634  14.260  31.287  1.00  0.90           N  
ATOM   1693  CA  GLN A 211      38.919  14.478  29.883  1.00  0.90           C  
ATOM   1694  C   GLN A 211      39.171  15.960  29.677  1.00  0.90           C  
ATOM   1695  O   GLN A 211      38.613  16.788  30.391  1.00  0.90           O  
ATOM   1696  CB  GLN A 211      37.733  14.004  28.992  1.00  0.90           C  
ATOM   1697  CG  GLN A 211      37.870  14.239  27.460  1.00  0.90           C  
ATOM   1698  CD  GLN A 211      36.720  13.678  26.611  1.00  0.90           C  
ATOM   1699  OE1 GLN A 211      36.382  14.242  25.568  1.00  0.90           O  
ATOM   1700  NE2 GLN A 211      36.099  12.560  27.045  1.00  0.90           N  
ATOM   1701  N   VAL A 212      40.016  16.344  28.700  1.00  0.97           N  
ATOM   1702  CA  VAL A 212      40.126  17.728  28.254  1.00  0.97           C  
ATOM   1703  C   VAL A 212      40.272  17.691  26.744  1.00  0.97           C  
ATOM   1704  O   VAL A 212      41.044  16.907  26.198  1.00  0.97           O  
ATOM   1705  CB  VAL A 212      41.315  18.488  28.856  1.00  0.97           C  
ATOM   1706  CG1 VAL A 212      41.431  19.922  28.293  1.00  0.97           C  
ATOM   1707  CG2 VAL A 212      41.192  18.562  30.392  1.00  0.97           C  
ATOM   1708  N   ASN A 213      39.515  18.531  26.011  1.00  0.95           N  
ATOM   1709  CA  ASN A 213      39.617  18.649  24.569  1.00  0.95           C  
ATOM   1710  C   ASN A 213      40.589  19.776  24.214  1.00  0.95           C  
ATOM   1711  O   ASN A 213      40.238  20.951  24.311  1.00  0.95           O  
ATOM   1712  CB  ASN A 213      38.192  18.897  23.991  1.00  0.95           C  
ATOM   1713  CG  ASN A 213      38.070  18.862  22.465  1.00  0.95           C  
ATOM   1714  OD1 ASN A 213      37.651  17.872  21.858  1.00  0.95           O  
ATOM   1715  ND2 ASN A 213      38.356  20.014  21.813  1.00  0.95           N  
ATOM   1716  N   LEU A 214      41.819  19.426  23.783  1.00  0.96           N  
ATOM   1717  CA  LEU A 214      42.909  20.342  23.466  1.00  0.96           C  
ATOM   1718  C   LEU A 214      43.008  20.526  21.959  1.00  0.96           C  
ATOM   1719  O   LEU A 214      42.941  19.557  21.201  1.00  0.96           O  
ATOM   1720  CB  LEU A 214      44.251  19.759  23.998  1.00  0.96           C  
ATOM   1721  CG  LEU A 214      45.547  20.557  23.698  1.00  0.96           C  
ATOM   1722  CD1 LEU A 214      45.583  21.939  24.369  1.00  0.96           C  
ATOM   1723  CD2 LEU A 214      46.789  19.745  24.104  1.00  0.96           C  
ATOM   1724  N   ALA A 215      43.145  21.777  21.479  1.00  0.98           N  
ATOM   1725  CA  ALA A 215      43.175  22.088  20.069  1.00  0.98           C  
ATOM   1726  C   ALA A 215      44.371  22.898  19.596  1.00  0.98           C  
ATOM   1727  O   ALA A 215      45.054  23.597  20.342  1.00  0.98           O  
ATOM   1728  CB  ALA A 215      41.873  22.831  19.708  1.00  0.98           C  
ATOM   1729  N   GLN A 216      44.638  22.793  18.280  1.00  0.92           N  
ATOM   1730  CA  GLN A 216      45.595  23.601  17.566  1.00  0.92           C  
ATOM   1731  C   GLN A 216      44.892  24.387  16.491  1.00  0.92           C  
ATOM   1732  O   GLN A 216      43.854  23.976  15.978  1.00  0.92           O  
ATOM   1733  CB  GLN A 216      46.743  22.757  16.968  1.00  0.92           C  
ATOM   1734  CG  GLN A 216      46.479  21.821  15.762  1.00  0.92           C  
ATOM   1735  CD  GLN A 216      47.808  21.210  15.286  1.00  0.92           C  
ATOM   1736  OE1 GLN A 216      48.830  21.894  15.196  1.00  0.92           O  
ATOM   1737  NE2 GLN A 216      47.838  19.901  14.960  1.00  0.92           N  
ATOM   1738  N   ARG A 217      45.429  25.566  16.148  1.00  0.91           N  
ATOM   1739  CA  ARG A 217      44.830  26.473  15.201  1.00  0.91           C  
ATOM   1740  C   ARG A 217      45.768  26.675  14.041  1.00  0.91           C  
ATOM   1741  O   ARG A 217      46.877  27.182  14.192  1.00  0.91           O  
ATOM   1742  CB  ARG A 217      44.548  27.845  15.858  1.00  0.91           C  
ATOM   1743  CG  ARG A 217      43.868  28.858  14.917  1.00  0.91           C  
ATOM   1744  CD  ARG A 217      43.483  30.178  15.593  1.00  0.91           C  
ATOM   1745  NE  ARG A 217      44.744  30.947  15.815  1.00  0.91           N  
ATOM   1746  CZ  ARG A 217      44.762  32.232  16.190  1.00  0.91           C  
ATOM   1747  NH1 ARG A 217      43.695  32.847  16.689  1.00  0.91           N  
ATOM   1748  NH2 ARG A 217      45.879  32.938  16.071  1.00  0.91           N  
ATOM   1749  N   PHE A 218      45.312  26.315  12.834  1.00  0.93           N  
ATOM   1750  CA  PHE A 218      45.998  26.577  11.595  1.00  0.93           C  
ATOM   1751  C   PHE A 218      45.554  27.940  11.093  1.00  0.93           C  
ATOM   1752  O   PHE A 218      44.375  28.290  11.172  1.00  0.93           O  
ATOM   1753  CB  PHE A 218      45.662  25.511  10.523  1.00  0.93           C  
ATOM   1754  CG  PHE A 218      46.111  24.169  11.009  1.00  0.93           C  
ATOM   1755  CD1 PHE A 218      47.447  23.776  10.842  1.00  0.93           C  
ATOM   1756  CD2 PHE A 218      45.214  23.304  11.658  1.00  0.93           C  
ATOM   1757  CE1 PHE A 218      47.879  22.526  11.299  1.00  0.93           C  
ATOM   1758  CE2 PHE A 218      45.641  22.051  12.112  1.00  0.93           C  
ATOM   1759  CZ  PHE A 218      46.973  21.662  11.927  1.00  0.93           C  
ATOM   1760  N   HIS A 219      46.481  28.760  10.575  1.00  0.91           N  
ATOM   1761  CA  HIS A 219      46.153  30.047   9.995  1.00  0.91           C  
ATOM   1762  C   HIS A 219      46.859  30.208   8.667  1.00  0.91           C  
ATOM   1763  O   HIS A 219      47.880  29.567   8.417  1.00  0.91           O  
ATOM   1764  CB  HIS A 219      46.506  31.239  10.931  1.00  0.91           C  
ATOM   1765  CG  HIS A 219      47.927  31.739  10.886  1.00  0.91           C  
ATOM   1766  ND1 HIS A 219      48.170  33.007  10.389  1.00  0.91           N  
ATOM   1767  CD2 HIS A 219      49.096  31.144  11.239  1.00  0.91           C  
ATOM   1768  CE1 HIS A 219      49.477  33.155  10.446  1.00  0.91           C  
ATOM   1769  NE2 HIS A 219      50.089  32.057  10.950  1.00  0.91           N  
ATOM   1770  N   ALA A 220      46.320  31.070   7.793  1.00  0.95           N  
ATOM   1771  CA  ALA A 220      46.949  31.442   6.552  1.00  0.95           C  
ATOM   1772  C   ALA A 220      46.386  32.793   6.151  1.00  0.95           C  
ATOM   1773  O   ALA A 220      45.328  33.212   6.627  1.00  0.95           O  
ATOM   1774  CB  ALA A 220      46.670  30.401   5.446  1.00  0.95           C  
ATOM   1775  N   THR A 221      47.074  33.536   5.269  1.00  0.93           N  
ATOM   1776  CA  THR A 221      46.520  34.735   4.661  1.00  0.93           C  
ATOM   1777  C   THR A 221      45.780  34.360   3.395  1.00  0.93           C  
ATOM   1778  O   THR A 221      46.050  33.344   2.755  1.00  0.93           O  
ATOM   1779  CB  THR A 221      47.546  35.819   4.343  1.00  0.93           C  
ATOM   1780  OG1 THR A 221      48.722  35.279   3.759  1.00  0.93           O  
ATOM   1781  CG2 THR A 221      48.014  36.509   5.629  1.00  0.93           C  
ATOM   1782  N   TYR A 222      44.790  35.176   3.002  1.00  0.92           N  
ATOM   1783  CA  TYR A 222      44.034  34.946   1.794  1.00  0.92           C  
ATOM   1784  C   TYR A 222      43.690  36.269   1.133  1.00  0.92           C  
ATOM   1785  O   TYR A 222      43.793  37.347   1.720  1.00  0.92           O  
ATOM   1786  CB  TYR A 222      42.769  34.048   2.030  1.00  0.92           C  
ATOM   1787  CG  TYR A 222      41.609  34.771   2.674  1.00  0.92           C  
ATOM   1788  CD1 TYR A 222      41.612  35.060   4.046  1.00  0.92           C  
ATOM   1789  CD2 TYR A 222      40.525  35.205   1.891  1.00  0.92           C  
ATOM   1790  CE1 TYR A 222      40.567  35.802   4.615  1.00  0.92           C  
ATOM   1791  CE2 TYR A 222      39.474  35.937   2.464  1.00  0.92           C  
ATOM   1792  CZ  TYR A 222      39.501  36.243   3.828  1.00  0.92           C  
ATOM   1793  OH  TYR A 222      38.472  36.987   4.441  1.00  0.92           O  
ATOM   1794  N   SER A 223      43.248  36.186  -0.124  1.00  0.92           N  
ATOM   1795  CA  SER A 223      42.483  37.220  -0.786  1.00  0.92           C  
ATOM   1796  C   SER A 223      41.415  36.498  -1.579  1.00  0.92           C  
ATOM   1797  O   SER A 223      41.470  35.278  -1.740  1.00  0.92           O  
ATOM   1798  CB  SER A 223      43.315  38.207  -1.659  1.00  0.92           C  
ATOM   1799  OG  SER A 223      44.132  37.550  -2.629  1.00  0.92           O  
ATOM   1800  N   GLY A 224      40.376  37.229  -2.025  1.00  0.88           N  
ATOM   1801  CA  GLY A 224      39.210  36.658  -2.686  1.00  0.88           C  
ATOM   1802  C   GLY A 224      37.979  36.580  -1.841  1.00  0.88           C  
ATOM   1803  O   GLY A 224      38.041  36.674  -0.620  1.00  0.88           O  
ATOM   1804  N   ASP A 225      36.806  36.389  -2.478  1.00  0.87           N  
ATOM   1805  CA  ASP A 225      35.571  36.143  -1.764  1.00  0.87           C  
ATOM   1806  C   ASP A 225      35.482  34.689  -1.287  1.00  0.87           C  
ATOM   1807  O   ASP A 225      35.914  33.738  -1.938  1.00  0.87           O  
ATOM   1808  CB  ASP A 225      34.334  36.527  -2.620  1.00  0.87           C  
ATOM   1809  CG  ASP A 225      33.089  36.413  -1.762  1.00  0.87           C  
ATOM   1810  OD1 ASP A 225      32.888  37.269  -0.864  1.00  0.87           O  
ATOM   1811  OD2 ASP A 225      32.373  35.389  -1.896  1.00  0.87           O  
ATOM   1812  N   GLU A 226      34.887  34.484  -0.104  1.00  0.89           N  
ATOM   1813  CA  GLU A 226      34.845  33.210   0.557  1.00  0.89           C  
ATOM   1814  C   GLU A 226      33.637  32.349   0.188  1.00  0.89           C  
ATOM   1815  O   GLU A 226      33.598  31.161   0.515  1.00  0.89           O  
ATOM   1816  CB  GLU A 226      34.823  33.443   2.087  1.00  0.89           C  
ATOM   1817  CG  GLU A 226      35.891  34.440   2.621  1.00  0.89           C  
ATOM   1818  CD  GLU A 226      35.461  35.903   2.602  1.00  0.89           C  
ATOM   1819  OE1 GLU A 226      34.382  36.199   2.031  1.00  0.89           O  
ATOM   1820  OE2 GLU A 226      36.196  36.742   3.181  1.00  0.89           O  
ATOM   1821  N   TRP A 227      32.614  32.884  -0.521  1.00  0.90           N  
ATOM   1822  CA  TRP A 227      31.429  32.119  -0.899  1.00  0.90           C  
ATOM   1823  C   TRP A 227      31.736  30.999  -1.892  1.00  0.90           C  
ATOM   1824  O   TRP A 227      31.296  29.861  -1.735  1.00  0.90           O  
ATOM   1825  CB  TRP A 227      30.323  33.060  -1.457  1.00  0.90           C  
ATOM   1826  CG  TRP A 227      29.079  32.396  -2.023  1.00  0.90           C  
ATOM   1827  CD1 TRP A 227      28.621  32.445  -3.311  1.00  0.90           C  
ATOM   1828  CD2 TRP A 227      28.208  31.473  -1.328  1.00  0.90           C  
ATOM   1829  NE1 TRP A 227      27.518  31.634  -3.464  1.00  0.90           N  
ATOM   1830  CE2 TRP A 227      27.273  31.015  -2.260  1.00  0.90           C  
ATOM   1831  CE3 TRP A 227      28.202  31.016  -0.007  1.00  0.90           C  
ATOM   1832  CZ2 TRP A 227      26.305  30.075  -1.917  1.00  0.90           C  
ATOM   1833  CZ3 TRP A 227      27.233  30.059   0.341  1.00  0.90           C  
ATOM   1834  CH2 TRP A 227      26.313  29.582  -0.603  1.00  0.90           C  
ATOM   1835  N   GLN A 228      32.555  31.284  -2.925  1.00  0.79           N  
ATOM   1836  CA  GLN A 228      32.969  30.297  -3.917  1.00  0.79           C  
ATOM   1837  C   GLN A 228      33.797  29.161  -3.316  1.00  0.79           C  
ATOM   1838  O   GLN A 228      33.650  27.996  -3.689  1.00  0.79           O  
ATOM   1839  CB  GLN A 228      33.732  30.949  -5.098  1.00  0.79           C  
ATOM   1840  CG  GLN A 228      33.944  30.015  -6.322  1.00  0.79           C  
ATOM   1841  CD  GLN A 228      32.616  29.659  -6.997  1.00  0.79           C  
ATOM   1842  OE1 GLN A 228      31.838  30.533  -7.378  1.00  0.79           O  
ATOM   1843  NE2 GLN A 228      32.324  28.349  -7.168  1.00  0.79           N  
ATOM   1844  N   ALA A 229      34.664  29.489  -2.330  1.00  0.86           N  
ATOM   1845  CA  ALA A 229      35.380  28.542  -1.492  1.00  0.86           C  
ATOM   1846  C   ALA A 229      34.454  27.664  -0.647  1.00  0.86           C  
ATOM   1847  O   ALA A 229      34.615  26.447  -0.588  1.00  0.86           O  
ATOM   1848  CB  ALA A 229      36.376  29.291  -0.583  1.00  0.86           C  
ATOM   1849  N   PHE A 230      33.403  28.247  -0.026  1.00  0.93           N  
ATOM   1850  CA  PHE A 230      32.363  27.494   0.666  1.00  0.93           C  
ATOM   1851  C   PHE A 230      31.635  26.509  -0.246  1.00  0.93           C  
ATOM   1852  O   PHE A 230      31.412  25.369   0.145  1.00  0.93           O  
ATOM   1853  CB  PHE A 230      31.351  28.453   1.357  1.00  0.93           C  
ATOM   1854  CG  PHE A 230      30.286  27.706   2.129  1.00  0.93           C  
ATOM   1855  CD1 PHE A 230      30.529  27.214   3.422  1.00  0.93           C  
ATOM   1856  CD2 PHE A 230      29.047  27.433   1.523  1.00  0.93           C  
ATOM   1857  CE1 PHE A 230      29.549  26.474   4.097  1.00  0.93           C  
ATOM   1858  CE2 PHE A 230      28.063  26.696   2.194  1.00  0.93           C  
ATOM   1859  CZ  PHE A 230      28.314  26.221   3.486  1.00  0.93           C  
ATOM   1860  N   LEU A 231      31.288  26.895  -1.491  1.00  0.90           N  
ATOM   1861  CA  LEU A 231      30.641  26.007  -2.447  1.00  0.90           C  
ATOM   1862  C   LEU A 231      31.455  24.750  -2.763  1.00  0.90           C  
ATOM   1863  O   LEU A 231      30.935  23.634  -2.735  1.00  0.90           O  
ATOM   1864  CB  LEU A 231      30.344  26.766  -3.769  1.00  0.90           C  
ATOM   1865  CG  LEU A 231      29.208  27.808  -3.681  1.00  0.90           C  
ATOM   1866  CD1 LEU A 231      29.127  28.628  -4.977  1.00  0.90           C  
ATOM   1867  CD2 LEU A 231      27.856  27.134  -3.426  1.00  0.90           C  
ATOM   1868  N   GLN A 232      32.780  24.862  -3.016  1.00  0.83           N  
ATOM   1869  CA  GLN A 232      33.609  23.664  -3.144  1.00  0.83           C  
ATOM   1870  C   GLN A 232      33.737  22.863  -1.843  1.00  0.83           C  
ATOM   1871  O   GLN A 232      33.571  21.643  -1.850  1.00  0.83           O  
ATOM   1872  CB  GLN A 232      35.006  23.897  -3.795  1.00  0.83           C  
ATOM   1873  CG  GLN A 232      35.429  25.376  -3.920  1.00  0.83           C  
ATOM   1874  CD  GLN A 232      36.942  25.547  -4.066  1.00  0.83           C  
ATOM   1875  OE1 GLN A 232      37.593  26.040  -3.146  1.00  0.83           O  
ATOM   1876  NE2 GLN A 232      37.514  25.154  -5.224  1.00  0.83           N  
ATOM   1877  N   LEU A 233      33.965  23.521  -0.682  1.00  0.93           N  
ATOM   1878  CA  LEU A 233      34.057  22.852   0.609  1.00  0.93           C  
ATOM   1879  C   LEU A 233      32.783  22.106   1.012  1.00  0.93           C  
ATOM   1880  O   LEU A 233      32.849  20.966   1.465  1.00  0.93           O  
ATOM   1881  CB  LEU A 233      34.388  23.859   1.744  1.00  0.93           C  
ATOM   1882  CG  LEU A 233      35.806  24.470   1.727  1.00  0.93           C  
ATOM   1883  CD1 LEU A 233      35.854  25.702   2.645  1.00  0.93           C  
ATOM   1884  CD2 LEU A 233      36.883  23.460   2.152  1.00  0.93           C  
ATOM   1885  N   ASN A 234      31.588  22.713   0.829  1.00  0.94           N  
ATOM   1886  CA  ASN A 234      30.287  22.144   1.158  1.00  0.94           C  
ATOM   1887  C   ASN A 234      30.019  20.875   0.356  1.00  0.94           C  
ATOM   1888  O   ASN A 234      29.671  19.831   0.908  1.00  0.94           O  
ATOM   1889  CB  ASN A 234      29.186  23.221   0.906  1.00  0.94           C  
ATOM   1890  CG  ASN A 234      27.836  22.861   1.524  1.00  0.94           C  
ATOM   1891  OD1 ASN A 234      27.758  22.269   2.605  1.00  0.94           O  
ATOM   1892  ND2 ASN A 234      26.732  23.247   0.846  1.00  0.94           N  
ATOM   1893  N   GLN A 235      30.295  20.930  -0.964  1.00  0.88           N  
ATOM   1894  CA  GLN A 235      30.223  19.808  -1.886  1.00  0.88           C  
ATOM   1895  C   GLN A 235      31.143  18.655  -1.489  1.00  0.88           C  
ATOM   1896  O   GLN A 235      30.768  17.483  -1.491  1.00  0.88           O  
ATOM   1897  CB  GLN A 235      30.677  20.324  -3.279  1.00  0.88           C  
ATOM   1898  CG  GLN A 235      30.556  19.310  -4.448  1.00  0.88           C  
ATOM   1899  CD  GLN A 235      31.263  19.748  -5.739  1.00  0.88           C  
ATOM   1900  OE1 GLN A 235      31.139  19.103  -6.779  1.00  0.88           O  
ATOM   1901  NE2 GLN A 235      32.043  20.850  -5.690  1.00  0.88           N  
ATOM   1902  N   ALA A 236      32.392  18.987  -1.111  1.00  0.93           N  
ATOM   1903  CA  ALA A 236      33.416  18.039  -0.753  1.00  0.93           C  
ATOM   1904  C   ALA A 236      33.292  17.450   0.649  1.00  0.93           C  
ATOM   1905  O   ALA A 236      33.856  16.390   0.919  1.00  0.93           O  
ATOM   1906  CB  ALA A 236      34.766  18.769  -0.861  1.00  0.93           C  
ATOM   1907  N   ASN A 237      32.590  18.109   1.587  1.00  0.93           N  
ATOM   1908  CA  ASN A 237      32.480  17.636   2.959  1.00  0.93           C  
ATOM   1909  C   ASN A 237      31.127  17.042   3.283  1.00  0.93           C  
ATOM   1910  O   ASN A 237      31.047  16.172   4.150  1.00  0.93           O  
ATOM   1911  CB  ASN A 237      32.783  18.782   3.954  1.00  0.93           C  
ATOM   1912  CG  ASN A 237      34.284  18.811   4.190  1.00  0.93           C  
ATOM   1913  OD1 ASN A 237      35.116  18.715   3.286  1.00  0.93           O  
ATOM   1914  ND2 ASN A 237      34.683  18.878   5.480  1.00  0.93           N  
ATOM   1915  N   ARG A 238      30.054  17.461   2.585  1.00  0.87           N  
ATOM   1916  CA  ARG A 238      28.706  16.932   2.719  1.00  0.87           C  
ATOM   1917  C   ARG A 238      28.139  16.930   4.134  1.00  0.87           C  
ATOM   1918  O   ARG A 238      27.503  15.966   4.561  1.00  0.87           O  
ATOM   1919  CB  ARG A 238      28.562  15.472   2.217  1.00  0.87           C  
ATOM   1920  CG  ARG A 238      29.073  15.141   0.801  1.00  0.87           C  
ATOM   1921  CD  ARG A 238      29.103  13.634   0.467  1.00  0.87           C  
ATOM   1922  NE  ARG A 238      28.162  12.905   1.394  1.00  0.87           N  
ATOM   1923  CZ  ARG A 238      27.029  12.275   1.062  1.00  0.87           C  
ATOM   1924  NH1 ARG A 238      26.540  12.287  -0.169  1.00  0.87           N  
ATOM   1925  NH2 ARG A 238      26.350  11.631   2.011  1.00  0.87           N  
ATOM   1926  N   ALA A 239      28.371  17.981   4.930  1.00  0.96           N  
ATOM   1927  CA  ALA A 239      28.147  17.856   6.347  1.00  0.96           C  
ATOM   1928  C   ALA A 239      26.744  18.326   6.747  1.00  0.96           C  
ATOM   1929  O   ALA A 239      26.289  19.348   6.233  1.00  0.96           O  
ATOM   1930  CB  ALA A 239      29.261  18.596   7.083  1.00  0.96           C  
