CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 221109160621130861

Job options:

ID        	=	 221109160621130861
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Good Salad
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   09-NOV-22 1MOD    1       15:45
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   MONOMER (USER)
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.65
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.67
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    MG
REMARK   3  BIND    A.465
REMARK   3  BIND 2  A.493
REMARK   3  BIND 3  A.572
REMARK   3  BIND 4  _.1
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    ATP
REMARK   3  BIND    A.401
REMARK   3  BIND 2  A.459
REMARK   3  BIND 3  A.460
REMARK   3  BIND 4  A.461
REMARK   3  BIND 5  A.462
REMARK   3  BIND 6  A.463
REMARK   3  BIND 7  A.464
REMARK   3  BIND 8  A.465
REMARK   3  BIND 9  A.466
REMARK   3  BIND 10  A.493
REMARK   3  BIND 11  A.1330
REMARK   3  BIND 12  A.1344
REMARK   3  BIND 13  A.1345
REMARK   3  BIND 14  A.1347
REMARK   3  BIND 15  A.1348
REMARK   3  BIND 16  A.1349
REMARK   3  BIND 17  A.1350
REMARK   3  BIND 18  _.1
REMARK   3  BIND 19  _.3
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    ATP
REMARK   3  BIND    A.533
REMARK   3  BIND 2  A.546
REMARK   3  BIND 3  A.547
REMARK   3  BIND 4  A.549
REMARK   3  BIND 5  A.550
REMARK   3  BIND 6  A.551
REMARK   3  BIND 7  A.552
REMARK   3  BIND 8  A.1219
REMARK   3  BIND 9  A.1226
REMARK   3  BIND 10  A.1245
REMARK   3  BIND 11  A.1246
REMARK   3  BIND 12  A.1247
REMARK   3  BIND 13  A.1248
REMARK   3  BIND 14  A.1249
REMARK   3  BIND 15  A.1250
REMARK   3  BIND 16  A.1251
REMARK   3  BIND 17  A.1252
REMARK   3  BIND 18  A.1291
REMARK   3  BIND 19  A.1402
REMARK   3  BIND 20  _.4
REMARK   3 
REMARK   3 MODEL LIGAND 4
REMARK   3  NAME    CLR
REMARK   3  BIND    A.89
REMARK   3  BIND 2  A.206
REMARK   3  BIND 3  A.210
REMARK   3  BIND 4  A.213
REMARK   3  BIND 5  A.217
REMARK   3  BIND 6  _.5
REMARK   3 
REMARK   3 MODEL LIGAND 5
REMARK   3  NAME    D12
REMARK   3  BIND    A.82
REMARK   3  BIND 2  A.202
REMARK   3  BIND 3  A.361
REMARK   3  BIND 4  _.6
REMARK   3 
REMARK   3 MODEL LIGAND 6
REMARK   3  NAME    VX8
REMARK   3  BIND    A.68
REMARK   3  BIND 2  A.70
REMARK   3  BIND 3  A.71
REMARK   3  BIND 4  A.73
REMARK   3  BIND 5  A.74
REMARK   3  BIND 6  A.77
REMARK   3  BIND 7  A.78
REMARK   3  BIND 8  A.81
REMARK   3  BIND 9  A.152
REMARK   3  BIND 10  A.195
REMARK   3  BIND 11  A.198
REMARK   3  BIND 12  A.360
REMARK   3  BIND 13  A.361
REMARK   3  BIND 14  A.364
REMARK   3  BIND 15  A.365
REMARK   3  BIND 16  _.6
REMARK   3  BIND 17  _.7
REMARK   3 
REMARK   3 MODEL LIGAND 7
REMARK   3  NAME    WJX
REMARK   3  BIND    A.18
REMARK   3  BIND 2  A.21
REMARK   3  BIND 3  A.24
REMARK   3  BIND 4  A.132
REMARK   3  BIND 5  A.1032
REMARK   3  BIND 6  A.1098
REMARK   3  BIND 7  A.1102
REMARK   3  BIND 8  A.1105
REMARK   3  BIND 9  A.1106
REMARK   3  BIND 10  A.1108
REMARK   3  BIND 11  A.1109
REMARK   3  BIND 12  _.8
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   8eio
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-10-28
REMARK   3  SMTLE   8eio.1.A
REMARK   3  SMTLV   2022-11-08
REMARK   3  MTHD    ELECTRON MICROSCOPY 0.00 A
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.71
REMARK   3  SIM     0.61
REMARK   3  SID     99.93
REMARK   3  OSTAT   monomer
REMARK   3  LIGND   MG
REMARK   3  LIGND 2 MG
REMARK   3  LIGND 3 ATP
REMARK   3  LIGND 4 ATP
REMARK   3  LIGND 5 CLR
REMARK   3  LIGND 6 D12
REMARK   3  LIGND 7 VX8
REMARK   3  LIGND 8 WJX
REMARK   3  ALN A TRG MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWD
REMARK   3  ALN A TRG RELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEE
REMARK   3  ALN A TRG RSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDK
REMARK   3  ALN A TRG ISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIV
REMARK   3  ALN A TRG LALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQ
REMARK   3  ALN A TRG TELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRM
REMARK   3  ALN A TRG AVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFG
REMARK   3  ALN A TRG ELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGK
REMARK   3  ALN A TRG TSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIK
REMARK   3  ALN A TRG ACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDV
REMARK   3  ALN A TRG LTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQP
REMARK   3  ALN A TRG DFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEK
REMARK   3  ALN A TRG RKNSILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISV
REMARK   3  ALN A TRG ISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRL
REMARK   3  ALN A TRG SQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIF
REMARK   3  ALN A TRG LAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADTLLA
REMARK   3  ALN A TRG MGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDL
REMARK   3  ALN A TRG LPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLE
REMARK   3  ALN A TRG SEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMR
REMARK   3  ALN A TRG IEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSV
REMARK   3  ALN A TRG SRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAK
REMARK   3  ALN A TRG YTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDS
REMARK   3  ALN A TRG ITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGK
REMARK   3  ALN A TRG LDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAF
REMARK   3  ALN A TRG ADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLF
REMARK   3  ALN A TRG PHRNSSKCKSKPQIAALKEETEEEVQDTRL
REMARK   3  ALN A TPL MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWD
REMARK   3  ALN A TPL RELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEE
REMARK   3  ALN A TPL RSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDK
REMARK   3  ALN A TPL ISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIV
REMARK   3  ALN A TPL LALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQ
REMARK   3  ALN A TPL TELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRM
REMARK   3  ALN A TPL AVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFG
REMARK   3  ALN A TPL ELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGK
REMARK   3  ALN A TPL TSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENII-GVSYDEYRYRSVIK
REMARK   3  ALN A TPL ACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDV
REMARK   3  ALN A TPL LTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQP
REMARK   3  ALN A TPL DFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEK
REMARK   3  ALN A TPL RKNSILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISV
REMARK   3  ALN A TPL ISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRL
REMARK   3  ALN A TPL SQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIF
REMARK   3  ALN A TPL LAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADTLLA
REMARK   3  ALN A TPL MGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDL
REMARK   3  ALN A TPL LPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLE
REMARK   3  ALN A TPL SEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMR
REMARK   3  ALN A TPL IEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSV
REMARK   3  ALN A TPL SRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAK
REMARK   3  ALN A TPL YTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDS
REMARK   3  ALN A TPL ITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGK
REMARK   3  ALN A TPL LDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDQPSAHLDPVTYQIIRRTLKQAF
REMARK   3  ALN A TPL ADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLF
REMARK   3  ALN A TPL PHRNSSKCKSKPQIAALKEETEEEVQDTRL
REMARK   3  ALN A OFF 0
ATOM      1  N   MET A   1     126.600 168.875 133.360  1.00  0.60           N  
ATOM      2  CA  MET A   1     128.002 168.903 133.871  1.00  0.60           C  
ATOM      3  C   MET A   1     128.183 170.200 134.623  1.00  0.60           C  
ATOM      4  O   MET A   1     128.367 171.252 134.019  1.00  0.60           O  
ATOM      5  CB  MET A   1     128.961 168.812 132.656  1.00  0.60           C  
ATOM      6  CG  MET A   1     130.391 168.385 133.027  1.00  0.60           C  
ATOM      7  SD  MET A   1     131.493 168.255 131.589  1.00  0.60           S  
ATOM      8  CE  MET A   1     132.805 167.386 132.495  1.00  0.60           C  
ATOM      9  N   GLN A   2     128.010 170.187 135.951  1.00  0.64           N  
ATOM     10  CA  GLN A   2     127.996 171.394 136.749  1.00  0.64           C  
ATOM     11  C   GLN A   2     129.416 171.802 137.122  1.00  0.64           C  
ATOM     12  O   GLN A   2     130.391 171.071 136.934  1.00  0.64           O  
ATOM     13  CB  GLN A   2     127.096 171.277 138.021  1.00  0.64           C  
ATOM     14  CG  GLN A   2     125.666 170.703 137.799  1.00  0.64           C  
ATOM     15  CD  GLN A   2     125.681 169.172 137.731  1.00  0.64           C  
ATOM     16  OE1 GLN A   2     126.743 168.557 137.702  1.00  0.64           O  
ATOM     17  NE2 GLN A   2     124.495 168.530 137.666  1.00  0.64           N  
ATOM     18  N   ARG A   3     129.570 173.029 137.649  1.00  0.69           N  
ATOM     19  CA  ARG A   3     130.814 173.501 138.220  1.00  0.69           C  
ATOM     20  C   ARG A   3     131.223 172.675 139.433  1.00  0.69           C  
ATOM     21  O   ARG A   3     130.374 172.214 140.191  1.00  0.69           O  
ATOM     22  CB  ARG A   3     130.682 174.987 138.636  1.00  0.69           C  
ATOM     23  CG  ARG A   3     130.328 175.941 137.477  1.00  0.69           C  
ATOM     24  CD  ARG A   3     131.412 176.124 136.398  1.00  0.69           C  
ATOM     25  NE  ARG A   3     132.503 177.010 136.947  1.00  0.69           N  
ATOM     26  CZ  ARG A   3     133.665 176.594 137.478  1.00  0.69           C  
ATOM     27  NH1 ARG A   3     134.051 175.325 137.488  1.00  0.69           N  
ATOM     28  NH2 ARG A   3     134.486 177.489 138.028  1.00  0.69           N  
ATOM     29  N   SER A   4     132.538 172.469 139.654  1.00  0.82           N  
ATOM     30  CA  SER A   4     133.018 171.708 140.803  1.00  0.82           C  
ATOM     31  C   SER A   4     132.559 172.294 142.148  1.00  0.82           C  
ATOM     32  O   SER A   4     132.628 173.514 142.339  1.00  0.82           O  
ATOM     33  CB  SER A   4     134.566 171.567 140.784  1.00  0.82           C  
ATOM     34  OG  SER A   4     135.069 170.765 141.857  1.00  0.82           O  
ATOM     35  N   PRO A   5     132.083 171.508 143.121  1.00  0.83           N  
ATOM     36  CA  PRO A   5     131.561 172.059 144.369  1.00  0.83           C  
ATOM     37  C   PRO A   5     132.704 172.453 145.279  1.00  0.83           C  
ATOM     38  O   PRO A   5     132.499 173.208 146.226  1.00  0.83           O  
ATOM     39  CB  PRO A   5     130.700 170.921 144.949  1.00  0.83           C  
ATOM     40  CG  PRO A   5     131.253 169.646 144.313  1.00  0.83           C  
ATOM     41  CD  PRO A   5     131.671 170.113 142.926  1.00  0.83           C  
ATOM     42  N   LEU A   6     133.929 171.978 144.988  1.00  0.82           N  
ATOM     43  CA  LEU A   6     135.141 172.301 145.719  1.00  0.82           C  
ATOM     44  C   LEU A   6     135.494 173.788 145.677  1.00  0.82           C  
ATOM     45  O   LEU A   6     135.956 174.362 146.670  1.00  0.82           O  
ATOM     46  CB  LEU A   6     136.320 171.440 145.206  1.00  0.82           C  
ATOM     47  CG  LEU A   6     137.647 171.618 145.975  1.00  0.82           C  
ATOM     48  CD1 LEU A   6     137.511 171.263 147.460  1.00  0.82           C  
ATOM     49  CD2 LEU A   6     138.755 170.769 145.345  1.00  0.82           C  
ATOM     50  N   GLU A   7     135.215 174.449 144.527  1.00  0.78           N  
ATOM     51  CA  GLU A   7     135.531 175.839 144.213  1.00  0.78           C  
ATOM     52  C   GLU A   7     134.976 176.805 145.263  1.00  0.78           C  
ATOM     53  O   GLU A   7     135.630 177.747 145.697  1.00  0.78           O  
ATOM     54  CB  GLU A   7     134.903 176.240 142.841  1.00  0.78           C  
ATOM     55  CG  GLU A   7     135.245 175.356 141.605  1.00  0.78           C  
ATOM     56  CD  GLU A   7     136.521 175.689 140.834  1.00  0.78           C  
ATOM     57  OE1 GLU A   7     137.512 176.144 141.446  1.00  0.78           O  
ATOM     58  OE2 GLU A   7     136.479 175.508 139.577  1.00  0.78           O  
ATOM     59  N   LYS A   8     133.736 176.547 145.732  1.00  0.76           N  
ATOM     60  CA  LYS A   8     133.047 177.386 146.699  1.00  0.76           C  
ATOM     61  C   LYS A   8     132.780 176.675 148.018  1.00  0.76           C  
ATOM     62  O   LYS A   8     132.050 177.175 148.870  1.00  0.76           O  
ATOM     63  CB  LYS A   8     131.716 177.914 146.106  1.00  0.76           C  
ATOM     64  CG  LYS A   8     130.739 176.825 145.632  1.00  0.76           C  
ATOM     65  CD  LYS A   8     129.418 177.400 145.088  1.00  0.76           C  
ATOM     66  CE  LYS A   8     129.564 178.362 143.906  1.00  0.76           C  
ATOM     67  NZ  LYS A   8     130.245 177.670 142.792  1.00  0.76           N  
ATOM     68  N   ALA A   9     133.376 175.487 148.250  1.00  0.78           N  
ATOM     69  CA  ALA A   9     133.268 174.809 149.528  1.00  0.78           C  
ATOM     70  C   ALA A   9     133.865 175.606 150.690  1.00  0.78           C  
ATOM     71  O   ALA A   9     134.977 176.133 150.602  1.00  0.78           O  
ATOM     72  CB  ALA A   9     133.920 173.412 149.461  1.00  0.78           C  
ATOM     73  N   SER A  10     133.141 175.696 151.822  1.00  0.58           N  
ATOM     74  CA  SER A  10     133.614 176.337 153.043  1.00  0.58           C  
ATOM     75  C   SER A  10     134.845 175.668 153.643  1.00  0.58           C  
ATOM     76  O   SER A  10     135.190 174.537 153.302  1.00  0.58           O  
ATOM     77  CB  SER A  10     132.504 176.465 154.124  1.00  0.58           C  
ATOM     78  OG  SER A  10     132.111 175.193 154.647  1.00  0.58           O  
ATOM     79  N   VAL A  11     135.557 176.351 154.565  1.00  0.49           N  
ATOM     80  CA  VAL A  11     136.763 175.821 155.198  1.00  0.49           C  
ATOM     81  C   VAL A  11     136.510 174.508 155.945  1.00  0.49           C  
ATOM     82  O   VAL A  11     137.217 173.518 155.769  1.00  0.49           O  
ATOM     83  CB  VAL A  11     137.360 176.867 156.139  1.00  0.49           C  
ATOM     84  CG1 VAL A  11     138.639 176.341 156.815  1.00  0.49           C  
ATOM     85  CG2 VAL A  11     137.691 178.143 155.341  1.00  0.49           C  
ATOM     86  N   VAL A  12     135.420 174.446 156.738  1.00  0.50           N  
ATOM     87  CA  VAL A  12     134.954 173.231 157.398  1.00  0.50           C  
ATOM     88  C   VAL A  12     134.531 172.129 156.423  1.00  0.50           C  
ATOM     89  O   VAL A  12     134.838 170.951 156.601  1.00  0.50           O  
ATOM     90  CB  VAL A  12     133.869 173.546 158.431  1.00  0.50           C  
ATOM     91  CG1 VAL A  12     132.612 174.178 157.805  1.00  0.50           C  
ATOM     92  CG2 VAL A  12     133.516 172.292 159.250  1.00  0.50           C  
ATOM     93  N   SER A  13     133.842 172.487 155.319  1.00  0.65           N  
ATOM     94  CA  SER A  13     133.443 171.539 154.284  1.00  0.65           C  
ATOM     95  C   SER A  13     134.621 170.890 153.574  1.00  0.65           C  
ATOM     96  O   SER A  13     134.620 169.682 153.341  1.00  0.65           O  
ATOM     97  CB  SER A  13     132.502 172.191 153.240  1.00  0.65           C  
ATOM     98  OG  SER A  13     131.939 171.228 152.345  1.00  0.65           O  
ATOM     99  N   LYS A  14     135.676 171.673 153.257  1.00  0.68           N  
ATOM    100  CA  LYS A  14     136.938 171.165 152.737  1.00  0.68           C  
ATOM    101  C   LYS A  14     137.654 170.214 153.693  1.00  0.68           C  
ATOM    102  O   LYS A  14     138.108 169.147 153.290  1.00  0.68           O  
ATOM    103  CB  LYS A  14     137.902 172.332 152.381  1.00  0.68           C  
ATOM    104  CG  LYS A  14     137.536 173.079 151.084  1.00  0.68           C  
ATOM    105  CD  LYS A  14     138.589 174.138 150.705  1.00  0.68           C  
ATOM    106  CE  LYS A  14     138.452 174.731 149.292  1.00  0.68           C  
ATOM    107  NZ  LYS A  14     137.201 175.497 149.130  1.00  0.68           N  
ATOM    108  N   LEU A  15     137.727 170.560 154.994  1.00  0.66           N  
ATOM    109  CA  LEU A  15     138.369 169.756 156.026  1.00  0.66           C  
ATOM    110  C   LEU A  15     137.767 168.363 156.213  1.00  0.66           C  
ATOM    111  O   LEU A  15     138.472 167.364 156.334  1.00  0.66           O  
ATOM    112  CB  LEU A  15     138.282 170.533 157.364  1.00  0.66           C  
ATOM    113  CG  LEU A  15     138.941 169.868 158.589  1.00  0.66           C  
ATOM    114  CD1 LEU A  15     140.451 169.698 158.410  1.00  0.66           C  
ATOM    115  CD2 LEU A  15     138.634 170.674 159.858  1.00  0.66           C  
ATOM    116  N   PHE A  16     136.425 168.263 156.218  1.00  0.75           N  
ATOM    117  CA  PHE A  16     135.733 167.007 156.455  1.00  0.75           C  
ATOM    118  C   PHE A  16     135.298 166.311 155.179  1.00  0.75           C  
ATOM    119  O   PHE A  16     134.660 165.256 155.236  1.00  0.75           O  
ATOM    120  CB  PHE A  16     134.448 167.263 157.281  1.00  0.75           C  
ATOM    121  CG  PHE A  16     134.794 167.408 158.727  1.00  0.75           C  
ATOM    122  CD1 PHE A  16     134.917 166.264 159.532  1.00  0.75           C  
ATOM    123  CD2 PHE A  16     134.981 168.674 159.300  1.00  0.75           C  
ATOM    124  CE1 PHE A  16     135.206 166.385 160.896  1.00  0.75           C  
ATOM    125  CE2 PHE A  16     135.270 168.800 160.663  1.00  0.75           C  
ATOM    126  CZ  PHE A  16     135.376 167.655 161.462  1.00  0.75           C  
ATOM    127  N   PHE A  17     135.611 166.890 154.006  1.00  0.78           N  
ATOM    128  CA  PHE A  17     135.208 166.421 152.686  1.00  0.78           C  
ATOM    129  C   PHE A  17     133.686 166.325 152.526  1.00  0.78           C  
ATOM    130  O   PHE A  17     133.148 165.387 151.951  1.00  0.78           O  
ATOM    131  CB  PHE A  17     135.906 165.091 152.273  1.00  0.78           C  
ATOM    132  CG  PHE A  17     137.406 165.222 152.315  1.00  0.78           C  
ATOM    133  CD1 PHE A  17     138.117 165.646 151.182  1.00  0.78           C  
ATOM    134  CD2 PHE A  17     138.119 164.924 153.489  1.00  0.78           C  
ATOM    135  CE1 PHE A  17     139.510 165.784 151.229  1.00  0.78           C  
ATOM    136  CE2 PHE A  17     139.510 165.074 153.546  1.00  0.78           C  
ATOM    137  CZ  PHE A  17     140.207 165.503 152.411  1.00  0.78           C  
ATOM    138  N   SER A  18     132.929 167.318 153.040  1.00  0.81           N  
ATOM    139  CA  SER A  18     131.463 167.252 153.134  1.00  0.81           C  
ATOM    140  C   SER A  18     130.778 167.607 151.822  1.00  0.81           C  
ATOM    141  O   SER A  18     129.609 167.302 151.581  1.00  0.81           O  
ATOM    142  CB  SER A  18     130.951 168.176 154.277  1.00  0.81           C  
ATOM    143  OG  SER A  18     129.551 168.034 154.554  1.00  0.81           O  
ATOM    144  N   TRP A  19     131.544 168.205 150.895  1.00  0.77           N  
ATOM    145  CA  TRP A  19     131.131 168.579 149.557  1.00  0.77           C  
ATOM    146  C   TRP A  19     130.900 167.391 148.627  1.00  0.77           C  
ATOM    147  O   TRP A  19     130.304 167.527 147.563  1.00  0.77           O  
ATOM    148  CB  TRP A  19     132.169 169.559 148.947  1.00  0.77           C  
ATOM    149  CG  TRP A  19     133.611 169.078 148.948  1.00  0.77           C  
ATOM    150  CD1 TRP A  19     134.592 169.282 149.880  1.00  0.77           C  
ATOM    151  CD2 TRP A  19     134.210 168.311 147.890  1.00  0.77           C  
ATOM    152  NE1 TRP A  19     135.763 168.670 149.485  1.00  0.77           N  
ATOM    153  CE2 TRP A  19     135.551 168.083 148.257  1.00  0.77           C  
ATOM    154  CE3 TRP A  19     133.695 167.824 146.690  1.00  0.77           C  
ATOM    155  CZ2 TRP A  19     136.409 167.383 147.421  1.00  0.77           C  
ATOM    156  CZ3 TRP A  19     134.566 167.137 145.835  1.00  0.77           C  
ATOM    157  CH2 TRP A  19     135.906 166.935 146.189  1.00  0.77           C  
ATOM    158  N   THR A  20     131.336 166.178 149.023  1.00  0.84           N  
ATOM    159  CA  THR A  20     131.134 164.951 148.257  1.00  0.84           C  
ATOM    160  C   THR A  20     129.749 164.356 148.477  1.00  0.84           C  
ATOM    161  O   THR A  20     129.316 163.453 147.761  1.00  0.84           O  
ATOM    162  CB  THR A  20     132.175 163.875 148.560  1.00  0.84           C  
ATOM    163  OG1 THR A  20     132.112 163.459 149.916  1.00  0.84           O  
ATOM    164  CG2 THR A  20     133.587 164.431 148.317  1.00  0.84           C  
ATOM    165  N   ARG A  21     128.984 164.887 149.454  1.00  0.74           N  
ATOM    166  CA  ARG A  21     127.649 164.426 149.800  1.00  0.74           C  
ATOM    167  C   ARG A  21     126.625 164.349 148.659  1.00  0.74           C  
ATOM    168  O   ARG A  21     125.927 163.330 148.621  1.00  0.74           O  
ATOM    169  CB  ARG A  21     127.074 165.283 150.967  1.00  0.74           C  
ATOM    170  CG  ARG A  21     125.650 164.895 151.425  1.00  0.74           C  
ATOM    171  CD  ARG A  21     125.090 165.685 152.615  1.00  0.74           C  
ATOM    172  NE  ARG A  21     124.929 167.112 152.179  1.00  0.74           N  
ATOM    173  CZ  ARG A  21     125.695 168.127 152.605  1.00  0.74           C  
ATOM    174  NH1 ARG A  21     126.727 167.940 153.419  1.00  0.74           N  
ATOM    175  NH2 ARG A  21     125.427 169.360 152.183  1.00  0.74           N  
ATOM    176  N   PRO A  22     126.436 165.283 147.713  1.00  0.81           N  
ATOM    177  CA  PRO A  22     125.439 165.139 146.651  1.00  0.81           C  
ATOM    178  C   PRO A  22     125.588 163.891 145.799  1.00  0.81           C  
ATOM    179  O   PRO A  22     124.596 163.206 145.554  1.00  0.81           O  
ATOM    180  CB  PRO A  22     125.580 166.430 145.828  1.00  0.81           C  
ATOM    181  CG  PRO A  22     126.152 167.449 146.815  1.00  0.81           C  
ATOM    182  CD  PRO A  22     127.089 166.598 147.661  1.00  0.81           C  
ATOM    183  N   ILE A  23     126.823 163.568 145.358  1.00  0.82           N  
ATOM    184  CA  ILE A  23     127.087 162.408 144.517  1.00  0.82           C  
ATOM    185  C   ILE A  23     126.941 161.089 145.260  1.00  0.82           C  
ATOM    186  O   ILE A  23     126.390 160.119 144.741  1.00  0.82           O  
ATOM    187  CB  ILE A  23     128.394 162.508 143.729  1.00  0.82           C  
ATOM    188  CG1 ILE A  23     128.363 161.530 142.531  1.00  0.82           C  
ATOM    189  CG2 ILE A  23     129.641 162.325 144.617  1.00  0.82           C  
ATOM    190  CD1 ILE A  23     129.493 161.751 141.527  1.00  0.82           C  
ATOM    191  N   LEU A  24     127.384 161.031 146.535  1.00  0.85           N  
ATOM    192  CA  LEU A  24     127.262 159.850 147.371  1.00  0.85           C  
ATOM    193  C   LEU A  24     125.818 159.437 147.622  1.00  0.85           C  
ATOM    194  O   LEU A  24     125.474 158.262 147.532  1.00  0.85           O  
ATOM    195  CB  LEU A  24     127.997 160.060 148.719  1.00  0.85           C  
ATOM    196  CG  LEU A  24     129.536 160.084 148.602  1.00  0.85           C  
ATOM    197  CD1 LEU A  24     130.179 160.541 149.917  1.00  0.85           C  
ATOM    198  CD2 LEU A  24     130.097 158.715 148.201  1.00  0.85           C  
ATOM    199  N   ARG A  25     124.923 160.404 147.905  1.00  0.75           N  
ATOM    200  CA  ARG A  25     123.495 160.150 148.005  1.00  0.75           C  
ATOM    201  C   ARG A  25     122.826 159.752 146.690  1.00  0.75           C  
ATOM    202  O   ARG A  25     121.965 158.872 146.655  1.00  0.75           O  
ATOM    203  CB  ARG A  25     122.757 161.391 148.556  1.00  0.75           C  
ATOM    204  CG  ARG A  25     123.220 161.812 149.962  1.00  0.75           C  
ATOM    205  CD  ARG A  25     122.444 162.992 150.551  1.00  0.75           C  
ATOM    206  NE  ARG A  25     121.090 162.492 150.949  1.00  0.75           N  
ATOM    207  CZ  ARG A  25     119.952 162.697 150.271  1.00  0.75           C  
ATOM    208  NH1 ARG A  25     119.916 163.346 149.112  1.00  0.75           N  
ATOM    209  NH2 ARG A  25     118.817 162.211 150.768  1.00  0.75           N  
ATOM    210  N   LYS A  26     123.192 160.412 145.568  1.00  0.78           N  
ATOM    211  CA  LYS A  26     122.657 160.101 144.246  1.00  0.78           C  
ATOM    212  C   LYS A  26     123.005 158.691 143.783  1.00  0.78           C  
ATOM    213  O   LYS A  26     122.125 157.947 143.348  1.00  0.78           O  
ATOM    214  CB  LYS A  26     123.162 161.141 143.205  1.00  0.78           C  
ATOM    215  CG  LYS A  26     122.722 160.966 141.728  1.00  0.78           C  
ATOM    216  CD  LYS A  26     121.209 161.072 141.467  1.00  0.78           C  
ATOM    217  CE  LYS A  26     120.794 161.314 140.008  1.00  0.78           C  
ATOM    218  NZ  LYS A  26     121.401 160.345 139.089  1.00  0.78           N  
ATOM    219  N   GLY A  27     124.289 158.291 143.937  1.00  0.81           N  
ATOM    220  CA  GLY A  27     124.814 157.018 143.447  1.00  0.81           C  
ATOM    221  C   GLY A  27     124.483 155.802 144.270  1.00  0.81           C  
ATOM    222  O   GLY A  27     124.621 154.672 143.808  1.00  0.81           O  
ATOM    223  N   TYR A  28     124.019 155.996 145.518  1.00  0.74           N  
ATOM    224  CA  TYR A  28     123.519 154.916 146.352  1.00  0.74           C  
ATOM    225  C   TYR A  28     122.217 154.311 145.824  1.00  0.74           C  
ATOM    226  O   TYR A  28     122.068 153.094 145.736  1.00  0.74           O  
ATOM    227  CB  TYR A  28     123.342 155.441 147.808  1.00  0.74           C  
ATOM    228  CG  TYR A  28     122.774 154.407 148.751  1.00  0.74           C  
ATOM    229  CD1 TYR A  28     123.528 153.285 149.131  1.00  0.74           C  
ATOM    230  CD2 TYR A  28     121.456 154.533 149.221  1.00  0.74           C  
ATOM    231  CE1 TYR A  28     122.964 152.293 149.947  1.00  0.74           C  
ATOM    232  CE2 TYR A  28     120.890 153.544 150.039  1.00  0.74           C  
ATOM    233  CZ  TYR A  28     121.649 152.425 150.400  1.00  0.74           C  
ATOM    234  OH  TYR A  28     121.096 151.425 151.222  1.00  0.74           O  
ATOM    235  N   ARG A  29     121.236 155.165 145.466  1.00  0.55           N  
ATOM    236  CA  ARG A  29     119.914 154.704 145.073  1.00  0.55           C  
ATOM    237  C   ARG A  29     119.782 154.384 143.599  1.00  0.55           C  
ATOM    238  O   ARG A  29     119.121 153.424 143.212  1.00  0.55           O  
ATOM    239  CB  ARG A  29     118.829 155.753 145.411  1.00  0.55           C  
ATOM    240  CG  ARG A  29     118.796 156.160 146.892  1.00  0.55           C  
ATOM    241  CD  ARG A  29     117.452 156.727 147.360  1.00  0.55           C  
ATOM    242  NE  ARG A  29     117.114 157.899 146.494  1.00  0.55           N  
ATOM    243  CZ  ARG A  29     115.979 158.602 146.607  1.00  0.55           C  
ATOM    244  NH1 ARG A  29     115.088 158.342 147.559  1.00  0.55           N  
ATOM    245  NH2 ARG A  29     115.714 159.580 145.744  1.00  0.55           N  
ATOM    246  N   GLN A  30     120.394 155.204 142.733  1.00  0.52           N  
ATOM    247  CA  GLN A  30     120.241 155.064 141.305  1.00  0.52           C  
ATOM    248  C   GLN A  30     121.594 155.251 140.673  1.00  0.52           C  
ATOM    249  O   GLN A  30     122.532 155.764 141.272  1.00  0.52           O  
ATOM    250  CB  GLN A  30     119.209 156.046 140.677  1.00  0.52           C  
ATOM    251  CG  GLN A  30     119.294 157.516 141.156  1.00  0.52           C  
ATOM    252  CD  GLN A  30     118.404 157.820 142.364  1.00  0.52           C  
ATOM    253  OE1 GLN A  30     117.467 157.125 142.748  1.00  0.52           O  
ATOM    254  NE2 GLN A  30     118.681 158.974 143.017  1.00  0.52           N  
ATOM    255  N   ARG A  31     121.745 154.788 139.423  1.00  0.59           N  
ATOM    256  CA  ARG A  31     122.991 154.902 138.700  1.00  0.59           C  
ATOM    257  C   ARG A  31     123.424 156.342 138.425  1.00  0.59           C  
ATOM    258  O   ARG A  31     122.599 157.241 138.249  1.00  0.59           O  
ATOM    259  CB  ARG A  31     122.974 154.047 137.407  1.00  0.59           C  
ATOM    260  CG  ARG A  31     122.359 152.641 137.614  1.00  0.59           C  
ATOM    261  CD  ARG A  31     122.757 151.552 136.600  1.00  0.59           C  
ATOM    262  NE  ARG A  31     124.148 151.111 136.932  1.00  0.59           N  
ATOM    263  CZ  ARG A  31     125.262 151.545 136.331  1.00  0.59           C  
ATOM    264  NH1 ARG A  31     125.247 152.453 135.361  1.00  0.59           N  
ATOM    265  NH2 ARG A  31     126.433 151.057 136.731  1.00  0.59           N  
ATOM    266  N   LEU A  32     124.747 156.596 138.415  1.00  0.74           N  
ATOM    267  CA  LEU A  32     125.282 157.880 137.998  1.00  0.74           C  
ATOM    268  C   LEU A  32     125.134 158.118 136.501  1.00  0.74           C  
ATOM    269  O   LEU A  32     125.254 157.211 135.673  1.00  0.74           O  
ATOM    270  CB  LEU A  32     126.763 158.116 138.401  1.00  0.74           C  
ATOM    271  CG  LEU A  32     127.057 158.278 139.911  1.00  0.74           C  
ATOM    272  CD1 LEU A  32     126.029 159.153 140.635  1.00  0.74           C  
ATOM    273  CD2 LEU A  32     127.212 156.936 140.627  1.00  0.74           C  
ATOM    274  N   GLU A  33     124.867 159.381 136.142  1.00  0.62           N  
ATOM    275  CA  GLU A  33     124.640 159.836 134.790  1.00  0.62           C  
ATOM    276  C   GLU A  33     125.805 160.712 134.352  1.00  0.62           C  
ATOM    277  O   GLU A  33     126.664 161.106 135.138  1.00  0.62           O  
ATOM    278  CB  GLU A  33     123.312 160.632 134.718  1.00  0.62           C  
ATOM    279  CG  GLU A  33     122.118 159.853 135.307  1.00  0.62           C  
ATOM    280  CD  GLU A  33     120.966 160.770 135.681  1.00  0.62           C  
ATOM    281  OE1 GLU A  33     120.518 161.616 134.866  1.00  0.62           O  
ATOM    282  OE2 GLU A  33     120.401 160.631 136.781  1.00  0.62           O  
ATOM    283  N   LEU A  34     125.884 161.061 133.052  1.00  0.61           N  
ATOM    284  CA  LEU A  34     126.915 161.949 132.527  1.00  0.61           C  
ATOM    285  C   LEU A  34     126.828 163.373 133.067  1.00  0.61           C  
ATOM    286  O   LEU A  34     127.802 164.120 133.116  1.00  0.61           O  
ATOM    287  CB  LEU A  34     126.874 161.953 130.978  1.00  0.61           C  
ATOM    288  CG  LEU A  34     125.584 162.512 130.338  1.00  0.61           C  
ATOM    289  CD1 LEU A  34     125.740 163.977 129.906  1.00  0.61           C  
ATOM    290  CD2 LEU A  34     125.157 161.663 129.135  1.00  0.61           C  
ATOM    291  N   SER A  35     125.626 163.795 133.491  1.00  0.71           N  
ATOM    292  CA  SER A  35     125.381 165.100 134.059  1.00  0.71           C  
ATOM    293  C   SER A  35     125.785 165.232 135.515  1.00  0.71           C  
ATOM    294  O   SER A  35     126.062 166.352 135.934  1.00  0.71           O  
ATOM    295  CB  SER A  35     123.879 165.452 133.949  1.00  0.71           C  
ATOM    296  OG  SER A  35     123.105 164.357 134.434  1.00  0.71           O  
ATOM    297  N   ASP A  36     125.836 164.107 136.269  1.00  0.76           N  
ATOM    298  CA  ASP A  36     126.244 164.005 137.667  1.00  0.76           C  
ATOM    299  C   ASP A  36     127.747 164.279 137.862  1.00  0.76           C  
ATOM    300  O   ASP A  36     128.187 164.767 138.902  1.00  0.76           O  
ATOM    301  CB  ASP A  36     125.914 162.594 138.270  1.00  0.76           C  
ATOM    302  CG  ASP A  36     124.434 162.268 138.483  1.00  0.76           C  
ATOM    303  OD1 ASP A  36     123.654 163.169 138.870  1.00  0.76           O  
ATOM    304  OD2 ASP A  36     124.066 161.063 138.351  1.00  0.76           O  
ATOM    305  N   ILE A  37     128.594 163.940 136.863  1.00  0.79           N  
ATOM    306  CA  ILE A  37     130.026 164.230 136.885  1.00  0.79           C  
ATOM    307  C   ILE A  37     130.291 165.726 136.693  1.00  0.79           C  
ATOM    308  O   ILE A  37     129.827 166.379 135.755  1.00  0.79           O  
ATOM    309  CB  ILE A  37     130.841 163.333 135.935  1.00  0.79           C  
ATOM    310  CG1 ILE A  37     131.159 161.956 136.574  1.00  0.79           C  
ATOM    311  CG2 ILE A  37     132.190 163.969 135.518  1.00  0.79           C  
ATOM    312  CD1 ILE A  37     129.959 161.047 136.847  1.00  0.79           C  
ATOM    313  N   TYR A  38     131.063 166.314 137.627  1.00  0.77           N  
ATOM    314  CA  TYR A  38     131.429 167.713 137.610  1.00  0.77           C  
ATOM    315  C   TYR A  38     132.609 167.980 136.695  1.00  0.77           C  
ATOM    316  O   TYR A  38     133.389 167.096 136.343  1.00  0.77           O  
ATOM    317  CB  TYR A  38     131.815 168.241 139.018  1.00  0.77           C  
ATOM    318  CG  TYR A  38     130.766 167.898 140.030  1.00  0.77           C  
ATOM    319  CD1 TYR A  38     129.543 168.585 140.037  1.00  0.77           C  
ATOM    320  CD2 TYR A  38     130.993 166.889 140.982  1.00  0.77           C  
ATOM    321  CE1 TYR A  38     128.565 168.282 140.993  1.00  0.77           C  
ATOM    322  CE2 TYR A  38     130.013 166.578 141.934  1.00  0.77           C  
ATOM    323  CZ  TYR A  38     128.804 167.286 141.944  1.00  0.77           C  
ATOM    324  OH  TYR A  38     127.831 166.991 142.915  1.00  0.77           O  
ATOM    325  N   GLN A  39     132.793 169.248 136.293  1.00  0.76           N  
ATOM    326  CA  GLN A  39     134.039 169.689 135.697  1.00  0.76           C  
ATOM    327  C   GLN A  39     135.236 169.606 136.638  1.00  0.76           C  
ATOM    328  O   GLN A  39     135.112 169.711 137.858  1.00  0.76           O  
ATOM    329  CB  GLN A  39     133.913 171.117 135.127  1.00  0.76           C  
ATOM    330  CG  GLN A  39     132.853 171.196 134.008  1.00  0.76           C  
ATOM    331  CD  GLN A  39     132.689 172.619 133.480  1.00  0.76           C  
ATOM    332  OE1 GLN A  39     132.687 173.596 134.233  1.00  0.76           O  
ATOM    333  NE2 GLN A  39     132.526 172.736 132.140  1.00  0.76           N  
ATOM    334  N   ILE A  40     136.445 169.415 136.072  1.00  0.86           N  
ATOM    335  CA  ILE A  40     137.702 169.511 136.802  1.00  0.86           C  
ATOM    336  C   ILE A  40     137.875 170.889 137.455  1.00  0.86           C  
ATOM    337  O   ILE A  40     137.454 171.886 136.856  1.00  0.86           O  
ATOM    338  CB  ILE A  40     138.903 169.173 135.917  1.00  0.86           C  
ATOM    339  CG1 ILE A  40     139.045 170.114 134.696  1.00  0.86           C  
ATOM    340  CG2 ILE A  40     138.765 167.698 135.498  1.00  0.86           C  
ATOM    341  CD1 ILE A  40     140.265 169.790 133.831  1.00  0.86           C  
ATOM    342  N   PRO A  41     138.417 171.044 138.666  1.00  0.91           N  
ATOM    343  CA  PRO A  41     138.971 172.317 139.127  1.00  0.91           C  
ATOM    344  C   PRO A  41     139.933 172.971 138.137  1.00  0.91           C  
ATOM    345  O   PRO A  41     140.679 172.287 137.442  1.00  0.91           O  
ATOM    346  CB  PRO A  41     139.635 171.973 140.474  1.00  0.91           C  
ATOM    347  CG  PRO A  41     138.995 170.651 140.908  1.00  0.91           C  
ATOM    348  CD  PRO A  41     138.780 169.949 139.572  1.00  0.91           C  
ATOM    349  N   SER A  42     139.952 174.314 138.048  1.00  0.82           N  
ATOM    350  CA  SER A  42     140.789 175.034 137.081  1.00  0.82           C  
ATOM    351  C   SER A  42     142.296 174.829 137.281  1.00  0.82           C  
ATOM    352  O   SER A  42     143.091 174.873 136.345  1.00  0.82           O  
ATOM    353  CB  SER A  42     140.445 176.549 137.088  1.00  0.82           C  
ATOM    354  OG  SER A  42     141.042 177.252 135.997  1.00  0.82           O  
ATOM    355  N   VAL A  43     142.730 174.563 138.532  1.00  0.86           N  
ATOM    356  CA  VAL A  43     144.123 174.327 138.900  1.00  0.86           C  
ATOM    357  C   VAL A  43     144.777 173.130 138.213  1.00  0.86           C  
ATOM    358  O   VAL A  43     145.943 173.204 137.812  1.00  0.86           O  
ATOM    359  CB  VAL A  43     144.287 174.266 140.423  1.00  0.86           C  
ATOM    360  CG1 VAL A  43     143.514 173.090 141.045  1.00  0.86           C  
ATOM    361  CG2 VAL A  43     145.775 174.227 140.826  1.00  0.86           C  
ATOM    362  N   ASP A  44     144.034 172.016 138.047  1.00  0.86           N  
ATOM    363  CA  ASP A  44     144.528 170.782 137.478  1.00  0.86           C  
ATOM    364  C   ASP A  44     144.151 170.584 136.007  1.00  0.86           C  
ATOM    365  O   ASP A  44     144.298 169.494 135.453  1.00  0.86           O  
ATOM    366  CB  ASP A  44     144.210 169.556 138.382  1.00  0.86           C  
ATOM    367  CG  ASP A  44     142.785 169.476 138.905  1.00  0.86           C  
ATOM    368  OD1 ASP A  44     142.564 169.985 140.038  1.00  0.86           O  
ATOM    369  OD2 ASP A  44     141.935 168.836 138.243  1.00  0.86           O  
ATOM    370  N   SER A  45     143.732 171.663 135.298  1.00  0.91           N  
ATOM    371  CA  SER A  45     143.600 171.639 133.841  1.00  0.91           C  
ATOM    372  C   SER A  45     144.905 171.321 133.119  1.00  0.91           C  
ATOM    373  O   SER A  45     145.976 171.850 133.432  1.00  0.91           O  
ATOM    374  CB  SER A  45     142.951 172.917 133.218  1.00  0.91           C  
ATOM    375  OG  SER A  45     143.803 174.066 133.231  1.00  0.91           O  
ATOM    376  N   ALA A  46     144.854 170.424 132.112  1.00  0.94           N  
ATOM    377  CA  ALA A  46     146.030 169.986 131.387  1.00  0.94           C  
ATOM    378  C   ALA A  46     146.774 171.117 130.681  1.00  0.94           C  
ATOM    379  O   ALA A  46     148.006 171.172 130.686  1.00  0.94           O  
ATOM    380  CB  ALA A  46     145.643 168.871 130.397  1.00  0.94           C  
ATOM    381  N   ASP A  47     146.028 172.073 130.108  1.00  0.90           N  
ATOM    382  CA  ASP A  47     146.500 173.264 129.445  1.00  0.90           C  
ATOM    383  C   ASP A  47     147.377 174.155 130.348  1.00  0.90           C  
ATOM    384  O   ASP A  47     148.517 174.486 130.012  1.00  0.90           O  
ATOM    385  CB  ASP A  47     145.254 174.064 128.948  1.00  0.90           C  
ATOM    386  CG  ASP A  47     144.137 173.185 128.374  1.00  0.90           C  
ATOM    387  OD1 ASP A  47     143.558 172.365 129.147  1.00  0.90           O  
ATOM    388  OD2 ASP A  47     143.813 173.351 127.175  1.00  0.90           O  
ATOM    389  N   ASN A  48     146.888 174.495 131.566  1.00  0.91           N  
ATOM    390  CA  ASN A  48     147.617 175.268 132.571  1.00  0.91           C  
ATOM    391  C   ASN A  48     148.831 174.528 133.133  1.00  0.91           C  
ATOM    392  O   ASN A  48     149.921 175.079 133.283  1.00  0.91           O  
ATOM    393  CB  ASN A  48     146.634 175.659 133.715  1.00  0.91           C  
ATOM    394  CG  ASN A  48     147.257 176.528 134.806  1.00  0.91           C  
ATOM    395  OD1 ASN A  48     147.589 177.693 134.614  1.00  0.91           O  
ATOM    396  ND2 ASN A  48     147.419 175.954 136.024  1.00  0.91           N  
ATOM    397  N   LEU A  49     148.681 173.233 133.464  1.00  0.92           N  
ATOM    398  CA  LEU A  49     149.777 172.433 133.986  1.00  0.92           C  
ATOM    399  C   LEU A  49     150.930 172.234 132.999  1.00  0.92           C  
ATOM    400  O   LEU A  49     152.100 172.292 133.377  1.00  0.92           O  
ATOM    401  CB  LEU A  49     149.269 171.065 134.483  1.00  0.92           C  
ATOM    402  CG  LEU A  49     148.347 171.109 135.718  1.00  0.92           C  
ATOM    403  CD1 LEU A  49     147.904 169.680 136.042  1.00  0.92           C  
ATOM    404  CD2 LEU A  49     149.004 171.753 136.948  1.00  0.92           C  
ATOM    405  N   SER A  50     150.612 172.029 131.698  1.00  0.90           N  
ATOM    406  CA  SER A  50     151.565 171.947 130.584  1.00  0.90           C  
ATOM    407  C   SER A  50     152.398 173.205 130.434  1.00  0.90           C  
ATOM    408  O   SER A  50     153.623 173.139 130.378  1.00  0.90           O  
ATOM    409  CB  SER A  50     150.754 171.717 129.260  1.00  0.90           C  
ATOM    410  OG  SER A  50     151.495 171.538 128.043  1.00  0.90           O  
ATOM    411  N   GLU A  51     151.752 174.395 130.441  1.00  0.86           N  
ATOM    412  CA  GLU A  51     152.444 175.675 130.321  1.00  0.86           C  
ATOM    413  C   GLU A  51     153.422 175.925 131.452  1.00  0.86           C  
ATOM    414  O   GLU A  51     154.584 176.271 131.234  1.00  0.86           O  
ATOM    415  CB  GLU A  51     151.434 176.851 130.224  1.00  0.86           C  
ATOM    416  CG  GLU A  51     152.078 178.240 130.085  1.00  0.86           C  
ATOM    417  CD  GLU A  51     152.539 178.906 131.361  1.00  0.86           C  
ATOM    418  OE1 GLU A  51     152.152 178.597 132.521  1.00  0.86           O  
ATOM    419  OE2 GLU A  51     153.332 179.852 131.165  1.00  0.86           O  
ATOM    420  N   LYS A  52     152.976 175.673 132.694  1.00  0.87           N  
ATOM    421  CA  LYS A  52     153.769 175.892 133.881  1.00  0.87           C  
ATOM    422  C   LYS A  52     155.052 175.081 133.935  1.00  0.87           C  
ATOM    423  O   LYS A  52     156.128 175.605 134.218  1.00  0.87           O  
ATOM    424  CB  LYS A  52     152.900 175.502 135.096  1.00  0.87           C  
ATOM    425  CG  LYS A  52     153.522 175.809 136.466  1.00  0.87           C  
ATOM    426  CD  LYS A  52     152.707 175.218 137.629  1.00  0.87           C  
ATOM    427  CE  LYS A  52     151.234 175.638 137.609  1.00  0.87           C  
ATOM    428  NZ  LYS A  52     150.508 175.001 138.728  1.00  0.87           N  
ATOM    429  N   LEU A  53     154.975 173.764 133.654  1.00  0.89           N  
ATOM    430  CA  LEU A  53     156.154 172.915 133.677  1.00  0.89           C  
ATOM    431  C   LEU A  53     157.102 173.152 132.507  1.00  0.89           C  
ATOM    432  O   LEU A  53     158.318 173.183 132.698  1.00  0.89           O  
ATOM    433  CB  LEU A  53     155.787 171.420 133.815  1.00  0.89           C  
ATOM    434  CG  LEU A  53     156.985 170.470 134.051  1.00  0.89           C  
ATOM    435  CD1 LEU A  53     157.830 170.841 135.281  1.00  0.89           C  
ATOM    436  CD2 LEU A  53     156.510 169.017 134.156  1.00  0.89           C  
ATOM    437  N   GLU A  54     156.574 173.376 131.280  1.00  0.85           N  
ATOM    438  CA  GLU A  54     157.357 173.696 130.084  1.00  0.85           C  
ATOM    439  C   GLU A  54     158.234 174.929 130.292  1.00  0.85           C  
ATOM    440  O   GLU A  54     159.454 174.902 130.137  1.00  0.85           O  
ATOM    441  CB  GLU A  54     156.369 173.960 128.915  1.00  0.85           C  
ATOM    442  CG  GLU A  54     156.976 174.345 127.536  1.00  0.85           C  
ATOM    443  CD  GLU A  54     157.429 173.155 126.685  1.00  0.85           C  
ATOM    444  OE1 GLU A  54     157.701 172.073 127.260  1.00  0.85           O  
ATOM    445  OE2 GLU A  54     157.394 173.286 125.429  1.00  0.85           O  
ATOM    446  N   ARG A  55     157.622 176.010 130.824  1.00  0.81           N  
ATOM    447  CA  ARG A  55     158.268 177.274 131.131  1.00  0.81           C  
ATOM    448  C   ARG A  55     159.451 177.154 132.093  1.00  0.81           C  
ATOM    449  O   ARG A  55     160.423 177.906 132.012  1.00  0.81           O  
ATOM    450  CB  ARG A  55     157.195 178.262 131.669  1.00  0.81           C  
ATOM    451  CG  ARG A  55     157.697 179.690 131.968  1.00  0.81           C  
ATOM    452  CD  ARG A  55     156.635 180.797 131.912  1.00  0.81           C  
ATOM    453  NE  ARG A  55     155.392 180.354 132.565  1.00  0.81           N  
ATOM    454  CZ  ARG A  55     155.073 180.238 133.845  1.00  0.81           C  
ATOM    455  NH1 ARG A  55     155.943 180.580 134.780  1.00  0.81           N  
ATOM    456  NH2 ARG A  55     153.856 179.807 134.173  1.00  0.81           N  
ATOM    457  N   GLU A  56     159.390 176.194 133.035  1.00  0.84           N  
ATOM    458  CA  GLU A  56     160.443 175.898 133.988  1.00  0.84           C  
ATOM    459  C   GLU A  56     161.493 174.904 133.521  1.00  0.84           C  
ATOM    460  O   GLU A  56     162.652 174.969 133.948  1.00  0.84           O  
ATOM    461  CB  GLU A  56     159.787 175.361 135.280  1.00  0.84           C  
ATOM    462  CG  GLU A  56     158.991 176.462 136.020  1.00  0.84           C  
ATOM    463  CD  GLU A  56     159.890 177.405 136.801  1.00  0.84           C  
ATOM    464  OE1 GLU A  56     160.995 177.754 136.302  1.00  0.84           O  
ATOM    465  OE2 GLU A  56     159.539 177.764 137.946  1.00  0.84           O  
ATOM    466  N   TRP A  57     161.126 173.969 132.626  1.00  0.81           N  
ATOM    467  CA  TRP A  57     162.039 173.054 131.955  1.00  0.81           C  
ATOM    468  C   TRP A  57     162.996 173.777 131.010  1.00  0.81           C  
ATOM    469  O   TRP A  57     164.208 173.569 131.076  1.00  0.81           O  
ATOM    470  CB  TRP A  57     161.227 171.938 131.241  1.00  0.81           C  
ATOM    471  CG  TRP A  57     161.980 171.011 130.292  1.00  0.81           C  
ATOM    472  CD1 TRP A  57     161.770 170.875 128.948  1.00  0.81           C  
ATOM    473  CD2 TRP A  57     163.116 170.177 130.609  1.00  0.81           C  
ATOM    474  NE1 TRP A  57     162.682 169.993 128.406  1.00  0.81           N  
ATOM    475  CE2 TRP A  57     163.522 169.564 129.405  1.00  0.81           C  
ATOM    476  CE3 TRP A  57     163.808 169.950 131.800  1.00  0.81           C  
ATOM    477  CZ2 TRP A  57     164.622 168.718 129.364  1.00  0.81           C  
ATOM    478  CZ3 TRP A  57     164.946 169.130 131.746  1.00  0.81           C  
ATOM    479  CH2 TRP A  57     165.348 168.520 130.549  1.00  0.81           C  
ATOM    480  N   ASP A  58     162.490 174.723 130.192  1.00  0.82           N  
ATOM    481  CA  ASP A  58     163.290 175.552 129.296  1.00  0.82           C  
ATOM    482  C   ASP A  58     164.398 176.329 129.998  1.00  0.82           C  
ATOM    483  O   ASP A  58     165.489 176.530 129.466  1.00  0.82           O  
ATOM    484  CB  ASP A  58     162.403 176.563 128.535  1.00  0.82           C  
ATOM    485  CG  ASP A  58     161.492 175.858 127.546  1.00  0.82           C  
ATOM    486  OD1 ASP A  58     161.834 174.721 127.138  1.00  0.82           O  
ATOM    487  OD2 ASP A  58     160.485 176.502 127.159  1.00  0.82           O  
ATOM    488  N   ARG A  59     164.167 176.764 131.255  1.00  0.72           N  
ATOM    489  CA  ARG A  59     165.183 177.431 132.049  1.00  0.72           C  
ATOM    490  C   ARG A  59     166.416 176.577 132.313  1.00  0.72           C  
ATOM    491  O   ARG A  59     167.531 177.062 132.180  1.00  0.72           O  
ATOM    492  CB  ARG A  59     164.634 177.926 133.407  1.00  0.72           C  
ATOM    493  CG  ARG A  59     163.384 178.812 133.277  1.00  0.72           C  
ATOM    494  CD  ARG A  59     162.893 179.389 134.605  1.00  0.72           C  
ATOM    495  NE  ARG A  59     163.802 180.528 134.968  1.00  0.72           N  
ATOM    496  CZ  ARG A  59     163.525 181.815 134.725  1.00  0.72           C  
ATOM    497  NH1 ARG A  59     162.410 182.191 134.108  1.00  0.72           N  
ATOM    498  NH2 ARG A  59     164.396 182.749 135.100  1.00  0.72           N  
ATOM    499  N   GLU A  60     166.244 175.275 132.637  1.00  0.72           N  
ATOM    500  CA  GLU A  60     167.335 174.325 132.854  1.00  0.72           C  
ATOM    501  C   GLU A  60     168.204 174.163 131.611  1.00  0.72           C  
ATOM    502  O   GLU A  60     169.432 174.134 131.676  1.00  0.72           O  
ATOM    503  CB  GLU A  60     166.779 172.932 133.255  1.00  0.72           C  
ATOM    504  CG  GLU A  60     166.246 172.822 134.703  1.00  0.72           C  
ATOM    505  CD  GLU A  60     167.350 172.783 135.755  1.00  0.72           C  
ATOM    506  OE1 GLU A  60     168.239 171.892 135.666  1.00  0.72           O  
ATOM    507  OE2 GLU A  60     167.244 173.607 136.705  1.00  0.72           O  
ATOM    508  N   LEU A  61     167.563 174.125 130.425  1.00  0.68           N  
ATOM    509  CA  LEU A  61     168.214 173.989 129.133  1.00  0.68           C  
ATOM    510  C   LEU A  61     169.047 175.206 128.732  1.00  0.68           C  
ATOM    511  O   LEU A  61     169.896 175.121 127.848  1.00  0.68           O  
ATOM    512  CB  LEU A  61     167.152 173.739 128.025  1.00  0.68           C  
ATOM    513  CG  LEU A  61     166.311 172.454 128.183  1.00  0.68           C  
ATOM    514  CD1 LEU A  61     165.216 172.384 127.109  1.00  0.68           C  
ATOM    515  CD2 LEU A  61     167.177 171.193 128.115  1.00  0.68           C  
ATOM    516  N   ALA A  62     168.828 176.370 129.376  1.00  0.63           N  
ATOM    517  CA  ALA A  62     169.551 177.589 129.081  1.00  0.63           C  
ATOM    518  C   ALA A  62     170.306 178.174 130.274  1.00  0.63           C  
ATOM    519  O   ALA A  62     170.836 179.281 130.194  1.00  0.63           O  
ATOM    520  CB  ALA A  62     168.544 178.618 128.537  1.00  0.63           C  
ATOM    521  N   SER A  63     170.407 177.450 131.409  1.00  0.65           N  
ATOM    522  CA  SER A  63     171.105 177.954 132.592  1.00  0.65           C  
ATOM    523  C   SER A  63     172.118 176.975 133.143  1.00  0.65           C  
ATOM    524  O   SER A  63     173.057 177.358 133.841  1.00  0.65           O  
ATOM    525  CB  SER A  63     170.130 178.343 133.747  1.00  0.65           C  
ATOM    526  OG  SER A  63     169.523 177.213 134.384  1.00  0.65           O  
ATOM    527  N   LYS A  64     171.976 175.674 132.831  1.00  0.60           N  
ATOM    528  CA  LYS A  64     172.817 174.649 133.395  1.00  0.60           C  
ATOM    529  C   LYS A  64     173.439 173.787 132.310  1.00  0.60           C  
ATOM    530  O   LYS A  64     172.860 173.507 131.270  1.00  0.60           O  
ATOM    531  CB  LYS A  64     172.006 173.789 134.391  1.00  0.60           C  
ATOM    532  CG  LYS A  64     172.874 172.931 135.317  1.00  0.60           C  
ATOM    533  CD  LYS A  64     172.039 172.162 136.347  1.00  0.60           C  
ATOM    534  CE  LYS A  64     172.873 171.226 137.213  1.00  0.60           C  
ATOM    535  NZ  LYS A  64     173.892 172.014 137.941  1.00  0.60           N  
ATOM    536  N   LYS A  65     174.686 173.320 132.534  1.00  0.59           N  
ATOM    537  CA  LYS A  65     175.402 172.469 131.595  1.00  0.59           C  
ATOM    538  C   LYS A  65     174.885 171.032 131.573  1.00  0.59           C  
ATOM    539  O   LYS A  65     175.120 170.279 130.637  1.00  0.59           O  
ATOM    540  CB  LYS A  65     176.900 172.419 131.994  1.00  0.59           C  
ATOM    541  CG  LYS A  65     177.575 173.798 132.088  1.00  0.59           C  
ATOM    542  CD  LYS A  65     179.002 173.704 132.656  1.00  0.59           C  
ATOM    543  CE  LYS A  65     179.661 175.058 132.941  1.00  0.59           C  
ATOM    544  NZ  LYS A  65     179.855 175.812 131.683  1.00  0.59           N  
ATOM    545  N   ASN A  66     174.159 170.637 132.634  1.00  0.70           N  
ATOM    546  CA  ASN A  66     173.585 169.316 132.801  1.00  0.70           C  
ATOM    547  C   ASN A  66     172.133 169.512 133.238  1.00  0.70           C  
ATOM    548  O   ASN A  66     171.864 169.422 134.441  1.00  0.70           O  
ATOM    549  CB  ASN A  66     174.319 168.488 133.890  1.00  0.70           C  
ATOM    550  CG  ASN A  66     175.764 168.200 133.495  1.00  0.70           C  
ATOM    551  OD1 ASN A  66     176.065 167.198 132.857  1.00  0.70           O  
ATOM    552  ND2 ASN A  66     176.706 169.073 133.924  1.00  0.70           N  
ATOM    553  N   PRO A  67     171.208 169.851 132.340  1.00  0.80           N  
ATOM    554  CA  PRO A  67     169.798 170.077 132.665  1.00  0.80           C  
ATOM    555  C   PRO A  67     169.126 168.880 133.311  1.00  0.80           C  
ATOM    556  O   PRO A  67     169.244 167.766 132.803  1.00  0.80           O  
ATOM    557  CB  PRO A  67     169.158 170.438 131.316  1.00  0.80           C  
ATOM    558  CG  PRO A  67     170.047 169.760 130.273  1.00  0.80           C  
ATOM    559  CD  PRO A  67     171.438 169.870 130.887  1.00  0.80           C  
ATOM    560  N   LYS A  68     168.421 169.068 134.441  1.00  0.81           N  
ATOM    561  CA  LYS A  68     167.772 167.960 135.116  1.00  0.81           C  
ATOM    562  C   LYS A  68     166.289 168.203 135.272  1.00  0.81           C  
ATOM    563  O   LYS A  68     165.841 169.216 135.805  1.00  0.81           O  
ATOM    564  CB  LYS A  68     168.368 167.722 136.518  1.00  0.81           C  
ATOM    565  CG  LYS A  68     169.704 166.965 136.492  1.00  0.81           C  
ATOM    566  CD  LYS A  68     170.274 166.743 137.901  1.00  0.81           C  
ATOM    567  CE  LYS A  68     170.661 168.060 138.570  1.00  0.81           C  
ATOM    568  NZ  LYS A  68     171.188 167.830 139.931  1.00  0.81           N  
ATOM    569  N   LEU A  69     165.457 167.226 134.861  1.00  0.88           N  
ATOM    570  CA  LEU A  69     164.009 167.339 134.921  1.00  0.88           C  
ATOM    571  C   LEU A  69     163.488 167.509 136.346  1.00  0.88           C  
ATOM    572  O   LEU A  69     162.563 168.273 136.619  1.00  0.88           O  
ATOM    573  CB  LEU A  69     163.335 166.147 134.203  1.00  0.88           C  
ATOM    574  CG  LEU A  69     161.799 166.233 134.085  1.00  0.88           C  
ATOM    575  CD1 LEU A  69     161.331 167.522 133.395  1.00  0.88           C  
ATOM    576  CD2 LEU A  69     161.258 165.009 133.337  1.00  0.88           C  
ATOM    577  N   ILE A  70     164.143 166.842 137.320  1.00  0.85           N  
ATOM    578  CA  ILE A  70     163.853 166.981 138.740  1.00  0.85           C  
ATOM    579  C   ILE A  70     163.985 168.415 139.272  1.00  0.85           C  
ATOM    580  O   ILE A  70     163.227 168.847 140.137  1.00  0.85           O  
ATOM    581  CB  ILE A  70     164.643 165.978 139.592  1.00  0.85           C  
ATOM    582  CG1 ILE A  70     164.190 165.937 141.072  1.00  0.85           C  
ATOM    583  CG2 ILE A  70     166.165 166.213 139.490  1.00  0.85           C  
ATOM    584  CD1 ILE A  70     162.719 165.557 141.264  1.00  0.85           C  
ATOM    585  N   ASN A  71     164.940 169.227 138.768  1.00  0.85           N  
ATOM    586  CA  ASN A  71     165.087 170.624 139.160  1.00  0.85           C  
ATOM    587  C   ASN A  71     163.907 171.497 138.721  1.00  0.85           C  
ATOM    588  O   ASN A  71     163.421 172.318 139.498  1.00  0.85           O  
ATOM    589  CB  ASN A  71     166.471 171.188 138.711  1.00  0.85           C  
ATOM    590  CG  ASN A  71     167.667 170.603 139.474  1.00  0.85           C  
ATOM    591  OD1 ASN A  71     168.851 170.779 139.190  1.00  0.85           O  
ATOM    592  ND2 ASN A  71     167.382 169.843 140.558  1.00  0.85           N  
ATOM    593  N   ALA A  72     163.367 171.283 137.504  1.00  0.89           N  
ATOM    594  CA  ALA A  72     162.123 171.897 137.062  1.00  0.89           C  
ATOM    595  C   ALA A  72     160.899 171.496 137.901  1.00  0.89           C  
ATOM    596  O   ALA A  72     160.104 172.336 138.313  1.00  0.89           O  
ATOM    597  CB  ALA A  72     161.910 171.571 135.571  1.00  0.89           C  
ATOM    598  N   LEU A  73     160.750 170.198 138.240  1.00  0.87           N  
ATOM    599  CA  LEU A  73     159.700 169.717 139.134  1.00  0.87           C  
ATOM    600  C   LEU A  73     159.750 170.294 140.550  1.00  0.87           C  
ATOM    601  O   LEU A  73     158.729 170.679 141.122  1.00  0.87           O  
ATOM    602  CB  LEU A  73     159.728 168.171 139.218  1.00  0.87           C  
ATOM    603  CG  LEU A  73     159.251 167.457 137.936  1.00  0.87           C  
ATOM    604  CD1 LEU A  73     159.556 165.955 138.005  1.00  0.87           C  
ATOM    605  CD2 LEU A  73     157.754 167.682 137.681  1.00  0.87           C  
ATOM    606  N   ARG A  74     160.953 170.414 141.151  1.00  0.76           N  
ATOM    607  CA  ARG A  74     161.142 171.045 142.450  1.00  0.76           C  
ATOM    608  C   ARG A  74     160.687 172.495 142.483  1.00  0.76           C  
ATOM    609  O   ARG A  74     160.055 172.935 143.439  1.00  0.76           O  
ATOM    610  CB  ARG A  74     162.628 170.991 142.884  1.00  0.76           C  
ATOM    611  CG  ARG A  74     163.103 169.579 143.274  1.00  0.76           C  
ATOM    612  CD  ARG A  74     164.624 169.431 143.355  1.00  0.76           C  
ATOM    613  NE  ARG A  74     165.106 170.307 144.469  1.00  0.76           N  
ATOM    614  CZ  ARG A  74     166.394 170.479 144.796  1.00  0.76           C  
ATOM    615  NH1 ARG A  74     167.367 169.839 144.156  1.00  0.76           N  
ATOM    616  NH2 ARG A  74     166.712 171.289 145.801  1.00  0.76           N  
ATOM    617  N   ARG A  75     160.962 173.264 141.418  1.00  0.77           N  
ATOM    618  CA  ARG A  75     160.601 174.667 141.339  1.00  0.77           C  
ATOM    619  C   ARG A  75     159.082 174.912 141.336  1.00  0.77           C  
ATOM    620  O   ARG A  75     158.597 175.935 141.813  1.00  0.77           O  
ATOM    621  CB  ARG A  75     161.327 175.305 140.126  1.00  0.77           C  
ATOM    622  CG  ARG A  75     161.869 176.721 140.409  1.00  0.77           C  
ATOM    623  CD  ARG A  75     162.594 177.403 139.240  1.00  0.77           C  
ATOM    624  NE  ARG A  75     163.775 176.567 138.829  1.00  0.77           N  
ATOM    625  CZ  ARG A  75     163.861 175.902 137.666  1.00  0.77           C  
ATOM    626  NH1 ARG A  75     162.941 175.998 136.713  1.00  0.77           N  
ATOM    627  NH2 ARG A  75     164.926 175.131 137.448  1.00  0.77           N  
ATOM    628  N   CYS A  76     158.290 173.928 140.850  1.00  0.86           N  
ATOM    629  CA  CYS A  76     156.841 174.033 140.728  1.00  0.86           C  
ATOM    630  C   CYS A  76     156.031 173.430 141.882  1.00  0.86           C  
ATOM    631  O   CYS A  76     154.863 173.787 142.095  1.00  0.86           O  
ATOM    632  CB  CYS A  76     156.386 173.234 139.474  1.00  0.86           C  
ATOM    633  SG  CYS A  76     156.980 173.922 137.904  1.00  0.86           S  
ATOM    634  N   PHE A  77     156.603 172.473 142.645  1.00  0.81           N  
ATOM    635  CA  PHE A  77     155.822 171.714 143.618  1.00  0.81           C  
ATOM    636  C   PHE A  77     156.452 171.583 145.003  1.00  0.81           C  
ATOM    637  O   PHE A  77     155.755 171.186 145.936  1.00  0.81           O  
ATOM    638  CB  PHE A  77     155.524 170.277 143.097  1.00  0.81           C  
ATOM    639  CG  PHE A  77     154.706 170.297 141.832  1.00  0.81           C  
ATOM    640  CD1 PHE A  77     153.323 170.543 141.874  1.00  0.81           C  
ATOM    641  CD2 PHE A  77     155.310 170.039 140.590  1.00  0.81           C  
ATOM    642  CE1 PHE A  77     152.558 170.531 140.698  1.00  0.81           C  
ATOM    643  CE2 PHE A  77     154.554 170.039 139.411  1.00  0.81           C  
ATOM    644  CZ  PHE A  77     153.176 170.279 139.467  1.00  0.81           C  
ATOM    645  N   PHE A  78     157.741 171.943 145.217  1.00  0.77           N  
ATOM    646  CA  PHE A  78     158.449 171.655 146.470  1.00  0.77           C  
ATOM    647  C   PHE A  78     157.806 172.229 147.731  1.00  0.77           C  
ATOM    648  O   PHE A  78     157.603 171.522 148.715  1.00  0.77           O  
ATOM    649  CB  PHE A  78     159.922 172.160 146.371  1.00  0.77           C  
ATOM    650  CG  PHE A  78     160.710 172.004 147.647  1.00  0.77           C  
ATOM    651  CD1 PHE A  78     160.996 170.730 148.162  1.00  0.77           C  
ATOM    652  CD2 PHE A  78     161.068 173.142 148.389  1.00  0.77           C  
ATOM    653  CE1 PHE A  78     161.617 170.595 149.410  1.00  0.77           C  
ATOM    654  CE2 PHE A  78     161.689 173.011 149.636  1.00  0.77           C  
ATOM    655  CZ  PHE A  78     161.963 171.736 150.147  1.00  0.77           C  
ATOM    656  N   TRP A  79     157.439 173.521 147.725  1.00  0.58           N  
ATOM    657  CA  TRP A  79     156.888 174.172 148.899  1.00  0.58           C  
ATOM    658  C   TRP A  79     155.552 173.590 149.348  1.00  0.58           C  
ATOM    659  O   TRP A  79     155.329 173.363 150.531  1.00  0.58           O  
ATOM    660  CB  TRP A  79     156.833 175.702 148.690  1.00  0.58           C  
ATOM    661  CG  TRP A  79     158.220 176.303 148.521  1.00  0.58           C  
ATOM    662  CD1 TRP A  79     158.833 176.819 147.410  1.00  0.58           C  
ATOM    663  CD2 TRP A  79     159.184 176.386 149.588  1.00  0.58           C  
ATOM    664  NE1 TRP A  79     160.117 177.223 147.716  1.00  0.58           N  
ATOM    665  CE2 TRP A  79     160.347 176.970 149.050  1.00  0.58           C  
ATOM    666  CE3 TRP A  79     159.118 176.010 150.929  1.00  0.58           C  
ATOM    667  CZ2 TRP A  79     161.465 177.199 149.842  1.00  0.58           C  
ATOM    668  CZ3 TRP A  79     160.248 176.240 151.728  1.00  0.58           C  
ATOM    669  CH2 TRP A  79     161.403 176.830 151.195  1.00  0.58           C  
ATOM    670  N   ARG A  80     154.646 173.264 148.401  1.00  0.72           N  
ATOM    671  CA  ARG A  80     153.420 172.532 148.694  1.00  0.72           C  
ATOM    672  C   ARG A  80     153.658 171.101 149.163  1.00  0.72           C  
ATOM    673  O   ARG A  80     153.007 170.620 150.087  1.00  0.72           O  
ATOM    674  CB  ARG A  80     152.457 172.522 147.481  1.00  0.72           C  
ATOM    675  CG  ARG A  80     151.810 173.896 147.220  1.00  0.72           C  
ATOM    676  CD  ARG A  80     150.765 173.912 146.094  1.00  0.72           C  
ATOM    677  NE  ARG A  80     151.502 173.807 144.790  1.00  0.72           N  
ATOM    678  CZ  ARG A  80     150.954 173.430 143.626  1.00  0.72           C  
ATOM    679  NH1 ARG A  80     149.664 173.121 143.513  1.00  0.72           N  
ATOM    680  NH2 ARG A  80     151.726 173.338 142.545  1.00  0.72           N  
ATOM    681  N   PHE A  81     154.620 170.385 148.550  1.00  0.79           N  
ATOM    682  CA  PHE A  81     155.009 169.050 148.976  1.00  0.79           C  
ATOM    683  C   PHE A  81     155.521 169.022 150.418  1.00  0.79           C  
ATOM    684  O   PHE A  81     155.075 168.216 151.235  1.00  0.79           O  
ATOM    685  CB  PHE A  81     156.085 168.519 147.984  1.00  0.79           C  
ATOM    686  CG  PHE A  81     156.647 167.172 148.354  1.00  0.79           C  
ATOM    687  CD1 PHE A  81     155.845 166.020 148.319  1.00  0.79           C  
ATOM    688  CD2 PHE A  81     157.984 167.065 148.775  1.00  0.79           C  
ATOM    689  CE1 PHE A  81     156.366 164.781 148.717  1.00  0.79           C  
ATOM    690  CE2 PHE A  81     158.508 165.829 149.171  1.00  0.79           C  
ATOM    691  CZ  PHE A  81     157.697 164.688 149.145  1.00  0.79           C  
ATOM    692  N   MET A  82     156.436 169.940 150.780  1.00  0.72           N  
ATOM    693  CA  MET A  82     156.977 170.023 152.124  1.00  0.72           C  
ATOM    694  C   MET A  82     155.978 170.537 153.159  1.00  0.72           C  
ATOM    695  O   MET A  82     155.979 170.107 154.313  1.00  0.72           O  
ATOM    696  CB  MET A  82     158.300 170.822 152.144  1.00  0.72           C  
ATOM    697  CG  MET A  82     159.279 170.315 153.221  1.00  0.72           C  
ATOM    698  SD  MET A  82     159.893 168.634 152.875  1.00  0.72           S  
ATOM    699  CE  MET A  82     160.691 168.374 154.483  1.00  0.72           C  
ATOM    700  N   PHE A  83     155.047 171.425 152.745  1.00  0.75           N  
ATOM    701  CA  PHE A  83     153.941 171.914 153.558  1.00  0.75           C  
ATOM    702  C   PHE A  83     153.042 170.799 154.086  1.00  0.75           C  
ATOM    703  O   PHE A  83     152.677 170.779 155.255  1.00  0.75           O  
ATOM    704  CB  PHE A  83     153.114 172.932 152.720  1.00  0.75           C  
ATOM    705  CG  PHE A  83     151.916 173.491 153.439  1.00  0.75           C  
ATOM    706  CD1 PHE A  83     152.054 174.528 154.374  1.00  0.75           C  
ATOM    707  CD2 PHE A  83     150.642 172.956 153.188  1.00  0.75           C  
ATOM    708  CE1 PHE A  83     150.934 175.017 155.059  1.00  0.75           C  
ATOM    709  CE2 PHE A  83     149.523 173.433 153.879  1.00  0.75           C  
ATOM    710  CZ  PHE A  83     149.668 174.467 154.812  1.00  0.75           C  
ATOM    711  N   TYR A  84     152.680 169.800 153.263  1.00  0.81           N  
ATOM    712  CA  TYR A  84     151.883 168.692 153.766  1.00  0.81           C  
ATOM    713  C   TYR A  84     152.692 167.683 154.581  1.00  0.81           C  
ATOM    714  O   TYR A  84     152.147 166.945 155.403  1.00  0.81           O  
ATOM    715  CB  TYR A  84     151.173 167.960 152.605  1.00  0.81           C  
ATOM    716  CG  TYR A  84     150.166 168.852 151.931  1.00  0.81           C  
ATOM    717  CD1 TYR A  84     149.095 169.404 152.656  1.00  0.81           C  
ATOM    718  CD2 TYR A  84     150.267 169.127 150.557  1.00  0.81           C  
ATOM    719  CE1 TYR A  84     148.153 170.225 152.021  1.00  0.81           C  
ATOM    720  CE2 TYR A  84     149.324 169.946 149.919  1.00  0.81           C  
ATOM    721  CZ  TYR A  84     148.267 170.492 150.654  1.00  0.81           C  
ATOM    722  OH  TYR A  84     147.298 171.293 150.023  1.00  0.81           O  
ATOM    723  N   GLY A  85     154.033 167.662 154.412  1.00  0.84           N  
ATOM    724  CA  GLY A  85     154.921 166.731 155.106  1.00  0.84           C  
ATOM    725  C   GLY A  85     155.024 166.954 156.592  1.00  0.84           C  
ATOM    726  O   GLY A  85     155.094 166.009 157.374  1.00  0.84           O  
ATOM    727  N   ILE A  86     155.002 168.226 157.032  1.00  0.79           N  
ATOM    728  CA  ILE A  86     154.993 168.590 158.444  1.00  0.79           C  
ATOM    729  C   ILE A  86     153.720 168.160 159.177  1.00  0.79           C  
ATOM    730  O   ILE A  86     153.774 167.610 160.275  1.00  0.79           O  
ATOM    731  CB  ILE A  86     155.330 170.068 158.675  1.00  0.79           C  
ATOM    732  CG1 ILE A  86     154.288 171.035 158.072  1.00  0.79           C  
ATOM    733  CG2 ILE A  86     156.739 170.314 158.094  1.00  0.79           C  
ATOM    734  CD1 ILE A  86     154.579 172.528 158.267  1.00  0.79           C  
ATOM    735  N   PHE A  87     152.527 168.341 158.574  1.00  0.81           N  
ATOM    736  CA  PHE A  87     151.262 167.905 159.153  1.00  0.81           C  
ATOM    737  C   PHE A  87     151.134 166.390 159.225  1.00  0.81           C  
ATOM    738  O   PHE A  87     150.669 165.833 160.220  1.00  0.81           O  
ATOM    739  CB  PHE A  87     150.052 168.501 158.397  1.00  0.81           C  
ATOM    740  CG  PHE A  87     150.082 170.000 158.502  1.00  0.81           C  
ATOM    741  CD1 PHE A  87     149.848 170.645 159.730  1.00  0.81           C  
ATOM    742  CD2 PHE A  87     150.372 170.778 157.374  1.00  0.81           C  
ATOM    743  CE1 PHE A  87     149.908 172.042 159.824  1.00  0.81           C  
ATOM    744  CE2 PHE A  87     150.456 172.170 157.468  1.00  0.81           C  
ATOM    745  CZ  PHE A  87     150.215 172.806 158.690  1.00  0.81           C  
ATOM    746  N   LEU A  88     151.608 165.681 158.178  1.00  0.84           N  
ATOM    747  CA  LEU A  88     151.712 164.230 158.174  1.00  0.84           C  
ATOM    748  C   LEU A  88     152.617 163.704 159.292  1.00  0.84           C  
ATOM    749  O   LEU A  88     152.256 162.788 160.029  1.00  0.84           O  
ATOM    750  CB  LEU A  88     152.239 163.756 156.796  1.00  0.84           C  
ATOM    751  CG  LEU A  88     152.311 162.227 156.600  1.00  0.84           C  
ATOM    752  CD1 LEU A  88     150.929 161.566 156.644  1.00  0.84           C  
ATOM    753  CD2 LEU A  88     153.026 161.881 155.288  1.00  0.84           C  
ATOM    754  N   TYR A  89     153.791 164.344 159.497  1.00  0.83           N  
ATOM    755  CA  TYR A  89     154.689 164.065 160.610  1.00  0.83           C  
ATOM    756  C   TYR A  89     154.031 164.237 161.980  1.00  0.83           C  
ATOM    757  O   TYR A  89     154.120 163.362 162.840  1.00  0.83           O  
ATOM    758  CB  TYR A  89     155.939 164.992 160.489  1.00  0.83           C  
ATOM    759  CG  TYR A  89     156.887 164.885 161.657  1.00  0.83           C  
ATOM    760  CD1 TYR A  89     157.588 163.694 161.884  1.00  0.83           C  
ATOM    761  CD2 TYR A  89     157.020 165.941 162.576  1.00  0.83           C  
ATOM    762  CE1 TYR A  89     158.391 163.540 163.019  1.00  0.83           C  
ATOM    763  CE2 TYR A  89     157.831 165.795 163.712  1.00  0.83           C  
ATOM    764  CZ  TYR A  89     158.512 164.589 163.931  1.00  0.83           C  
ATOM    765  OH  TYR A  89     159.302 164.403 165.080  1.00  0.83           O  
ATOM    766  N   LEU A  90     153.311 165.353 162.201  1.00  0.82           N  
ATOM    767  CA  LEU A  90     152.614 165.607 163.450  1.00  0.82           C  
ATOM    768  C   LEU A  90     151.551 164.557 163.784  1.00  0.82           C  
ATOM    769  O   LEU A  90     151.437 164.125 164.928  1.00  0.82           O  
ATOM    770  CB  LEU A  90     152.020 167.038 163.467  1.00  0.82           C  
ATOM    771  CG  LEU A  90     153.070 168.167 163.576  1.00  0.82           C  
ATOM    772  CD1 LEU A  90     152.418 169.543 163.383  1.00  0.82           C  
ATOM    773  CD2 LEU A  90     153.821 168.133 164.914  1.00  0.82           C  
ATOM    774  N   GLY A  91     150.775 164.066 162.790  1.00  0.86           N  
ATOM    775  CA  GLY A  91     149.809 162.984 163.012  1.00  0.86           C  
ATOM    776  C   GLY A  91     150.399 161.650 163.426  1.00  0.86           C  
ATOM    777  O   GLY A  91     149.801 160.907 164.209  1.00  0.86           O  
ATOM    778  N   GLU A  92     151.605 161.323 162.930  1.00  0.82           N  
ATOM    779  CA  GLU A  92     152.380 160.174 163.371  1.00  0.82           C  
ATOM    780  C   GLU A  92     152.996 160.346 164.765  1.00  0.82           C  
ATOM    781  O   GLU A  92     152.941 159.440 165.593  1.00  0.82           O  
ATOM    782  CB  GLU A  92     153.414 159.752 162.302  1.00  0.82           C  
ATOM    783  CG  GLU A  92     152.761 159.284 160.964  1.00  0.82           C  
ATOM    784  CD  GLU A  92     151.859 158.066 161.030  1.00  0.82           C  
ATOM    785  OE1 GLU A  92     151.991 157.280 162.003  1.00  0.82           O  
ATOM    786  OE2 GLU A  92     151.005 157.849 160.126  1.00  0.82           O  
ATOM    787  N   VAL A  93     153.522 161.540 165.128  1.00  0.83           N  
ATOM    788  CA  VAL A  93     153.978 161.828 166.497  1.00  0.83           C  
ATOM    789  C   VAL A  93     152.868 161.657 167.537  1.00  0.83           C  
ATOM    790  O   VAL A  93     153.051 161.033 168.582  1.00  0.83           O  
ATOM    791  CB  VAL A  93     154.592 163.225 166.615  1.00  0.83           C  
ATOM    792  CG1 VAL A  93     154.957 163.574 168.071  1.00  0.83           C  
ATOM    793  CG2 VAL A  93     155.868 163.293 165.763  1.00  0.83           C  
ATOM    794  N   THR A  94     151.648 162.135 167.221  1.00  0.85           N  
ATOM    795  CA  THR A  94     150.423 161.928 167.997  1.00  0.85           C  
ATOM    796  C   THR A  94     150.083 160.452 168.201  1.00  0.85           C  
ATOM    797  O   THR A  94     149.535 160.038 169.220  1.00  0.85           O  
ATOM    798  CB  THR A  94     149.240 162.625 167.323  1.00  0.85           C  
ATOM    799  OG1 THR A  94     149.493 164.018 167.236  1.00  0.85           O  
ATOM    800  CG2 THR A  94     147.944 162.503 168.120  1.00  0.85           C  
ATOM    801  N   LYS A  95     150.381 159.587 167.214  1.00  0.78           N  
ATOM    802  CA  LYS A  95     150.266 158.142 167.341  1.00  0.78           C  
ATOM    803  C   LYS A  95     151.287 157.495 168.276  1.00  0.78           C  
ATOM    804  O   LYS A  95     150.926 156.682 169.129  1.00  0.78           O  
ATOM    805  CB  LYS A  95     150.370 157.542 165.926  1.00  0.78           C  
ATOM    806  CG  LYS A  95     149.957 156.073 165.762  1.00  0.78           C  
ATOM    807  CD  LYS A  95     150.093 155.600 164.296  1.00  0.78           C  
ATOM    808  CE  LYS A  95     149.358 156.473 163.260  1.00  0.78           C  
ATOM    809  NZ  LYS A  95     149.718 156.108 161.881  1.00  0.78           N  
ATOM    810  N   ALA A  96     152.574 157.886 168.169  1.00  0.87           N  
ATOM    811  CA  ALA A  96     153.693 157.369 168.946  1.00  0.87           C  
ATOM    812  C   ALA A  96     153.555 157.535 170.456  1.00  0.87           C  
ATOM    813  O   ALA A  96     153.960 156.676 171.235  1.00  0.87           O  
ATOM    814  CB  ALA A  96     154.999 158.033 168.470  1.00  0.87           C  
ATOM    815  N   VAL A  97     152.942 158.645 170.905  1.00  0.85           N  
ATOM    816  CA  VAL A  97     152.783 158.955 172.319  1.00  0.85           C  
ATOM    817  C   VAL A  97     151.485 158.414 172.910  1.00  0.85           C  
ATOM    818  O   VAL A  97     151.232 158.526 174.107  1.00  0.85           O  
ATOM    819  CB  VAL A  97     152.864 160.458 172.571  1.00  0.85           C  
ATOM    820  CG1 VAL A  97     154.250 160.954 172.116  1.00  0.85           C  
ATOM    821  CG2 VAL A  97     151.734 161.214 171.847  1.00  0.85           C  
ATOM    822  N   GLN A  98     150.636 157.740 172.108  1.00  0.79           N  
ATOM    823  CA  GLN A  98     149.410 157.115 172.588  1.00  0.79           C  
ATOM    824  C   GLN A  98     149.578 156.040 173.676  1.00  0.79           C  
ATOM    825  O   GLN A  98     148.788 156.073 174.627  1.00  0.79           O  
ATOM    826  CB  GLN A  98     148.587 156.569 171.392  1.00  0.79           C  
ATOM    827  CG  GLN A  98     147.205 155.974 171.760  1.00  0.79           C  
ATOM    828  CD  GLN A  98     146.456 155.342 170.582  1.00  0.79           C  
ATOM    829  OE1 GLN A  98     145.312 154.918 170.713  1.00  0.79           O  
ATOM    830  NE2 GLN A  98     147.091 155.275 169.390  1.00  0.79           N  
ATOM    831  N   PRO A  99     150.544 155.104 173.674  1.00  0.84           N  
ATOM    832  CA  PRO A  99     150.739 154.160 174.776  1.00  0.84           C  
ATOM    833  C   PRO A  99     151.003 154.803 176.130  1.00  0.84           C  
ATOM    834  O   PRO A  99     150.688 154.187 177.146  1.00  0.84           O  
ATOM    835  CB  PRO A  99     151.907 153.277 174.312  1.00  0.84           C  
ATOM    836  CG  PRO A  99     151.840 153.334 172.786  1.00  0.84           C  
ATOM    837  CD  PRO A  99     151.414 154.774 172.536  1.00  0.84           C  
ATOM    838  N   LEU A 100     151.568 156.029 176.179  1.00  0.80           N  
ATOM    839  CA  LEU A 100     151.802 156.765 177.414  1.00  0.80           C  
ATOM    840  C   LEU A 100     150.527 157.109 178.168  1.00  0.80           C  
ATOM    841  O   LEU A 100     150.471 157.031 179.395  1.00  0.80           O  
ATOM    842  CB  LEU A 100     152.559 158.094 177.153  1.00  0.80           C  
ATOM    843  CG  LEU A 100     154.008 157.944 176.655  1.00  0.80           C  
ATOM    844  CD1 LEU A 100     154.591 159.312 176.277  1.00  0.80           C  
ATOM    845  CD2 LEU A 100     154.901 157.278 177.707  1.00  0.80           C  
ATOM    846  N   LEU A 101     149.467 157.508 177.444  1.00  0.80           N  
ATOM    847  CA  LEU A 101     148.174 157.787 178.035  1.00  0.80           C  
ATOM    848  C   LEU A 101     147.348 156.524 178.208  1.00  0.80           C  
ATOM    849  O   LEU A 101     146.868 156.216 179.300  1.00  0.80           O  
ATOM    850  CB  LEU A 101     147.404 158.796 177.150  1.00  0.80           C  
ATOM    851  CG  LEU A 101     148.079 160.180 177.055  1.00  0.80           C  
ATOM    852  CD1 LEU A 101     147.390 161.044 175.996  1.00  0.80           C  
ATOM    853  CD2 LEU A 101     148.089 160.912 178.402  1.00  0.80           C  
ATOM    854  N   LEU A 102     147.205 155.715 177.136  1.00  0.76           N  
ATOM    855  CA  LEU A 102     146.363 154.527 177.141  1.00  0.76           C  
ATOM    856  C   LEU A 102     146.824 153.460 178.137  1.00  0.76           C  
ATOM    857  O   LEU A 102     146.021 152.864 178.855  1.00  0.76           O  
ATOM    858  CB  LEU A 102     146.211 153.957 175.704  1.00  0.76           C  
ATOM    859  CG  LEU A 102     145.169 152.828 175.532  1.00  0.76           C  
ATOM    860  CD1 LEU A 102     143.761 153.243 175.976  1.00  0.76           C  
ATOM    861  CD2 LEU A 102     145.116 152.352 174.073  1.00  0.76           C  
ATOM    862  N   GLY A 103     148.153 153.241 178.261  1.00  0.80           N  
ATOM    863  CA  GLY A 103     148.746 152.283 179.196  1.00  0.80           C  
ATOM    864  C   GLY A 103     148.541 152.581 180.663  1.00  0.80           C  
ATOM    865  O   GLY A 103     148.560 151.687 181.507  1.00  0.80           O  
ATOM    866  N   ARG A 104     148.358 153.861 181.026  1.00  0.71           N  
ATOM    867  CA  ARG A 104     147.980 154.267 182.369  1.00  0.71           C  
ATOM    868  C   ARG A 104     146.498 154.065 182.651  1.00  0.71           C  
ATOM    869  O   ARG A 104     146.117 153.635 183.735  1.00  0.71           O  
ATOM    870  CB  ARG A 104     148.357 155.738 182.628  1.00  0.71           C  
ATOM    871  CG  ARG A 104     149.866 156.013 182.528  1.00  0.71           C  
ATOM    872  CD  ARG A 104     150.221 157.471 182.820  1.00  0.71           C  
ATOM    873  NE  ARG A 104     151.681 157.625 182.532  1.00  0.71           N  
ATOM    874  CZ  ARG A 104     152.662 157.490 183.436  1.00  0.71           C  
ATOM    875  NH1 ARG A 104     152.435 157.110 184.691  1.00  0.71           N  
ATOM    876  NH2 ARG A 104     153.919 157.725 183.055  1.00  0.71           N  
ATOM    877  N   ILE A 105     145.615 154.340 181.665  1.00  0.72           N  
ATOM    878  CA  ILE A 105     144.180 154.079 181.779  1.00  0.72           C  
ATOM    879  C   ILE A 105     143.889 152.597 181.968  1.00  0.72           C  
ATOM    880  O   ILE A 105     143.097 152.213 182.820  1.00  0.72           O  
ATOM    881  CB  ILE A 105     143.386 154.646 180.600  1.00  0.72           C  
ATOM    882  CG1 ILE A 105     143.564 156.180 180.538  1.00  0.72           C  
ATOM    883  CG2 ILE A 105     141.887 154.279 180.713  1.00  0.72           C  
ATOM    884  CD1 ILE A 105     142.896 156.823 179.322  1.00  0.72           C  
ATOM    885  N   ILE A 106     144.578 151.707 181.225  1.00  0.73           N  
ATOM    886  CA  ILE A 106     144.487 150.262 181.430  1.00  0.73           C  
ATOM    887  C   ILE A 106     144.942 149.838 182.824  1.00  0.73           C  
ATOM    888  O   ILE A 106     144.314 149.021 183.490  1.00  0.73           O  
ATOM    889  CB  ILE A 106     145.216 149.499 180.323  1.00  0.73           C  
ATOM    890  CG1 ILE A 106     144.478 149.766 178.991  1.00  0.73           C  
ATOM    891  CG2 ILE A 106     145.267 147.986 180.632  1.00  0.73           C  
ATOM    892  CD1 ILE A 106     145.149 149.178 177.749  1.00  0.73           C  
ATOM    893  N   ALA A 107     146.022 150.445 183.341  1.00  0.80           N  
ATOM    894  CA  ALA A 107     146.535 150.144 184.658  1.00  0.80           C  
ATOM    895  C   ALA A 107     145.679 150.632 185.821  1.00  0.80           C  
ATOM    896  O   ALA A 107     145.822 150.150 186.940  1.00  0.80           O  
ATOM    897  CB  ALA A 107     147.941 150.747 184.760  1.00  0.80           C  
ATOM    898  N   SER A 108     144.727 151.561 185.599  1.00  0.74           N  
ATOM    899  CA  SER A 108     143.867 152.068 186.666  1.00  0.74           C  
ATOM    900  C   SER A 108     142.829 151.062 187.132  1.00  0.74           C  
ATOM    901  O   SER A 108     142.267 151.178 188.219  1.00  0.74           O  
ATOM    902  CB  SER A 108     143.170 153.411 186.297  1.00  0.74           C  
ATOM    903  OG  SER A 108     142.055 153.256 185.417  1.00  0.74           O  
ATOM    904  N   TYR A 109     142.576 150.011 186.330  1.00  0.74           N  
ATOM    905  CA  TYR A 109     141.684 148.920 186.681  1.00  0.74           C  
ATOM    906  C   TYR A 109     142.198 148.129 187.870  1.00  0.74           C  
ATOM    907  O   TYR A 109     141.437 147.730 188.752  1.00  0.74           O  
ATOM    908  CB  TYR A 109     141.402 147.988 185.472  1.00  0.74           C  
ATOM    909  CG  TYR A 109     140.933 148.750 184.248  1.00  0.74           C  
ATOM    910  CD1 TYR A 109     140.201 149.954 184.320  1.00  0.74           C  
ATOM    911  CD2 TYR A 109     141.263 148.249 182.978  1.00  0.74           C  
ATOM    912  CE1 TYR A 109     139.869 150.666 183.153  1.00  0.74           C  
ATOM    913  CE2 TYR A 109     140.922 148.949 181.815  1.00  0.74           C  
ATOM    914  CZ  TYR A 109     140.240 150.162 181.898  1.00  0.74           C  
ATOM    915  OH  TYR A 109     139.969 150.852 180.698  1.00  0.74           O  
ATOM    916  N   ASP A 110     143.531 147.949 187.963  1.00  0.74           N  
ATOM    917  CA  ASP A 110     144.153 147.334 189.116  1.00  0.74           C  
ATOM    918  C   ASP A 110     143.917 148.187 190.392  1.00  0.74           C  
ATOM    919  O   ASP A 110     144.159 149.401 190.378  1.00  0.74           O  
ATOM    920  CB  ASP A 110     145.646 147.052 188.791  1.00  0.74           C  
ATOM    921  CG  ASP A 110     146.263 145.987 189.683  1.00  0.74           C  
ATOM    922  OD1 ASP A 110     145.755 145.793 190.816  1.00  0.74           O  
ATOM    923  OD2 ASP A 110     147.229 145.333 189.211  1.00  0.74           O  
ATOM    924  N   PRO A 111     143.396 147.664 191.506  1.00  0.70           N  
ATOM    925  CA  PRO A 111     143.302 148.396 192.768  1.00  0.70           C  
ATOM    926  C   PRO A 111     144.660 148.688 193.389  1.00  0.70           C  
ATOM    927  O   PRO A 111     144.758 149.600 194.223  1.00  0.70           O  
ATOM    928  CB  PRO A 111     142.402 147.511 193.653  1.00  0.70           C  
ATOM    929  CG  PRO A 111     142.508 146.113 193.041  1.00  0.70           C  
ATOM    930  CD  PRO A 111     142.673 146.389 191.554  1.00  0.70           C  
ATOM    931  N   ASP A 112     145.719 147.941 193.025  1.00  0.69           N  
ATOM    932  CA  ASP A 112     147.063 148.186 193.513  1.00  0.69           C  
ATOM    933  C   ASP A 112     147.628 149.532 193.023  1.00  0.69           C  
ATOM    934  O   ASP A 112     148.161 150.320 193.811  1.00  0.69           O  
ATOM    935  CB  ASP A 112     147.976 146.979 193.174  1.00  0.69           C  
ATOM    936  CG  ASP A 112     147.572 145.733 193.965  1.00  0.69           C  
ATOM    937  OD1 ASP A 112     146.708 145.852 194.876  1.00  0.69           O  
ATOM    938  OD2 ASP A 112     148.168 144.656 193.705  1.00  0.69           O  
ATOM    939  N   ASN A 113     147.437 149.868 191.725  1.00  0.67           N  
ATOM    940  CA  ASN A 113     147.827 151.132 191.098  1.00  0.67           C  
ATOM    941  C   ASN A 113     146.993 152.346 191.519  1.00  0.67           C  
ATOM    942  O   ASN A 113     146.157 152.876 190.787  1.00  0.67           O  
ATOM    943  CB  ASN A 113     147.801 151.053 189.551  1.00  0.67           C  
ATOM    944  CG  ASN A 113     148.909 150.143 189.046  1.00  0.67           C  
ATOM    945  OD1 ASN A 113     148.783 148.927 188.945  1.00  0.67           O  
ATOM    946  ND2 ASN A 113     150.074 150.749 188.713  1.00  0.67           N  
ATOM    947  N   LYS A 114     147.246 152.859 192.734  1.00  0.62           N  
ATOM    948  CA  LYS A 114     146.600 154.045 193.270  1.00  0.62           C  
ATOM    949  C   LYS A 114     146.907 155.324 192.496  1.00  0.62           C  
ATOM    950  O   LYS A 114     146.009 156.122 192.233  1.00  0.62           O  
ATOM    951  CB  LYS A 114     146.887 154.176 194.785  1.00  0.62           C  
ATOM    952  CG  LYS A 114     146.302 152.977 195.555  1.00  0.62           C  
ATOM    953  CD  LYS A 114     146.619 152.977 197.056  1.00  0.62           C  
ATOM    954  CE  LYS A 114     145.947 151.828 197.823  1.00  0.62           C  
ATOM    955  NZ  LYS A 114     146.227 150.518 197.179  1.00  0.62           N  
ATOM    956  N   GLU A 115     148.166 155.511 192.058  1.00  0.60           N  
ATOM    957  CA  GLU A 115     148.623 156.687 191.334  1.00  0.60           C  
ATOM    958  C   GLU A 115     147.882 156.926 190.018  1.00  0.60           C  
ATOM    959  O   GLU A 115     147.338 158.001 189.763  1.00  0.60           O  
ATOM    960  CB  GLU A 115     150.136 156.531 191.039  1.00  0.60           C  
ATOM    961  CG  GLU A 115     151.020 156.324 192.294  1.00  0.60           C  
ATOM    962  CD  GLU A 115     150.893 157.474 193.288  1.00  0.60           C  
ATOM    963  OE1 GLU A 115     150.975 158.648 192.847  1.00  0.60           O  
ATOM    964  OE2 GLU A 115     150.701 157.176 194.495  1.00  0.60           O  
ATOM    965  N   GLU A 116     147.754 155.876 189.179  1.00  0.67           N  
ATOM    966  CA  GLU A 116     146.962 155.895 187.963  1.00  0.67           C  
ATOM    967  C   GLU A 116     145.473 156.183 188.179  1.00  0.67           C  
ATOM    968  O   GLU A 116     144.862 156.930 187.417  1.00  0.67           O  
ATOM    969  CB  GLU A 116     147.120 154.556 187.202  1.00  0.67           C  
ATOM    970  CG  GLU A 116     148.394 154.450 186.314  1.00  0.67           C  
ATOM    971  CD  GLU A 116     149.755 154.217 186.971  1.00  0.67           C  
ATOM    972  OE1 GLU A 116     149.824 153.614 188.071  1.00  0.67           O  
ATOM    973  OE2 GLU A 116     150.764 154.561 186.283  1.00  0.67           O  
ATOM    974  N   ARG A 117     144.843 155.619 189.232  1.00  0.59           N  
ATOM    975  CA  ARG A 117     143.460 155.907 189.602  1.00  0.59           C  
ATOM    976  C   ARG A 117     143.198 157.371 189.953  1.00  0.59           C  
ATOM    977  O   ARG A 117     142.210 157.953 189.509  1.00  0.59           O  
ATOM    978  CB  ARG A 117     143.021 155.018 190.793  1.00  0.59           C  
ATOM    979  CG  ARG A 117     142.812 153.536 190.423  1.00  0.59           C  
ATOM    980  CD  ARG A 117     142.625 152.617 191.637  1.00  0.59           C  
ATOM    981  NE  ARG A 117     142.037 151.329 191.146  1.00  0.59           N  
ATOM    982  CZ  ARG A 117     140.742 150.983 191.232  1.00  0.59           C  
ATOM    983  NH1 ARG A 117     139.835 151.808 191.748  1.00  0.59           N  
ATOM    984  NH2 ARG A 117     140.354 149.791 190.784  1.00  0.59           N  
ATOM    985  N   SER A 118     144.104 158.016 190.715  1.00  0.63           N  
ATOM    986  CA  SER A 118     143.974 159.402 191.171  1.00  0.63           C  
ATOM    987  C   SER A 118     143.833 160.424 190.057  1.00  0.63           C  
ATOM    988  O   SER A 118     143.169 161.445 190.214  1.00  0.63           O  
ATOM    989  CB  SER A 118     145.173 159.839 192.051  1.00  0.63           C  
ATOM    990  OG  SER A 118     145.180 159.109 193.276  1.00  0.63           O  
ATOM    991  N   ILE A 119     144.460 160.178 188.891  1.00  0.71           N  
ATOM    992  CA  ILE A 119     144.421 161.098 187.762  1.00  0.71           C  
ATOM    993  C   ILE A 119     143.715 160.512 186.548  1.00  0.71           C  
ATOM    994  O   ILE A 119     143.750 161.092 185.462  1.00  0.71           O  
ATOM    995  CB  ILE A 119     145.820 161.565 187.372  1.00  0.71           C  
ATOM    996  CG1 ILE A 119     146.746 160.389 186.987  1.00  0.71           C  
ATOM    997  CG2 ILE A 119     146.371 162.389 188.554  1.00  0.71           C  
ATOM    998  CD1 ILE A 119     148.108 160.844 186.456  1.00  0.71           C  
ATOM    999  N   ALA A 120     143.011 159.365 186.694  1.00  0.80           N  
ATOM   1000  CA  ALA A 120     142.469 158.590 185.585  1.00  0.80           C  
ATOM   1001  C   ALA A 120     141.537 159.362 184.657  1.00  0.80           C  
ATOM   1002  O   ALA A 120     141.633 159.272 183.435  1.00  0.80           O  
ATOM   1003  CB  ALA A 120     141.729 157.343 186.113  1.00  0.80           C  
ATOM   1004  N   ILE A 121     140.643 160.194 185.223  1.00  0.76           N  
ATOM   1005  CA  ILE A 121     139.745 161.049 184.461  1.00  0.76           C  
ATOM   1006  C   ILE A 121     140.460 162.061 183.560  1.00  0.76           C  
ATOM   1007  O   ILE A 121     140.106 162.246 182.397  1.00  0.76           O  
ATOM   1008  CB  ILE A 121     138.701 161.701 185.370  1.00  0.76           C  
ATOM   1009  CG1 ILE A 121     137.610 162.463 184.583  1.00  0.76           C  
ATOM   1010  CG2 ILE A 121     139.352 162.604 186.441  1.00  0.76           C  
ATOM   1011  CD1 ILE A 121     136.805 161.580 183.624  1.00  0.76           C  
ATOM   1012  N   TYR A 122     141.543 162.697 184.048  1.00  0.73           N  
ATOM   1013  CA  TYR A 122     142.348 163.654 183.303  1.00  0.73           C  
ATOM   1014  C   TYR A 122     143.059 163.021 182.110  1.00  0.73           C  
ATOM   1015  O   TYR A 122     143.126 163.587 181.018  1.00  0.73           O  
ATOM   1016  CB  TYR A 122     143.377 164.344 184.240  1.00  0.73           C  
ATOM   1017  CG  TYR A 122     142.735 165.018 185.436  1.00  0.73           C  
ATOM   1018  CD1 TYR A 122     141.501 165.692 185.347  1.00  0.73           C  
ATOM   1019  CD2 TYR A 122     143.397 164.996 186.678  1.00  0.73           C  
ATOM   1020  CE1 TYR A 122     140.929 166.291 186.478  1.00  0.73           C  
ATOM   1021  CE2 TYR A 122     142.832 165.607 187.808  1.00  0.73           C  
ATOM   1022  CZ  TYR A 122     141.593 166.249 187.705  1.00  0.73           C  
ATOM   1023  OH  TYR A 122     141.007 166.864 188.829  1.00  0.73           O  
ATOM   1024  N   LEU A 123     143.555 161.779 182.286  1.00  0.80           N  
ATOM   1025  CA  LEU A 123     144.104 160.957 181.220  1.00  0.80           C  
ATOM   1026  C   LEU A 123     143.081 160.654 180.130  1.00  0.80           C  
ATOM   1027  O   LEU A 123     143.394 160.679 178.942  1.00  0.80           O  
ATOM   1028  CB  LEU A 123     144.659 159.624 181.781  1.00  0.80           C  
ATOM   1029  CG  LEU A 123     145.740 159.774 182.870  1.00  0.80           C  
ATOM   1030  CD1 LEU A 123     146.056 158.405 183.482  1.00  0.80           C  
ATOM   1031  CD2 LEU A 123     147.019 160.430 182.338  1.00  0.80           C  
ATOM   1032  N   GLY A 124     141.807 160.405 180.509  1.00  0.82           N  
ATOM   1033  CA  GLY A 124     140.718 160.212 179.555  1.00  0.82           C  
ATOM   1034  C   GLY A 124     140.396 161.428 178.715  1.00  0.82           C  
ATOM   1035  O   GLY A 124     140.180 161.314 177.512  1.00  0.82           O  
ATOM   1036  N   ILE A 125     140.413 162.642 179.306  1.00  0.76           N  
ATOM   1037  CA  ILE A 125     140.259 163.901 178.569  1.00  0.76           C  
ATOM   1038  C   ILE A 125     141.389 164.105 177.566  1.00  0.76           C  
ATOM   1039  O   ILE A 125     141.157 164.404 176.394  1.00  0.76           O  
ATOM   1040  CB  ILE A 125     140.131 165.111 179.514  1.00  0.76           C  
ATOM   1041  CG1 ILE A 125     138.669 165.334 179.963  1.00  0.76           C  
ATOM   1042  CG2 ILE A 125     140.625 166.436 178.883  1.00  0.76           C  
ATOM   1043  CD1 ILE A 125     138.141 164.312 180.964  1.00  0.76           C  
ATOM   1044  N   GLY A 126     142.654 163.885 177.991  1.00  0.82           N  
ATOM   1045  CA  GLY A 126     143.810 164.055 177.115  1.00  0.82           C  
ATOM   1046  C   GLY A 126     143.884 163.039 176.005  1.00  0.82           C  
ATOM   1047  O   GLY A 126     144.265 163.351 174.879  1.00  0.82           O  
ATOM   1048  N   LEU A 127     143.477 161.788 176.281  1.00  0.83           N  
ATOM   1049  CA  LEU A 127     143.373 160.750 175.273  1.00  0.83           C  
ATOM   1050  C   LEU A 127     142.329 161.036 174.203  1.00  0.83           C  
ATOM   1051  O   LEU A 127     142.578 160.873 173.010  1.00  0.83           O  
ATOM   1052  CB  LEU A 127     143.064 159.384 175.925  1.00  0.83           C  
ATOM   1053  CG  LEU A 127     143.060 158.197 174.941  1.00  0.83           C  
ATOM   1054  CD1 LEU A 127     144.413 158.003 174.243  1.00  0.83           C  
ATOM   1055  CD2 LEU A 127     142.646 156.895 175.626  1.00  0.83           C  
ATOM   1056  N   CYS A 128     141.128 161.509 174.586  1.00  0.81           N  
ATOM   1057  CA  CYS A 128     140.090 161.862 173.629  1.00  0.81           C  
ATOM   1058  C   CYS A 128     140.498 162.984 172.681  1.00  0.81           C  
ATOM   1059  O   CYS A 128     140.302 162.884 171.472  1.00  0.81           O  
ATOM   1060  CB  CYS A 128     138.771 162.220 174.349  1.00  0.81           C  
ATOM   1061  SG  CYS A 128     138.074 160.761 175.201  1.00  0.81           S  
ATOM   1062  N   LEU A 129     141.153 164.047 173.190  1.00  0.80           N  
ATOM   1063  CA  LEU A 129     141.738 165.097 172.365  1.00  0.80           C  
ATOM   1064  C   LEU A 129     142.814 164.583 171.405  1.00  0.80           C  
ATOM   1065  O   LEU A 129     142.873 164.982 170.241  1.00  0.80           O  
ATOM   1066  CB  LEU A 129     142.308 166.235 173.248  1.00  0.80           C  
ATOM   1067  CG  LEU A 129     141.251 166.980 174.093  1.00  0.80           C  
ATOM   1068  CD1 LEU A 129     141.922 167.985 175.039  1.00  0.80           C  
ATOM   1069  CD2 LEU A 129     140.201 167.692 173.230  1.00  0.80           C  
ATOM   1070  N   LEU A 130     143.654 163.629 171.855  1.00  0.84           N  
ATOM   1071  CA  LEU A 130     144.678 162.976 171.052  1.00  0.84           C  
ATOM   1072  C   LEU A 130     144.140 162.275 169.803  1.00  0.84           C  
ATOM   1073  O   LEU A 130     144.706 162.367 168.711  1.00  0.84           O  
ATOM   1074  CB  LEU A 130     145.410 161.922 171.922  1.00  0.84           C  
ATOM   1075  CG  LEU A 130     146.800 161.516 171.411  1.00  0.84           C  
ATOM   1076  CD1 LEU A 130     147.836 162.585 171.773  1.00  0.84           C  
ATOM   1077  CD2 LEU A 130     147.225 160.147 171.952  1.00  0.84           C  
ATOM   1078  N   PHE A 131     143.001 161.564 169.931  1.00  0.80           N  
ATOM   1079  CA  PHE A 131     142.286 160.996 168.799  1.00  0.80           C  
ATOM   1080  C   PHE A 131     141.746 162.041 167.820  1.00  0.80           C  
ATOM   1081  O   PHE A 131     141.938 161.916 166.613  1.00  0.80           O  
ATOM   1082  CB  PHE A 131     141.099 160.120 169.282  1.00  0.80           C  
ATOM   1083  CG  PHE A 131     141.557 158.762 169.739  1.00  0.80           C  
ATOM   1084  CD1 PHE A 131     141.888 157.780 168.790  1.00  0.80           C  
ATOM   1085  CD2 PHE A 131     141.614 158.431 171.102  1.00  0.80           C  
ATOM   1086  CE1 PHE A 131     142.304 156.505 169.196  1.00  0.80           C  
ATOM   1087  CE2 PHE A 131     142.036 157.160 171.511  1.00  0.80           C  
ATOM   1088  CZ  PHE A 131     142.390 156.200 170.558  1.00  0.80           C  
ATOM   1089  N   ILE A 132     141.095 163.121 168.309  1.00  0.81           N  
ATOM   1090  CA  ILE A 132     140.520 164.168 167.459  1.00  0.81           C  
ATOM   1091  C   ILE A 132     141.573 164.896 166.629  1.00  0.81           C  
ATOM   1092  O   ILE A 132     141.414 165.095 165.423  1.00  0.81           O  
ATOM   1093  CB  ILE A 132     139.717 165.187 168.277  1.00  0.81           C  
ATOM   1094  CG1 ILE A 132     138.585 164.523 169.100  1.00  0.81           C  
ATOM   1095  CG2 ILE A 132     139.140 166.302 167.375  1.00  0.81           C  
ATOM   1096  CD1 ILE A 132     137.454 163.895 168.282  1.00  0.81           C  
ATOM   1097  N   VAL A 133     142.714 165.266 167.248  1.00  0.82           N  
ATOM   1098  CA  VAL A 133     143.831 165.901 166.558  1.00  0.82           C  
ATOM   1099  C   VAL A 133     144.423 165.012 165.475  1.00  0.82           C  
ATOM   1100  O   VAL A 133     144.677 165.452 164.357  1.00  0.82           O  
ATOM   1101  CB  VAL A 133     144.918 166.337 167.540  1.00  0.82           C  
ATOM   1102  CG1 VAL A 133     146.162 166.888 166.816  1.00  0.82           C  
ATOM   1103  CG2 VAL A 133     144.352 167.437 168.453  1.00  0.82           C  
ATOM   1104  N   ARG A 134     144.617 163.706 165.746  1.00  0.79           N  
ATOM   1105  CA  ARG A 134     145.162 162.793 164.754  1.00  0.79           C  
ATOM   1106  C   ARG A 134     144.319 162.663 163.484  1.00  0.79           C  
ATOM   1107  O   ARG A 134     144.841 162.766 162.372  1.00  0.79           O  
ATOM   1108  CB  ARG A 134     145.403 161.405 165.385  1.00  0.79           C  
ATOM   1109  CG  ARG A 134     146.102 160.427 164.425  1.00  0.79           C  
ATOM   1110  CD  ARG A 134     146.910 159.322 165.099  1.00  0.79           C  
ATOM   1111  NE  ARG A 134     145.929 158.426 165.784  1.00  0.79           N  
ATOM   1112  CZ  ARG A 134     145.834 158.248 167.108  1.00  0.79           C  
ATOM   1113  NH1 ARG A 134     146.606 158.888 167.981  1.00  0.79           N  
ATOM   1114  NH2 ARG A 134     144.927 157.392 167.566  1.00  0.79           N  
ATOM   1115  N   THR A 135     142.985 162.532 163.631  1.00  0.84           N  
ATOM   1116  CA  THR A 135     142.025 162.463 162.527  1.00  0.84           C  
ATOM   1117  C   THR A 135     142.060 163.682 161.615  1.00  0.84           C  
ATOM   1118  O   THR A 135     142.049 163.578 160.387  1.00  0.84           O  
ATOM   1119  CB  THR A 135     140.594 162.339 163.051  1.00  0.84           C  
ATOM   1120  OG1 THR A 135     140.477 161.206 163.894  1.00  0.84           O  
ATOM   1121  CG2 THR A 135     139.580 162.141 161.918  1.00  0.84           C  
ATOM   1122  N   LEU A 136     142.129 164.897 162.196  1.00  0.82           N  
ATOM   1123  CA  LEU A 136     142.156 166.132 161.429  1.00  0.82           C  
ATOM   1124  C   LEU A 136     143.497 166.428 160.777  1.00  0.82           C  
ATOM   1125  O   LEU A 136     143.575 167.167 159.801  1.00  0.82           O  
ATOM   1126  CB  LEU A 136     141.784 167.336 162.329  1.00  0.82           C  
ATOM   1127  CG  LEU A 136     140.344 167.317 162.878  1.00  0.82           C  
ATOM   1128  CD1 LEU A 136     140.119 168.528 163.792  1.00  0.82           C  
ATOM   1129  CD2 LEU A 136     139.299 167.296 161.757  1.00  0.82           C  
ATOM   1130  N   LEU A 137     144.598 165.857 161.287  1.00  0.83           N  
ATOM   1131  CA  LEU A 137     145.911 166.054 160.702  1.00  0.83           C  
ATOM   1132  C   LEU A 137     146.187 165.135 159.519  1.00  0.83           C  
ATOM   1133  O   LEU A 137     146.660 165.575 158.471  1.00  0.83           O  
ATOM   1134  CB  LEU A 137     146.991 165.873 161.796  1.00  0.83           C  
ATOM   1135  CG  LEU A 137     147.415 167.179 162.508  1.00  0.83           C  
ATOM   1136  CD1 LEU A 137     146.256 168.069 162.980  1.00  0.83           C  
ATOM   1137  CD2 LEU A 137     148.324 166.833 163.689  1.00  0.83           C  
ATOM   1138  N   LEU A 138     145.897 163.823 159.640  1.00  0.84           N  
ATOM   1139  CA  LEU A 138     146.280 162.861 158.617  1.00  0.84           C  
ATOM   1140  C   LEU A 138     145.501 162.953 157.309  1.00  0.84           C  
ATOM   1141  O   LEU A 138     146.074 163.108 156.232  1.00  0.84           O  
ATOM   1142  CB  LEU A 138     146.110 161.423 159.165  1.00  0.84           C  
ATOM   1143  CG  LEU A 138     147.101 161.022 160.274  1.00  0.84           C  
ATOM   1144  CD1 LEU A 138     146.696 159.657 160.843  1.00  0.84           C  
ATOM   1145  CD2 LEU A 138     148.548 160.971 159.770  1.00  0.84           C  
ATOM   1146  N   HIS A 139     144.156 162.884 157.352  1.00  0.82           N  
ATOM   1147  CA  HIS A 139     143.348 162.816 156.136  1.00  0.82           C  
ATOM   1148  C   HIS A 139     143.422 164.020 155.193  1.00  0.82           C  
ATOM   1149  O   HIS A 139     143.542 163.786 153.985  1.00  0.82           O  
ATOM   1150  CB  HIS A 139     141.881 162.434 156.432  1.00  0.82           C  
ATOM   1151  CG  HIS A 139     141.775 161.072 157.034  1.00  0.82           C  
ATOM   1152  ND1 HIS A 139     141.906 159.928 156.253  1.00  0.82           N  
ATOM   1153  CD2 HIS A 139     141.628 160.749 158.342  1.00  0.82           C  
ATOM   1154  CE1 HIS A 139     141.825 158.931 157.133  1.00  0.82           C  
ATOM   1155  NE2 HIS A 139     141.665 159.380 158.398  1.00  0.82           N  
ATOM   1156  N   PRO A 140     143.400 165.284 155.618  1.00  0.86           N  
ATOM   1157  CA  PRO A 140     143.662 166.420 154.734  1.00  0.86           C  
ATOM   1158  C   PRO A 140     145.059 166.426 154.138  1.00  0.86           C  
ATOM   1159  O   PRO A 140     145.205 166.716 152.951  1.00  0.86           O  
ATOM   1160  CB  PRO A 140     143.406 167.648 155.623  1.00  0.86           C  
ATOM   1161  CG  PRO A 140     142.428 167.144 156.683  1.00  0.86           C  
ATOM   1162  CD  PRO A 140     142.904 165.721 156.928  1.00  0.86           C  
ATOM   1163  N   ALA A 141     146.101 166.101 154.930  1.00  0.86           N  
ATOM   1164  CA  ALA A 141     147.475 166.069 154.464  1.00  0.86           C  
ATOM   1165  C   ALA A 141     147.743 165.012 153.393  1.00  0.86           C  
ATOM   1166  O   ALA A 141     148.352 165.290 152.361  1.00  0.86           O  
ATOM   1167  CB  ALA A 141     148.413 165.853 155.666  1.00  0.86           C  
ATOM   1168  N   ILE A 142     147.239 163.774 153.591  1.00  0.83           N  
ATOM   1169  CA  ILE A 142     147.361 162.680 152.628  1.00  0.83           C  
ATOM   1170  C   ILE A 142     146.659 162.988 151.308  1.00  0.83           C  
ATOM   1171  O   ILE A 142     147.193 162.758 150.224  1.00  0.83           O  
ATOM   1172  CB  ILE A 142     146.854 161.354 153.209  1.00  0.83           C  
ATOM   1173  CG1 ILE A 142     147.702 160.941 154.435  1.00  0.83           C  
ATOM   1174  CG2 ILE A 142     146.911 160.239 152.143  1.00  0.83           C  
ATOM   1175  CD1 ILE A 142     147.133 159.758 155.227  1.00  0.83           C  
ATOM   1176  N   PHE A 143     145.438 163.558 151.352  1.00  0.85           N  
ATOM   1177  CA  PHE A 143     144.753 164.002 150.147  1.00  0.85           C  
ATOM   1178  C   PHE A 143     145.483 165.123 149.410  1.00  0.85           C  
ATOM   1179  O   PHE A 143     145.579 165.113 148.183  1.00  0.85           O  