ATOM   1931  N   PRO A 240      25.990  17.636   7.610  1.00  0.97           N  
ATOM   1932  CA  PRO A 240      24.565  17.922   7.770  1.00  0.97           C  
ATOM   1933  C   PRO A 240      24.263  19.194   8.544  1.00  0.97           C  
ATOM   1934  O   PRO A 240      23.098  19.569   8.604  1.00  0.97           O  
ATOM   1935  CB  PRO A 240      24.001  16.668   8.478  1.00  0.97           C  
ATOM   1936  CG  PRO A 240      25.220  15.972   9.085  1.00  0.97           C  
ATOM   1937  CD  PRO A 240      26.306  16.283   8.065  1.00  0.97           C  
ATOM   1938  N   PHE A 241      25.262  19.863   9.152  1.00  0.96           N  
ATOM   1939  CA  PHE A 241      25.044  21.050   9.961  1.00  0.96           C  
ATOM   1940  C   PHE A 241      25.960  22.172   9.485  1.00  0.96           C  
ATOM   1941  O   PHE A 241      26.358  23.061  10.244  1.00  0.96           O  
ATOM   1942  CB  PHE A 241      25.234  20.746  11.476  1.00  0.96           C  
ATOM   1943  CG  PHE A 241      24.112  19.852  11.927  1.00  0.96           C  
ATOM   1944  CD1 PHE A 241      24.245  18.455  11.881  1.00  0.96           C  
ATOM   1945  CD2 PHE A 241      22.868  20.405  12.274  1.00  0.96           C  
ATOM   1946  CE1 PHE A 241      23.134  17.625  12.078  1.00  0.96           C  
ATOM   1947  CE2 PHE A 241      21.759  19.581  12.497  1.00  0.96           C  
ATOM   1948  CZ  PHE A 241      21.888  18.192  12.368  1.00  0.96           C  
ATOM   1949  N   SER A 242      26.312  22.151   8.179  1.00  0.99           N  
ATOM   1950  CA  SER A 242      27.056  23.198   7.491  1.00  0.99           C  
ATOM   1951  C   SER A 242      26.368  24.554   7.503  1.00  0.99           C  
ATOM   1952  O   SER A 242      25.145  24.680   7.529  1.00  0.99           O  
ATOM   1953  CB  SER A 242      27.349  22.906   5.992  1.00  0.99           C  
ATOM   1954  OG  SER A 242      28.199  21.778   5.805  1.00  0.99           O  
ATOM   1955  N   ALA A 243      27.152  25.643   7.465  1.00  1.00           N  
ATOM   1956  CA  ALA A 243      26.589  26.972   7.439  1.00  1.00           C  
ATOM   1957  C   ALA A 243      27.559  27.963   6.826  1.00  1.00           C  
ATOM   1958  O   ALA A 243      28.775  27.813   6.925  1.00  1.00           O  
ATOM   1959  CB  ALA A 243      26.209  27.452   8.859  1.00  1.00           C  
ATOM   1960  N   PHE A 244      27.021  29.028   6.208  1.00  0.97           N  
ATOM   1961  CA  PHE A 244      27.786  30.178   5.771  1.00  0.97           C  
ATOM   1962  C   PHE A 244      27.146  31.388   6.418  1.00  0.97           C  
ATOM   1963  O   PHE A 244      25.957  31.648   6.234  1.00  0.97           O  
ATOM   1964  CB  PHE A 244      27.774  30.340   4.226  1.00  0.97           C  
ATOM   1965  CG  PHE A 244      28.696  31.447   3.763  1.00  0.97           C  
ATOM   1966  CD1 PHE A 244      28.247  32.774   3.635  1.00  0.97           C  
ATOM   1967  CD2 PHE A 244      30.031  31.157   3.451  1.00  0.97           C  
ATOM   1968  CE1 PHE A 244      29.107  33.780   3.171  1.00  0.97           C  
ATOM   1969  CE2 PHE A 244      30.892  32.154   2.974  1.00  0.97           C  
ATOM   1970  CZ  PHE A 244      30.428  33.466   2.830  1.00  0.97           C  
ATOM   1971  N   LEU A 245      27.922  32.166   7.190  1.00  0.98           N  
ATOM   1972  CA  LEU A 245      27.429  33.384   7.800  1.00  0.98           C  
ATOM   1973  C   LEU A 245      28.250  34.535   7.275  1.00  0.98           C  
ATOM   1974  O   LEU A 245      29.470  34.551   7.439  1.00  0.98           O  
ATOM   1975  CB  LEU A 245      27.586  33.399   9.344  1.00  0.98           C  
ATOM   1976  CG  LEU A 245      27.054  32.163  10.095  1.00  0.98           C  
ATOM   1977  CD1 LEU A 245      27.275  32.364  11.598  1.00  0.98           C  
ATOM   1978  CD2 LEU A 245      25.572  31.862   9.839  1.00  0.98           C  
ATOM   1979  N   ARG A 246      27.612  35.549   6.661  1.00  0.90           N  
ATOM   1980  CA  ARG A 246      28.285  36.799   6.376  1.00  0.90           C  
ATOM   1981  C   ARG A 246      27.966  37.771   7.496  1.00  0.90           C  
ATOM   1982  O   ARG A 246      26.849  38.265   7.640  1.00  0.90           O  
ATOM   1983  CB  ARG A 246      27.847  37.386   5.015  1.00  0.90           C  
ATOM   1984  CG  ARG A 246      28.594  38.676   4.589  1.00  0.90           C  
ATOM   1985  CD  ARG A 246      30.089  38.535   4.251  1.00  0.90           C  
ATOM   1986  NE  ARG A 246      30.174  37.694   3.016  1.00  0.90           N  
ATOM   1987  CZ  ARG A 246      31.289  37.456   2.309  1.00  0.90           C  
ATOM   1988  NH1 ARG A 246      32.491  37.810   2.731  1.00  0.90           N  
ATOM   1989  NH2 ARG A 246      31.188  36.830   1.139  1.00  0.90           N  
ATOM   1990  N   LEU A 247      28.959  38.059   8.345  1.00  0.97           N  
ATOM   1991  CA  LEU A 247      28.820  38.928   9.487  1.00  0.97           C  
ATOM   1992  C   LEU A 247      29.452  40.256   9.119  1.00  0.97           C  
ATOM   1993  O   LEU A 247      30.128  40.383   8.100  1.00  0.97           O  
ATOM   1994  CB  LEU A 247      29.504  38.314  10.740  1.00  0.97           C  
ATOM   1995  CG  LEU A 247      29.011  36.894  11.107  1.00  0.97           C  
ATOM   1996  CD1 LEU A 247      29.843  36.320  12.263  1.00  0.97           C  
ATOM   1997  CD2 LEU A 247      27.518  36.858  11.471  1.00  0.97           C  
ATOM   1998  N   GLU A 248      29.238  41.305   9.929  1.00  0.94           N  
ATOM   1999  CA  GLU A 248      29.831  42.615   9.717  1.00  0.94           C  
ATOM   2000  C   GLU A 248      31.359  42.598   9.801  1.00  0.94           C  
ATOM   2001  O   GLU A 248      32.058  43.329   9.105  1.00  0.94           O  
ATOM   2002  CB  GLU A 248      29.268  43.608  10.761  1.00  0.94           C  
ATOM   2003  CG  GLU A 248      27.724  43.721  10.752  1.00  0.94           C  
ATOM   2004  CD  GLU A 248      27.179  44.597  11.880  1.00  0.94           C  
ATOM   2005  OE1 GLU A 248      27.740  44.554  13.007  1.00  0.94           O  
ATOM   2006  OE2 GLU A 248      26.135  45.253  11.627  1.00  0.94           O  
ATOM   2007  N   GLN A 249      31.911  41.732  10.673  1.00  0.94           N  
ATOM   2008  CA  GLN A 249      33.324  41.659  10.981  1.00  0.94           C  
ATOM   2009  C   GLN A 249      34.074  40.617  10.155  1.00  0.94           C  
ATOM   2010  O   GLN A 249      35.287  40.482  10.273  1.00  0.94           O  
ATOM   2011  CB  GLN A 249      33.506  41.274  12.479  1.00  0.94           C  
ATOM   2012  CG  GLN A 249      32.828  42.235  13.494  1.00  0.94           C  
ATOM   2013  CD  GLN A 249      31.311  42.039  13.631  1.00  0.94           C  
ATOM   2014  OE1 GLN A 249      30.733  41.041  13.196  1.00  0.94           O  
ATOM   2015  NE2 GLN A 249      30.643  43.040  14.248  1.00  0.94           N  
ATOM   2016  N   GLY A 250      33.384  39.849   9.287  1.00  0.99           N  
ATOM   2017  CA  GLY A 250      34.010  38.767   8.532  1.00  0.99           C  
ATOM   2018  C   GLY A 250      33.022  37.699   8.163  1.00  0.99           C  
ATOM   2019  O   GLY A 250      31.811  37.898   8.212  1.00  0.99           O  
ATOM   2020  N   ALA A 251      33.509  36.514   7.765  1.00  0.99           N  
ATOM   2021  CA  ALA A 251      32.649  35.411   7.394  1.00  0.99           C  
ATOM   2022  C   ALA A 251      33.025  34.126   8.113  1.00  0.99           C  
ATOM   2023  O   ALA A 251      34.182  33.868   8.448  1.00  0.99           O  
ATOM   2024  CB  ALA A 251      32.622  35.212   5.863  1.00  0.99           C  
ATOM   2025  N   ILE A 252      32.004  33.290   8.380  1.00  0.98           N  
ATOM   2026  CA  ILE A 252      32.143  32.009   9.053  1.00  0.98           C  
ATOM   2027  C   ILE A 252      31.736  30.939   8.066  1.00  0.98           C  
ATOM   2028  O   ILE A 252      30.619  30.945   7.547  1.00  0.98           O  
ATOM   2029  CB  ILE A 252      31.276  31.884  10.310  1.00  0.98           C  
ATOM   2030  CG1 ILE A 252      31.551  33.032  11.315  1.00  0.98           C  
ATOM   2031  CG2 ILE A 252      31.493  30.494  10.957  1.00  0.98           C  
ATOM   2032  CD1 ILE A 252      32.989  33.082  11.843  1.00  0.98           C  
ATOM   2033  N   LEU A 253      32.653  29.997   7.777  1.00  0.98           N  
ATOM   2034  CA  LEU A 253      32.439  28.904   6.850  1.00  0.98           C  
ATOM   2035  C   LEU A 253      32.440  27.636   7.685  1.00  0.98           C  
ATOM   2036  O   LEU A 253      33.484  27.176   8.135  1.00  0.98           O  
ATOM   2037  CB  LEU A 253      33.588  28.793   5.802  1.00  0.98           C  
ATOM   2038  CG  LEU A 253      33.650  29.874   4.695  1.00  0.98           C  
ATOM   2039  CD1 LEU A 253      33.935  31.289   5.226  1.00  0.98           C  
ATOM   2040  CD2 LEU A 253      34.721  29.485   3.662  1.00  0.98           C  
ATOM   2041  N   SER A 254      31.265  27.032   7.919  1.00  1.00           N  
ATOM   2042  CA  SER A 254      31.099  25.884   8.803  1.00  1.00           C  
ATOM   2043  C   SER A 254      30.777  24.672   7.974  1.00  1.00           C  
ATOM   2044  O   SER A 254      29.821  24.686   7.205  1.00  1.00           O  
ATOM   2045  CB  SER A 254      29.930  26.114   9.809  1.00  1.00           C  
ATOM   2046  OG  SER A 254      29.705  25.014  10.701  1.00  1.00           O  
ATOM   2047  N   LEU A 255      31.569  23.594   8.123  1.00  0.97           N  
ATOM   2048  CA  LEU A 255      31.371  22.315   7.468  1.00  0.97           C  
ATOM   2049  C   LEU A 255      31.106  21.274   8.546  1.00  0.97           C  
ATOM   2050  O   LEU A 255      31.531  20.120   8.453  1.00  0.97           O  
ATOM   2051  CB  LEU A 255      32.593  21.854   6.618  1.00  0.97           C  
ATOM   2052  CG  LEU A 255      33.031  22.768   5.447  1.00  0.97           C  
ATOM   2053  CD1 LEU A 255      31.845  23.254   4.600  1.00  0.97           C  
ATOM   2054  CD2 LEU A 255      33.929  23.935   5.890  1.00  0.97           C  
ATOM   2055  N   SER A 256      30.454  21.691   9.651  1.00  0.97           N  
ATOM   2056  CA  SER A 256      30.141  20.836  10.788  1.00  0.97           C  
ATOM   2057  C   SER A 256      29.214  19.652  10.494  1.00  0.97           C  
ATOM   2058  O   SER A 256      28.170  19.822   9.861  1.00  0.97           O  
ATOM   2059  CB  SER A 256      29.517  21.610  11.972  1.00  0.97           C  
ATOM   2060  OG  SER A 256      29.393  20.761  13.118  1.00  0.97           O  
ATOM   2061  N   PRO A 257      29.505  18.447  10.981  1.00  0.96           N  
ATOM   2062  CA  PRO A 257      28.553  17.349  10.952  1.00  0.96           C  
ATOM   2063  C   PRO A 257      27.916  17.177  12.323  1.00  0.96           C  
ATOM   2064  O   PRO A 257      27.128  16.249  12.497  1.00  0.96           O  
ATOM   2065  CB  PRO A 257      29.466  16.161  10.608  1.00  0.96           C  
ATOM   2066  CG  PRO A 257      30.768  16.465  11.356  1.00  0.96           C  
ATOM   2067  CD  PRO A 257      30.872  17.987  11.246  1.00  0.96           C  
ATOM   2068  N   GLU A 258      28.227  18.041  13.312  1.00  0.90           N  
ATOM   2069  CA  GLU A 258      27.840  17.837  14.697  1.00  0.90           C  
ATOM   2070  C   GLU A 258      26.652  18.691  15.065  1.00  0.90           C  
ATOM   2071  O   GLU A 258      26.712  19.922  15.083  1.00  0.90           O  
ATOM   2072  CB  GLU A 258      28.992  18.152  15.690  1.00  0.90           C  
ATOM   2073  CG  GLU A 258      28.738  17.661  17.147  1.00  0.90           C  
ATOM   2074  CD  GLU A 258      30.002  17.535  18.005  1.00  0.90           C  
ATOM   2075  OE1 GLU A 258      31.123  17.807  17.510  1.00  0.90           O  
ATOM   2076  OE2 GLU A 258      29.854  17.117  19.190  1.00  0.90           O  
ATOM   2077  N   ARG A 259      25.523  18.043  15.403  1.00  0.91           N  
ATOM   2078  CA  ARG A 259      24.419  18.707  16.059  1.00  0.91           C  
ATOM   2079  C   ARG A 259      24.711  18.846  17.537  1.00  0.91           C  
ATOM   2080  O   ARG A 259      25.041  17.880  18.221  1.00  0.91           O  
ATOM   2081  CB  ARG A 259      23.080  17.942  15.902  1.00  0.91           C  
ATOM   2082  CG  ARG A 259      21.910  18.539  16.718  1.00  0.91           C  
ATOM   2083  CD  ARG A 259      20.564  17.843  16.521  1.00  0.91           C  
ATOM   2084  NE  ARG A 259      19.891  18.472  15.338  1.00  0.91           N  
ATOM   2085  CZ  ARG A 259      19.074  17.855  14.478  1.00  0.91           C  
ATOM   2086  NH1 ARG A 259      18.912  16.539  14.499  1.00  0.91           N  
ATOM   2087  NH2 ARG A 259      18.404  18.561  13.578  1.00  0.91           N  
ATOM   2088  N   PHE A 260      24.530  20.065  18.065  1.00  0.94           N  
ATOM   2089  CA  PHE A 260      24.566  20.328  19.478  1.00  0.94           C  
ATOM   2090  C   PHE A 260      23.192  20.018  20.050  1.00  0.94           C  
ATOM   2091  O   PHE A 260      22.948  18.892  20.464  1.00  0.94           O  
ATOM   2092  CB  PHE A 260      25.046  21.777  19.745  1.00  0.94           C  
ATOM   2093  CG  PHE A 260      25.146  22.137  21.204  1.00  0.94           C  
ATOM   2094  CD1 PHE A 260      25.565  21.209  22.176  1.00  0.94           C  
ATOM   2095  CD2 PHE A 260      24.835  23.445  21.608  1.00  0.94           C  
ATOM   2096  CE1 PHE A 260      25.635  21.576  23.523  1.00  0.94           C  
ATOM   2097  CE2 PHE A 260      24.937  23.823  22.949  1.00  0.94           C  
ATOM   2098  CZ  PHE A 260      25.329  22.885  23.905  1.00  0.94           C  
ATOM   2099  N   ILE A 261      22.249  20.976  20.103  1.00  0.97           N  
ATOM   2100  CA  ILE A 261      20.943  20.723  20.692  1.00  0.97           C  
ATOM   2101  C   ILE A 261      19.845  21.082  19.711  1.00  0.97           C  
ATOM   2102  O   ILE A 261      19.668  22.235  19.320  1.00  0.97           O  
ATOM   2103  CB  ILE A 261      20.751  21.443  22.032  1.00  0.97           C  
ATOM   2104  CG1 ILE A 261      21.744  20.872  23.077  1.00  0.97           C  
ATOM   2105  CG2 ILE A 261      19.294  21.285  22.529  1.00  0.97           C  
ATOM   2106  CD1 ILE A 261      21.737  21.583  24.434  1.00  0.97           C  
ATOM   2107  N   LEU A 262      19.034  20.070  19.343  1.00  0.95           N  
ATOM   2108  CA  LEU A 262      17.736  20.256  18.732  1.00  0.95           C  
ATOM   2109  C   LEU A 262      16.730  20.381  19.851  1.00  0.95           C  
ATOM   2110  O   LEU A 262      16.760  19.613  20.811  1.00  0.95           O  
ATOM   2111  CB  LEU A 262      17.349  19.030  17.860  1.00  0.95           C  
ATOM   2112  CG  LEU A 262      15.948  19.017  17.208  1.00  0.95           C  
ATOM   2113  CD1 LEU A 262      15.818  20.079  16.108  1.00  0.95           C  
ATOM   2114  CD2 LEU A 262      15.634  17.629  16.626  1.00  0.95           C  
ATOM   2115  N   CYS A 263      15.820  21.359  19.749  1.00  0.97           N  
ATOM   2116  CA  CYS A 263      14.592  21.372  20.503  1.00  0.97           C  
ATOM   2117  C   CYS A 263      13.463  21.510  19.495  1.00  0.97           C  
ATOM   2118  O   CYS A 263      13.268  22.580  18.923  1.00  0.97           O  
ATOM   2119  CB  CYS A 263      14.557  22.524  21.538  1.00  0.97           C  
ATOM   2120  SG  CYS A 263      13.203  22.358  22.749  1.00  0.97           S  
ATOM   2121  N   ASP A 264      12.701  20.430  19.251  1.00  0.93           N  
ATOM   2122  CA  ASP A 264      11.640  20.394  18.265  1.00  0.93           C  
ATOM   2123  C   ASP A 264      10.370  20.089  19.031  1.00  0.93           C  
ATOM   2124  O   ASP A 264      10.230  19.016  19.612  1.00  0.93           O  
ATOM   2125  CB  ASP A 264      11.918  19.298  17.201  1.00  0.93           C  
ATOM   2126  CG  ASP A 264      10.990  19.390  15.995  1.00  0.93           C  
ATOM   2127  OD1 ASP A 264      10.097  20.281  15.967  1.00  0.93           O  
ATOM   2128  OD2 ASP A 264      11.198  18.572  15.063  1.00  0.93           O  
ATOM   2129  N   ASN A 265       9.432  21.057  19.119  1.00  0.91           N  
ATOM   2130  CA  ASN A 265       8.159  20.897  19.813  1.00  0.91           C  
ATOM   2131  C   ASN A 265       8.303  20.399  21.264  1.00  0.91           C  
ATOM   2132  O   ASN A 265       7.611  19.486  21.706  1.00  0.91           O  
ATOM   2133  CB  ASN A 265       7.239  19.978  18.963  1.00  0.91           C  
ATOM   2134  CG  ASN A 265       5.768  20.139  19.317  1.00  0.91           C  
ATOM   2135  OD1 ASN A 265       5.316  21.180  19.797  1.00  0.91           O  
ATOM   2136  ND2 ASN A 265       4.978  19.075  19.047  1.00  0.91           N  
ATOM   2137  N   SER A 266       9.279  20.972  22.001  1.00  0.92           N  
ATOM   2138  CA  SER A 266       9.664  20.600  23.365  1.00  0.92           C  
ATOM   2139  C   SER A 266      10.436  19.283  23.500  1.00  0.92           C  
ATOM   2140  O   SER A 266      10.904  18.952  24.587  1.00  0.92           O  
ATOM   2141  CB  SER A 266       8.515  20.666  24.418  1.00  0.92           C  
ATOM   2142  OG  SER A 266       8.047  22.008  24.570  1.00  0.92           O  
ATOM   2143  N   GLU A 267      10.678  18.525  22.408  1.00  0.90           N  
ATOM   2144  CA  GLU A 267      11.514  17.332  22.382  1.00  0.90           C  
ATOM   2145  C   GLU A 267      12.961  17.752  22.200  1.00  0.90           C  
ATOM   2146  O   GLU A 267      13.280  18.579  21.353  1.00  0.90           O  
ATOM   2147  CB  GLU A 267      10.983  16.324  21.311  1.00  0.90           C  
ATOM   2148  CG  GLU A 267      11.914  15.822  20.173  1.00  0.90           C  
ATOM   2149  CD  GLU A 267      12.929  14.797  20.664  1.00  0.90           C  
ATOM   2150  OE1 GLU A 267      14.128  14.926  20.315  1.00  0.90           O  
ATOM   2151  OE2 GLU A 267      12.502  13.858  21.389  1.00  0.90           O  
ATOM   2152  N   ILE A 268      13.867  17.254  23.063  1.00  0.93           N  
ATOM   2153  CA  ILE A 268      15.252  17.680  23.113  1.00  0.93           C  
ATOM   2154  C   ILE A 268      16.116  16.547  22.616  1.00  0.93           C  
ATOM   2155  O   ILE A 268      16.110  15.471  23.205  1.00  0.93           O  
ATOM   2156  CB  ILE A 268      15.701  17.994  24.544  1.00  0.93           C  
ATOM   2157  CG1 ILE A 268      14.875  19.158  25.136  1.00  0.93           C  
ATOM   2158  CG2 ILE A 268      17.228  18.271  24.600  1.00  0.93           C  
ATOM   2159  CD1 ILE A 268      15.193  19.404  26.617  1.00  0.93           C  
ATOM   2160  N   GLN A 269      16.943  16.779  21.577  1.00  0.88           N  
ATOM   2161  CA  GLN A 269      17.905  15.789  21.126  1.00  0.88           C  
ATOM   2162  C   GLN A 269      19.291  16.394  20.961  1.00  0.88           C  
ATOM   2163  O   GLN A 269      19.492  17.360  20.222  1.00  0.88           O  
ATOM   2164  CB  GLN A 269      17.493  15.162  19.770  1.00  0.88           C  
ATOM   2165  CG  GLN A 269      18.355  13.934  19.353  1.00  0.88           C  
ATOM   2166  CD  GLN A 269      18.415  13.649  17.851  1.00  0.88           C  
ATOM   2167  OE1 GLN A 269      18.598  12.523  17.383  1.00  0.88           O  
ATOM   2168  NE2 GLN A 269      18.334  14.720  17.031  1.00  0.88           N  