ATOM   1180  CB  PHE A 143     143.302 164.409 150.486  1.00  0.85           C  
ATOM   1181  CG  PHE A 143     142.505 164.761 149.257  1.00  0.85           C  
ATOM   1182  CD1 PHE A 143     142.029 163.771 148.379  1.00  0.85           C  
ATOM   1183  CD2 PHE A 143     142.273 166.112 148.955  1.00  0.85           C  
ATOM   1184  CE1 PHE A 143     141.333 164.132 147.218  1.00  0.85           C  
ATOM   1185  CE2 PHE A 143     141.567 166.475 147.803  1.00  0.85           C  
ATOM   1186  CZ  PHE A 143     141.100 165.484 146.934  1.00  0.85           C  
ATOM   1187  N   GLY A 144     146.049 166.104 150.145  1.00  0.86           N  
ATOM   1188  CA  GLY A 144     146.857 167.159 149.540  1.00  0.86           C  
ATOM   1189  C   GLY A 144     148.075 166.668 148.792  1.00  0.86           C  
ATOM   1190  O   GLY A 144     148.380 167.150 147.704  1.00  0.86           O  
ATOM   1191  N   LEU A 145     148.771 165.645 149.322  1.00  0.85           N  
ATOM   1192  CA  LEU A 145     149.853 164.958 148.630  1.00  0.85           C  
ATOM   1193  C   LEU A 145     149.407 164.214 147.375  1.00  0.85           C  
ATOM   1194  O   LEU A 145     150.033 164.322 146.319  1.00  0.85           O  
ATOM   1195  CB  LEU A 145     150.577 163.987 149.592  1.00  0.85           C  
ATOM   1196  CG  LEU A 145     151.352 164.699 150.719  1.00  0.85           C  
ATOM   1197  CD1 LEU A 145     151.821 163.706 151.789  1.00  0.85           C  
ATOM   1198  CD2 LEU A 145     152.548 165.490 150.173  1.00  0.85           C  
ATOM   1199  N   HIS A 146     148.265 163.499 147.440  1.00  0.85           N  
ATOM   1200  CA  HIS A 146     147.649 162.848 146.289  1.00  0.85           C  
ATOM   1201  C   HIS A 146     147.281 163.824 145.175  1.00  0.85           C  
ATOM   1202  O   HIS A 146     147.502 163.568 143.992  1.00  0.85           O  
ATOM   1203  CB  HIS A 146     146.361 162.085 146.697  1.00  0.85           C  
ATOM   1204  CG  HIS A 146     146.580 160.861 147.546  1.00  0.85           C  
ATOM   1205  ND1 HIS A 146     147.783 160.195 147.465  1.00  0.85           N  
ATOM   1206  CD2 HIS A 146     145.691 160.121 148.266  1.00  0.85           C  
ATOM   1207  CE1 HIS A 146     147.617 159.073 148.125  1.00  0.85           C  
ATOM   1208  NE2 HIS A 146     146.364 158.971 148.633  1.00  0.85           N  
ATOM   1209  N   HIS A 147     146.733 165.010 145.521  1.00  0.87           N  
ATOM   1210  CA  HIS A 147     146.473 166.054 144.536  1.00  0.87           C  
ATOM   1211  C   HIS A 147     147.730 166.597 143.857  1.00  0.87           C  
ATOM   1212  O   HIS A 147     147.745 166.815 142.647  1.00  0.87           O  
ATOM   1213  CB  HIS A 147     145.654 167.237 145.100  1.00  0.87           C  
ATOM   1214  CG  HIS A 147     144.937 168.034 144.035  1.00  0.87           C  
ATOM   1215  ND1 HIS A 147     144.600 169.351 144.287  1.00  0.87           N  
ATOM   1216  CD2 HIS A 147     144.410 167.638 142.843  1.00  0.87           C  
ATOM   1217  CE1 HIS A 147     143.873 169.726 143.248  1.00  0.87           C  
ATOM   1218  NE2 HIS A 147     143.731 168.731 142.344  1.00  0.87           N  
ATOM   1219  N   ILE A 148     148.839 166.797 144.606  1.00  0.86           N  
ATOM   1220  CA  ILE A 148     150.130 167.187 144.035  1.00  0.86           C  
ATOM   1221  C   ILE A 148     150.666 166.152 143.051  1.00  0.86           C  
ATOM   1222  O   ILE A 148     151.097 166.501 141.953  1.00  0.86           O  
ATOM   1223  CB  ILE A 148     151.171 167.488 145.124  1.00  0.86           C  
ATOM   1224  CG1 ILE A 148     150.759 168.697 145.996  1.00  0.86           C  
ATOM   1225  CG2 ILE A 148     152.586 167.715 144.544  1.00  0.86           C  
ATOM   1226  CD1 ILE A 148     150.705 170.044 145.269  1.00  0.86           C  
ATOM   1227  N   GLY A 149     150.592 164.843 143.385  1.00  0.88           N  
ATOM   1228  CA  GLY A 149     151.083 163.776 142.508  1.00  0.88           C  
ATOM   1229  C   GLY A 149     150.332 163.653 141.210  1.00  0.88           C  
ATOM   1230  O   GLY A 149     150.921 163.457 140.149  1.00  0.88           O  
ATOM   1231  N   MET A 150     149.004 163.854 141.264  1.00  0.85           N  
ATOM   1232  CA  MET A 150     148.149 163.918 140.094  1.00  0.85           C  
ATOM   1233  C   MET A 150     148.509 165.062 139.144  1.00  0.85           C  
ATOM   1234  O   MET A 150     148.638 164.876 137.935  1.00  0.85           O  
ATOM   1235  CB  MET A 150     146.687 164.080 140.574  1.00  0.85           C  
ATOM   1236  CG  MET A 150     145.622 163.957 139.468  1.00  0.85           C  
ATOM   1237  SD  MET A 150     143.936 164.420 139.978  1.00  0.85           S  
ATOM   1238  CE  MET A 150     143.785 163.344 141.433  1.00  0.85           C  
ATOM   1239  N   GLN A 151     148.743 166.283 139.680  1.00  0.87           N  
ATOM   1240  CA  GLN A 151     149.167 167.441 138.899  1.00  0.87           C  
ATOM   1241  C   GLN A 151     150.522 167.245 138.226  1.00  0.87           C  
ATOM   1242  O   GLN A 151     150.721 167.623 137.070  1.00  0.87           O  
ATOM   1243  CB  GLN A 151     149.220 168.744 139.750  1.00  0.87           C  
ATOM   1244  CG  GLN A 151     147.838 169.202 140.273  1.00  0.87           C  
ATOM   1245  CD  GLN A 151     147.875 170.440 141.185  1.00  0.87           C  
ATOM   1246  OE1 GLN A 151     148.785 171.283 141.220  1.00  0.87           O  
ATOM   1247  NE2 GLN A 151     146.786 170.565 141.983  1.00  0.87           N  
ATOM   1248  N   MET A 152     151.484 166.618 138.933  1.00  0.87           N  
ATOM   1249  CA  MET A 152     152.774 166.256 138.371  1.00  0.87           C  
ATOM   1250  C   MET A 152     152.665 165.296 137.192  1.00  0.87           C  
ATOM   1251  O   MET A 152     153.259 165.520 136.138  1.00  0.87           O  
ATOM   1252  CB  MET A 152     153.672 165.591 139.442  1.00  0.87           C  
ATOM   1253  CG  MET A 152     154.148 166.547 140.549  1.00  0.87           C  
ATOM   1254  SD  MET A 152     155.154 165.758 141.838  1.00  0.87           S  
ATOM   1255  CE  MET A 152     156.599 165.339 140.823  1.00  0.87           C  
ATOM   1256  N   ARG A 153     151.846 164.231 137.317  1.00  0.86           N  
ATOM   1257  CA  ARG A 153     151.636 163.265 136.253  1.00  0.86           C  
ATOM   1258  C   ARG A 153     151.049 163.867 134.973  1.00  0.86           C  
ATOM   1259  O   ARG A 153     151.518 163.607 133.865  1.00  0.86           O  
ATOM   1260  CB  ARG A 153     150.699 162.139 136.745  1.00  0.86           C  
ATOM   1261  CG  ARG A 153     150.746 160.871 135.871  1.00  0.86           C  
ATOM   1262  CD  ARG A 153     149.492 159.996 135.956  1.00  0.86           C  
ATOM   1263  NE  ARG A 153     148.431 160.666 135.134  1.00  0.86           N  
ATOM   1264  CZ  ARG A 153     147.340 161.252 135.646  1.00  0.86           C  
ATOM   1265  NH1 ARG A 153     147.077 161.295 136.943  1.00  0.86           N  
ATOM   1266  NH2 ARG A 153     146.475 161.824 134.807  1.00  0.86           N  
ATOM   1267  N   ILE A 154     150.019 164.734 135.103  1.00  0.88           N  
ATOM   1268  CA  ILE A 154     149.377 165.418 133.981  1.00  0.88           C  
ATOM   1269  C   ILE A 154     150.339 166.342 133.236  1.00  0.88           C  
ATOM   1270  O   ILE A 154     150.410 166.333 132.005  1.00  0.88           O  
ATOM   1271  CB  ILE A 154     148.141 166.206 134.434  1.00  0.88           C  
ATOM   1272  CG1 ILE A 154     147.087 165.284 135.089  1.00  0.88           C  
ATOM   1273  CG2 ILE A 154     147.499 166.955 133.246  1.00  0.88           C  
ATOM   1274  CD1 ILE A 154     145.995 166.047 135.849  1.00  0.88           C  
ATOM   1275  N   ALA A 155     151.142 167.135 133.977  1.00  0.92           N  
ATOM   1276  CA  ALA A 155     152.151 168.009 133.411  1.00  0.92           C  
ATOM   1277  C   ALA A 155     153.250 167.279 132.652  1.00  0.92           C  
ATOM   1278  O   ALA A 155     153.658 167.691 131.574  1.00  0.92           O  
ATOM   1279  CB  ALA A 155     152.776 168.873 134.520  1.00  0.92           C  
ATOM   1280  N   MET A 156     153.751 166.151 133.180  1.00  0.87           N  
ATOM   1281  CA  MET A 156     154.732 165.340 132.481  1.00  0.87           C  
ATOM   1282  C   MET A 156     154.189 164.681 131.209  1.00  0.87           C  
ATOM   1283  O   MET A 156     154.834 164.681 130.161  1.00  0.87           O  
ATOM   1284  CB  MET A 156     155.336 164.307 133.459  1.00  0.87           C  
ATOM   1285  CG  MET A 156     156.105 164.985 134.618  1.00  0.87           C  
ATOM   1286  SD  MET A 156     156.583 163.873 135.973  1.00  0.87           S  
ATOM   1287  CE  MET A 156     157.982 163.160 135.074  1.00  0.87           C  
ATOM   1288  N   PHE A 157     152.958 164.133 131.252  1.00  0.87           N  
ATOM   1289  CA  PHE A 157     152.312 163.480 130.118  1.00  0.87           C  
ATOM   1290  C   PHE A 157     152.047 164.389 128.923  1.00  0.87           C  
ATOM   1291  O   PHE A 157     152.185 163.984 127.767  1.00  0.87           O  
ATOM   1292  CB  PHE A 157     150.987 162.803 130.558  1.00  0.87           C  
ATOM   1293  CG  PHE A 157     151.170 161.494 131.295  1.00  0.87           C  
ATOM   1294  CD1 PHE A 157     152.409 161.007 131.766  1.00  0.87           C  
ATOM   1295  CD2 PHE A 157     150.028 160.696 131.476  1.00  0.87           C  
ATOM   1296  CE1 PHE A 157     152.499 159.757 132.390  1.00  0.87           C  
ATOM   1297  CE2 PHE A 157     150.120 159.442 132.088  1.00  0.87           C  
ATOM   1298  CZ  PHE A 157     151.353 158.973 132.551  1.00  0.87           C  
ATOM   1299  N   SER A 158     151.671 165.661 129.156  1.00  0.89           N  
ATOM   1300  CA  SER A 158     151.537 166.643 128.089  1.00  0.89           C  
ATOM   1301  C   SER A 158     152.838 166.932 127.344  1.00  0.89           C  
ATOM   1302  O   SER A 158     152.853 166.982 126.115  1.00  0.89           O  
ATOM   1303  CB  SER A 158     150.909 167.965 128.603  1.00  0.89           C  
ATOM   1304  OG  SER A 158     151.773 168.660 129.497  1.00  0.89           O  
ATOM   1305  N   LEU A 159     153.966 167.081 128.070  1.00  0.88           N  
ATOM   1306  CA  LEU A 159     155.295 167.272 127.501  1.00  0.88           C  
ATOM   1307  C   LEU A 159     155.763 166.099 126.648  1.00  0.88           C  
ATOM   1308  O   LEU A 159     156.333 166.285 125.574  1.00  0.88           O  
ATOM   1309  CB  LEU A 159     156.372 167.561 128.579  1.00  0.88           C  
ATOM   1310  CG  LEU A 159     156.123 168.794 129.474  1.00  0.88           C  
ATOM   1311  CD1 LEU A 159     157.396 169.168 130.247  1.00  0.88           C  
ATOM   1312  CD2 LEU A 159     155.628 170.015 128.695  1.00  0.88           C  
ATOM   1313  N   ILE A 160     155.490 164.845 127.079  1.00  0.86           N  
ATOM   1314  CA  ILE A 160     155.780 163.648 126.291  1.00  0.86           C  
ATOM   1315  C   ILE A 160     155.068 163.670 124.942  1.00  0.86           C  
ATOM   1316  O   ILE A 160     155.685 163.480 123.898  1.00  0.86           O  
ATOM   1317  CB  ILE A 160     155.402 162.375 127.058  1.00  0.86           C  
ATOM   1318  CG1 ILE A 160     156.262 162.238 128.334  1.00  0.86           C  
ATOM   1319  CG2 ILE A 160     155.559 161.115 126.174  1.00  0.86           C  
ATOM   1320  CD1 ILE A 160     155.762 161.154 129.293  1.00  0.86           C  
ATOM   1321  N   TYR A 161     153.755 163.978 124.914  1.00  0.85           N  
ATOM   1322  CA  TYR A 161     153.001 164.072 123.673  1.00  0.85           C  
ATOM   1323  C   TYR A 161     153.483 165.177 122.722  1.00  0.85           C  
ATOM   1324  O   TYR A 161     153.633 164.956 121.520  1.00  0.85           O  
ATOM   1325  CB  TYR A 161     151.493 164.220 123.999  1.00  0.85           C  
ATOM   1326  CG  TYR A 161     150.653 164.091 122.759  1.00  0.85           C  
ATOM   1327  CD1 TYR A 161     150.455 162.834 122.164  1.00  0.85           C  
ATOM   1328  CD2 TYR A 161     150.125 165.235 122.139  1.00  0.85           C  
ATOM   1329  CE1 TYR A 161     149.767 162.729 120.948  1.00  0.85           C  
ATOM   1330  CE2 TYR A 161     149.451 165.132 120.915  1.00  0.85           C  
ATOM   1331  CZ  TYR A 161     149.279 163.878 120.321  1.00  0.85           C  
ATOM   1332  OH  TYR A 161     148.626 163.782 119.083  1.00  0.85           O  
ATOM   1333  N   LYS A 162     153.779 166.383 123.245  1.00  0.83           N  
ATOM   1334  CA  LYS A 162     154.338 167.479 122.464  1.00  0.83           C  
ATOM   1335  C   LYS A 162     155.708 167.167 121.873  1.00  0.83           C  
ATOM   1336  O   LYS A 162     156.002 167.487 120.721  1.00  0.83           O  
ATOM   1337  CB  LYS A 162     154.417 168.766 123.310  1.00  0.83           C  
ATOM   1338  CG  LYS A 162     153.028 169.300 123.681  1.00  0.83           C  
ATOM   1339  CD  LYS A 162     153.099 170.684 124.337  1.00  0.83           C  
ATOM   1340  CE  LYS A 162     151.720 171.284 124.597  1.00  0.83           C  
ATOM   1341  NZ  LYS A 162     151.884 172.628 125.182  1.00  0.83           N  
ATOM   1342  N   LYS A 163     156.581 166.484 122.639  1.00  0.83           N  
ATOM   1343  CA  LYS A 163     157.834 165.956 122.127  1.00  0.83           C  
ATOM   1344  C   LYS A 163     157.660 164.912 121.021  1.00  0.83           C  
ATOM   1345  O   LYS A 163     158.367 164.948 120.015  1.00  0.83           O  
ATOM   1346  CB  LYS A 163     158.694 165.366 123.270  1.00  0.83           C  
ATOM   1347  CG  LYS A 163     160.080 164.843 122.839  1.00  0.83           C  
ATOM   1348  CD  LYS A 163     161.015 165.938 122.283  1.00  0.83           C  
ATOM   1349  CE  LYS A 163     162.384 165.411 121.830  1.00  0.83           C  
ATOM   1350  NZ  LYS A 163     163.317 166.522 121.518  1.00  0.83           N  
ATOM   1351  N   THR A 164     156.686 163.982 121.147  1.00  0.86           N  
ATOM   1352  CA  THR A 164     156.402 162.914 120.174  1.00  0.86           C  
ATOM   1353  C   THR A 164     156.148 163.432 118.767  1.00  0.86           C  
ATOM   1354  O   THR A 164     156.652 162.894 117.783  1.00  0.86           O  
ATOM   1355  CB  THR A 164     155.213 162.040 120.586  1.00  0.86           C  
ATOM   1356  OG1 THR A 164     155.500 161.381 121.810  1.00  0.86           O  
ATOM   1357  CG2 THR A 164     154.907 160.921 119.582  1.00  0.86           C  
ATOM   1358  N   LEU A 165     155.414 164.553 118.621  1.00  0.85           N  
ATOM   1359  CA  LEU A 165     155.133 165.145 117.321  1.00  0.85           C  
ATOM   1360  C   LEU A 165     156.357 165.782 116.656  1.00  0.85           C  
ATOM   1361  O   LEU A 165     156.401 166.002 115.441  1.00  0.85           O  
ATOM   1362  CB  LEU A 165     154.016 166.210 117.455  1.00  0.85           C  
ATOM   1363  CG  LEU A 165     152.688 165.690 118.047  1.00  0.85           C  
ATOM   1364  CD1 LEU A 165     151.638 166.810 118.066  1.00  0.85           C  
ATOM   1365  CD2 LEU A 165     152.141 164.466 117.303  1.00  0.85           C  
ATOM   1366  N   LYS A 166     157.408 166.060 117.446  1.00  0.80           N  
ATOM   1367  CA  LYS A 166     158.629 166.686 116.991  1.00  0.80           C  
ATOM   1368  C   LYS A 166     159.755 165.699 116.737  1.00  0.80           C  
ATOM   1369  O   LYS A 166     160.795 166.067 116.204  1.00  0.80           O  
ATOM   1370  CB  LYS A 166     159.120 167.671 118.072  1.00  0.80           C  
ATOM   1371  CG  LYS A 166     158.143 168.811 118.371  1.00  0.80           C  
ATOM   1372  CD  LYS A 166     158.701 169.713 119.480  1.00  0.80           C  
ATOM   1373  CE  LYS A 166     157.856 170.942 119.776  1.00  0.80           C  
ATOM   1374  NZ  LYS A 166     157.865 171.790 118.570  1.00  0.80           N  
ATOM   1375  N   LEU A 167     159.593 164.405 117.067  1.00  0.82           N  
ATOM   1376  CA  LEU A 167     160.645 163.421 116.863  1.00  0.82           C  
ATOM   1377  C   LEU A 167     161.085 163.257 115.410  1.00  0.82           C  
ATOM   1378  O   LEU A 167     160.271 163.144 114.489  1.00  0.82           O  
ATOM   1379  CB  LEU A 167     160.237 162.034 117.403  1.00  0.82           C  
ATOM   1380  CG  LEU A 167     160.103 161.931 118.931  1.00  0.82           C  
ATOM   1381  CD1 LEU A 167     159.440 160.595 119.275  1.00  0.82           C  
ATOM   1382  CD2 LEU A 167     161.452 162.058 119.649  1.00  0.82           C  
ATOM   1383  N   SER A 168     162.417 163.234 115.187  1.00  0.81           N  
ATOM   1384  CA  SER A 168     163.029 162.959 113.890  1.00  0.81           C  
ATOM   1385  C   SER A 168     162.677 161.581 113.366  1.00  0.81           C  
ATOM   1386  O   SER A 168     162.553 160.618 114.119  1.00  0.81           O  
ATOM   1387  CB  SER A 168     164.577 163.117 113.923  1.00  0.81           C  
ATOM   1388  OG  SER A 168     165.192 162.870 112.654  1.00  0.81           O  
ATOM   1389  N   SER A 169     162.536 161.433 112.037  1.00  0.81           N  
ATOM   1390  CA  SER A 169     162.241 160.161 111.391  1.00  0.81           C  
ATOM   1391  C   SER A 169     163.274 159.079 111.701  1.00  0.81           C  
ATOM   1392  O   SER A 169     162.942 157.913 111.862  1.00  0.81           O  
ATOM   1393  CB  SER A 169     162.062 160.336 109.860  1.00  0.81           C  
ATOM   1394  OG  SER A 169     163.246 160.871 109.263  1.00  0.81           O  
ATOM   1395  N   ARG A 170     164.553 159.465 111.886  1.00  0.71           N  
ATOM   1396  CA  ARG A 170     165.657 158.555 112.155  1.00  0.71           C  
ATOM   1397  C   ARG A 170     165.626 157.885 113.533  1.00  0.71           C  
ATOM   1398  O   ARG A 170     166.262 156.850 113.760  1.00  0.71           O  
ATOM   1399  CB  ARG A 170     167.013 159.302 112.037  1.00  0.71           C  
ATOM   1400  CG  ARG A 170     167.114 160.279 110.847  1.00  0.71           C  
ATOM   1401  CD  ARG A 170     168.551 160.717 110.518  1.00  0.71           C  
ATOM   1402  NE  ARG A 170     169.162 159.671 109.622  1.00  0.71           N  
ATOM   1403  CZ  ARG A 170     169.154 159.729 108.281  1.00  0.71           C  
ATOM   1404  NH1 ARG A 170     168.650 160.773 107.629  1.00  0.71           N  
ATOM   1405  NH2 ARG A 170     169.672 158.729 107.569  1.00  0.71           N  
ATOM   1406  N   VAL A 171     164.892 158.470 114.508  1.00  0.79           N  
ATOM   1407  CA  VAL A 171     164.749 157.884 115.835  1.00  0.79           C  
ATOM   1408  C   VAL A 171     163.413 157.183 115.980  1.00  0.79           C  
ATOM   1409  O   VAL A 171     163.211 156.436 116.936  1.00  0.79           O  
ATOM   1410  CB  VAL A 171     164.939 158.879 116.986  1.00  0.79           C  
ATOM   1411  CG1 VAL A 171     166.357 159.466 116.908  1.00  0.79           C  
ATOM   1412  CG2 VAL A 171     163.889 160.002 116.982  1.00  0.79           C  
ATOM   1413  N   LEU A 172     162.499 157.341 114.996  1.00  0.78           N  
ATOM   1414  CA  LEU A 172     161.183 156.714 114.989  1.00  0.78           C  
ATOM   1415  C   LEU A 172     161.269 155.195 114.968  1.00  0.78           C  
ATOM   1416  O   LEU A 172     160.592 154.528 115.743  1.00  0.78           O  
ATOM   1417  CB  LEU A 172     160.262 157.270 113.864  1.00  0.78           C  
ATOM   1418  CG  LEU A 172     159.102 158.169 114.356  1.00  0.78           C  
ATOM   1419  CD1 LEU A 172     158.083 157.378 115.185  1.00  0.78           C  
ATOM   1420  CD2 LEU A 172     159.589 159.400 115.127  1.00  0.78           C  
ATOM   1421  N   ASP A 173     162.201 154.613 114.178  1.00  0.75           N  
ATOM   1422  CA  ASP A 173     162.458 153.179 114.114  1.00  0.75           C  
ATOM   1423  C   ASP A 173     162.719 152.507 115.468  1.00  0.75           C  
ATOM   1424  O   ASP A 173     162.494 151.315 115.664  1.00  0.75           O  
ATOM   1425  CB  ASP A 173     163.746 152.855 113.311  1.00  0.75           C  
ATOM   1426  CG  ASP A 173     164.016 153.733 112.114  1.00  0.75           C  
ATOM   1427  OD1 ASP A 173     163.114 153.973 111.287  1.00  0.75           O  
ATOM   1428  OD2 ASP A 173     165.200 154.177 112.061  1.00  0.75           O  
ATOM   1429  N   LYS A 174     163.286 153.269 116.427  1.00  0.74           N  
ATOM   1430  CA  LYS A 174     163.696 152.745 117.715  1.00  0.74           C  
ATOM   1431  C   LYS A 174     162.640 153.005 118.779  1.00  0.74           C  
ATOM   1432  O   LYS A 174     162.806 152.597 119.928  1.00  0.74           O  
ATOM   1433  CB  LYS A 174     165.043 153.379 118.174  1.00  0.74           C  
ATOM   1434  CG  LYS A 174     166.317 152.650 117.690  1.00  0.74           C  
ATOM   1435  CD  LYS A 174     166.579 152.633 116.164  1.00  0.74           C  
ATOM   1436  CE  LYS A 174     166.831 154.017 115.535  1.00  0.74           C  
ATOM   1437  NZ  LYS A 174     167.078 153.979 114.066  1.00  0.74           N  
ATOM   1438  N   ILE A 175     161.521 153.668 118.432  1.00  0.76           N  
ATOM   1439  CA  ILE A 175     160.471 153.985 119.383  1.00  0.76           C  
ATOM   1440  C   ILE A 175     159.203 153.315 118.907  1.00  0.76           C  
ATOM   1441  O   ILE A 175     158.543 153.739 117.963  1.00  0.76           O  
ATOM   1442  CB  ILE A 175     160.256 155.488 119.537  1.00  0.76           C  
ATOM   1443  CG1 ILE A 175     161.564 156.151 120.027  1.00  0.76           C  
ATOM   1444  CG2 ILE A 175     159.090 155.758 120.516  1.00  0.76           C  
ATOM   1445  CD1 ILE A 175     161.524 157.675 119.971  1.00  0.76           C  
ATOM   1446  N   SER A 176     158.799 152.225 119.579  1.00  0.79           N  
ATOM   1447  CA  SER A 176     157.594 151.511 119.201  1.00  0.79           C  
ATOM   1448  C   SER A 176     156.387 152.033 119.949  1.00  0.79           C  
ATOM   1449  O   SER A 176     156.490 152.665 121.001  1.00  0.79           O  
ATOM   1450  CB  SER A 176     157.708 149.966 119.376  1.00  0.79           C  
ATOM   1451  OG  SER A 176     157.732 149.544 120.746  1.00  0.79           O  
ATOM   1452  N   ILE A 177     155.172 151.735 119.442  1.00  0.76           N  
ATOM   1453  CA  ILE A 177     153.924 152.043 120.133  1.00  0.76           C  
ATOM   1454  C   ILE A 177     153.853 151.417 121.527  1.00  0.76           C  
ATOM   1455  O   ILE A 177     153.431 152.049 122.494  1.00  0.76           O  
ATOM   1456  CB  ILE A 177     152.700 151.673 119.286  1.00  0.76           C  
ATOM   1457  CG1 ILE A 177     151.354 152.014 119.972  1.00  0.76           C  
ATOM   1458  CG2 ILE A 177     152.729 150.189 118.854  1.00  0.76           C  
ATOM   1459  CD1 ILE A 177     151.132 153.508 120.220  1.00  0.76           C  
ATOM   1460  N   GLY A 178     154.343 150.165 121.682  1.00  0.82           N  
ATOM   1461  CA  GLY A 178     154.347 149.461 122.959  1.00  0.82           C  
ATOM   1462  C   GLY A 178     155.186 150.097 124.035  1.00  0.82           C  
ATOM   1463  O   GLY A 178     154.823 150.067 125.204  1.00  0.82           O  
ATOM   1464  N   GLN A 179     156.316 150.734 123.672  1.00  0.78           N  
ATOM   1465  CA  GLN A 179     157.133 151.469 124.624  1.00  0.78           C  
ATOM   1466  C   GLN A 179     156.433 152.686 125.222  1.00  0.78           C  
ATOM   1467  O   GLN A 179     156.443 152.897 126.434  1.00  0.78           O  
ATOM   1468  CB  GLN A 179     158.453 151.929 123.961  1.00  0.78           C  
ATOM   1469  CG  GLN A 179     159.411 150.767 123.612  1.00  0.78           C  
ATOM   1470  CD  GLN A 179     160.673 151.296 122.926  1.00  0.78           C  
ATOM   1471  OE1 GLN A 179     160.910 152.499 122.843  1.00  0.78           O  
ATOM   1472  NE2 GLN A 179     161.511 150.368 122.409  1.00  0.78           N  
ATOM   1473  N   LEU A 180     155.766 153.501 124.381  1.00  0.83           N  
ATOM   1474  CA  LEU A 180     155.014 154.654 124.842  1.00  0.83           C  
ATOM   1475  C   LEU A 180     153.795 154.290 125.682  1.00  0.83           C  
ATOM   1476  O   LEU A 180     153.546 154.884 126.731  1.00  0.83           O  
ATOM   1477  CB  LEU A 180     154.581 155.538 123.654  1.00  0.83           C  
ATOM   1478  CG  LEU A 180     155.740 156.229 122.909  1.00  0.83           C  
ATOM   1479  CD1 LEU A 180     155.190 156.966 121.686  1.00  0.83           C  
ATOM   1480  CD2 LEU A 180     156.508 157.211 123.798  1.00  0.83           C  
ATOM   1481  N   VAL A 181     153.019 153.266 125.269  1.00  0.82           N  
ATOM   1482  CA  VAL A 181     151.882 152.777 126.043  1.00  0.82           C  
ATOM   1483  C   VAL A 181     152.293 152.228 127.405  1.00  0.82           C  
ATOM   1484  O   VAL A 181     151.690 152.576 128.419  1.00  0.82           O  
ATOM   1485  CB  VAL A 181     151.065 151.759 125.254  1.00  0.82           C  
ATOM   1486  CG1 VAL A 181     149.899 151.198 126.092  1.00  0.82           C  
ATOM   1487  CG2 VAL A 181     150.508 152.462 124.003  1.00  0.82           C  
ATOM   1488  N   SER A 182     153.379 151.424 127.474  1.00  0.83           N  
ATOM   1489  CA  SER A 182     153.965 150.937 128.725  1.00  0.83           C  
ATOM   1490  C   SER A 182     154.415 152.054 129.655  1.00  0.83           C  
ATOM   1491  O   SER A 182     154.226 151.999 130.868  1.00  0.83           O  
ATOM   1492  CB  SER A 182     155.211 150.038 128.483  1.00  0.83           C  
ATOM   1493  OG  SER A 182     154.851 148.776 127.922  1.00  0.83           O  
ATOM   1494  N   LEU A 183     155.028 153.130 129.125  1.00  0.82           N  
ATOM   1495  CA  LEU A 183     155.422 154.274 129.938  1.00  0.82           C  
ATOM   1496  C   LEU A 183     154.239 154.987 130.601  1.00  0.82           C  
ATOM   1497  O   LEU A 183     154.239 155.255 131.806  1.00  0.82           O  
ATOM   1498  CB  LEU A 183     156.244 155.251 129.059  1.00  0.82           C  
ATOM   1499  CG  LEU A 183     157.197 156.207 129.808  1.00  0.82           C  
ATOM   1500  CD1 LEU A 183     158.303 156.706 128.867  1.00  0.82           C  
ATOM   1501  CD2 LEU A 183     156.496 157.412 130.441  1.00  0.82           C  
ATOM   1502  N   LEU A 184     153.173 155.268 129.829  1.00  0.83           N  
ATOM   1503  CA  LEU A 184     151.957 155.880 130.337  1.00  0.83           C  
ATOM   1504  C   LEU A 184     151.163 154.983 131.291  1.00  0.83           C  
ATOM   1505  O   LEU A 184     150.745 155.410 132.368  1.00  0.83           O  
ATOM   1506  CB  LEU A 184     151.046 156.309 129.155  1.00  0.83           C  
ATOM   1507  CG  LEU A 184     151.306 157.725 128.586  1.00  0.83           C  
ATOM   1508  CD1 LEU A 184     152.723 157.935 128.037  1.00  0.83           C  
ATOM   1509  CD2 LEU A 184     150.274 158.045 127.496  1.00  0.83           C  
ATOM   1510  N   SER A 185     150.946 153.698 130.939  1.00  0.83           N  
ATOM   1511  CA  SER A 185     150.110 152.772 131.702  1.00  0.83           C  
ATOM   1512  C   SER A 185     150.629 152.466 133.103  1.00  0.83           C  
ATOM   1513  O   SER A 185     149.872 152.469 134.083  1.00  0.83           O  
ATOM   1514  CB  SER A 185     149.831 151.445 130.937  1.00  0.83           C  
ATOM   1515  OG  SER A 185     150.992 150.623 130.826  1.00  0.83           O  
ATOM   1516  N   ASN A 186     151.954 152.251 133.229  1.00  0.80           N  
ATOM   1517  CA  ASN A 186     152.669 151.962 134.464  1.00  0.80           C  
ATOM   1518  C   ASN A 186     152.547 153.052 135.518  1.00  0.80           C  
ATOM   1519  O   ASN A 186     152.462 152.779 136.715  1.00  0.80           O  
ATOM   1520  CB  ASN A 186     154.175 151.710 134.178  1.00  0.80           C  
ATOM   1521  CG  ASN A 186     154.346 150.353 133.497  1.00  0.80           C  
ATOM   1522  OD1 ASN A 186     153.497 149.474 133.603  1.00  0.80           O  
ATOM   1523  ND2 ASN A 186     155.501 150.148 132.822  1.00  0.80           N  
ATOM   1524  N   ASN A 187     152.528 154.331 135.108  1.00  0.82           N  
ATOM   1525  CA  ASN A 187     152.534 155.444 136.041  1.00  0.82           C  
ATOM   1526  C   ASN A 187     151.161 156.073 136.207  1.00  0.82           C  
ATOM   1527  O   ASN A 187     150.995 157.023 136.963  1.00  0.82           O  
ATOM   1528  CB  ASN A 187     153.569 156.494 135.586  1.00  0.82           C  
ATOM   1529  CG  ASN A 187     154.933 155.810 135.556  1.00  0.82           C  
ATOM   1530  OD1 ASN A 187     155.443 155.314 136.567  1.00  0.82           O  
ATOM   1531  ND2 ASN A 187     155.532 155.715 134.347  1.00  0.82           N  
ATOM   1532  N   LEU A 188     150.123 155.524 135.544  1.00  0.80           N  
ATOM   1533  CA  LEU A 188     148.798 156.123 135.487  1.00  0.80           C  
ATOM   1534  C   LEU A 188     148.067 156.280 136.820  1.00  0.80           C  
ATOM   1535  O   LEU A 188     147.358 157.253 137.037  1.00  0.80           O  
ATOM   1536  CB  LEU A 188     147.921 155.397 134.442  1.00  0.80           C  
ATOM   1537  CG  LEU A 188     146.678 156.167 133.942  1.00  0.80           C  
ATOM   1538  CD1 LEU A 188     146.897 157.667 133.722  1.00  0.80           C  
ATOM   1539  CD2 LEU A 188     146.243 155.567 132.606  1.00  0.80           C  
ATOM   1540  N   ASN A 189     148.237 155.323 137.755  1.00  0.79           N  
ATOM   1541  CA  ASN A 189     147.634 155.425 139.081  1.00  0.79           C  
ATOM   1542  C   ASN A 189     148.700 155.313 140.170  1.00  0.79           C  
ATOM   1543  O   ASN A 189     148.604 155.927 141.225  1.00  0.79           O  
ATOM   1544  CB  ASN A 189     146.587 154.299 139.281  1.00  0.79           C  
ATOM   1545  CG  ASN A 189     145.490 154.369 138.219  1.00  0.79           C  
ATOM   1546  OD1 ASN A 189     145.409 153.465 137.378  1.00  0.79           O  
ATOM   1547  ND2 ASN A 189     144.648 155.427 138.257  1.00  0.79           N  
ATOM   1548  N   LYS A 190     149.796 154.566 139.900  1.00  0.77           N  
ATOM   1549  CA  LYS A 190     150.892 154.343 140.836  1.00  0.77           C  
ATOM   1550  C   LYS A 190     151.614 155.619 141.252  1.00  0.77           C  
ATOM   1551  O   LYS A 190     151.979 155.805 142.410  1.00  0.77           O  
ATOM   1552  CB  LYS A 190     151.926 153.377 140.186  1.00  0.77           C  
ATOM   1553  CG  LYS A 190     153.173 153.066 141.043  1.00  0.77           C  
ATOM   1554  CD  LYS A 190     154.355 152.477 140.248  1.00  0.77           C  
ATOM   1555  CE  LYS A 190     154.932 153.473 139.236  1.00  0.77           C  
ATOM   1556  NZ  LYS A 190     156.103 152.907 138.538  1.00  0.77           N  
ATOM   1557  N   PHE A 191     151.865 156.533 140.293  1.00  0.81           N  
ATOM   1558  CA  PHE A 191     152.608 157.753 140.561  1.00  0.81           C  
ATOM   1559  C   PHE A 191     151.876 158.682 141.525  1.00  0.81           C  
ATOM   1560  O   PHE A 191     152.453 159.184 142.490  1.00  0.81           O  
ATOM   1561  CB  PHE A 191     152.895 158.473 139.218  1.00  0.81           C  
ATOM   1562  CG  PHE A 191     153.952 159.532 139.365  1.00  0.81           C  
ATOM   1563  CD1 PHE A 191     155.310 159.214 139.197  1.00  0.81           C  
ATOM   1564  CD2 PHE A 191     153.594 160.848 139.702  1.00  0.81           C  
ATOM   1565  CE1 PHE A 191     156.297 160.194 139.370  1.00  0.81           C  
ATOM   1566  CE2 PHE A 191     154.579 161.823 139.896  1.00  0.81           C  
ATOM   1567  CZ  PHE A 191     155.930 161.498 139.725  1.00  0.81           C  
ATOM   1568  N   ASP A 192     150.562 158.879 141.299  1.00  0.82           N  
ATOM   1569  CA  ASP A 192     149.724 159.785 142.057  1.00  0.82           C  
ATOM   1570  C   ASP A 192     149.655 159.404 143.546  1.00  0.82           C  
ATOM   1571  O   ASP A 192     149.825 160.244 144.429  1.00  0.82           O  
ATOM   1572  CB  ASP A 192     148.287 159.851 141.450  1.00  0.82           C  
ATOM   1573  CG  ASP A 192     148.207 160.226 139.978  1.00  0.82           C  
ATOM   1574  OD1 ASP A 192     149.233 160.368 139.276  1.00  0.82           O  
ATOM   1575  OD2 ASP A 192     147.058 160.396 139.490  1.00  0.82           O  
ATOM   1576  N   GLU A 193     149.478 158.096 143.847  1.00  0.76           N  
ATOM   1577  CA  GLU A 193     149.396 157.551 145.196  1.00  0.76           C  
ATOM   1578  C   GLU A 193     150.743 157.500 145.917  1.00  0.76           C  
ATOM   1579  O   GLU A 193     150.820 157.510 147.149  1.00  0.76           O  
ATOM   1580  CB  GLU A 193     148.786 156.120 145.135  1.00  0.76           C  
ATOM   1581  CG  GLU A 193     147.359 156.079 144.517  1.00  0.76           C  
ATOM   1582  CD  GLU A 193     146.808 154.676 144.233  1.00  0.76           C  
ATOM   1583  OE1 GLU A 193     147.555 153.678 144.385  1.00  0.76           O  
ATOM   1584  OE2 GLU A 193     145.615 154.609 143.825  1.00  0.76           O  
ATOM   1585  N   GLY A 194     151.861 157.488 145.156  1.00  0.82           N  
ATOM   1586  CA  GLY A 194     153.225 157.406 145.675  1.00  0.82           C  
ATOM   1587  C   GLY A 194     153.666 158.571 146.523  1.00  0.82           C  
ATOM   1588  O   GLY A 194     154.461 158.429 147.452  1.00  0.82           O  
ATOM   1589  N   LEU A 195     153.139 159.778 146.265  1.00  0.80           N  
ATOM   1590  CA  LEU A 195     153.540 160.972 146.993  1.00  0.80           C  
ATOM   1591  C   LEU A 195     153.139 160.972 148.460  1.00  0.80           C  
ATOM   1592  O   LEU A 195     153.801 161.589 149.294  1.00  0.80           O  
ATOM   1593  CB  LEU A 195     153.038 162.259 146.311  1.00  0.80           C  
ATOM   1594  CG  LEU A 195     154.042 162.827 145.291  1.00  0.80           C  
ATOM   1595  CD1 LEU A 195     154.072 162.043 143.973  1.00  0.80           C  
ATOM   1596  CD2 LEU A 195     153.745 164.309 145.068  1.00  0.80           C  
ATOM   1597  N   ALA A 196     152.085 160.221 148.831  1.00  0.84           N  
ATOM   1598  CA  ALA A 196     151.695 160.042 150.214  1.00  0.84           C  
ATOM   1599  C   ALA A 196     152.705 159.234 151.035  1.00  0.84           C  
ATOM   1600  O   ALA A 196     152.789 159.356 152.254  1.00  0.84           O  
ATOM   1601  CB  ALA A 196     150.313 159.368 150.246  1.00  0.84           C  
ATOM   1602  N   LEU A 197     153.529 158.404 150.365  1.00  0.79           N  
ATOM   1603  CA  LEU A 197     154.498 157.545 151.019  1.00  0.79           C  
ATOM   1604  C   LEU A 197     155.893 158.161 151.073  1.00  0.79           C  
ATOM   1605  O   LEU A 197     156.715 157.801 151.913  1.00  0.79           O  
ATOM   1606  CB  LEU A 197     154.616 156.212 150.234  1.00  0.79           C  
ATOM   1607  CG  LEU A 197     153.298 155.430 150.060  1.00  0.79           C  
ATOM   1608  CD1 LEU A 197     153.492 154.294 149.046  1.00  0.79           C  
ATOM   1609  CD2 LEU A 197     152.764 154.881 151.388  1.00  0.79           C  
ATOM   1610  N   ALA A 198     156.196 159.141 150.199  1.00  0.84           N  
ATOM   1611  CA  ALA A 198     157.535 159.678 149.998  1.00  0.84           C  
ATOM   1612  C   ALA A 198     158.178 160.325 151.224  1.00  0.84           C  
ATOM   1613  O   ALA A 198     159.374 160.172 151.471  1.00  0.84           O  
ATOM   1614  CB  ALA A 198     157.520 160.665 148.817  1.00  0.84           C  
ATOM   1615  N   HIS A 199     157.383 161.032 152.052  1.00  0.81           N  
ATOM   1616  CA  HIS A 199     157.855 161.698 153.261  1.00  0.81           C  
ATOM   1617  C   HIS A 199     158.310 160.752 154.371  1.00  0.81           C  
ATOM   1618  O   HIS A 199     159.081 161.121 155.256  1.00  0.81           O  
ATOM   1619  CB  HIS A 199     156.764 162.635 153.827  1.00  0.81           C  
ATOM   1620  CG  HIS A 199     156.646 163.924 153.068  1.00  0.81           C  
ATOM   1621  ND1 HIS A 199     157.731 164.780 153.087  1.00  0.81           N  
ATOM   1622  CD2 HIS A 199     155.615 164.488 152.385  1.00  0.81           C  
ATOM   1623  CE1 HIS A 199     157.342 165.846 152.418  1.00  0.81           C  
ATOM   1624  NE2 HIS A 199     156.070 165.723 151.975  1.00  0.81           N  
ATOM   1625  N   PHE A 200     157.911 159.464 154.339  1.00  0.80           N  
ATOM   1626  CA  PHE A 200     158.305 158.507 155.364  1.00  0.80           C  
ATOM   1627  C   PHE A 200     159.782 158.138 155.328  1.00  0.80           C  
ATOM   1628  O   PHE A 200     160.307 157.586 156.293  1.00  0.80           O  
ATOM   1629  CB  PHE A 200     157.435 157.232 155.364  1.00  0.80           C  
ATOM   1630  CG  PHE A 200     156.071 157.540 155.902  1.00  0.80           C  
ATOM   1631  CD1 PHE A 200     155.824 157.481 157.283  1.00  0.80           C  
ATOM   1632  CD2 PHE A 200     155.019 157.875 155.036  1.00  0.80           C  
ATOM   1633  CE1 PHE A 200     154.540 157.727 157.784  1.00  0.80           C  
ATOM   1634  CE2 PHE A 200     153.736 158.127 155.533  1.00  0.80           C  
ATOM   1635  CZ  PHE A 200     153.495 158.049 156.910  1.00  0.80           C  
ATOM   1636  N   VAL A 201     160.507 158.509 154.249  1.00  0.80           N  
ATOM   1637  CA  VAL A 201     161.956 158.378 154.146  1.00  0.80           C  
ATOM   1638  C   VAL A 201     162.701 159.127 155.255  1.00  0.80           C  
ATOM   1639  O   VAL A 201     163.712 158.654 155.768  1.00  0.80           O  
ATOM   1640  CB  VAL A 201     162.454 158.728 152.741  1.00  0.80           C  
ATOM   1641  CG1 VAL A 201     162.562 160.245 152.493  1.00  0.80           C  
ATOM   1642  CG2 VAL A 201     163.793 158.017 152.472  1.00  0.80           C  
ATOM   1643  N   TRP A 202     162.174 160.295 155.694  1.00  0.77           N  
ATOM   1644  CA  TRP A 202     162.706 161.031 156.830  1.00  0.77           C  
ATOM   1645  C   TRP A 202     161.802 160.992 158.064  1.00  0.77           C  
ATOM   1646  O   TRP A 202     162.296 161.056 159.187  1.00  0.77           O  
ATOM   1647  CB  TRP A 202     163.021 162.500 156.435  1.00  0.77           C  
ATOM   1648  CG  TRP A 202     161.841 163.328 155.953  1.00  0.77           C  
ATOM   1649  CD1 TRP A 202     161.361 163.490 154.681  1.00  0.77           C  
ATOM   1650  CD2 TRP A 202     160.974 164.092 156.813  1.00  0.77           C  
ATOM   1651  NE1 TRP A 202     160.240 164.292 154.694  1.00  0.77           N  
ATOM   1652  CE2 TRP A 202     159.992 164.675 155.988  1.00  0.77           C  
ATOM   1653  CE3 TRP A 202     160.970 164.295 158.194  1.00  0.77           C  
ATOM   1654  CZ2 TRP A 202     158.988 165.469 156.521  1.00  0.77           C  
ATOM   1655  CZ3 TRP A 202     159.946 165.088 158.734  1.00  0.77           C  
ATOM   1656  CH2 TRP A 202     158.971 165.670 157.909  1.00  0.77           C  
ATOM   1657  N   ILE A 203     160.463 160.826 157.933  1.00  0.81           N  
ATOM   1658  CA  ILE A 203     159.579 160.682 159.099  1.00  0.81           C  
ATOM   1659  C   ILE A 203     159.862 159.425 159.915  1.00  0.81           C  
ATOM   1660  O   ILE A 203     159.964 159.468 161.142  1.00  0.81           O  
ATOM   1661  CB  ILE A 203     158.092 160.745 158.724  1.00  0.81           C  
ATOM   1662  CG1 ILE A 203     157.755 162.153 158.184  1.00  0.81           C  
ATOM   1663  CG2 ILE A 203     157.171 160.319 159.896  1.00  0.81           C  
ATOM   1664  CD1 ILE A 203     156.327 162.301 157.651  1.00  0.81           C  
ATOM   1665  N   ALA A 204     160.034 158.261 159.257  1.00  0.83           N  
ATOM   1666  CA  ALA A 204     160.269 157.012 159.956  1.00  0.83           C  
ATOM   1667  C   ALA A 204     161.558 156.944 160.796  1.00  0.83           C  
ATOM   1668  O   ALA A 204     161.454 156.505 161.942  1.00  0.83           O  
ATOM   1669  CB  ALA A 204     160.129 155.829 158.981  1.00  0.83           C  
ATOM   1670  N   PRO A 205     162.756 157.387 160.388  1.00  0.83           N  
ATOM   1671  CA  PRO A 205     163.913 157.524 161.278  1.00  0.83           C  
ATOM   1672  C   PRO A 205     163.679 158.375 162.517  1.00  0.83           C  
ATOM   1673  O   PRO A 205     164.137 158.009 163.599  1.00  0.83           O  
ATOM   1674  CB  PRO A 205     165.014 158.100 160.373  1.00  0.83           C  
ATOM   1675  CG  PRO A 205     164.638 157.629 158.967  1.00  0.83           C  
ATOM   1676  CD  PRO A 205     163.115 157.663 158.994  1.00  0.83           C  
ATOM   1677  N   LEU A 206     162.968 159.512 162.394  1.00  0.82           N  
ATOM   1678  CA  LEU A 206     162.621 160.363 163.524  1.00  0.82           C  
ATOM   1679  C   LEU A 206     161.666 159.683 164.508  1.00  0.82           C  
ATOM   1680  O   LEU A 206     161.832 159.773 165.724  1.00  0.82           O  
ATOM   1681  CB  LEU A 206     162.065 161.736 163.055  1.00  0.82           C  
ATOM   1682  CG  LEU A 206     163.125 162.838 162.798  1.00  0.82           C  
ATOM   1683  CD1 LEU A 206     163.902 163.196 164.071  1.00  0.82           C  
ATOM   1684  CD2 LEU A 206     164.098 162.515 161.660  1.00  0.82           C  
ATOM   1685  N   GLN A 207     160.666 158.929 164.007  1.00  0.81           N  
ATOM   1686  CA  GLN A 207     159.819 158.076 164.829  1.00  0.81           C  
ATOM   1687  C   GLN A 207     160.579 156.993 165.588  1.00  0.81           C  
ATOM   1688  O   GLN A 207     160.343 156.778 166.775  1.00  0.81           O  
ATOM   1689  CB  GLN A 207     158.717 157.417 163.966  1.00  0.81           C  
ATOM   1690  CG  GLN A 207     157.641 158.409 163.475  1.00  0.81           C  
ATOM   1691  CD  GLN A 207     156.758 158.841 164.642  1.00  0.81           C  
ATOM   1692  OE1 GLN A 207     155.886 158.100 165.086  1.00  0.81           O  
ATOM   1693  NE2 GLN A 207     157.002 160.055 165.186  1.00  0.81           N  
ATOM   1694  N   VAL A 208     161.554 156.318 164.943  1.00  0.83           N  
ATOM   1695  CA  VAL A 208     162.421 155.346 165.604  1.00  0.83           C  
ATOM   1696  C   VAL A 208     163.231 155.959 166.743  1.00  0.83           C  
ATOM   1697  O   VAL A 208     163.259 155.420 167.848  1.00  0.83           O  
ATOM   1698  CB  VAL A 208     163.349 154.650 164.606  1.00  0.83           C  
ATOM   1699  CG1 VAL A 208     164.342 153.700 165.302  1.00  0.83           C  
ATOM   1700  CG2 VAL A 208     162.500 153.834 163.616  1.00  0.83           C  
ATOM   1701  N   ALA A 209     163.852 157.140 166.536  1.00  0.83           N  
ATOM   1702  CA  ALA A 209     164.581 157.847 167.579  1.00  0.83           C  
ATOM   1703  C   ALA A 209     163.723 158.242 168.786  1.00  0.83           C  
ATOM   1704  O   ALA A 209     164.109 158.037 169.937  1.00  0.83           O  
ATOM   1705  CB  ALA A 209     165.240 159.102 166.975  1.00  0.83           C  
ATOM   1706  N   LEU A 210     162.507 158.775 168.541  1.00  0.82           N  
ATOM   1707  CA  LEU A 210     161.540 159.089 169.585  1.00  0.82           C  
ATOM   1708  C   LEU A 210     161.081 157.875 170.389  1.00  0.82           C  
ATOM   1709  O   LEU A 210     161.129 157.858 171.619  1.00  0.82           O  
ATOM   1710  CB  LEU A 210     160.293 159.735 168.922  1.00  0.82           C  
ATOM   1711  CG  LEU A 210     159.114 160.075 169.862  1.00  0.82           C  
ATOM   1712  CD1 LEU A 210     159.476 161.165 170.877  1.00  0.82           C  
ATOM   1713  CD2 LEU A 210     157.870 160.471 169.053  1.00  0.82           C  
ATOM   1714  N   LEU A 211     160.658 156.798 169.699  1.00  0.84           N  
ATOM   1715  CA  LEU A 211     160.175 155.581 170.327  1.00  0.84           C  
ATOM   1716  C   LEU A 211     161.237 154.850 171.120  1.00  0.84           C  
ATOM   1717  O   LEU A 211     160.977 154.359 172.217  1.00  0.84           O  
ATOM   1718  CB  LEU A 211     159.550 154.631 169.283  1.00  0.84           C  
ATOM   1719  CG  LEU A 211     158.202 155.131 168.727  1.00  0.84           C  
ATOM   1720  CD1 LEU A 211     157.815 154.359 167.462  1.00  0.84           C  
ATOM   1721  CD2 LEU A 211     157.082 155.024 169.768  1.00  0.84           C  
ATOM   1722  N   MET A 212     162.484 154.791 170.615  1.00  0.76           N  
ATOM   1723  CA  MET A 212     163.579 154.140 171.311  1.00  0.76           C  
ATOM   1724  C   MET A 212     163.877 154.738 172.684  1.00  0.76           C  
ATOM   1725  O   MET A 212     164.155 154.017 173.639  1.00  0.76           O  
ATOM   1726  CB  MET A 212     164.852 154.054 170.433  1.00  0.76           C  
ATOM   1727  CG  MET A 212     165.575 152.706 170.591  1.00  0.76           C  
ATOM   1728  SD  MET A 212     164.602 151.323 169.912  1.00  0.76           S  
ATOM   1729  CE  MET A 212     165.192 150.108 171.115  1.00  0.76           C  
ATOM   1730  N   GLY A 213     163.754 156.078 172.833  1.00  0.78           N  
ATOM   1731  CA  GLY A 213     163.866 156.746 174.131  1.00  0.78           C  
ATOM   1732  C   GLY A 213     162.772 156.415 175.125  1.00  0.78           C  
ATOM   1733  O   GLY A 213     163.020 156.300 176.320  1.00  0.78           O  
ATOM   1734  N   LEU A 214     161.529 156.220 174.652  1.00  0.79           N  
ATOM   1735  CA  LEU A 214     160.413 155.766 175.473  1.00  0.79           C  
ATOM   1736  C   LEU A 214     160.573 154.318 175.937  1.00  0.79           C  
ATOM   1737  O   LEU A 214     160.329 153.966 177.088  1.00  0.79           O  
ATOM   1738  CB  LEU A 214     159.076 155.935 174.705  1.00  0.79           C  
ATOM   1739  CG  LEU A 214     158.753 157.388 174.289  1.00  0.79           C  
ATOM   1740  CD1 LEU A 214     157.550 157.437 173.338  1.00  0.79           C  
ATOM   1741  CD2 LEU A 214     158.493 158.289 175.501  1.00  0.79           C  
ATOM   1742  N   ILE A 215     161.040 153.422 175.044  1.00  0.77           N  
ATOM   1743  CA  ILE A 215     161.365 152.037 175.378  1.00  0.77           C  
ATOM   1744  C   ILE A 215     162.528 151.943 176.374  1.00  0.77           C  
ATOM   1745  O   ILE A 215     162.522 151.113 177.287  1.00  0.77           O  
ATOM   1746  CB  ILE A 215     161.588 151.190 174.122  1.00  0.77           C  
ATOM   1747  CG1 ILE A 215     160.324 151.223 173.226  1.00  0.77           C  
ATOM   1748  CG2 ILE A 215     161.913 149.732 174.510  1.00  0.77           C  
ATOM   1749  CD1 ILE A 215     160.518 150.588 171.846  1.00  0.77           C  
ATOM   1750  N   TRP A 216     163.533 152.841 176.255  1.00  0.65           N  
ATOM   1751  CA  TRP A 216     164.671 152.962 177.164  1.00  0.65           C  
ATOM   1752  C   TRP A 216     164.267 153.180 178.623  1.00  0.65           C  
ATOM   1753  O   TRP A 216     164.828 152.572 179.532  1.00  0.65           O  
ATOM   1754  CB  TRP A 216     165.590 154.134 176.710  1.00  0.65           C  
ATOM   1755  CG  TRP A 216     166.972 154.174 177.344  1.00  0.65           C  
ATOM   1756  CD1 TRP A 216     168.120 153.591 176.890  1.00  0.65           C  
ATOM   1757  CD2 TRP A 216     167.304 154.778 178.611  1.00  0.65           C  
ATOM   1758  NE1 TRP A 216     169.146 153.774 177.792  1.00  0.65           N  
ATOM   1759  CE2 TRP A 216     168.658 154.484 178.863  1.00  0.65           C  
ATOM   1760  CE3 TRP A 216     166.539 155.495 179.530  1.00  0.65           C  
ATOM   1761  CZ2 TRP A 216     169.270 154.875 180.047  1.00  0.65           C  
ATOM   1762  CZ3 TRP A 216     167.153 155.878 180.732  1.00  0.65           C  
ATOM   1763  CH2 TRP A 216     168.497 155.570 180.989  1.00  0.65           C  
ATOM   1764  N   GLU A 217     163.229 154.014 178.873  1.00  0.67           N  
ATOM   1765  CA  GLU A 217     162.682 154.278 180.202  1.00  0.67           C  
ATOM   1766  C   GLU A 217     162.236 153.001 180.908  1.00  0.67           C  
ATOM   1767  O   GLU A 217     162.491 152.769 182.093  1.00  0.67           O  
ATOM   1768  CB  GLU A 217     161.472 155.254 180.098  1.00  0.67           C  
ATOM   1769  CG  GLU A 217     160.802 155.633 181.451  1.00  0.67           C  
ATOM   1770  CD  GLU A 217     159.585 156.561 181.332  1.00  0.67           C  
ATOM   1771  OE1 GLU A 217     159.326 157.103 180.230  1.00  0.67           O  
ATOM   1772  OE2 GLU A 217     158.885 156.717 182.371  1.00  0.67           O  
ATOM   1773  N   LEU A 218     161.583 152.088 180.166  1.00  0.71           N  
ATOM   1774  CA  LEU A 218     161.213 150.797 180.692  1.00  0.71           C  
ATOM   1775  C   LEU A 218     162.400 149.853 180.869  1.00  0.71           C  
ATOM   1776  O   LEU A 218     162.624 149.302 181.955  1.00  0.71           O  
ATOM   1777  CB  LEU A 218     160.195 150.110 179.747  1.00  0.71           C  
ATOM   1778  CG  LEU A 218     158.947 150.945 179.403  1.00  0.71           C  
ATOM   1779  CD1 LEU A 218     158.110 150.200 178.357  1.00  0.71           C  
ATOM   1780  CD2 LEU A 218     158.101 151.308 180.631  1.00  0.71           C  
ATOM   1781  N   LEU A 219     163.197 149.658 179.802  1.00  0.67           N  
ATOM   1782  CA  LEU A 219     164.233 148.646 179.751  1.00  0.67           C  
ATOM   1783  C   LEU A 219     165.544 149.295 179.342  1.00  0.67           C  
ATOM   1784  O   LEU A 219     165.794 149.537 178.167  1.00  0.67           O  
ATOM   1785  CB  LEU A 219     163.905 147.534 178.715  1.00  0.67           C  
ATOM   1786  CG  LEU A 219     162.475 146.957 178.730  1.00  0.67           C  
ATOM   1787  CD1 LEU A 219     162.284 146.033 177.520  1.00  0.67           C  
ATOM   1788  CD2 LEU A 219     162.136 146.207 180.022  1.00  0.67           C  
ATOM   1789  N   GLN A 220     166.443 149.565 180.308  1.00  0.60           N  
ATOM   1790  CA  GLN A 220     167.551 150.488 180.099  1.00  0.60           C  
ATOM   1791  C   GLN A 220     168.551 150.108 178.995  1.00  0.60           C  
ATOM   1792  O   GLN A 220     168.714 150.793 177.994  1.00  0.60           O  
ATOM   1793  CB  GLN A 220     168.312 150.653 181.444  1.00  0.60           C  
ATOM   1794  CG  GLN A 220     167.428 150.782 182.717  1.00  0.60           C  
ATOM   1795  CD  GLN A 220     166.525 152.021 182.695  1.00  0.60           C  
ATOM   1796  OE1 GLN A 220     167.000 153.130 182.487  1.00  0.60           O  
ATOM   1797  NE2 GLN A 220     165.212 151.835 182.972  1.00  0.60           N  
ATOM   1798  N   ALA A 221     169.216 148.940 179.108  1.00  0.66           N  
ATOM   1799  CA  ALA A 221     170.147 148.489 178.087  1.00  0.66           C  
ATOM   1800  C   ALA A 221     169.579 147.311 177.304  1.00  0.66           C  
ATOM   1801  O   ALA A 221     170.032 146.974 176.214  1.00  0.66           O  
ATOM   1802  CB  ALA A 221     171.467 148.095 178.779  1.00  0.66           C  
ATOM   1803  N   SER A 222     168.499 146.688 177.824  1.00  0.66           N  
ATOM   1804  CA  SER A 222     167.871 145.506 177.233  1.00  0.66           C  
ATOM   1805  C   SER A 222     167.047 145.858 176.002  1.00  0.66           C  
ATOM   1806  O   SER A 222     166.815 145.035 175.120  1.00  0.66           O  
ATOM   1807  CB  SER A 222     166.988 144.788 178.286  1.00  0.66           C  
ATOM   1808  OG  SER A 222     166.605 143.476 177.902  1.00  0.66           O  
ATOM   1809  N   ALA A 223     166.645 147.140 175.870  1.00  0.70           N  
ATOM   1810  CA  ALA A 223     165.946 147.672 174.715  1.00  0.70           C  
ATOM   1811  C   ALA A 223     166.707 147.531 173.396  1.00  0.70           C  
ATOM   1812  O   ALA A 223     166.140 147.190 172.358  1.00  0.70           O  
ATOM   1813  CB  ALA A 223     165.631 149.157 174.970  1.00  0.70           C  
ATOM   1814  N   PHE A 224     168.037 147.744 173.417  1.00  0.66           N  
ATOM   1815  CA  PHE A 224     168.883 147.707 172.234  1.00  0.66           C  
ATOM   1816  C   PHE A 224     169.007 146.322 171.603  1.00  0.66           C  
ATOM   1817  O   PHE A 224     169.243 146.199 170.402  1.00  0.66           O  
ATOM   1818  CB  PHE A 224     170.299 148.254 172.539  1.00  0.66           C  
ATOM   1819  CG  PHE A 224     170.239 149.710 172.908  1.00  0.66           C  
ATOM   1820  CD1 PHE A 224     170.215 150.701 171.911  1.00  0.66           C  
ATOM   1821  CD2 PHE A 224     170.227 150.104 174.256  1.00  0.66           C  
ATOM   1822  CE1 PHE A 224     170.180 152.059 172.255  1.00  0.66           C  
ATOM   1823  CE2 PHE A 224     170.188 151.459 174.605  1.00  0.66           C  
ATOM   1824  CZ  PHE A 224     170.165 152.437 173.604  1.00  0.66           C  
ATOM   1825  N   CYS A 225     168.788 145.236 172.378  1.00  0.72           N  
ATOM   1826  CA  CYS A 225     168.749 143.875 171.849  1.00  0.72           C  
ATOM   1827  C   CYS A 225     167.625 143.680 170.830  1.00  0.72           C  
ATOM   1828  O   CYS A 225     167.801 143.078 169.772  1.00  0.72           O  
ATOM   1829  CB  CYS A 225     168.627 142.843 173.003  1.00  0.72           C  
ATOM   1830  SG  CYS A 225     168.951 141.117 172.489  1.00  0.72           S  
ATOM   1831  N   GLY A 226     166.439 144.266 171.105  1.00  0.76           N  
ATOM   1832  CA  GLY A 226     165.322 144.263 170.163  1.00  0.76           C  
ATOM   1833  C   GLY A 226     165.547 145.125 168.942  1.00  0.76           C  
ATOM   1834  O   GLY A 226     165.099 144.806 167.843  1.00  0.76           O  
ATOM   1835  N   LEU A 227     166.281 146.246 169.088  1.00  0.74           N  
ATOM   1836  CA  LEU A 227     166.650 147.103 167.969  1.00  0.74           C  
ATOM   1837  C   LEU A 227     167.571 146.428 166.963  1.00  0.74           C  
ATOM   1838  O   LEU A 227     167.386 146.550 165.754  1.00  0.74           O  
ATOM   1839  CB  LEU A 227     167.294 148.430 168.442  1.00  0.74           C  
ATOM   1840  CG  LEU A 227     167.573 149.470 167.331  1.00  0.74           C  
ATOM   1841  CD1 LEU A 227     166.306 149.883 166.569  1.00  0.74           C  
ATOM   1842  CD2 LEU A 227     168.257 150.715 167.909  1.00  0.74           C  
ATOM   1843  N   GLY A 228     168.577 145.653 167.431  1.00  0.80           N  
ATOM   1844  CA  GLY A 228     169.499 144.942 166.541  1.00  0.80           C  
ATOM   1845  C   GLY A 228     168.843 143.946 165.611  1.00  0.80           C  
ATOM   1846  O   GLY A 228     169.266 143.767 164.473  1.00  0.80           O  
ATOM   1847  N   PHE A 229     167.740 143.317 166.055  1.00  0.77           N  
ATOM   1848  CA  PHE A 229     166.887 142.483 165.222  1.00  0.77           C  
ATOM   1849  C   PHE A 229     166.222 143.257 164.077  1.00  0.77           C  
ATOM   1850  O   PHE A 229     166.188 142.824 162.925  1.00  0.77           O  
ATOM   1851  CB  PHE A 229     165.817 141.823 166.134  1.00  0.77           C  
ATOM   1852  CG  PHE A 229     164.927 140.869 165.387  1.00  0.77           C  
ATOM   1853  CD1 PHE A 229     165.404 139.613 164.978  1.00  0.77           C  
ATOM   1854  CD2 PHE A 229     163.620 141.251 165.046  1.00  0.77           C  
ATOM   1855  CE1 PHE A 229     164.594 138.760 164.217  1.00  0.77           C  
ATOM   1856  CE2 PHE A 229     162.809 140.396 164.292  1.00  0.77           C  
ATOM   1857  CZ  PHE A 229     163.296 139.154 163.871  1.00  0.77           C  
ATOM   1858  N   LEU A 230     165.700 144.461 164.372  1.00  0.80           N  
ATOM   1859  CA  LEU A 230     165.107 145.351 163.391  1.00  0.80           C  
ATOM   1860  C   LEU A 230     166.097 145.853 162.342  1.00  0.80           C  
ATOM   1861  O   LEU A 230     165.766 145.954 161.162  1.00  0.80           O  
ATOM   1862  CB  LEU A 230     164.387 146.530 164.086  1.00  0.80           C  
ATOM   1863  CG  LEU A 230     163.125 146.138 164.884  1.00  0.80           C  
ATOM   1864  CD1 LEU A 230     162.524 147.376 165.558  1.00  0.80           C  
ATOM   1865  CD2 LEU A 230     162.056 145.464 164.012  1.00  0.80           C  
ATOM   1866  N   ILE A 231     167.357 146.140 162.729  1.00  0.76           N  
ATOM   1867  CA  ILE A 231     168.437 146.455 161.794  1.00  0.76           C  
ATOM   1868  C   ILE A 231     168.745 145.308 160.827  1.00  0.76           C  
ATOM   1869  O   ILE A 231     168.912 145.520 159.626  1.00  0.76           O  
ATOM   1870  CB  ILE A 231     169.694 146.915 162.534  1.00  0.76           C  
ATOM   1871  CG1 ILE A 231     169.417 148.173 163.397  1.00  0.76           C  
ATOM   1872  CG2 ILE A 231     170.865 147.168 161.557  1.00  0.76           C  
ATOM   1873  CD1 ILE A 231     168.893 149.393 162.629  1.00  0.76           C  
ATOM   1874  N   VAL A 232     168.768 144.043 161.305  1.00  0.78           N  
ATOM   1875  CA  VAL A 232     168.894 142.863 160.446  1.00  0.78           C  
ATOM   1876  C   VAL A 232     167.754 142.747 159.434  1.00  0.78           C  
ATOM   1877  O   VAL A 232     167.977 142.525 158.243  1.00  0.78           O  
ATOM   1878  CB  VAL A 232     169.007 141.584 161.281  1.00  0.78           C  
ATOM   1879  CG1 VAL A 232     168.948 140.310 160.415  1.00  0.78           C  
ATOM   1880  CG2 VAL A 232     170.337 141.614 162.053  1.00  0.78           C  
ATOM   1881  N   LEU A 233     166.494 142.965 159.865  1.00  0.79           N  
ATOM   1882  CA  LEU A 233     165.352 143.035 158.962  1.00  0.79           C  
ATOM   1883  C   LEU A 233     165.426 144.161 157.937  1.00  0.79           C  
ATOM   1884  O   LEU A 233     165.129 143.953 156.763  1.00  0.79           O  
ATOM   1885  CB  LEU A 233     164.019 143.162 159.734  1.00  0.79           C  
ATOM   1886  CG  LEU A 233     163.543 141.867 160.417  1.00  0.79           C  
ATOM   1887  CD1 LEU A 233     162.273 142.146 161.222  1.00  0.79           C  
ATOM   1888  CD2 LEU A 233     163.262 140.743 159.411  1.00  0.79           C  
ATOM   1889  N   ALA A 234     165.864 145.369 158.338  1.00  0.80           N  
ATOM   1890  CA  ALA A 234     166.055 146.489 157.435  1.00  0.80           C  
ATOM   1891  C   ALA A 234     167.063 146.213 156.316  1.00  0.80           C  
ATOM   1892  O   ALA A 234     166.810 146.488 155.143  1.00  0.80           O  
ATOM   1893  CB  ALA A 234     166.499 147.710 158.264  1.00  0.80           C  
ATOM   1894  N   LEU A 235     168.218 145.597 156.646  1.00  0.76           N  
ATOM   1895  CA  LEU A 235     169.184 145.131 155.661  1.00  0.76           C  
ATOM   1896  C   LEU A 235     168.657 144.016 154.760  1.00  0.76           C  
ATOM   1897  O   LEU A 235     168.868 144.024 153.547  1.00  0.76           O  
ATOM   1898  CB  LEU A 235     170.497 144.679 156.345  1.00  0.76           C  
ATOM   1899  CG  LEU A 235     171.246 145.804 157.091  1.00  0.76           C  
ATOM   1900  CD1 LEU A 235     172.438 145.235 157.872  1.00  0.76           C  
ATOM   1901  CD2 LEU A 235     171.718 146.919 156.149  1.00  0.76           C  
ATOM   1902  N   PHE A 236     167.917 143.037 155.322  1.00  0.76           N  
ATOM   1903  CA  PHE A 236     167.258 141.992 154.552  1.00  0.76           C  
ATOM   1904  C   PHE A 236     166.241 142.536 153.539  1.00  0.76           C  
ATOM   1905  O   PHE A 236     166.302 142.222 152.351  1.00  0.76           O  
ATOM   1906  CB  PHE A 236     166.586 141.006 155.552  1.00  0.76           C  
ATOM   1907  CG  PHE A 236     165.850 139.870 154.892  1.00  0.76           C  
ATOM   1908  CD1 PHE A 236     166.514 138.997 154.015  1.00  0.76           C  
ATOM   1909  CD2 PHE A 236     164.478 139.687 155.130  1.00  0.76           C  
ATOM   1910  CE1 PHE A 236     165.810 137.979 153.358  1.00  0.76           C  
ATOM   1911  CE2 PHE A 236     163.774 138.661 154.489  1.00  0.76           C  
ATOM   1912  CZ  PHE A 236     164.439 137.813 153.593  1.00  0.76           C  
ATOM   1913  N   GLN A 237     165.334 143.436 153.971  1.00  0.73           N  
ATOM   1914  CA  GLN A 237     164.371 144.109 153.109  1.00  0.73           C  
ATOM   1915  C   GLN A 237     165.019 144.977 152.028  1.00  0.73           C  
ATOM   1916  O   GLN A 237     164.584 144.992 150.876  1.00  0.73           O  
ATOM   1917  CB  GLN A 237     163.325 144.897 153.942  1.00  0.73           C  
ATOM   1918  CG  GLN A 237     162.323 143.963 154.672  1.00  0.73           C  
ATOM   1919  CD  GLN A 237     161.326 144.743 155.534  1.00  0.73           C  
ATOM   1920  OE1 GLN A 237     161.678 145.347 156.546  1.00  0.73           O  
ATOM   1921  NE2 GLN A 237     160.025 144.721 155.152  1.00  0.73           N  
ATOM   1922  N   ALA A 238     166.129 145.675 152.342  1.00  0.79           N  
ATOM   1923  CA  ALA A 238     166.925 146.388 151.356  1.00  0.79           C  
ATOM   1924  C   ALA A 238     167.488 145.499 150.241  1.00  0.79           C  
ATOM   1925  O   ALA A 238     167.481 145.866 149.066  1.00  0.79           O  
ATOM   1926  CB  ALA A 238     168.074 147.125 152.070  1.00  0.79           C  
ATOM   1927  N   GLY A 239     167.959 144.278 150.574  1.00  0.80           N  
ATOM   1928  CA  GLY A 239     168.384 143.294 149.578  1.00  0.80           C  
ATOM   1929  C   GLY A 239     167.264 142.729 148.732  1.00  0.80           C  
ATOM   1930  O   GLY A 239     167.428 142.511 147.530  1.00  0.80           O  
ATOM   1931  N   LEU A 240     166.074 142.514 149.328  1.00  0.80           N  
ATOM   1932  CA  LEU A 240     164.876 142.085 148.620  1.00  0.80           C  
ATOM   1933  C   LEU A 240     164.411 143.081 147.560  1.00  0.80           C  
ATOM   1934  O   LEU A 240     164.118 142.703 146.425  1.00  0.80           O  
ATOM   1935  CB  LEU A 240     163.703 141.830 149.603  1.00  0.80           C  
ATOM   1936  CG  LEU A 240     163.893 140.658 150.588  1.00  0.80           C  
ATOM   1937  CD1 LEU A 240     162.759 140.652 151.617  1.00  0.80           C  
ATOM   1938  CD2 LEU A 240     163.941 139.287 149.907  1.00  0.80           C  
ATOM   1939  N   GLY A 241     164.386 144.397 147.877  1.00  0.78           N  
ATOM   1940  CA  GLY A 241     163.990 145.428 146.910  1.00  0.78           C  
ATOM   1941  C   GLY A 241     164.871 145.504 145.684  1.00  0.78           C  
ATOM   1942  O   GLY A 241     164.400 145.656 144.559  1.00  0.78           O  
ATOM   1943  N   ARG A 242     166.193 145.321 145.861  1.00  0.71           N  
ATOM   1944  CA  ARG A 242     167.150 145.270 144.768  1.00  0.71           C  
ATOM   1945  C   ARG A 242     166.956 144.080 143.829  1.00  0.71           C  
ATOM   1946  O   ARG A 242     167.041 144.204 142.607  1.00  0.71           O  
ATOM   1947  CB  ARG A 242     168.601 145.278 145.307  1.00  0.71           C  
ATOM   1948  CG  ARG A 242     168.939 146.556 146.103  1.00  0.71           C  
ATOM   1949  CD  ARG A 242     170.349 146.586 146.703  1.00  0.71           C  
ATOM   1950  NE  ARG A 242     171.338 146.582 145.574  1.00  0.71           N  
ATOM   1951  CZ  ARG A 242     171.716 147.668 144.884  1.00  0.71           C  
ATOM   1952  NH1 ARG A 242     171.226 148.877 145.134  1.00  0.71           N  
ATOM   1953  NH2 ARG A 242     172.607 147.531 143.903  1.00  0.71           N  
ATOM   1954  N   MET A 243     166.669 142.880 144.376  1.00  0.76           N  
ATOM   1955  CA  MET A 243     166.337 141.714 143.573  1.00  0.76           C  
ATOM   1956  C   MET A 243     165.046 141.861 142.781  1.00  0.76           C  
ATOM   1957  O   MET A 243     164.975 141.470 141.616  1.00  0.76           O  
ATOM   1958  CB  MET A 243     166.236 140.435 144.431  1.00  0.76           C  
ATOM   1959  CG  MET A 243     167.580 139.983 145.027  1.00  0.76           C  
ATOM   1960  SD  MET A 243     167.555 138.281 145.665  1.00  0.76           S  
ATOM   1961  CE  MET A 243     166.407 138.604 147.032  1.00  0.76           C  
ATOM   1962  N   MET A 244     164.002 142.451 143.396  1.00  0.76           N  
ATOM   1963  CA  MET A 244     162.739 142.732 142.737  1.00  0.76           C  
ATOM   1964  C   MET A 244     162.872 143.683 141.552  1.00  0.76           C  
ATOM   1965  O   MET A 244     162.312 143.439 140.482  1.00  0.76           O  
ATOM   1966  CB  MET A 244     161.743 143.340 143.751  1.00  0.76           C  
ATOM   1967  CG  MET A 244     160.317 143.546 143.199  1.00  0.76           C  
ATOM   1968  SD  MET A 244     159.425 144.939 143.954  1.00  0.76           S  
ATOM   1969  CE  MET A 244     160.393 146.262 143.175  1.00  0.76           C  
ATOM   1970  N   MET A 245     163.657 144.772 141.703  1.00  0.75           N  
ATOM   1971  CA  MET A 245     163.940 145.707 140.625  1.00  0.75           C  
ATOM   1972  C   MET A 245     164.623 145.041 139.434  1.00  0.75           C  
ATOM   1973  O   MET A 245     164.179 145.180 138.300  1.00  0.75           O  
ATOM   1974  CB  MET A 245     164.821 146.869 141.144  1.00  0.75           C  
ATOM   1975  CG  MET A 245     164.087 147.820 142.114  1.00  0.75           C  
ATOM   1976  SD  MET A 245     165.168 148.870 143.138  1.00  0.75           S  
ATOM   1977  CE  MET A 245     166.087 149.681 141.800  1.00  0.75           C  
ATOM   1978  N   LYS A 246     165.650 144.200 139.685  1.00  0.75           N  
ATOM   1979  CA  LYS A 246     166.355 143.456 138.649  1.00  0.75           C  
ATOM   1980  C   LYS A 246     165.452 142.567 137.793  1.00  0.75           C  
ATOM   1981  O   LYS A 246     165.542 142.555 136.568  1.00  0.75           O  
ATOM   1982  CB  LYS A 246     167.437 142.564 139.323  1.00  0.75           C  
ATOM   1983  CG  LYS A 246     168.244 141.660 138.369  1.00  0.75           C  
ATOM   1984  CD  LYS A 246     169.170 140.656 139.085  1.00  0.75           C  
ATOM   1985  CE  LYS A 246     168.407 139.654 139.958  1.00  0.75           C  
ATOM   1986  NZ  LYS A 246     169.326 138.668 140.573  1.00  0.75           N  
ATOM   1987  N   TYR A 247     164.531 141.806 138.417  1.00  0.77           N  
ATOM   1988  CA  TYR A 247     163.569 140.989 137.691  1.00  0.77           C  
ATOM   1989  C   TYR A 247     162.576 141.808 136.878  1.00  0.77           C  
ATOM   1990  O   TYR A 247     162.224 141.459 135.750  1.00  0.77           O  
ATOM   1991  CB  TYR A 247     162.775 140.062 138.651  1.00  0.77           C  
ATOM   1992  CG  TYR A 247     163.658 139.075 139.366  1.00  0.77           C  
ATOM   1993  CD1 TYR A 247     164.697 138.395 138.703  1.00  0.77           C  
ATOM   1994  CD2 TYR A 247     163.433 138.802 140.727  1.00  0.77           C  
ATOM   1995  CE1 TYR A 247     165.528 137.513 139.403  1.00  0.77           C  
ATOM   1996  CE2 TYR A 247     164.255 137.906 141.426  1.00  0.77           C  
ATOM   1997  CZ  TYR A 247     165.313 137.276 140.763  1.00  0.77           C  
ATOM   1998  OH  TYR A 247     166.166 136.387 141.443  1.00  0.77           O  
ATOM   1999  N   ARG A 248     162.105 142.935 137.442  1.00  0.74           N  
ATOM   2000  CA  ARG A 248     161.195 143.848 136.779  1.00  0.74           C  
ATOM   2001  C   ARG A 248     161.775 144.491 135.521  1.00  0.74           C  
ATOM   2002  O   ARG A 248     161.139 144.495 134.464  1.00  0.74           O  
ATOM   2003  CB  ARG A 248     160.759 144.933 137.792  1.00  0.74           C  
ATOM   2004  CG  ARG A 248     159.634 145.853 137.288  1.00  0.74           C  
ATOM   2005  CD  ARG A 248     159.055 146.793 138.354  1.00  0.74           C  
ATOM   2006  NE  ARG A 248     160.151 147.696 138.817  1.00  0.74           N  
ATOM   2007  CZ  ARG A 248     160.025 148.590 139.804  1.00  0.74           C  
ATOM   2008  NH1 ARG A 248     158.917 148.742 140.527  1.00  0.74           N  
ATOM   2009  NH2 ARG A 248     161.033 149.408 140.077  1.00  0.74           N  
ATOM   2010  N   ASP A 249     163.022 144.988 135.596  1.00  0.77           N  
ATOM   2011  CA  ASP A 249     163.732 145.613 134.494  1.00  0.77           C  
ATOM   2012  C   ASP A 249     163.978 144.644 133.323  1.00  0.77           C  
ATOM   2013  O   ASP A 249     163.723 144.953 132.158  1.00  0.77           O  
ATOM   2014  CB  ASP A 249     165.052 146.223 135.036  1.00  0.77           C  
ATOM   2015  CG  ASP A 249     164.810 147.364 136.027  1.00  0.77           C  
ATOM   2016  OD1 ASP A 249     163.639 147.793 136.221  1.00  0.77           O  
ATOM   2017  OD2 ASP A 249     165.828 147.838 136.592  1.00  0.77           O  
ATOM   2018  N   GLN A 250     164.396 143.390 133.613  1.00  0.74           N  
ATOM   2019  CA  GLN A 250     164.546 142.312 132.638  1.00  0.74           C  
ATOM   2020  C   GLN A 250     163.244 141.890 131.964  1.00  0.74           C  
ATOM   2021  O   GLN A 250     163.213 141.437 130.816  1.00  0.74           O  
ATOM   2022  CB  GLN A 250     165.141 141.051 133.310  1.00  0.74           C  
ATOM   2023  CG  GLN A 250     166.573 141.251 133.848  1.00  0.74           C  
ATOM   2024  CD  GLN A 250     167.026 140.063 134.700  1.00  0.74           C  
ATOM   2025  OE1 GLN A 250     166.312 139.102 134.986  1.00  0.74           O  
ATOM   2026  NE2 GLN A 250     168.310 140.127 135.127  1.00  0.74           N  
ATOM   2027  N   ARG A 251     162.118 141.968 132.692  1.00  0.74           N  
ATOM   2028  CA  ARG A 251     160.785 141.699 132.188  1.00  0.74           C  
ATOM   2029  C   ARG A 251     160.277 142.739 131.194  1.00  0.74           C  
ATOM   2030  O   ARG A 251     159.623 142.389 130.210  1.00  0.74           O  
ATOM   2031  CB  ARG A 251     159.804 141.487 133.369  1.00  0.74           C  
ATOM   2032  CG  ARG A 251     158.438 140.892 132.968  1.00  0.74           C  
ATOM   2033  CD  ARG A 251     157.424 140.696 134.115  1.00  0.74           C  
ATOM   2034  NE  ARG A 251     157.149 142.038 134.731  1.00  0.74           N  
ATOM   2035  CZ  ARG A 251     156.252 142.281 135.705  1.00  0.74           C  
ATOM   2036  NH1 ARG A 251     155.545 141.335 136.304  1.00  0.74           N  
ATOM   2037  NH2 ARG A 251     156.046 143.537 136.104  1.00  0.74           N  
ATOM   2038  N   ALA A 252     160.610 144.030 131.403  1.00  0.82           N  
ATOM   2039  CA  ALA A 252     160.051 145.178 130.704  1.00  0.82           C  
ATOM   2040  C   ALA A 252     160.136 145.134 129.179  1.00  0.82           C  
ATOM   2041  O   ALA A 252     159.196 145.505 128.480  1.00  0.82           O  
ATOM   2042  CB  ALA A 252     160.738 146.459 131.221  1.00  0.82           C  
ATOM   2043  N   GLY A 253     161.262 144.640 128.620  1.00  0.80           N  
ATOM   2044  CA  GLY A 253     161.434 144.523 127.170  1.00  0.80           C  
ATOM   2045  C   GLY A 253     160.462 143.603 126.461  1.00  0.80           C  
ATOM   2046  O   GLY A 253     160.014 143.893 125.357  1.00  0.80           O  
ATOM   2047  N   LYS A 254     160.085 142.483 127.110  1.00  0.78           N  
ATOM   2048  CA  LYS A 254     159.153 141.504 126.565  1.00  0.78           C  
ATOM   2049  C   LYS A 254     157.722 142.010 126.552  1.00  0.78           C  
ATOM   2050  O   LYS A 254     156.965 141.761 125.616  1.00  0.78           O  
ATOM   2051  CB  LYS A 254     159.233 140.168 127.342  1.00  0.78           C  
ATOM   2052  CG  LYS A 254     160.516 139.379 127.033  1.00  0.78           C  
ATOM   2053  CD  LYS A 254     160.752 138.201 127.991  1.00  0.78           C  
ATOM   2054  CE  LYS A 254     161.205 138.594 129.398  1.00  0.78           C  
ATOM   2055  NZ  LYS A 254     162.518 139.263 129.321  1.00  0.78           N  
ATOM   2056  N   ILE A 255     157.323 142.781 127.586  1.00  0.82           N  
ATOM   2057  CA  ILE A 255     155.990 143.366 127.673  1.00  0.82           C  
ATOM   2058  C   ILE A 255     155.731 144.315 126.506  1.00  0.82           C  
ATOM   2059  O   ILE A 255     154.714 144.237 125.816  1.00  0.82           O  
ATOM   2060  CB  ILE A 255     155.780 144.094 129.007  1.00  0.82           C  
ATOM   2061  CG1 ILE A 255     155.929 143.106 130.192  1.00  0.82           C  
ATOM   2062  CG2 ILE A 255     154.397 144.785 129.021  1.00  0.82           C  
ATOM   2063  CD1 ILE A 255     155.821 143.754 131.578  1.00  0.82           C  
ATOM   2064  N   SER A 256     156.702 145.200 126.204  1.00  0.83           N  
ATOM   2065  CA  SER A 256     156.641 146.105 125.062  1.00  0.83           C  
ATOM   2066  C   SER A 256     156.602 145.394 123.717  1.00  0.83           C  
ATOM   2067  O   SER A 256     155.872 145.806 122.815  1.00  0.83           O  
ATOM   2068  CB  SER A 256     157.823 147.103 125.040  1.00  0.83           C  
ATOM   2069  OG  SER A 256     157.748 147.999 126.151  1.00  0.83           O  
ATOM   2070  N   GLU A 257     157.379 144.300 123.558  1.00  0.80           N  
ATOM   2071  CA  GLU A 257     157.345 143.413 122.400  1.00  0.80           C  
ATOM   2072  C   GLU A 257     155.996 142.715 122.204  1.00  0.80           C  
ATOM   2073  O   GLU A 257     155.443 142.668 121.106  1.00  0.80           O  
ATOM   2074  CB  GLU A 257     158.477 142.366 122.518  1.00  0.80           C  
ATOM   2075  CG  GLU A 257     158.646 141.446 121.285  1.00  0.80           C  
ATOM   2076  CD  GLU A 257     159.834 140.487 121.404  1.00  0.80           C  
ATOM   2077  OE1 GLU A 257     160.548 140.521 122.441  1.00  0.80           O  
ATOM   2078  OE2 GLU A 257     160.024 139.704 120.439  1.00  0.80           O  
ATOM   2079  N   ARG A 258     155.374 142.209 123.285  1.00  0.80           N  
ATOM   2080  CA  ARG A 258     154.033 141.649 123.233  1.00  0.80           C  
ATOM   2081  C   ARG A 258     152.947 142.624 122.793  1.00  0.80           C  
ATOM   2082  O   ARG A 258     152.100 142.301 121.962  1.00  0.80           O  
ATOM   2083  CB  ARG A 258     153.663 141.059 124.618  1.00  0.80           C  
ATOM   2084  CG  ARG A 258     152.257 140.431 124.699  1.00  0.80           C  
ATOM   2085  CD  ARG A 258     151.983 139.664 126.000  1.00  0.80           C  
ATOM   2086  NE  ARG A 258     152.099 140.583 127.176  1.00  0.80           N  
ATOM   2087  CZ  ARG A 258     151.136 141.382 127.660  1.00  0.80           C  
ATOM   2088  NH1 ARG A 258     149.924 141.485 127.114  1.00  0.80           N  
ATOM   2089  NH2 ARG A 258     151.398 142.104 128.743  1.00  0.80           N  
ATOM   2090  N   LEU A 259     152.939 143.862 123.325  1.00  0.84           N  
ATOM   2091  CA  LEU A 259     151.926 144.855 122.999  1.00  0.84           C  
ATOM   2092  C   LEU A 259     151.878 145.275 121.533  1.00  0.84           C  
ATOM   2093  O   LEU A 259     150.796 145.431 120.967  1.00  0.84           O  
ATOM   2094  CB  LEU A 259     152.071 146.115 123.880  1.00  0.84           C  
ATOM   2095  CG  LEU A 259     151.808 145.886 125.382  1.00  0.84           C  
ATOM   2096  CD1 LEU A 259     152.074 147.180 126.159  1.00  0.84           C  
ATOM   2097  CD2 LEU A 259     150.393 145.365 125.670  1.00  0.84           C  
ATOM   2098  N   VAL A 260     153.041 145.452 120.869  1.00  0.85           N  
ATOM   2099  CA  VAL A 260     153.083 145.749 119.439  1.00  0.85           C  
ATOM   2100  C   VAL A 260     152.483 144.636 118.572  1.00  0.85           C  
ATOM   2101  O   VAL A 260     151.591 144.897 117.768  1.00  0.85           O  
ATOM   2102  CB  VAL A 260     154.485 146.178 118.986  1.00  0.85           C  
ATOM   2103  CG1 VAL A 260     155.568 145.171 119.392  1.00  0.85           C  
ATOM   2104  CG2 VAL A 260     154.540 146.437 117.472  1.00  0.85           C  
ATOM   2105  N   ILE A 261     152.866 143.359 118.797  1.00  0.86           N  
ATOM   2106  CA  ILE A 261     152.349 142.205 118.058  1.00  0.86           C  
ATOM   2107  C   ILE A 261     150.843 142.004 118.260  1.00  0.86           C  
ATOM   2108  O   ILE A 261     150.081 141.782 117.315  1.00  0.86           O  
ATOM   2109  CB  ILE A 261     153.132 140.933 118.409  1.00  0.86           C  
ATOM   2110  CG1 ILE A 261     154.621 141.095 118.015  1.00  0.86           C  
ATOM   2111  CG2 ILE A 261     152.523 139.703 117.701  1.00  0.86           C  
ATOM   2112  CD1 ILE A 261     155.509 139.884 118.333  1.00  0.86           C  
ATOM   2113  N   THR A 262     150.352 142.135 119.513  1.00  0.88           N  
ATOM   2114  CA  THR A 262     148.923 142.085 119.846  1.00  0.88           C  
ATOM   2115  C   THR A 262     148.121 143.165 119.134  1.00  0.88           C  
ATOM   2116  O   THR A 262     147.034 142.914 118.618  1.00  0.88           O  
ATOM   2117  CB  THR A 262     148.661 142.220 121.348  1.00  0.88           C  
ATOM   2118  OG1 THR A 262     149.297 141.171 122.065  1.00  0.88           O  
ATOM   2119  CG2 THR A 262     147.169 142.113 121.700  1.00  0.88           C  
ATOM   2120  N   SER A 263     148.645 144.406 119.053  1.00  0.87           N  
ATOM   2121  CA  SER A 263     147.995 145.485 118.307  1.00  0.87           C  
ATOM   2122  C   SER A 263     147.874 145.208 116.803  1.00  0.87           C  
ATOM   2123  O   SER A 263     146.792 145.303 116.221  1.00  0.87           O  
ATOM   2124  CB  SER A 263     148.758 146.821 118.516  1.00  0.87           C  
ATOM   2125  OG  SER A 263     147.973 147.950 118.134  1.00  0.87           O  
ATOM   2126  N   GLU A 264     148.981 144.761 116.160  1.00  0.86           N  
ATOM   2127  CA  GLU A 264     149.065 144.473 114.730  1.00  0.86           C  
ATOM   2128  C   GLU A 264     148.063 143.419 114.246  1.00  0.86           C  
ATOM   2129  O   GLU A 264     147.377 143.596 113.235  1.00  0.86           O  
ATOM   2130  CB  GLU A 264     150.498 143.969 114.366  1.00  0.86           C  
ATOM   2131  CG  GLU A 264     151.626 145.045 114.427  1.00  0.86           C  
ATOM   2132  CD  GLU A 264     153.051 144.490 114.281  1.00  0.86           C  
ATOM   2133  OE1 GLU A 264     153.223 143.246 114.314  1.00  0.86           O  
ATOM   2134  OE2 GLU A 264     154.018 145.291 114.148  1.00  0.86           O  
ATOM   2135  N   MET A 265     147.923 142.289 114.972  1.00  0.84           N  
ATOM   2136  CA  MET A 265     146.980 141.237 114.619  1.00  0.84           C  
ATOM   2137  C   MET A 265     145.512 141.638 114.721  1.00  0.84           C  
ATOM   2138  O   MET A 265     144.700 141.261 113.881  1.00  0.84           O  
ATOM   2139  CB  MET A 265     147.263 139.916 115.382  1.00  0.84           C  
ATOM   2140  CG  MET A 265     146.892 139.908 116.879  1.00  0.84           C  
ATOM   2141  SD  MET A 265     147.136 138.317 117.719  1.00  0.84           S  
ATOM   2142  CE  MET A 265     148.942 138.305 117.578  1.00  0.84           C  
ATOM   2143  N   ILE A 266     145.133 142.426 115.750  1.00  0.81           N  
ATOM   2144  CA  ILE A 266     143.769 142.901 115.953  1.00  0.81           C  
ATOM   2145  C   ILE A 266     143.371 143.949 114.916  1.00  0.81           C  
ATOM   2146  O   ILE A 266     142.278 143.902 114.356  1.00  0.81           O  
ATOM   2147  CB  ILE A 266     143.528 143.318 117.406  1.00  0.81           C  
ATOM   2148  CG1 ILE A 266     143.738 142.071 118.307  1.00  0.81           C  
ATOM   2149  CG2 ILE A 266     142.110 143.902 117.579  1.00  0.81           C  
ATOM   2150  CD1 ILE A 266     143.556 142.294 119.811  1.00  0.81           C  
ATOM   2151  N   GLU A 267     144.283 144.877 114.552  1.00  0.79           N  
ATOM   2152  CA  GLU A 267     144.081 145.823 113.453  1.00  0.79           C  
ATOM   2153  C   GLU A 267     143.831 145.141 112.102  1.00  0.79           C  
ATOM   2154  O   GLU A 267     143.060 145.593 111.250  1.00  0.79           O  
ATOM   2155  CB  GLU A 267     145.307 146.769 113.299  1.00  0.79           C  
ATOM   2156  CG  GLU A 267     145.113 147.801 112.156  1.00  0.79           C  
ATOM   2157  CD  GLU A 267     146.317 148.627 111.724  1.00  0.79           C  
ATOM   2158  OE1 GLU A 267     147.388 148.587 112.365  1.00  0.79           O  
ATOM   2159  OE2 GLU A 267     146.140 149.271 110.646  1.00  0.79           O  
ATOM   2160  N   ASN A 268     144.512 144.011 111.862  1.00  0.85           N  
ATOM   2161  CA  ASN A 268     144.431 143.264 110.624  1.00  0.85           C  
ATOM   2162  C   ASN A 268     143.614 141.990 110.783  1.00  0.85           C  
ATOM   2163  O   ASN A 268     143.817 141.015 110.059  1.00  0.85           O  
ATOM   2164  CB  ASN A 268     145.839 142.940 110.091  1.00  0.85           C  
ATOM   2165  CG  ASN A 268     146.521 144.254 109.737  1.00  0.85           C  
ATOM   2166  OD1 ASN A 268     146.293 144.778 108.647  1.00  0.85           O  
ATOM   2167  ND2 ASN A 268     147.329 144.820 110.657  1.00  0.85           N  
ATOM   2168  N   ILE A 269     142.638 141.977 111.717  1.00  0.84           N  
ATOM   2169  CA  ILE A 269     141.860 140.799 112.095  1.00  0.84           C  
ATOM   2170  C   ILE A 269     141.164 140.097 110.933  1.00  0.84           C  
ATOM   2171  O   ILE A 269     141.125 138.870 110.848  1.00  0.84           O  
ATOM   2172  CB  ILE A 269     140.862 141.103 113.215  1.00  0.84           C  
ATOM   2173  CG1 ILE A 269     140.110 139.843 113.703  1.00  0.84           C  
ATOM   2174  CG2 ILE A 269     139.878 142.225 112.815  1.00  0.84           C  
ATOM   2175  CD1 ILE A 269     141.013 138.749 114.274  1.00  0.84           C  
ATOM   2176  N   GLN A 270     140.638 140.856 109.956  1.00  0.81           N  
ATOM   2177  CA  GLN A 270     140.034 140.299 108.762  1.00  0.81           C  
ATOM   2178  C   GLN A 270     140.985 139.450 107.916  1.00  0.81           C  
ATOM   2179  O   GLN A 270     140.646 138.354 107.471  1.00  0.81           O  
ATOM   2180  CB  GLN A 270     139.439 141.447 107.919  1.00  0.81           C  
ATOM   2181  CG  GLN A 270     138.630 140.945 106.705  1.00  0.81           C  
ATOM   2182  CD  GLN A 270     137.885 142.081 106.003  1.00  0.81           C  
ATOM   2183  OE1 GLN A 270     137.536 143.098 106.594  1.00  0.81           O  
ATOM   2184  NE2 GLN A 270     137.613 141.894 104.690  1.00  0.81           N  
ATOM   2185  N   SER A 271     142.232 139.921 107.725  1.00  0.88           N  
ATOM   2186  CA  SER A 271     143.302 139.179 107.068  1.00  0.88           C  
ATOM   2187  C   SER A 271     143.717 137.931 107.834  1.00  0.88           C  
ATOM   2188  O   SER A 271     143.960 136.883 107.242  1.00  0.88           O  
ATOM   2189  CB  SER A 271     144.555 140.057 106.803  1.00  0.88           C  
ATOM   2190  OG  SER A 271     144.197 141.211 106.040  1.00  0.88           O  
ATOM   2191  N   VAL A 272     143.774 137.998 109.183  1.00  0.89           N  
ATOM   2192  CA  VAL A 272     144.039 136.849 110.054  1.00  0.89           C  
ATOM   2193  C   VAL A 272     142.998 135.735 109.903  1.00  0.89           C  
ATOM   2194  O   VAL A 272     143.350 134.568 109.747  1.00  0.89           O  
ATOM   2195  CB  VAL A 272     144.135 137.291 111.521  1.00  0.89           C  
ATOM   2196  CG1 VAL A 272     144.231 136.101 112.497  1.00  0.89           C  
ATOM   2197  CG2 VAL A 272     145.359 138.206 111.707  1.00  0.89           C  
ATOM   2198  N   LYS A 273     141.693 136.085 109.889  1.00  0.84           N  
ATOM   2199  CA  LYS A 273     140.595 135.151 109.658  1.00  0.84           C  
ATOM   2200  C   LYS A 273     140.557 134.537 108.263  1.00  0.84           C  
ATOM   2201  O   LYS A 273     140.261 133.357 108.087  1.00  0.84           O  
ATOM   2202  CB  LYS A 273     139.225 135.832 109.890  1.00  0.84           C  
ATOM   2203  CG  LYS A 273     138.928 136.177 111.357  1.00  0.84           C  
ATOM   2204  CD  LYS A 273     137.514 136.763 111.497  1.00  0.84           C  
ATOM   2205  CE  LYS A 273     137.097 137.153 112.917  1.00  0.84           C  
ATOM   2206  NZ  LYS A 273     136.859 135.960 113.749  1.00  0.84           N  
ATOM   2207  N   ALA A 274     140.830 135.335 107.213  1.00  0.89           N  
ATOM   2208  CA  ALA A 274     140.903 134.854 105.844  1.00  0.89           C  
ATOM   2209  C   ALA A 274     142.039 133.862 105.601  1.00  0.89           C  
ATOM   2210  O   ALA A 274     141.888 132.881 104.879  1.00  0.89           O  
ATOM   2211  CB  ALA A 274     141.020 136.051 104.884  1.00  0.89           C  
ATOM   2212  N   TYR A 275     143.207 134.093 106.227  1.00  0.82           N  
ATOM   2213  CA  TYR A 275     144.326 133.172 106.175  1.00  0.82           C  
ATOM   2214  C   TYR A 275     144.198 131.981 107.128  1.00  0.82           C  
ATOM   2215  O   TYR A 275     144.947 131.010 107.012  1.00  0.82           O  
ATOM   2216  CB  TYR A 275     145.640 133.922 106.527  1.00  0.82           C  
ATOM   2217  CG  TYR A 275     146.170 134.817 105.435  1.00  0.82           C  
ATOM   2218  CD1 TYR A 275     146.273 134.378 104.101  1.00  0.82           C  
ATOM   2219  CD2 TYR A 275     146.700 136.074 105.772  1.00  0.82           C  
ATOM   2220  CE1 TYR A 275     146.910 135.173 103.133  1.00  0.82           C  
ATOM   2221  CE2 TYR A 275     147.321 136.876 104.805  1.00  0.82           C  
ATOM   2222  CZ  TYR A 275     147.440 136.419 103.492  1.00  0.82           C  
ATOM   2223  OH  TYR A 275     148.117 137.228 102.557  1.00  0.82           O  
ATOM   2224  N   CYS A 276     143.258 132.026 108.099  1.00  0.84           N  
ATOM   2225  CA  CYS A 276     143.105 131.041 109.166  1.00  0.84           C  
ATOM   2226  C   CYS A 276     144.362 130.924 110.023  1.00  0.84           C  
ATOM   2227  O   CYS A 276     144.961 129.856 110.201  1.00  0.84           O  
ATOM   2228  CB  CYS A 276     142.602 129.658 108.672  1.00  0.84           C  
ATOM   2229  SG  CYS A 276     140.933 129.756 107.930  1.00  0.84           S  
ATOM   2230  N   TRP A 277     144.815 132.081 110.536  1.00  0.81           N  
ATOM   2231  CA  TRP A 277     146.050 132.231 111.278  1.00  0.81           C  
ATOM   2232  C   TRP A 277     145.815 132.421 112.763  1.00  0.81           C  
ATOM   2233  O   TRP A 277     146.735 132.797 113.489  1.00  0.81           O  
ATOM   2234  CB  TRP A 277     146.878 133.425 110.726  1.00  0.81           C  
ATOM   2235  CG  TRP A 277     147.667 133.129 109.464  1.00  0.81           C  
ATOM   2236  CD1 TRP A 277     147.736 131.971 108.739  1.00  0.81           C  
ATOM   2237  CD2 TRP A 277     148.574 134.053 108.833  1.00  0.81           C  
ATOM   2238  NE1 TRP A 277     148.633 132.105 107.701  1.00  0.81           N  
ATOM   2239  CE2 TRP A 277     149.154 133.378 107.740  1.00  0.81           C  
ATOM   2240  CE3 TRP A 277     148.920 135.369 109.137  1.00  0.81           C  
ATOM   2241  CZ2 TRP A 277     150.103 133.997 106.938  1.00  0.81           C  
ATOM   2242  CZ3 TRP A 277     149.892 135.989 108.336  1.00  0.81           C  
ATOM   2243  CH2 TRP A 277     150.480 135.308 107.261  1.00  0.81           C  
ATOM   2244  N   GLU A 278     144.603 132.146 113.279  1.00  0.83           N  
ATOM   2245  CA  GLU A 278     144.282 132.325 114.683  1.00  0.83           C  
ATOM   2246  C   GLU A 278     145.164 131.473 115.600  1.00  0.83           C  
ATOM   2247  O   GLU A 278     145.841 131.996 116.482  1.00  0.83           O  
ATOM   2248  CB  GLU A 278     142.777 132.044 114.941  1.00  0.83           C  
ATOM   2249  CG  GLU A 278     141.788 132.838 114.036  1.00  0.83           C  
ATOM   2250  CD  GLU A 278     141.454 132.194 112.689  1.00  0.83           C  
ATOM   2251  OE1 GLU A 278     142.234 131.327 112.216  1.00  0.83           O  
ATOM   2252  OE2 GLU A 278     140.415 132.591 112.097  1.00  0.83           O  
ATOM   2253  N   GLU A 279     145.298 130.162 115.298  1.00  0.82           N  
ATOM   2254  CA  GLU A 279     146.138 129.220 116.035  1.00  0.82           C  
ATOM   2255  C   GLU A 279     147.621 129.602 116.070  1.00  0.82           C  
ATOM   2256  O   GLU A 279     148.278 129.594 117.114  1.00  0.82           O  
ATOM   2257  CB  GLU A 279     145.993 127.805 115.411  1.00  0.82           C  
ATOM   2258  CG  GLU A 279     146.798 126.694 116.136  1.00  0.82           C  
ATOM   2259  CD  GLU A 279     146.760 125.326 115.449  1.00  0.82           C  
ATOM   2260  OE1 GLU A 279     145.978 125.142 114.482  1.00  0.82           O  
ATOM   2261  OE2 GLU A 279     147.555 124.457 115.898  1.00  0.82           O  
ATOM   2262  N   ALA A 280     148.197 130.010 114.917  1.00  0.90           N  
ATOM   2263  CA  ALA A 280     149.569 130.483 114.847  1.00  0.90           C  
ATOM   2264  C   ALA A 280     149.841 131.732 115.683  1.00  0.90           C  
ATOM   2265  O   ALA A 280     150.859 131.837 116.369  1.00  0.90           O  
ATOM   2266  CB  ALA A 280     149.964 130.768 113.386  1.00  0.90           C  
ATOM   2267  N   MET A 281     148.916 132.710 115.649  1.00  0.85           N  
ATOM   2268  CA  MET A 281     148.989 133.916 116.453  1.00  0.85           C  
ATOM   2269  C   MET A 281     148.844 133.684 117.953  1.00  0.85           C  
ATOM   2270  O   MET A 281     149.594 134.255 118.746  1.00  0.85           O  
ATOM   2271  CB  MET A 281     147.964 134.958 115.955  1.00  0.85           C  
ATOM   2272  CG  MET A 281     148.291 135.503 114.550  1.00  0.85           C  
ATOM   2273  SD  MET A 281     149.898 136.347 114.440  1.00  0.85           S  
ATOM   2274  CE  MET A 281     149.907 136.434 112.632  1.00  0.85           C  
ATOM   2275  N   GLU A 282     147.917 132.807 118.392  1.00  0.85           N  
ATOM   2276  CA  GLU A 282     147.777 132.431 119.794  1.00  0.85           C  
ATOM   2277  C   GLU A 282     149.037 131.798 120.367  1.00  0.85           C  
ATOM   2278  O   GLU A 282     149.557 132.234 121.393  1.00  0.85           O  
ATOM   2279  CB  GLU A 282     146.605 131.437 119.954  1.00  0.85           C  
ATOM   2280  CG  GLU A 282     145.230 132.087 119.680  1.00  0.85           C  
ATOM   2281  CD  GLU A 282     144.082 131.083 119.592  1.00  0.85           C  
ATOM   2282  OE1 GLU A 282     144.220 129.976 120.168  1.00  0.85           O  
ATOM   2283  OE2 GLU A 282     143.069 131.438 118.930  1.00  0.85           O  
ATOM   2284  N   LYS A 283     149.621 130.820 119.646  1.00  0.84           N  
ATOM   2285  CA  LYS A 283     150.879 130.190 120.018  1.00  0.84           C  
ATOM   2286  C   LYS A 283     152.067 131.156 120.063  1.00  0.84           C  
ATOM   2287  O   LYS A 283     152.934 131.086 120.934  1.00  0.84           O  
ATOM   2288  CB  LYS A 283     151.186 129.013 119.061  1.00  0.84           C  
ATOM   2289  CG  LYS A 283     152.355 128.136 119.538  1.00  0.84           C  
ATOM   2290  CD  LYS A 283     152.632 126.945 118.608  1.00  0.84           C  
ATOM   2291  CE  LYS A 283     153.833 126.110 119.056  1.00  0.84           C  
ATOM   2292  NZ  LYS A 283     154.082 125.024 118.081  1.00  0.84           N  
ATOM   2293  N   MET A 284     152.138 132.119 119.119  1.00  0.85           N  
ATOM   2294  CA  MET A 284     153.148 133.167 119.122  1.00  0.85           C  
ATOM   2295  C   MET A 284     153.109 134.051 120.371  1.00  0.85           C  
ATOM   2296  O   MET A 284     154.126 134.273 121.028  1.00  0.85           O  
ATOM   2297  CB  MET A 284     152.950 134.043 117.857  1.00  0.85           C  
ATOM   2298  CG  MET A 284     153.967 135.183 117.654  1.00  0.85           C  
ATOM   2299  SD  MET A 284     153.596 136.271 116.239  1.00  0.85           S  
ATOM   2300  CE  MET A 284     153.598 135.024 114.920  1.00  0.85           C  
ATOM   2301  N   ILE A 285     151.913 134.532 120.764  1.00  0.86           N  
ATOM   2302  CA  ILE A 285     151.710 135.308 121.984  1.00  0.86           C  
ATOM   2303  C   ILE A 285     151.939 134.488 123.250  1.00  0.86           C  
ATOM   2304  O   ILE A 285     152.504 134.982 124.229  1.00  0.86           O  
ATOM   2305  CB  ILE A 285     150.345 135.996 121.995  1.00  0.86           C  
ATOM   2306  CG1 ILE A 285     150.209 136.988 120.815  1.00  0.86           C  
ATOM   2307  CG2 ILE A 285     150.077 136.718 123.334  1.00  0.86           C  
ATOM   2308  CD1 ILE A 285     151.172 138.182 120.841  1.00  0.86           C  
ATOM   2309  N   GLU A 286     151.533 133.201 123.259  1.00  0.83           N  
ATOM   2310  CA  GLU A 286     151.731 132.289 124.378  1.00  0.83           C  
ATOM   2311  C   GLU A 286     153.193 132.120 124.782  1.00  0.83           C  
ATOM   2312  O   GLU A 286     153.547 132.258 125.954  1.00  0.83           O  
ATOM   2313  CB  GLU A 286     151.137 130.902 124.037  1.00  0.83           C  
ATOM   2314  CG  GLU A 286     151.157 129.900 125.217  1.00  0.83           C  
ATOM   2315  CD  GLU A 286     150.492 128.558 124.905  1.00  0.83           C  
ATOM   2316  OE1 GLU A 286     150.265 128.248 123.707  1.00  0.83           O  
ATOM   2317  OE2 GLU A 286     150.194 127.840 125.898  1.00  0.83           O  
ATOM   2318  N   ASN A 287     154.099 131.922 123.800  1.00  0.83           N  
ATOM   2319  CA  ASN A 287     155.536 131.855 124.033  1.00  0.83           C  
ATOM   2320  C   ASN A 287     156.116 133.140 124.643  1.00  0.83           C  
ATOM   2321  O   ASN A 287     156.943 133.102 125.554  1.00  0.83           O  
ATOM   2322  CB  ASN A 287     156.304 131.516 122.727  1.00  0.83           C  
ATOM   2323  CG  ASN A 287     155.918 130.128 122.220  1.00  0.83           C  
ATOM   2324  OD1 ASN A 287     155.533 129.228 122.957  1.00  0.83           O  
ATOM   2325  ND2 ASN A 287     156.065 129.908 120.891  1.00  0.83           N  
ATOM   2326  N   LEU A 288     155.665 134.327 124.185  1.00  0.85           N  
ATOM   2327  CA  LEU A 288     156.036 135.608 124.783  1.00  0.85           C  
ATOM   2328  C   LEU A 288     155.581 135.737 126.240  1.00  0.85           C  
ATOM   2329  O   LEU A 288     156.353 136.121 127.122  1.00  0.85           O  
ATOM   2330  CB  LEU A 288     155.460 136.784 123.949  1.00  0.85           C  
ATOM   2331  CG  LEU A 288     156.409 137.338 122.862  1.00  0.85           C  
ATOM   2332  CD1 LEU A 288     156.894 136.292 121.855  1.00  0.85           C  
ATOM   2333  CD2 LEU A 288     155.757 138.507 122.114  1.00  0.85           C  
ATOM   2334  N   ARG A 289     154.320 135.346 126.537  1.00  0.80           N  
ATOM   2335  CA  ARG A 289     153.786 135.294 127.890  1.00  0.80           C  
ATOM   2336  C   ARG A 289     154.541 134.338 128.802  1.00  0.80           C  
ATOM   2337  O   ARG A 289     154.827 134.659 129.953  1.00  0.80           O  
ATOM   2338  CB  ARG A 289     152.276 134.930 127.907  1.00  0.80           C  
ATOM   2339  CG  ARG A 289     151.340 136.108 127.571  1.00  0.80           C  
ATOM   2340  CD  ARG A 289     151.250 137.195 128.658  1.00  0.80           C  
ATOM   2341  NE  ARG A 289     150.431 136.704 129.815  1.00  0.80           N  
ATOM   2342  CZ  ARG A 289     150.321 137.364 130.984  1.00  0.80           C  
ATOM   2343  NH1 ARG A 289     151.039 138.444 131.275  1.00  0.80           N  
ATOM   2344  NH2 ARG A 289     149.445 136.937 131.897  1.00  0.80           N  
ATOM   2345  N   GLN A 290     154.925 133.145 128.314  1.00  0.79           N  
ATOM   2346  CA  GLN A 290     155.685 132.186 129.096  1.00  0.79           C  
ATOM   2347  C   GLN A 290     157.016 132.723 129.616  1.00  0.79           C  
ATOM   2348  O   GLN A 290     157.350 132.574 130.792  1.00  0.79           O  
ATOM   2349  CB  GLN A 290     155.954 130.918 128.250  1.00  0.79           C  
ATOM   2350  CG  GLN A 290     156.754 129.828 129.001  1.00  0.79           C  
ATOM   2351  CD  GLN A 290     156.926 128.565 128.159  1.00  0.79           C  
ATOM   2352  OE1 GLN A 290     156.655 128.510 126.967  1.00  0.79           O  
ATOM   2353  NE2 GLN A 290     157.430 127.490 128.815  1.00  0.79           N  
ATOM   2354  N   THR A 291     157.802 133.395 128.755  1.00  0.80           N  
ATOM   2355  CA  THR A 291     159.090 133.978 129.123  1.00  0.80           C  
ATOM   2356  C   THR A 291     158.981 135.121 130.132  1.00  0.80           C  
ATOM   2357  O   THR A 291     159.767 135.209 131.076  1.00  0.80           O  
ATOM   2358  CB  THR A 291     159.891 134.442 127.908  1.00  0.80           C  
ATOM   2359  OG1 THR A 291     159.904 133.424 126.918  1.00  0.80           O  
ATOM   2360  CG2 THR A 291     161.364 134.676 128.274  1.00  0.80           C  
ATOM   2361  N   GLU A 292     157.993 136.038 129.980  1.00  0.80           N  
ATOM   2362  CA  GLU A 292     157.743 137.120 130.935  1.00  0.80           C  
ATOM   2363  C   GLU A 292     157.196 136.641 132.290  1.00  0.80           C  
ATOM   2364  O   GLU A 292     157.589 137.135 133.350  1.00  0.80           O  
ATOM   2365  CB  GLU A 292     156.937 138.306 130.303  1.00  0.80           C  
ATOM   2366  CG  GLU A 292     155.400 138.103 130.172  1.00  0.80           C  
ATOM   2367  CD  GLU A 292     154.596 139.196 129.446  1.00  0.80           C  
ATOM   2368  OE1 GLU A 292     155.157 139.996 128.662  1.00  0.80           O  
ATOM   2369  OE2 GLU A 292     153.349 139.249 129.657  1.00  0.80           O  
ATOM   2370  N   LEU A 293     156.319 135.611 132.299  1.00  0.85           N  
ATOM   2371  CA  LEU A 293     155.689 135.080 133.502  1.00  0.85           C  
ATOM   2372  C   LEU A 293     156.626 134.337 134.444  1.00  0.85           C  
ATOM   2373  O   LEU A 293     156.332 134.180 135.631  1.00  0.85           O  
ATOM   2374  CB  LEU A 293     154.522 134.120 133.155  1.00  0.85           C  
ATOM   2375  CG  LEU A 293     153.205 134.814 132.758  1.00  0.85           C  
ATOM   2376  CD1 LEU A 293     152.197 133.778 132.247  1.00  0.85           C  
ATOM   2377  CD2 LEU A 293     152.593 135.604 133.922  1.00  0.85           C  
ATOM   2378  N   LYS A 294     157.791 133.857 133.970  1.00  0.80           N  
ATOM   2379  CA  LYS A 294     158.836 133.359 134.851  1.00  0.80           C  
ATOM   2380  C   LYS A 294     159.406 134.443 135.761  1.00  0.80           C  
ATOM   2381  O   LYS A 294     159.548 134.260 136.967  1.00  0.80           O  
ATOM   2382  CB  LYS A 294     159.981 132.720 134.031  1.00  0.80           C  
ATOM   2383  CG  LYS A 294     159.540 131.451 133.284  1.00  0.80           C  
ATOM   2384  CD  LYS A 294     160.707 130.749 132.569  1.00  0.80           C  
ATOM   2385  CE  LYS A 294     160.277 129.482 131.824  1.00  0.80           C  
ATOM   2386  NZ  LYS A 294     161.445 128.869 131.152  1.00  0.80           N  
ATOM   2387  N   LEU A 295     159.693 135.631 135.201  1.00  0.83           N  
ATOM   2388  CA  LEU A 295     160.188 136.780 135.938  1.00  0.83           C  
ATOM   2389  C   LEU A 295     159.156 137.352 136.904  1.00  0.83           C  
ATOM   2390  O   LEU A 295     159.483 137.731 138.029  1.00  0.83           O  
ATOM   2391  CB  LEU A 295     160.730 137.855 134.970  1.00  0.83           C  
ATOM   2392  CG  LEU A 295     161.853 137.354 134.031  1.00  0.83           C  
ATOM   2393  CD1 LEU A 295     162.302 138.483 133.101  1.00  0.83           C  
ATOM   2394  CD2 LEU A 295     163.071 136.813 134.791  1.00  0.83           C  
ATOM   2395  N   THR A 296     157.863 137.358 136.507  1.00  0.86           N  
ATOM   2396  CA  THR A 296     156.738 137.743 137.368  1.00  0.86           C  
ATOM   2397  C   THR A 296     156.644 136.892 138.629  1.00  0.86           C  
ATOM   2398  O   THR A 296     156.495 137.416 139.732  1.00  0.86           O  
ATOM   2399  CB  THR A 296     155.391 137.666 136.639  1.00  0.86           C  
ATOM   2400  OG1 THR A 296     155.391 138.524 135.504  1.00  0.86           O  
ATOM   2401  CG2 THR A 296     154.218 138.121 137.518  1.00  0.86           C  
ATOM   2402  N   ARG A 297     156.787 135.551 138.523  1.00  0.81           N  
ATOM   2403  CA  ARG A 297     156.828 134.675 139.690  1.00  0.81           C  
ATOM   2404  C   ARG A 297     158.006 134.914 140.623  1.00  0.81           C  
ATOM   2405  O   ARG A 297     157.850 134.990 141.839  1.00  0.81           O  
ATOM   2406  CB  ARG A 297     156.863 133.185 139.286  1.00  0.81           C  
ATOM   2407  CG  ARG A 297     155.539 132.682 138.699  1.00  0.81           C  
ATOM   2408  CD  ARG A 297     155.545 131.169 138.491  1.00  0.81           C  
ATOM   2409  NE  ARG A 297     154.163 130.794 138.073  1.00  0.81           N  
ATOM   2410  CZ  ARG A 297     153.730 130.801 136.808  1.00  0.81           C  
ATOM   2411  NH1 ARG A 297     154.499 131.197 135.796  1.00  0.81           N  
ATOM   2412  NH2 ARG A 297     152.484 130.414 136.559  1.00  0.81           N  
ATOM   2413  N   LYS A 298     159.224 135.074 140.072  1.00  0.82           N  
ATOM   2414  CA  LYS A 298     160.419 135.334 140.859  1.00  0.82           C  
ATOM   2415  C   LYS A 298     160.345 136.643 141.644  1.00  0.82           C  
ATOM   2416  O   LYS A 298     160.695 136.704 142.821  1.00  0.82           O  
ATOM   2417  CB  LYS A 298     161.672 135.315 139.950  1.00  0.82           C  
ATOM   2418  CG  LYS A 298     161.902 133.956 139.264  1.00  0.82           C  
ATOM   2419  CD  LYS A 298     163.048 133.977 138.238  1.00  0.82           C  
ATOM   2420  CE  LYS A 298     164.426 134.066 138.890  1.00  0.82           C  
ATOM   2421  NZ  LYS A 298     165.485 134.041 137.858  1.00  0.82           N  
ATOM   2422  N   ALA A 299     159.824 137.718 141.020  1.00  0.87           N  
ATOM   2423  CA  ALA A 299     159.501 138.959 141.698  1.00  0.87           C  
ATOM   2424  C   ALA A 299     158.417 138.822 142.768  1.00  0.87           C  
ATOM   2425  O   ALA A 299     158.498 139.401 143.849  1.00  0.87           O  
ATOM   2426  CB  ALA A 299     159.071 140.004 140.654  1.00  0.87           C  
ATOM   2427  N   ALA A 300     157.358 138.038 142.503  1.00  0.89           N  
ATOM   2428  CA  ALA A 300     156.312 137.746 143.463  1.00  0.89           C  
ATOM   2429  C   ALA A 300     156.781 137.020 144.727  1.00  0.89           C  
ATOM   2430  O   ALA A 300     156.400 137.393 145.836  1.00  0.89           O  
ATOM   2431  CB  ALA A 300     155.197 136.971 142.751  1.00  0.89           C  
ATOM   2432  N   TYR A 301     157.666 136.010 144.603  1.00  0.84           N  
ATOM   2433  CA  TYR A 301     158.264 135.320 145.742  1.00  0.84           C  
ATOM   2434  C   TYR A 301     159.099 136.222 146.643  1.00  0.84           C  
ATOM   2435  O   TYR A 301     158.978 136.182 147.864  1.00  0.84           O  
ATOM   2436  CB  TYR A 301     159.170 134.150 145.280  1.00  0.84           C  
ATOM   2437  CG  TYR A 301     158.452 133.098 144.476  1.00  0.84           C  
ATOM   2438  CD1 TYR A 301     157.065 132.861 144.560  1.00  0.84           C  
ATOM   2439  CD2 TYR A 301     159.220 132.304 143.607  1.00  0.84           C  
ATOM   2440  CE1 TYR A 301     156.460 131.891 143.750  1.00  0.84           C  
ATOM   2441  CE2 TYR A 301     158.620 131.319 142.814  1.00  0.84           C  
ATOM   2442  CZ  TYR A 301     157.240 131.125 142.879  1.00  0.84           C  
ATOM   2443  OH  TYR A 301     156.643 130.155 142.062  1.00  0.84           O  
ATOM   2444  N   VAL A 302     159.935 137.103 146.061  1.00  0.85           N  
ATOM   2445  CA  VAL A 302     160.699 138.109 146.796  1.00  0.85           C  
ATOM   2446  C   VAL A 302     159.796 139.083 147.550  1.00  0.85           C  
ATOM   2447  O   VAL A 302     160.009 139.405 148.721  1.00  0.85           O  
ATOM   2448  CB  VAL A 302     161.616 138.861 145.834  1.00  0.85           C  
ATOM   2449  CG1 VAL A 302     162.326 140.045 146.506  1.00  0.85           C  
ATOM   2450  CG2 VAL A 302     162.680 137.887 145.301  1.00  0.85           C  
ATOM   2451  N   ARG A 303     158.711 139.543 146.898  1.00  0.79           N  
ATOM   2452  CA  ARG A 303     157.737 140.435 147.498  1.00  0.79           C  
ATOM   2453  C   ARG A 303     156.942 139.836 148.656  1.00  0.79           C  
ATOM   2454  O   ARG A 303     156.558 140.564 149.570  1.00  0.79           O  