ATOM   2169  N   THR A 270      20.302  15.790  21.617  1.00  0.92           N  
ATOM   2170  CA  THR A 270      21.714  16.140  21.465  1.00  0.92           C  
ATOM   2171  C   THR A 270      22.465  14.940  20.927  1.00  0.92           C  
ATOM   2172  O   THR A 270      22.124  13.793  21.216  1.00  0.92           O  
ATOM   2173  CB  THR A 270      22.363  16.711  22.736  1.00  0.92           C  
ATOM   2174  OG1 THR A 270      23.753  16.977  22.593  1.00  0.92           O  
ATOM   2175  CG2 THR A 270      22.234  15.770  23.931  1.00  0.92           C  
ATOM   2176  N   ARG A 271      23.480  15.177  20.065  1.00  0.82           N  
ATOM   2177  CA  ARG A 271      24.218  14.120  19.383  1.00  0.82           C  
ATOM   2178  C   ARG A 271      25.735  14.341  19.417  1.00  0.82           C  
ATOM   2179  O   ARG A 271      26.326  14.497  18.347  1.00  0.82           O  
ATOM   2180  CB  ARG A 271      23.786  13.965  17.898  1.00  0.82           C  
ATOM   2181  CG  ARG A 271      22.303  13.600  17.707  1.00  0.82           C  
ATOM   2182  CD  ARG A 271      21.955  13.177  16.278  1.00  0.82           C  
ATOM   2183  NE  ARG A 271      22.459  11.770  16.109  1.00  0.82           N  
ATOM   2184  CZ  ARG A 271      23.141  11.310  15.053  1.00  0.82           C  
ATOM   2185  NH1 ARG A 271      23.680  12.105  14.135  1.00  0.82           N  
ATOM   2186  NH2 ARG A 271      23.379  10.013  14.895  1.00  0.82           N  
ATOM   2187  N   PRO A 272      26.402  14.384  20.577  1.00  0.87           N  
ATOM   2188  CA  PRO A 272      27.849  14.595  20.683  1.00  0.87           C  
ATOM   2189  C   PRO A 272      28.739  13.652  19.873  1.00  0.87           C  
ATOM   2190  O   PRO A 272      28.595  12.428  19.953  1.00  0.87           O  
ATOM   2191  CB  PRO A 272      28.121  14.480  22.194  1.00  0.87           C  
ATOM   2192  CG  PRO A 272      27.026  13.542  22.700  1.00  0.87           C  
ATOM   2193  CD  PRO A 272      25.826  13.987  21.869  1.00  0.87           C  
ATOM   2194  N   ILE A 273      29.705  14.215  19.117  1.00  0.85           N  
ATOM   2195  CA  ILE A 273      30.700  13.449  18.376  1.00  0.85           C  
ATOM   2196  C   ILE A 273      31.975  13.250  19.190  1.00  0.85           C  
ATOM   2197  O   ILE A 273      32.677  14.192  19.574  1.00  0.85           O  
ATOM   2198  CB  ILE A 273      31.057  14.083  17.031  1.00  0.85           C  
ATOM   2199  CG1 ILE A 273      29.799  14.117  16.136  1.00  0.85           C  
ATOM   2200  CG2 ILE A 273      32.188  13.280  16.341  1.00  0.85           C  
ATOM   2201  CD1 ILE A 273      30.038  14.765  14.773  1.00  0.85           C  
ATOM   2202  N   LYS A 274      32.353  11.979  19.452  1.00  0.91           N  
ATOM   2203  CA  LYS A 274      33.633  11.684  20.072  1.00  0.91           C  
ATOM   2204  C   LYS A 274      34.217  10.358  19.652  1.00  0.91           C  
ATOM   2205  O   LYS A 274      33.555   9.330  19.728  1.00  0.91           O  
ATOM   2206  CB  LYS A 274      33.558  11.670  21.618  1.00  0.91           C  
ATOM   2207  CG  LYS A 274      33.968  12.985  22.285  1.00  0.91           C  
ATOM   2208  CD  LYS A 274      35.451  13.349  22.092  1.00  0.91           C  
ATOM   2209  CE  LYS A 274      35.773  14.774  22.532  1.00  0.91           C  
ATOM   2210  NZ  LYS A 274      35.485  15.713  21.430  1.00  0.91           N  
ATOM   2211  N   GLY A 275      35.516  10.384  19.283  1.00  0.91           N  
ATOM   2212  CA  GLY A 275      36.286   9.272  18.744  1.00  0.91           C  
ATOM   2213  C   GLY A 275      36.314   9.336  17.244  1.00  0.91           C  
ATOM   2214  O   GLY A 275      35.270   9.490  16.603  1.00  0.91           O  
ATOM   2215  N   THR A 276      37.508   9.223  16.632  1.00  0.91           N  
ATOM   2216  CA  THR A 276      37.635   9.206  15.180  1.00  0.91           C  
ATOM   2217  C   THR A 276      38.773   8.307  14.748  1.00  0.91           C  
ATOM   2218  O   THR A 276      39.756   8.135  15.458  1.00  0.91           O  
ATOM   2219  CB  THR A 276      37.836  10.558  14.463  1.00  0.91           C  
ATOM   2220  OG1 THR A 276      39.164  11.060  14.500  1.00  0.91           O  
ATOM   2221  CG2 THR A 276      36.863  11.656  14.948  1.00  0.91           C  
ATOM   2222  N   LEU A 277      38.677   7.767  13.523  1.00  0.84           N  
ATOM   2223  CA  LEU A 277      39.771   7.133  12.813  1.00  0.84           C  
ATOM   2224  C   LEU A 277      39.711   7.751  11.424  1.00  0.84           C  
ATOM   2225  O   LEU A 277      38.596   8.039  10.979  1.00  0.84           O  
ATOM   2226  CB  LEU A 277      39.562   5.593  12.702  1.00  0.84           C  
ATOM   2227  CG  LEU A 277      40.357   4.671  13.664  1.00  0.84           C  
ATOM   2228  CD1 LEU A 277      40.985   5.324  14.903  1.00  0.84           C  
ATOM   2229  CD2 LEU A 277      39.442   3.541  14.140  1.00  0.84           C  
ATOM   2230  N   PRO A 278      40.799   8.007  10.693  1.00  0.87           N  
ATOM   2231  CA  PRO A 278      40.735   8.444   9.299  1.00  0.87           C  
ATOM   2232  C   PRO A 278      39.956   7.499   8.389  1.00  0.87           C  
ATOM   2233  O   PRO A 278      39.687   6.354   8.755  1.00  0.87           O  
ATOM   2234  CB  PRO A 278      42.202   8.630   8.868  1.00  0.87           C  
ATOM   2235  CG  PRO A 278      43.080   7.952   9.933  1.00  0.87           C  
ATOM   2236  CD  PRO A 278      42.129   7.509  11.049  1.00  0.87           C  
ATOM   2237  N   ARG A 279      39.551   7.960   7.186  1.00  0.75           N  
ATOM   2238  CA  ARG A 279      38.823   7.147   6.223  1.00  0.75           C  
ATOM   2239  C   ARG A 279      39.664   6.035   5.595  1.00  0.75           C  
ATOM   2240  O   ARG A 279      40.107   6.093   4.449  1.00  0.75           O  
ATOM   2241  CB  ARG A 279      38.137   8.008   5.133  1.00  0.75           C  
ATOM   2242  CG  ARG A 279      37.265   7.187   4.151  1.00  0.75           C  
ATOM   2243  CD  ARG A 279      36.286   8.008   3.308  1.00  0.75           C  
ATOM   2244  NE  ARG A 279      37.085   9.017   2.544  1.00  0.75           N  
ATOM   2245  CZ  ARG A 279      37.685   8.815   1.364  1.00  0.75           C  
ATOM   2246  NH1 ARG A 279      38.444   9.785   0.862  1.00  0.75           N  
ATOM   2247  NH2 ARG A 279      37.567   7.680   0.686  1.00  0.75           N  
ATOM   2248  N   LEU A 280      39.870   4.957   6.364  1.00  0.44           N  
ATOM   2249  CA  LEU A 280      40.588   3.776   5.957  1.00  0.44           C  
ATOM   2250  C   LEU A 280      39.621   2.603   6.009  1.00  0.44           C  
ATOM   2251  O   LEU A 280      39.366   2.061   7.088  1.00  0.44           O  
ATOM   2252  CB  LEU A 280      41.745   3.533   6.960  1.00  0.44           C  
ATOM   2253  CG  LEU A 280      42.790   4.670   7.008  1.00  0.44           C  
ATOM   2254  CD1 LEU A 280      43.735   4.499   8.208  1.00  0.44           C  
ATOM   2255  CD2 LEU A 280      43.593   4.763   5.703  1.00  0.44           C  
ATOM   2256  N   PRO A 281      39.049   2.138   4.904  1.00  0.35           N  
ATOM   2257  CA  PRO A 281      38.062   1.076   5.001  1.00  0.35           C  
ATOM   2258  C   PRO A 281      38.709  -0.212   4.542  1.00  0.35           C  
ATOM   2259  O   PRO A 281      38.205  -0.843   3.620  1.00  0.35           O  
ATOM   2260  CB  PRO A 281      36.925   1.548   4.077  1.00  0.35           C  
ATOM   2261  CG  PRO A 281      37.632   2.361   2.990  1.00  0.35           C  
ATOM   2262  CD  PRO A 281      38.810   2.993   3.734  1.00  0.35           C  
ATOM   2263  N   ASP A 282      39.784  -0.637   5.235  1.00  0.33           N  
ATOM   2264  CA  ASP A 282      40.561  -1.824   4.934  1.00  0.33           C  
ATOM   2265  C   ASP A 282      40.225  -2.932   5.951  1.00  0.33           C  
ATOM   2266  O   ASP A 282      40.618  -2.811   7.113  1.00  0.33           O  
ATOM   2267  CB  ASP A 282      42.054  -1.407   5.026  1.00  0.33           C  
ATOM   2268  CG  ASP A 282      42.984  -2.431   4.398  1.00  0.33           C  
ATOM   2269  OD1 ASP A 282      42.470  -3.409   3.802  1.00  0.33           O  
ATOM   2270  OD2 ASP A 282      44.218  -2.209   4.486  1.00  0.33           O  
ATOM   2271  N   PRO A 283      39.457  -3.988   5.655  1.00  0.40           N  
ATOM   2272  CA  PRO A 283      39.047  -4.961   6.662  1.00  0.40           C  
ATOM   2273  C   PRO A 283      40.163  -5.846   7.165  1.00  0.40           C  
ATOM   2274  O   PRO A 283      40.972  -6.332   6.387  1.00  0.40           O  
ATOM   2275  CB  PRO A 283      37.987  -5.821   5.955  1.00  0.40           C  
ATOM   2276  CG  PRO A 283      37.406  -4.890   4.893  1.00  0.40           C  
ATOM   2277  CD  PRO A 283      38.634  -4.091   4.452  1.00  0.40           C  
ATOM   2278  N   GLN A 284      40.183  -6.116   8.477  1.00  0.38           N  
ATOM   2279  CA  GLN A 284      41.185  -6.955   9.079  1.00  0.38           C  
ATOM   2280  C   GLN A 284      40.489  -8.088   9.816  1.00  0.38           C  
ATOM   2281  O   GLN A 284      39.418  -7.901  10.398  1.00  0.38           O  
ATOM   2282  CB  GLN A 284      42.027  -6.163  10.103  1.00  0.38           C  
ATOM   2283  CG  GLN A 284      42.833  -4.964   9.553  1.00  0.38           C  
ATOM   2284  CD  GLN A 284      43.508  -4.221  10.710  1.00  0.38           C  
ATOM   2285  OE1 GLN A 284      43.240  -3.042  10.954  1.00  0.38           O  
ATOM   2286  NE2 GLN A 284      44.360  -4.931  11.486  1.00  0.38           N  
ATOM   2287  N   GLU A 285      41.082  -9.298   9.829  1.00  0.34           N  
ATOM   2288  CA  GLU A 285      40.622 -10.424  10.629  1.00  0.34           C  
ATOM   2289  C   GLU A 285      40.838 -10.207  12.121  1.00  0.34           C  
ATOM   2290  O   GLU A 285      40.014 -10.575  12.961  1.00  0.34           O  
ATOM   2291  CB  GLU A 285      41.299 -11.726  10.163  1.00  0.34           C  
ATOM   2292  CG  GLU A 285      40.967 -12.051   8.687  1.00  0.34           C  
ATOM   2293  CD  GLU A 285      41.635 -13.334   8.201  1.00  0.34           C  
ATOM   2294  OE1 GLU A 285      42.347 -13.986   9.006  1.00  0.34           O  
ATOM   2295  OE2 GLU A 285      41.429 -13.658   7.005  1.00  0.34           O  
ATOM   2296  N   ASP A 286      41.931  -9.506  12.481  1.00  0.42           N  
ATOM   2297  CA  ASP A 286      42.279  -9.116  13.826  1.00  0.42           C  
ATOM   2298  C   ASP A 286      41.683  -7.750  14.163  1.00  0.42           C  
ATOM   2299  O   ASP A 286      42.037  -7.111  15.149  1.00  0.42           O  
ATOM   2300  CB  ASP A 286      43.821  -9.160  14.043  1.00  0.42           C  
ATOM   2301  CG  ASP A 286      44.636  -8.297  13.087  1.00  0.42           C  
ATOM   2302  OD1 ASP A 286      44.054  -7.723  12.132  1.00  0.42           O  
ATOM   2303  OD2 ASP A 286      45.868  -8.221  13.305  1.00  0.42           O  
ATOM   2304  N   SER A 287      40.659  -7.294  13.401  1.00  0.44           N  
ATOM   2305  CA  SER A 287      39.939  -6.045  13.656  1.00  0.44           C  
ATOM   2306  C   SER A 287      39.316  -6.008  15.049  1.00  0.44           C  
ATOM   2307  O   SER A 287      39.221  -4.953  15.677  1.00  0.44           O  
ATOM   2308  CB  SER A 287      38.871  -5.703  12.576  1.00  0.44           C  
ATOM   2309  OG  SER A 287      37.819  -6.668  12.492  1.00  0.44           O  
ATOM   2310  N   LYS A 288      38.972  -7.211  15.574  1.00  0.35           N  
ATOM   2311  CA  LYS A 288      38.593  -7.548  16.942  1.00  0.35           C  
ATOM   2312  C   LYS A 288      39.565  -7.126  18.048  1.00  0.35           C  
ATOM   2313  O   LYS A 288      39.219  -7.171  19.223  1.00  0.35           O  
ATOM   2314  CB  LYS A 288      38.346  -9.074  17.070  1.00  0.35           C  
ATOM   2315  CG  LYS A 288      37.263  -9.604  16.115  1.00  0.35           C  
ATOM   2316  CD  LYS A 288      36.974 -11.095  16.355  1.00  0.35           C  
ATOM   2317  CE  LYS A 288      35.944 -11.681  15.384  1.00  0.35           C  
ATOM   2318  NZ  LYS A 288      35.760 -13.124  15.661  1.00  0.35           N  
ATOM   2319  N   GLN A 289      40.773  -6.636  17.697  1.00  0.34           N  
ATOM   2320  CA  GLN A 289      41.683  -5.940  18.591  1.00  0.34           C  
ATOM   2321  C   GLN A 289      41.223  -4.532  18.945  1.00  0.34           C  
ATOM   2322  O   GLN A 289      41.785  -3.930  19.855  1.00  0.34           O  
ATOM   2323  CB  GLN A 289      43.074  -5.770  17.939  1.00  0.34           C  
ATOM   2324  CG  GLN A 289      43.882  -7.075  17.795  1.00  0.34           C  
ATOM   2325  CD  GLN A 289      45.199  -6.763  17.085  1.00  0.34           C  
ATOM   2326  OE1 GLN A 289      45.478  -5.631  16.692  1.00  0.34           O  
ATOM   2327  NE2 GLN A 289      46.049  -7.799  16.924  1.00  0.34           N  
ATOM   2328  N   ALA A 290      40.217  -3.995  18.211  1.00  0.39           N  
ATOM   2329  CA  ALA A 290      39.557  -2.722  18.447  1.00  0.39           C  
ATOM   2330  C   ALA A 290      40.130  -1.584  17.601  1.00  0.39           C  
ATOM   2331  O   ALA A 290      40.180  -0.434  18.029  1.00  0.39           O  
ATOM   2332  CB  ALA A 290      39.400  -2.365  19.946  1.00  0.39           C  
ATOM   2333  N   VAL A 291      40.561  -1.887  16.353  1.00  0.43           N  
ATOM   2334  CA  VAL A 291      41.130  -0.901  15.432  1.00  0.43           C  
ATOM   2335  C   VAL A 291      40.057  -0.354  14.491  1.00  0.43           C  
ATOM   2336  O   VAL A 291      39.321   0.557  14.843  1.00  0.43           O  
ATOM   2337  CB  VAL A 291      42.329  -1.456  14.657  1.00  0.43           C  
ATOM   2338  CG1 VAL A 291      43.000  -0.350  13.808  1.00  0.43           C  
ATOM   2339  CG2 VAL A 291      43.352  -2.012  15.668  1.00  0.43           C  
ATOM   2340  N   LYS A 292      39.898  -0.907  13.263  1.00  0.42           N  
ATOM   2341  CA  LYS A 292      38.889  -0.487  12.293  1.00  0.42           C  
ATOM   2342  C   LYS A 292      37.459  -0.664  12.776  1.00  0.42           C  
ATOM   2343  O   LYS A 292      36.540   0.070  12.411  1.00  0.42           O  
ATOM   2344  CB  LYS A 292      39.028  -1.298  10.984  1.00  0.42           C  
ATOM   2345  CG  LYS A 292      37.998  -0.920   9.901  1.00  0.42           C  
ATOM   2346  CD  LYS A 292      37.981  -1.955   8.782  1.00  0.42           C  
ATOM   2347  CE  LYS A 292      37.068  -1.609   7.609  1.00  0.42           C  
ATOM   2348  NZ  LYS A 292      35.647  -1.649   8.018  1.00  0.42           N  
ATOM   2349  N   LEU A 293      37.217  -1.697  13.596  1.00  0.39           N  
ATOM   2350  CA  LEU A 293      35.950  -1.851  14.263  1.00  0.39           C  
ATOM   2351  C   LEU A 293      35.595  -0.668  15.145  1.00  0.39           C  
ATOM   2352  O   LEU A 293      36.408  -0.192  15.929  1.00  0.39           O  
ATOM   2353  CB  LEU A 293      35.998  -3.035  15.253  1.00  0.39           C  
ATOM   2354  CG  LEU A 293      35.905  -4.448  14.673  1.00  0.39           C  
ATOM   2355  CD1 LEU A 293      35.878  -5.434  15.843  1.00  0.39           C  
ATOM   2356  CD2 LEU A 293      34.661  -4.698  13.819  1.00  0.39           C  
ATOM   2357  N   ALA A 294      34.308  -0.272  15.167  1.00  0.82           N  
ATOM   2358  CA  ALA A 294      33.786   0.666  16.146  1.00  0.82           C  
ATOM   2359  C   ALA A 294      33.575   0.011  17.518  1.00  0.82           C  
ATOM   2360  O   ALA A 294      32.606   0.229  18.239  1.00  0.82           O  
ATOM   2361  CB  ALA A 294      32.482   1.275  15.618  1.00  0.82           C  
ATOM   2362  N   ASN A 295      34.551  -0.830  17.891  1.00  0.66           N  
ATOM   2363  CA  ASN A 295      34.707  -1.537  19.131  1.00  0.66           C  
ATOM   2364  C   ASN A 295      35.964  -0.983  19.795  1.00  0.66           C  
ATOM   2365  O   ASN A 295      36.417  -1.506  20.808  1.00  0.66           O  
ATOM   2366  CB  ASN A 295      34.802  -3.064  18.909  1.00  0.66           C  
ATOM   2367  CG  ASN A 295      33.415  -3.592  18.551  1.00  0.66           C  
ATOM   2368  OD1 ASN A 295      32.673  -4.020  19.434  1.00  0.66           O  
ATOM   2369  ND2 ASN A 295      33.013  -3.547  17.262  1.00  0.66           N  
ATOM   2370  N   SER A 296      36.500   0.136  19.242  1.00  0.74           N  
ATOM   2371  CA  SER A 296      37.632   0.956  19.668  1.00  0.74           C  
ATOM   2372  C   SER A 296      37.543   1.400  21.114  1.00  0.74           C  
ATOM   2373  O   SER A 296      37.009   2.455  21.435  1.00  0.74           O  
ATOM   2374  CB  SER A 296      37.783   2.204  18.747  1.00  0.74           C  
ATOM   2375  OG  SER A 296      36.508   2.755  18.394  1.00  0.74           O  
ATOM   2376  N   ALA A 297      38.068   0.576  22.048  1.00  0.79           N  
ATOM   2377  CA  ALA A 297      37.761   0.624  23.467  1.00  0.79           C  
ATOM   2378  C   ALA A 297      38.019   1.954  24.159  1.00  0.79           C  
ATOM   2379  O   ALA A 297      37.237   2.379  25.002  1.00  0.79           O  
ATOM   2380  CB  ALA A 297      38.541  -0.504  24.171  1.00  0.79           C  
ATOM   2381  N   LYS A 298      39.109   2.650  23.788  1.00  0.71           N  
ATOM   2382  CA  LYS A 298      39.423   3.985  24.266  1.00  0.71           C  
ATOM   2383  C   LYS A 298      38.381   5.030  23.839  1.00  0.71           C  
ATOM   2384  O   LYS A 298      37.847   5.793  24.643  1.00  0.71           O  
ATOM   2385  CB  LYS A 298      40.835   4.346  23.721  1.00  0.71           C  
ATOM   2386  CG  LYS A 298      41.695   5.240  24.630  1.00  0.71           C  
ATOM   2387  CD  LYS A 298      41.224   6.684  24.883  1.00  0.71           C  
ATOM   2388  CE  LYS A 298      40.889   7.617  23.703  1.00  0.71           C  
ATOM   2389  NZ  LYS A 298      41.961   7.708  22.696  1.00  0.71           N  
ATOM   2390  N   ASP A 299      38.038   5.057  22.544  1.00  0.83           N  
ATOM   2391  CA  ASP A 299      37.104   5.958  21.908  1.00  0.83           C  
ATOM   2392  C   ASP A 299      35.667   5.773  22.368  1.00  0.83           C  
ATOM   2393  O   ASP A 299      34.985   6.722  22.755  1.00  0.83           O  
ATOM   2394  CB  ASP A 299      37.192   5.751  20.381  1.00  0.83           C  
ATOM   2395  CG  ASP A 299      38.614   6.012  19.909  1.00  0.83           C  
ATOM   2396  OD1 ASP A 299      38.771   6.968  19.117  1.00  0.83           O  
ATOM   2397  OD2 ASP A 299      39.545   5.267  20.329  1.00  0.83           O  
ATOM   2398  N   ARG A 300      35.171   4.520  22.440  1.00  0.76           N  
ATOM   2399  CA  ARG A 300      33.844   4.227  22.975  1.00  0.76           C  
ATOM   2400  C   ARG A 300      33.855   4.059  24.495  1.00  0.76           C  
ATOM   2401  O   ARG A 300      33.272   3.137  25.065  1.00  0.76           O  
ATOM   2402  CB  ARG A 300      33.140   3.040  22.275  1.00  0.76           C  
ATOM   2403  CG  ARG A 300      33.911   1.720  22.299  1.00  0.76           C  
ATOM   2404  CD  ARG A 300      33.252   0.572  21.528  1.00  0.76           C  
ATOM   2405  NE  ARG A 300      31.964  -0.013  22.058  1.00  0.76           N  
ATOM   2406  CZ  ARG A 300      31.536  -0.147  23.321  1.00  0.76           C  