ATOM   2455  CB  ARG A 303     156.776 141.027 146.442  1.00  0.79           C  
ATOM   2456  CG  ARG A 303     157.455 142.023 145.480  1.00  0.79           C  
ATOM   2457  CD  ARG A 303     156.500 142.734 144.509  1.00  0.79           C  
ATOM   2458  NE  ARG A 303     155.934 141.714 143.571  1.00  0.79           N  
ATOM   2459  CZ  ARG A 303     154.911 141.947 142.733  1.00  0.79           C  
ATOM   2460  NH1 ARG A 303     154.294 143.123 142.677  1.00  0.79           N  
ATOM   2461  NH2 ARG A 303     154.481 140.979 141.929  1.00  0.79           N  
ATOM   2462  N   TYR A 304     156.704 138.507 148.675  1.00  0.85           N  
ATOM   2463  CA  TYR A 304     156.128 137.819 149.827  1.00  0.85           C  
ATOM   2464  C   TYR A 304     156.979 137.974 151.097  1.00  0.85           C  
ATOM   2465  O   TYR A 304     156.480 138.350 152.153  1.00  0.85           O  
ATOM   2466  CB  TYR A 304     155.907 136.312 149.467  1.00  0.85           C  
ATOM   2467  CG  TYR A 304     155.675 135.441 150.677  1.00  0.85           C  
ATOM   2468  CD1 TYR A 304     154.492 135.529 151.431  1.00  0.85           C  
ATOM   2469  CD2 TYR A 304     156.745 134.673 151.167  1.00  0.85           C  
ATOM   2470  CE1 TYR A 304     154.412 134.903 152.685  1.00  0.85           C  
ATOM   2471  CE2 TYR A 304     156.658 134.034 152.406  1.00  0.85           C  
ATOM   2472  CZ  TYR A 304     155.497 134.164 153.167  1.00  0.85           C  
ATOM   2473  OH  TYR A 304     155.449 133.573 154.436  1.00  0.85           O  
ATOM   2474  N   PHE A 305     158.303 137.733 151.019  1.00  0.82           N  
ATOM   2475  CA  PHE A 305     159.203 137.870 152.158  1.00  0.82           C  
ATOM   2476  C   PHE A 305     159.298 139.309 152.646  1.00  0.82           C  
ATOM   2477  O   PHE A 305     159.400 139.598 153.837  1.00  0.82           O  
ATOM   2478  CB  PHE A 305     160.616 137.329 151.838  1.00  0.82           C  
ATOM   2479  CG  PHE A 305     160.577 135.841 151.630  1.00  0.82           C  
ATOM   2480  CD1 PHE A 305     160.451 134.971 152.728  1.00  0.82           C  
ATOM   2481  CD2 PHE A 305     160.700 135.296 150.344  1.00  0.82           C  
ATOM   2482  CE1 PHE A 305     160.462 133.582 152.541  1.00  0.82           C  
ATOM   2483  CE2 PHE A 305     160.690 133.909 150.148  1.00  0.82           C  
ATOM   2484  CZ  PHE A 305     160.581 133.052 151.250  1.00  0.82           C  
ATOM   2485  N   ASN A 306     159.225 140.270 151.708  1.00  0.81           N  
ATOM   2486  CA  ASN A 306     159.152 141.681 152.023  1.00  0.81           C  
ATOM   2487  C   ASN A 306     157.893 142.076 152.801  1.00  0.81           C  
ATOM   2488  O   ASN A 306     157.942 142.890 153.723  1.00  0.81           O  
ATOM   2489  CB  ASN A 306     159.259 142.496 150.714  1.00  0.81           C  
ATOM   2490  CG  ASN A 306     159.736 143.906 151.030  1.00  0.81           C  
ATOM   2491  OD1 ASN A 306     160.894 144.115 151.382  1.00  0.81           O  
ATOM   2492  ND2 ASN A 306     158.824 144.900 150.950  1.00  0.81           N  
ATOM   2493  N   SER A 307     156.721 141.516 152.441  1.00  0.82           N  
ATOM   2494  CA  SER A 307     155.460 141.844 153.091  1.00  0.82           C  
ATOM   2495  C   SER A 307     155.155 141.002 154.323  1.00  0.82           C  
ATOM   2496  O   SER A 307     154.334 141.396 155.153  1.00  0.82           O  
ATOM   2497  CB  SER A 307     154.261 141.783 152.103  1.00  0.82           C  
ATOM   2498  OG  SER A 307     154.006 140.458 151.640  1.00  0.82           O  
ATOM   2499  N   SER A 308     155.836 139.858 154.523  1.00  0.85           N  
ATOM   2500  CA  SER A 308     155.625 139.001 155.687  1.00  0.85           C  
ATOM   2501  C   SER A 308     156.486 139.375 156.885  1.00  0.85           C  
ATOM   2502  O   SER A 308     156.178 139.015 158.022  1.00  0.85           O  
ATOM   2503  CB  SER A 308     155.822 137.499 155.342  1.00  0.85           C  
ATOM   2504  OG  SER A 308     157.179 137.169 155.046  1.00  0.85           O  
ATOM   2505  N   ALA A 309     157.542 140.192 156.671  1.00  0.85           N  
ATOM   2506  CA  ALA A 309     158.492 140.624 157.687  1.00  0.85           C  
ATOM   2507  C   ALA A 309     157.871 141.346 158.884  1.00  0.85           C  
ATOM   2508  O   ALA A 309     158.305 141.182 160.020  1.00  0.85           O  
ATOM   2509  CB  ALA A 309     159.568 141.524 157.046  1.00  0.85           C  
ATOM   2510  N   PHE A 310     156.820 142.162 158.658  1.00  0.73           N  
ATOM   2511  CA  PHE A 310     156.048 142.809 159.713  1.00  0.73           C  
ATOM   2512  C   PHE A 310     155.354 141.835 160.669  1.00  0.73           C  
ATOM   2513  O   PHE A 310     155.490 141.944 161.885  1.00  0.73           O  
ATOM   2514  CB  PHE A 310     155.005 143.758 159.040  1.00  0.73           C  
ATOM   2515  CG  PHE A 310     154.066 144.417 160.023  1.00  0.73           C  
ATOM   2516  CD1 PHE A 310     154.456 145.535 160.781  1.00  0.73           C  
ATOM   2517  CD2 PHE A 310     152.799 143.850 160.247  1.00  0.73           C  
ATOM   2518  CE1 PHE A 310     153.608 146.048 161.773  1.00  0.73           C  
ATOM   2519  CE2 PHE A 310     151.956 144.353 161.242  1.00  0.73           C  
ATOM   2520  CZ  PHE A 310     152.362 145.452 162.007  1.00  0.73           C  
ATOM   2521  N   PHE A 311     154.607 140.851 160.132  1.00  0.77           N  
ATOM   2522  CA  PHE A 311     153.827 139.918 160.929  1.00  0.77           C  
ATOM   2523  C   PHE A 311     154.709 138.976 161.723  1.00  0.77           C  
ATOM   2524  O   PHE A 311     154.502 138.747 162.906  1.00  0.77           O  
ATOM   2525  CB  PHE A 311     152.843 139.105 160.052  1.00  0.77           C  
ATOM   2526  CG  PHE A 311     151.879 140.019 159.345  1.00  0.77           C  
ATOM   2527  CD1 PHE A 311     150.766 140.530 160.032  1.00  0.77           C  
ATOM   2528  CD2 PHE A 311     152.059 140.362 157.992  1.00  0.77           C  
ATOM   2529  CE1 PHE A 311     149.848 141.368 159.387  1.00  0.77           C  
ATOM   2530  CE2 PHE A 311     151.141 141.199 157.342  1.00  0.77           C  
ATOM   2531  CZ  PHE A 311     150.035 141.701 158.039  1.00  0.77           C  
ATOM   2532  N   PHE A 312     155.785 138.457 161.105  1.00  0.78           N  
ATOM   2533  CA  PHE A 312     156.698 137.562 161.792  1.00  0.78           C  
ATOM   2534  C   PHE A 312     157.588 138.253 162.815  1.00  0.78           C  
ATOM   2535  O   PHE A 312     158.160 137.603 163.685  1.00  0.78           O  
ATOM   2536  CB  PHE A 312     157.591 136.805 160.776  1.00  0.78           C  
ATOM   2537  CG  PHE A 312     156.873 135.575 160.304  1.00  0.78           C  
ATOM   2538  CD1 PHE A 312     156.958 134.399 161.067  1.00  0.78           C  
ATOM   2539  CD2 PHE A 312     156.087 135.579 159.140  1.00  0.78           C  
ATOM   2540  CE1 PHE A 312     156.258 133.249 160.685  1.00  0.78           C  
ATOM   2541  CE2 PHE A 312     155.386 134.429 158.752  1.00  0.78           C  
ATOM   2542  CZ  PHE A 312     155.468 133.268 159.531  1.00  0.78           C  
ATOM   2543  N   SER A 313     157.725 139.593 162.786  1.00  0.81           N  
ATOM   2544  CA  SER A 313     158.615 140.280 163.712  1.00  0.81           C  
ATOM   2545  C   SER A 313     157.972 140.631 165.039  1.00  0.81           C  
ATOM   2546  O   SER A 313     158.664 141.060 165.962  1.00  0.81           O  
ATOM   2547  CB  SER A 313     159.260 141.556 163.099  1.00  0.81           C  
ATOM   2548  OG  SER A 313     158.340 142.613 162.827  1.00  0.81           O  
ATOM   2549  N   GLY A 314     156.644 140.423 165.189  1.00  0.78           N  
ATOM   2550  CA  GLY A 314     155.870 140.857 166.354  1.00  0.78           C  
ATOM   2551  C   GLY A 314     156.250 140.251 167.673  1.00  0.78           C  
ATOM   2552  O   GLY A 314     156.286 140.927 168.696  1.00  0.78           O  
ATOM   2553  N   PHE A 315     156.581 138.953 167.681  1.00  0.76           N  
ATOM   2554  CA  PHE A 315     156.998 138.261 168.885  1.00  0.76           C  
ATOM   2555  C   PHE A 315     158.471 138.504 169.175  1.00  0.76           C  
ATOM   2556  O   PHE A 315     158.853 138.880 170.281  1.00  0.76           O  
ATOM   2557  CB  PHE A 315     156.708 136.743 168.709  1.00  0.76           C  
ATOM   2558  CG  PHE A 315     157.271 135.882 169.808  1.00  0.76           C  
ATOM   2559  CD1 PHE A 315     156.741 135.906 171.109  1.00  0.76           C  
ATOM   2560  CD2 PHE A 315     158.390 135.077 169.538  1.00  0.76           C  
ATOM   2561  CE1 PHE A 315     157.333 135.144 172.127  1.00  0.76           C  
ATOM   2562  CE2 PHE A 315     158.985 134.321 170.552  1.00  0.76           C  
ATOM   2563  CZ  PHE A 315     158.456 134.355 171.848  1.00  0.76           C  
ATOM   2564  N   PHE A 316     159.338 138.298 168.165  1.00  0.77           N  
ATOM   2565  CA  PHE A 316     160.780 138.255 168.346  1.00  0.77           C  
ATOM   2566  C   PHE A 316     161.366 139.560 168.858  1.00  0.77           C  
ATOM   2567  O   PHE A 316     162.194 139.552 169.763  1.00  0.77           O  
ATOM   2568  CB  PHE A 316     161.517 137.812 167.058  1.00  0.77           C  
ATOM   2569  CG  PHE A 316     161.169 136.388 166.717  1.00  0.77           C  
ATOM   2570  CD1 PHE A 316     160.058 136.108 165.908  1.00  0.77           C  
ATOM   2571  CD2 PHE A 316     161.947 135.318 167.192  1.00  0.77           C  
ATOM   2572  CE1 PHE A 316     159.722 134.791 165.575  1.00  0.77           C  
ATOM   2573  CE2 PHE A 316     161.620 133.996 166.859  1.00  0.77           C  
ATOM   2574  CZ  PHE A 316     160.508 133.733 166.048  1.00  0.77           C  
ATOM   2575  N   VAL A 317     160.906 140.723 168.346  1.00  0.80           N  
ATOM   2576  CA  VAL A 317     161.367 142.030 168.810  1.00  0.80           C  
ATOM   2577  C   VAL A 317     161.100 142.286 170.298  1.00  0.80           C  
ATOM   2578  O   VAL A 317     161.939 142.820 171.024  1.00  0.80           O  
ATOM   2579  CB  VAL A 317     160.821 143.159 167.931  1.00  0.80           C  
ATOM   2580  CG1 VAL A 317     159.322 143.424 168.146  1.00  0.80           C  
ATOM   2581  CG2 VAL A 317     161.616 144.451 168.168  1.00  0.80           C  
ATOM   2582  N   VAL A 318     159.914 141.874 170.793  1.00  0.79           N  
ATOM   2583  CA  VAL A 318     159.537 141.968 172.193  1.00  0.79           C  
ATOM   2584  C   VAL A 318     160.264 140.936 173.038  1.00  0.79           C  
ATOM   2585  O   VAL A 318     160.814 141.244 174.090  1.00  0.79           O  
ATOM   2586  CB  VAL A 318     158.027 141.827 172.379  1.00  0.79           C  
ATOM   2587  CG1 VAL A 318     157.647 141.989 173.863  1.00  0.79           C  
ATOM   2588  CG2 VAL A 318     157.294 142.892 171.543  1.00  0.79           C  
ATOM   2589  N   PHE A 319     160.333 139.669 172.588  1.00  0.77           N  
ATOM   2590  CA  PHE A 319     161.002 138.606 173.325  1.00  0.77           C  
ATOM   2591  C   PHE A 319     162.494 138.877 173.547  1.00  0.77           C  
ATOM   2592  O   PHE A 319     162.997 138.760 174.664  1.00  0.77           O  
ATOM   2593  CB  PHE A 319     160.755 137.258 172.594  1.00  0.77           C  
ATOM   2594  CG  PHE A 319     161.426 136.094 173.271  1.00  0.77           C  
ATOM   2595  CD1 PHE A 319     160.997 135.633 174.527  1.00  0.77           C  
ATOM   2596  CD2 PHE A 319     162.538 135.491 172.663  1.00  0.77           C  
ATOM   2597  CE1 PHE A 319     161.683 134.595 175.171  1.00  0.77           C  
ATOM   2598  CE2 PHE A 319     163.231 134.461 173.307  1.00  0.77           C  
ATOM   2599  CZ  PHE A 319     162.799 134.010 174.560  1.00  0.77           C  
ATOM   2600  N   LEU A 320     163.215 139.326 172.500  1.00  0.77           N  
ATOM   2601  CA  LEU A 320     164.624 139.687 172.569  1.00  0.77           C  
ATOM   2602  C   LEU A 320     164.929 140.830 173.536  1.00  0.77           C  
ATOM   2603  O   LEU A 320     165.991 140.859 174.151  1.00  0.77           O  
ATOM   2604  CB  LEU A 320     165.196 140.004 171.159  1.00  0.77           C  
ATOM   2605  CG  LEU A 320     165.833 138.800 170.421  1.00  0.77           C  
ATOM   2606  CD1 LEU A 320     164.888 137.613 170.199  1.00  0.77           C  
ATOM   2607  CD2 LEU A 320     166.418 139.254 169.077  1.00  0.77           C  
ATOM   2608  N   SER A 321     164.020 141.812 173.702  1.00  0.74           N  
ATOM   2609  CA  SER A 321     164.225 142.910 174.636  1.00  0.74           C  
ATOM   2610  C   SER A 321     163.705 142.627 176.035  1.00  0.74           C  
ATOM   2611  O   SER A 321     164.235 143.124 177.020  1.00  0.74           O  
ATOM   2612  CB  SER A 321     163.605 144.227 174.092  1.00  0.74           C  
ATOM   2613  OG  SER A 321     162.184 144.163 173.957  1.00  0.74           O  
ATOM   2614  N   VAL A 322     162.653 141.816 176.196  1.00  0.78           N  
ATOM   2615  CA  VAL A 322     162.103 141.426 177.491  1.00  0.78           C  
ATOM   2616  C   VAL A 322     162.964 140.401 178.216  1.00  0.78           C  
ATOM   2617  O   VAL A 322     163.220 140.526 179.415  1.00  0.78           O  
ATOM   2618  CB  VAL A 322     160.643 140.977 177.366  1.00  0.78           C  
ATOM   2619  CG1 VAL A 322     160.099 140.377 178.678  1.00  0.78           C  
ATOM   2620  CG2 VAL A 322     159.815 142.223 176.995  1.00  0.78           C  
ATOM   2621  N   LEU A 323     163.474 139.373 177.507  1.00  0.77           N  
ATOM   2622  CA  LEU A 323     164.236 138.284 178.109  1.00  0.77           C  
ATOM   2623  C   LEU A 323     165.499 138.676 178.893  1.00  0.77           C  
ATOM   2624  O   LEU A 323     165.632 138.181 180.016  1.00  0.77           O  
ATOM   2625  CB  LEU A 323     164.570 137.220 177.028  1.00  0.77           C  
ATOM   2626  CG  LEU A 323     165.307 135.958 177.517  1.00  0.77           C  
ATOM   2627  CD1 LEU A 323     164.387 135.068 178.358  1.00  0.77           C  
ATOM   2628  CD2 LEU A 323     165.884 135.177 176.329  1.00  0.77           C  
ATOM   2629  N   PRO A 324     166.434 139.541 178.476  1.00  0.75           N  
ATOM   2630  CA  PRO A 324     167.585 139.903 179.301  1.00  0.75           C  
ATOM   2631  C   PRO A 324     167.190 140.684 180.539  1.00  0.75           C  
ATOM   2632  O   PRO A 324     167.874 140.590 181.554  1.00  0.75           O  
ATOM   2633  CB  PRO A 324     168.498 140.725 178.372  1.00  0.75           C  
ATOM   2634  CG  PRO A 324     168.015 140.411 176.953  1.00  0.75           C  
ATOM   2635  CD  PRO A 324     166.530 140.122 177.137  1.00  0.75           C  
ATOM   2636  N   TYR A 325     166.109 141.485 180.482  1.00  0.69           N  
ATOM   2637  CA  TYR A 325     165.608 142.200 181.644  1.00  0.69           C  
ATOM   2638  C   TYR A 325     165.038 141.259 182.700  1.00  0.69           C  
ATOM   2639  O   TYR A 325     165.416 141.333 183.866  1.00  0.69           O  
ATOM   2640  CB  TYR A 325     164.547 143.240 181.189  1.00  0.69           C  
ATOM   2641  CG  TYR A 325     164.090 144.167 182.292  1.00  0.69           C  
ATOM   2642  CD1 TYR A 325     162.964 143.842 183.066  1.00  0.69           C  
ATOM   2643  CD2 TYR A 325     164.745 145.388 182.527  1.00  0.69           C  
ATOM   2644  CE1 TYR A 325     162.487 144.725 184.045  1.00  0.69           C  
ATOM   2645  CE2 TYR A 325     164.268 146.277 183.504  1.00  0.69           C  
ATOM   2646  CZ  TYR A 325     163.138 145.942 184.261  1.00  0.69           C  
ATOM   2647  OH  TYR A 325     162.678 146.822 185.264  1.00  0.69           O  
ATOM   2648  N   ALA A 326     164.165 140.323 182.272  1.00  0.77           N  
ATOM   2649  CA  ALA A 326     163.473 139.360 183.113  1.00  0.77           C  
ATOM   2650  C   ALA A 326     164.384 138.382 183.849  1.00  0.77           C  
ATOM   2651  O   ALA A 326     164.121 137.965 184.973  1.00  0.77           O  
ATOM   2652  CB  ALA A 326     162.455 138.585 182.255  1.00  0.77           C  
ATOM   2653  N   LEU A 327     165.487 137.971 183.202  1.00  0.67           N  
ATOM   2654  CA  LEU A 327     166.511 137.133 183.802  1.00  0.67           C  
ATOM   2655  C   LEU A 327     167.315 137.816 184.906  1.00  0.67           C  
ATOM   2656  O   LEU A 327     167.692 137.187 185.891  1.00  0.67           O  
ATOM   2657  CB  LEU A 327     167.437 136.565 182.699  1.00  0.67           C  
ATOM   2658  CG  LEU A 327     167.013 135.170 182.187  1.00  0.67           C  
ATOM   2659  CD1 LEU A 327     165.538 135.090 181.776  1.00  0.67           C  
ATOM   2660  CD2 LEU A 327     167.902 134.735 181.018  1.00  0.67           C  
ATOM   2661  N   ILE A 328     167.622 139.120 184.763  1.00  0.60           N  
ATOM   2662  CA  ILE A 328     168.336 139.884 185.782  1.00  0.60           C  
ATOM   2663  C   ILE A 328     167.429 140.295 186.935  1.00  0.60           C  
ATOM   2664  O   ILE A 328     167.824 140.302 188.101  1.00  0.60           O  
ATOM   2665  CB  ILE A 328     169.040 141.099 185.171  1.00  0.60           C  
ATOM   2666  CG1 ILE A 328     170.072 140.613 184.126  1.00  0.60           C  
ATOM   2667  CG2 ILE A 328     169.732 141.941 186.268  1.00  0.60           C  
ATOM   2668  CD1 ILE A 328     170.771 141.733 183.350  1.00  0.60           C  
ATOM   2669  N   LYS A 329     166.179 140.680 186.639  1.00  0.63           N  
ATOM   2670  CA  LYS A 329     165.245 141.104 187.656  1.00  0.63           C  
ATOM   2671  C   LYS A 329     163.839 140.792 187.211  1.00  0.63           C  
ATOM   2672  O   LYS A 329     163.513 140.841 186.030  1.00  0.63           O  
ATOM   2673  CB  LYS A 329     165.378 142.617 187.963  1.00  0.63           C  
ATOM   2674  CG  LYS A 329     165.038 143.527 186.771  1.00  0.63           C  
ATOM   2675  CD  LYS A 329     165.664 144.923 186.872  1.00  0.63           C  
ATOM   2676  CE  LYS A 329     167.171 144.891 186.611  1.00  0.63           C  
ATOM   2677  NZ  LYS A 329     167.737 146.256 186.667  1.00  0.63           N  
ATOM   2678  N   GLY A 330     162.951 140.453 188.165  1.00  0.67           N  
ATOM   2679  CA  GLY A 330     161.562 140.144 187.853  1.00  0.67           C  
ATOM   2680  C   GLY A 330     160.809 141.221 187.107  1.00  0.67           C  
ATOM   2681  O   GLY A 330     160.926 142.414 187.387  1.00  0.67           O  
ATOM   2682  N   ILE A 331     159.970 140.805 186.147  1.00  0.70           N  
ATOM   2683  CA  ILE A 331     159.175 141.715 185.347  1.00  0.70           C  
ATOM   2684  C   ILE A 331     157.696 141.470 185.616  1.00  0.70           C  
ATOM   2685  O   ILE A 331     157.214 140.345 185.763  1.00  0.70           O  
ATOM   2686  CB  ILE A 331     159.541 141.671 183.860  1.00  0.70           C  
ATOM   2687  CG1 ILE A 331     158.922 142.859 183.080  1.00  0.70           C  
ATOM   2688  CG2 ILE A 331     159.192 140.295 183.262  1.00  0.70           C  
ATOM   2689  CD1 ILE A 331     159.433 143.015 181.644  1.00  0.70           C  
ATOM   2690  N   ILE A 332     156.925 142.563 185.750  1.00  0.72           N  
ATOM   2691  CA  ILE A 332     155.486 142.533 185.935  1.00  0.72           C  
ATOM   2692  C   ILE A 332     154.777 142.509 184.587  1.00  0.72           C  
ATOM   2693  O   ILE A 332     155.252 143.073 183.599  1.00  0.72           O  
ATOM   2694  CB  ILE A 332     154.987 143.722 186.766  1.00  0.72           C  
ATOM   2695  CG1 ILE A 332     155.333 145.076 186.103  1.00  0.72           C  
ATOM   2696  CG2 ILE A 332     155.578 143.605 188.186  1.00  0.72           C  
ATOM   2697  CD1 ILE A 332     154.804 146.308 186.840  1.00  0.72           C  
ATOM   2698  N   LEU A 333     153.582 141.890 184.508  1.00  0.72           N  
ATOM   2699  CA  LEU A 333     152.796 141.813 183.280  1.00  0.72           C  
ATOM   2700  C   LEU A 333     152.447 143.158 182.644  1.00  0.72           C  
ATOM   2701  O   LEU A 333     152.456 143.310 181.424  1.00  0.72           O  
ATOM   2702  CB  LEU A 333     151.470 141.060 183.513  1.00  0.72           C  
ATOM   2703  CG  LEU A 333     151.593 139.591 183.947  1.00  0.72           C  
ATOM   2704  CD1 LEU A 333     150.186 138.989 184.054  1.00  0.72           C  
ATOM   2705  CD2 LEU A 333     152.451 138.765 182.983  1.00  0.72           C  
ATOM   2706  N   ARG A 334     152.183 144.188 183.474  1.00  0.68           N  
ATOM   2707  CA  ARG A 334     151.953 145.559 183.043  1.00  0.68           C  
ATOM   2708  C   ARG A 334     153.102 146.134 182.226  1.00  0.68           C  
ATOM   2709  O   ARG A 334     152.906 146.780 181.202  1.00  0.68           O  
ATOM   2710  CB  ARG A 334     151.696 146.433 184.306  1.00  0.68           C  
ATOM   2711  CG  ARG A 334     151.910 147.957 184.142  1.00  0.68           C  
ATOM   2712  CD  ARG A 334     151.186 148.814 185.193  1.00  0.68           C  
ATOM   2713  NE  ARG A 334     151.839 150.169 185.266  1.00  0.68           N  
ATOM   2714  CZ  ARG A 334     151.620 151.191 184.425  1.00  0.68           C  
ATOM   2715  NH1 ARG A 334     150.947 151.044 183.290  1.00  0.68           N  
ATOM   2716  NH2 ARG A 334     152.096 152.393 184.745  1.00  0.68           N  
ATOM   2717  N   LYS A 335     154.352 145.882 182.648  1.00  0.75           N  
ATOM   2718  CA  LYS A 335     155.529 146.324 181.932  1.00  0.75           C  
ATOM   2719  C   LYS A 335     155.724 145.617 180.600  1.00  0.75           C  
ATOM   2720  O   LYS A 335     156.082 146.239 179.603  1.00  0.75           O  
ATOM   2721  CB  LYS A 335     156.770 146.194 182.834  1.00  0.75           C  
ATOM   2722  CG  LYS A 335     157.934 147.077 182.381  1.00  0.75           C  
ATOM   2723  CD  LYS A 335     158.966 147.288 183.497  1.00  0.75           C  
ATOM   2724  CE  LYS A 335     159.948 148.384 183.111  1.00  0.75           C  
ATOM   2725  NZ  LYS A 335     160.859 148.717 184.220  1.00  0.75           N  
ATOM   2726  N   ILE A 336     155.440 144.296 180.550  1.00  0.78           N  
ATOM   2727  CA  ILE A 336     155.471 143.509 179.321  1.00  0.78           C  
ATOM   2728  C   ILE A 336     154.485 144.038 178.285  1.00  0.78           C  
ATOM   2729  O   ILE A 336     154.851 144.289 177.139  1.00  0.78           O  
ATOM   2730  CB  ILE A 336     155.187 142.024 179.584  1.00  0.78           C  
ATOM   2731  CG1 ILE A 336     156.205 141.435 180.589  1.00  0.78           C  
ATOM   2732  CG2 ILE A 336     155.209 141.236 178.255  1.00  0.78           C  
ATOM   2733  CD1 ILE A 336     155.935 139.977 180.979  1.00  0.78           C  
ATOM   2734  N   PHE A 337     153.222 144.296 178.683  1.00  0.76           N  
ATOM   2735  CA  PHE A 337     152.210 144.865 177.803  1.00  0.76           C  
ATOM   2736  C   PHE A 337     152.580 146.255 177.267  1.00  0.76           C  
ATOM   2737  O   PHE A 337     152.457 146.525 176.073  1.00  0.76           O  
ATOM   2738  CB  PHE A 337     150.843 144.886 178.542  1.00  0.76           C  
ATOM   2739  CG  PHE A 337     149.752 145.517 177.717  1.00  0.76           C  
ATOM   2740  CD1 PHE A 337     149.288 144.918 176.534  1.00  0.76           C  
ATOM   2741  CD2 PHE A 337     149.255 146.777 178.086  1.00  0.76           C  
ATOM   2742  CE1 PHE A 337     148.345 145.575 175.730  1.00  0.76           C  
ATOM   2743  CE2 PHE A 337     148.314 147.433 177.288  1.00  0.76           C  
ATOM   2744  CZ  PHE A 337     147.854 146.830 176.111  1.00  0.76           C  
ATOM   2745  N   THR A 338     153.097 147.158 178.125  1.00  0.79           N  
ATOM   2746  CA  THR A 338     153.554 148.490 177.713  1.00  0.79           C  
ATOM   2747  C   THR A 338     154.665 148.439 176.667  1.00  0.79           C  
ATOM   2748  O   THR A 338     154.645 149.185 175.687  1.00  0.79           O  
ATOM   2749  CB  THR A 338     154.023 149.340 178.892  1.00  0.79           C  
ATOM   2750  OG1 THR A 338     152.989 149.465 179.859  1.00  0.79           O  
ATOM   2751  CG2 THR A 338     154.360 150.774 178.466  1.00  0.79           C  
ATOM   2752  N   THR A 339     155.641 147.512 176.809  1.00  0.81           N  
ATOM   2753  CA  THR A 339     156.666 147.241 175.790  1.00  0.81           C  
ATOM   2754  C   THR A 339     156.071 146.793 174.462  1.00  0.81           C  
ATOM   2755  O   THR A 339     156.471 147.268 173.400  1.00  0.81           O  
ATOM   2756  CB  THR A 339     157.684 146.184 176.231  1.00  0.81           C  
ATOM   2757  OG1 THR A 339     158.340 146.599 177.421  1.00  0.81           O  
ATOM   2758  CG2 THR A 339     158.794 145.960 175.190  1.00  0.81           C  
ATOM   2759  N   ILE A 340     155.053 145.899 174.470  1.00  0.80           N  
ATOM   2760  CA  ILE A 340     154.356 145.462 173.257  1.00  0.80           C  
ATOM   2761  C   ILE A 340     153.702 146.624 172.516  1.00  0.80           C  
ATOM   2762  O   ILE A 340     153.887 146.788 171.311  1.00  0.80           O  
ATOM   2763  CB  ILE A 340     153.306 144.377 173.539  1.00  0.80           C  
ATOM   2764  CG1 ILE A 340     153.972 143.117 174.132  1.00  0.80           C  
ATOM   2765  CG2 ILE A 340     152.536 144.002 172.254  1.00  0.80           C  
ATOM   2766  CD1 ILE A 340     152.997 142.037 174.609  1.00  0.80           C  
ATOM   2767  N   SER A 341     152.984 147.511 173.231  1.00  0.81           N  
ATOM   2768  CA  SER A 341     152.310 148.671 172.649  1.00  0.81           C  
ATOM   2769  C   SER A 341     153.230 149.638 171.916  1.00  0.81           C  
ATOM   2770  O   SER A 341     152.931 150.083 170.810  1.00  0.81           O  
ATOM   2771  CB  SER A 341     151.548 149.482 173.724  1.00  0.81           C  
ATOM   2772  OG  SER A 341     150.515 148.691 174.303  1.00  0.81           O  
ATOM   2773  N   PHE A 342     154.409 149.964 172.484  1.00  0.82           N  
ATOM   2774  CA  PHE A 342     155.435 150.713 171.769  1.00  0.82           C  
ATOM   2775  C   PHE A 342     156.037 149.966 170.582  1.00  0.82           C  
ATOM   2776  O   PHE A 342     156.223 150.519 169.496  1.00  0.82           O  
ATOM   2777  CB  PHE A 342     156.590 151.107 172.720  1.00  0.82           C  
ATOM   2778  CG  PHE A 342     156.178 152.218 173.637  1.00  0.82           C  
ATOM   2779  CD1 PHE A 342     155.788 153.454 173.096  1.00  0.82           C  
ATOM   2780  CD2 PHE A 342     156.222 152.067 175.033  1.00  0.82           C  
ATOM   2781  CE1 PHE A 342     155.433 154.518 173.930  1.00  0.82           C  
ATOM   2782  CE2 PHE A 342     155.882 153.135 175.873  1.00  0.82           C  
ATOM   2783  CZ  PHE A 342     155.487 154.359 175.319  1.00  0.82           C  
ATOM   2784  N   CYS A 343     156.337 148.665 170.749  1.00  0.81           N  
ATOM   2785  CA  CYS A 343     156.907 147.841 169.697  1.00  0.81           C  
ATOM   2786  C   CYS A 343     155.998 147.638 168.486  1.00  0.81           C  
ATOM   2787  O   CYS A 343     156.490 147.475 167.374  1.00  0.81           O  
ATOM   2788  CB  CYS A 343     157.406 146.471 170.219  1.00  0.81           C  
ATOM   2789  SG  CYS A 343     158.905 146.621 171.252  1.00  0.81           S  
ATOM   2790  N   ILE A 344     154.654 147.670 168.627  1.00  0.78           N  
ATOM   2791  CA  ILE A 344     153.730 147.667 167.485  1.00  0.78           C  
ATOM   2792  C   ILE A 344     153.962 148.854 166.549  1.00  0.78           C  
ATOM   2793  O   ILE A 344     154.106 148.696 165.335  1.00  0.78           O  
ATOM   2794  CB  ILE A 344     152.267 147.635 167.955  1.00  0.78           C  
ATOM   2795  CG1 ILE A 344     151.949 146.274 168.619  1.00  0.78           C  
ATOM   2796  CG2 ILE A 344     151.286 147.908 166.791  1.00  0.78           C  
ATOM   2797  CD1 ILE A 344     150.573 146.195 169.289  1.00  0.78           C  
ATOM   2798  N   VAL A 345     154.073 150.077 167.106  1.00  0.82           N  
ATOM   2799  CA  VAL A 345     154.356 151.288 166.345  1.00  0.82           C  
ATOM   2800  C   VAL A 345     155.755 151.260 165.739  1.00  0.82           C  
ATOM   2801  O   VAL A 345     155.965 151.580 164.568  1.00  0.82           O  
ATOM   2802  CB  VAL A 345     154.163 152.545 167.190  1.00  0.82           C  
ATOM   2803  CG1 VAL A 345     154.220 153.798 166.297  1.00  0.82           C  
ATOM   2804  CG2 VAL A 345     152.799 152.491 167.904  1.00  0.82           C  
ATOM   2805  N   LEU A 346     156.751 150.803 166.528  1.00  0.83           N  
ATOM   2806  CA  LEU A 346     158.135 150.675 166.098  1.00  0.83           C  
ATOM   2807  C   LEU A 346     158.341 149.738 164.913  1.00  0.83           C  
ATOM   2808  O   LEU A 346     159.036 150.065 163.952  1.00  0.83           O  
ATOM   2809  CB  LEU A 346     159.003 150.176 167.278  1.00  0.83           C  
ATOM   2810  CG  LEU A 346     160.526 150.286 167.066  1.00  0.83           C  
ATOM   2811  CD1 LEU A 346     160.979 151.746 166.959  1.00  0.83           C  
ATOM   2812  CD2 LEU A 346     161.284 149.586 168.201  1.00  0.83           C  
ATOM   2813  N   ARG A 347     157.694 148.553 164.922  1.00  0.74           N  
ATOM   2814  CA  ARG A 347     157.719 147.640 163.793  1.00  0.74           C  
ATOM   2815  C   ARG A 347     157.114 148.229 162.529  1.00  0.74           C  
ATOM   2816  O   ARG A 347     157.672 148.088 161.446  1.00  0.74           O  
ATOM   2817  CB  ARG A 347     156.948 146.343 164.107  1.00  0.74           C  
ATOM   2818  CG  ARG A 347     157.629 145.439 165.142  1.00  0.74           C  
ATOM   2819  CD  ARG A 347     156.867 144.132 165.379  1.00  0.74           C  
ATOM   2820  NE  ARG A 347     155.461 144.431 165.823  1.00  0.74           N  
ATOM   2821  CZ  ARG A 347     154.361 143.878 165.279  1.00  0.74           C  
ATOM   2822  NH1 ARG A 347     154.363 143.125 164.188  1.00  0.74           N  
ATOM   2823  NH2 ARG A 347     153.172 144.010 165.861  1.00  0.74           N  
ATOM   2824  N   MET A 348     155.973 148.939 162.643  1.00  0.76           N  
ATOM   2825  CA  MET A 348     155.313 149.566 161.507  1.00  0.76           C  
ATOM   2826  C   MET A 348     156.182 150.590 160.783  1.00  0.76           C  
ATOM   2827  O   MET A 348     156.263 150.613 159.554  1.00  0.76           O  
ATOM   2828  CB  MET A 348     153.993 150.245 161.950  1.00  0.76           C  
ATOM   2829  CG  MET A 348     153.043 150.575 160.783  1.00  0.76           C  
ATOM   2830  SD  MET A 348     152.356 149.092 159.985  1.00  0.76           S  
ATOM   2831  CE  MET A 348     151.389 149.985 158.737  1.00  0.76           C  
ATOM   2832  N   ALA A 349     156.900 151.444 161.536  1.00  0.83           N  
ATOM   2833  CA  ALA A 349     157.846 152.379 160.964  1.00  0.83           C  
ATOM   2834  C   ALA A 349     159.011 151.713 160.226  1.00  0.83           C  
ATOM   2835  O   ALA A 349     159.315 152.050 159.081  1.00  0.83           O  
ATOM   2836  CB  ALA A 349     158.403 153.266 162.092  1.00  0.83           C  
ATOM   2837  N   VAL A 350     159.662 150.719 160.867  1.00  0.81           N  
ATOM   2838  CA  VAL A 350     160.827 150.034 160.320  1.00  0.81           C  
ATOM   2839  C   VAL A 350     160.523 149.093 159.163  1.00  0.81           C  
ATOM   2840  O   VAL A 350     161.199 149.135 158.139  1.00  0.81           O  
ATOM   2841  CB  VAL A 350     161.596 149.280 161.408  1.00  0.81           C  
ATOM   2842  CG1 VAL A 350     162.841 148.583 160.825  1.00  0.81           C  
ATOM   2843  CG2 VAL A 350     162.042 150.275 162.494  1.00  0.81           C  
ATOM   2844  N   THR A 351     159.500 148.220 159.271  1.00  0.80           N  
ATOM   2845  CA  THR A 351     159.327 147.126 158.309  1.00  0.80           C  
ATOM   2846  C   THR A 351     158.204 147.377 157.330  1.00  0.80           C  
ATOM   2847  O   THR A 351     157.987 146.586 156.410  1.00  0.80           O  
ATOM   2848  CB  THR A 351     159.078 145.759 158.956  1.00  0.80           C  
ATOM   2849  OG1 THR A 351     157.874 145.722 159.708  1.00  0.80           O  
ATOM   2850  CG2 THR A 351     160.209 145.421 159.934  1.00  0.80           C  
ATOM   2851  N   ARG A 352     157.468 148.498 157.474  1.00  0.74           N  
ATOM   2852  CA  ARG A 352     156.370 148.804 156.574  1.00  0.74           C  
ATOM   2853  C   ARG A 352     156.470 150.187 155.959  1.00  0.74           C  
ATOM   2854  O   ARG A 352     156.399 150.332 154.746  1.00  0.74           O  
ATOM   2855  CB  ARG A 352     155.014 148.652 157.316  1.00  0.74           C  
ATOM   2856  CG  ARG A 352     153.852 148.127 156.444  1.00  0.74           C  
ATOM   2857  CD  ARG A 352     154.070 146.678 156.009  1.00  0.74           C  
ATOM   2858  NE  ARG A 352     152.825 146.144 155.353  1.00  0.74           N  
ATOM   2859  CZ  ARG A 352     152.660 144.833 155.120  1.00  0.74           C  
ATOM   2860  NH1 ARG A 352     153.645 143.996 155.442  1.00  0.74           N  
ATOM   2861  NH2 ARG A 352     151.549 144.352 154.571  1.00  0.74           N  
ATOM   2862  N   GLN A 353     156.644 151.257 156.752  1.00  0.77           N  
ATOM   2863  CA  GLN A 353     156.620 152.606 156.206  1.00  0.77           C  
ATOM   2864  C   GLN A 353     157.913 153.032 155.526  1.00  0.77           C  
ATOM   2865  O   GLN A 353     157.910 153.509 154.391  1.00  0.77           O  
ATOM   2866  CB  GLN A 353     156.274 153.599 157.328  1.00  0.77           C  
ATOM   2867  CG  GLN A 353     154.849 153.391 157.888  1.00  0.77           C  
ATOM   2868  CD  GLN A 353     154.608 154.342 159.059  1.00  0.77           C  
ATOM   2869  OE1 GLN A 353     155.536 154.889 159.650  1.00  0.77           O  
ATOM   2870  NE2 GLN A 353     153.316 154.545 159.410  1.00  0.77           N  
ATOM   2871  N   PHE A 354     159.071 152.831 156.183  1.00  0.78           N  
ATOM   2872  CA  PHE A 354     160.367 153.138 155.596  1.00  0.78           C  
ATOM   2873  C   PHE A 354     160.708 152.360 154.310  1.00  0.78           C  
ATOM   2874  O   PHE A 354     161.076 153.023 153.337  1.00  0.78           O  
ATOM   2875  CB  PHE A 354     161.463 152.987 156.689  1.00  0.78           C  
ATOM   2876  CG  PHE A 354     162.822 153.403 156.206  1.00  0.78           C  
ATOM   2877  CD1 PHE A 354     163.155 154.761 156.076  1.00  0.78           C  
ATOM   2878  CD2 PHE A 354     163.762 152.426 155.844  1.00  0.78           C  
ATOM   2879  CE1 PHE A 354     164.414 155.136 155.591  1.00  0.78           C  
ATOM   2880  CE2 PHE A 354     165.018 152.797 155.352  1.00  0.78           C  
ATOM   2881  CZ  PHE A 354     165.345 154.154 155.229  1.00  0.78           C  
ATOM   2882  N   PRO A 355     160.579 151.036 154.156  1.00  0.80           N  
ATOM   2883  CA  PRO A 355     160.988 150.369 152.921  1.00  0.80           C  
ATOM   2884  C   PRO A 355     160.067 150.703 151.763  1.00  0.80           C  
ATOM   2885  O   PRO A 355     160.527 150.751 150.624  1.00  0.80           O  
ATOM   2886  CB  PRO A 355     161.012 148.869 153.277  1.00  0.80           C  
ATOM   2887  CG  PRO A 355     160.189 148.736 154.559  1.00  0.80           C  
ATOM   2888  CD  PRO A 355     160.389 150.079 155.247  1.00  0.80           C  
ATOM   2889  N   TRP A 356     158.769 150.953 152.024  1.00  0.77           N  
ATOM   2890  CA  TRP A 356     157.814 151.402 151.023  1.00  0.77           C  
ATOM   2891  C   TRP A 356     158.156 152.794 150.504  1.00  0.77           C  
ATOM   2892  O   TRP A 356     158.143 153.043 149.302  1.00  0.77           O  
ATOM   2893  CB  TRP A 356     156.359 151.362 151.571  1.00  0.77           C  
ATOM   2894  CG  TRP A 356     155.574 150.083 151.273  1.00  0.77           C  
ATOM   2895  CD1 TRP A 356     154.442 149.965 150.511  1.00  0.77           C  
ATOM   2896  CD2 TRP A 356     155.878 148.746 151.734  1.00  0.77           C  
ATOM   2897  NE1 TRP A 356     154.029 148.649 150.454  1.00  0.77           N  
ATOM   2898  CE2 TRP A 356     154.900 147.888 151.196  1.00  0.77           C  
ATOM   2899  CE3 TRP A 356     156.892 148.244 152.544  1.00  0.77           C  
ATOM   2900  CZ2 TRP A 356     154.925 146.521 151.447  1.00  0.77           C  
ATOM   2901  CZ3 TRP A 356     156.918 146.867 152.809  1.00  0.77           C  
ATOM   2902  CH2 TRP A 356     155.948 146.015 152.263  1.00  0.77           C  
ATOM   2903  N   ALA A 357     158.536 153.735 151.394  1.00  0.83           N  
ATOM   2904  CA  ALA A 357     159.021 155.042 150.993  1.00  0.83           C  
ATOM   2905  C   ALA A 357     160.279 155.000 150.131  1.00  0.83           C  
ATOM   2906  O   ALA A 357     160.353 155.651 149.090  1.00  0.83           O  
ATOM   2907  CB  ALA A 357     159.298 155.885 152.246  1.00  0.83           C  
ATOM   2908  N   VAL A 358     161.278 154.176 150.515  1.00  0.78           N  
ATOM   2909  CA  VAL A 358     162.498 153.966 149.740  1.00  0.78           C  
ATOM   2910  C   VAL A 358     162.216 153.405 148.349  1.00  0.78           C  
ATOM   2911  O   VAL A 358     162.716 153.915 147.346  1.00  0.78           O  
ATOM   2912  CB  VAL A 358     163.469 153.048 150.485  1.00  0.78           C  
ATOM   2913  CG1 VAL A 358     164.706 152.705 149.634  1.00  0.78           C  
ATOM   2914  CG2 VAL A 358     163.936 153.738 151.777  1.00  0.78           C  
ATOM   2915  N   GLN A 359     161.352 152.373 148.241  1.00  0.76           N  
ATOM   2916  CA  GLN A 359     160.944 151.811 146.961  1.00  0.76           C  
ATOM   2917  C   GLN A 359     160.208 152.797 146.054  1.00  0.76           C  
ATOM   2918  O   GLN A 359     160.464 152.867 144.852  1.00  0.76           O  
ATOM   2919  CB  GLN A 359     160.092 150.537 147.159  1.00  0.76           C  
ATOM   2920  CG  GLN A 359     159.839 149.728 145.863  1.00  0.76           C  
ATOM   2921  CD  GLN A 359     161.148 149.207 145.268  1.00  0.76           C  
ATOM   2922  OE1 GLN A 359     161.859 148.414 145.884  1.00  0.76           O  
ATOM   2923  NE2 GLN A 359     161.486 149.650 144.034  1.00  0.76           N  
ATOM   2924  N   THR A 360     159.311 153.632 146.619  1.00  0.80           N  
ATOM   2925  CA  THR A 360     158.628 154.712 145.900  1.00  0.80           C  
ATOM   2926  C   THR A 360     159.584 155.711 145.270  1.00  0.80           C  
ATOM   2927  O   THR A 360     159.418 156.098 144.115  1.00  0.80           O  
ATOM   2928  CB  THR A 360     157.672 155.489 146.803  1.00  0.80           C  
ATOM   2929  OG1 THR A 360     156.602 154.650 147.211  1.00  0.80           O  
ATOM   2930  CG2 THR A 360     157.021 156.683 146.095  1.00  0.80           C  
ATOM   2931  N   TRP A 361     160.650 156.137 145.981  1.00  0.78           N  
ATOM   2932  CA  TRP A 361     161.674 156.998 145.399  1.00  0.78           C  
ATOM   2933  C   TRP A 361     162.405 156.359 144.218  1.00  0.78           C  
ATOM   2934  O   TRP A 361     162.612 157.007 143.192  1.00  0.78           O  
ATOM   2935  CB  TRP A 361     162.694 157.487 146.460  1.00  0.78           C  
ATOM   2936  CG  TRP A 361     162.154 158.570 147.384  1.00  0.78           C  
ATOM   2937  CD1 TRP A 361     161.699 158.486 148.672  1.00  0.78           C  
ATOM   2938  CD2 TRP A 361     162.060 159.959 147.017  1.00  0.78           C  
ATOM   2939  NE1 TRP A 361     161.274 159.722 149.117  1.00  0.78           N  
ATOM   2940  CE2 TRP A 361     161.508 160.642 148.121  1.00  0.78           C  
ATOM   2941  CE3 TRP A 361     162.415 160.638 145.852  1.00  0.78           C  
ATOM   2942  CZ2 TRP A 361     161.295 162.013 148.081  1.00  0.78           C  
ATOM   2943  CZ3 TRP A 361     162.214 162.026 145.818  1.00  0.78           C  
ATOM   2944  CH2 TRP A 361     161.661 162.704 146.915  1.00  0.78           C  
ATOM   2945  N   TYR A 362     162.756 155.057 144.302  1.00  0.79           N  
ATOM   2946  CA  TYR A 362     163.318 154.314 143.179  1.00  0.79           C  
ATOM   2947  C   TYR A 362     162.393 154.252 141.964  1.00  0.79           C  
ATOM   2948  O   TYR A 362     162.803 154.538 140.838  1.00  0.79           O  
ATOM   2949  CB  TYR A 362     163.633 152.850 143.594  1.00  0.79           C  
ATOM   2950  CG  TYR A 362     164.963 152.735 144.275  1.00  0.79           C  
ATOM   2951  CD1 TYR A 362     166.136 152.901 143.522  1.00  0.79           C  
ATOM   2952  CD2 TYR A 362     165.068 152.390 145.632  1.00  0.79           C  
ATOM   2953  CE1 TYR A 362     167.394 152.717 144.112  1.00  0.79           C  
ATOM   2954  CE2 TYR A 362     166.326 152.220 146.229  1.00  0.79           C  
ATOM   2955  CZ  TYR A 362     167.488 152.374 145.464  1.00  0.79           C  
ATOM   2956  OH  TYR A 362     168.752 152.185 146.058  1.00  0.79           O  
ATOM   2957  N   ASP A 363     161.103 153.919 142.167  1.00  0.79           N  
ATOM   2958  CA  ASP A 363     160.123 153.873 141.097  1.00  0.79           C  
ATOM   2959  C   ASP A 363     159.850 155.249 140.462  1.00  0.79           C  
ATOM   2960  O   ASP A 363     159.822 155.380 139.236  1.00  0.79           O  
ATOM   2961  CB  ASP A 363     158.792 153.229 141.592  1.00  0.79           C  
ATOM   2962  CG  ASP A 363     158.863 151.719 141.692  1.00  0.79           C  
ATOM   2963  OD1 ASP A 363     159.976 151.143 141.662  1.00  0.79           O  
ATOM   2964  OD2 ASP A 363     157.791 151.058 141.704  1.00  0.79           O  
ATOM   2965  N   SER A 364     159.661 156.320 141.266  1.00  0.82           N  
ATOM   2966  CA  SER A 364     159.447 157.673 140.752  1.00  0.82           C  
ATOM   2967  C   SER A 364     160.644 158.260 140.029  1.00  0.82           C  
ATOM   2968  O   SER A 364     160.520 158.763 138.915  1.00  0.82           O  
ATOM   2969  CB  SER A 364     159.051 158.684 141.857  1.00  0.82           C  
ATOM   2970  OG  SER A 364     157.785 158.341 142.415  1.00  0.82           O  
ATOM   2971  N   LEU A 365     161.861 158.179 140.605  1.00  0.78           N  
ATOM   2972  CA  LEU A 365     163.072 158.656 139.950  1.00  0.78           C  
ATOM   2973  C   LEU A 365     163.423 157.865 138.695  1.00  0.78           C  
ATOM   2974  O   LEU A 365     163.880 158.431 137.700  1.00  0.78           O  
ATOM   2975  CB  LEU A 365     164.276 158.724 140.923  1.00  0.78           C  
ATOM   2976  CG  LEU A 365     164.180 159.852 141.976  1.00  0.78           C  
ATOM   2977  CD1 LEU A 365     165.308 159.726 143.008  1.00  0.78           C  
ATOM   2978  CD2 LEU A 365     164.212 161.253 141.348  1.00  0.78           C  
ATOM   2979  N   GLY A 366     163.183 156.535 138.683  1.00  0.83           N  
ATOM   2980  CA  GLY A 366     163.361 155.707 137.490  1.00  0.83           C  
ATOM   2981  C   GLY A 366     162.449 156.056 136.334  1.00  0.83           C  
ATOM   2982  O   GLY A 366     162.836 155.968 135.168  1.00  0.83           O  
ATOM   2983  N   ALA A 367     161.207 156.490 136.620  1.00  0.84           N  
ATOM   2984  CA  ALA A 367     160.323 157.073 135.629  1.00  0.84           C  
ATOM   2985  C   ALA A 367     160.738 158.474 135.163  1.00  0.84           C  
ATOM   2986  O   ALA A 367     160.766 158.744 133.964  1.00  0.84           O  
ATOM   2987  CB  ALA A 367     158.877 157.079 136.157  1.00  0.84           C  
ATOM   2988  N   ILE A 368     161.116 159.389 136.090  1.00  0.81           N  
ATOM   2989  CA  ILE A 368     161.539 160.759 135.767  1.00  0.81           C  
ATOM   2990  C   ILE A 368     162.759 160.802 134.857  1.00  0.81           C  
ATOM   2991  O   ILE A 368     162.769 161.516 133.856  1.00  0.81           O  
ATOM   2992  CB  ILE A 368     161.794 161.603 137.028  1.00  0.81           C  
ATOM   2993  CG1 ILE A 368     160.469 161.843 137.787  1.00  0.81           C  
ATOM   2994  CG2 ILE A 368     162.447 162.965 136.688  1.00  0.81           C  
ATOM   2995  CD1 ILE A 368     160.629 162.501 139.163  1.00  0.81           C  
ATOM   2996  N   ASN A 369     163.804 159.997 135.144  1.00  0.79           N  
ATOM   2997  CA  ASN A 369     164.973 159.898 134.279  1.00  0.79           C  
ATOM   2998  C   ASN A 369     164.633 159.359 132.884  1.00  0.79           C  
ATOM   2999  O   ASN A 369     165.047 159.909 131.871  1.00  0.79           O  
ATOM   3000  CB  ASN A 369     166.083 159.052 134.951  1.00  0.79           C  
ATOM   3001  CG  ASN A 369     166.764 159.882 136.036  1.00  0.79           C  
ATOM   3002  OD1 ASN A 369     167.624 160.716 135.762  1.00  0.79           O  
ATOM   3003  ND2 ASN A 369     166.386 159.676 137.318  1.00  0.79           N  
ATOM   3004  N   LYS A 370     163.777 158.322 132.795  1.00  0.79           N  
ATOM   3005  CA  LYS A 370     163.323 157.761 131.529  1.00  0.79           C  
ATOM   3006  C   LYS A 370     162.574 158.750 130.625  1.00  0.79           C  
ATOM   3007  O   LYS A 370     162.768 158.800 129.409  1.00  0.79           O  
ATOM   3008  CB  LYS A 370     162.414 156.543 131.841  1.00  0.79           C  
ATOM   3009  CG  LYS A 370     162.119 155.639 130.635  1.00  0.79           C  
ATOM   3010  CD  LYS A 370     161.191 154.455 130.966  1.00  0.79           C  
ATOM   3011  CE  LYS A 370     161.662 153.535 132.100  1.00  0.79           C  
ATOM   3012  NZ  LYS A 370     162.985 152.949 131.786  1.00  0.79           N  
ATOM   3013  N   ILE A 371     161.696 159.585 131.216  1.00  0.82           N  
ATOM   3014  CA  ILE A 371     161.049 160.706 130.542  1.00  0.82           C  
ATOM   3015  C   ILE A 371     162.047 161.784 130.125  1.00  0.82           C  
ATOM   3016  O   ILE A 371     161.983 162.319 129.018  1.00  0.82           O  
ATOM   3017  CB  ILE A 371     159.917 161.280 131.399  1.00  0.82           C  
ATOM   3018  CG1 ILE A 371     158.822 160.203 131.569  1.00  0.82           C  
ATOM   3019  CG2 ILE A 371     159.334 162.558 130.755  1.00  0.82           C  
ATOM   3020  CD1 ILE A 371     157.715 160.557 132.566  1.00  0.82           C  
ATOM   3021  N   GLN A 372     163.033 162.109 130.986  1.00  0.79           N  
ATOM   3022  CA  GLN A 372     164.083 163.072 130.686  1.00  0.79           C  
ATOM   3023  C   GLN A 372     164.915 162.710 129.451  1.00  0.79           C  
ATOM   3024  O   GLN A 372     165.139 163.545 128.570  1.00  0.79           O  
ATOM   3025  CB  GLN A 372     165.006 163.269 131.922  1.00  0.79           C  
ATOM   3026  CG  GLN A 372     166.115 164.324 131.694  1.00  0.79           C  
ATOM   3027  CD  GLN A 372     166.946 164.663 132.934  1.00  0.79           C  
ATOM   3028  OE1 GLN A 372     166.463 164.794 134.060  1.00  0.79           O  
ATOM   3029  NE2 GLN A 372     168.256 164.909 132.698  1.00  0.79           N  
ATOM   3030  N   ASP A 373     165.327 161.435 129.314  1.00  0.80           N  
ATOM   3031  CA  ASP A 373     166.001 160.914 128.134  1.00  0.80           C  
ATOM   3032  C   ASP A 373     165.160 161.021 126.859  1.00  0.80           C  
ATOM   3033  O   ASP A 373     165.649 161.365 125.782  1.00  0.80           O  
ATOM   3034  CB  ASP A 373     166.388 159.432 128.344  1.00  0.80           C  
ATOM   3035  CG  ASP A 373     167.366 159.258 129.495  1.00  0.80           C  
ATOM   3036  OD1 ASP A 373     168.096 160.231 129.813  1.00  0.80           O  
ATOM   3037  OD2 ASP A 373     167.402 158.120 130.028  1.00  0.80           O  
ATOM   3038  N   PHE A 374     163.839 160.752 126.946  1.00  0.80           N  
ATOM   3039  CA  PHE A 374     162.897 160.929 125.847  1.00  0.80           C  
ATOM   3040  C   PHE A 374     162.801 162.378 125.356  1.00  0.80           C  
ATOM   3041  O   PHE A 374     162.825 162.655 124.156  1.00  0.80           O  
ATOM   3042  CB  PHE A 374     161.506 160.368 126.256  1.00  0.80           C  
ATOM   3043  CG  PHE A 374     160.518 160.356 125.118  1.00  0.80           C  
ATOM   3044  CD1 PHE A 374     160.488 159.302 124.189  1.00  0.80           C  
ATOM   3045  CD2 PHE A 374     159.608 161.416 124.974  1.00  0.80           C  
ATOM   3046  CE1 PHE A 374     159.577 159.320 123.124  1.00  0.80           C  
ATOM   3047  CE2 PHE A 374     158.703 161.441 123.907  1.00  0.80           C  
ATOM   3048  CZ  PHE A 374     158.687 160.392 122.985  1.00  0.80           C  
ATOM   3049  N   LEU A 375     162.755 163.352 126.282  1.00  0.82           N  
ATOM   3050  CA  LEU A 375     162.672 164.773 125.981  1.00  0.82           C  
ATOM   3051  C   LEU A 375     163.901 165.324 125.252  1.00  0.82           C  
ATOM   3052  O   LEU A 375     163.815 166.286 124.486  1.00  0.82           O  
ATOM   3053  CB  LEU A 375     162.376 165.562 127.283  1.00  0.82           C  
ATOM   3054  CG  LEU A 375     160.880 165.882 127.523  1.00  0.82           C  
ATOM   3055  CD1 LEU A 375     159.949 164.666 127.418  1.00  0.82           C  
ATOM   3056  CD2 LEU A 375     160.683 166.569 128.880  1.00  0.82           C  
ATOM   3057  N   GLN A 376     165.073 164.688 125.427  1.00  0.78           N  
ATOM   3058  CA  GLN A 376     166.322 165.099 124.806  1.00  0.78           C  
ATOM   3059  C   GLN A 376     166.652 164.342 123.523  1.00  0.78           C  
ATOM   3060  O   GLN A 376     167.713 164.517 122.931  1.00  0.78           O  
ATOM   3061  CB  GLN A 376     167.471 164.925 125.822  1.00  0.78           C  
ATOM   3062  CG  GLN A 376     167.311 165.857 127.045  1.00  0.78           C  
ATOM   3063  CD  GLN A 376     168.457 165.693 128.041  1.00  0.78           C  
ATOM   3064  OE1 GLN A 376     169.200 166.632 128.321  1.00  0.78           O  
ATOM   3065  NE2 GLN A 376     168.606 164.470 128.600  1.00  0.78           N  
ATOM   3066  N   LYS A 377     165.734 163.498 123.016  1.00  0.79           N  
ATOM   3067  CA  LYS A 377     165.883 162.869 121.713  1.00  0.79           C  
ATOM   3068  C   LYS A 377     165.916 163.813 120.518  1.00  0.79           C  
ATOM   3069  O   LYS A 377     165.354 164.913 120.540  1.00  0.79           O  
ATOM   3070  CB  LYS A 377     164.821 161.781 121.467  1.00  0.79           C  
ATOM   3071  CG  LYS A 377     164.999 160.583 122.405  1.00  0.79           C  
ATOM   3072  CD  LYS A 377     163.951 159.505 122.119  1.00  0.79           C  
ATOM   3073  CE  LYS A 377     164.047 158.259 122.999  1.00  0.79           C  
ATOM   3074  NZ  LYS A 377     165.361 157.607 122.815  1.00  0.79           N  
ATOM   3075  N   GLN A 378     166.594 163.367 119.432  1.00  0.75           N  
ATOM   3076  CA  GLN A 378     166.721 164.073 118.167  1.00  0.75           C  
ATOM   3077  C   GLN A 378     165.396 164.550 117.590  1.00  0.75           C  
ATOM   3078  O   GLN A 378     164.413 163.815 117.462  1.00  0.75           O  
ATOM   3079  CB  GLN A 378     167.442 163.210 117.093  1.00  0.75           C  
ATOM   3080  CG  GLN A 378     167.735 163.937 115.749  1.00  0.75           C  
ATOM   3081  CD  GLN A 378     168.173 162.983 114.630  1.00  0.75           C  
ATOM   3082  OE1 GLN A 378     168.123 161.760 114.739  1.00  0.75           O  
ATOM   3083  NE2 GLN A 378     168.577 163.573 113.478  1.00  0.75           N  
ATOM   3084  N   GLU A 379     165.372 165.834 117.219  1.00  0.74           N  
ATOM   3085  CA  GLU A 379     164.194 166.525 116.773  1.00  0.74           C  
ATOM   3086  C   GLU A 379     164.209 166.649 115.260  1.00  0.74           C  
ATOM   3087  O   GLU A 379     165.263 166.705 114.627  1.00  0.74           O  
ATOM   3088  CB  GLU A 379     164.113 167.896 117.488  1.00  0.74           C  
ATOM   3089  CG  GLU A 379     162.784 168.645 117.242  1.00  0.74           C  
ATOM   3090  CD  GLU A 379     162.360 169.615 118.345  1.00  0.74           C  
ATOM   3091  OE1 GLU A 379     162.700 169.344 119.531  1.00  0.74           O  
ATOM   3092  OE2 GLU A 379     161.584 170.557 118.027  1.00  0.74           O  
ATOM   3093  N   TYR A 380     163.023 166.616 114.631  1.00  0.76           N  
ATOM   3094  CA  TYR A 380     162.822 166.883 113.221  1.00  0.76           C  
ATOM   3095  C   TYR A 380     163.202 168.322 112.871  1.00  0.76           C  
ATOM   3096  O   TYR A 380     162.698 169.284 113.447  1.00  0.76           O  
ATOM   3097  CB  TYR A 380     161.333 166.583 112.889  1.00  0.76           C  
ATOM   3098  CG  TYR A 380     160.896 167.005 111.512  1.00  0.76           C  
ATOM   3099  CD1 TYR A 380     161.271 166.291 110.363  1.00  0.76           C  
ATOM   3100  CD2 TYR A 380     160.114 168.163 111.373  1.00  0.76           C  
ATOM   3101  CE1 TYR A 380     160.865 166.734 109.095  1.00  0.76           C  
ATOM   3102  CE2 TYR A 380     159.713 168.605 110.106  1.00  0.76           C  
ATOM   3103  CZ  TYR A 380     160.087 167.887 108.968  1.00  0.76           C  
ATOM   3104  OH  TYR A 380     159.701 168.327 107.689  1.00  0.76           O  
ATOM   3105  N   LYS A 381     164.110 168.501 111.897  1.00  0.68           N  
ATOM   3106  CA  LYS A 381     164.593 169.815 111.547  1.00  0.68           C  
ATOM   3107  C   LYS A 381     163.806 170.430 110.400  1.00  0.68           C  
ATOM   3108  O   LYS A 381     164.076 170.222 109.217  1.00  0.68           O  
ATOM   3109  CB  LYS A 381     166.098 169.750 111.220  1.00  0.68           C  
ATOM   3110  CG  LYS A 381     166.733 171.114 110.915  1.00  0.68           C  
ATOM   3111  CD  LYS A 381     167.390 171.102 109.531  1.00  0.68           C  
ATOM   3112  CE  LYS A 381     167.981 172.450 109.151  1.00  0.68           C  
ATOM   3113  NZ  LYS A 381     168.599 172.338 107.816  1.00  0.68           N  
ATOM   3114  N   THR A 382     162.808 171.266 110.733  1.00  0.67           N  
ATOM   3115  CA  THR A 382     162.011 171.977 109.739  1.00  0.67           C  
ATOM   3116  C   THR A 382     162.808 173.080 109.067  1.00  0.67           C  
ATOM   3117  O   THR A 382     163.073 174.128 109.649  1.00  0.67           O  
ATOM   3118  CB  THR A 382     160.748 172.614 110.312  1.00  0.67           C  
ATOM   3119  OG1 THR A 382     159.962 171.654 110.999  1.00  0.67           O  
ATOM   3120  CG2 THR A 382     159.844 173.163 109.204  1.00  0.67           C  
ATOM   3121  N   LEU A 383     163.207 172.897 107.794  1.00  0.52           N  
ATOM   3122  CA  LEU A 383     163.940 173.915 107.053  1.00  0.52           C  
ATOM   3123  C   LEU A 383     162.983 174.688 106.150  1.00  0.52           C  
ATOM   3124  O   LEU A 383     163.069 174.668 104.925  1.00  0.52           O  
ATOM   3125  CB  LEU A 383     165.127 173.285 106.273  1.00  0.52           C  
ATOM   3126  CG  LEU A 383     166.131 174.282 105.644  1.00  0.52           C  
ATOM   3127  CD1 LEU A 383     166.819 175.230 106.641  1.00  0.52           C  
ATOM   3128  CD2 LEU A 383     167.144 173.556 104.743  1.00  0.52           C  
ATOM   3129  N   GLU A 384     162.001 175.368 106.773  1.00  0.50           N  
ATOM   3130  CA  GLU A 384     161.064 176.249 106.097  1.00  0.50           C  
ATOM   3131  C   GLU A 384     161.713 177.544 105.601  1.00  0.50           C  
ATOM   3132  O   GLU A 384     162.654 178.066 106.197  1.00  0.50           O  
ATOM   3133  CB  GLU A 384     159.833 176.537 106.992  1.00  0.50           C  
ATOM   3134  CG  GLU A 384     158.650 177.244 106.279  1.00  0.50           C  
ATOM   3135  CD  GLU A 384     157.386 177.353 107.134  1.00  0.50           C  
ATOM   3136  OE1 GLU A 384     157.404 176.876 108.297  1.00  0.50           O  
ATOM   3137  OE2 GLU A 384     156.385 177.897 106.599  1.00  0.50           O  
ATOM   3138  N   TYR A 385     161.218 178.086 104.471  1.00  0.45           N  
ATOM   3139  CA  TYR A 385     161.688 179.326 103.887  1.00  0.45           C  
ATOM   3140  C   TYR A 385     160.507 180.222 103.581  1.00  0.45           C  
ATOM   3141  O   TYR A 385     159.492 179.772 103.051  1.00  0.45           O  
ATOM   3142  CB  TYR A 385     162.426 179.117 102.542  1.00  0.45           C  
ATOM   3143  CG  TYR A 385     163.792 178.549 102.769  1.00  0.45           C  
ATOM   3144  CD1 TYR A 385     164.893 179.396 102.988  1.00  0.45           C  
ATOM   3145  CD2 TYR A 385     163.988 177.162 102.754  1.00  0.45           C  
ATOM   3146  CE1 TYR A 385     166.173 178.859 103.191  1.00  0.45           C  
ATOM   3147  CE2 TYR A 385     165.266 176.625 102.950  1.00  0.45           C  
ATOM   3148  CZ  TYR A 385     166.357 177.472 103.169  1.00  0.45           C  
ATOM   3149  OH  TYR A 385     167.634 176.914 103.369  1.00  0.45           O  
ATOM   3150  N   ASN A 386     160.641 181.535 103.873  1.00  0.46           N  
ATOM   3151  CA  ASN A 386     159.627 182.546 103.595  1.00  0.46           C  
ATOM   3152  C   ASN A 386     159.306 182.719 102.109  1.00  0.46           C  
ATOM   3153  O   ASN A 386     158.158 182.917 101.712  1.00  0.46           O  
ATOM   3154  CB  ASN A 386     160.069 183.932 104.149  1.00  0.46           C  
ATOM   3155  CG  ASN A 386     160.075 183.912 105.674  1.00  0.46           C  
ATOM   3156  OD1 ASN A 386     159.373 183.137 106.313  1.00  0.46           O  
ATOM   3157  ND2 ASN A 386     160.884 184.797 106.302  1.00  0.46           N  
ATOM   3158  N   LEU A 387     160.339 182.661 101.252  1.00  0.52           N  
ATOM   3159  CA  LEU A 387     160.222 182.919  99.836  1.00  0.52           C  
ATOM   3160  C   LEU A 387     161.341 182.191  99.116  1.00  0.52           C  
ATOM   3161  O   LEU A 387     162.231 181.620  99.742  1.00  0.52           O  
ATOM   3162  CB  LEU A 387     160.197 184.438  99.505  1.00  0.52           C  
ATOM   3163  CG  LEU A 387     161.418 185.287  99.932  1.00  0.52           C  
ATOM   3164  CD1 LEU A 387     162.620 185.192  98.981  1.00  0.52           C  
ATOM   3165  CD2 LEU A 387     161.006 186.760 100.048  1.00  0.52           C  
ATOM   3166  N   THR A 388     161.298 182.174  97.772  1.00  0.58           N  
ATOM   3167  CA  THR A 388     162.271 181.515  96.908  1.00  0.58           C  
ATOM   3168  C   THR A 388     162.124 182.150  95.536  1.00  0.58           C  
ATOM   3169  O   THR A 388     161.308 183.051  95.351  1.00  0.58           O  
ATOM   3170  CB  THR A 388     162.142 179.991  96.825  1.00  0.58           C  
ATOM   3171  OG1 THR A 388     163.254 179.390  96.164  1.00  0.58           O  
ATOM   3172  CG2 THR A 388     160.876 179.582  96.066  1.00  0.58           C  
ATOM   3173  N   THR A 389     162.887 181.693  94.526  1.00  0.45           N  
ATOM   3174  CA  THR A 389     162.900 182.170  93.141  1.00  0.45           C  
ATOM   3175  C   THR A 389     161.697 181.725  92.303  1.00  0.45           C  
ATOM   3176  O   THR A 389     161.709 181.816  91.086  1.00  0.45           O  
ATOM   3177  CB  THR A 389     164.168 181.694  92.418  1.00  0.45           C  
ATOM   3178  OG1 THR A 389     164.418 180.306  92.653  1.00  0.45           O  
ATOM   3179  CG2 THR A 389     165.392 182.459  92.958  1.00  0.45           C  
ATOM   3180  N   THR A 390     160.624 181.255  92.970  1.00  0.51           N  
ATOM   3181  CA  THR A 390     159.377 180.674  92.447  1.00  0.51           C  
ATOM   3182  C   THR A 390     159.526 179.328  91.761  1.00  0.51           C  
ATOM   3183  O   THR A 390     158.591 178.814  91.150  1.00  0.51           O  
ATOM   3184  CB  THR A 390     158.394 181.585  91.692  1.00  0.51           C  
ATOM   3185  OG1 THR A 390     158.739 181.886  90.350  1.00  0.51           O  
ATOM   3186  CG2 THR A 390     158.236 182.918  92.424  1.00  0.51           C  
ATOM   3187  N   GLU A 391     160.692 178.682  91.941  1.00  0.67           N  
ATOM   3188  CA  GLU A 391     161.016 177.404  91.346  1.00  0.67           C  
ATOM   3189  C   GLU A 391     161.596 176.473  92.401  1.00  0.67           C  
ATOM   3190  O   GLU A 391     161.958 176.876  93.512  1.00  0.67           O  
ATOM   3191  CB  GLU A 391     162.006 177.549  90.152  1.00  0.67           C  
ATOM   3192  CG  GLU A 391     163.423 178.051  90.544  1.00  0.67           C  
ATOM   3193  CD  GLU A 391     164.512 177.876  89.494  1.00  0.67           C  
ATOM   3194  OE1 GLU A 391     164.168 177.557  88.344  1.00  0.67           O  
ATOM   3195  OE2 GLU A 391     165.720 178.021  89.851  1.00  0.67           O  
ATOM   3196  N   VAL A 392     161.675 175.172  92.072  1.00  0.80           N  
ATOM   3197  CA  VAL A 392     162.281 174.151  92.905  1.00  0.80           C  
ATOM   3198  C   VAL A 392     163.418 173.533  92.117  1.00  0.80           C  
ATOM   3199  O   VAL A 392     163.275 173.130  90.962  1.00  0.80           O  
ATOM   3200  CB  VAL A 392     161.282 173.104  93.415  1.00  0.80           C  
ATOM   3201  CG1 VAL A 392     160.348 172.632  92.295  1.00  0.80           C  
ATOM   3202  CG2 VAL A 392     161.980 171.893  94.067  1.00  0.80           C  
ATOM   3203  N   VAL A 393     164.609 173.476  92.736  1.00  0.84           N  
ATOM   3204  CA  VAL A 393     165.815 172.977  92.108  1.00  0.84           C  
ATOM   3205  C   VAL A 393     166.486 171.988  93.045  1.00  0.84           C  
ATOM   3206  O   VAL A 393     166.523 172.163  94.267  1.00  0.84           O  
ATOM   3207  CB  VAL A 393     166.745 174.105  91.660  1.00  0.84           C  
ATOM   3208  CG1 VAL A 393     167.192 174.975  92.847  1.00  0.84           C  
ATOM   3209  CG2 VAL A 393     167.959 173.563  90.883  1.00  0.84           C  
ATOM   3210  N   MET A 394     166.988 170.880  92.472  1.00  0.80           N  
ATOM   3211  CA  MET A 394     167.661 169.821  93.189  1.00  0.80           C  
ATOM   3212  C   MET A 394     169.004 169.597  92.522  1.00  0.80           C  
ATOM   3213  O   MET A 394     169.070 169.461  91.301  1.00  0.80           O  
ATOM   3214  CB  MET A 394     166.792 168.544  93.147  1.00  0.80           C  
ATOM   3215  CG  MET A 394     167.092 167.515  94.250  1.00  0.80           C  
ATOM   3216  SD  MET A 394     165.731 166.322  94.439  1.00  0.80           S  
ATOM   3217  CE  MET A 394     166.447 165.232  95.691  1.00  0.80           C  
ATOM   3218  N   GLU A 395     170.111 169.602  93.290  1.00  0.80           N  
ATOM   3219  CA  GLU A 395     171.453 169.561  92.729  1.00  0.80           C  
ATOM   3220  C   GLU A 395     172.241 168.412  93.353  1.00  0.80           C  
ATOM   3221  O   GLU A 395     172.659 168.491  94.507  1.00  0.80           O  
ATOM   3222  CB  GLU A 395     172.191 170.909  92.997  1.00  0.80           C  
ATOM   3223  CG  GLU A 395     171.443 172.177  92.482  1.00  0.80           C  
ATOM   3224  CD  GLU A 395     172.040 173.518  92.935  1.00  0.80           C  
ATOM   3225  OE1 GLU A 395     173.229 173.563  93.334  1.00  0.80           O  
ATOM   3226  OE2 GLU A 395     171.285 174.532  92.950  1.00  0.80           O  
ATOM   3227  N   ASN A 396     172.458 167.311  92.590  1.00  0.80           N  
ATOM   3228  CA  ASN A 396     173.294 166.156  92.925  1.00  0.80           C  
ATOM   3229  C   ASN A 396     173.066 165.561  94.302  1.00  0.80           C  
ATOM   3230  O   ASN A 396     173.968 165.424  95.121  1.00  0.80           O  
ATOM   3231  CB  ASN A 396     174.793 166.403  92.648  1.00  0.80           C  
ATOM   3232  CG  ASN A 396     174.974 166.644  91.157  1.00  0.80           C  
ATOM   3233  OD1 ASN A 396     174.128 166.294  90.331  1.00  0.80           O  
ATOM   3234  ND2 ASN A 396     176.106 167.276  90.777  1.00  0.80           N  
ATOM   3235  N   VAL A 397     171.811 165.195  94.587  1.00  0.81           N  
ATOM   3236  CA  VAL A 397     171.446 164.664  95.881  1.00  0.81           C  
ATOM   3237  C   VAL A 397     171.747 163.179  96.001  1.00  0.81           C  
ATOM   3238  O   VAL A 397     171.292 162.363  95.198  1.00  0.81           O  
ATOM   3239  CB  VAL A 397     169.989 164.959  96.190  1.00  0.81           C  
ATOM   3240  CG1 VAL A 397     169.480 164.148  97.391  1.00  0.81           C  
ATOM   3241  CG2 VAL A 397     169.852 166.461  96.498  1.00  0.81           C  
ATOM   3242  N   THR A 398     172.495 162.813  97.062  1.00  0.76           N  
ATOM   3243  CA  THR A 398     172.778 161.432  97.431  1.00  0.76           C  
ATOM   3244  C   THR A 398     172.238 161.205  98.830  1.00  0.76           C  
ATOM   3245  O   THR A 398     172.506 161.969  99.758  1.00  0.76           O  
ATOM   3246  CB  THR A 398     174.266 161.072  97.376  1.00  0.76           C  
ATOM   3247  OG1 THR A 398     174.722 161.101  96.028  1.00  0.76           O  
ATOM   3248  CG2 THR A 398     174.533 159.650  97.898  1.00  0.76           C  
ATOM   3249  N   ALA A 399     171.431 160.140  99.030  1.00  0.82           N  
ATOM   3250  CA  ALA A 399     170.761 159.880 100.293  1.00  0.82           C  
ATOM   3251  C   ALA A 399     170.844 158.414 100.696  1.00  0.82           C  
ATOM   3252  O   ALA A 399     170.950 157.508  99.869  1.00  0.82           O  
ATOM   3253  CB  ALA A 399     169.273 160.289 100.229  1.00  0.82           C  
ATOM   3254  N   PHE A 400     170.779 158.161 102.019  1.00  0.70           N  
ATOM   3255  CA  PHE A 400     170.908 156.842 102.605  1.00  0.70           C  
ATOM   3256  C   PHE A 400     169.880 156.688 103.713  1.00  0.70           C  
ATOM   3257  O   PHE A 400     169.608 157.624 104.469  1.00  0.70           O  
ATOM   3258  CB  PHE A 400     172.296 156.604 103.258  1.00  0.70           C  
ATOM   3259  CG  PHE A 400     173.404 156.669 102.252  1.00  0.70           C  
ATOM   3260  CD1 PHE A 400     174.038 157.889 101.969  1.00  0.70           C  
ATOM   3261  CD2 PHE A 400     173.860 155.503 101.620  1.00  0.70           C  
ATOM   3262  CE1 PHE A 400     175.114 157.946 101.076  1.00  0.70           C  
ATOM   3263  CE2 PHE A 400     174.954 155.550 100.745  1.00  0.70           C  
ATOM   3264  CZ  PHE A 400     175.572 156.774 100.463  1.00  0.70           C  
ATOM   3265  N   TRP A 401     169.306 155.475 103.856  1.00  0.64           N  
ATOM   3266  CA  TRP A 401     168.358 155.174 104.921  1.00  0.64           C  
ATOM   3267  C   TRP A 401     169.064 154.651 106.164  1.00  0.64           C  
ATOM   3268  O   TRP A 401     168.463 154.510 107.222  1.00  0.64           O  
ATOM   3269  CB  TRP A 401     167.314 154.114 104.466  1.00  0.64           C  
ATOM   3270  CG  TRP A 401     166.162 154.647 103.628  1.00  0.64           C  
ATOM   3271  CD1 TRP A 401     165.747 154.295 102.372  1.00  0.64           C  
ATOM   3272  CD2 TRP A 401     165.186 155.585 104.120  1.00  0.64           C  
ATOM   3273  NE1 TRP A 401     164.626 155.018 102.013  1.00  0.64           N  
ATOM   3274  CE2 TRP A 401     164.268 155.812 103.077  1.00  0.64           C  
ATOM   3275  CE3 TRP A 401     165.034 156.200 105.362  1.00  0.64           C  
ATOM   3276  CZ2 TRP A 401     163.197 156.682 103.239  1.00  0.64           C  
ATOM   3277  CZ3 TRP A 401     163.937 157.057 105.535  1.00  0.64           C  
ATOM   3278  CH2 TRP A 401     163.041 157.309 104.486  1.00  0.64           C  
ATOM   3279  N   GLU A 402     170.381 154.404 106.063  1.00  0.58           N  
ATOM   3280  CA  GLU A 402     171.270 154.120 107.172  1.00  0.58           C  
ATOM   3281  C   GLU A 402     171.296 155.196 108.259  1.00  0.58           C  
ATOM   3282  O   GLU A 402     170.687 156.265 108.161  1.00  0.58           O  
ATOM   3283  CB  GLU A 402     172.711 153.887 106.650  1.00  0.58           C  
ATOM   3284  CG  GLU A 402     172.819 152.759 105.594  1.00  0.58           C  
ATOM   3285  CD  GLU A 402     172.410 151.404 106.172  1.00  0.58           C  
ATOM   3286  OE1 GLU A 402     172.568 151.224 107.405  1.00  0.58           O  
ATOM   3287  OE2 GLU A 402     171.933 150.559 105.377  1.00  0.58           O  
ATOM   3288  N   GLU A 403     172.095 154.991 109.323  1.00  0.44           N  
ATOM   3289  CA  GLU A 403     172.301 155.974 110.379  1.00  0.44           C  
ATOM   3290  C   GLU A 403     172.980 157.251 109.885  1.00  0.44           C  
ATOM   3291  O   GLU A 403     172.900 158.311 110.499  1.00  0.44           O  
ATOM   3292  CB  GLU A 403     173.102 155.336 111.532  1.00  0.44           C  
ATOM   3293  CG  GLU A 403     172.297 154.185 112.187  1.00  0.44           C  
ATOM   3294  CD  GLU A 403     172.955 153.566 113.418  1.00  0.44           C  
ATOM   3295  OE1 GLU A 403     174.141 153.869 113.693  1.00  0.44           O  
ATOM   3296  OE2 GLU A 403     172.236 152.787 114.101  1.00  0.44           O  
ATOM   3297  N   GLY A 404     173.608 157.169 108.696  1.00  0.45           N  
ATOM   3298  CA  GLY A 404     174.326 158.252 108.051  1.00  0.45           C  
ATOM   3299  C   GLY A 404     175.780 157.954 108.174  1.00  0.45           C  
ATOM   3300  O   GLY A 404     176.517 158.585 108.924  1.00  0.45           O  
ATOM   3301  N   PHE A 405     176.245 156.953 107.406  1.00  0.36           N  
ATOM   3302  CA  PHE A 405     177.647 156.601 107.361  1.00  0.36           C  
ATOM   3303  C   PHE A 405     178.454 157.711 106.699  1.00  0.36           C  
ATOM   3304  O   PHE A 405     178.340 157.977 105.505  1.00  0.36           O  
ATOM   3305  CB  PHE A 405     177.892 155.284 106.606  1.00  0.36           C  
ATOM   3306  CG  PHE A 405     177.539 154.060 107.400  1.00  0.36           C  
ATOM   3307  CD1 PHE A 405     178.492 153.487 108.257  1.00  0.36           C  
ATOM   3308  CD2 PHE A 405     176.314 153.401 107.212  1.00  0.36           C  
ATOM   3309  CE1 PHE A 405     178.237 152.265 108.891  1.00  0.36           C  
ATOM   3310  CE2 PHE A 405     176.051 152.179 107.845  1.00  0.36           C  
ATOM   3311  CZ  PHE A 405     177.019 151.608 108.679  1.00  0.36           C  
ATOM   3312  N   GLY A 406     179.271 158.403 107.506  1.00  0.33           N  
ATOM   3313  CA  GLY A 406     180.090 159.531 107.088  1.00  0.33           C  
ATOM   3314  C   GLY A 406     181.504 159.348 107.546  1.00  0.33           C  
ATOM   3315  O   GLY A 406     182.319 160.259 107.453  1.00  0.33           O  
ATOM   3316  N   GLU A 407     181.806 158.170 108.137  1.00  0.29           N  
ATOM   3317  CA  GLU A 407     183.136 157.734 108.536  1.00  0.29           C  
ATOM   3318  C   GLU A 407     184.199 158.048 107.474  1.00  0.29           C  
ATOM   3319  O   GLU A 407     184.064 157.706 106.303  1.00  0.29           O  
ATOM   3320  CB  GLU A 407     183.094 156.216 108.902  1.00  0.29           C  
ATOM   3321  CG  GLU A 407     184.319 155.626 109.657  1.00  0.29           C  
ATOM   3322  CD  GLU A 407     184.208 154.131 110.017  1.00  0.29           C  
ATOM   3323  OE1 GLU A 407     183.123 153.506 109.868  1.00  0.29           O  
ATOM   3324  OE2 GLU A 407     185.242 153.564 110.460  1.00  0.29           O  
ATOM   3325  N   LEU A 408     185.304 158.727 107.863  1.00  0.24           N  
ATOM   3326  CA  LEU A 408     186.371 159.151 106.954  1.00  0.24           C  
ATOM   3327  C   LEU A 408     187.204 157.957 106.504  1.00  0.24           C  
ATOM   3328  O   LEU A 408     188.083 158.034 105.645  1.00  0.24           O  
ATOM   3329  CB  LEU A 408     187.327 160.146 107.659  1.00  0.24           C  
ATOM   3330  CG  LEU A 408     186.705 161.496 108.064  1.00  0.24           C  
ATOM   3331  CD1 LEU A 408     187.696 162.287 108.930  1.00  0.24           C  
ATOM   3332  CD2 LEU A 408     186.294 162.327 106.842  1.00  0.24           C  
ATOM   3333  N   PHE A 409     186.935 156.814 107.140  1.00  0.22           N  
ATOM   3334  CA  PHE A 409     187.598 155.555 107.017  1.00  0.22           C  
ATOM   3335  C   PHE A 409     186.683 154.704 106.153  1.00  0.22           C  
ATOM   3336  O   PHE A 409     185.466 154.727 106.301  1.00  0.22           O  
ATOM   3337  CB  PHE A 409     187.781 154.805 108.374  1.00  0.22           C  
ATOM   3338  CG  PHE A 409     188.508 155.530 109.491  1.00  0.22           C  
ATOM   3339  CD1 PHE A 409     188.318 156.883 109.844  1.00  0.22           C  
ATOM   3340  CD2 PHE A 409     189.421 154.776 110.250  1.00  0.22           C  
ATOM   3341  CE1 PHE A 409     189.102 157.491 110.829  1.00  0.22           C  
ATOM   3342  CE2 PHE A 409     190.192 155.371 111.254  1.00  0.22           C  
ATOM   3343  CZ  PHE A 409     190.054 156.737 111.521  1.00  0.22           C  
ATOM   3344  N   GLU A 410     187.240 153.941 105.202  1.00  0.22           N  
ATOM   3345  CA  GLU A 410     186.461 153.190 104.239  1.00  0.22           C  
ATOM   3346  C   GLU A 410     186.498 151.694 104.508  1.00  0.22           C  
ATOM   3347  O   GLU A 410     185.633 150.941 104.070  1.00  0.22           O  
ATOM   3348  CB  GLU A 410     187.120 153.493 102.878  1.00  0.22           C  
ATOM   3349  CG  GLU A 410     188.606 153.049 102.778  1.00  0.22           C  
ATOM   3350  CD  GLU A 410     189.310 153.543 101.536  1.00  0.22           C  
ATOM   3351  OE1 GLU A 410     190.534 153.312 101.390  1.00  0.22           O  
ATOM   3352  OE2 GLU A 410     188.625 154.159 100.698  1.00  0.22           O  
ATOM   3353  N   LYS A 411     187.528 151.242 105.267  1.00  0.26           N  
ATOM   3354  CA  LYS A 411     187.802 149.852 105.629  1.00  0.26           C  
ATOM   3355  C   LYS A 411     188.120 148.981 104.420  1.00  0.26           C  
ATOM   3356  O   LYS A 411     187.984 147.757 104.410  1.00  0.26           O  
ATOM   3357  CB  LYS A 411     186.670 149.252 106.488  1.00  0.26           C  
ATOM   3358  CG  LYS A 411     186.310 150.153 107.675  1.00  0.26           C  
ATOM   3359  CD  LYS A 411     185.098 149.644 108.461  1.00  0.26           C  
ATOM   3360  CE  LYS A 411     184.718 150.639 109.557  1.00  0.26           C  
ATOM   3361  NZ  LYS A 411     183.497 150.211 110.260  1.00  0.26           N  
ATOM   3362  N   ALA A 412     188.578 149.644 103.347  1.00  0.30           N  
ATOM   3363  CA  ALA A 412     188.818 149.071 102.056  1.00  0.30           C  
ATOM   3364  C   ALA A 412     190.044 148.215 102.037  1.00  0.30           C  
ATOM   3365  O   ALA A 412     190.944 148.320 102.870  1.00  0.30           O  
ATOM   3366  CB  ALA A 412     188.935 150.102 100.932  1.00  0.30           C  
ATOM   3367  N   LYS A 413     190.031 147.254 101.095  1.00  0.28           N  
ATOM   3368  CA  LYS A 413     191.040 146.232 100.955  1.00  0.28           C  
ATOM   3369  C   LYS A 413     191.225 145.439 102.240  1.00  0.28           C  
ATOM   3370  O   LYS A 413     192.286 144.899 102.493  1.00  0.28           O  
ATOM   3371  CB  LYS A 413     192.394 146.814 100.485  1.00  0.28           C  
ATOM   3372  CG  LYS A 413     192.346 147.801  99.316  1.00  0.28           C  
ATOM   3373  CD  LYS A 413     191.783 147.300  97.981  1.00  0.28           C  
ATOM   3374  CE  LYS A 413     191.840 148.446  96.962  1.00  0.28           C  
ATOM   3375  NZ  LYS A 413     191.217 148.170  95.655  1.00  0.28           N  
ATOM   3376  N   GLN A 414     190.172 145.377 103.091  1.00  0.37           N  
ATOM   3377  CA  GLN A 414     190.179 144.692 104.369  1.00  0.37           C  
ATOM   3378  C   GLN A 414     191.236 145.221 105.344  1.00  0.37           C  
ATOM   3379  O   GLN A 414     191.795 144.467 106.138  1.00  0.37           O  
ATOM   3380  CB  GLN A 414     190.340 143.174 104.126  1.00  0.37           C  
ATOM   3381  CG  GLN A 414     189.329 142.601 103.100  1.00  0.37           C  
ATOM   3382  CD  GLN A 414     189.584 141.119 102.840  1.00  0.37           C  
ATOM   3383  OE1 GLN A 414     190.118 140.380 103.665  1.00  0.37           O  
ATOM   3384  NE2 GLN A 414     189.202 140.650 101.627  1.00  0.37           N  
ATOM   3385  N   ASN A 415     191.544 146.541 105.286  1.00  0.28           N  
ATOM   3386  CA  ASN A 415     192.628 147.182 106.024  1.00  0.28           C  
ATOM   3387  C   ASN A 415     194.018 146.670 105.596  1.00  0.28           C  
ATOM   3388  O   ASN A 415     194.980 146.695 106.354  1.00  0.28           O  
ATOM   3389  CB  ASN A 415     192.457 147.091 107.567  1.00  0.28           C  
ATOM   3390  CG  ASN A 415     191.105 147.651 108.000  1.00  0.28           C  
ATOM   3391  OD1 ASN A 415     190.687 148.742 107.614  1.00  0.28           O  
ATOM   3392  ND2 ASN A 415     190.382 146.895 108.861  1.00  0.28           N  
ATOM   3393  N   ASN A 416     194.154 146.178 104.341  1.00  0.26           N  
ATOM   3394  CA  ASN A 416     195.391 145.623 103.829  1.00  0.26           C  
ATOM   3395  C   ASN A 416     195.714 146.209 102.453  1.00  0.26           C  
ATOM   3396  O   ASN A 416     195.154 145.835 101.442  1.00  0.26           O  
ATOM   3397  CB  ASN A 416     195.262 144.104 103.553  1.00  0.26           C  
ATOM   3398  CG  ASN A 416     194.864 143.232 104.736  1.00  0.26           C  
ATOM   3399  OD1 ASN A 416     194.030 142.338 104.553  1.00  0.26           O  
ATOM   3400  ND2 ASN A 416     195.515 143.397 105.907  1.00  0.26           N  
ATOM   3401  N   ASN A 417     196.737 147.075 102.379  1.00  0.27           N  
ATOM   3402  CA  ASN A 417     197.214 147.701 101.150  1.00  0.27           C  
ATOM   3403  C   ASN A 417     198.093 146.770 100.318  1.00  0.27           C  
ATOM   3404  O   ASN A 417     198.419 147.019  99.162  1.00  0.27           O  
ATOM   3405  CB  ASN A 417     197.997 148.992 101.509  1.00  0.27           C  
ATOM   3406  CG  ASN A 417     199.267 148.708 102.328  1.00  0.27           C  
ATOM   3407  OD1 ASN A 417     199.271 147.824 103.189  1.00  0.27           O  
ATOM   3408  ND2 ASN A 417     200.361 149.452 102.048  1.00  0.27           N  
ATOM   3409  N   ASN A 418     198.483 145.628 100.906  1.00  0.30           N  
ATOM   3410  CA  ASN A 418     199.231 144.580 100.241  1.00  0.30           C  
ATOM   3411  C   ASN A 418     198.351 143.810  99.264  1.00  0.30           C  
ATOM   3412  O   ASN A 418     198.820 143.186  98.318  1.00  0.30           O  
ATOM   3413  CB  ASN A 418     199.771 143.579 101.289  1.00  0.30           C  
ATOM   3414  CG  ASN A 418     200.714 144.303 102.245  1.00  0.30           C  
ATOM   3415  OD1 ASN A 418     201.474 145.184 101.860  1.00  0.30           O  
ATOM   3416  ND2 ASN A 418     200.678 143.916 103.542  1.00  0.30           N  
ATOM   3417  N   ARG A 419     197.017 143.845  99.468  1.00  0.20           N  
ATOM   3418  CA  ARG A 419     196.069 143.238  98.554  1.00  0.20           C  
ATOM   3419  C   ARG A 419     196.012 143.945  97.213  1.00  0.20           C  
ATOM   3420  O   ARG A 419     195.809 143.326  96.168  1.00  0.20           O  
ATOM   3421  CB  ARG A 419     194.645 143.234  99.152  1.00  0.20           C  
ATOM   3422  CG  ARG A 419     194.485 142.265 100.334  1.00  0.20           C  
ATOM   3423  CD  ARG A 419     193.049 142.206 100.848  1.00  0.20           C  
ATOM   3424  NE  ARG A 419     193.063 141.408 102.108  1.00  0.20           N  
ATOM   3425  CZ  ARG A 419     192.908 140.083 102.182  1.00  0.20           C  
ATOM   3426  NH1 ARG A 419     192.960 139.511 103.380  1.00  0.20           N  
ATOM   3427  NH2 ARG A 419     192.705 139.329 101.105  1.00  0.20           N  
ATOM   3428  N   LYS A 420     196.124 145.284  97.232  1.00  0.27           N  
ATOM   3429  CA  LYS A 420     196.124 146.087  96.037  1.00  0.27           C  
ATOM   3430  C   LYS A 420     196.958 147.324  96.265  1.00  0.27           C  
ATOM   3431  O   LYS A 420     196.673 148.113  97.160  1.00  0.27           O  
ATOM   3432  CB  LYS A 420     194.703 146.600  95.701  1.00  0.27           C  
ATOM   3433  CG  LYS A 420     193.669 145.521  95.354  1.00  0.27           C  
ATOM   3434  CD  LYS A 420     193.913 144.861  93.993  1.00  0.27           C  
ATOM   3435  CE  LYS A 420     192.896 143.757  93.702  1.00  0.27           C  
ATOM   3436  NZ  LYS A 420     193.203 143.118  92.408  1.00  0.27           N  
ATOM   3437  N   THR A 421     197.914 147.608  95.367  1.00  0.30           N  
ATOM   3438  CA  THR A 421     198.806 148.758  95.473  1.00  0.30           C  
ATOM   3439  C   THR A 421     198.140 150.011  94.932  1.00  0.30           C  
ATOM   3440  O   THR A 421     198.692 151.106  94.927  1.00  0.30           O  
ATOM   3441  CB  THR A 421     200.070 148.527  94.663  1.00  0.30           C  
ATOM   3442  OG1 THR A 421     199.753 148.158  93.322  1.00  0.30           O  
ATOM   3443  CG2 THR A 421     200.849 147.352  95.270  1.00  0.30           C  
ATOM   3444  N   SER A 422     196.871 149.856  94.512  1.00  0.27           N  
ATOM   3445  CA  SER A 422     195.988 150.911  94.065  1.00  0.27           C  
ATOM   3446  C   SER A 422     195.158 151.462  95.211  1.00  0.27           C  
ATOM   3447  O   SER A 422     194.297 152.314  95.017  1.00  0.27           O  
ATOM   3448  CB  SER A 422     195.035 150.430  92.937  1.00  0.27           C  
ATOM   3449  OG  SER A 422     194.153 149.364  93.330  1.00  0.27           O  
ATOM   3450  N   ASN A 423     195.420 151.010  96.452  1.00  0.24           N  
ATOM   3451  CA  ASN A 423     194.946 151.656  97.654  1.00  0.24           C  
ATOM   3452  C   ASN A 423     196.154 151.840  98.563  1.00  0.24           C  
ATOM   3453  O   ASN A 423     196.857 150.880  98.869  1.00  0.24           O  
ATOM   3454  CB  ASN A 423     193.826 150.788  98.276  1.00  0.24           C  
ATOM   3455  CG  ASN A 423     193.209 151.224  99.597  1.00  0.24           C  
ATOM   3456  OD1 ASN A 423     193.308 150.466 100.576  1.00  0.24           O  
ATOM   3457  ND2 ASN A 423     192.507 152.359  99.640  1.00  0.24           N  
ATOM   3458  N   GLY A 424     196.449 153.093  98.981  1.00  0.24           N  
ATOM   3459  CA  GLY A 424     197.353 153.377 100.098  1.00  0.24           C  
ATOM   3460  C   GLY A 424     196.794 152.881 101.409  1.00  0.24           C  
ATOM   3461  O   GLY A 424     195.585 152.791 101.584  1.00  0.24           O  
ATOM   3462  N   ASP A 425     197.650 152.605 102.394  1.00  0.25           N  
ATOM   3463  CA  ASP A 425     197.286 152.332 103.770  1.00  0.25           C  
ATOM   3464  C   ASP A 425     197.386 153.642 104.572  1.00  0.25           C  
ATOM   3465  O   ASP A 425     196.846 153.754 105.670  1.00  0.25           O  
ATOM   3466  CB  ASP A 425     198.200 151.254 104.412  1.00  0.25           C  
ATOM   3467  CG  ASP A 425     199.673 151.499 104.116  1.00  0.25           C  
ATOM   3468  OD1 ASP A 425     200.041 152.158 103.106  1.00  0.25           O  
ATOM   3469  OD2 ASP A 425     200.506 150.960 104.878  1.00  0.25           O  
ATOM   3470  N   ASP A 426     198.032 154.678 103.980  1.00  0.34           N  
ATOM   3471  CA  ASP A 426     198.238 156.015 104.514  1.00  0.34           C  
ATOM   3472  C   ASP A 426     196.940 156.812 104.579  1.00  0.34           C  
ATOM   3473  O   ASP A 426     196.238 156.899 105.586  1.00  0.34           O  
ATOM   3474  CB  ASP A 426     199.170 156.806 103.556  1.00  0.34           C  
ATOM   3475  CG  ASP A 426     200.617 156.376 103.645  1.00  0.34           C  
ATOM   3476  OD1 ASP A 426     201.107 156.133 104.772  1.00  0.34           O  
ATOM   3477  OD2 ASP A 426     201.262 156.392 102.564  1.00  0.34           O  
ATOM   3478  N   SER A 427     196.599 157.470 103.453  1.00  0.20           N  
ATOM   3479  CA  SER A 427     195.310 158.097 103.255  1.00  0.20           C  
ATOM   3480  C   SER A 427     194.201 157.069 103.194  1.00  0.20           C  
ATOM   3481  O   SER A 427     194.263 156.096 102.446  1.00  0.20           O  
ATOM   3482  CB  SER A 427     195.265 158.966 101.977  1.00  0.20           C  
ATOM   3483  OG  SER A 427     194.154 159.863 101.993  1.00  0.20           O  
ATOM   3484  N   LEU A 428     193.139 157.296 103.978  1.00  0.21           N  
ATOM   3485  CA  LEU A 428     191.925 156.517 103.944  1.00  0.21           C  
ATOM   3486  C   LEU A 428     191.019 157.120 102.894  1.00  0.21           C  
ATOM   3487  O   LEU A 428     191.454 157.985 102.139  1.00  0.21           O  
ATOM   3488  CB  LEU A 428     191.210 156.478 105.310  1.00  0.21           C  
ATOM   3489  CG  LEU A 428     192.100 156.104 106.514  1.00  0.21           C  
ATOM   3490  CD1 LEU A 428     191.292 156.298 107.798  1.00  0.21           C  
ATOM   3491  CD2 LEU A 428     192.642 154.670 106.429  1.00  0.21           C  
ATOM   3492  N   PHE A 429     189.776 156.614 102.742  1.00  0.23           N  
ATOM   3493  CA  PHE A 429     188.800 157.051 101.737  1.00  0.23           C  
ATOM   3494  C   PHE A 429     189.324 156.994 100.291  1.00  0.23           C  
ATOM   3495  O   PHE A 429     188.747 157.545  99.352  1.00  0.23           O  
ATOM   3496  CB  PHE A 429     188.059 158.388 102.088  1.00  0.23           C  
ATOM   3497  CG  PHE A 429     188.851 159.653 101.813  1.00  0.23           C  
ATOM   3498  CD1 PHE A 429     189.751 160.205 102.745  1.00  0.23           C  
ATOM   3499  CD2 PHE A 429     188.738 160.265 100.552  1.00  0.23           C  
ATOM   3500  CE1 PHE A 429     190.645 161.215 102.352  1.00  0.23           C  
ATOM   3501  CE2 PHE A 429     189.596 161.301 100.171  1.00  0.23           C  
ATOM   3502  CZ  PHE A 429     190.578 161.749 101.059  1.00  0.23           C  
ATOM   3503  N   PHE A 430     190.439 156.286 100.080  1.00  0.18           N  
ATOM   3504  CA  PHE A 430     191.225 156.255  98.885  1.00  0.18           C  
ATOM   3505  C   PHE A 430     190.651 155.284  97.843  1.00  0.18           C  
ATOM   3506  O   PHE A 430     190.847 155.427  96.640  1.00  0.18           O  
ATOM   3507  CB  PHE A 430     192.634 155.869  99.381  1.00  0.18           C  
ATOM   3508  CG  PHE A 430     193.680 156.126  98.355  1.00  0.18           C  
ATOM   3509  CD1 PHE A 430     193.968 155.195  97.349  1.00  0.18           C  
ATOM   3510  CD2 PHE A 430     194.373 157.342  98.384  1.00  0.18           C  
ATOM   3511  CE1 PHE A 430     194.970 155.457  96.407  1.00  0.18           C  
ATOM   3512  CE2 PHE A 430     195.350 157.627  97.427  1.00  0.18           C  
ATOM   3513  CZ  PHE A 430     195.660 156.676  96.446  1.00  0.18           C  
ATOM   3514  N   SER A 431     189.855 154.297  98.302  1.00  0.24           N  
ATOM   3515  CA  SER A 431     188.998 153.424  97.510  1.00  0.24           C  
ATOM   3516  C   SER A 431     187.575 153.974  97.513  1.00  0.24           C  
ATOM   3517  O   SER A 431     186.677 153.368  96.929  1.00  0.24           O  
ATOM   3518  CB  SER A 431     188.873 152.013  98.157  1.00  0.24           C  
ATOM   3519  OG  SER A 431     190.082 151.245  98.093  1.00  0.24           O  
ATOM   3520  N   ASN A 432     187.366 155.145  98.158  1.00  0.27           N  
ATOM   3521  CA  ASN A 432     186.100 155.799  98.453  1.00  0.27           C  
ATOM   3522  C   ASN A 432     185.327 155.208  99.642  1.00  0.27           C  
ATOM   3523  O   ASN A 432     185.225 154.000  99.845  1.00  0.27           O  
ATOM   3524  CB  ASN A 432     185.155 155.927  97.233  1.00  0.27           C  
ATOM   3525  CG  ASN A 432     185.891 156.579  96.069  1.00  0.27           C  
ATOM   3526  OD1 ASN A 432     186.264 157.749  96.137  1.00  0.27           O  
ATOM   3527  ND2 ASN A 432     186.085 155.830  94.958  1.00  0.27           N  
ATOM   3528  N   PHE A 433     184.651 156.073 100.440  1.00  0.25           N  
ATOM   3529  CA  PHE A 433     183.797 155.647 101.550  1.00  0.25           C  
ATOM   3530  C   PHE A 433     182.370 155.365 101.069  1.00  0.25           C  
ATOM   3531  O   PHE A 433     181.418 155.251 101.835  1.00  0.25           O  
ATOM   3532  CB  PHE A 433     183.788 156.647 102.748  1.00  0.25           C  
ATOM   3533  CG  PHE A 433     183.334 158.032 102.373  1.00  0.25           C  
ATOM   3534  CD1 PHE A 433     184.282 158.995 102.012  1.00  0.25           C  
ATOM   3535  CD2 PHE A 433     181.975 158.390 102.384  1.00  0.25           C  
ATOM   3536  CE1 PHE A 433     183.894 160.268 101.587  1.00  0.25           C  
ATOM   3537  CE2 PHE A 433     181.576 159.670 101.975  1.00  0.25           C  
ATOM   3538  CZ  PHE A 433     182.536 160.601 101.557  1.00  0.25           C  
ATOM   3539  N   SER A 434     182.195 155.178  99.746  1.00  0.36           N  
ATOM   3540  CA  SER A 434     180.919 154.936  99.092  1.00  0.36           C  
ATOM   3541  C   SER A 434     180.589 153.452  99.098  1.00  0.36           C  
ATOM   3542  O   SER A 434     179.565 153.017  98.581  1.00  0.36           O  
ATOM   3543  CB  SER A 434     180.935 155.445  97.626  1.00  0.36           C  
ATOM   3544  OG  SER A 434     182.017 154.880  96.881  1.00  0.36           O  
ATOM   3545  N   LEU A 435     181.447 152.668  99.777  1.00  0.36           N  
ATOM   3546  CA  LEU A 435     181.303 151.264 100.097  1.00  0.36           C  
ATOM   3547  C   LEU A 435     180.690 151.071 101.474  1.00  0.36           C  
ATOM   3548  O   LEU A 435     180.689 149.977 102.031  1.00  0.36           O  
ATOM   3549  CB  LEU A 435     182.686 150.582 100.126  1.00  0.36           C  
ATOM   3550  CG  LEU A 435     183.493 150.687  98.822  1.00  0.36           C  
ATOM   3551  CD1 LEU A 435     184.874 150.051  99.034  1.00  0.36           C  
ATOM   3552  CD2 LEU A 435     182.752 150.038  97.646  1.00  0.36           C  
ATOM   3553  N   LEU A 436     180.107 152.142 102.050  1.00  0.32           N  
ATOM   3554  CA  LEU A 436     179.328 152.091 103.275  1.00  0.32           C  
ATOM   3555  C   LEU A 436     178.129 151.158 103.159  1.00  0.32           C  
ATOM   3556  O   LEU A 436     177.653 150.575 104.129  1.00  0.32           O  
ATOM   3557  CB  LEU A 436     178.906 153.521 103.690  1.00  0.32           C  
ATOM   3558  CG  LEU A 436     177.747 154.186 102.919  1.00  0.32           C  
ATOM   3559  CD1 LEU A 436     176.374 153.803 103.492  1.00  0.32           C  
ATOM   3560  CD2 LEU A 436     177.913 155.709 102.940  1.00  0.32           C  
ATOM   3561  N   GLY A 437     177.609 151.026 101.926  1.00  0.50           N  
ATOM   3562  CA  GLY A 437     176.458 150.222 101.604  1.00  0.50           C  
ATOM   3563  C   GLY A 437     175.928 150.709 100.293  1.00  0.50           C  
ATOM   3564  O   GLY A 437     176.639 151.317  99.496  1.00  0.50           O  
ATOM   3565  N   THR A 438     174.640 150.469 100.036  1.00  0.60           N  
ATOM   3566  CA  THR A 438     173.990 150.844  98.788  1.00  0.60           C  
ATOM   3567  C   THR A 438     173.343 152.211  98.958  1.00  0.60           C  
ATOM   3568  O   THR A 438     172.530 152.367  99.872  1.00  0.60           O  
ATOM   3569  CB  THR A 438     172.919 149.826  98.404  1.00  0.60           C  
ATOM   3570  OG1 THR A 438     173.519 148.557  98.180  1.00  0.60           O  
ATOM   3571  CG2 THR A 438     172.181 150.189  97.110  1.00  0.60           C  
ATOM   3572  N   PRO A 439     173.623 153.254  98.173  1.00  0.66           N  
ATOM   3573  CA  PRO A 439     172.881 154.505  98.259  1.00  0.66           C  
ATOM   3574  C   PRO A 439     171.489 154.363  97.686  1.00  0.66           C  
ATOM   3575  O   PRO A 439     171.289 153.690  96.680  1.00  0.66           O  
ATOM   3576  CB  PRO A 439     173.723 155.497  97.446  1.00  0.66           C  
ATOM   3577  CG  PRO A 439     174.428 154.615  96.417  1.00  0.66           C  
ATOM   3578  CD  PRO A 439     174.692 153.313  97.174  1.00  0.66           C  
ATOM   3579  N   VAL A 440     170.501 154.986  98.345  1.00  0.76           N  
ATOM   3580  CA  VAL A 440     169.105 154.940  97.946  1.00  0.76           C  
ATOM   3581  C   VAL A 440     168.853 155.826  96.742  1.00  0.76           C  
ATOM   3582  O   VAL A 440     168.045 155.529  95.867  1.00  0.76           O  
ATOM   3583  CB  VAL A 440     168.198 155.380  99.088  1.00  0.76           C  
ATOM   3584  CG1 VAL A 440     166.726 155.126  98.719  1.00  0.76           C  
ATOM   3585  CG2 VAL A 440     168.562 154.600 100.364  1.00  0.76           C  
ATOM   3586  N   LEU A 441     169.570 156.959  96.699  1.00  0.77           N  
ATOM   3587  CA  LEU A 441     169.543 157.902  95.610  1.00  0.77           C  
ATOM   3588  C   LEU A 441     170.954 158.369  95.415  1.00  0.77           C  
ATOM   3589  O   LEU A 441     171.710 158.470  96.383  1.00  0.77           O  
ATOM   3590  CB  LEU A 441     168.716 159.173  95.917  1.00  0.77           C  
ATOM   3591  CG  LEU A 441     167.214 158.935  96.124  1.00  0.77           C  
ATOM   3592  CD1 LEU A 441     166.548 160.229  96.603  1.00  0.77           C  
ATOM   3593  CD2 LEU A 441     166.535 158.408  94.855  1.00  0.77           C  
ATOM   3594  N   LYS A 442     171.330 158.675  94.169  1.00  0.72           N  
ATOM   3595  CA  LYS A 442     172.615 159.261  93.874  1.00  0.72           C  
ATOM   3596  C   LYS A 442     172.501 160.193  92.692  1.00  0.72           C  
ATOM   3597  O   LYS A 442     171.753 159.930  91.750  1.00  0.72           O  
ATOM   3598  CB  LYS A 442     173.678 158.182  93.585  1.00  0.72           C  
ATOM   3599  CG  LYS A 442     173.195 157.087  92.622  1.00  0.72           C  
ATOM   3600  CD  LYS A 442     174.348 156.298  91.992  1.00  0.72           C  
ATOM   3601  CE  LYS A 442     175.324 155.727  93.012  1.00  0.72           C  
ATOM   3602  NZ  LYS A 442     176.413 155.029  92.301  1.00  0.72           N  
ATOM   3603  N   ASP A 443     173.229 161.326  92.747  1.00  0.75           N  
ATOM   3604  CA  ASP A 443     173.412 162.291  91.676  1.00  0.75           C  
ATOM   3605  C   ASP A 443     172.111 162.820  91.062  1.00  0.75           C  
ATOM   3606  O   ASP A 443     172.039 163.216  89.899  1.00  0.75           O  
ATOM   3607  CB  ASP A 443     174.410 161.749  90.616  1.00  0.75           C  
ATOM   3608  CG  ASP A 443     175.755 161.395  91.241  1.00  0.75           C  
ATOM   3609  OD1 ASP A 443     176.007 161.805  92.401  1.00  0.75           O  
ATOM   3610  OD2 ASP A 443     176.539 160.683  90.561  1.00  0.75           O  
ATOM   3611  N   ILE A 444     171.026 162.895  91.865  1.00  0.79           N  
ATOM   3612  CA  ILE A 444     169.714 163.284  91.374  1.00  0.79           C  
ATOM   3613  C   ILE A 444     169.649 164.790  91.271  1.00  0.79           C  
ATOM   3614  O   ILE A 444     169.923 165.518  92.227  1.00  0.79           O  
ATOM   3615  CB  ILE A 444     168.559 162.758  92.230  1.00  0.79           C  
ATOM   3616  CG1 ILE A 444     168.592 161.216  92.345  1.00  0.79           C  
ATOM   3617  CG2 ILE A 444     167.190 163.238  91.691  1.00  0.79           C  
ATOM   3618  CD1 ILE A 444     168.423 160.452  91.027  1.00  0.79           C  
ATOM   3619  N   ASN A 445     169.292 165.295  90.079  1.00  0.78           N  
ATOM   3620  CA  ASN A 445     169.205 166.705  89.824  1.00  0.78           C  
ATOM   3621  C   ASN A 445     168.050 166.955  88.879  1.00  0.78           C  
ATOM   3622  O   ASN A 445     167.750 166.136  88.013  1.00  0.78           O  
ATOM   3623  CB  ASN A 445     170.542 167.313  89.307  1.00  0.78           C  
ATOM   3624  CG  ASN A 445     171.078 166.637  88.047  1.00  0.78           C  
ATOM   3625  OD1 ASN A 445     170.700 166.994  86.933  1.00  0.78           O  
ATOM   3626  ND2 ASN A 445     172.001 165.664  88.207  1.00  0.78           N  
ATOM   3627  N   PHE A 446     167.341 168.075  89.086  1.00  0.79           N  
ATOM   3628  CA  PHE A 446     166.296 168.537  88.202  1.00  0.79           C  
ATOM   3629  C   PHE A 446     165.996 169.976  88.551  1.00  0.79           C  
ATOM   3630  O   PHE A 446     166.449 170.501  89.571  1.00  0.79           O  
ATOM   3631  CB  PHE A 446     165.002 167.669  88.168  1.00  0.79           C  
ATOM   3632  CG  PHE A 446     164.385 167.449  89.514  1.00  0.79           C  
ATOM   3633  CD1 PHE A 446     163.514 168.401  90.068  1.00  0.79           C  
ATOM   3634  CD2 PHE A 446     164.653 166.269  90.222  1.00  0.79           C  
ATOM   3635  CE1 PHE A 446     162.946 168.195  91.330  1.00  0.79           C  
ATOM   3636  CE2 PHE A 446     164.074 166.051  91.474  1.00  0.79           C  
ATOM   3637  CZ  PHE A 446     163.230 167.019  92.034  1.00  0.79           C  
ATOM   3638  N   LYS A 447     165.206 170.648  87.706  1.00  0.77           N  
ATOM   3639  CA  LYS A 447     164.718 171.972  87.987  1.00  0.77           C  
ATOM   3640  C   LYS A 447     163.322 172.044  87.437  1.00  0.77           C  
ATOM   3641  O   LYS A 447     163.071 171.570  86.331  1.00  0.77           O  
ATOM   3642  CB  LYS A 447     165.587 173.055  87.328  1.00  0.77           C  
ATOM   3643  CG  LYS A 447     165.085 174.474  87.593  1.00  0.77           C  
ATOM   3644  CD  LYS A 447     166.018 175.522  86.992  1.00  0.77           C  
ATOM   3645  CE  LYS A 447     167.368 175.627  87.667  1.00  0.77           C  
ATOM   3646  NZ  LYS A 447     168.026 176.826  87.129  1.00  0.77           N  
ATOM   3647  N   ILE A 448     162.383 172.581  88.234  1.00  0.79           N  
ATOM   3648  CA  ILE A 448     160.998 172.740  87.843  1.00  0.79           C  
ATOM   3649  C   ILE A 448     160.585 174.161  88.140  1.00  0.79           C  
ATOM   3650  O   ILE A 448     160.450 174.578  89.295  1.00  0.79           O  
ATOM   3651  CB  ILE A 448     160.097 171.749  88.579  1.00  0.79           C  
ATOM   3652  CG1 ILE A 448     160.413 170.297  88.162  1.00  0.79           C  
ATOM   3653  CG2 ILE A 448     158.591 172.054  88.424  1.00  0.79           C  
ATOM   3654  CD1 ILE A 448     160.176 170.002  86.677  1.00  0.79           C  
ATOM   3655  N   GLU A 449     160.360 174.923  87.065  1.00  0.74           N  
ATOM   3656  CA  GLU A 449     159.841 176.263  87.025  1.00  0.74           C  
ATOM   3657  C   GLU A 449     158.371 176.354  87.447  1.00  0.74           C  
ATOM   3658  O   GLU A 449     157.635 175.368  87.555  1.00  0.74           O  
ATOM   3659  CB  GLU A 449     160.030 176.842  85.600  1.00  0.74           C  
ATOM   3660  CG  GLU A 449     161.503 176.824  85.072  1.00  0.74           C  
ATOM   3661  CD  GLU A 449     162.083 175.469  84.629  1.00  0.74           C  
ATOM   3662  OE1 GLU A 449     161.320 174.463  84.587  1.00  0.74           O  
ATOM   3663  OE2 GLU A 449     163.308 175.382  84.357  1.00  0.74           O  
ATOM   3664  N   ARG A 450     157.897 177.580  87.733  1.00  0.69           N  
ATOM   3665  CA  ARG A 450     156.547 177.857  88.192  1.00  0.69           C  
ATOM   3666  C   ARG A 450     155.407 177.390  87.274  1.00  0.69           C  
ATOM   3667  O   ARG A 450     155.335 177.738  86.100  1.00  0.69           O  
ATOM   3668  CB  ARG A 450     156.407 179.373  88.446  1.00  0.69           C  
ATOM   3669  CG  ARG A 450     155.073 179.777  89.100  1.00  0.69           C  
ATOM   3670  CD  ARG A 450     155.018 181.244  89.521  1.00  0.69           C  
ATOM   3671  NE  ARG A 450     155.060 182.064  88.267  1.00  0.69           N  
ATOM   3672  CZ  ARG A 450     153.990 182.611  87.675  1.00  0.69           C  
ATOM   3673  NH1 ARG A 450     152.758 182.451  88.150  1.00  0.69           N  
ATOM   3674  NH2 ARG A 450     154.165 183.334  86.571  1.00  0.69           N  
ATOM   3675  N   GLY A 451     154.453 176.600  87.824  1.00  0.80           N  
ATOM   3676  CA  GLY A 451     153.280 176.075  87.121  1.00  0.80           C  
ATOM   3677  C   GLY A 451     153.488 174.764  86.406  1.00  0.80           C  
ATOM   3678  O   GLY A 451     152.530 174.141  85.951  1.00  0.80           O  
ATOM   3679  N   GLN A 452     154.739 174.282  86.315  1.00  0.77           N  
ATOM   3680  CA  GLN A 452     155.055 173.082  85.562  1.00  0.77           C  
ATOM   3681  C   GLN A 452     154.745 171.785  86.310  1.00  0.77           C  
ATOM   3682  O   GLN A 452     154.691 171.719  87.542  1.00  0.77           O  
ATOM   3683  CB  GLN A 452     156.526 173.080  85.070  1.00  0.77           C  
ATOM   3684  CG  GLN A 452     156.829 174.250  84.100  1.00  0.77           C  
ATOM   3685  CD  GLN A 452     158.186 174.192  83.385  1.00  0.77           C  
ATOM   3686  OE1 GLN A 452     158.448 175.000  82.495  1.00  0.77           O  
ATOM   3687  NE2 GLN A 452     159.077 173.266  83.800  1.00  0.77           N  
ATOM   3688  N   LEU A 453     154.531 170.704  85.543  1.00  0.81           N  
ATOM   3689  CA  LEU A 453     154.286 169.360  86.013  1.00  0.81           C  
ATOM   3690  C   LEU A 453     155.485 168.472  85.702  1.00  0.81           C  
ATOM   3691  O   LEU A 453     155.984 168.382  84.580  1.00  0.81           O  
ATOM   3692  CB  LEU A 453     152.997 168.790  85.358  1.00  0.81           C  
ATOM   3693  CG  LEU A 453     152.726 167.274  85.503  1.00  0.81           C  
ATOM   3694  CD1 LEU A 453     152.569 166.794  86.947  1.00  0.81           C  
ATOM   3695  CD2 LEU A 453     151.469 166.885  84.716  1.00  0.81           C  
ATOM   3696  N   LEU A 454     155.976 167.760  86.731  1.00  0.84           N  
ATOM   3697  CA  LEU A 454     157.032 166.777  86.594  1.00  0.84           C  
ATOM   3698  C   LEU A 454     156.455 165.387  86.794  1.00  0.84           C  
ATOM   3699  O   LEU A 454     155.789 165.098  87.791  1.00  0.84           O  
ATOM   3700  CB  LEU A 454     158.142 167.026  87.644  1.00  0.84           C  
ATOM   3701  CG  LEU A 454     159.321 166.026  87.674  1.00  0.84           C  
ATOM   3702  CD1 LEU A 454     160.136 165.995  86.377  1.00  0.84           C  
ATOM   3703  CD2 LEU A 454     160.245 166.327  88.861  1.00  0.84           C  
ATOM   3704  N   ALA A 455     156.710 164.479  85.835  1.00  0.87           N  
ATOM   3705  CA  ALA A 455     156.360 163.082  85.957  1.00  0.87           C  
ATOM   3706  C   ALA A 455     157.551 162.271  86.452  1.00  0.87           C  
ATOM   3707  O   ALA A 455     158.664 162.388  85.938  1.00  0.87           O  
ATOM   3708  CB  ALA A 455     155.886 162.528  84.601  1.00  0.87           C  
ATOM   3709  N   VAL A 456     157.332 161.419  87.470  1.00  0.86           N  
ATOM   3710  CA  VAL A 456     158.352 160.540  88.019  1.00  0.86           C  
ATOM   3711  C   VAL A 456     157.966 159.103  87.714  1.00  0.86           C  
ATOM   3712  O   VAL A 456     156.901 158.619  88.105  1.00  0.86           O  
ATOM   3713  CB  VAL A 456     158.530 160.717  89.526  1.00  0.86           C  
ATOM   3714  CG1 VAL A 456     159.575 159.737  90.096  1.00  0.86           C  
ATOM   3715  CG2 VAL A 456     158.960 162.164  89.825  1.00  0.86           C  
ATOM   3716  N   ALA A 457     158.853 158.385  87.002  1.00  0.85           N  
ATOM   3717  CA  ALA A 457     158.643 157.034  86.538  1.00  0.85           C  
ATOM   3718  C   ALA A 457     159.790 156.146  86.993  1.00  0.85           C  
ATOM   3719  O   ALA A 457     160.816 156.607  87.493  1.00  0.85           O  
ATOM   3720  CB  ALA A 457     158.583 157.017  84.999  1.00  0.85           C  
ATOM   3721  N   GLY A 458     159.633 154.817  86.860  1.00  0.83           N  
ATOM   3722  CA  GLY A 458     160.633 153.860  87.312  1.00  0.83           C  
ATOM   3723  C   GLY A 458     159.984 152.625  87.852  1.00  0.83           C  
ATOM   3724  O   GLY A 458     158.779 152.587  88.087  1.00  0.83           O  
ATOM   3725  N   SER A 459     160.784 151.577  88.064  1.00  0.79           N  
ATOM   3726  CA  SER A 459     160.327 150.268  88.505  1.00  0.79           C  
ATOM   3727  C   SER A 459     160.026 150.188  90.002  1.00  0.79           C  
ATOM   3728  O   SER A 459     160.255 151.122  90.780  1.00  0.79           O  
ATOM   3729  CB  SER A 459     161.375 149.183  88.157  1.00  0.79           C  