ATOM   2407  NH1 ARG A 300      31.996   0.552  24.347  1.00  0.76           N  
ATOM   2408  NH2 ARG A 300      30.556  -1.024  23.556  1.00  0.76           N  
ATOM   2409  N   ALA A 301      34.514   5.021  25.154  1.00  0.83           N  
ATOM   2410  CA  ALA A 301      34.723   5.164  26.574  1.00  0.83           C  
ATOM   2411  C   ALA A 301      34.860   6.661  26.763  1.00  0.83           C  
ATOM   2412  O   ALA A 301      34.130   7.279  27.531  1.00  0.83           O  
ATOM   2413  CB  ALA A 301      35.966   4.395  27.063  1.00  0.83           C  
ATOM   2414  N   GLU A 302      35.735   7.295  25.955  1.00  0.81           N  
ATOM   2415  CA  GLU A 302      35.866   8.734  25.797  1.00  0.81           C  
ATOM   2416  C   GLU A 302      34.577   9.425  25.365  1.00  0.81           C  
ATOM   2417  O   GLU A 302      34.178  10.464  25.890  1.00  0.81           O  
ATOM   2418  CB  GLU A 302      36.940   8.976  24.729  1.00  0.81           C  
ATOM   2419  CG  GLU A 302      37.467  10.418  24.693  1.00  0.81           C  
ATOM   2420  CD  GLU A 302      38.830  10.393  24.036  1.00  0.81           C  
ATOM   2421  OE1 GLU A 302      38.918  10.005  22.846  1.00  0.81           O  
ATOM   2422  OE2 GLU A 302      39.801  10.654  24.783  1.00  0.81           O  
ATOM   2423  N   ASN A 303      33.856   8.785  24.420  1.00  0.85           N  
ATOM   2424  CA  ASN A 303      32.497   9.095  24.021  1.00  0.85           C  
ATOM   2425  C   ASN A 303      31.496   8.985  25.177  1.00  0.85           C  
ATOM   2426  O   ASN A 303      30.664   9.867  25.363  1.00  0.85           O  
ATOM   2427  CB  ASN A 303      32.122   8.161  22.833  1.00  0.85           C  
ATOM   2428  CG  ASN A 303      30.821   8.578  22.156  1.00  0.85           C  
ATOM   2429  OD1 ASN A 303      29.738   8.382  22.708  1.00  0.85           O  
ATOM   2430  ND2 ASN A 303      30.906   9.149  20.937  1.00  0.85           N  
ATOM   2431  N   LEU A 304      31.590   7.931  26.019  1.00  0.82           N  
ATOM   2432  CA  LEU A 304      30.712   7.709  27.163  1.00  0.82           C  
ATOM   2433  C   LEU A 304      30.811   8.825  28.211  1.00  0.82           C  
ATOM   2434  O   LEU A 304      29.806   9.329  28.703  1.00  0.82           O  
ATOM   2435  CB  LEU A 304      30.991   6.324  27.805  1.00  0.82           C  
ATOM   2436  CG  LEU A 304      29.758   5.591  28.392  1.00  0.82           C  
ATOM   2437  CD1 LEU A 304      30.209   4.323  29.131  1.00  0.82           C  
ATOM   2438  CD2 LEU A 304      28.879   6.433  29.329  1.00  0.82           C  
ATOM   2439  N   MET A 305      32.038   9.316  28.505  1.00  0.75           N  
ATOM   2440  CA  MET A 305      32.267  10.440  29.410  1.00  0.75           C  
ATOM   2441  C   MET A 305      31.508  11.695  28.989  1.00  0.75           C  
ATOM   2442  O   MET A 305      30.937  12.428  29.796  1.00  0.75           O  
ATOM   2443  CB  MET A 305      33.765  10.851  29.413  1.00  0.75           C  
ATOM   2444  CG  MET A 305      34.775   9.765  29.820  1.00  0.75           C  
ATOM   2445  SD  MET A 305      36.473  10.398  29.740  1.00  0.75           S  
ATOM   2446  CE  MET A 305      37.345   8.900  30.271  1.00  0.75           C  
ATOM   2447  N   ILE A 306      31.491  11.957  27.672  1.00  0.79           N  
ATOM   2448  CA  ILE A 306      30.723  13.024  27.062  1.00  0.79           C  
ATOM   2449  C   ILE A 306      29.226  12.776  27.086  1.00  0.79           C  
ATOM   2450  O   ILE A 306      28.451  13.699  27.321  1.00  0.79           O  
ATOM   2451  CB  ILE A 306      31.235  13.328  25.667  1.00  0.79           C  
ATOM   2452  CG1 ILE A 306      32.732  13.726  25.708  1.00  0.79           C  
ATOM   2453  CG2 ILE A 306      30.407  14.432  24.979  1.00  0.79           C  
ATOM   2454  CD1 ILE A 306      33.144  14.768  26.757  1.00  0.79           C  
ATOM   2455  N   VAL A 307      28.755  11.527  26.902  1.00  0.76           N  
ATOM   2456  CA  VAL A 307      27.348  11.181  27.079  1.00  0.76           C  
ATOM   2457  C   VAL A 307      26.851  11.498  28.485  1.00  0.76           C  
ATOM   2458  O   VAL A 307      25.797  12.108  28.652  1.00  0.76           O  
ATOM   2459  CB  VAL A 307      27.089   9.714  26.733  1.00  0.76           C  
ATOM   2460  CG1 VAL A 307      25.654   9.272  27.088  1.00  0.76           C  
ATOM   2461  CG2 VAL A 307      27.321   9.521  25.225  1.00  0.76           C  
ATOM   2462  N   ASP A 308      27.630  11.161  29.529  1.00  0.78           N  
ATOM   2463  CA  ASP A 308      27.346  11.478  30.920  1.00  0.78           C  
ATOM   2464  C   ASP A 308      27.349  12.966  31.206  1.00  0.78           C  
ATOM   2465  O   ASP A 308      26.470  13.493  31.892  1.00  0.78           O  
ATOM   2466  CB  ASP A 308      28.354  10.739  31.828  1.00  0.78           C  
ATOM   2467  CG  ASP A 308      28.101   9.248  31.733  1.00  0.78           C  
ATOM   2468  OD1 ASP A 308      27.044   8.859  31.164  1.00  0.78           O  
ATOM   2469  OD2 ASP A 308      28.927   8.469  32.259  1.00  0.78           O  
ATOM   2470  N   LEU A 309      28.314  13.699  30.625  1.00  0.77           N  
ATOM   2471  CA  LEU A 309      28.338  15.147  30.679  1.00  0.77           C  
ATOM   2472  C   LEU A 309      27.107  15.781  30.037  1.00  0.77           C  
ATOM   2473  O   LEU A 309      26.449  16.625  30.639  1.00  0.77           O  
ATOM   2474  CB  LEU A 309      29.628  15.658  30.003  1.00  0.77           C  
ATOM   2475  CG  LEU A 309      29.822  17.187  29.970  1.00  0.77           C  
ATOM   2476  CD1 LEU A 309      29.680  17.863  31.342  1.00  0.77           C  
ATOM   2477  CD2 LEU A 309      31.202  17.490  29.380  1.00  0.77           C  
ATOM   2478  N   MET A 310      26.705  15.324  28.832  1.00  0.81           N  
ATOM   2479  CA  MET A 310      25.482  15.763  28.186  1.00  0.81           C  
ATOM   2480  C   MET A 310      24.211  15.378  28.934  1.00  0.81           C  
ATOM   2481  O   MET A 310      23.284  16.184  29.000  1.00  0.81           O  
ATOM   2482  CB  MET A 310      25.395  15.333  26.700  1.00  0.81           C  
ATOM   2483  CG  MET A 310      26.478  15.940  25.773  1.00  0.81           C  
ATOM   2484  SD  MET A 310      26.863  17.711  26.000  1.00  0.81           S  
ATOM   2485  CE  MET A 310      25.212  18.406  25.710  1.00  0.81           C  
ATOM   2486  N   ARG A 311      24.147  14.177  29.565  1.00  0.73           N  
ATOM   2487  CA  ARG A 311      23.074  13.772  30.471  1.00  0.73           C  
ATOM   2488  C   ARG A 311      22.896  14.751  31.632  1.00  0.73           C  
ATOM   2489  O   ARG A 311      21.776  15.116  31.988  1.00  0.73           O  
ATOM   2490  CB  ARG A 311      23.298  12.356  31.100  1.00  0.73           C  
ATOM   2491  CG  ARG A 311      23.010  11.150  30.178  1.00  0.73           C  
ATOM   2492  CD  ARG A 311      22.837   9.813  30.931  1.00  0.73           C  
ATOM   2493  NE  ARG A 311      24.092   8.982  30.883  1.00  0.73           N  
ATOM   2494  CZ  ARG A 311      24.123   7.660  31.107  1.00  0.73           C  
ATOM   2495  NH1 ARG A 311      23.044   6.985  31.487  1.00  0.73           N  
ATOM   2496  NH2 ARG A 311      25.279   7.019  30.995  1.00  0.73           N  
ATOM   2497  N   ASN A 312      24.004  15.213  32.244  1.00  0.83           N  
ATOM   2498  CA  ASN A 312      23.975  16.247  33.261  1.00  0.83           C  
ATOM   2499  C   ASN A 312      23.626  17.643  32.726  1.00  0.83           C  
ATOM   2500  O   ASN A 312      22.780  18.330  33.297  1.00  0.83           O  
ATOM   2501  CB  ASN A 312      25.329  16.247  34.022  1.00  0.83           C  
ATOM   2502  CG  ASN A 312      25.210  16.921  35.385  1.00  0.83           C  
ATOM   2503  OD1 ASN A 312      25.829  17.945  35.670  1.00  0.83           O  
ATOM   2504  ND2 ASN A 312      24.389  16.321  36.278  1.00  0.83           N  
ATOM   2505  N   ASP A 313      24.228  18.082  31.597  1.00  0.90           N  
ATOM   2506  CA  ASP A 313      23.985  19.391  31.004  1.00  0.90           C  
ATOM   2507  C   ASP A 313      22.518  19.623  30.582  1.00  0.90           C  
ATOM   2508  O   ASP A 313      21.951  20.669  30.902  1.00  0.90           O  
ATOM   2509  CB  ASP A 313      24.941  19.633  29.788  1.00  0.90           C  
ATOM   2510  CG  ASP A 313      26.292  20.265  30.118  1.00  0.90           C  
ATOM   2511  OD1 ASP A 313      26.512  20.779  31.244  1.00  0.90           O  
ATOM   2512  OD2 ASP A 313      27.121  20.360  29.170  1.00  0.90           O  
ATOM   2513  N   ILE A 314      21.838  18.661  29.895  1.00  0.92           N  
ATOM   2514  CA  ILE A 314      20.407  18.803  29.573  1.00  0.92           C  
ATOM   2515  C   ILE A 314      19.490  18.563  30.769  1.00  0.92           C  
ATOM   2516  O   ILE A 314      18.442  19.195  30.899  1.00  0.92           O  
ATOM   2517  CB  ILE A 314      19.871  18.071  28.319  1.00  0.92           C  
ATOM   2518  CG1 ILE A 314      19.283  16.644  28.510  1.00  0.92           C  
ATOM   2519  CG2 ILE A 314      20.923  18.120  27.190  1.00  0.92           C  
ATOM   2520  CD1 ILE A 314      20.302  15.586  28.914  1.00  0.92           C  
ATOM   2521  N   GLY A 315      19.876  17.665  31.710  1.00  0.91           N  
ATOM   2522  CA  GLY A 315      19.052  17.203  32.835  1.00  0.91           C  
ATOM   2523  C   GLY A 315      18.939  18.196  33.961  1.00  0.91           C  
ATOM   2524  O   GLY A 315      18.200  18.007  34.919  1.00  0.91           O  
ATOM   2525  N   ARG A 316      19.672  19.307  33.824  1.00  0.85           N  
ATOM   2526  CA  ARG A 316      19.683  20.473  34.684  1.00  0.85           C  
ATOM   2527  C   ARG A 316      18.555  21.451  34.310  1.00  0.85           C  
ATOM   2528  O   ARG A 316      18.281  22.407  35.033  1.00  0.85           O  
ATOM   2529  CB  ARG A 316      21.118  21.083  34.558  1.00  0.85           C  
ATOM   2530  CG  ARG A 316      21.272  22.603  34.344  1.00  0.85           C  
ATOM   2531  CD  ARG A 316      22.610  22.969  33.686  1.00  0.85           C  
ATOM   2532  NE  ARG A 316      23.715  22.923  34.698  1.00  0.85           N  
ATOM   2533  CZ  ARG A 316      24.991  22.683  34.360  1.00  0.85           C  
ATOM   2534  NH1 ARG A 316      25.332  22.377  33.114  1.00  0.85           N  
ATOM   2535  NH2 ARG A 316      25.960  22.782  35.265  1.00  0.85           N  
ATOM   2536  N   VAL A 317      17.861  21.213  33.170  1.00  0.93           N  
ATOM   2537  CA  VAL A 317      16.714  22.000  32.702  1.00  0.93           C  
ATOM   2538  C   VAL A 317      15.554  21.111  32.250  1.00  0.93           C  
ATOM   2539  O   VAL A 317      14.394  21.511  32.316  1.00  0.93           O  
ATOM   2540  CB  VAL A 317      17.151  22.955  31.571  1.00  0.93           C  
ATOM   2541  CG1 VAL A 317      16.097  23.206  30.463  1.00  0.93           C  
ATOM   2542  CG2 VAL A 317      17.554  24.289  32.229  1.00  0.93           C  
ATOM   2543  N   ALA A 318      15.825  19.874  31.784  1.00  0.93           N  
ATOM   2544  CA  ALA A 318      14.844  18.894  31.349  1.00  0.93           C  
ATOM   2545  C   ALA A 318      13.749  18.481  32.344  1.00  0.93           C  
ATOM   2546  O   ALA A 318      13.865  18.606  33.560  1.00  0.93           O  
ATOM   2547  CB  ALA A 318      15.557  17.626  30.838  1.00  0.93           C  
ATOM   2548  N   VAL A 319      12.625  17.933  31.828  1.00  0.89           N  
ATOM   2549  CA  VAL A 319      11.602  17.270  32.636  1.00  0.89           C  
ATOM   2550  C   VAL A 319      12.171  16.078  33.418  1.00  0.89           C  
ATOM   2551  O   VAL A 319      12.898  15.260  32.858  1.00  0.89           O  
ATOM   2552  CB  VAL A 319      10.435  16.794  31.765  1.00  0.89           C  
ATOM   2553  CG1 VAL A 319       9.391  15.981  32.561  1.00  0.89           C  
ATOM   2554  CG2 VAL A 319       9.755  18.012  31.116  1.00  0.89           C  
ATOM   2555  N   ALA A 320      11.820  15.949  34.720  1.00  0.88           N  
ATOM   2556  CA  ALA A 320      12.418  15.100  35.749  1.00  0.88           C  
ATOM   2557  C   ALA A 320      13.052  13.740  35.366  1.00  0.88           C  
ATOM   2558  O   ALA A 320      14.221  13.489  35.642  1.00  0.88           O  
ATOM   2559  CB  ALA A 320      11.332  14.889  36.833  1.00  0.88           C  
ATOM   2560  N   GLY A 321      12.280  12.836  34.713  1.00  0.89           N  
ATOM   2561  CA  GLY A 321      12.679  11.491  34.268  1.00  0.89           C  
ATOM   2562  C   GLY A 321      12.758  11.351  32.762  1.00  0.89           C  
ATOM   2563  O   GLY A 321      12.622  10.263  32.200  1.00  0.89           O  
ATOM   2564  N   SER A 322      12.895  12.473  32.030  1.00  0.89           N  
ATOM   2565  CA  SER A 322      12.828  12.466  30.575  1.00  0.89           C  
ATOM   2566  C   SER A 322      14.114  12.086  29.877  1.00  0.89           C  
ATOM   2567  O   SER A 322      14.055  11.630  28.737  1.00  0.89           O  
ATOM   2568  CB  SER A 322      12.340  13.811  29.970  1.00  0.89           C  
ATOM   2569  OG  SER A 322      13.249  14.905  30.139  1.00  0.89           O  
ATOM   2570  N   VAL A 323      15.281  12.228  30.547  1.00  0.87           N  
ATOM   2571  CA  VAL A 323      16.597  11.949  29.981  1.00  0.87           C  
ATOM   2572  C   VAL A 323      16.786  10.472  29.682  1.00  0.87           C  
ATOM   2573  O   VAL A 323      16.715   9.611  30.557  1.00  0.87           O  
ATOM   2574  CB  VAL A 323      17.775  12.467  30.814  1.00  0.87           C  
ATOM   2575  CG1 VAL A 323      19.117  12.158  30.105  1.00  0.87           C  
ATOM   2576  CG2 VAL A 323      17.631  13.991  30.997  1.00  0.87           C  
ATOM   2577  N   LYS A 324      17.030  10.145  28.403  1.00  0.82           N  
ATOM   2578  CA  LYS A 324      17.227   8.788  27.951  1.00  0.82           C  
ATOM   2579  C   LYS A 324      18.380   8.795  26.971  1.00  0.82           C  
ATOM   2580  O   LYS A 324      18.657   9.801  26.320  1.00  0.82           O  
ATOM   2581  CB  LYS A 324      15.969   8.224  27.230  1.00  0.82           C  
ATOM   2582  CG  LYS A 324      14.687   8.275  28.080  1.00  0.82           C  
ATOM   2583  CD  LYS A 324      13.428   7.897  27.284  1.00  0.82           C  
ATOM   2584  CE  LYS A 324      12.222   8.784  27.616  1.00  0.82           C  
ATOM   2585  NZ  LYS A 324      11.794   8.573  29.017  1.00  0.82           N  
ATOM   2586  N   VAL A 325      19.080   7.657  26.825  1.00  0.85           N  
ATOM   2587  CA  VAL A 325      20.133   7.513  25.833  1.00  0.85           C  
ATOM   2588  C   VAL A 325      19.613   6.511  24.809  1.00  0.85           C  
ATOM   2589  O   VAL A 325      19.675   5.311  25.078  1.00  0.85           O  
ATOM   2590  CB  VAL A 325      21.448   7.024  26.455  1.00  0.85           C  
ATOM   2591  CG1 VAL A 325      22.584   7.078  25.413  1.00  0.85           C  
ATOM   2592  CG2 VAL A 325      21.817   7.908  27.667  1.00  0.85           C  
ATOM   2593  N   PRO A 326      19.071   6.904  23.651  1.00  0.74           N  
ATOM   2594  CA  PRO A 326      18.496   5.933  22.721  1.00  0.74           C  
ATOM   2595  C   PRO A 326      19.553   5.289  21.860  1.00  0.74           C  
ATOM   2596  O   PRO A 326      19.273   4.227  21.315  1.00  0.74           O  
ATOM   2597  CB  PRO A 326      17.521   6.758  21.854  1.00  0.74           C  
ATOM   2598  CG  PRO A 326      18.005   8.198  22.003  1.00  0.74           C  
ATOM   2599  CD  PRO A 326      18.470   8.227  23.452  1.00  0.74           C  
ATOM   2600  N   GLU A 327      20.731   5.918  21.698  1.00  0.71           N  
ATOM   2601  CA  GLU A 327      21.771   5.424  20.817  1.00  0.71           C  
ATOM   2602  C   GLU A 327      23.118   5.636  21.455  1.00  0.71           C  
ATOM   2603  O   GLU A 327      23.413   6.700  22.003  1.00  0.71           O  
ATOM   2604  CB  GLU A 327      21.772   6.130  19.432  1.00  0.71           C  
ATOM   2605  CG  GLU A 327      20.792   5.480  18.431  1.00  0.71           C  
ATOM   2606  CD  GLU A 327      21.411   4.247  17.774  1.00  0.71           C  
ATOM   2607  OE1 GLU A 327      21.966   3.388  18.504  1.00  0.71           O  
ATOM   2608  OE2 GLU A 327      21.362   4.192  16.519  1.00  0.71           O  
ATOM   2609  N   LEU A 328      23.975   4.610  21.371  1.00  0.74           N  
ATOM   2610  CA  LEU A 328      25.339   4.650  21.839  1.00  0.74           C  
ATOM   2611  C   LEU A 328      26.208   4.079  20.747  1.00  0.74           C  
ATOM   2612  O   LEU A 328      25.945   2.995  20.238  1.00  0.74           O  
ATOM   2613  CB  LEU A 328      25.579   3.787  23.105  1.00  0.74           C  
ATOM   2614  CG  LEU A 328      25.247   4.471  24.442  1.00  0.74           C  
ATOM   2615  CD1 LEU A 328      25.225   3.416  25.554  1.00  0.74           C  
ATOM   2616  CD2 LEU A 328      26.265   5.569  24.794  1.00  0.74           C  
ATOM   2617  N   PHE A 329      27.292   4.791  20.395  1.00  0.85           N  
ATOM   2618  CA  PHE A 329      28.417   4.219  19.670  1.00  0.85           C  
ATOM   2619  C   PHE A 329      28.142   3.861  18.210  1.00  0.85           C  
ATOM   2620  O   PHE A 329      28.627   2.856  17.692  1.00  0.85           O  
ATOM   2621  CB  PHE A 329      29.082   3.008  20.406  1.00  0.85           C  
ATOM   2622  CG  PHE A 329      29.345   3.266  21.870  1.00  0.85           C  
ATOM   2623  CD1 PHE A 329      29.863   4.487  22.342  1.00  0.85           C  
ATOM   2624  CD2 PHE A 329      29.036   2.260  22.801  1.00  0.85           C  
ATOM   2625  CE1 PHE A 329      30.049   4.700  23.714  1.00  0.85           C  
ATOM   2626  CE2 PHE A 329      29.217   2.471  24.174  1.00  0.85           C  
ATOM   2627  CZ  PHE A 329      29.735   3.688  24.629  1.00  0.85           C  
ATOM   2628  N   VAL A 330      27.421   4.736  17.485  1.00  0.89           N  
ATOM   2629  CA  VAL A 330      27.200   4.600  16.052  1.00  0.89           C  
ATOM   2630  C   VAL A 330      28.297   5.318  15.297  1.00  0.89           C  
ATOM   2631  O   VAL A 330      28.579   6.494  15.519  1.00  0.89           O  
ATOM   2632  CB  VAL A 330      25.835   5.135  15.617  1.00  0.89           C  
ATOM   2633  CG1 VAL A 330      25.713   5.369  14.089  1.00  0.89           C  
ATOM   2634  CG2 VAL A 330      24.770   4.122  16.070  1.00  0.89           C  
ATOM   2635  N   VAL A 331      28.960   4.605  14.366  1.00  0.91           N  
ATOM   2636  CA  VAL A 331      29.898   5.183  13.421  1.00  0.91           C  
ATOM   2637  C   VAL A 331      29.149   5.752  12.226  1.00  0.91           C  
ATOM   2638  O   VAL A 331      28.363   5.069  11.570  1.00  0.91           O  
ATOM   2639  CB  VAL A 331      31.038   4.232  13.011  1.00  0.91           C  
ATOM   2640  CG1 VAL A 331      30.589   2.758  13.042  1.00  0.91           C  
ATOM   2641  CG2 VAL A 331      31.668   4.576  11.639  1.00  0.91           C  
ATOM   2642  N   GLU A 332      29.389   7.042  11.918  1.00  0.87           N  
ATOM   2643  CA  GLU A 332      28.884   7.683  10.721  1.00  0.87           C  
ATOM   2644  C   GLU A 332      30.095   7.958   9.813  1.00  0.87           C  