ATOM   3730  OG  SER A 459     161.697 149.240  86.768  1.00  0.79           O  
ATOM   3731  N   THR A 460     159.477 149.048  90.482  1.00  0.77           N  
ATOM   3732  CA  THR A 460     159.298 148.775  91.914  1.00  0.77           C  
ATOM   3733  C   THR A 460     160.600 148.841  92.697  1.00  0.77           C  
ATOM   3734  O   THR A 460     161.571 148.157  92.398  1.00  0.77           O  
ATOM   3735  CB  THR A 460     158.661 147.412  92.191  1.00  0.77           C  
ATOM   3736  OG1 THR A 460     157.317 147.400  91.739  1.00  0.77           O  
ATOM   3737  CG2 THR A 460     158.570 147.080  93.688  1.00  0.77           C  
ATOM   3738  N   GLY A 461     160.651 149.672  93.763  1.00  0.80           N  
ATOM   3739  CA  GLY A 461     161.858 149.829  94.571  1.00  0.80           C  
ATOM   3740  C   GLY A 461     162.873 150.817  94.055  1.00  0.80           C  
ATOM   3741  O   GLY A 461     163.924 150.985  94.656  1.00  0.80           O  
ATOM   3742  N   ALA A 462     162.574 151.563  92.973  1.00  0.82           N  
ATOM   3743  CA  ALA A 462     163.550 152.427  92.324  1.00  0.82           C  
ATOM   3744  C   ALA A 462     163.815 153.763  93.024  1.00  0.82           C  
ATOM   3745  O   ALA A 462     164.576 154.593  92.535  1.00  0.82           O  
ATOM   3746  CB  ALA A 462     163.038 152.740  90.906  1.00  0.82           C  
ATOM   3747  N   GLY A 463     163.197 153.996  94.203  1.00  0.84           N  
ATOM   3748  CA  GLY A 463     163.448 155.180  95.022  1.00  0.84           C  
ATOM   3749  C   GLY A 463     162.498 156.329  94.814  1.00  0.84           C  
ATOM   3750  O   GLY A 463     162.708 157.409  95.352  1.00  0.84           O  
ATOM   3751  N   LYS A 464     161.399 156.132  94.057  1.00  0.81           N  
ATOM   3752  CA  LYS A 464     160.410 157.168  93.759  1.00  0.81           C  
ATOM   3753  C   LYS A 464     159.727 157.776  94.992  1.00  0.81           C  
ATOM   3754  O   LYS A 464     159.668 158.993  95.138  1.00  0.81           O  
ATOM   3755  CB  LYS A 464     159.305 156.605  92.822  1.00  0.81           C  
ATOM   3756  CG  LYS A 464     159.847 156.028  91.503  1.00  0.81           C  
ATOM   3757  CD  LYS A 464     158.790 155.432  90.551  1.00  0.81           C  
ATOM   3758  CE  LYS A 464     158.308 154.012  90.871  1.00  0.81           C  
ATOM   3759  NZ  LYS A 464     157.315 154.012  91.963  1.00  0.81           N  
ATOM   3760  N   THR A 465     159.262 156.935  95.948  1.00  0.81           N  
ATOM   3761  CA  THR A 465     158.732 157.372  97.251  1.00  0.81           C  
ATOM   3762  C   THR A 465     159.773 158.122  98.066  1.00  0.81           C  
ATOM   3763  O   THR A 465     159.539 159.189  98.631  1.00  0.81           O  
ATOM   3764  CB  THR A 465     158.327 156.205  98.147  1.00  0.81           C  
ATOM   3765  OG1 THR A 465     157.411 155.359  97.471  1.00  0.81           O  
ATOM   3766  CG2 THR A 465     157.566 156.668  99.377  1.00  0.81           C  
ATOM   3767  N   SER A 466     161.007 157.570  98.108  1.00  0.83           N  
ATOM   3768  CA  SER A 466     162.153 158.125  98.818  1.00  0.83           C  
ATOM   3769  C   SER A 466     162.543 159.498  98.313  1.00  0.83           C  
ATOM   3770  O   SER A 466     162.871 160.382  99.096  1.00  0.83           O  
ATOM   3771  CB  SER A 466     163.423 157.235  98.754  1.00  0.83           C  
ATOM   3772  OG  SER A 466     163.178 155.922  99.260  1.00  0.83           O  
ATOM   3773  N   LEU A 467     162.470 159.733  96.986  1.00  0.82           N  
ATOM   3774  CA  LEU A 467     162.698 161.030  96.367  1.00  0.82           C  
ATOM   3775  C   LEU A 467     161.807 162.132  96.941  1.00  0.82           C  
ATOM   3776  O   LEU A 467     162.278 163.206  97.312  1.00  0.82           O  
ATOM   3777  CB  LEU A 467     162.483 160.907  94.831  1.00  0.82           C  
ATOM   3778  CG  LEU A 467     162.619 162.207  94.009  1.00  0.82           C  
ATOM   3779  CD1 LEU A 467     163.977 162.875  94.227  1.00  0.82           C  
ATOM   3780  CD2 LEU A 467     162.387 161.957  92.511  1.00  0.82           C  
ATOM   3781  N   LEU A 468     160.500 161.858  97.105  1.00  0.83           N  
ATOM   3782  CA  LEU A 468     159.557 162.777  97.721  1.00  0.83           C  
ATOM   3783  C   LEU A 468     159.843 163.076  99.193  1.00  0.83           C  
ATOM   3784  O   LEU A 468     159.753 164.220  99.637  1.00  0.83           O  
ATOM   3785  CB  LEU A 468     158.106 162.276  97.533  1.00  0.83           C  
ATOM   3786  CG  LEU A 468     157.695 162.052  96.060  1.00  0.83           C  
ATOM   3787  CD1 LEU A 468     156.228 161.623  95.980  1.00  0.83           C  
ATOM   3788  CD2 LEU A 468     157.915 163.288  95.182  1.00  0.83           C  
ATOM   3789  N   MET A 469     160.257 162.058  99.979  1.00  0.80           N  
ATOM   3790  CA  MET A 469     160.667 162.209 101.372  1.00  0.80           C  
ATOM   3791  C   MET A 469     161.848 163.147 101.563  1.00  0.80           C  
ATOM   3792  O   MET A 469     161.872 163.972 102.477  1.00  0.80           O  
ATOM   3793  CB  MET A 469     161.039 160.838 101.986  1.00  0.80           C  
ATOM   3794  CG  MET A 469     159.849 159.875 102.138  1.00  0.80           C  
ATOM   3795  SD  MET A 469     158.610 160.450 103.335  1.00  0.80           S  
ATOM   3796  CE  MET A 469     157.382 161.038 102.137  1.00  0.80           C  
ATOM   3797  N   VAL A 470     162.853 163.068 100.673  1.00  0.82           N  
ATOM   3798  CA  VAL A 470     163.981 163.986 100.668  1.00  0.82           C  
ATOM   3799  C   VAL A 470     163.557 165.443 100.423  1.00  0.82           C  
ATOM   3800  O   VAL A 470     163.982 166.354 101.131  1.00  0.82           O  
ATOM   3801  CB  VAL A 470     165.042 163.543  99.663  1.00  0.82           C  
ATOM   3802  CG1 VAL A 470     166.249 164.476  99.738  1.00  0.82           C  
ATOM   3803  CG2 VAL A 470     165.566 162.137  99.986  1.00  0.82           C  
ATOM   3804  N   ILE A 471     162.647 165.700  99.454  1.00  0.80           N  
ATOM   3805  CA  ILE A 471     162.113 167.033  99.140  1.00  0.80           C  
ATOM   3806  C   ILE A 471     161.375 167.676 100.308  1.00  0.80           C  
ATOM   3807  O   ILE A 471     161.519 168.870 100.574  1.00  0.80           O  
ATOM   3808  CB  ILE A 471     161.201 167.005  97.908  1.00  0.80           C  
ATOM   3809  CG1 ILE A 471     161.995 166.530  96.671  1.00  0.80           C  
ATOM   3810  CG2 ILE A 471     160.564 168.391  97.640  1.00  0.80           C  
ATOM   3811  CD1 ILE A 471     161.120 166.278  95.439  1.00  0.80           C  
ATOM   3812  N   MET A 472     160.585 166.881 101.057  1.00  0.78           N  
ATOM   3813  CA  MET A 472     159.852 167.341 102.226  1.00  0.78           C  
ATOM   3814  C   MET A 472     160.742 167.660 103.422  1.00  0.78           C  
ATOM   3815  O   MET A 472     160.322 168.347 104.347  1.00  0.78           O  
ATOM   3816  CB  MET A 472     158.849 166.254 102.688  1.00  0.78           C  
ATOM   3817  CG  MET A 472     157.639 166.068 101.757  1.00  0.78           C  
ATOM   3818  SD  MET A 472     156.631 164.599 102.128  1.00  0.78           S  
ATOM   3819  CE  MET A 472     156.296 164.882 103.892  1.00  0.78           C  
ATOM   3820  N   GLY A 473     162.000 167.170 103.427  1.00  0.79           N  
ATOM   3821  CA  GLY A 473     162.897 167.296 104.571  1.00  0.79           C  
ATOM   3822  C   GLY A 473     162.806 166.153 105.545  1.00  0.79           C  
ATOM   3823  O   GLY A 473     163.428 166.177 106.600  1.00  0.79           O  
ATOM   3824  N   GLU A 474     162.048 165.091 105.210  1.00  0.76           N  
ATOM   3825  CA  GLU A 474     161.822 163.961 106.101  1.00  0.76           C  
ATOM   3826  C   GLU A 474     162.959 162.945 106.001  1.00  0.76           C  
ATOM   3827  O   GLU A 474     163.122 162.055 106.836  1.00  0.76           O  
ATOM   3828  CB  GLU A 474     160.461 163.289 105.771  1.00  0.76           C  
ATOM   3829  CG  GLU A 474     159.807 162.490 106.930  1.00  0.76           C  
ATOM   3830  CD  GLU A 474     159.241 163.338 108.069  1.00  0.76           C  
ATOM   3831  OE1 GLU A 474     158.336 164.182 107.856  1.00  0.76           O  
ATOM   3832  OE2 GLU A 474     159.676 163.095 109.229  1.00  0.76           O  
ATOM   3833  N   LEU A 475     163.811 163.081 104.963  1.00  0.76           N  
ATOM   3834  CA  LEU A 475     165.034 162.321 104.807  1.00  0.76           C  
ATOM   3835  C   LEU A 475     166.172 163.265 104.446  1.00  0.76           C  
ATOM   3836  O   LEU A 475     166.234 163.821 103.352  1.00  0.76           O  
ATOM   3837  CB  LEU A 475     164.856 161.234 103.718  1.00  0.76           C  
ATOM   3838  CG  LEU A 475     166.076 160.334 103.432  1.00  0.76           C  
ATOM   3839  CD1 LEU A 475     166.567 159.606 104.687  1.00  0.76           C  
ATOM   3840  CD2 LEU A 475     165.737 159.302 102.348  1.00  0.76           C  
ATOM   3841  N   GLU A 476     167.123 163.474 105.376  1.00  0.72           N  
ATOM   3842  CA  GLU A 476     168.287 164.315 105.157  1.00  0.72           C  
ATOM   3843  C   GLU A 476     169.291 163.679 104.184  1.00  0.72           C  
ATOM   3844  O   GLU A 476     169.694 162.530 104.409  1.00  0.72           O  
ATOM   3845  CB  GLU A 476     168.974 164.655 106.501  1.00  0.72           C  
ATOM   3846  CG  GLU A 476     168.019 165.366 107.496  1.00  0.72           C  
ATOM   3847  CD  GLU A 476     168.607 165.572 108.891  1.00  0.72           C  
ATOM   3848  OE1 GLU A 476     169.601 164.883 109.235  1.00  0.72           O  
ATOM   3849  OE2 GLU A 476     168.018 166.385 109.649  1.00  0.72           O  
ATOM   3850  N   PRO A 477     169.702 164.332 103.093  1.00  0.76           N  
ATOM   3851  CA  PRO A 477     170.721 163.806 102.196  1.00  0.76           C  
ATOM   3852  C   PRO A 477     172.125 164.000 102.740  1.00  0.76           C  
ATOM   3853  O   PRO A 477     172.401 164.964 103.449  1.00  0.76           O  
ATOM   3854  CB  PRO A 477     170.493 164.610 100.910  1.00  0.76           C  
ATOM   3855  CG  PRO A 477     169.996 165.970 101.391  1.00  0.76           C  
ATOM   3856  CD  PRO A 477     169.149 165.605 102.608  1.00  0.76           C  
ATOM   3857  N   SER A 478     173.039 163.065 102.419  1.00  0.65           N  
ATOM   3858  CA  SER A 478     174.429 163.130 102.854  1.00  0.65           C  
ATOM   3859  C   SER A 478     175.269 164.005 101.946  1.00  0.65           C  
ATOM   3860  O   SER A 478     176.367 164.418 102.307  1.00  0.65           O  
ATOM   3861  CB  SER A 478     175.124 161.744 102.845  1.00  0.65           C  
ATOM   3862  OG  SER A 478     174.481 160.824 103.726  1.00  0.65           O  
ATOM   3863  N   GLU A 479     174.757 164.304 100.740  1.00  0.63           N  
ATOM   3864  CA  GLU A 479     175.417 165.155  99.775  1.00  0.63           C  
ATOM   3865  C   GLU A 479     174.361 165.807  98.905  1.00  0.63           C  
ATOM   3866  O   GLU A 479     173.258 165.283  98.738  1.00  0.63           O  
ATOM   3867  CB  GLU A 479     176.401 164.365  98.881  1.00  0.63           C  
ATOM   3868  CG  GLU A 479     177.375 165.230  98.042  1.00  0.63           C  
ATOM   3869  CD  GLU A 479     178.287 164.386  97.153  1.00  0.63           C  
ATOM   3870  OE1 GLU A 479     178.186 163.133  97.204  1.00  0.63           O  
ATOM   3871  OE2 GLU A 479     179.099 165.015  96.427  1.00  0.63           O  
ATOM   3872  N   GLY A 480     174.688 166.981  98.332  1.00  0.79           N  
ATOM   3873  CA  GLY A 480     173.794 167.756  97.491  1.00  0.79           C  
ATOM   3874  C   GLY A 480     172.973 168.748  98.256  1.00  0.79           C  
ATOM   3875  O   GLY A 480     173.124 168.949  99.459  1.00  0.79           O  
ATOM   3876  N   LYS A 481     172.086 169.451  97.545  1.00  0.74           N  
ATOM   3877  CA  LYS A 481     171.326 170.525  98.138  1.00  0.74           C  
ATOM   3878  C   LYS A 481     169.987 170.655  97.450  1.00  0.74           C  
ATOM   3879  O   LYS A 481     169.783 170.228  96.312  1.00  0.74           O  
ATOM   3880  CB  LYS A 481     172.086 171.870  98.078  1.00  0.74           C  
ATOM   3881  CG  LYS A 481     172.547 172.224  96.663  1.00  0.74           C  
ATOM   3882  CD  LYS A 481     173.324 173.539  96.591  1.00  0.74           C  
ATOM   3883  CE  LYS A 481     172.456 174.765  96.830  1.00  0.74           C  
ATOM   3884  NZ  LYS A 481     173.266 175.953  96.513  1.00  0.74           N  
ATOM   3885  N   ILE A 482     169.016 171.232  98.179  1.00  0.75           N  
ATOM   3886  CA  ILE A 482     167.643 171.364  97.744  1.00  0.75           C  
ATOM   3887  C   ILE A 482     167.256 172.793  98.017  1.00  0.75           C  
ATOM   3888  O   ILE A 482     167.616 173.350  99.054  1.00  0.75           O  
ATOM   3889  CB  ILE A 482     166.695 170.435  98.495  1.00  0.75           C  
ATOM   3890  CG1 ILE A 482     167.232 168.992  98.451  1.00  0.75           C  
ATOM   3891  CG2 ILE A 482     165.287 170.526  97.874  1.00  0.75           C  
ATOM   3892  CD1 ILE A 482     166.460 168.021  99.329  1.00  0.75           C  
ATOM   3893  N   LYS A 483     166.554 173.451  97.080  1.00  0.70           N  
ATOM   3894  CA  LYS A 483     166.132 174.817  97.290  1.00  0.70           C  
ATOM   3895  C   LYS A 483     164.738 175.048  96.734  1.00  0.70           C  
ATOM   3896  O   LYS A 483     164.492 174.847  95.545  1.00  0.70           O  
ATOM   3897  CB  LYS A 483     167.178 175.722  96.614  1.00  0.70           C  
ATOM   3898  CG  LYS A 483     167.019 177.223  96.856  1.00  0.70           C  
ATOM   3899  CD  LYS A 483     168.362 177.960  96.711  1.00  0.70           C  
ATOM   3900  CE  LYS A 483     169.113 177.727  95.392  1.00  0.70           C  
ATOM   3901  NZ  LYS A 483     168.330 178.215  94.237  1.00  0.70           N  
ATOM   3902  N   HIS A 484     163.787 175.463  97.600  1.00  0.68           N  
ATOM   3903  CA  HIS A 484     162.398 175.698  97.246  1.00  0.68           C  
ATOM   3904  C   HIS A 484     161.708 176.528  98.333  1.00  0.68           C  
ATOM   3905  O   HIS A 484     162.333 176.919  99.316  1.00  0.68           O  
ATOM   3906  CB  HIS A 484     161.637 174.391  96.918  1.00  0.68           C  
ATOM   3907  CG  HIS A 484     161.690 173.330  97.972  1.00  0.68           C  
ATOM   3908  ND1 HIS A 484     161.041 173.560  99.159  1.00  0.68           N  
ATOM   3909  CD2 HIS A 484     162.243 172.090  97.975  1.00  0.68           C  
ATOM   3910  CE1 HIS A 484     161.202 172.467  99.868  1.00  0.68           C  
ATOM   3911  NE2 HIS A 484     161.925 171.539  99.200  1.00  0.68           N  
ATOM   3912  N   SER A 485     160.418 176.885  98.142  1.00  0.64           N  
ATOM   3913  CA  SER A 485     159.590 177.583  99.129  1.00  0.64           C  
ATOM   3914  C   SER A 485     159.001 176.599 100.119  1.00  0.64           C  
ATOM   3915  O   SER A 485     158.730 175.457  99.773  1.00  0.64           O  
ATOM   3916  CB  SER A 485     158.381 178.291  98.454  1.00  0.64           C  
ATOM   3917  OG  SER A 485     157.643 179.140  99.338  1.00  0.64           O  
ATOM   3918  N   GLY A 486     158.707 177.017 101.369  1.00  0.53           N  
ATOM   3919  CA  GLY A 486     158.269 176.087 102.411  1.00  0.53           C  
ATOM   3920  C   GLY A 486     156.853 175.564 102.305  1.00  0.53           C  
ATOM   3921  O   GLY A 486     156.422 174.711 103.075  1.00  0.53           O  
ATOM   3922  N   ARG A 487     156.064 176.051 101.332  1.00  0.64           N  
ATOM   3923  CA  ARG A 487     154.673 175.670 101.203  1.00  0.64           C  
ATOM   3924  C   ARG A 487     154.482 174.418 100.368  1.00  0.64           C  
ATOM   3925  O   ARG A 487     154.295 174.477  99.152  1.00  0.64           O  
ATOM   3926  CB  ARG A 487     153.820 176.793 100.578  1.00  0.64           C  
ATOM   3927  CG  ARG A 487     153.825 178.110 101.371  1.00  0.64           C  
ATOM   3928  CD  ARG A 487     152.782 179.122 100.876  1.00  0.64           C  
ATOM   3929  NE  ARG A 487     152.977 179.343  99.401  1.00  0.64           N  
ATOM   3930  CZ  ARG A 487     153.841 180.214  98.862  1.00  0.64           C  
ATOM   3931  NH1 ARG A 487     154.660 180.950  99.608  1.00  0.64           N  
ATOM   3932  NH2 ARG A 487     153.892 180.336  97.537  1.00  0.64           N  
ATOM   3933  N   ILE A 488     154.467 173.254 101.035  1.00  0.79           N  
ATOM   3934  CA  ILE A 488     154.304 171.955 100.410  1.00  0.79           C  
ATOM   3935  C   ILE A 488     152.925 171.391 100.773  1.00  0.79           C  
ATOM   3936  O   ILE A 488     152.340 171.698 101.819  1.00  0.79           O  
ATOM   3937  CB  ILE A 488     155.505 171.053 100.763  1.00  0.79           C  
ATOM   3938  CG1 ILE A 488     156.610 171.114  99.676  1.00  0.79           C  
ATOM   3939  CG2 ILE A 488     155.148 169.572 101.008  1.00  0.79           C  
ATOM   3940  CD1 ILE A 488     157.358 172.444  99.569  1.00  0.79           C  
ATOM   3941  N   SER A 489     152.336 170.598  99.858  1.00  0.83           N  
ATOM   3942  CA  SER A 489     151.186 169.737 100.095  1.00  0.83           C  
ATOM   3943  C   SER A 489     151.571 168.333  99.669  1.00  0.83           C  
ATOM   3944  O   SER A 489     152.232 168.134  98.652  1.00  0.83           O  
ATOM   3945  CB  SER A 489     149.915 170.147  99.310  1.00  0.83           C  
ATOM   3946  OG  SER A 489     149.324 171.321  99.870  1.00  0.83           O  
ATOM   3947  N   PHE A 490     151.192 167.310 100.455  1.00  0.82           N  
ATOM   3948  CA  PHE A 490     151.648 165.944 100.268  1.00  0.82           C  
ATOM   3949  C   PHE A 490     150.454 164.996 100.252  1.00  0.82           C  
ATOM   3950  O   PHE A 490     149.542 165.103 101.069  1.00  0.82           O  
ATOM   3951  CB  PHE A 490     152.652 165.591 101.408  1.00  0.82           C  
ATOM   3952  CG  PHE A 490     153.075 164.146 101.471  1.00  0.82           C  
ATOM   3953  CD1 PHE A 490     153.702 163.517 100.382  1.00  0.82           C  
ATOM   3954  CD2 PHE A 490     152.849 163.413 102.647  1.00  0.82           C  
ATOM   3955  CE1 PHE A 490     154.077 162.169 100.463  1.00  0.82           C  
ATOM   3956  CE2 PHE A 490     153.235 162.072 102.737  1.00  0.82           C  
ATOM   3957  CZ  PHE A 490     153.844 161.448 101.641  1.00  0.82           C  
ATOM   3958  N   CYS A 491     150.449 164.036  99.308  1.00  0.84           N  
ATOM   3959  CA  CYS A 491     149.535 162.910  99.293  1.00  0.84           C  
ATOM   3960  C   CYS A 491     150.370 161.638  99.352  1.00  0.84           C  
ATOM   3961  O   CYS A 491     151.176 161.367  98.461  1.00  0.84           O  
ATOM   3962  CB  CYS A 491     148.666 162.928  98.007  1.00  0.84           C  
ATOM   3963  SG  CYS A 491     147.340 161.674  97.958  1.00  0.84           S  
ATOM   3964  N   SER A 492     150.212 160.851 100.436  1.00  0.82           N  
ATOM   3965  CA  SER A 492     150.923 159.608 100.681  1.00  0.82           C  
ATOM   3966  C   SER A 492     150.379 158.419  99.909  1.00  0.82           C  
ATOM   3967  O   SER A 492     149.179 158.294  99.680  1.00  0.82           O  
ATOM   3968  CB  SER A 492     150.923 159.230 102.196  1.00  0.82           C  
ATOM   3969  OG  SER A 492     149.632 159.355 102.801  1.00  0.82           O  
ATOM   3970  N   GLN A 493     151.273 157.477  99.528  1.00  0.77           N  
ATOM   3971  CA  GLN A 493     150.921 156.214  98.889  1.00  0.77           C  
ATOM   3972  C   GLN A 493     150.049 155.305  99.761  1.00  0.77           C  
ATOM   3973  O   GLN A 493     149.108 154.651  99.310  1.00  0.77           O  
ATOM   3974  CB  GLN A 493     152.217 155.474  98.474  1.00  0.77           C  
ATOM   3975  CG  GLN A 493     151.958 154.335  97.464  1.00  0.77           C  
ATOM   3976  CD  GLN A 493     153.234 153.695  96.920  1.00  0.77           C  
ATOM   3977  OE1 GLN A 493     154.360 153.818  97.395  1.00  0.77           O  
ATOM   3978  NE2 GLN A 493     153.033 152.906  95.833  1.00  0.77           N  
ATOM   3979  N   PHE A 494     150.345 155.280 101.075  1.00  0.73           N  
ATOM   3980  CA  PHE A 494     149.506 154.675 102.089  1.00  0.73           C  
ATOM   3981  C   PHE A 494     148.590 155.757 102.666  1.00  0.73           C  
ATOM   3982  O   PHE A 494     149.008 156.647 103.412  1.00  0.73           O  
ATOM   3983  CB  PHE A 494     150.389 154.002 103.179  1.00  0.73           C  
ATOM   3984  CG  PHE A 494     149.597 153.447 104.336  1.00  0.73           C  
ATOM   3985  CD1 PHE A 494     148.859 152.257 104.214  1.00  0.73           C  
ATOM   3986  CD2 PHE A 494     149.582 154.136 105.560  1.00  0.73           C  
ATOM   3987  CE1 PHE A 494     148.110 151.774 105.296  1.00  0.73           C  
ATOM   3988  CE2 PHE A 494     148.834 153.658 106.641  1.00  0.73           C  
ATOM   3989  CZ  PHE A 494     148.097 152.475 106.509  1.00  0.73           C  
ATOM   3990  N   SER A 495     147.297 155.710 102.295  1.00  0.78           N  
ATOM   3991  CA  SER A 495     146.281 156.642 102.759  1.00  0.78           C  
ATOM   3992  C   SER A 495     145.926 156.517 104.223  1.00  0.78           C  
ATOM   3993  O   SER A 495     145.424 155.497 104.689  1.00  0.78           O  
ATOM   3994  CB  SER A 495     144.943 156.505 101.997  1.00  0.78           C  
ATOM   3995  OG  SER A 495     145.130 156.775 100.612  1.00  0.78           O  
ATOM   3996  N   TRP A 496     146.115 157.613 104.975  1.00  0.71           N  
ATOM   3997  CA  TRP A 496     145.765 157.684 106.374  1.00  0.71           C  
ATOM   3998  C   TRP A 496     144.530 158.559 106.548  1.00  0.71           C  
ATOM   3999  O   TRP A 496     144.424 159.675 106.021  1.00  0.71           O  
ATOM   4000  CB  TRP A 496     146.957 158.203 107.214  1.00  0.71           C  
ATOM   4001  CG  TRP A 496     146.676 158.381 108.695  1.00  0.71           C  
ATOM   4002  CD1 TRP A 496     146.478 157.451 109.680  1.00  0.71           C  
ATOM   4003  CD2 TRP A 496     146.506 159.666 109.306  1.00  0.71           C  
ATOM   4004  NE1 TRP A 496     146.200 158.076 110.877  1.00  0.71           N  
ATOM   4005  CE2 TRP A 496     146.238 159.436 110.671  1.00  0.71           C  
ATOM   4006  CE3 TRP A 496     146.568 160.956 108.781  1.00  0.71           C  
ATOM   4007  CZ2 TRP A 496     146.054 160.495 111.543  1.00  0.71           C  
ATOM   4008  CZ3 TRP A 496     146.393 162.025 109.665  1.00  0.71           C  
ATOM   4009  CH2 TRP A 496     146.140 161.794 111.026  1.00  0.71           C  
ATOM   4010  N   ILE A 497     143.558 158.025 107.307  1.00  0.78           N  
ATOM   4011  CA  ILE A 497     142.279 158.641 107.590  1.00  0.78           C  
ATOM   4012  C   ILE A 497     142.232 158.833 109.083  1.00  0.78           C  
ATOM   4013  O   ILE A 497     142.295 157.863 109.841  1.00  0.78           O  
ATOM   4014  CB  ILE A 497     141.100 157.773 107.153  1.00  0.78           C  
ATOM   4015  CG1 ILE A 497     141.143 157.477 105.636  1.00  0.78           C  
ATOM   4016  CG2 ILE A 497     139.764 158.427 107.570  1.00  0.78           C  
ATOM   4017  CD1 ILE A 497     141.034 158.717 104.744  1.00  0.78           C  
ATOM   4018  N   MET A 498     142.132 160.100 109.542  1.00  0.74           N  
ATOM   4019  CA  MET A 498     142.024 160.400 110.958  1.00  0.74           C  
ATOM   4020  C   MET A 498     140.544 160.300 111.356  1.00  0.74           C  
ATOM   4021  O   MET A 498     139.681 160.644 110.542  1.00  0.74           O  
ATOM   4022  CB  MET A 498     142.674 161.765 111.409  1.00  0.74           C  
ATOM   4023  CG  MET A 498     143.128 162.722 110.278  1.00  0.74           C  
ATOM   4024  SD  MET A 498     143.629 164.441 110.712  1.00  0.74           S  
ATOM   4025  CE  MET A 498     142.566 164.876 112.133  1.00  0.74           C  
ATOM   4026  N   PRO A 499     140.201 159.799 112.553  1.00  0.78           N  
ATOM   4027  CA  PRO A 499     138.835 159.804 113.086  1.00  0.78           C  
ATOM   4028  C   PRO A 499     138.105 161.129 112.984  1.00  0.78           C  
ATOM   4029  O   PRO A 499     138.708 162.171 113.234  1.00  0.78           O  
ATOM   4030  CB  PRO A 499     138.984 159.373 114.558  1.00  0.78           C  
ATOM   4031  CG  PRO A 499     140.357 158.709 114.635  1.00  0.78           C  
ATOM   4032  CD  PRO A 499     141.168 159.476 113.602  1.00  0.78           C  
ATOM   4033  N   GLY A 500     136.804 161.101 112.653  1.00  0.79           N  
ATOM   4034  CA  GLY A 500     135.999 162.307 112.549  1.00  0.79           C  
ATOM   4035  C   GLY A 500     135.174 162.244 111.305  1.00  0.79           C  
ATOM   4036  O   GLY A 500     134.929 161.175 110.750  1.00  0.79           O  
ATOM   4037  N   THR A 501     134.688 163.395 110.837  1.00  0.78           N  
ATOM   4038  CA  THR A 501     133.767 163.454 109.707  1.00  0.78           C  
ATOM   4039  C   THR A 501     134.491 163.433 108.355  1.00  0.78           C  
ATOM   4040  O   THR A 501     135.630 163.885 108.239  1.00  0.78           O  
ATOM   4041  CB  THR A 501     132.891 164.691 109.861  1.00  0.78           C  
ATOM   4042  OG1 THR A 501     132.142 164.603 111.063  1.00  0.78           O  
ATOM   4043  CG2 THR A 501     131.864 164.828 108.750  1.00  0.78           C  
ATOM   4044  N   ILE A 502     133.866 162.919 107.257  1.00  0.78           N  
ATOM   4045  CA  ILE A 502     134.414 162.995 105.889  1.00  0.78           C  
ATOM   4046  C   ILE A 502     134.665 164.426 105.454  1.00  0.78           C  
ATOM   4047  O   ILE A 502     135.756 164.776 105.013  1.00  0.78           O  
ATOM   4048  CB  ILE A 502     133.493 162.369 104.828  1.00  0.78           C  
ATOM   4049  CG1 ILE A 502     133.362 160.854 105.068  1.00  0.78           C  
ATOM   4050  CG2 ILE A 502     133.991 162.657 103.385  1.00  0.78           C  
ATOM   4051  CD1 ILE A 502     132.466 160.135 104.057  1.00  0.78           C  
ATOM   4052  N   LYS A 503     133.665 165.311 105.630  1.00  0.78           N  
ATOM   4053  CA  LYS A 503     133.817 166.723 105.338  1.00  0.78           C  
ATOM   4054  C   LYS A 503     134.942 167.386 106.110  1.00  0.78           C  
ATOM   4055  O   LYS A 503     135.767 168.112 105.556  1.00  0.78           O  
ATOM   4056  CB  LYS A 503     132.524 167.491 105.671  1.00  0.78           C  
ATOM   4057  CG  LYS A 503     132.655 168.987 105.357  1.00  0.78           C  
ATOM   4058  CD  LYS A 503     131.304 169.694 105.361  1.00  0.78           C  
ATOM   4059  CE  LYS A 503     131.393 171.086 104.752  1.00  0.78           C  
ATOM   4060  NZ  LYS A 503     130.031 171.632 104.648  1.00  0.78           N  
ATOM   4061  N   GLU A 504     135.027 167.096 107.422  1.00  0.74           N  
ATOM   4062  CA  GLU A 504     136.077 167.598 108.280  1.00  0.74           C  
ATOM   4063  C   GLU A 504     137.415 167.052 107.742  1.00  0.74           C  
ATOM   4064  O   GLU A 504     138.316 167.840 107.489  1.00  0.74           O  
ATOM   4065  CB  GLU A 504     135.671 167.271 109.740  1.00  0.74           C  
ATOM   4066  CG  GLU A 504     135.904 168.221 110.945  1.00  0.74           C  
ATOM   4067  CD  GLU A 504     135.883 167.352 112.204  1.00  0.74           C  
ATOM   4068  OE1 GLU A 504     135.382 166.197 112.104  1.00  0.74           O  
ATOM   4069  OE2 GLU A 504     136.379 167.802 113.261  1.00  0.74           O  
ATOM   4070  N   ASN A 505     137.527 165.746 107.359  1.00  0.80           N  
ATOM   4071  CA  ASN A 505     138.731 165.183 106.712  1.00  0.80           C  
ATOM   4072  C   ASN A 505     139.334 165.927 105.522  1.00  0.80           C  
ATOM   4073  O   ASN A 505     140.557 165.986 105.396  1.00  0.80           O  
ATOM   4074  CB  ASN A 505     138.692 163.664 106.336  1.00  0.80           C  
ATOM   4075  CG  ASN A 505     139.151 162.748 107.470  1.00  0.80           C  
ATOM   4076  OD1 ASN A 505     140.298 162.282 107.462  1.00  0.80           O  
ATOM   4077  ND2 ASN A 505     138.269 162.501 108.461  1.00  0.80           N  
ATOM   4078  N   ILE A 506     138.525 166.481 104.610  1.00  0.82           N  
ATOM   4079  CA  ILE A 506     138.992 167.268 103.474  1.00  0.82           C  
ATOM   4080  C   ILE A 506     139.521 168.644 103.854  1.00  0.82           C  
ATOM   4081  O   ILE A 506     140.564 169.089 103.378  1.00  0.82           O  
ATOM   4082  CB  ILE A 506     137.862 167.390 102.462  1.00  0.82           C  
ATOM   4083  CG1 ILE A 506     137.316 165.990 102.090  1.00  0.82           C  
ATOM   4084  CG2 ILE A 506     138.300 168.181 101.210  1.00  0.82           C  
ATOM   4085  CD1 ILE A 506     138.370 165.010 101.568  1.00  0.82           C  
ATOM   4086  N   ILE A 507     138.820 169.349 104.764  1.00  0.79           N  
ATOM   4087  CA  ILE A 507     139.130 170.732 105.108  1.00  0.79           C  
ATOM   4088  C   ILE A 507     140.068 170.800 106.303  1.00  0.79           C  
ATOM   4089  O   ILE A 507     140.392 171.860 106.831  1.00  0.79           O  
ATOM   4090  CB  ILE A 507     137.875 171.576 105.337  1.00  0.79           C  
ATOM   4091  CG1 ILE A 507     137.071 171.167 106.592  1.00  0.79           C  
ATOM   4092  CG2 ILE A 507     137.013 171.506 104.057  1.00  0.79           C  
ATOM   4093  CD1 ILE A 507     135.953 172.154 106.948  1.00  0.79           C  
ATOM   4094  N   PHE A 508     140.557 169.631 106.747  1.00  0.74           N  
ATOM   4095  CA  PHE A 508     141.463 169.416 107.848  1.00  0.74           C  
ATOM   4096  C   PHE A 508     142.692 170.311 107.873  1.00  0.74           C  
ATOM   4097  O   PHE A 508     143.673 170.109 107.163  1.00  0.74           O  
ATOM   4098  CB  PHE A 508     141.859 167.889 107.907  1.00  0.74           C  
ATOM   4099  CG  PHE A 508     141.004 166.991 108.821  1.00  0.74           C  
ATOM   4100  CD1 PHE A 508     139.939 167.476 109.617  1.00  0.74           C  
ATOM   4101  CD2 PHE A 508     141.278 165.611 108.856  1.00  0.74           C  
ATOM   4102  CE1 PHE A 508     139.165 166.635 110.412  1.00  0.74           C  
ATOM   4103  CE2 PHE A 508     140.423 164.757 109.573  1.00  0.74           C  
ATOM   4104  CZ  PHE A 508     139.371 165.268 110.341  1.00  0.74           C  
ATOM   4105  N   GLY A 509     142.669 171.295 108.805  1.00  0.64           N  
ATOM   4106  CA  GLY A 509     143.763 172.232 109.048  1.00  0.64           C  
ATOM   4107  C   GLY A 509     143.636 173.479 108.240  1.00  0.64           C  
ATOM   4108  O   GLY A 509     144.558 174.281 108.160  1.00  0.64           O  
ATOM   4109  N   VAL A 510     142.471 173.672 107.617  1.00  0.68           N  
ATOM   4110  CA  VAL A 510     142.192 174.812 106.788  1.00  0.68           C  
ATOM   4111  C   VAL A 510     140.854 175.348 107.267  1.00  0.68           C  
ATOM   4112  O   VAL A 510     140.018 174.630 107.814  1.00  0.68           O  
ATOM   4113  CB  VAL A 510     142.146 174.412 105.312  1.00  0.68           C  
ATOM   4114  CG1 VAL A 510     141.903 175.626 104.394  1.00  0.68           C  
ATOM   4115  CG2 VAL A 510     143.456 173.719 104.882  1.00  0.68           C  
ATOM   4116  N   SER A 511     140.600 176.657 107.109  1.00  0.71           N  
ATOM   4117  CA  SER A 511     139.262 177.206 107.212  1.00  0.71           C  
ATOM   4118  C   SER A 511     138.264 176.606 106.218  1.00  0.71           C  
ATOM   4119  O   SER A 511     138.599 175.970 105.214  1.00  0.71           O  
ATOM   4120  CB  SER A 511     139.261 178.750 107.115  1.00  0.71           C  
ATOM   4121  OG  SER A 511     139.765 179.191 105.854  1.00  0.71           O  
ATOM   4122  N   TYR A 512     136.963 176.772 106.491  1.00  0.73           N  
ATOM   4123  CA  TYR A 512     135.932 176.267 105.616  1.00  0.73           C  
ATOM   4124  C   TYR A 512     135.568 177.308 104.558  1.00  0.73           C  
ATOM   4125  O   TYR A 512     134.987 178.352 104.850  1.00  0.73           O  
ATOM   4126  CB  TYR A 512     134.721 175.846 106.487  1.00  0.73           C  
ATOM   4127  CG  TYR A 512     133.485 175.452 105.718  1.00  0.73           C  
ATOM   4128  CD1 TYR A 512     133.513 174.543 104.643  1.00  0.73           C  
ATOM   4129  CD2 TYR A 512     132.257 176.012 106.102  1.00  0.73           C  
ATOM   4130  CE1 TYR A 512     132.323 174.206 103.971  1.00  0.73           C  
ATOM   4131  CE2 TYR A 512     131.071 175.651 105.454  1.00  0.73           C  
ATOM   4132  CZ  TYR A 512     131.100 174.753 104.390  1.00  0.73           C  
ATOM   4133  OH  TYR A 512     129.866 174.342 103.847  1.00  0.73           O  
ATOM   4134  N   ASP A 513     135.901 176.998 103.294  1.00  0.76           N  
ATOM   4135  CA  ASP A 513     135.518 177.728 102.106  1.00  0.76           C  
ATOM   4136  C   ASP A 513     134.570 176.795 101.345  1.00  0.76           C  
ATOM   4137  O   ASP A 513     134.968 175.750 100.825  1.00  0.76           O  
ATOM   4138  CB  ASP A 513     136.803 178.077 101.296  1.00  0.76           C  
ATOM   4139  CG  ASP A 513     136.579 178.783  99.965  1.00  0.76           C  
ATOM   4140  OD1 ASP A 513     135.407 179.072  99.610  1.00  0.76           O  
ATOM   4141  OD2 ASP A 513     137.603 178.973  99.248  1.00  0.76           O  
ATOM   4142  N   GLU A 514     133.264 177.134 101.290  1.00  0.75           N  
ATOM   4143  CA  GLU A 514     132.238 176.322 100.641  1.00  0.75           C  
ATOM   4144  C   GLU A 514     132.448 176.190  99.146  1.00  0.75           C  
ATOM   4145  O   GLU A 514     132.287 175.120  98.559  1.00  0.75           O  
ATOM   4146  CB  GLU A 514     130.825 176.902 100.919  1.00  0.75           C  
ATOM   4147  CG  GLU A 514     129.614 176.256 100.180  1.00  0.75           C  
ATOM   4148  CD  GLU A 514     129.291 174.805 100.524  1.00  0.75           C  
ATOM   4149  OE1 GLU A 514     130.128 174.090 101.118  1.00  0.75           O  
ATOM   4150  OE2 GLU A 514     128.144 174.390 100.206  1.00  0.75           O  
ATOM   4151  N   TYR A 515     132.857 177.286  98.472  1.00  0.74           N  
ATOM   4152  CA  TYR A 515     133.087 177.265  97.041  1.00  0.74           C  
ATOM   4153  C   TYR A 515     134.224 176.311  96.671  1.00  0.74           C  
ATOM   4154  O   TYR A 515     134.121 175.492  95.754  1.00  0.74           O  
ATOM   4155  CB  TYR A 515     133.351 178.708  96.535  1.00  0.74           C  
ATOM   4156  CG  TYR A 515     133.550 178.703  95.047  1.00  0.74           C  
ATOM   4157  CD1 TYR A 515     132.457 178.591  94.172  1.00  0.74           C  
ATOM   4158  CD2 TYR A 515     134.852 178.654  94.533  1.00  0.74           C  
ATOM   4159  CE1 TYR A 515     132.668 178.420  92.796  1.00  0.74           C  
ATOM   4160  CE2 TYR A 515     135.059 178.435  93.168  1.00  0.74           C  
ATOM   4161  CZ  TYR A 515     133.969 178.343  92.294  1.00  0.74           C  
ATOM   4162  OH  TYR A 515     134.176 178.183  90.908  1.00  0.74           O  
ATOM   4163  N   ARG A 516     135.331 176.367  97.431  1.00  0.73           N  
ATOM   4164  CA  ARG A 516     136.423 175.431  97.285  1.00  0.73           C  
ATOM   4165  C   ARG A 516     136.063 173.989  97.619  1.00  0.73           C  
ATOM   4166  O   ARG A 516     136.452 173.069  96.900  1.00  0.73           O  
ATOM   4167  CB  ARG A 516     137.622 175.886  98.129  1.00  0.73           C  
ATOM   4168  CG  ARG A 516     138.939 175.182  97.761  1.00  0.73           C  
ATOM   4169  CD  ARG A 516     140.118 175.569  98.652  1.00  0.73           C  
ATOM   4170  NE  ARG A 516     140.281 177.044  98.529  1.00  0.73           N  
ATOM   4171  CZ  ARG A 516     141.228 177.726  99.177  1.00  0.73           C  
ATOM   4172  NH1 ARG A 516     142.152 177.114  99.915  1.00  0.73           N  
ATOM   4173  NH2 ARG A 516     141.221 179.052  99.089  1.00  0.73           N  
ATOM   4174  N   TYR A 517     135.286 173.752  98.702  1.00  0.80           N  
ATOM   4175  CA  TYR A 517     134.847 172.421  99.107  1.00  0.80           C  
ATOM   4176  C   TYR A 517     134.027 171.720  98.024  1.00  0.80           C  
ATOM   4177  O   TYR A 517     134.318 170.589  97.639  1.00  0.80           O  
ATOM   4178  CB  TYR A 517     134.033 172.518 100.434  1.00  0.80           C  
ATOM   4179  CG  TYR A 517     133.569 171.172 100.948  1.00  0.80           C  
ATOM   4180  CD1 TYR A 517     134.492 170.221 101.417  1.00  0.80           C  
ATOM   4181  CD2 TYR A 517     132.204 170.834 100.911  1.00  0.80           C  
ATOM   4182  CE1 TYR A 517     134.057 168.946 101.814  1.00  0.80           C  
ATOM   4183  CE2 TYR A 517     131.770 169.560 101.310  1.00  0.80           C  
ATOM   4184  CZ  TYR A 517     132.694 168.615 101.762  1.00  0.80           C  
ATOM   4185  OH  TYR A 517     132.250 167.345 102.197  1.00  0.80           O  
ATOM   4186  N   ARG A 518     133.029 172.414  97.446  1.00  0.74           N  
ATOM   4187  CA  ARG A 518     132.256 171.896  96.332  1.00  0.74           C  
ATOM   4188  C   ARG A 518     133.078 171.639  95.069  1.00  0.74           C  
ATOM   4189  O   ARG A 518     132.875 170.656  94.358  1.00  0.74           O  
ATOM   4190  CB  ARG A 518     131.096 172.849  95.977  1.00  0.74           C  
ATOM   4191  CG  ARG A 518     130.043 173.026  97.087  1.00  0.74           C  
ATOM   4192  CD  ARG A 518     128.822 173.759  96.532  1.00  0.74           C  
ATOM   4193  NE  ARG A 518     127.869 174.002  97.638  1.00  0.74           N  
ATOM   4194  CZ  ARG A 518     126.672 174.580  97.510  1.00  0.74           C  
ATOM   4195  NH1 ARG A 518     126.190 174.921  96.323  1.00  0.74           N  
ATOM   4196  NH2 ARG A 518     126.001 174.842  98.625  1.00  0.74           N  
ATOM   4197  N   SER A 519     134.043 172.527  94.752  1.00  0.79           N  
ATOM   4198  CA  SER A 519     134.917 172.374  93.589  1.00  0.79           C  
ATOM   4199  C   SER A 519     135.785 171.117  93.624  1.00  0.79           C  
ATOM   4200  O   SER A 519     135.819 170.332  92.675  1.00  0.79           O  
ATOM   4201  CB  SER A 519     135.849 173.611  93.461  1.00  0.79           C  
ATOM   4202  OG  SER A 519     136.541 173.644  92.211  1.00  0.79           O  
ATOM   4203  N   VAL A 520     136.472 170.862  94.761  1.00  0.84           N  
ATOM   4204  CA  VAL A 520     137.322 169.687  94.929  1.00  0.84           C  
ATOM   4205  C   VAL A 520     136.551 168.371  94.982  1.00  0.84           C  
ATOM   4206  O   VAL A 520     136.977 167.367  94.417  1.00  0.84           O  
ATOM   4207  CB  VAL A 520     138.324 169.800  96.082  1.00  0.84           C  
ATOM   4208  CG1 VAL A 520     139.179 171.068  95.895  1.00  0.84           C  
ATOM   4209  CG2 VAL A 520     137.643 169.802  97.459  1.00  0.84           C  
ATOM   4210  N   ILE A 521     135.371 168.334  95.639  1.00  0.82           N  
ATOM   4211  CA  ILE A 521     134.529 167.141  95.752  1.00  0.82           C  
ATOM   4212  C   ILE A 521     134.046 166.628  94.400  1.00  0.82           C  
ATOM   4213  O   ILE A 521     134.085 165.424  94.124  1.00  0.82           O  
ATOM   4214  CB  ILE A 521     133.398 167.387  96.759  1.00  0.82           C  
ATOM   4215  CG1 ILE A 521     133.738 166.782  98.140  1.00  0.82           C  
ATOM   4216  CG2 ILE A 521     132.018 166.865  96.307  1.00  0.82           C  
ATOM   4217  CD1 ILE A 521     135.040 167.286  98.763  1.00  0.82           C  
ATOM   4218  N   LYS A 522     133.634 167.549  93.507  1.00  0.78           N  
ATOM   4219  CA  LYS A 522     133.269 167.231  92.142  1.00  0.78           C  
ATOM   4220  C   LYS A 522     134.425 166.699  91.303  1.00  0.78           C  
ATOM   4221  O   LYS A 522     134.333 165.653  90.667  1.00  0.78           O  
ATOM   4222  CB  LYS A 522     132.714 168.506  91.472  1.00  0.78           C  
ATOM   4223  CG  LYS A 522     132.021 168.246  90.126  1.00  0.78           C  
ATOM   4224  CD  LYS A 522     131.824 169.525  89.301  1.00  0.78           C  
ATOM   4225  CE  LYS A 522     131.031 170.599  90.042  1.00  0.78           C  
ATOM   4226  NZ  LYS A 522     130.914 171.789  89.172  1.00  0.78           N  
ATOM   4227  N   ALA A 523     135.591 167.379  91.333  1.00  0.84           N  
ATOM   4228  CA  ALA A 523     136.735 167.023  90.510  1.00  0.84           C  
ATOM   4229  C   ALA A 523     137.429 165.740  90.953  1.00  0.84           C  
ATOM   4230  O   ALA A 523     138.112 165.065  90.185  1.00  0.84           O  
ATOM   4231  CB  ALA A 523     137.739 168.187  90.522  1.00  0.84           C  
ATOM   4232  N   CYS A 524     137.221 165.338  92.218  1.00  0.84           N  
ATOM   4233  CA  CYS A 524     137.760 164.104  92.750  1.00  0.84           C  
ATOM   4234  C   CYS A 524     136.788 162.938  92.631  1.00  0.84           C  
ATOM   4235  O   CYS A 524     137.089 161.851  93.114  1.00  0.84           O  
ATOM   4236  CB  CYS A 524     138.157 164.282  94.239  1.00  0.84           C  
ATOM   4237  SG  CYS A 524     139.652 165.316  94.415  1.00  0.84           S  
ATOM   4238  N   GLN A 525     135.615 163.103  91.974  1.00  0.78           N  
ATOM   4239  CA  GLN A 525     134.647 162.035  91.712  1.00  0.78           C  
ATOM   4240  C   GLN A 525     134.020 161.440  92.978  1.00  0.78           C  
ATOM   4241  O   GLN A 525     133.658 160.263  93.037  1.00  0.78           O  
ATOM   4242  CB  GLN A 525     135.217 160.936  90.756  1.00  0.78           C  
ATOM   4243  CG  GLN A 525     134.751 161.064  89.285  1.00  0.78           C  
ATOM   4244  CD  GLN A 525     135.126 162.412  88.669  1.00  0.78           C  
ATOM   4245  OE1 GLN A 525     134.279 163.236  88.336  1.00  0.78           O  
ATOM   4246  NE2 GLN A 525     136.449 162.673  88.567  1.00  0.78           N  
ATOM   4247  N   LEU A 526     133.837 162.267  94.029  1.00  0.81           N  
ATOM   4248  CA  LEU A 526     133.359 161.794  95.321  1.00  0.81           C  
ATOM   4249  C   LEU A 526     131.860 161.986  95.499  1.00  0.81           C  
ATOM   4250  O   LEU A 526     131.258 161.399  96.395  1.00  0.81           O  
ATOM   4251  CB  LEU A 526     134.099 162.535  96.470  1.00  0.81           C  
ATOM   4252  CG  LEU A 526     135.501 161.979  96.794  1.00  0.81           C  
ATOM   4253  CD1 LEU A 526     136.281 162.945  97.697  1.00  0.81           C  
ATOM   4254  CD2 LEU A 526     135.405 160.606  97.474  1.00  0.81           C  
ATOM   4255  N   GLU A 527     131.196 162.756  94.614  1.00  0.75           N  
ATOM   4256  CA  GLU A 527     129.765 163.030  94.686  1.00  0.75           C  
ATOM   4257  C   GLU A 527     128.889 161.774  94.611  1.00  0.75           C  
ATOM   4258  O   GLU A 527     127.935 161.618  95.374  1.00  0.75           O  
ATOM   4259  CB  GLU A 527     129.351 164.032  93.578  1.00  0.75           C  
ATOM   4260  CG  GLU A 527     129.990 165.437  93.736  1.00  0.75           C  
ATOM   4261  CD  GLU A 527     129.480 166.473  92.727  1.00  0.75           C  
ATOM   4262  OE1 GLU A 527     128.737 166.093  91.791  1.00  0.75           O  
ATOM   4263  OE2 GLU A 527     129.843 167.667  92.898  1.00  0.75           O  
ATOM   4264  N   GLU A 528     129.238 160.827  93.713  1.00  0.72           N  
ATOM   4265  CA  GLU A 528     128.576 159.536  93.563  1.00  0.72           C  
ATOM   4266  C   GLU A 528     128.665 158.623  94.788  1.00  0.72           C  
ATOM   4267  O   GLU A 528     127.686 158.001  95.194  1.00  0.72           O  
ATOM   4268  CB  GLU A 528     129.147 158.776  92.334  1.00  0.72           C  
ATOM   4269  CG  GLU A 528     128.418 157.433  92.051  1.00  0.72           C  
ATOM   4270  CD  GLU A 528     128.999 156.582  90.923  1.00  0.72           C  
ATOM   4271  OE1 GLU A 528     129.917 157.047  90.206  1.00  0.72           O  
ATOM   4272  OE2 GLU A 528     128.542 155.408  90.820  1.00  0.72           O  
ATOM   4273  N   ASP A 529     129.851 158.518  95.426  1.00  0.75           N  
ATOM   4274  CA  ASP A 529     130.015 157.762  96.659  1.00  0.75           C  
ATOM   4275  C   ASP A 529     129.239 158.397  97.838  1.00  0.75           C  
ATOM   4276  O   ASP A 529     128.539 157.713  98.578  1.00  0.75           O  
ATOM   4277  CB  ASP A 529     131.520 157.601  97.022  1.00  0.75           C  
ATOM   4278  CG  ASP A 529     132.311 156.761  96.046  1.00  0.75           C  
ATOM   4279  OD1 ASP A 529     132.259 155.506  96.069  1.00  0.75           O  
ATOM   4280  OD2 ASP A 529     133.101 157.387  95.291  1.00  0.75           O  
ATOM   4281  N   ILE A 530     129.298 159.744  98.002  1.00  0.70           N  
ATOM   4282  CA  ILE A 530     128.630 160.512  99.067  1.00  0.70           C  
ATOM   4283  C   ILE A 530     127.108 160.378  99.071  1.00  0.70           C  
ATOM   4284  O   ILE A 530     126.451 160.366 100.112  1.00  0.70           O  
ATOM   4285  CB  ILE A 530     129.083 161.989  99.063  1.00  0.70           C  
ATOM   4286  CG1 ILE A 530     130.246 162.234 100.055  1.00  0.70           C  
ATOM   4287  CG2 ILE A 530     127.956 162.992  99.409  1.00  0.70           C  
ATOM   4288  CD1 ILE A 530     131.528 161.455  99.766  1.00  0.70           C  
ATOM   4289  N   SER A 531     126.473 160.273  97.891  1.00  0.66           N  
ATOM   4290  CA  SER A 531     125.022 160.176  97.783  1.00  0.66           C  
ATOM   4291  C   SER A 531     124.451 158.837  98.222  1.00  0.66           C  
ATOM   4292  O   SER A 531     123.247 158.708  98.421  1.00  0.66           O  
ATOM   4293  CB  SER A 531     124.533 160.501  96.350  1.00  0.66           C  
ATOM   4294  OG  SER A 531     125.017 159.560  95.393  1.00  0.66           O  
ATOM   4295  N   LYS A 532     125.318 157.826  98.407  1.00  0.63           N  
ATOM   4296  CA  LYS A 532     124.958 156.488  98.831  1.00  0.63           C  
ATOM   4297  C   LYS A 532     125.269 156.225 100.296  1.00  0.63           C  
ATOM   4298  O   LYS A 532     125.436 155.079 100.709  1.00  0.63           O  
ATOM   4299  CB  LYS A 532     125.723 155.451  97.980  1.00  0.63           C  
ATOM   4300  CG  LYS A 532     125.338 155.505  96.499  1.00  0.63           C  
ATOM   4301  CD  LYS A 532     125.929 154.326  95.717  1.00  0.63           C  
ATOM   4302  CE  LYS A 532     125.453 154.303  94.268  1.00  0.63           C  
ATOM   4303  NZ  LYS A 532     126.031 153.135  93.574  1.00  0.63           N  
ATOM   4304  N   PHE A 533     125.367 157.285 101.114  1.00  0.50           N  
ATOM   4305  CA  PHE A 533     125.624 157.168 102.533  1.00  0.50           C  
ATOM   4306  C   PHE A 533     124.525 157.799 103.365  1.00  0.50           C  
ATOM   4307  O   PHE A 533     124.025 158.881 103.050  1.00  0.50           O  
ATOM   4308  CB  PHE A 533     126.922 157.911 102.929  1.00  0.50           C  
ATOM   4309  CG  PHE A 533     128.186 157.295 102.401  1.00  0.50           C  
ATOM   4310  CD1 PHE A 533     128.381 155.904 102.347  1.00  0.50           C  
ATOM   4311  CD2 PHE A 533     129.238 158.142 102.013  1.00  0.50           C  
ATOM   4312  CE1 PHE A 533     129.593 155.374 101.884  1.00  0.50           C  
ATOM   4313  CE2 PHE A 533     130.449 157.617 101.550  1.00  0.50           C  
ATOM   4314  CZ  PHE A 533     130.625 156.230 101.482  1.00  0.50           C  
ATOM   4315  N   ALA A 534     124.197 157.167 104.513  1.00  0.51           N  
ATOM   4316  CA  ALA A 534     123.126 157.540 105.421  1.00  0.51           C  
ATOM   4317  C   ALA A 534     123.129 159.008 105.840  1.00  0.51           C  
ATOM   4318  O   ALA A 534     122.114 159.702 105.800  1.00  0.51           O  
ATOM   4319  CB  ALA A 534     123.264 156.672 106.690  1.00  0.51           C  
ATOM   4320  N   GLU A 535     124.327 159.520 106.187  1.00  0.56           N  
ATOM   4321  CA  GLU A 535     124.527 160.864 106.692  1.00  0.56           C  
ATOM   4322  C   GLU A 535     125.089 161.787 105.619  1.00  0.56           C  
ATOM   4323  O   GLU A 535     125.581 162.878 105.920  1.00  0.56           O  
ATOM   4324  CB  GLU A 535     125.535 160.872 107.872  1.00  0.56           C  
ATOM   4325  CG  GLU A 535     125.448 159.664 108.833  1.00  0.56           C  
ATOM   4326  CD  GLU A 535     124.142 159.578 109.621  1.00  0.56           C  
ATOM   4327  OE1 GLU A 535     123.370 160.568 109.636  1.00  0.56           O  
ATOM   4328  OE2 GLU A 535     123.939 158.501 110.238  1.00  0.56           O  
ATOM   4329  N   LYS A 536     125.072 161.345 104.339  1.00  0.62           N  
ATOM   4330  CA  LYS A 536     125.623 162.041 103.182  1.00  0.62           C  
ATOM   4331  C   LYS A 536     127.143 162.225 103.216  1.00  0.62           C  
ATOM   4332  O   LYS A 536     127.890 161.427 102.659  1.00  0.62           O  
ATOM   4333  CB  LYS A 536     124.860 163.368 102.943  1.00  0.62           C  
ATOM   4334  CG  LYS A 536     125.235 164.138 101.672  1.00  0.62           C  
ATOM   4335  CD  LYS A 536     124.462 165.463 101.590  1.00  0.62           C  
ATOM   4336  CE  LYS A 536     124.918 166.384 100.462  1.00  0.62           C  
ATOM   4337  NZ  LYS A 536     124.769 165.678  99.172  1.00  0.62           N  
ATOM   4338  N   ASP A 537     127.655 163.280 103.877  1.00  0.64           N  
ATOM   4339  CA  ASP A 537     129.071 163.525 104.056  1.00  0.64           C  
ATOM   4340  C   ASP A 537     129.421 163.733 105.536  1.00  0.64           C  
ATOM   4341  O   ASP A 537     130.568 164.005 105.896  1.00  0.64           O  
ATOM   4342  CB  ASP A 537     129.566 164.667 103.118  1.00  0.64           C  
ATOM   4343  CG  ASP A 537     128.868 166.013 103.261  1.00  0.64           C  
ATOM   4344  OD1 ASP A 537     127.708 166.067 103.748  1.00  0.64           O  
ATOM   4345  OD2 ASP A 537     129.500 167.019 102.826  1.00  0.64           O  
ATOM   4346  N   ASN A 538     128.442 163.512 106.448  1.00  0.69           N  
ATOM   4347  CA  ASN A 538     128.602 163.715 107.885  1.00  0.69           C  
ATOM   4348  C   ASN A 538     128.878 162.418 108.641  1.00  0.69           C  
ATOM   4349  O   ASN A 538     128.761 162.343 109.860  1.00  0.69           O  
ATOM   4350  CB  ASN A 538     127.405 164.453 108.530  1.00  0.69           C  
ATOM   4351  CG  ASN A 538     127.287 165.822 107.876  1.00  0.69           C  
ATOM   4352  OD1 ASN A 538     128.020 166.754 108.209  1.00  0.69           O  
ATOM   4353  ND2 ASN A 538     126.362 165.946 106.899  1.00  0.69           N  
ATOM   4354  N   ILE A 539     129.258 161.346 107.922  1.00  0.65           N  
ATOM   4355  CA  ILE A 539     129.555 160.037 108.487  1.00  0.65           C  
ATOM   4356  C   ILE A 539     130.747 160.058 109.429  1.00  0.65           C  
ATOM   4357  O   ILE A 539     131.813 160.579 109.099  1.00  0.65           O  
ATOM   4358  CB  ILE A 539     129.781 158.958 107.423  1.00  0.65           C  
ATOM   4359  CG1 ILE A 539     128.668 158.966 106.359  1.00  0.65           C  
ATOM   4360  CG2 ILE A 539     129.833 157.556 108.067  1.00  0.65           C  
ATOM   4361  CD1 ILE A 539     129.009 159.803 105.132  1.00  0.65           C  
ATOM   4362  N   VAL A 540     130.591 159.452 110.624  1.00  0.73           N  
ATOM   4363  CA  VAL A 540     131.662 159.288 111.588  1.00  0.73           C  
ATOM   4364  C   VAL A 540     132.616 158.198 111.129  1.00  0.73           C  
ATOM   4365  O   VAL A 540     132.318 157.003 111.166  1.00  0.73           O  
ATOM   4366  CB  VAL A 540     131.132 158.973 112.985  1.00  0.73           C  