ATOM   2645  O   GLU A 332      31.082   8.515  10.309  1.00  0.87           O  
ATOM   2646  CB  GLU A 332      28.136   9.011  11.017  1.00  0.87           C  
ATOM   2647  CG  GLU A 332      26.922   8.887  11.982  1.00  0.87           C  
ATOM   2648  CD  GLU A 332      26.188  10.203  12.237  1.00  0.87           C  
ATOM   2649  OE1 GLU A 332      26.667  11.287  11.817  1.00  0.87           O  
ATOM   2650  OE2 GLU A 332      25.096  10.166  12.872  1.00  0.87           O  
ATOM   2651  N   PRO A 333      30.135   7.606   8.521  1.00  0.87           N  
ATOM   2652  CA  PRO A 333      31.354   7.772   7.731  1.00  0.87           C  
ATOM   2653  C   PRO A 333      31.353   9.118   7.033  1.00  0.87           C  
ATOM   2654  O   PRO A 333      30.413   9.417   6.297  1.00  0.87           O  
ATOM   2655  CB  PRO A 333      31.303   6.649   6.667  1.00  0.87           C  
ATOM   2656  CG  PRO A 333      30.171   5.720   7.115  1.00  0.87           C  
ATOM   2657  CD  PRO A 333      29.231   6.647   7.882  1.00  0.87           C  
ATOM   2658  N   PHE A 334      32.402   9.941   7.207  1.00  0.92           N  
ATOM   2659  CA  PHE A 334      32.492  11.235   6.566  1.00  0.92           C  
ATOM   2660  C   PHE A 334      33.760  11.287   5.709  1.00  0.92           C  
ATOM   2661  O   PHE A 334      34.654  10.456   5.870  1.00  0.92           O  
ATOM   2662  CB  PHE A 334      32.468  12.368   7.633  1.00  0.92           C  
ATOM   2663  CG  PHE A 334      31.030  12.697   7.938  1.00  0.92           C  
ATOM   2664  CD1 PHE A 334      30.333  13.626   7.145  1.00  0.92           C  
ATOM   2665  CD2 PHE A 334      30.335  12.017   8.952  1.00  0.92           C  
ATOM   2666  CE1 PHE A 334      28.967  13.858   7.347  1.00  0.92           C  
ATOM   2667  CE2 PHE A 334      28.971  12.257   9.164  1.00  0.92           C  
ATOM   2668  CZ  PHE A 334      28.286  13.177   8.363  1.00  0.92           C  
ATOM   2669  N   PRO A 335      33.900  12.214   4.757  1.00  0.96           N  
ATOM   2670  CA  PRO A 335      35.018  12.257   3.812  1.00  0.96           C  
ATOM   2671  C   PRO A 335      36.439  12.156   4.350  1.00  0.96           C  
ATOM   2672  O   PRO A 335      37.287  11.544   3.695  1.00  0.96           O  
ATOM   2673  CB  PRO A 335      34.791  13.600   3.120  1.00  0.96           C  
ATOM   2674  CG  PRO A 335      33.274  13.687   2.992  1.00  0.96           C  
ATOM   2675  CD  PRO A 335      32.794  13.072   4.303  1.00  0.96           C  
ATOM   2676  N   ALA A 336      36.733  12.832   5.479  1.00  0.94           N  
ATOM   2677  CA  ALA A 336      37.998  12.790   6.189  1.00  0.94           C  
ATOM   2678  C   ALA A 336      38.148  11.526   7.023  1.00  0.94           C  
ATOM   2679  O   ALA A 336      39.201  10.892   7.057  1.00  0.94           O  
ATOM   2680  CB  ALA A 336      38.096  14.040   7.105  1.00  0.94           C  
ATOM   2681  N   VAL A 337      37.071  11.146   7.726  1.00  0.92           N  
ATOM   2682  CA  VAL A 337      37.181  10.501   9.013  1.00  0.92           C  
ATOM   2683  C   VAL A 337      35.938   9.653   9.239  1.00  0.92           C  
ATOM   2684  O   VAL A 337      34.834  10.012   8.834  1.00  0.92           O  
ATOM   2685  CB  VAL A 337      37.405  11.586  10.093  1.00  0.92           C  
ATOM   2686  CG1 VAL A 337      36.378  11.578  11.243  1.00  0.92           C  
ATOM   2687  CG2 VAL A 337      38.849  11.491  10.625  1.00  0.92           C  
ATOM   2688  N   HIS A 338      36.080   8.506   9.929  1.00  0.84           N  
ATOM   2689  CA  HIS A 338      34.965   7.782  10.514  1.00  0.84           C  
ATOM   2690  C   HIS A 338      34.787   8.310  11.915  1.00  0.84           C  
ATOM   2691  O   HIS A 338      35.735   8.278  12.697  1.00  0.84           O  
ATOM   2692  CB  HIS A 338      35.278   6.277  10.659  1.00  0.84           C  
ATOM   2693  CG  HIS A 338      35.235   5.549   9.361  1.00  0.84           C  
ATOM   2694  ND1 HIS A 338      34.005   5.238   8.821  1.00  0.84           N  
ATOM   2695  CD2 HIS A 338      36.232   5.081   8.566  1.00  0.84           C  
ATOM   2696  CE1 HIS A 338      34.270   4.586   7.712  1.00  0.84           C  
ATOM   2697  NE2 HIS A 338      35.604   4.461   7.506  1.00  0.84           N  
ATOM   2698  N   HIS A 339      33.598   8.827  12.280  1.00  0.88           N  
ATOM   2699  CA  HIS A 339      33.405   9.417  13.595  1.00  0.88           C  
ATOM   2700  C   HIS A 339      32.352   8.669  14.368  1.00  0.88           C  
ATOM   2701  O   HIS A 339      31.476   8.033  13.792  1.00  0.88           O  
ATOM   2702  CB  HIS A 339      33.103  10.938  13.545  1.00  0.88           C  
ATOM   2703  CG  HIS A 339      31.800  11.397  12.941  1.00  0.88           C  
ATOM   2704  ND1 HIS A 339      31.781  12.630  12.313  1.00  0.88           N  
ATOM   2705  CD2 HIS A 339      30.536  10.905  13.041  1.00  0.88           C  
ATOM   2706  CE1 HIS A 339      30.505  12.851  12.040  1.00  0.88           C  
ATOM   2707  NE2 HIS A 339      29.710  11.842  12.462  1.00  0.88           N  
ATOM   2708  N   LEU A 340      32.440   8.702  15.707  1.00  0.84           N  
ATOM   2709  CA  LEU A 340      31.584   7.925  16.575  1.00  0.84           C  
ATOM   2710  C   LEU A 340      30.630   8.832  17.353  1.00  0.84           C  
ATOM   2711  O   LEU A 340      31.037   9.788  18.017  1.00  0.84           O  
ATOM   2712  CB  LEU A 340      32.506   7.117  17.510  1.00  0.84           C  
ATOM   2713  CG  LEU A 340      31.815   6.088  18.409  1.00  0.84           C  
ATOM   2714  CD1 LEU A 340      31.280   4.928  17.569  1.00  0.84           C  
ATOM   2715  CD2 LEU A 340      32.793   5.554  19.459  1.00  0.84           C  
ATOM   2716  N   VAL A 341      29.311   8.568  17.247  1.00  0.86           N  
ATOM   2717  CA  VAL A 341      28.245   9.429  17.744  1.00  0.86           C  
ATOM   2718  C   VAL A 341      27.367   8.656  18.697  1.00  0.86           C  
ATOM   2719  O   VAL A 341      27.141   7.456  18.541  1.00  0.86           O  
ATOM   2720  CB  VAL A 341      27.356   9.998  16.633  1.00  0.86           C  
ATOM   2721  CG1 VAL A 341      26.461  11.140  17.164  1.00  0.86           C  
ATOM   2722  CG2 VAL A 341      28.278  10.552  15.543  1.00  0.86           C  
ATOM   2723  N   SER A 342      26.830   9.343  19.716  1.00  0.74           N  
ATOM   2724  CA  SER A 342      25.826   8.794  20.605  1.00  0.74           C  
ATOM   2725  C   SER A 342      24.749   9.843  20.753  1.00  0.74           C  
ATOM   2726  O   SER A 342      24.999  11.022  20.521  1.00  0.74           O  
ATOM   2727  CB  SER A 342      26.404   8.499  22.001  1.00  0.74           C  
ATOM   2728  OG  SER A 342      27.368   7.446  21.931  1.00  0.74           O  
ATOM   2729  N   THR A 343      23.512   9.460  21.120  1.00  0.80           N  
ATOM   2730  CA  THR A 343      22.361  10.368  21.088  1.00  0.80           C  
ATOM   2731  C   THR A 343      21.732  10.396  22.460  1.00  0.80           C  
ATOM   2732  O   THR A 343      21.488   9.346  23.046  1.00  0.80           O  
ATOM   2733  CB  THR A 343      21.256   9.954  20.107  1.00  0.80           C  
ATOM   2734  OG1 THR A 343      21.737   9.864  18.767  1.00  0.80           O  
ATOM   2735  CG2 THR A 343      20.104  10.969  20.080  1.00  0.80           C  
ATOM   2736  N   ILE A 344      21.436  11.593  23.009  1.00  0.85           N  
ATOM   2737  CA  ILE A 344      20.745  11.754  24.283  1.00  0.85           C  
ATOM   2738  C   ILE A 344      19.474  12.540  24.008  1.00  0.85           C  
ATOM   2739  O   ILE A 344      19.496  13.559  23.316  1.00  0.85           O  
ATOM   2740  CB  ILE A 344      21.586  12.451  25.362  1.00  0.85           C  
ATOM   2741  CG1 ILE A 344      22.923  11.715  25.621  1.00  0.85           C  
ATOM   2742  CG2 ILE A 344      20.805  12.601  26.690  1.00  0.85           C  
ATOM   2743  CD1 ILE A 344      24.100  12.237  24.786  1.00  0.85           C  
ATOM   2744  N   THR A 345      18.333  12.049  24.533  1.00  0.85           N  
ATOM   2745  CA  THR A 345      16.992  12.578  24.294  1.00  0.85           C  
ATOM   2746  C   THR A 345      16.384  12.998  25.614  1.00  0.85           C  
ATOM   2747  O   THR A 345      16.593  12.337  26.630  1.00  0.85           O  
ATOM   2748  CB  THR A 345      16.049  11.556  23.662  1.00  0.85           C  
ATOM   2749  OG1 THR A 345      16.504  11.209  22.368  1.00  0.85           O  
ATOM   2750  CG2 THR A 345      14.613  12.069  23.466  1.00  0.85           C  
ATOM   2751  N   ALA A 346      15.614  14.105  25.639  1.00  0.91           N  
ATOM   2752  CA  ALA A 346      14.925  14.600  26.811  1.00  0.91           C  
ATOM   2753  C   ALA A 346      13.671  15.379  26.409  1.00  0.91           C  
ATOM   2754  O   ALA A 346      13.342  15.510  25.235  1.00  0.91           O  
ATOM   2755  CB  ALA A 346      15.861  15.483  27.662  1.00  0.91           C  
ATOM   2756  N   GLN A 347      12.907  15.901  27.386  1.00  0.88           N  
ATOM   2757  CA  GLN A 347      11.782  16.790  27.146  1.00  0.88           C  
ATOM   2758  C   GLN A 347      12.050  18.100  27.858  1.00  0.88           C  
ATOM   2759  O   GLN A 347      12.521  18.130  28.996  1.00  0.88           O  
ATOM   2760  CB  GLN A 347      10.434  16.212  27.657  1.00  0.88           C  
ATOM   2761  CG  GLN A 347       9.803  15.150  26.723  1.00  0.88           C  
ATOM   2762  CD  GLN A 347       9.130  15.815  25.518  1.00  0.88           C  
ATOM   2763  OE1 GLN A 347       8.309  16.715  25.679  1.00  0.88           O  
ATOM   2764  NE2 GLN A 347       9.446  15.359  24.288  1.00  0.88           N  
ATOM   2765  N   LEU A 348      11.765  19.229  27.189  1.00  0.92           N  
ATOM   2766  CA  LEU A 348      11.792  20.554  27.766  1.00  0.92           C  
ATOM   2767  C   LEU A 348      10.540  20.760  28.621  1.00  0.92           C  
ATOM   2768  O   LEU A 348       9.474  20.297  28.215  1.00  0.92           O  
ATOM   2769  CB  LEU A 348      11.863  21.611  26.634  1.00  0.92           C  
ATOM   2770  CG  LEU A 348      12.144  23.058  27.087  1.00  0.92           C  
ATOM   2771  CD1 LEU A 348      13.535  23.230  27.718  1.00  0.92           C  
ATOM   2772  CD2 LEU A 348      11.988  24.019  25.902  1.00  0.92           C  
ATOM   2773  N   PRO A 349      10.543  21.396  29.788  1.00  0.93           N  
ATOM   2774  CA  PRO A 349       9.305  21.735  30.476  1.00  0.93           C  
ATOM   2775  C   PRO A 349       8.588  22.866  29.762  1.00  0.93           C  
ATOM   2776  O   PRO A 349       9.242  23.810  29.331  1.00  0.93           O  
ATOM   2777  CB  PRO A 349       9.766  22.182  31.881  1.00  0.93           C  
ATOM   2778  CG  PRO A 349      11.150  21.551  32.050  1.00  0.93           C  
ATOM   2779  CD  PRO A 349      11.713  21.611  30.633  1.00  0.93           C  
ATOM   2780  N   GLU A 350       7.247  22.824  29.668  1.00  0.82           N  
ATOM   2781  CA  GLU A 350       6.421  23.761  28.922  1.00  0.82           C  
ATOM   2782  C   GLU A 350       6.429  25.207  29.456  1.00  0.82           C  
ATOM   2783  O   GLU A 350       5.896  26.133  28.850  1.00  0.82           O  
ATOM   2784  CB  GLU A 350       4.979  23.199  28.906  1.00  0.82           C  
ATOM   2785  CG  GLU A 350       4.876  21.700  28.502  1.00  0.82           C  
ATOM   2786  CD  GLU A 350       4.067  21.530  27.220  1.00  0.82           C  
ATOM   2787  OE1 GLU A 350       4.628  21.844  26.140  1.00  0.82           O  
ATOM   2788  OE2 GLU A 350       2.893  21.095  27.328  1.00  0.82           O  
ATOM   2789  N   GLN A 351       7.068  25.432  30.625  1.00  0.76           N  
ATOM   2790  CA  GLN A 351       7.302  26.738  31.221  1.00  0.76           C  
ATOM   2791  C   GLN A 351       8.698  27.303  30.945  1.00  0.76           C  
ATOM   2792  O   GLN A 351       9.012  28.389  31.426  1.00  0.76           O  
ATOM   2793  CB  GLN A 351       7.115  26.679  32.763  1.00  0.76           C  
ATOM   2794  CG  GLN A 351       5.659  26.945  33.202  1.00  0.76           C  
ATOM   2795  CD  GLN A 351       5.608  27.263  34.695  1.00  0.76           C  
ATOM   2796  OE1 GLN A 351       5.349  26.412  35.543  1.00  0.76           O  
ATOM   2797  NE2 GLN A 351       5.891  28.543  35.034  1.00  0.76           N  
ATOM   2798  N   LEU A 352       9.560  26.610  30.175  1.00  0.90           N  
ATOM   2799  CA  LEU A 352      10.900  27.086  29.853  1.00  0.90           C  
ATOM   2800  C   LEU A 352      11.061  27.225  28.359  1.00  0.90           C  
ATOM   2801  O   LEU A 352      10.426  26.532  27.567  1.00  0.90           O  
ATOM   2802  CB  LEU A 352      12.023  26.144  30.368  1.00  0.90           C  
ATOM   2803  CG  LEU A 352      12.302  26.268  31.879  1.00  0.90           C  
ATOM   2804  CD1 LEU A 352      13.316  25.202  32.311  1.00  0.90           C  
ATOM   2805  CD2 LEU A 352      12.831  27.664  32.255  1.00  0.90           C  
ATOM   2806  N   HIS A 353      11.938  28.147  27.921  1.00  0.90           N  
ATOM   2807  CA  HIS A 353      12.222  28.323  26.517  1.00  0.90           C  
ATOM   2808  C   HIS A 353      13.437  27.502  26.096  1.00  0.90           C  
ATOM   2809  O   HIS A 353      14.259  27.046  26.888  1.00  0.90           O  
ATOM   2810  CB  HIS A 353      12.496  29.802  26.169  1.00  0.90           C  
ATOM   2811  CG  HIS A 353      11.306  30.716  26.232  1.00  0.90           C  
ATOM   2812  ND1 HIS A 353      11.107  31.478  27.361  1.00  0.90           N  
ATOM   2813  CD2 HIS A 353      10.459  31.113  25.243  1.00  0.90           C  
ATOM   2814  CE1 HIS A 353      10.152  32.330  27.043  1.00  0.90           C  
ATOM   2815  NE2 HIS A 353       9.726  32.157  25.770  1.00  0.90           N  
ATOM   2816  N   ALA A 354      13.611  27.308  24.772  1.00  0.97           N  
ATOM   2817  CA  ALA A 354      14.782  26.668  24.204  1.00  0.97           C  
ATOM   2818  C   ALA A 354      16.104  27.415  24.466  1.00  0.97           C  
ATOM   2819  O   ALA A 354      17.172  26.814  24.565  1.00  0.97           O  
ATOM   2820  CB  ALA A 354      14.549  26.487  22.695  1.00  0.97           C  
ATOM   2821  N   SER A 355      16.051  28.756  24.640  1.00  0.96           N  
ATOM   2822  CA  SER A 355      17.165  29.607  25.062  1.00  0.96           C  
ATOM   2823  C   SER A 355      17.718  29.251  26.428  1.00  0.96           C  
ATOM   2824  O   SER A 355      18.928  29.263  26.635  1.00  0.96           O  
ATOM   2825  CB  SER A 355      16.791  31.120  25.093  1.00  0.96           C  
ATOM   2826  OG  SER A 355      15.583  31.360  25.820  1.00  0.96           O  
ATOM   2827  N   ASP A 356      16.852  28.913  27.402  1.00  0.94           N  
ATOM   2828  CA  ASP A 356      17.255  28.499  28.735  1.00  0.94           C  
ATOM   2829  C   ASP A 356      18.000  27.176  28.750  1.00  0.94           C  
ATOM   2830  O   ASP A 356      19.016  27.023  29.426  1.00  0.94           O  
ATOM   2831  CB  ASP A 356      16.039  28.448  29.679  1.00  0.94           C  
ATOM   2832  CG  ASP A 356      15.382  29.805  29.615  1.00  0.94           C  
ATOM   2833  OD1 ASP A 356      16.076  30.803  29.960  1.00  0.94           O  
ATOM   2834  OD2 ASP A 356      14.227  29.858  29.134  1.00  0.94           O  
ATOM   2835  N   LEU A 357      17.535  26.211  27.936  1.00  0.95           N  
ATOM   2836  CA  LEU A 357      18.222  24.966  27.639  1.00  0.95           C  
ATOM   2837  C   LEU A 357      19.574  25.179  26.964  1.00  0.95           C  
ATOM   2838  O   LEU A 357      20.572  24.556  27.325  1.00  0.95           O  
ATOM   2839  CB  LEU A 357      17.301  24.117  26.735  1.00  0.95           C  
ATOM   2840  CG  LEU A 357      17.911  22.824  26.162  1.00  0.95           C  
ATOM   2841  CD1 LEU A 357      18.319  21.821  27.253  1.00  0.95           C  
ATOM   2842  CD2 LEU A 357      16.912  22.202  25.180  1.00  0.95           C  
ATOM   2843  N   LEU A 358      19.650  26.107  25.986  1.00  0.96           N  
ATOM   2844  CA  LEU A 358      20.898  26.512  25.360  1.00  0.96           C  
ATOM   2845  C   LEU A 358      21.888  27.137  26.336  1.00  0.96           C  
ATOM   2846  O   LEU A 358      23.054  26.757  26.366  1.00  0.96           O  
ATOM   2847  CB  LEU A 358      20.626  27.501  24.196  1.00  0.96           C  
ATOM   2848  CG  LEU A 358      21.859  27.932  23.369  1.00  0.96           C  
ATOM   2849  CD1 LEU A 358      22.571  26.735  22.724  1.00  0.96           C  
ATOM   2850  CD2 LEU A 358      21.457  28.951  22.292  1.00  0.96           C  
ATOM   2851  N   ARG A 359      21.434  28.060  27.213  1.00  0.90           N  
ATOM   2852  CA  ARG A 359      22.246  28.673  28.257  1.00  0.90           C  
ATOM   2853  C   ARG A 359      22.794  27.655  29.245  1.00  0.90           C  
ATOM   2854  O   ARG A 359      23.965  27.676  29.611  1.00  0.90           O  
ATOM   2855  CB  ARG A 359      21.413  29.714  29.054  1.00  0.90           C  
ATOM   2856  CG  ARG A 359      22.268  30.608  29.984  1.00  0.90           C  
ATOM   2857  CD  ARG A 359      21.510  31.369  31.079  1.00  0.90           C  
ATOM   2858  NE  ARG A 359      20.639  32.369  30.405  1.00  0.90           N  
ATOM   2859  CZ  ARG A 359      19.313  32.283  30.240  1.00  0.90           C  
ATOM   2860  NH1 ARG A 359      18.602  31.247  30.658  1.00  0.90           N  
ATOM   2861  NH2 ARG A 359      18.699  33.299  29.657  1.00  0.90           N  
ATOM   2862  N   ALA A 360      21.940  26.704  29.664  1.00  0.97           N  
ATOM   2863  CA  ALA A 360      22.250  25.645  30.599  1.00  0.97           C  
ATOM   2864  C   ALA A 360      23.349  24.683  30.145  1.00  0.97           C  
ATOM   2865  O   ALA A 360      24.063  24.108  30.967  1.00  0.97           O  
ATOM   2866  CB  ALA A 360      20.948  24.870  30.884  1.00  0.97           C  
ATOM   2867  N   ALA A 361      23.485  24.472  28.822  1.00  0.98           N  
ATOM   2868  CA  ALA A 361      24.424  23.529  28.260  1.00  0.98           C  
ATOM   2869  C   ALA A 361      25.588  24.167  27.500  1.00  0.98           C  
ATOM   2870  O   ALA A 361      26.495  23.458  27.074  1.00  0.98           O  
ATOM   2871  CB  ALA A 361      23.642  22.608  27.304  1.00  0.98           C  
ATOM   2872  N   PHE A 362      25.641  25.500  27.308  1.00  0.96           N  
ATOM   2873  CA  PHE A 362      26.691  26.143  26.522  1.00  0.96           C  
ATOM   2874  C   PHE A 362      28.053  26.240  27.251  1.00  0.96           C  
ATOM   2875  O   PHE A 362      28.082  26.346  28.477  1.00  0.96           O  
ATOM   2876  CB  PHE A 362      26.209  27.541  26.027  1.00  0.96           C  
ATOM   2877  CG  PHE A 362      27.018  28.043  24.865  1.00  0.96           C  
ATOM   2878  CD1 PHE A 362      26.733  27.608  23.558  1.00  0.96           C  
ATOM   2879  CD2 PHE A 362      28.110  28.899  25.076  1.00  0.96           C  
ATOM   2880  CE1 PHE A 362      27.543  28.003  22.487  1.00  0.96           C  
ATOM   2881  CE2 PHE A 362      28.925  29.287  24.009  1.00  0.96           C  
ATOM   2882  CZ  PHE A 362      28.639  28.839  22.714  1.00  0.96           C  
ATOM   2883  N   PRO A 363      29.211  26.228  26.572  1.00  0.99           N  
ATOM   2884  CA  PRO A 363      29.457  25.586  25.282  1.00  0.99           C  
ATOM   2885  C   PRO A 363      29.332  24.078  25.392  1.00  0.99           C  
ATOM   2886  O   PRO A 363      29.328  23.535  26.500  1.00  0.99           O  
ATOM   2887  CB  PRO A 363      30.884  26.032  24.935  1.00  0.99           C  
ATOM   2888  CG  PRO A 363      31.577  26.137  26.294  1.00  0.99           C  
ATOM   2889  CD  PRO A 363      30.461  26.653  27.209  1.00  0.99           C  
ATOM   2890  N   GLY A 364      29.191  23.375  24.249  1.00  0.96           N  
ATOM   2891  CA  GLY A 364      29.015  21.926  24.221  1.00  0.96           C  
ATOM   2892  C   GLY A 364      30.024  21.106  24.989  1.00  0.96           C  
ATOM   2893  O   GLY A 364      31.230  21.319  24.908  1.00  0.96           O  
ATOM   2894  N   GLY A 365      29.548  20.085  25.733  1.00  0.94           N  
ATOM   2895  CA  GLY A 365      30.399  19.208  26.533  1.00  0.94           C  
ATOM   2896  C   GLY A 365      31.384  18.373  25.751  1.00  0.94           C  
ATOM   2897  O   GLY A 365      32.439  17.996  26.253  1.00  0.94           O  
ATOM   2898  N   SER A 366      31.065  18.098  24.471  1.00  0.91           N  
ATOM   2899  CA  SER A 366      31.893  17.382  23.511  1.00  0.91           C  
ATOM   2900  C   SER A 366      33.183  18.097  23.177  1.00  0.91           C  
ATOM   2901  O   SER A 366      34.186  17.457  22.885  1.00  0.91           O  
ATOM   2902  CB  SER A 366      31.145  17.008  22.191  1.00  0.91           C  
ATOM   2903  OG  SER A 366      30.597  18.142  21.521  1.00  0.91           O  
ATOM   2904  N   ILE A 367      33.235  19.436  23.215  1.00  0.96           N  
ATOM   2905  CA  ILE A 367      34.414  20.175  22.788  1.00  0.96           C  
ATOM   2906  C   ILE A 367      35.143  20.838  23.948  1.00  0.96           C  
ATOM   2907  O   ILE A 367      36.115  21.578  23.764  1.00  0.96           O  
ATOM   2908  CB  ILE A 367      34.084  21.114  21.636  1.00  0.96           C  
ATOM   2909  CG1 ILE A 367      32.844  22.014  21.859  1.00  0.96           C  
ATOM   2910  CG2 ILE A 367      33.856  20.214  20.397  1.00  0.96           C  
ATOM   2911  CD1 ILE A 367      33.024  23.130  22.891  1.00  0.96           C  
ATOM   2912  N   THR A 368      34.726  20.532  25.192  1.00  0.97           N  
ATOM   2913  CA  THR A 368      35.396  20.936  26.427  1.00  0.97           C  
ATOM   2914  C   THR A 368      36.062  19.756  27.117  1.00  0.97           C  
ATOM   2915  O   THR A 368      37.285  19.723  27.243  1.00  0.97           O  
ATOM   2916  CB  THR A 368      34.464  21.627  27.412  1.00  0.97           C  
ATOM   2917  OG1 THR A 368      33.286  20.868  27.639  1.00  0.97           O  
ATOM   2918  CG2 THR A 368      33.993  22.954  26.808  1.00  0.97           C  
ATOM   2919  N   GLY A 369      35.276  18.747  27.556  1.00  0.96           N  
ATOM   2920  CA  GLY A 369      35.740  17.558  28.272  1.00  0.96           C  
ATOM   2921  C   GLY A 369      35.402  17.622  29.745  1.00  0.96           C  
ATOM   2922  O   GLY A 369      35.710  18.578  30.438  1.00  0.96           O  
ATOM   2923  N   ALA A 370      34.701  16.628  30.296  1.00  0.92           N  
ATOM   2924  CA  ALA A 370      34.287  16.607  31.686  1.00  0.92           C  
ATOM   2925  C   ALA A 370      35.370  16.660  32.807  1.00  0.92           C  
ATOM   2926  O   ALA A 370      36.409  16.007  32.676  1.00  0.92           O  
ATOM   2927  CB  ALA A 370      33.431  15.348  31.905  1.00  0.92           C  
ATOM   2928  N   PRO A 371      35.174  17.342  33.960  1.00  0.95           N  
ATOM   2929  CA  PRO A 371      34.123  18.306  34.267  1.00  0.95           C  
ATOM   2930  C   PRO A 371      34.350  19.640  33.573  1.00  0.95           C  
ATOM   2931  O   PRO A 371      35.477  20.119  33.481  1.00  0.95           O  
ATOM   2932  CB  PRO A 371      34.156  18.478  35.805  1.00  0.95           C  
ATOM   2933  CG  PRO A 371      35.342  17.650  36.328  1.00  0.95           C  
ATOM   2934  CD  PRO A 371      36.102  17.200  35.078  1.00  0.95           C  
ATOM   2935  N   LYS A 372      33.264  20.264  33.073  1.00  0.92           N  
ATOM   2936  CA  LYS A 372      33.345  21.319  32.079  1.00  0.92           C  
ATOM   2937  C   LYS A 372      34.115  22.592  32.447  1.00  0.92           C  
ATOM   2938  O   LYS A 372      34.958  23.036  31.674  1.00  0.92           O  
ATOM   2939  CB  LYS A 372      31.914  21.668  31.591  1.00  0.92           C  
ATOM   2940  CG  LYS A 372      31.902  22.470  30.280  1.00  0.92           C  
ATOM   2941  CD  LYS A 372      30.635  22.231  29.439  1.00  0.92           C  
ATOM   2942  CE  LYS A 372      29.412  23.010  29.933  1.00  0.92           C  
ATOM   2943  NZ  LYS A 372      28.261  22.719  29.073  1.00  0.92           N  
ATOM   2944  N   VAL A 373      33.892  23.196  33.639  1.00  0.93           N  
ATOM   2945  CA  VAL A 373      34.566  24.435  34.042  1.00  0.93           C  
ATOM   2946  C   VAL A 373      36.071  24.281  34.183  1.00  0.93           C  
ATOM   2947  O   VAL A 373      36.845  25.036  33.600  1.00  0.93           O  
ATOM   2948  CB  VAL A 373      33.995  25.013  35.336  1.00  0.93           C  
ATOM   2949  CG1 VAL A 373      34.620  26.397  35.622  1.00  0.93           C  
ATOM   2950  CG2 VAL A 373      32.472  25.162  35.182  1.00  0.93           C  
ATOM   2951  N   ARG A 374      36.527  23.224  34.888  1.00  0.88           N  
ATOM   2952  CA  ARG A 374      37.938  22.943  35.092  1.00  0.88           C  
ATOM   2953  C   ARG A 374      38.679  22.663  33.785  1.00  0.88           C  
ATOM   2954  O   ARG A 374      39.799  23.111  33.555  1.00  0.88           O  
ATOM   2955  CB  ARG A 374      38.118  21.775  36.100  1.00  0.88           C  
ATOM   2956  CG  ARG A 374      39.590  21.505  36.512  1.00  0.88           C  
ATOM   2957  CD  ARG A 374      40.263  22.659  37.286  1.00  0.88           C  
ATOM   2958  NE  ARG A 374      41.752  22.439  37.340  1.00  0.88           N  
ATOM   2959  CZ  ARG A 374      42.702  23.239  36.826  1.00  0.88           C  
ATOM   2960  NH1 ARG A 374      42.478  24.426  36.288  1.00  0.88           N  
ATOM   2961  NH2 ARG A 374      43.954  22.791  36.892  1.00  0.88           N  
ATOM   2962  N   ALA A 375      38.036  21.942  32.851  1.00  0.96           N  
ATOM   2963  CA  ALA A 375      38.537  21.738  31.513  1.00  0.96           C  
ATOM   2964  C   ALA A 375      38.657  23.008  30.686  1.00  0.96           C  
ATOM   2965  O   ALA A 375      39.650  23.221  29.996  1.00  0.96           O  
ATOM   2966  CB  ALA A 375      37.582  20.776  30.823  1.00  0.96           C  
ATOM   2967  N   MET A 376      37.656  23.909  30.770  1.00  0.93           N  
ATOM   2968  CA  MET A 376      37.688  25.228  30.162  1.00  0.93           C  
ATOM   2969  C   MET A 376      38.815  26.114  30.688  1.00  0.93           C  
ATOM   2970  O   MET A 376      39.437  26.839  29.913  1.00  0.93           O  
ATOM   2971  CB  MET A 376      36.328  25.956  30.286  1.00  0.93           C  
ATOM   2972  CG  MET A 376      35.233  25.343  29.391  1.00  0.93           C  
ATOM   2973  SD  MET A 376      33.618  26.170  29.492  1.00  0.93           S  
ATOM   2974  CE  MET A 376      34.105  27.631  28.529  1.00  0.93           C  
ATOM   2975  N   GLU A 377      39.137  26.047  32.000  1.00  0.91           N  
ATOM   2976  CA  GLU A 377      40.320  26.679  32.573  1.00  0.91           C  
ATOM   2977  C   GLU A 377      41.622  26.157  31.968  1.00  0.91           C  
ATOM   2978  O   GLU A 377      42.467  26.934  31.531  1.00  0.91           O  
ATOM   2979  CB  GLU A 377      40.400  26.423  34.099  1.00  0.91           C  
ATOM   2980  CG  GLU A 377      39.237  26.999  34.944  1.00  0.91           C  
ATOM   2981  CD  GLU A 377      39.266  26.471  36.376  1.00  0.91           C  
ATOM   2982  OE1 GLU A 377      40.295  25.851  36.758  1.00  0.91           O  
ATOM   2983  OE2 GLU A 377      38.256  26.658  37.093  1.00  0.91           O  
ATOM   2984  N   ILE A 378      41.773  24.816  31.861  1.00  0.95           N  
ATOM   2985  CA  ILE A 378      42.921  24.151  31.243  1.00  0.95           C  
ATOM   2986  C   ILE A 378      43.050  24.498  29.760  1.00  0.95           C  
ATOM   2987  O   ILE A 378      44.141  24.742  29.248  1.00  0.95           O  
ATOM   2988  CB  ILE A 378      42.881  22.633  31.468  1.00  0.95           C  
ATOM   2989  CG1 ILE A 378      42.985  22.322  32.983  1.00  0.95           C  
ATOM   2990  CG2 ILE A 378      44.031  21.934  30.703  1.00  0.95           C  
ATOM   2991  CD1 ILE A 378      42.683  20.861  33.338  1.00  0.95           C  
ATOM   2992  N   ILE A 379      41.925  24.576  29.021  1.00  0.95           N  
ATOM   2993  CA  ILE A 379      41.896  25.055  27.643  1.00  0.95           C  
ATOM   2994  C   ILE A 379      42.413  26.486  27.499  1.00  0.95           C  
ATOM   2995  O   ILE A 379      43.286  26.740  26.675  1.00  0.95           O  
ATOM   2996  CB  ILE A 379      40.480  24.919  27.073  1.00  0.95           C  
ATOM   2997  CG1 ILE A 379      40.171  23.427  26.799  1.00  0.95           C  
ATOM   2998  CG2 ILE A 379      40.292  25.751  25.784  1.00  0.95           C  
ATOM   2999  CD1 ILE A 379      38.672  23.128  26.677  1.00  0.95           C  
ATOM   3000  N   ASP A 380      41.945  27.440  28.336  1.00  0.94           N  
ATOM   3001  CA  ASP A 380      42.386  28.828  28.320  1.00  0.94           C  
ATOM   3002  C   ASP A 380      43.876  28.981  28.664  1.00  0.94           C  
ATOM   3003  O   ASP A 380      44.621  29.725  28.034  1.00  0.94           O  
ATOM   3004  CB  ASP A 380      41.466  29.610  29.298  1.00  0.94           C  
ATOM   3005  CG  ASP A 380      41.643  31.108  29.179  1.00  0.94           C  
ATOM   3006  OD1 ASP A 380      40.962  31.720  28.317  1.00  0.94           O  
ATOM   3007  OD2 ASP A 380      42.450  31.677  29.951  1.00  0.94           O  
ATOM   3008  N   GLU A 381      44.347  28.225  29.669  1.00  0.92           N  
ATOM   3009  CA  GLU A 381      45.733  28.146  30.087  1.00  0.92           C  
ATOM   3010  C   GLU A 381      46.682  27.600  29.017  1.00  0.92           C  
ATOM   3011  O   GLU A 381      47.770  28.129  28.778  1.00  0.92           O  
ATOM   3012  CB  GLU A 381      45.734  27.239  31.347  1.00  0.92           C  
ATOM   3013  CG  GLU A 381      47.104  26.858  31.957  1.00  0.92           C  
ATOM   3014  CD  GLU A 381      46.970  25.909  33.148  1.00  0.92           C  
ATOM   3015  OE1 GLU A 381      45.916  25.904  33.836  1.00  0.92           O  
ATOM   3016  OE2 GLU A 381      47.942  25.147  33.386  1.00  0.92           O  
ATOM   3017  N   LEU A 382      46.300  26.507  28.326  1.00  0.95           N  
ATOM   3018  CA  LEU A 382      47.181  25.849  27.381  1.00  0.95           C  
ATOM   3019  C   LEU A 382      47.073  26.320  25.938  1.00  0.95           C  
ATOM   3020  O   LEU A 382      48.106  26.436  25.266  1.00  0.95           O  
ATOM   3021  CB  LEU A 382      47.014  24.313  27.454  1.00  0.95           C  
ATOM   3022  CG  LEU A 382      47.316  23.723  28.851  1.00  0.95           C  
ATOM   3023  CD1 LEU A 382      47.145  22.202  28.831  1.00  0.95           C  
ATOM   3024  CD2 LEU A 382      48.708  24.091  29.385  1.00  0.95           C  
ATOM   3025  N   GLU A 383      45.865  26.593  25.398  1.00  0.93           N  
ATOM   3026  CA  GLU A 383      45.691  27.053  24.024  1.00  0.93           C  
ATOM   3027  C   GLU A 383      46.196  28.491  23.859  1.00  0.93           C  
ATOM   3028  O   GLU A 383      45.798  29.349  24.641  1.00  0.93           O  
ATOM   3029  CB  GLU A 383      44.229  26.907  23.510  1.00  0.93           C  
ATOM   3030  CG  GLU A 383      43.866  25.414  23.301  1.00  0.93           C  
ATOM   3031  CD  GLU A 383      42.450  25.086  22.855  1.00  0.93           C  
ATOM   3032  OE1 GLU A 383      41.641  25.949  22.439  1.00  0.93           O  
ATOM   3033  OE2 GLU A 383      42.128  23.870  22.943  1.00  0.93           O  
ATOM   3034  N   PRO A 384      47.084  28.841  22.913  1.00  0.98           N  
ATOM   3035  CA  PRO A 384      47.745  30.146  22.944  1.00  0.98           C  
ATOM   3036  C   PRO A 384      46.796  31.302  22.666  1.00  0.98           C  
ATOM   3037  O   PRO A 384      47.066  32.422  23.093  1.00  0.98           O  
ATOM   3038  CB  PRO A 384      48.885  30.064  21.905  1.00  0.98           C  
ATOM   3039  CG  PRO A 384      48.944  28.615  21.393  1.00  0.98           C  
ATOM   3040  CD  PRO A 384      47.809  27.867  22.095  1.00  0.98           C  
ATOM   3041  N   GLN A 385      45.695  31.048  21.938  1.00  0.92           N  
ATOM   3042  CA  GLN A 385      44.724  32.047  21.560  1.00  0.92           C  
ATOM   3043  C   GLN A 385      43.334  31.537  21.849  1.00  0.92           C  
ATOM   3044  O   GLN A 385      43.080  30.334  21.860  1.00  0.92           O  
ATOM   3045  CB  GLN A 385      44.773  32.411  20.057  1.00  0.92           C  
ATOM   3046  CG  GLN A 385      46.070  33.132  19.628  1.00  0.92           C  
ATOM   3047  CD  GLN A 385      47.220  32.219  19.214  1.00  0.92           C  
ATOM   3048  OE1 GLN A 385      47.079  31.050  18.840  1.00  0.92           O  
ATOM   3049  NE2 GLN A 385      48.435  32.815  19.235  1.00  0.92           N  
ATOM   3050  N   ARG A 386      42.388  32.467  22.087  1.00  0.91           N  
ATOM   3051  CA  ARG A 386      40.978  32.177  22.241  1.00  0.91           C  
ATOM   3052  C   ARG A 386      40.351  31.548  21.008  1.00  0.91           C  
ATOM   3053  O   ARG A 386      40.702  31.829  19.863  1.00  0.91           O  
ATOM   3054  CB  ARG A 386      40.143  33.423  22.624  1.00  0.91           C  
ATOM   3055  CG  ARG A 386      40.521  34.027  23.984  1.00  0.91           C  
ATOM   3056  CD  ARG A 386      39.519  35.075  24.468  1.00  0.91           C  
ATOM   3057  NE  ARG A 386      40.113  35.643  25.709  1.00  0.91           N  
ATOM   3058  CZ  ARG A 386      39.473  36.476  26.534  1.00  0.91           C  
ATOM   3059  NH1 ARG A 386      38.255  36.951  26.298  1.00  0.91           N  
ATOM   3060  NH2 ARG A 386      40.075  36.863  27.648  1.00  0.91           N  
ATOM   3061  N   ARG A 387      39.381  30.650  21.240  1.00  0.92           N  
ATOM   3062  CA  ARG A 387      38.710  29.918  20.191  1.00  0.92           C  
ATOM   3063  C   ARG A 387      37.782  30.769  19.337  1.00  0.92           C  
ATOM   3064  O   ARG A 387      37.654  30.541  18.131  1.00  0.92           O  
ATOM   3065  CB  ARG A 387      37.941  28.729  20.791  1.00  0.92           C  
ATOM   3066  CG  ARG A 387      38.863  27.673  21.428  1.00  0.92           C  
ATOM   3067  CD  ARG A 387      38.064  26.500  21.987  1.00  0.92           C  
ATOM   3068  NE  ARG A 387      39.029  25.456  22.428  1.00  0.92           N  
ATOM   3069  CZ  ARG A 387      38.666  24.240  22.855  1.00  0.92           C  
ATOM   3070  NH1 ARG A 387      37.390  23.956  23.095  1.00  0.92           N  
ATOM   3071  NH2 ARG A 387      39.599  23.318  23.036  1.00  0.92           N  
ATOM   3072  N   ASN A 388      37.112  31.774  19.946  1.00  0.97           N  
ATOM   3073  CA  ASN A 388      36.182  32.670  19.291  1.00  0.97           C  
ATOM   3074  C   ASN A 388      35.007  31.913  18.647  1.00  0.97           C  
ATOM   3075  O   ASN A 388      34.238  31.239  19.326  1.00  0.97           O  
ATOM   3076  CB  ASN A 388      36.969  33.658  18.378  1.00  0.97           C  
ATOM   3077  CG  ASN A 388      36.098  34.776  17.824  1.00  0.97           C  
ATOM   3078  OD1 ASN A 388      35.756  34.728  16.641  1.00  0.97           O  
ATOM   3079  ND2 ASN A 388      35.712  35.750  18.674  1.00  0.97           N  
ATOM   3080  N   ALA A 389      34.815  32.001  17.318  1.00  1.00           N  
ATOM   3081  CA  ALA A 389      33.733  31.335  16.621  1.00  1.00           C  
ATOM   3082  C   ALA A 389      33.891  29.821  16.451  1.00  1.00           C  
ATOM   3083  O   ALA A 389      32.926  29.129  16.120  1.00  1.00           O  
ATOM   3084  CB  ALA A 389      33.571  31.977  15.232  1.00  1.00           C  
ATOM   3085  N   TRP A 390      35.098  29.254  16.670  1.00  0.96           N  
ATOM   3086  CA  TRP A 390      35.330  27.823  16.552  1.00  0.96           C  
ATOM   3087  C   TRP A 390      34.961  27.089  17.838  1.00  0.96           C  
ATOM   3088  O   TRP A 390      35.302  27.507  18.943  1.00  0.96           O  
ATOM   3089  CB  TRP A 390      36.799  27.509  16.159  1.00  0.96           C  
ATOM   3090  CG  TRP A 390      37.093  26.037  15.925  1.00  0.96           C  
ATOM   3091  CD1 TRP A 390      36.931  25.286  14.793  1.00  0.96           C  
ATOM   3092  CD2 TRP A 390      37.650  25.137  16.914  1.00  0.96           C  
ATOM   3093  NE1 TRP A 390      37.366  23.986  14.996  1.00  0.96           N  
ATOM   3094  CE2 TRP A 390      37.785  23.892  16.309  1.00  0.96           C  
ATOM   3095  CE3 TRP A 390      38.065  25.366  18.230  1.00  0.96           C  
ATOM   3096  CZ2 TRP A 390      38.343  22.808  16.993  1.00  0.96           C  
ATOM   3097  CZ3 TRP A 390      38.639  24.281  18.919  1.00  0.96           C  
ATOM   3098  CH2 TRP A 390      38.758  23.022  18.318  1.00  0.96           C  
ATOM   3099  N   CYS A 391      34.219  25.970  17.705  1.00  1.00           N  
ATOM   3100  CA  CYS A 391      33.670  25.171  18.793  1.00  1.00           C  
ATOM   3101  C   CYS A 391      32.703  25.914  19.705  1.00  1.00           C  
ATOM   3102  O   CYS A 391      32.519  25.591  20.875  1.00  1.00           O  
ATOM   3103  CB  CYS A 391      34.761  24.408  19.581  1.00  1.00           C  
ATOM   3104  SG  CYS A 391      35.360  22.963  18.668  1.00  1.00           S  
ATOM   3105  N   GLY A 392      31.991  26.893  19.128  1.00  1.00           N  
ATOM   3106  CA  GLY A 392      30.746  27.435  19.635  1.00  1.00           C  
ATOM   3107  C   GLY A 392      29.597  26.725  18.974  1.00  1.00           C  
ATOM   3108  O   GLY A 392      29.644  25.527  18.707  1.00  1.00           O  
ATOM   3109  N   SER A 393      28.533  27.472  18.655  1.00  1.00           N  
ATOM   3110  CA  SER A 393      27.350  26.936  18.010  1.00  1.00           C  
ATOM   3111  C   SER A 393      26.836  27.897  16.970  1.00  1.00           C  
ATOM   3112  O   SER A 393      26.867  29.113  17.134  1.00  1.00           O  
ATOM   3113  CB  SER A 393      26.149  26.718  18.967  1.00  1.00           C  
ATOM   3114  OG  SER A 393      26.446  25.741  19.965  1.00  1.00           O  
ATOM   3115  N   ILE A 394      26.295  27.361  15.864  1.00  0.99           N  
ATOM   3116  CA  ILE A 394      25.515  28.129  14.908  1.00  0.99           C  
ATOM   3117  C   ILE A 394      24.140  27.515  14.934  1.00  0.99           C  
ATOM   3118  O   ILE A 394      23.995  26.297  15.004  1.00  0.99           O  
ATOM   3119  CB  ILE A 394      26.093  28.094  13.493  1.00  0.99           C  
ATOM   3120  CG1 ILE A 394      27.400  28.916  13.460  1.00  0.99           C  
ATOM   3121  CG2 ILE A 394      25.072  28.621  12.456  1.00  0.99           C  
ATOM   3122  CD1 ILE A 394      28.174  28.787  12.144  1.00  0.99           C  
ATOM   3123  N   GLY A 395      23.077  28.336  14.914  1.00  0.99           N  
ATOM   3124  CA  GLY A 395      21.740  27.778  14.850  1.00  0.99           C  
ATOM   3125  C   GLY A 395      20.663  28.804  14.769  1.00  0.99           C  
ATOM   3126  O   GLY A 395      20.902  29.976  14.480  1.00  0.99           O  
ATOM   3127  N   TYR A 396      19.426  28.359  15.041  1.00  0.97           N  
ATOM   3128  CA  TYR A 396      18.253  29.205  15.040  1.00  0.97           C  
ATOM   3129  C   TYR A 396      17.434  28.995  16.294  1.00  0.97           C  
ATOM   3130  O   TYR A 396      17.390  27.901  16.846  1.00  0.97           O  
ATOM   3131  CB  TYR A 396      17.361  29.015  13.778  1.00  0.97           C  
ATOM   3132  CG  TYR A 396      16.770  27.635  13.627  1.00  0.97           C  
ATOM   3133  CD1 TYR A 396      15.568  27.277  14.266  1.00  0.97           C  
ATOM   3134  CD2 TYR A 396      17.411  26.689  12.815  1.00  0.97           C  
ATOM   3135  CE1 TYR A 396      15.016  26.001  14.085  1.00  0.97           C  
ATOM   3136  CE2 TYR A 396      16.863  25.415  12.629  1.00  0.97           C  
ATOM   3137  CZ  TYR A 396      15.668  25.073  13.267  1.00  0.97           C  
ATOM   3138  OH  TYR A 396      15.145  23.777  13.122  1.00  0.97           O  
ATOM   3139  N   LEU A 397      16.746  30.055  16.750  1.00  0.97           N  
ATOM   3140  CA  LEU A 397      15.705  29.981  17.754  1.00  0.97           C  
ATOM   3141  C   LEU A 397      14.480  30.584  17.092  1.00  0.97           C  
ATOM   3142  O   LEU A 397      14.412  31.780  16.816  1.00  0.97           O  
ATOM   3143  CB  LEU A 397      16.010  30.769  19.060  1.00  0.97           C  
ATOM   3144  CG  LEU A 397      17.070  30.165  20.014  1.00  0.97           C  
ATOM   3145  CD1 LEU A 397      18.514  30.233  19.493  1.00  0.97           C  
ATOM   3146  CD2 LEU A 397      17.015  30.878  21.372  1.00  0.97           C  
ATOM   3147  N   SER A 398      13.483  29.746  16.781  1.00  0.97           N  
ATOM   3148  CA  SER A 398      12.313  30.120  16.006  1.00  0.97           C  
ATOM   3149  C   SER A 398      11.265  30.805  16.860  1.00  0.97           C  
ATOM   3150  O   SER A 398      11.128  30.524  18.049  1.00  0.97           O  
ATOM   3151  CB  SER A 398      11.682  28.860  15.351  1.00  0.97           C  
ATOM   3152  OG  SER A 398      10.618  29.163  14.443  1.00  0.97           O  
ATOM   3153  N   PHE A 399      10.432  31.677  16.255  1.00  0.94           N  
ATOM   3154  CA  PHE A 399       9.280  32.281  16.911  1.00  0.94           C  
ATOM   3155  C   PHE A 399       8.213  31.253  17.308  1.00  0.94           C  
ATOM   3156  O   PHE A 399       7.374  31.505  18.167  1.00  0.94           O  
ATOM   3157  CB  PHE A 399       8.595  33.320  15.979  1.00  0.94           C  
ATOM   3158  CG  PHE A 399       9.334  34.626  15.837  1.00  0.94           C  
ATOM   3159  CD1 PHE A 399       9.705  35.385  16.961  1.00  0.94           C  
ATOM   3160  CD2 PHE A 399       9.527  35.180  14.560  1.00  0.94           C  
ATOM   3161  CE1 PHE A 399      10.294  36.648  16.810  1.00  0.94           C  
ATOM   3162  CE2 PHE A 399      10.118  36.441  14.403  1.00  0.94           C  
ATOM   3163  CZ  PHE A 399      10.511  37.172  15.530  1.00  0.94           C  
ATOM   3164  N   CYS A 400       8.231  30.038  16.715  1.00  0.96           N  
ATOM   3165  CA  CYS A 400       7.359  28.945  17.134  1.00  0.96           C  
ATOM   3166  C   CYS A 400       7.866  28.215  18.381  1.00  0.96           C  
ATOM   3167  O   CYS A 400       7.164  27.391  18.959  1.00  0.96           O  
ATOM   3168  CB  CYS A 400       7.101  27.921  15.989  1.00  0.96           C  
ATOM   3169  SG  CYS A 400       8.552  26.980  15.406  1.00  0.96           S  
ATOM   3170  N   GLY A 401       9.112  28.501  18.826  1.00  0.96           N  
ATOM   3171  CA  GLY A 401       9.730  27.913  20.015  1.00  0.96           C  
ATOM   3172  C   GLY A 401      10.777  26.870  19.724  1.00  0.96           C  
ATOM   3173  O   GLY A 401      11.563  26.518  20.601  1.00  0.96           O  
ATOM   3174  N   ASN A 402      10.840  26.364  18.476  1.00  0.95           N  
ATOM   3175  CA  ASN A 402      11.876  25.440  18.026  1.00  0.95           C  
ATOM   3176  C   ASN A 402      13.289  26.008  18.040  1.00  0.95           C  
ATOM   3177  O   ASN A 402      13.520  27.203  17.860  1.00  0.95           O  
ATOM   3178  CB  ASN A 402      11.645  24.883  16.597  1.00  0.95           C  
ATOM   3179  CG  ASN A 402      10.433  23.968  16.550  1.00  0.95           C  
ATOM   3180  OD1 ASN A 402       9.927  23.498  17.570  1.00  0.95           O  
ATOM   3181  ND2 ASN A 402       9.969  23.696  15.308  1.00  0.95           N  
ATOM   3182  N   MET A 403      14.279  25.122  18.213  1.00  0.96           N  
ATOM   3183  CA  MET A 403      15.679  25.462  18.147  1.00  0.96           C  
ATOM   3184  C   MET A 403      16.424  24.313  17.513  1.00  0.96           C  
ATOM   3185  O   MET A 403      16.081  23.155  17.722  1.00  0.96           O  
ATOM   3186  CB  MET A 403      16.245  25.723  19.568  1.00  0.96           C  
ATOM   3187  CG  MET A 403      17.738  26.105  19.649  1.00  0.96           C  
ATOM   3188  SD  MET A 403      18.314  26.506  21.319  1.00  0.96           S  
ATOM   3189  CE  MET A 403      18.425  24.793  21.910  1.00  0.96           C  
ATOM   3190  N   ASP A 404      17.473  24.601  16.734  1.00  0.96           N  
ATOM   3191  CA  ASP A 404      18.427  23.602  16.316  1.00  0.96           C  
ATOM   3192  C   ASP A 404      19.758  24.314  16.284  1.00  0.96           C  
ATOM   3193  O   ASP A 404      19.836  25.489  15.916  1.00  0.96           O  
ATOM   3194  CB  ASP A 404      18.061  22.997  14.941  1.00  0.96           C  
ATOM   3195  CG  ASP A 404      18.731  21.673  14.660  1.00  0.96           C  
ATOM   3196  OD1 ASP A 404      19.484  21.119  15.500  1.00  0.96           O  
ATOM   3197  OD2 ASP A 404      18.447  21.137  13.559  1.00  0.96           O  
ATOM   3198  N   THR A 405      20.825  23.632  16.722  1.00  0.99           N  
ATOM   3199  CA  THR A 405      22.151  24.213  16.863  1.00  0.99           C  
ATOM   3200  C   THR A 405      23.202  23.190  16.502  1.00  0.99           C  
ATOM   3201  O   THR A 405      23.072  21.992  16.742  1.00  0.99           O  
ATOM   3202  CB  THR A 405      22.525  24.795  18.240  1.00  0.99           C  
ATOM   3203  OG1 THR A 405      22.339  23.891  19.316  1.00  0.99           O  
ATOM   3204  CG2 THR A 405      21.674  26.021  18.588  1.00  0.99           C  
ATOM   3205  N   SER A 406      24.303  23.654  15.892  1.00  0.98           N  
ATOM   3206  CA  SER A 406      25.495  22.867  15.633  1.00  0.98           C  
ATOM   3207  C   SER A 406      26.519  23.029  16.745  1.00  0.98           C  
ATOM   3208  O   SER A 406      26.411  23.914  17.592  1.00  0.98           O  
ATOM   3209  CB  SER A 406      26.140  23.222  14.261  1.00  0.98           C  
ATOM   3210  OG  SER A 406      26.671  24.549  14.198  1.00  0.98           O  
ATOM   3211  N   ILE A 407      27.561  22.177  16.770  1.00  0.98           N  
ATOM   3212  CA  ILE A 407      28.849  22.557  17.343  1.00  0.98           C  
ATOM   3213  C   ILE A 407      29.690  23.023  16.175  1.00  0.98           C  
ATOM   3214  O   ILE A 407      29.742  22.359  15.144  1.00  0.98           O  
ATOM   3215  CB  ILE A 407      29.595  21.415  18.034  1.00  0.98           C  
ATOM   3216  CG1 ILE A 407      28.805  20.837  19.228  1.00  0.98           C  
ATOM   3217  CG2 ILE A 407      31.003  21.857  18.495  1.00  0.98           C  
ATOM   3218  CD1 ILE A 407      28.651  21.793  20.417  1.00  0.98           C  
ATOM   3219  N   THR A 408      30.382  24.174  16.250  1.00  0.99           N  
ATOM   3220  CA  THR A 408      31.227  24.639  15.148  1.00  0.99           C  
ATOM   3221  C   THR A 408      32.608  23.998  15.109  1.00  0.99           C  
ATOM   3222  O   THR A 408      33.636  24.675  15.093  1.00  0.99           O  
ATOM   3223  CB  THR A 408      31.355  26.154  15.034  1.00  0.99           C  
ATOM   3224  OG1 THR A 408      31.693  26.758  16.269  1.00  0.99           O  
ATOM   3225  CG2 THR A 408      30.001  26.731  14.617  1.00  0.99           C  
ATOM   3226  N   ILE A 409      32.657  22.651  15.033  1.00  0.97           N  
ATOM   3227  CA  ILE A 409      33.810  21.906  14.552  1.00  0.97           C  
ATOM   3228  C   ILE A 409      33.839  21.930  13.028  1.00  0.97           C  
ATOM   3229  O   ILE A 409      32.804  22.034  12.379  1.00  0.97           O  
ATOM   3230  CB  ILE A 409      33.843  20.439  14.994  1.00  0.97           C  
ATOM   3231  CG1 ILE A 409      32.543  19.675  14.646  1.00  0.97           C  
ATOM   3232  CG2 ILE A 409      34.151  20.363  16.502  1.00  0.97           C  
ATOM   3233  CD1 ILE A 409      32.731  18.153  14.612  1.00  0.97           C  
ATOM   3234  N   ARG A 410      35.048  21.818  12.422  1.00  0.91           N  
ATOM   3235  CA  ARG A 410      35.253  21.818  10.971  1.00  0.91           C  
ATOM   3236  C   ARG A 410      34.897  23.160  10.341  1.00  0.91           C  
ATOM   3237  O   ARG A 410      34.304  23.238   9.267  1.00  0.91           O  
ATOM   3238  CB  ARG A 410      34.496  20.675  10.229  1.00  0.91           C  
ATOM   3239  CG  ARG A 410      34.657  19.253  10.800  1.00  0.91           C  
ATOM   3240  CD  ARG A 410      36.071  18.668  10.724  1.00  0.91           C  
ATOM   3241  NE  ARG A 410      35.975  17.255  11.226  1.00  0.91           N  
ATOM   3242  CZ  ARG A 410      35.833  16.915  12.513  1.00  0.91           C  
ATOM   3243  NH1 ARG A 410      36.100  17.783  13.483  1.00  0.91           N  
ATOM   3244  NH2 ARG A 410      35.406  15.692  12.822  1.00  0.91           N  
ATOM   3245  N   THR A 411      35.270  24.251  11.026  1.00  0.98           N  
ATOM   3246  CA  THR A 411      34.734  25.574  10.760  1.00  0.98           C  
ATOM   3247  C   THR A 411      35.869  26.533  10.645  1.00  0.98           C  
ATOM   3248  O   THR A 411      36.809  26.507  11.439  1.00  0.98           O  
ATOM   3249  CB  THR A 411      33.782  26.053  11.847  1.00  0.98           C  
ATOM   3250  OG1 THR A 411      32.648  25.207  11.827  1.00  0.98           O  
ATOM   3251  CG2 THR A 411      33.258  27.481  11.622  1.00  0.98           C  
ATOM   3252  N   LEU A 412      35.801  27.399   9.624  1.00  0.97           N  
ATOM   3253  CA  LEU A 412      36.813  28.372   9.329  1.00  0.97           C  
ATOM   3254  C   LEU A 412      36.279  29.769   9.551  1.00  0.97           C  
ATOM   3255  O   LEU A 412      35.135  30.093   9.229  1.00  0.97           O  
ATOM   3256  CB  LEU A 412      37.345  28.292   7.876  1.00  0.97           C  
ATOM   3257  CG  LEU A 412      37.824  26.893   7.442  1.00  0.97           C  
ATOM   3258  CD1 LEU A 412      36.745  26.147   6.640  1.00  0.97           C  
ATOM   3259  CD2 LEU A 412      39.119  27.000   6.627  1.00  0.97           C  
ATOM   3260  N   THR A 413      37.139  30.633  10.105  1.00  0.98           N  
ATOM   3261  CA  THR A 413      36.835  32.029  10.380  1.00  0.98           C  
ATOM   3262  C   THR A 413      37.671  32.848   9.437  1.00  0.98           C  
ATOM   3263  O   THR A 413      38.898  32.790   9.490  1.00  0.98           O  
ATOM   3264  CB  THR A 413      37.204  32.465  11.794  1.00  0.98           C  
ATOM   3265  OG1 THR A 413      36.511  31.676  12.747  1.00  0.98           O  
ATOM   3266  CG2 THR A 413      36.787  33.920  12.053  1.00  0.98           C  
ATOM   3267  N   ALA A 414      37.033  33.621   8.540  1.00  0.97           N  
ATOM   3268  CA  ALA A 414      37.710  34.414   7.537  1.00  0.97           C  
ATOM   3269  C   ALA A 414      37.505  35.890   7.844  1.00  0.97           C  
ATOM   3270  O   ALA A 414      36.387  36.408   7.830  1.00  0.97           O  
ATOM   3271  CB  ALA A 414      37.147  34.066   6.150  1.00  0.97           C  
ATOM   3272  N   ILE A 415      38.596  36.586   8.210  1.00  0.93           N  
ATOM   3273  CA  ILE A 415      38.523  37.922   8.768  1.00  0.93           C  
ATOM   3274  C   ILE A 415      39.800  38.685   8.444  1.00  0.93           C  
ATOM   3275  O   ILE A 415      40.903  38.171   8.593  1.00  0.93           O  
ATOM   3276  CB  ILE A 415      38.250  37.871  10.279  1.00  0.93           C  
ATOM   3277  CG1 ILE A 415      38.293  39.268  10.934  1.00  0.93           C  
ATOM   3278  CG2 ILE A 415      39.198  36.873  10.991  1.00  0.93           C  
ATOM   3279  CD1 ILE A 415      37.589  39.317  12.292  1.00  0.93           C  
ATOM   3280  N   ASN A 416      39.702  39.952   7.975  1.00  0.83           N  
ATOM   3281  CA  ASN A 416      40.831  40.872   7.804  1.00  0.83           C  
ATOM   3282  C   ASN A 416      42.027  40.346   6.997  1.00  0.83           C  
ATOM   3283  O   ASN A 416      43.181  40.622   7.315  1.00  0.83           O  
ATOM   3284  CB  ASN A 416      41.325  41.419   9.176  1.00  0.83           C  
ATOM   3285  CG  ASN A 416      40.196  42.160   9.878  1.00  0.83           C  
ATOM   3286  OD1 ASN A 416      39.272  42.674   9.252  1.00  0.83           O  
ATOM   3287  ND2 ASN A 416      40.262  42.234  11.228  1.00  0.83           N  
ATOM   3288  N   GLY A 417      41.771  39.581   5.911  1.00  0.90           N  
ATOM   3289  CA  GLY A 417      42.811  38.981   5.071  1.00  0.90           C  
ATOM   3290  C   GLY A 417      43.416  37.705   5.614  1.00  0.90           C  
ATOM   3291  O   GLY A 417      44.336  37.149   5.019  1.00  0.90           O  
ATOM   3292  N   GLN A 418      42.918  37.203   6.761  1.00  0.91           N  
ATOM   3293  CA  GLN A 418      43.400  36.013   7.437  1.00  0.91           C  
ATOM   3294  C   GLN A 418      42.299  34.989   7.632  1.00  0.91           C  
ATOM   3295  O   GLN A 418      41.168  35.301   8.005  1.00  0.91           O  
ATOM   3296  CB  GLN A 418      44.002  36.333   8.824  1.00  0.91           C  
ATOM   3297  CG  GLN A 418      45.187  37.319   8.733  1.00  0.91           C  
ATOM   3298  CD  GLN A 418      46.300  36.935   9.705  1.00  0.91           C  
ATOM   3299  OE1 GLN A 418      46.256  37.214  10.901  1.00  0.91           O  
ATOM   3300  NE2 GLN A 418      47.332  36.238   9.176  1.00  0.91           N  
ATOM   3301  N   ILE A 419      42.612  33.711   7.367  1.00  0.94           N  
ATOM   3302  CA  ILE A 419      41.676  32.615   7.512  1.00  0.94           C  
ATOM   3303  C   ILE A 419      42.227  31.622   8.515  1.00  0.94           C  
ATOM   3304  O   ILE A 419      43.385  31.207   8.465  1.00  0.94           O  
ATOM   3305  CB  ILE A 419      41.272  31.977   6.179  1.00  0.94           C  
ATOM   3306  CG1 ILE A 419      40.181  30.895   6.371  1.00  0.94           C  
ATOM   3307  CG2 ILE A 419      42.499  31.460   5.394  1.00  0.94           C  
ATOM   3308  CD1 ILE A 419      39.381  30.600   5.096  1.00  0.94           C  
ATOM   3309  N   PHE A 420      41.391  31.256   9.501  1.00  0.94           N  
ATOM   3310  CA  PHE A 420      41.752  30.408  10.618  1.00  0.94           C  
ATOM   3311  C   PHE A 420      40.911  29.153  10.578  1.00  0.94           C  
ATOM   3312  O   PHE A 420      39.720  29.220  10.290  1.00  0.94           O  
ATOM   3313  CB  PHE A 420      41.452  31.087  11.980  1.00  0.94           C  
ATOM   3314  CG  PHE A 420      42.229  32.360  12.127  1.00  0.94           C  
ATOM   3315  CD1 PHE A 420      43.557  32.326  12.578  1.00  0.94           C  
ATOM   3316  CD2 PHE A 420      41.635  33.600  11.840  1.00  0.94           C  
ATOM   3317  CE1 PHE A 420      44.273  33.514  12.769  1.00  0.94           C  
ATOM   3318  CE2 PHE A 420      42.352  34.789  12.021  1.00  0.94           C  
ATOM   3319  CZ  PHE A 420      43.668  34.746  12.494  1.00  0.94           C  
ATOM   3320  N   CYS A 421      41.504  27.986  10.889  1.00  0.99           N  
ATOM   3321  CA  CYS A 421      40.781  26.737  11.073  1.00  0.99           C  
ATOM   3322  C   CYS A 421      41.429  25.989  12.217  1.00  0.99           C  
ATOM   3323  O   CYS A 421      42.648  25.851  12.263  1.00  0.99           O  
ATOM   3324  CB  CYS A 421      40.854  25.844   9.803  1.00  0.99           C  
ATOM   3325  SG  CYS A 421      39.829  24.326   9.853  1.00  0.99           S  
ATOM   3326  N   SER A 422      40.644  25.478  13.180  1.00  0.98           N  
ATOM   3327  CA  SER A 422      41.202  24.819  14.352  1.00  0.98           C  
ATOM   3328  C   SER A 422      40.796  23.365  14.421  1.00  0.98           C  
ATOM   3329  O   SER A 422      39.770  22.928  13.892  1.00  0.98           O  
ATOM   3330  CB  SER A 422      40.827  25.492  15.695  1.00  0.98           C  
ATOM   3331  OG  SER A 422      41.255  26.852  15.744  1.00  0.98           O  
ATOM   3332  N   ALA A 423      41.638  22.554  15.074  1.00  0.99           N  
ATOM   3333  CA  ALA A 423      41.467  21.132  15.168  1.00  0.99           C  
ATOM   3334  C   ALA A 423      41.796  20.643  16.564  1.00  0.99           C  
ATOM   3335  O   ALA A 423      42.891  20.879  17.065  1.00  0.99           O  
ATOM   3336  CB  ALA A 423      42.427  20.470  14.179  1.00  0.99           C  
ATOM   3337  N   GLY A 424      40.850  19.940  17.228  1.00  0.97           N  
ATOM   3338  CA  GLY A 424      41.032  19.457  18.595  1.00  0.97           C  
ATOM   3339  C   GLY A 424      40.915  17.975  18.744  1.00  0.97           C  
ATOM   3340  O   GLY A 424      40.254  17.307  17.951  1.00  0.97           O  
ATOM   3341  N   GLY A 425      41.551  17.431  19.793  1.00  0.96           N  
ATOM   3342  CA  GLY A 425      41.509  16.021  20.166  1.00  0.96           C  
ATOM   3343  C   GLY A 425      41.005  15.911  21.568  1.00  0.96           C  
ATOM   3344  O   GLY A 425      40.910  16.916  22.268  1.00  0.96           O  
ATOM   3345  N   GLY A 426      40.653  14.695  22.010  1.00  0.92           N  
ATOM   3346  CA  GLY A 426      40.137  14.428  23.346  1.00  0.92           C  
ATOM   3347  C   GLY A 426      41.197  13.722  24.130  1.00  0.92           C  
ATOM   3348  O   GLY A 426      41.632  12.639  23.778  1.00  0.92           O  
ATOM   3349  N   ILE A 427      41.667  14.317  25.234  1.00  0.94           N  
ATOM   3350  CA  ILE A 427      42.749  13.711  25.981  1.00  0.94           C  
ATOM   3351  C   ILE A 427      42.188  13.100  27.241  1.00  0.94           C  
ATOM   3352  O   ILE A 427      41.601  13.788  28.079  1.00  0.94           O  
ATOM   3353  CB  ILE A 427      43.845  14.712  26.312  1.00  0.94           C  
ATOM   3354  CG1 ILE A 427      44.425  15.300  25.003  1.00  0.94           C  
ATOM   3355  CG2 ILE A 427      44.951  14.025  27.150  1.00  0.94           C  
ATOM   3356  CD1 ILE A 427      45.372  16.481  25.227  1.00  0.94           C  
ATOM   3357  N   VAL A 428      42.384  11.779  27.398  1.00  0.91           N  
ATOM   3358  CA  VAL A 428      42.088  11.016  28.596  1.00  0.91           C  
ATOM   3359  C   VAL A 428      43.374  10.319  29.014  1.00  0.91           C  
ATOM   3360  O   VAL A 428      44.407  10.473  28.373  1.00  0.91           O  
ATOM   3361  CB  VAL A 428      40.957  10.012  28.433  1.00  0.91           C  
ATOM   3362  CG1 VAL A 428      39.673  10.788  28.098  1.00  0.91           C  
ATOM   3363  CG2 VAL A 428      41.275   9.008  27.319  1.00  0.91           C  
ATOM   3364  N   ALA A 429      43.375   9.540  30.118  1.00  0.90           N  
ATOM   3365  CA  ALA A 429      44.563   8.872  30.640  1.00  0.90           C  
ATOM   3366  C   ALA A 429      45.265   7.920  29.664  1.00  0.90           C  
ATOM   3367  O   ALA A 429      46.489   7.811  29.652  1.00  0.90           O  
ATOM   3368  CB  ALA A 429      44.181   8.101  31.919  1.00  0.90           C  
ATOM   3369  N   ASP A 430      44.482   7.240  28.808  1.00  0.85           N  
ATOM   3370  CA  ASP A 430      44.959   6.256  27.862  1.00  0.85           C  
ATOM   3371  C   ASP A 430      45.316   6.879  26.501  1.00  0.85           C  
ATOM   3372  O   ASP A 430      45.688   6.185  25.551  1.00  0.85           O  
ATOM   3373  CB  ASP A 430      43.824   5.226  27.610  1.00  0.85           C  
ATOM   3374  CG  ASP A 430      43.454   4.367  28.811  1.00  0.85           C  
ATOM   3375  OD1 ASP A 430      43.951   4.609  29.935  1.00  0.85           O  
ATOM   3376  OD2 ASP A 430      42.612   3.461  28.582  1.00  0.85           O  
ATOM   3377  N   SER A 431      45.219   8.218  26.344  1.00  0.90           N  
ATOM   3378  CA  SER A 431      45.647   8.912  25.130  1.00  0.90           C  
ATOM   3379  C   SER A 431      47.158   8.876  24.944  1.00  0.90           C  
ATOM   3380  O   SER A 431      47.929   8.730  25.886  1.00  0.90           O  
ATOM   3381  CB  SER A 431      45.109  10.360  24.988  1.00  0.90           C  
ATOM   3382  OG  SER A 431      43.691  10.334  24.800  1.00  0.90           O  
ATOM   3383  N   GLN A 432      47.652   8.955  23.690  1.00  0.86           N  
ATOM   3384  CA  GLN A 432      49.077   8.847  23.408  1.00  0.86           C  
ATOM   3385  C   GLN A 432      49.522  10.034  22.573  1.00  0.86           C  
ATOM   3386  O   GLN A 432      48.873  10.379  21.588  1.00  0.86           O  
ATOM   3387  CB  GLN A 432      49.413   7.527  22.667  1.00  0.86           C  
ATOM   3388  CG  GLN A 432      49.102   6.248  23.484  1.00  0.86           C  
ATOM   3389  CD  GLN A 432      49.982   6.163  24.735  1.00  0.86           C  
ATOM   3390  OE1 GLN A 432      51.210   6.178  24.637  1.00  0.86           O  
ATOM   3391  NE2 GLN A 432      49.365   6.078  25.933  1.00  0.86           N  
ATOM   3392  N   GLU A 433      50.644  10.690  22.955  1.00  0.89           N  
ATOM   3393  CA  GLU A 433      51.046  12.019  22.498  1.00  0.89           C  
ATOM   3394  C   GLU A 433      51.119  12.215  20.980  1.00  0.89           C  
ATOM   3395  O   GLU A 433      50.487  13.115  20.425  1.00  0.89           O  
ATOM   3396  CB  GLU A 433      52.423  12.337  23.151  1.00  0.89           C  
ATOM   3397  CG  GLU A 433      52.924  13.792  22.985  1.00  0.89           C  
ATOM   3398  CD  GLU A 433      54.329  13.997  23.556  1.00  0.89           C  
ATOM   3399  OE1 GLU A 433      54.586  13.734  24.760  1.00  0.89           O  
ATOM   3400  OE2 GLU A 433      55.193  14.449  22.761  1.00  0.89           O  
ATOM   3401  N   GLU A 434      51.841  11.326  20.262  1.00  0.84           N  
ATOM   3402  CA  GLU A 434      51.958  11.342  18.807  1.00  0.84           C  
ATOM   3403  C   GLU A 434      50.654  11.028  18.073  1.00  0.84           C  
ATOM   3404  O   GLU A 434      50.270  11.678  17.103  1.00  0.84           O  
ATOM   3405  CB  GLU A 434      53.056  10.349  18.334  1.00  0.84           C  
ATOM   3406  CG  GLU A 434      53.708  10.761  16.991  1.00  0.84           C  
ATOM   3407  CD  GLU A 434      54.539  12.005  17.238  1.00  0.84           C  
ATOM   3408  OE1 GLU A 434      55.438  11.954  18.119  1.00  0.84           O  
ATOM   3409  OE2 GLU A 434      54.241  13.070  16.645  1.00  0.84           O  
ATOM   3410  N   ALA A 435      49.904  10.012  18.553  1.00  0.92           N  
ATOM   3411  CA  ALA A 435      48.637   9.585  17.979  1.00  0.92           C  
ATOM   3412  C   ALA A 435      47.554  10.656  18.076  1.00  0.92           C  
ATOM   3413  O   ALA A 435      46.840  10.928  17.116  1.00  0.92           O  
ATOM   3414  CB  ALA A 435      48.155   8.279  18.651  1.00  0.92           C  
ATOM   3415  N   GLU A 436      47.457  11.326  19.243  1.00  0.90           N  
ATOM   3416  CA  GLU A 436      46.577  12.459  19.478  1.00  0.90           C  
ATOM   3417  C   GLU A 436      46.935  13.671  18.623  1.00  0.90           C  
ATOM   3418  O   GLU A 436      46.080  14.362  18.071  1.00  0.90           O  
ATOM   3419  CB  GLU A 436      46.613  12.851  20.972  1.00  0.90           C  
ATOM   3420  CG  GLU A 436      45.358  13.631  21.421  1.00  0.90           C  
ATOM   3421  CD  GLU A 436      44.130  12.737  21.550  1.00  0.90           C  
ATOM   3422  OE1 GLU A 436      44.258  11.643  22.165  1.00  0.90           O  
ATOM   3423  OE2 GLU A 436      43.066  13.173  21.052  1.00  0.90           O  
ATOM   3424  N   TYR A 437      48.251  13.939  18.448  1.00  0.92           N  
ATOM   3425  CA  TYR A 437      48.756  14.961  17.544  1.00  0.92           C  
ATOM   3426  C   TYR A 437      48.303  14.713  16.107  1.00  0.92           C  
ATOM   3427  O   TYR A 437      47.764  15.614  15.464  1.00  0.92           O  
ATOM   3428  CB  TYR A 437      50.310  14.998  17.629  1.00  0.92           C  
ATOM   3429  CG  TYR A 437      50.949  16.068  16.782  1.00  0.92           C  
ATOM   3430  CD1 TYR A 437      50.762  17.431  17.064  1.00  0.92           C  
ATOM   3431  CD2 TYR A 437      51.769  15.705  15.701  1.00  0.92           C  
ATOM   3432  CE1 TYR A 437      51.441  18.412  16.327  1.00  0.92           C  
ATOM   3433  CE2 TYR A 437      52.429  16.683  14.945  1.00  0.92           C  
ATOM   3434  CZ  TYR A 437      52.287  18.035  15.278  1.00  0.92           C  
ATOM   3435  OH  TYR A 437      52.955  19.018  14.526  1.00  0.92           O  
ATOM   3436  N   GLN A 438      48.430  13.456  15.623  1.00  0.88           N  
ATOM   3437  CA  GLN A 438      47.937  13.021  14.327  1.00  0.88           C  
ATOM   3438  C   GLN A 438      46.421  13.140  14.170  1.00  0.88           C  
ATOM   3439  O   GLN A 438      45.953  13.636  13.147  1.00  0.88           O  
ATOM   3440  CB  GLN A 438      48.407  11.581  13.983  1.00  0.88           C  
ATOM   3441  CG  GLN A 438      48.023  11.104  12.555  1.00  0.88           C  
ATOM   3442  CD  GLN A 438      48.553  12.071  11.494  1.00  0.88           C  
ATOM   3443  OE1 GLN A 438      49.736  12.419  11.485  1.00  0.88           O  
ATOM   3444  NE2 GLN A 438      47.687  12.537  10.571  1.00  0.88           N  
ATOM   3445  N   GLU A 439      45.608  12.776  15.197  1.00  0.89           N  
ATOM   3446  CA  GLU A 439      44.147  12.882  15.121  1.00  0.89           C  
ATOM   3447  C   GLU A 439      43.679  14.310  14.840  1.00  0.89           C  
ATOM   3448  O   GLU A 439      42.748  14.554  14.067  1.00  0.89           O  
ATOM   3449  CB  GLU A 439      43.362  12.340  16.368  1.00  0.89           C  
ATOM   3450  CG  GLU A 439      41.820  12.444  16.132  1.00  0.89           C  
ATOM   3451  CD  GLU A 439      40.793  12.261  17.257  1.00  0.89           C  
ATOM   3452  OE1 GLU A 439      40.983  12.822  18.350  1.00  0.89           O  
ATOM   3453  OE2 GLU A 439      39.629  11.931  16.899  1.00  0.89           O  
ATOM   3454  N   THR A 440      44.335  15.331  15.434  1.00  0.93           N  
ATOM   3455  CA  THR A 440      44.003  16.722  15.124  1.00  0.93           C  
ATOM   3456  C   THR A 440      44.200  17.076  13.643  1.00  0.93           C  
ATOM   3457  O   THR A 440      43.351  17.728  13.039  1.00  0.93           O  
ATOM   3458  CB  THR A 440      44.627  17.774  16.045  1.00  0.93           C  
ATOM   3459  OG1 THR A 440      46.025  17.922  15.860  1.00  0.93           O  
ATOM   3460  CG2 THR A 440      44.412  17.421  17.522  1.00  0.93           C  
ATOM   3461  N   PHE A 441      45.270  16.586  12.980  1.00  0.89           N  
ATOM   3462  CA  PHE A 441      45.418  16.668  11.530  1.00  0.89           C  
ATOM   3463  C   PHE A 441      44.354  15.908  10.745  1.00  0.89           C  
ATOM   3464  O   PHE A 441      43.775  16.453   9.805  1.00  0.89           O  
ATOM   3465  CB  PHE A 441      46.795  16.127  11.074  1.00  0.89           C  
ATOM   3466  CG  PHE A 441      47.873  17.098  11.424  1.00  0.89           C  
ATOM   3467  CD1 PHE A 441      48.110  18.220  10.613  1.00  0.89           C  
ATOM   3468  CD2 PHE A 441      48.663  16.898  12.559  1.00  0.89           C  
ATOM   3469  CE1 PHE A 441      49.132  19.124  10.931  1.00  0.89           C  
ATOM   3470  CE2 PHE A 441      49.656  17.818  12.902  1.00  0.89           C  
ATOM   3471  CZ  PHE A 441      49.901  18.929  12.086  1.00  0.89           C  
ATOM   3472  N   ASP A 442      44.022  14.655  11.127  1.00  0.89           N  
ATOM   3473  CA  ASP A 442      43.084  13.789  10.418  1.00  0.89           C  
ATOM   3474  C   ASP A 442      41.707  14.429  10.245  1.00  0.89           C  
ATOM   3475  O   ASP A 442      41.085  14.376   9.183  1.00  0.89           O  
ATOM   3476  CB  ASP A 442      42.946  12.434  11.165  1.00  0.89           C  
ATOM   3477  CG  ASP A 442      44.222  11.613  11.077  1.00  0.89           C  
ATOM   3478  OD1 ASP A 442      45.065  11.899  10.187  1.00  0.89           O  
ATOM   3479  OD2 ASP A 442      44.365  10.667  11.889  1.00  0.89           O  
ATOM   3480  N   LYS A 443      41.237  15.136  11.287  1.00  0.88           N  
ATOM   3481  CA  LYS A 443      40.015  15.914  11.274  1.00  0.88           C  
ATOM   3482  C   LYS A 443      39.921  17.029  10.232  1.00  0.88           C  
ATOM   3483  O   LYS A 443      38.849  17.244   9.661  1.00  0.88           O  
ATOM   3484  CB  LYS A 443      39.803  16.517  12.682  1.00  0.88           C  
ATOM   3485  CG  LYS A 443      39.118  15.505  13.615  1.00  0.88           C  
ATOM   3486  CD  LYS A 443      39.675  15.523  15.047  1.00  0.88           C  
ATOM   3487  CE  LYS A 443      38.697  15.058  16.114  1.00  0.88           C  
ATOM   3488  NZ  LYS A 443      39.307  14.852  17.395  1.00  0.88           N  
ATOM   3489  N   VAL A 444      41.009  17.794   9.987  1.00  0.94           N  
ATOM   3490  CA  VAL A 444      40.946  18.985   9.141  1.00  0.94           C  
ATOM   3491  C   VAL A 444      41.815  18.938   7.894  1.00  0.94           C  
ATOM   3492  O   VAL A 444      41.683  19.809   7.036  1.00  0.94           O  
ATOM   3493  CB  VAL A 444      41.240  20.283   9.896  1.00  0.94           C  
ATOM   3494  CG1 VAL A 444      40.210  20.448  11.033  1.00  0.94           C  
ATOM   3495  CG2 VAL A 444      42.689  20.329  10.420  1.00  0.94           C  
ATOM   3496  N   ASN A 445      42.662  17.903   7.687  1.00  0.91           N  
ATOM   3497  CA  ASN A 445      43.591  17.811   6.558  1.00  0.91           C  
ATOM   3498  C   ASN A 445      42.927  17.951   5.191  1.00  0.91           C  
ATOM   3499  O   ASN A 445      43.435  18.617   4.292  1.00  0.91           O  
ATOM   3500  CB  ASN A 445      44.363  16.454   6.589  1.00  0.91           C  
ATOM   3501  CG  ASN A 445      45.703  16.608   7.302  1.00  0.91           C  
ATOM   3502  OD1 ASN A 445      46.153  17.701   7.639  1.00  0.91           O  
ATOM   3503  ND2 ASN A 445      46.405  15.469   7.506  1.00  0.91           N  
ATOM   3504  N   ARG A 446      41.729  17.361   5.007  1.00  0.86           N  
ATOM   3505  CA  ARG A 446      40.955  17.539   3.790  1.00  0.86           C  
ATOM   3506  C   ARG A 446      40.514  18.964   3.481  1.00  0.86           C  
ATOM   3507  O   ARG A 446      40.393  19.327   2.307  1.00  0.86           O  
ATOM   3508  CB  ARG A 446      39.673  16.686   3.742  1.00  0.86           C  
ATOM   3509  CG  ARG A 446      39.907  15.200   3.436  1.00  0.86           C  
ATOM   3510  CD  ARG A 446      38.617  14.462   3.062  1.00  0.86           C  
ATOM   3511  NE  ARG A 446      38.123  14.928   1.714  1.00  0.86           N  
ATOM   3512  CZ  ARG A 446      37.047  15.712   1.542  1.00  0.86           C  
ATOM   3513  NH1 ARG A 446      36.575  16.501   2.499  1.00  0.86           N  
ATOM   3514  NH2 ARG A 446      36.388  15.677   0.390  1.00  0.86           N  
ATOM   3515  N   ILE A 447      40.203  19.756   4.524  1.00  0.94           N  
ATOM   3516  CA  ILE A 447      39.818  21.153   4.420  1.00  0.94           C  
ATOM   3517  C   ILE A 447      41.021  22.009   4.088  1.00  0.94           C  
ATOM   3518  O   ILE A 447      40.980  22.797   3.144  1.00  0.94           O  
ATOM   3519  CB  ILE A 447      39.128  21.599   5.713  1.00  0.94           C  
ATOM   3520  CG1 ILE A 447      37.722  20.953   5.762  1.00  0.94           C  
ATOM   3521  CG2 ILE A 447      39.050  23.140   5.837  1.00  0.94           C  
ATOM   3522  CD1 ILE A 447      36.994  21.154   7.097  1.00  0.94           C  
ATOM   3523  N   LEU A 448      42.151  21.818   4.807  1.00  0.92           N  
ATOM   3524  CA  LEU A 448      43.354  22.612   4.616  1.00  0.92           C  
ATOM   3525  C   LEU A 448      43.941  22.455   3.218  1.00  0.92           C  
ATOM   3526  O   LEU A 448      44.147  23.441   2.512  1.00  0.92           O  
ATOM   3527  CB  LEU A 448      44.435  22.278   5.681  1.00  0.92           C  
ATOM   3528  CG  LEU A 448      43.994  22.434   7.155  1.00  0.92           C  
ATOM   3529  CD1 LEU A 448      45.162  22.084   8.090  1.00  0.92           C  
ATOM   3530  CD2 LEU A 448      43.452  23.833   7.490  1.00  0.92           C  
ATOM   3531  N   LYS A 449      44.084  21.198   2.738  1.00  0.86           N  
ATOM   3532  CA  LYS A 449      44.611  20.888   1.412  1.00  0.86           C  
ATOM   3533  C   LYS A 449      43.786  21.504   0.268  1.00  0.86           C  
ATOM   3534  O   LYS A 449      44.289  21.810  -0.805  1.00  0.86           O  
ATOM   3535  CB  LYS A 449      44.722  19.337   1.186  1.00  0.86           C  
ATOM   3536  CG  LYS A 449      43.362  18.674   0.889  1.00  0.86           C  
ATOM   3537  CD  LYS A 449      43.316  17.196   0.476  1.00  0.86           C  
ATOM   3538  CE  LYS A 449      41.900  16.732   0.062  1.00  0.86           C  
ATOM   3539  NZ  LYS A 449      41.099  17.824  -0.561  1.00  0.86           N  
ATOM   3540  N   GLN A 450      42.447  21.637   0.452  1.00  0.82           N  
ATOM   3541  CA  GLN A 450      41.524  22.037  -0.602  1.00  0.82           C  
ATOM   3542  C   GLN A 450      41.466  23.538  -0.761  1.00  0.82           C  
ATOM   3543  O   GLN A 450      41.121  24.059  -1.814  1.00  0.82           O  
ATOM   3544  CB  GLN A 450      40.097  21.513  -0.280  1.00  0.82           C  
ATOM   3545  CG  GLN A 450      39.034  21.821  -1.373  1.00  0.82           C  
ATOM   3546  CD  GLN A 450      37.692  21.112  -1.185  1.00  0.82           C  
ATOM   3547  OE1 GLN A 450      36.854  21.063  -2.081  1.00  0.82           O  
ATOM   3548  NE2 GLN A 450      37.468  20.526   0.014  1.00  0.82           N  
ATOM   3549  N   LEU A 451      41.848  24.286   0.286  1.00  0.88           N  
ATOM   3550  CA  LEU A 451      41.962  25.722   0.163  1.00  0.88           C  
ATOM   3551  C   LEU A 451      43.308  26.148  -0.380  1.00  0.88           C  
ATOM   3552  O   LEU A 451      43.446  27.265  -0.869  1.00  0.88           O  
ATOM   3553  CB  LEU A 451      41.674  26.400   1.516  1.00  0.88           C  
ATOM   3554  CG  LEU A 451      40.196  26.296   1.947  1.00  0.88           C  
ATOM   3555  CD1 LEU A 451      39.983  27.072   3.248  1.00  0.88           C  
ATOM   3556  CD2 LEU A 451      39.231  26.820   0.871  1.00  0.88           C  
ATOM   3557  N   GLU A 452      44.317  25.253  -0.377  1.00  0.81           N  
ATOM   3558  CA  GLU A 452      45.518  25.427  -1.170  1.00  0.81           C  
ATOM   3559  C   GLU A 452      45.211  25.327  -2.672  1.00  0.81           C  
ATOM   3560  O   GLU A 452      45.642  26.177  -3.450  1.00  0.81           O  
ATOM   3561  CB  GLU A 452      46.562  24.352  -0.762  1.00  0.81           C  
ATOM   3562  CG  GLU A 452      47.063  24.452   0.705  1.00  0.81           C  
ATOM   3563  CD  GLU A 452      47.856  23.224   1.165  1.00  0.81           C  
ATOM   3564  OE1 GLU A 452      47.917  22.218   0.411  1.00  0.81           O  
ATOM   3565  OE2 GLU A 452      48.376  23.279   2.309  1.00  0.81           O  
ATOM   3566  N   LYS A 453      44.429  24.288  -3.071  1.00  0.69           N  
ATOM   3567  CA  LYS A 453      43.973  23.956  -4.421  1.00  0.69           C  
ATOM   3568  C   LYS A 453      43.351  22.529  -4.515  1.00  0.69           C  
ATOM   3569  O   LYS A 453      43.981  21.525  -4.067  1.00  0.69           O  
ATOM   3570  CB  LYS A 453      45.007  24.009  -5.596  1.00  0.69           C  
ATOM   3571  CG  LYS A 453      46.513  23.775  -5.320  1.00  0.69           C  
ATOM   3572  CD  LYS A 453      46.938  22.759  -4.236  1.00  0.69           C  
ATOM   3573  CE  LYS A 453      47.532  21.464  -4.755  1.00  0.69           C  
ATOM   3574  NZ  LYS A 453      46.416  20.615  -5.195  1.00  0.69           N  
ATOM   3575  OXT LYS A 453      42.287  22.411  -5.174  1.00  0.69           O  
TER    3576      LYS A 453                                                      
HETATM 3577  N   TRP _   1      20.563  19.944   9.186  1.00 15.93           N  
HETATM 3578  CA  TRP _   1      19.402  20.706   9.675  1.00 16.67           C  
HETATM 3579  C   TRP _   1      18.040  20.105   9.307  1.00 21.52           C  
HETATM 3580  O   TRP _   1      17.776  19.235   8.420  1.00 13.38           O  
HETATM 3581  CB  TRP _   1      19.419  22.153   9.142  1.00 10.69           C  
HETATM 3582  CG  TRP _   1      20.824  22.722   9.290  1.00 17.59           C  
HETATM 3583  CD1 TRP _   1      21.805  22.748   8.332  1.00 13.93           C  
HETATM 3584  CD2 TRP _   1      21.355  23.338  10.479  1.00 16.55           C  
HETATM 3585  NE1 TRP _   1      22.907  23.353   8.895  1.00 14.40           N  
HETATM 3586  CE2 TRP _   1      22.675  23.720  10.178  1.00 15.75           C  
HETATM 3587  CE3 TRP _   1      20.927  23.646  11.788  1.00 19.44           C  
HETATM 3588  CZ2 TRP _   1      23.467  24.356  11.149  1.00 15.82           C  
HETATM 3589  CZ3 TRP _   1      21.708  24.278  12.767  1.00 13.09           C  
HETATM 3590  CH2 TRP _   1      23.067  24.650  12.410  1.00  8.22           C  
HETATM 3591  OXT TRP _   1      17.029  20.520   9.957  1.00 18.03           O  
TER    3592      TRP _   1                                                      
CONECT 3577 3578
CONECT 3578 3577 3579 3581
CONECT 3579 3578 3580 3591
CONECT 3580 3579
CONECT 3581 3578 3582
CONECT 3582 3581 3583 3584
CONECT 3583 3582 3585
CONECT 3584 3582 3586 3587
CONECT 3585 3583 3586
CONECT 3586 3584 3585 3588
CONECT 3587 3584 3589
CONECT 3588 3586 3590
CONECT 3589 3587 3590
CONECT 3590 3588 3589
CONECT 3591 3579
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.