ATOM   4367  CG1 VAL A 540     132.287 158.871 114.001  1.00  0.73           C  
ATOM   4368  CG2 VAL A 540     130.158 160.085 113.414  1.00  0.73           C  
ATOM   4369  N   LEU A 541     133.813 158.587 110.668  1.00  0.77           N  
ATOM   4370  CA  LEU A 541     134.823 157.648 110.250  1.00  0.77           C  
ATOM   4371  C   LEU A 541     135.613 157.139 111.444  1.00  0.77           C  
ATOM   4372  O   LEU A 541     135.960 157.876 112.369  1.00  0.77           O  
ATOM   4373  CB  LEU A 541     135.805 158.277 109.237  1.00  0.77           C  
ATOM   4374  CG  LEU A 541     135.164 158.845 107.955  1.00  0.77           C  
ATOM   4375  CD1 LEU A 541     136.271 159.491 107.114  1.00  0.77           C  
ATOM   4376  CD2 LEU A 541     134.391 157.794 107.147  1.00  0.77           C  
ATOM   4377  N   GLY A 542     135.912 155.823 111.456  1.00  0.70           N  
ATOM   4378  CA  GLY A 542     136.780 155.226 112.462  1.00  0.70           C  
ATOM   4379  C   GLY A 542     138.241 155.502 112.213  1.00  0.70           C  
ATOM   4380  O   GLY A 542     138.627 156.047 111.181  1.00  0.70           O  
ATOM   4381  N   GLU A 543     139.118 155.065 113.138  1.00  0.63           N  
ATOM   4382  CA  GLU A 543     140.560 155.206 112.971  1.00  0.63           C  
ATOM   4383  C   GLU A 543     141.058 154.356 111.818  1.00  0.63           C  
ATOM   4384  O   GLU A 543     140.831 153.152 111.767  1.00  0.63           O  
ATOM   4385  CB  GLU A 543     141.325 154.874 114.277  1.00  0.63           C  
ATOM   4386  CG  GLU A 543     142.755 155.476 114.395  1.00  0.63           C  
ATOM   4387  CD  GLU A 543     143.854 154.839 113.547  1.00  0.63           C  
ATOM   4388  OE1 GLU A 543     144.218 153.663 113.772  1.00  0.63           O  
ATOM   4389  OE2 GLU A 543     144.416 155.534 112.657  1.00  0.63           O  
ATOM   4390  N   GLY A 544     141.676 154.985 110.801  1.00  0.73           N  
ATOM   4391  CA  GLY A 544     142.100 154.284 109.597  1.00  0.73           C  
ATOM   4392  C   GLY A 544     141.021 154.059 108.564  1.00  0.73           C  
ATOM   4393  O   GLY A 544     141.284 153.519 107.493  1.00  0.73           O  
ATOM   4394  N   GLY A 545     139.769 154.496 108.820  1.00  0.75           N  
ATOM   4395  CA  GLY A 545     138.711 154.461 107.813  1.00  0.75           C  
ATOM   4396  C   GLY A 545     138.219 153.086 107.403  1.00  0.75           C  
ATOM   4397  O   GLY A 545     138.047 152.823 106.213  1.00  0.75           O  
ATOM   4398  N   ILE A 546     137.970 152.172 108.368  1.00  0.63           N  
ATOM   4399  CA  ILE A 546     137.545 150.782 108.145  1.00  0.63           C  
ATOM   4400  C   ILE A 546     136.259 150.657 107.331  1.00  0.63           C  
ATOM   4401  O   ILE A 546     136.132 149.812 106.453  1.00  0.63           O  
ATOM   4402  CB  ILE A 546     137.363 150.031 109.471  1.00  0.63           C  
ATOM   4403  CG1 ILE A 546     138.626 150.111 110.357  1.00  0.63           C  
ATOM   4404  CG2 ILE A 546     137.013 148.546 109.221  1.00  0.63           C  
ATOM   4405  CD1 ILE A 546     138.506 151.108 111.511  1.00  0.63           C  
ATOM   4406  N   THR A 547     135.293 151.560 107.584  1.00  0.70           N  
ATOM   4407  CA  THR A 547     133.992 151.635 106.913  1.00  0.70           C  
ATOM   4408  C   THR A 547     134.081 151.975 105.423  1.00  0.70           C  
ATOM   4409  O   THR A 547     133.166 151.729 104.644  1.00  0.70           O  
ATOM   4410  CB  THR A 547     133.083 152.626 107.659  1.00  0.70           C  
ATOM   4411  OG1 THR A 547     131.773 152.711 107.124  1.00  0.70           O  
ATOM   4412  CG2 THR A 547     133.661 154.049 107.682  1.00  0.70           C  
ATOM   4413  N   LEU A 548     135.222 152.531 104.971  1.00  0.78           N  
ATOM   4414  CA  LEU A 548     135.407 152.940 103.595  1.00  0.78           C  
ATOM   4415  C   LEU A 548     136.102 151.902 102.723  1.00  0.78           C  
ATOM   4416  O   LEU A 548     136.877 151.051 103.162  1.00  0.78           O  
ATOM   4417  CB  LEU A 548     136.239 154.241 103.524  1.00  0.78           C  
ATOM   4418  CG  LEU A 548     135.580 155.462 104.188  1.00  0.78           C  
ATOM   4419  CD1 LEU A 548     136.567 156.632 104.200  1.00  0.78           C  
ATOM   4420  CD2 LEU A 548     134.280 155.871 103.486  1.00  0.78           C  
ATOM   4421  N   SER A 549     135.855 151.989 101.406  1.00  0.79           N  
ATOM   4422  CA  SER A 549     136.528 151.209 100.377  1.00  0.79           C  
ATOM   4423  C   SER A 549     137.958 151.668 100.121  1.00  0.79           C  
ATOM   4424  O   SER A 549     138.335 152.808 100.401  1.00  0.79           O  
ATOM   4425  CB  SER A 549     135.714 151.279  99.060  1.00  0.79           C  
ATOM   4426  OG  SER A 549     136.302 150.573  97.964  1.00  0.79           O  
ATOM   4427  N   GLY A 550     138.813 150.782  99.554  1.00  0.81           N  
ATOM   4428  CA  GLY A 550     140.203 151.090  99.212  1.00  0.81           C  
ATOM   4429  C   GLY A 550     140.407 152.297  98.331  1.00  0.81           C  
ATOM   4430  O   GLY A 550     141.274 153.134  98.576  1.00  0.81           O  
ATOM   4431  N   GLY A 551     139.568 152.434  97.285  1.00  0.83           N  
ATOM   4432  CA  GLY A 551     139.635 153.573  96.375  1.00  0.83           C  
ATOM   4433  C   GLY A 551     138.973 154.820  96.904  1.00  0.83           C  
ATOM   4434  O   GLY A 551     139.311 155.929  96.505  1.00  0.83           O  
ATOM   4435  N   GLN A 552     138.022 154.681  97.850  1.00  0.80           N  
ATOM   4436  CA  GLN A 552     137.403 155.815  98.519  1.00  0.80           C  
ATOM   4437  C   GLN A 552     138.382 156.527  99.451  1.00  0.80           C  
ATOM   4438  O   GLN A 552     138.489 157.752  99.452  1.00  0.80           O  
ATOM   4439  CB  GLN A 552     136.125 155.386  99.284  1.00  0.80           C  
ATOM   4440  CG  GLN A 552     134.956 154.980  98.350  1.00  0.80           C  
ATOM   4441  CD  GLN A 552     133.793 154.352  99.125  1.00  0.80           C  
ATOM   4442  OE1 GLN A 552     133.966 153.879 100.250  1.00  0.80           O  
ATOM   4443  NE2 GLN A 552     132.604 154.276  98.488  1.00  0.80           N  
ATOM   4444  N   ARG A 553     139.185 155.755 100.220  1.00  0.76           N  
ATOM   4445  CA  ARG A 553     140.268 156.282 101.043  1.00  0.76           C  
ATOM   4446  C   ARG A 553     141.337 157.025 100.236  1.00  0.76           C  
ATOM   4447  O   ARG A 553     141.834 158.071 100.653  1.00  0.76           O  
ATOM   4448  CB  ARG A 553     140.949 155.164 101.884  1.00  0.76           C  
ATOM   4449  CG  ARG A 553     140.049 154.567 102.990  1.00  0.76           C  
ATOM   4450  CD  ARG A 553     140.767 153.650 103.996  1.00  0.76           C  
ATOM   4451  NE  ARG A 553     141.078 152.358 103.298  1.00  0.76           N  
ATOM   4452  CZ  ARG A 553     140.379 151.223 103.445  1.00  0.76           C  
ATOM   4453  NH1 ARG A 553     139.377 151.090 104.303  1.00  0.76           N  
ATOM   4454  NH2 ARG A 553     140.704 150.169 102.697  1.00  0.76           N  
ATOM   4455  N   ALA A 554     141.701 156.517  99.039  1.00  0.83           N  
ATOM   4456  CA  ALA A 554     142.586 157.202  98.110  1.00  0.83           C  
ATOM   4457  C   ALA A 554     142.060 158.555  97.629  1.00  0.83           C  
ATOM   4458  O   ALA A 554     142.767 159.561  97.663  1.00  0.83           O  
ATOM   4459  CB  ALA A 554     142.856 156.280  96.905  1.00  0.83           C  
ATOM   4460  N   ARG A 555     140.775 158.633  97.234  1.00  0.79           N  
ATOM   4461  CA  ARG A 555     140.146 159.887  96.855  1.00  0.79           C  
ATOM   4462  C   ARG A 555     140.039 160.924  97.968  1.00  0.79           C  
ATOM   4463  O   ARG A 555     140.296 162.104  97.745  1.00  0.79           O  
ATOM   4464  CB  ARG A 555     138.738 159.647  96.286  1.00  0.79           C  
ATOM   4465  CG  ARG A 555     138.725 158.974  94.907  1.00  0.79           C  
ATOM   4466  CD  ARG A 555     137.322 158.993  94.289  1.00  0.79           C  
ATOM   4467  NE  ARG A 555     136.436 158.005  94.983  1.00  0.79           N  
ATOM   4468  CZ  ARG A 555     136.173 156.794  94.483  1.00  0.79           C  
ATOM   4469  NH1 ARG A 555     136.807 156.358  93.412  1.00  0.79           N  
ATOM   4470  NH2 ARG A 555     135.252 156.028  95.038  1.00  0.79           N  
ATOM   4471  N   ILE A 556     139.676 160.521  99.203  1.00  0.83           N  
ATOM   4472  CA  ILE A 556     139.667 161.412 100.365  1.00  0.83           C  
ATOM   4473  C   ILE A 556     141.059 161.945 100.690  1.00  0.83           C  
ATOM   4474  O   ILE A 556     141.249 163.135 100.941  1.00  0.83           O  
ATOM   4475  CB  ILE A 556     139.021 160.728 101.572  1.00  0.83           C  
ATOM   4476  CG1 ILE A 556     137.516 160.518 101.281  1.00  0.83           C  
ATOM   4477  CG2 ILE A 556     139.221 161.537 102.874  1.00  0.83           C  
ATOM   4478  CD1 ILE A 556     136.774 159.738 102.367  1.00  0.83           C  
ATOM   4479  N   SER A 557     142.094 161.080 100.636  1.00  0.83           N  
ATOM   4480  CA  SER A 557     143.484 161.496 100.807  1.00  0.83           C  
ATOM   4481  C   SER A 557     143.953 162.486  99.739  1.00  0.83           C  
ATOM   4482  O   SER A 557     144.559 163.514 100.044  1.00  0.83           O  
ATOM   4483  CB  SER A 557     144.436 160.273 100.831  1.00  0.83           C  
ATOM   4484  OG  SER A 557     145.712 160.598 101.394  1.00  0.83           O  
ATOM   4485  N   LEU A 558     143.618 162.229  98.454  1.00  0.83           N  
ATOM   4486  CA  LEU A 558     143.869 163.151  97.352  1.00  0.83           C  
ATOM   4487  C   LEU A 558     143.132 164.488  97.451  1.00  0.83           C  
ATOM   4488  O   LEU A 558     143.726 165.554  97.288  1.00  0.83           O  
ATOM   4489  CB  LEU A 558     143.521 162.471  95.999  1.00  0.83           C  
ATOM   4490  CG  LEU A 558     143.867 163.281  94.728  1.00  0.83           C  
ATOM   4491  CD1 LEU A 558     145.347 163.676  94.674  1.00  0.83           C  
ATOM   4492  CD2 LEU A 558     143.484 162.514  93.453  1.00  0.83           C  
ATOM   4493  N   ALA A 559     141.821 164.474  97.774  1.00  0.87           N  
ATOM   4494  CA  ALA A 559     140.997 165.658  97.946  1.00  0.87           C  
ATOM   4495  C   ALA A 559     141.480 166.585  99.062  1.00  0.87           C  
ATOM   4496  O   ALA A 559     141.465 167.807  98.928  1.00  0.87           O  
ATOM   4497  CB  ALA A 559     139.530 165.242  98.144  1.00  0.87           C  
ATOM   4498  N   ARG A 560     141.975 166.012 100.174  1.00  0.80           N  
ATOM   4499  CA  ARG A 560     142.643 166.743 101.240  1.00  0.80           C  
ATOM   4500  C   ARG A 560     143.902 167.499 100.800  1.00  0.80           C  
ATOM   4501  O   ARG A 560     144.107 168.663 101.142  1.00  0.80           O  
ATOM   4502  CB  ARG A 560     143.007 165.733 102.356  1.00  0.80           C  
ATOM   4503  CG  ARG A 560     143.722 166.338 103.578  1.00  0.80           C  
ATOM   4504  CD  ARG A 560     143.866 165.377 104.766  1.00  0.80           C  
ATOM   4505  NE  ARG A 560     144.644 164.171 104.313  1.00  0.80           N  
ATOM   4506  CZ  ARG A 560     144.536 162.953 104.860  1.00  0.80           C  
ATOM   4507  NH1 ARG A 560     143.728 162.702 105.886  1.00  0.80           N  
ATOM   4508  NH2 ARG A 560     145.220 161.926 104.360  1.00  0.80           N  
ATOM   4509  N   ALA A 561     144.777 166.864  99.992  1.00  0.85           N  
ATOM   4510  CA  ALA A 561     145.978 167.494  99.471  1.00  0.85           C  
ATOM   4511  C   ALA A 561     145.724 168.678  98.540  1.00  0.85           C  
ATOM   4512  O   ALA A 561     146.401 169.702  98.625  1.00  0.85           O  
ATOM   4513  CB  ALA A 561     146.855 166.442  98.765  1.00  0.85           C  
ATOM   4514  N   VAL A 562     144.734 168.561  97.630  1.00  0.84           N  
ATOM   4515  CA  VAL A 562     144.392 169.612  96.675  1.00  0.84           C  
ATOM   4516  C   VAL A 562     143.594 170.770  97.274  1.00  0.84           C  
ATOM   4517  O   VAL A 562     143.633 171.889  96.767  1.00  0.84           O  
ATOM   4518  CB  VAL A 562     143.664 169.069  95.442  1.00  0.84           C  
ATOM   4519  CG1 VAL A 562     144.488 167.938  94.800  1.00  0.84           C  
ATOM   4520  CG2 VAL A 562     142.262 168.550  95.790  1.00  0.84           C  
ATOM   4521  N   TYR A 563     142.854 170.548  98.385  1.00  0.80           N  
ATOM   4522  CA  TYR A 563     142.117 171.587  99.098  1.00  0.80           C  
ATOM   4523  C   TYR A 563     143.036 172.625  99.744  1.00  0.80           C  
ATOM   4524  O   TYR A 563     142.759 173.831  99.763  1.00  0.80           O  
ATOM   4525  CB  TYR A 563     141.195 170.934 100.166  1.00  0.80           C  
ATOM   4526  CG  TYR A 563     140.272 171.925 100.829  1.00  0.80           C  
ATOM   4527  CD1 TYR A 563     139.085 172.356 100.208  1.00  0.80           C  
ATOM   4528  CD2 TYR A 563     140.613 172.456 102.083  1.00  0.80           C  
ATOM   4529  CE1 TYR A 563     138.267 173.315 100.828  1.00  0.80           C  
ATOM   4530  CE2 TYR A 563     139.794 173.416 102.691  1.00  0.80           C  
ATOM   4531  CZ  TYR A 563     138.628 173.850 102.068  1.00  0.80           C  
ATOM   4532  OH  TYR A 563     137.826 174.806 102.722  1.00  0.80           O  
ATOM   4533  N   LYS A 564     144.161 172.152 100.313  1.00  0.78           N  
ATOM   4534  CA  LYS A 564     145.186 172.997 100.882  1.00  0.78           C  
ATOM   4535  C   LYS A 564     145.879 173.880  99.857  1.00  0.78           C  
ATOM   4536  O   LYS A 564     146.387 173.429  98.828  1.00  0.78           O  
ATOM   4537  CB  LYS A 564     146.243 172.156 101.641  1.00  0.78           C  
ATOM   4538  CG  LYS A 564     147.319 172.988 102.365  1.00  0.78           C  
ATOM   4539  CD  LYS A 564     148.312 172.125 103.160  1.00  0.78           C  
ATOM   4540  CE  LYS A 564     149.430 172.910 103.851  1.00  0.78           C  
ATOM   4541  NZ  LYS A 564     150.288 173.565 102.841  1.00  0.78           N  
ATOM   4542  N   ASP A 565     145.958 175.195 100.144  1.00  0.76           N  
ATOM   4543  CA  ASP A 565     146.783 176.079  99.355  1.00  0.76           C  
ATOM   4544  C   ASP A 565     148.266 175.880  99.688  1.00  0.76           C  
ATOM   4545  O   ASP A 565     148.700 175.794 100.845  1.00  0.76           O  
ATOM   4546  CB  ASP A 565     146.328 177.554  99.446  1.00  0.76           C  
ATOM   4547  CG  ASP A 565     147.057 178.380  98.409  1.00  0.76           C  
ATOM   4548  OD1 ASP A 565     146.917 178.034  97.210  1.00  0.76           O  
ATOM   4549  OD2 ASP A 565     147.793 179.323  98.771  1.00  0.76           O  
ATOM   4550  N   ALA A 566     149.071 175.745  98.631  1.00  0.79           N  
ATOM   4551  CA  ALA A 566     150.487 175.577  98.722  1.00  0.79           C  
ATOM   4552  C   ALA A 566     151.105 175.953  97.389  1.00  0.79           C  
ATOM   4553  O   ALA A 566     150.406 176.271  96.423  1.00  0.79           O  
ATOM   4554  CB  ALA A 566     150.850 174.140  99.129  1.00  0.79           C  
ATOM   4555  N   ASP A 567     152.450 175.977  97.340  1.00  0.75           N  
ATOM   4556  CA  ASP A 567     153.207 176.236  96.133  1.00  0.75           C  
ATOM   4557  C   ASP A 567     153.413 174.911  95.392  1.00  0.75           C  
ATOM   4558  O   ASP A 567     152.994 174.745  94.248  1.00  0.75           O  
ATOM   4559  CB  ASP A 567     154.543 176.883  96.604  1.00  0.75           C  
ATOM   4560  CG  ASP A 567     155.251 177.747  95.573  1.00  0.75           C  
ATOM   4561  OD1 ASP A 567     154.691 177.980  94.479  1.00  0.75           O  
ATOM   4562  OD2 ASP A 567     156.324 178.290  95.952  1.00  0.75           O  
ATOM   4563  N   LEU A 568     153.975 173.907  96.108  1.00  0.79           N  
ATOM   4564  CA  LEU A 568     154.350 172.619  95.551  1.00  0.79           C  
ATOM   4565  C   LEU A 568     153.455 171.491  96.043  1.00  0.79           C  
ATOM   4566  O   LEU A 568     153.167 171.344  97.232  1.00  0.79           O  
ATOM   4567  CB  LEU A 568     155.825 172.282  95.907  1.00  0.79           C  
ATOM   4568  CG  LEU A 568     156.402 170.973  95.316  1.00  0.79           C  
ATOM   4569  CD1 LEU A 568     156.419 170.984  93.786  1.00  0.79           C  
ATOM   4570  CD2 LEU A 568     157.822 170.704  95.834  1.00  0.79           C  
ATOM   4571  N   TYR A 569     152.996 170.640  95.109  1.00  0.82           N  
ATOM   4572  CA  TYR A 569     152.114 169.525  95.392  1.00  0.82           C  
ATOM   4573  C   TYR A 569     152.809 168.217  95.037  1.00  0.82           C  
ATOM   4574  O   TYR A 569     153.209 167.983  93.897  1.00  0.82           O  
ATOM   4575  CB  TYR A 569     150.804 169.639  94.570  1.00  0.82           C  
ATOM   4576  CG  TYR A 569     149.967 170.797  95.050  1.00  0.82           C  
ATOM   4577  CD1 TYR A 569     150.278 172.113  94.666  1.00  0.82           C  
ATOM   4578  CD2 TYR A 569     148.862 170.583  95.893  1.00  0.82           C  
ATOM   4579  CE1 TYR A 569     149.527 173.192  95.143  1.00  0.82           C  
ATOM   4580  CE2 TYR A 569     148.093 171.664  96.351  1.00  0.82           C  
ATOM   4581  CZ  TYR A 569     148.428 172.971  95.975  1.00  0.82           C  
ATOM   4582  OH  TYR A 569     147.662 174.063  96.436  1.00  0.82           O  
ATOM   4583  N   LEU A 570     152.969 167.315  96.022  1.00  0.84           N  
ATOM   4584  CA  LEU A 570     153.634 166.038  95.841  1.00  0.84           C  
ATOM   4585  C   LEU A 570     152.617 164.919  95.910  1.00  0.84           C  
ATOM   4586  O   LEU A 570     151.985 164.688  96.942  1.00  0.84           O  
ATOM   4587  CB  LEU A 570     154.688 165.792  96.945  1.00  0.84           C  
ATOM   4588  CG  LEU A 570     155.784 166.869  97.042  1.00  0.84           C  
ATOM   4589  CD1 LEU A 570     156.728 166.546  98.205  1.00  0.84           C  
ATOM   4590  CD2 LEU A 570     156.570 167.041  95.739  1.00  0.84           C  
ATOM   4591  N   LEU A 571     152.421 164.198  94.793  1.00  0.84           N  
ATOM   4592  CA  LEU A 571     151.402 163.176  94.700  1.00  0.84           C  
ATOM   4593  C   LEU A 571     152.055 161.823  94.452  1.00  0.84           C  
ATOM   4594  O   LEU A 571     152.476 161.502  93.336  1.00  0.84           O  
ATOM   4595  CB  LEU A 571     150.423 163.529  93.550  1.00  0.84           C  
ATOM   4596  CG  LEU A 571     149.769 164.927  93.669  1.00  0.84           C  
ATOM   4597  CD1 LEU A 571     148.960 165.262  92.409  1.00  0.84           C  
ATOM   4598  CD2 LEU A 571     148.892 165.073  94.918  1.00  0.84           C  
ATOM   4599  N   ASP A 572     152.139 160.975  95.500  1.00  0.82           N  
ATOM   4600  CA  ASP A 572     152.777 159.674  95.413  1.00  0.82           C  
ATOM   4601  C   ASP A 572     151.774 158.612  94.957  1.00  0.82           C  
ATOM   4602  O   ASP A 572     151.186 157.871  95.742  1.00  0.82           O  
ATOM   4603  CB  ASP A 572     153.434 159.313  96.771  1.00  0.82           C  
ATOM   4604  CG  ASP A 572     154.454 158.185  96.651  1.00  0.82           C  
ATOM   4605  OD1 ASP A 572     154.797 157.780  95.508  1.00  0.82           O  
ATOM   4606  OD2 ASP A 572     154.925 157.724  97.721  1.00  0.82           O  
ATOM   4607  N   SER A 573     151.549 158.539  93.630  1.00  0.83           N  
ATOM   4608  CA  SER A 573     150.724 157.526  92.978  1.00  0.83           C  
ATOM   4609  C   SER A 573     149.282 157.355  93.489  1.00  0.83           C  
ATOM   4610  O   SER A 573     148.897 156.261  93.921  1.00  0.83           O  
ATOM   4611  CB  SER A 573     151.469 156.170  92.947  1.00  0.83           C  
ATOM   4612  OG  SER A 573     150.963 155.305  91.924  1.00  0.83           O  
ATOM   4613  N   PRO A 574     148.419 158.385  93.463  1.00  0.81           N  
ATOM   4614  CA  PRO A 574     147.077 158.325  94.050  1.00  0.81           C  
ATOM   4615  C   PRO A 574     146.114 157.484  93.225  1.00  0.81           C  
ATOM   4616  O   PRO A 574     144.992 157.237  93.662  1.00  0.81           O  
ATOM   4617  CB  PRO A 574     146.649 159.805  94.076  1.00  0.81           C  
ATOM   4618  CG  PRO A 574     147.359 160.434  92.874  1.00  0.81           C  
ATOM   4619  CD  PRO A 574     148.689 159.682  92.826  1.00  0.81           C  
ATOM   4620  N   PHE A 575     146.522 157.042  92.026  1.00  0.78           N  
ATOM   4621  CA  PHE A 575     145.672 156.364  91.067  1.00  0.78           C  
ATOM   4622  C   PHE A 575     145.837 154.847  91.099  1.00  0.78           C  
ATOM   4623  O   PHE A 575     145.404 154.147  90.192  1.00  0.78           O  
ATOM   4624  CB  PHE A 575     145.949 156.897  89.632  1.00  0.78           C  
ATOM   4625  CG  PHE A 575     145.741 158.389  89.473  1.00  0.78           C  
ATOM   4626  CD1 PHE A 575     144.753 159.092  90.187  1.00  0.78           C  
ATOM   4627  CD2 PHE A 575     146.514 159.095  88.533  1.00  0.78           C  
ATOM   4628  CE1 PHE A 575     144.548 160.460  89.976  1.00  0.78           C  
ATOM   4629  CE2 PHE A 575     146.314 160.466  88.318  1.00  0.78           C  
ATOM   4630  CZ  PHE A 575     145.328 161.148  89.040  1.00  0.78           C  
ATOM   4631  N   GLY A 576     146.453 154.282  92.162  1.00  0.78           N  
ATOM   4632  CA  GLY A 576     146.689 152.835  92.254  1.00  0.78           C  
ATOM   4633  C   GLY A 576     145.466 151.964  92.443  1.00  0.78           C  
ATOM   4634  O   GLY A 576     145.384 150.864  91.921  1.00  0.78           O  
ATOM   4635  N   TYR A 577     144.457 152.435  93.197  1.00  0.78           N  
ATOM   4636  CA  TYR A 577     143.260 151.652  93.486  1.00  0.78           C  
ATOM   4637  C   TYR A 577     142.060 152.140  92.702  1.00  0.78           C  
ATOM   4638  O   TYR A 577     140.916 151.934  93.117  1.00  0.78           O  
ATOM   4639  CB  TYR A 577     142.872 151.747  94.986  1.00  0.78           C  
ATOM   4640  CG  TYR A 577     143.938 151.189  95.874  1.00  0.78           C  
ATOM   4641  CD1 TYR A 577     144.261 149.823  95.826  1.00  0.78           C  
ATOM   4642  CD2 TYR A 577     144.593 152.019  96.798  1.00  0.78           C  
ATOM   4643  CE1 TYR A 577     145.218 149.292  96.701  1.00  0.78           C  
ATOM   4644  CE2 TYR A 577     145.562 151.493  97.663  1.00  0.78           C  
ATOM   4645  CZ  TYR A 577     145.868 150.128  97.615  1.00  0.78           C  
ATOM   4646  OH  TYR A 577     146.832 149.593  98.486  1.00  0.78           O  
ATOM   4647  N   LEU A 578     142.282 152.844  91.579  1.00  0.79           N  
ATOM   4648  CA  LEU A 578     141.213 153.432  90.805  1.00  0.79           C  
ATOM   4649  C   LEU A 578     141.094 152.768  89.452  1.00  0.79           C  
ATOM   4650  O   LEU A 578     142.065 152.377  88.813  1.00  0.79           O  
ATOM   4651  CB  LEU A 578     141.365 154.960  90.609  1.00  0.79           C  
ATOM   4652  CG  LEU A 578     141.448 155.795  91.905  1.00  0.79           C  
ATOM   4653  CD1 LEU A 578     141.528 157.284  91.553  1.00  0.79           C  
ATOM   4654  CD2 LEU A 578     140.278 155.556  92.869  1.00  0.79           C  
ATOM   4655  N   ASP A 579     139.846 152.629  88.976  1.00  0.82           N  
ATOM   4656  CA  ASP A 579     139.543 152.180  87.644  1.00  0.82           C  
ATOM   4657  C   ASP A 579     139.939 153.193  86.569  1.00  0.82           C  
ATOM   4658  O   ASP A 579     140.046 154.393  86.824  1.00  0.82           O  
ATOM   4659  CB  ASP A 579     138.045 151.794  87.551  1.00  0.82           C  
ATOM   4660  CG  ASP A 579     137.166 152.948  88.002  1.00  0.82           C  
ATOM   4661  OD1 ASP A 579     136.989 153.129  89.242  1.00  0.82           O  
ATOM   4662  OD2 ASP A 579     136.665 153.693  87.123  1.00  0.82           O  
ATOM   4663  N   VAL A 580     140.149 152.718  85.322  1.00  0.80           N  
ATOM   4664  CA  VAL A 580     140.590 153.524  84.189  1.00  0.80           C  
ATOM   4665  C   VAL A 580     139.708 154.729  83.897  1.00  0.80           C  
ATOM   4666  O   VAL A 580     140.192 155.797  83.527  1.00  0.80           O  
ATOM   4667  CB  VAL A 580     140.745 152.691  82.912  1.00  0.80           C  
ATOM   4668  CG1 VAL A 580     141.857 151.650  83.126  1.00  0.80           C  
ATOM   4669  CG2 VAL A 580     139.434 151.997  82.491  1.00  0.80           C  
ATOM   4670  N   LEU A 581     138.376 154.598  84.067  1.00  0.78           N  
ATOM   4671  CA  LEU A 581     137.460 155.693  83.828  1.00  0.78           C  
ATOM   4672  C   LEU A 581     137.562 156.782  84.890  1.00  0.78           C  
ATOM   4673  O   LEU A 581     137.830 157.939  84.567  1.00  0.78           O  
ATOM   4674  CB  LEU A 581     136.019 155.144  83.725  1.00  0.78           C  
ATOM   4675  CG  LEU A 581     134.943 156.178  83.335  1.00  0.78           C  
ATOM   4676  CD1 LEU A 581     135.285 156.947  82.052  1.00  0.78           C  
ATOM   4677  CD2 LEU A 581     133.569 155.509  83.189  1.00  0.78           C  
ATOM   4678  N   THR A 582     137.478 156.413  86.193  1.00  0.80           N  
ATOM   4679  CA  THR A 582     137.656 157.347  87.312  1.00  0.80           C  
ATOM   4680  C   THR A 582     139.049 158.004  87.286  1.00  0.80           C  
ATOM   4681  O   THR A 582     139.188 159.212  87.490  1.00  0.80           O  
ATOM   4682  CB  THR A 582     137.452 156.707  88.707  1.00  0.80           C  
ATOM   4683  OG1 THR A 582     136.166 156.114  88.905  1.00  0.80           O  
ATOM   4684  CG2 THR A 582     137.654 157.757  89.822  1.00  0.80           C  
ATOM   4685  N   GLU A 583     140.132 157.236  86.994  1.00  0.79           N  
ATOM   4686  CA  GLU A 583     141.498 157.750  86.850  1.00  0.79           C  
ATOM   4687  C   GLU A 583     141.624 158.813  85.765  1.00  0.79           C  
ATOM   4688  O   GLU A 583     142.178 159.894  85.985  1.00  0.79           O  
ATOM   4689  CB  GLU A 583     142.508 156.601  86.521  1.00  0.79           C  
ATOM   4690  CG  GLU A 583     143.976 157.079  86.311  1.00  0.79           C  
ATOM   4691  CD  GLU A 583     145.038 156.020  85.989  1.00  0.79           C  
ATOM   4692  OE1 GLU A 583     144.723 154.868  85.595  1.00  0.79           O  
ATOM   4693  OE2 GLU A 583     146.234 156.411  86.100  1.00  0.79           O  
ATOM   4694  N   LYS A 584     141.053 158.552  84.571  1.00  0.78           N  
ATOM   4695  CA  LYS A 584     141.072 159.492  83.467  1.00  0.78           C  
ATOM   4696  C   LYS A 584     140.380 160.812  83.776  1.00  0.78           C  
ATOM   4697  O   LYS A 584     140.960 161.883  83.587  1.00  0.78           O  
ATOM   4698  CB  LYS A 584     140.419 158.853  82.218  1.00  0.78           C  
ATOM   4699  CG  LYS A 584     140.451 159.770  80.988  1.00  0.78           C  
ATOM   4700  CD  LYS A 584     139.980 159.088  79.700  1.00  0.78           C  
ATOM   4701  CE  LYS A 584     140.026 160.015  78.481  1.00  0.78           C  
ATOM   4702  NZ  LYS A 584     139.151 161.188  78.651  1.00  0.78           N  
ATOM   4703  N   GLU A 585     139.151 160.759  84.331  1.00  0.77           N  
ATOM   4704  CA  GLU A 585     138.378 161.935  84.689  1.00  0.77           C  
ATOM   4705  C   GLU A 585     139.057 162.816  85.735  1.00  0.77           C  
ATOM   4706  O   GLU A 585     139.169 164.027  85.560  1.00  0.77           O  
ATOM   4707  CB  GLU A 585     136.989 161.516  85.223  1.00  0.77           C  
ATOM   4708  CG  GLU A 585     136.083 160.823  84.174  1.00  0.77           C  
ATOM   4709  CD  GLU A 585     134.781 160.280  84.769  1.00  0.77           C  
ATOM   4710  OE1 GLU A 585     134.715 160.088  86.012  1.00  0.77           O  
ATOM   4711  OE2 GLU A 585     133.850 160.030  83.959  1.00  0.77           O  
ATOM   4712  N   ILE A 586     139.597 162.227  86.829  1.00  0.82           N  
ATOM   4713  CA  ILE A 586     140.340 162.961  87.860  1.00  0.82           C  
ATOM   4714  C   ILE A 586     141.601 163.616  87.311  1.00  0.82           C  
ATOM   4715  O   ILE A 586     141.914 164.774  87.601  1.00  0.82           O  
ATOM   4716  CB  ILE A 586     140.703 162.079  89.066  1.00  0.82           C  
ATOM   4717  CG1 ILE A 586     139.417 161.595  89.773  1.00  0.82           C  
ATOM   4718  CG2 ILE A 586     141.591 162.854  90.068  1.00  0.82           C  
ATOM   4719  CD1 ILE A 586     139.660 160.689  90.986  1.00  0.82           C  
ATOM   4720  N   PHE A 587     142.370 162.906  86.467  1.00  0.79           N  
ATOM   4721  CA  PHE A 587     143.574 163.453  85.870  1.00  0.79           C  
ATOM   4722  C   PHE A 587     143.304 164.676  84.984  1.00  0.79           C  
ATOM   4723  O   PHE A 587     143.986 165.699  85.076  1.00  0.79           O  
ATOM   4724  CB  PHE A 587     144.299 162.320  85.093  1.00  0.79           C  
ATOM   4725  CG  PHE A 587     145.636 162.734  84.544  1.00  0.79           C  
ATOM   4726  CD1 PHE A 587     146.637 163.243  85.387  1.00  0.79           C  
ATOM   4727  CD2 PHE A 587     145.902 162.599  83.172  1.00  0.79           C  
ATOM   4728  CE1 PHE A 587     147.866 163.660  84.860  1.00  0.79           C  
ATOM   4729  CE2 PHE A 587     147.140 162.989  82.647  1.00  0.79           C  
ATOM   4730  CZ  PHE A 587     148.116 163.536  83.488  1.00  0.79           C  
ATOM   4731  N   GLU A 588     142.262 164.622  84.129  1.00  0.76           N  
ATOM   4732  CA  GLU A 588     141.956 165.699  83.204  1.00  0.76           C  
ATOM   4733  C   GLU A 588     141.107 166.828  83.797  1.00  0.76           C  
ATOM   4734  O   GLU A 588     141.072 167.932  83.246  1.00  0.76           O  
ATOM   4735  CB  GLU A 588     141.428 165.117  81.856  1.00  0.76           C  
ATOM   4736  CG  GLU A 588     140.010 164.483  81.821  1.00  0.76           C  
ATOM   4737  CD  GLU A 588     139.811 163.529  80.639  1.00  0.76           C  
ATOM   4738  OE1 GLU A 588     140.731 163.353  79.794  1.00  0.76           O  
ATOM   4739  OE2 GLU A 588     138.728 162.897  80.544  1.00  0.76           O  
ATOM   4740  N   SER A 589     140.461 166.622  84.969  1.00  0.79           N  
ATOM   4741  CA  SER A 589     139.630 167.645  85.609  1.00  0.79           C  
ATOM   4742  C   SER A 589     140.159 168.226  86.915  1.00  0.79           C  
ATOM   4743  O   SER A 589     139.802 169.345  87.273  1.00  0.79           O  
ATOM   4744  CB  SER A 589     138.178 167.135  85.836  1.00  0.79           C  
ATOM   4745  OG  SER A 589     138.046 166.280  86.972  1.00  0.79           O  
ATOM   4746  N   CYS A 590     141.055 167.529  87.639  1.00  0.79           N  
ATOM   4747  CA  CYS A 590     141.646 168.027  88.874  1.00  0.79           C  
ATOM   4748  C   CYS A 590     143.107 168.396  88.640  1.00  0.79           C  
ATOM   4749  O   CYS A 590     143.479 169.569  88.667  1.00  0.79           O  
ATOM   4750  CB  CYS A 590     141.463 166.992  90.021  1.00  0.79           C  
ATOM   4751  SG  CYS A 590     141.914 167.621  91.676  1.00  0.79           S  
ATOM   4752  N   VAL A 591     143.975 167.402  88.346  1.00  0.80           N  
ATOM   4753  CA  VAL A 591     145.429 167.561  88.224  1.00  0.80           C  
ATOM   4754  C   VAL A 591     145.861 168.525  87.124  1.00  0.80           C  
ATOM   4755  O   VAL A 591     146.785 169.328  87.288  1.00  0.80           O  
ATOM   4756  CB  VAL A 591     146.132 166.215  88.010  1.00  0.80           C  
ATOM   4757  CG1 VAL A 591     147.660 166.389  87.870  1.00  0.80           C  
ATOM   4758  CG2 VAL A 591     145.840 165.295  89.209  1.00  0.80           C  
ATOM   4759  N   CYS A 592     145.202 168.466  85.954  1.00  0.78           N  
ATOM   4760  CA  CYS A 592     145.568 169.297  84.819  1.00  0.78           C  
ATOM   4761  C   CYS A 592     144.692 170.524  84.637  1.00  0.78           C  
ATOM   4762  O   CYS A 592     144.979 171.361  83.786  1.00  0.78           O  
ATOM   4763  CB  CYS A 592     145.474 168.461  83.521  1.00  0.78           C  
ATOM   4764  SG  CYS A 592     146.717 167.125  83.504  1.00  0.78           S  
ATOM   4765  N   LYS A 593     143.614 170.682  85.427  1.00  0.73           N  
ATOM   4766  CA  LYS A 593     142.705 171.812  85.286  1.00  0.73           C  
ATOM   4767  C   LYS A 593     142.737 172.713  86.509  1.00  0.73           C  
ATOM   4768  O   LYS A 593     143.146 173.870  86.423  1.00  0.73           O  
ATOM   4769  CB  LYS A 593     141.282 171.292  84.971  1.00  0.73           C  
ATOM   4770  CG  LYS A 593     140.193 172.361  84.784  1.00  0.73           C  
ATOM   4771  CD  LYS A 593     138.800 171.744  84.546  1.00  0.73           C  
ATOM   4772  CE  LYS A 593     138.622 170.987  83.226  1.00  0.73           C  
ATOM   4773  NZ  LYS A 593     138.766 171.922  82.090  1.00  0.73           N  
ATOM   4774  N   LEU A 594     142.353 172.204  87.703  1.00  0.73           N  
ATOM   4775  CA  LEU A 594     142.207 173.013  88.908  1.00  0.73           C  
ATOM   4776  C   LEU A 594     143.524 173.584  89.419  1.00  0.73           C  
ATOM   4777  O   LEU A 594     143.562 174.603  90.104  1.00  0.73           O  
ATOM   4778  CB  LEU A 594     141.542 172.220  90.069  1.00  0.73           C  
ATOM   4779  CG  LEU A 594     140.051 171.864  89.891  1.00  0.73           C  
ATOM   4780  CD1 LEU A 594     139.508 171.239  91.184  1.00  0.73           C  
ATOM   4781  CD2 LEU A 594     139.189 173.077  89.521  1.00  0.73           C  
ATOM   4782  N   MET A 595     144.654 172.946  89.070  1.00  0.71           N  
ATOM   4783  CA  MET A 595     145.962 173.366  89.519  1.00  0.71           C  
ATOM   4784  C   MET A 595     146.963 173.451  88.380  1.00  0.71           C  
ATOM   4785  O   MET A 595     148.156 173.204  88.542  1.00  0.71           O  
ATOM   4786  CB  MET A 595     146.448 172.471  90.676  1.00  0.71           C  
ATOM   4787  CG  MET A 595     146.288 170.959  90.442  1.00  0.71           C  
ATOM   4788  SD  MET A 595     147.102 169.934  91.706  1.00  0.71           S  
ATOM   4789  CE  MET A 595     146.272 170.657  93.150  1.00  0.71           C  
ATOM   4790  N   ALA A 596     146.509 173.902  87.191  1.00  0.77           N  
ATOM   4791  CA  ALA A 596     147.359 174.128  86.031  1.00  0.77           C  
ATOM   4792  C   ALA A 596     148.457 175.177  86.238  1.00  0.77           C  
ATOM   4793  O   ALA A 596     149.502 175.139  85.602  1.00  0.77           O  
ATOM   4794  CB  ALA A 596     146.496 174.524  84.816  1.00  0.77           C  
ATOM   4795  N   ASN A 597     148.237 176.142  87.156  1.00  0.76           N  
ATOM   4796  CA  ASN A 597     149.163 177.233  87.425  1.00  0.76           C  
ATOM   4797  C   ASN A 597     149.973 177.009  88.713  1.00  0.76           C  
ATOM   4798  O   ASN A 597     150.604 177.934  89.219  1.00  0.76           O  
ATOM   4799  CB  ASN A 597     148.407 178.592  87.536  1.00  0.76           C  
ATOM   4800  CG  ASN A 597     147.697 178.985  86.237  1.00  0.76           C  
ATOM   4801  OD1 ASN A 597     148.229 179.610  85.316  1.00  0.76           O  
ATOM   4802  ND2 ASN A 597     146.385 178.653  86.161  1.00  0.76           N  
ATOM   4803  N   LYS A 598     149.980 175.780  89.277  1.00  0.75           N  
ATOM   4804  CA  LYS A 598     150.703 175.442  90.502  1.00  0.75           C  
ATOM   4805  C   LYS A 598     151.711 174.335  90.212  1.00  0.75           C  
ATOM   4806  O   LYS A 598     151.453 173.433  89.413  1.00  0.75           O  
ATOM   4807  CB  LYS A 598     149.737 175.007  91.642  1.00  0.75           C  
ATOM   4808  CG  LYS A 598     148.869 176.163  92.192  1.00  0.75           C  
ATOM   4809  CD  LYS A 598     147.708 175.693  93.094  1.00  0.75           C  
ATOM   4810  CE  LYS A 598     147.007 176.779  93.930  1.00  0.75           C  
ATOM   4811  NZ  LYS A 598     147.875 177.235  95.023  1.00  0.75           N  
ATOM   4812  N   THR A 599     152.923 174.390  90.813  1.00  0.80           N  
ATOM   4813  CA  THR A 599     153.948 173.361  90.614  1.00  0.80           C  
ATOM   4814  C   THR A 599     153.532 172.030  91.208  1.00  0.80           C  
ATOM   4815  O   THR A 599     152.965 171.944  92.298  1.00  0.80           O  
ATOM   4816  CB  THR A 599     155.353 173.716  91.110  1.00  0.80           C  
ATOM   4817  OG1 THR A 599     155.402 173.912  92.510  1.00  0.80           O  
ATOM   4818  CG2 THR A 599     155.810 175.033  90.491  1.00  0.80           C  
ATOM   4819  N   ARG A 600     153.771 170.922  90.493  1.00  0.78           N  
ATOM   4820  CA  ARG A 600     153.322 169.649  91.005  1.00  0.78           C  
ATOM   4821  C   ARG A 600     154.174 168.519  90.482  1.00  0.78           C  
ATOM   4822  O   ARG A 600     154.698 168.549  89.367  1.00  0.78           O  
ATOM   4823  CB  ARG A 600     151.800 169.430  90.762  1.00  0.78           C  
ATOM   4824  CG  ARG A 600     151.346 169.523  89.288  1.00  0.78           C  
ATOM   4825  CD  ARG A 600     149.997 170.239  89.097  1.00  0.78           C  
ATOM   4826  NE  ARG A 600     149.626 170.248  87.638  1.00  0.78           N  
ATOM   4827  CZ  ARG A 600     150.096 171.125  86.734  1.00  0.78           C  
ATOM   4828  NH1 ARG A 600     150.932 172.108  87.041  1.00  0.78           N  
ATOM   4829  NH2 ARG A 600     149.714 171.002  85.463  1.00  0.78           N  
ATOM   4830  N   ILE A 601     154.362 167.490  91.322  1.00  0.85           N  
ATOM   4831  CA  ILE A 601     155.172 166.334  91.004  1.00  0.85           C  
ATOM   4832  C   ILE A 601     154.283 165.124  91.170  1.00  0.85           C  
ATOM   4833  O   ILE A 601     153.674 164.905  92.220  1.00  0.85           O  
ATOM   4834  CB  ILE A 601     156.430 166.216  91.864  1.00  0.85           C  
ATOM   4835  CG1 ILE A 601     157.293 167.494  91.714  1.00  0.85           C  
ATOM   4836  CG2 ILE A 601     157.211 164.951  91.449  1.00  0.85           C  
ATOM   4837  CD1 ILE A 601     158.577 167.512  92.548  1.00  0.85           C  
ATOM   4838  N   LEU A 602     154.172 164.315  90.105  1.00  0.84           N  
ATOM   4839  CA  LEU A 602     153.288 163.175  90.065  1.00  0.84           C  
ATOM   4840  C   LEU A 602     154.086 161.914  89.811  1.00  0.84           C  
ATOM   4841  O   LEU A 602     154.753 161.754  88.787  1.00  0.84           O  
ATOM   4842  CB  LEU A 602     152.234 163.375  88.948  1.00  0.84           C  
ATOM   4843  CG  LEU A 602     151.253 162.209  88.711  1.00  0.84           C  
ATOM   4844  CD1 LEU A 602     150.412 161.872  89.948  1.00  0.84           C  
ATOM   4845  CD2 LEU A 602     150.340 162.518  87.517  1.00  0.84           C  
ATOM   4846  N   VAL A 603     154.017 160.953  90.749  1.00  0.85           N  
ATOM   4847  CA  VAL A 603     154.544 159.617  90.535  1.00  0.85           C  
ATOM   4848  C   VAL A 603     153.503 158.813  89.770  1.00  0.85           C  
ATOM   4849  O   VAL A 603     152.359 158.673  90.201  1.00  0.85           O  
ATOM   4850  CB  VAL A 603     154.926 158.933  91.842  1.00  0.85           C  
ATOM   4851  CG1 VAL A 603     155.476 157.517  91.590  1.00  0.85           C  
ATOM   4852  CG2 VAL A 603     155.986 159.780  92.569  1.00  0.85           C  
ATOM   4853  N   THR A 604     153.863 158.300  88.579  1.00  0.82           N  
ATOM   4854  CA  THR A 604     152.912 157.633  87.696  1.00  0.82           C  
ATOM   4855  C   THR A 604     153.634 156.594  86.862  1.00  0.82           C  
ATOM   4856  O   THR A 604     154.811 156.725  86.536  1.00  0.82           O  
ATOM   4857  CB  THR A 604     152.100 158.592  86.809  1.00  0.82           C  
ATOM   4858  OG1 THR A 604     151.244 157.908  85.893  1.00  0.82           O  
ATOM   4859  CG2 THR A 604     153.008 159.526  85.999  1.00  0.82           C  
ATOM   4860  N   SER A 605     152.933 155.496  86.511  1.00  0.77           N  
ATOM   4861  CA  SER A 605     153.446 154.440  85.648  1.00  0.77           C  
ATOM   4862  C   SER A 605     152.698 154.396  84.326  1.00  0.77           C  
ATOM   4863  O   SER A 605     152.879 153.487  83.517  1.00  0.77           O  
ATOM   4864  CB  SER A 605     153.363 153.040  86.329  1.00  0.77           C  
ATOM   4865  OG  SER A 605     152.022 152.665  86.673  1.00  0.77           O  
ATOM   4866  N   LYS A 606     151.835 155.397  84.055  1.00  0.74           N  
ATOM   4867  CA  LYS A 606     151.020 155.432  82.855  1.00  0.74           C  
ATOM   4868  C   LYS A 606     151.637 156.318  81.788  1.00  0.74           C  
ATOM   4869  O   LYS A 606     151.847 157.514  81.982  1.00  0.74           O  
ATOM   4870  CB  LYS A 606     149.590 155.964  83.124  1.00  0.74           C  
ATOM   4871  CG  LYS A 606     148.858 155.321  84.309  1.00  0.74           C  
ATOM   4872  CD  LYS A 606     148.564 153.821  84.165  1.00  0.74           C  
ATOM   4873  CE  LYS A 606     147.865 153.288  85.420  1.00  0.74           C  
ATOM   4874  NZ  LYS A 606     147.545 151.855  85.259  1.00  0.74           N  
ATOM   4875  N   MET A 607     151.901 155.755  80.592  1.00  0.72           N  
ATOM   4876  CA  MET A 607     152.506 156.465  79.472  1.00  0.72           C  
ATOM   4877  C   MET A 607     151.694 157.658  78.979  1.00  0.72           C  
ATOM   4878  O   MET A 607     152.227 158.684  78.562  1.00  0.72           O  
ATOM   4879  CB  MET A 607     152.799 155.482  78.315  1.00  0.72           C  
ATOM   4880  CG  MET A 607     153.625 156.100  77.168  1.00  0.72           C  
ATOM   4881  SD  MET A 607     154.159 154.920  75.892  1.00  0.72           S  
ATOM   4882  CE  MET A 607     155.406 154.056  76.892  1.00  0.72           C  
ATOM   4883  N   GLU A 608     150.360 157.570  79.063  1.00  0.73           N  
ATOM   4884  CA  GLU A 608     149.450 158.629  78.680  1.00  0.73           C  
ATOM   4885  C   GLU A 608     149.557 159.880  79.558  1.00  0.73           C  
ATOM   4886  O   GLU A 608     149.339 161.004  79.109  1.00  0.73           O  
ATOM   4887  CB  GLU A 608     148.011 158.069  78.618  1.00  0.73           C  
ATOM   4888  CG  GLU A 608     147.902 156.729  77.830  1.00  0.73           C  
ATOM   4889  CD  GLU A 608     148.737 156.629  76.551  1.00  0.73           C  
ATOM   4890  OE1 GLU A 608     148.701 157.552  75.691  1.00  0.73           O  
ATOM   4891  OE2 GLU A 608     149.460 155.613  76.415  1.00  0.73           O  
ATOM   4892  N   HIS A 609     149.955 159.713  80.839  1.00  0.76           N  
ATOM   4893  CA  HIS A 609     150.180 160.809  81.774  1.00  0.76           C  
ATOM   4894  C   HIS A 609     151.501 161.526  81.501  1.00  0.76           C  
ATOM   4895  O   HIS A 609     151.628 162.729  81.714  1.00  0.76           O  
ATOM   4896  CB  HIS A 609     150.150 160.335  83.259  1.00  0.76           C  
ATOM   4897  CG  HIS A 609     148.806 159.879  83.793  1.00  0.76           C  
ATOM   4898  ND1 HIS A 609     147.767 159.589  82.930  1.00  0.76           N  
ATOM   4899  CD2 HIS A 609     148.437 159.587  85.072  1.00  0.76           C  
ATOM   4900  CE1 HIS A 609     146.794 159.129  83.693  1.00  0.76           C  
ATOM   4901  NE2 HIS A 609     147.148 159.099  84.998  1.00  0.76           N  
ATOM   4902  N   LEU A 610     152.511 160.797  80.978  1.00  0.79           N  
ATOM   4903  CA  LEU A 610     153.821 161.313  80.589  1.00  0.79           C  
ATOM   4904  C   LEU A 610     153.756 162.337  79.458  1.00  0.79           C  
ATOM   4905  O   LEU A 610     154.537 163.282  79.406  1.00  0.79           O  
ATOM   4906  CB  LEU A 610     154.781 160.159  80.182  1.00  0.79           C  
ATOM   4907  CG  LEU A 610     155.638 159.552  81.315  1.00  0.79           C  
ATOM   4908  CD1 LEU A 610     154.833 159.069  82.524  1.00  0.79           C  
ATOM   4909  CD2 LEU A 610     156.490 158.400  80.763  1.00  0.79           C  
ATOM   4910  N   LYS A 611     152.802 162.183  78.521  1.00  0.75           N  
ATOM   4911  CA  LYS A 611     152.657 163.051  77.361  1.00  0.75           C  
ATOM   4912  C   LYS A 611     152.148 164.448  77.693  1.00  0.75           C  
ATOM   4913  O   LYS A 611     152.260 165.366  76.887  1.00  0.75           O  
ATOM   4914  CB  LYS A 611     151.668 162.418  76.352  1.00  0.75           C  
ATOM   4915  CG  LYS A 611     152.144 161.064  75.810  1.00  0.75           C  
ATOM   4916  CD  LYS A 611     151.105 160.385  74.902  1.00  0.75           C  
ATOM   4917  CE  LYS A 611     151.532 158.979  74.467  1.00  0.75           C  
ATOM   4918  NZ  LYS A 611     150.397 158.243  73.880  1.00  0.75           N  
ATOM   4919  N   LYS A 612     151.578 164.639  78.898  1.00  0.76           N  
ATOM   4920  CA  LYS A 612     151.081 165.925  79.352  1.00  0.76           C  
ATOM   4921  C   LYS A 612     151.902 166.476  80.510  1.00  0.76           C  
ATOM   4922  O   LYS A 612     151.425 167.317  81.268  1.00  0.76           O  
ATOM   4923  CB  LYS A 612     149.583 165.850  79.750  1.00  0.76           C  
ATOM   4924  CG  LYS A 612     148.646 165.661  78.544  1.00  0.76           C  
ATOM   4925  CD  LYS A 612     147.170 165.980  78.856  1.00  0.76           C  
ATOM   4926  CE  LYS A 612     146.513 164.976  79.807  1.00  0.76           C  
ATOM   4927  NZ  LYS A 612     145.075 165.284  80.012  1.00  0.76           N  
ATOM   4928  N   ALA A 613     153.162 166.028  80.661  1.00  0.83           N  
ATOM   4929  CA  ALA A 613     154.084 166.544  81.651  1.00  0.83           C  
ATOM   4930  C   ALA A 613     155.195 167.348  80.981  1.00  0.83           C  
ATOM   4931  O   ALA A 613     155.767 166.940  79.970  1.00  0.83           O  
ATOM   4932  CB  ALA A 613     154.706 165.381  82.451  1.00  0.83           C  
ATOM   4933  N   ASP A 614     155.546 168.524  81.543  1.00  0.80           N  
ATOM   4934  CA  ASP A 614     156.608 169.398  81.068  1.00  0.80           C  
ATOM   4935  C   ASP A 614     157.981 168.733  81.066  1.00  0.80           C  
ATOM   4936  O   ASP A 614     158.824 168.942  80.185  1.00  0.80           O  
ATOM   4937  CB  ASP A 614     156.709 170.631  81.991  1.00  0.80           C  
ATOM   4938  CG  ASP A 614     155.376 171.345  82.055  1.00  0.80           C  
ATOM   4939  OD1 ASP A 614     154.548 170.942  82.912  1.00  0.80           O  
ATOM   4940  OD2 ASP A 614     155.176 172.303  81.277  1.00  0.80           O  
ATOM   4941  N   LYS A 615     158.235 167.912  82.098  1.00  0.80           N  
ATOM   4942  CA  LYS A 615     159.459 167.161  82.231  1.00  0.80           C  
ATOM   4943  C   LYS A 615     159.164 165.778  82.778  1.00  0.80           C  
ATOM   4944  O   LYS A 615     158.187 165.535  83.487  1.00  0.80           O  
ATOM   4945  CB  LYS A 615     160.490 167.871  83.148  1.00  0.80           C  
ATOM   4946  CG  LYS A 615     161.159 169.115  82.528  1.00  0.80           C  
ATOM   4947  CD  LYS A 615     162.080 168.770  81.344  1.00  0.80           C  
ATOM   4948  CE  LYS A 615     162.813 169.963  80.715  1.00  0.80           C  
ATOM   4949  NZ  LYS A 615     161.852 170.963  80.192  1.00  0.80           N  
ATOM   4950  N   ILE A 616     160.034 164.822  82.418  1.00  0.82           N  
ATOM   4951  CA  ILE A 616     159.937 163.425  82.786  1.00  0.82           C  
ATOM   4952  C   ILE A 616     161.246 163.036  83.439  1.00  0.82           C  
ATOM   4953  O   ILE A 616     162.325 163.318  82.918  1.00  0.82           O  
ATOM   4954  CB  ILE A 616     159.677 162.545  81.564  1.00  0.82           C  
ATOM   4955  CG1 ILE A 616     158.341 162.960  80.909  1.00  0.82           C  
ATOM   4956  CG2 ILE A 616     159.684 161.045  81.943  1.00  0.82           C  
ATOM   4957  CD1 ILE A 616     158.033 162.217  79.613  1.00  0.82           C  
ATOM   4958  N   LEU A 617     161.179 162.375  84.608  1.00  0.82           N  
ATOM   4959  CA  LEU A 617     162.319 161.793  85.282  1.00  0.82           C  
ATOM   4960  C   LEU A 617     162.080 160.299  85.422  1.00  0.82           C  
ATOM   4961  O   LEU A 617     161.034 159.856  85.894  1.00  0.82           O  
ATOM   4962  CB  LEU A 617     162.501 162.434  86.679  1.00  0.82           C  
ATOM   4963  CG  LEU A 617     163.638 161.867  87.556  1.00  0.82           C  
ATOM   4964  CD1 LEU A 617     165.011 161.953  86.883  1.00  0.82           C  
ATOM   4965  CD2 LEU A 617     163.682 162.593  88.906  1.00  0.82           C  
ATOM   4966  N   ILE A 618     163.053 159.472  85.000  1.00  0.80           N  
ATOM   4967  CA  ILE A 618     162.962 158.023  85.097  1.00  0.80           C  
ATOM   4968  C   ILE A 618     164.036 157.557  86.062  1.00  0.80           C  
ATOM   4969  O   ILE A 618     165.211 157.889  85.914  1.00  0.80           O  
ATOM   4970  CB  ILE A 618     163.114 157.323  83.741  1.00  0.80           C  
ATOM   4971  CG1 ILE A 618     162.082 157.885  82.731  1.00  0.80           C  
ATOM   4972  CG2 ILE A 618     162.960 155.796  83.924  1.00  0.80           C  
ATOM   4973  CD1 ILE A 618     162.131 157.272  81.326  1.00  0.80           C  
ATOM   4974  N   LEU A 619     163.657 156.774  87.090  1.00  0.81           N  
ATOM   4975  CA  LEU A 619     164.576 156.262  88.088  1.00  0.81           C  
ATOM   4976  C   LEU A 619     164.755 154.765  87.964  1.00  0.81           C  
ATOM   4977  O   LEU A 619     163.803 154.007  87.785  1.00  0.81           O  
ATOM   4978  CB  LEU A 619     164.098 156.537  89.532  1.00  0.81           C  
ATOM   4979  CG  LEU A 619     164.035 158.021  89.929  1.00  0.81           C  
ATOM   4980  CD1 LEU A 619     163.583 158.138  91.388  1.00  0.81           C  
ATOM   4981  CD2 LEU A 619     165.379 158.734  89.743  1.00  0.81           C  
ATOM   4982  N   HIS A 620     166.012 154.308  88.075  1.00  0.76           N  
ATOM   4983  CA  HIS A 620     166.351 152.902  88.101  1.00  0.76           C  
ATOM   4984  C   HIS A 620     167.476 152.721  89.103  1.00  0.76           C  
ATOM   4985  O   HIS A 620     168.497 153.400  89.000  1.00  0.76           O  
ATOM   4986  CB  HIS A 620     166.783 152.447  86.691  1.00  0.76           C  
ATOM   4987  CG  HIS A 620     167.110 150.996  86.591  1.00  0.76           C  
ATOM   4988  ND1 HIS A 620     166.172 150.083  87.019  1.00  0.76           N  
ATOM   4989  CD2 HIS A 620     168.247 150.366  86.199  1.00  0.76           C  
ATOM   4990  CE1 HIS A 620     166.756 148.907  86.889  1.00  0.76           C  
ATOM   4991  NE2 HIS A 620     168.013 149.021  86.394  1.00  0.76           N  
ATOM   4992  N   GLU A 621     167.300 151.853  90.127  1.00  0.77           N  
ATOM   4993  CA  GLU A 621     168.288 151.571  91.173  1.00  0.77           C  
ATOM   4994  C   GLU A 621     168.795 152.810  91.926  1.00  0.77           C  
ATOM   4995  O   GLU A 621     169.952 152.905  92.332  1.00  0.77           O  
ATOM   4996  CB  GLU A 621     169.474 150.736  90.619  1.00  0.77           C  
ATOM   4997  CG  GLU A 621     169.063 149.487  89.793  1.00  0.77           C  
ATOM   4998  CD  GLU A 621     168.438 148.336  90.581  1.00  0.77           C  
ATOM   4999  OE1 GLU A 621     168.362 148.411  91.832  1.00  0.77           O  
ATOM   5000  OE2 GLU A 621     168.030 147.357  89.900  1.00  0.77           O  
ATOM   5001  N   GLY A 622     167.921 153.829  92.110  1.00  0.83           N  
ATOM   5002  CA  GLY A 622     168.278 155.104  92.731  1.00  0.83           C  
ATOM   5003  C   GLY A 622     169.024 156.085  91.853  1.00  0.83           C  
ATOM   5004  O   GLY A 622     169.349 157.191  92.280  1.00  0.83           O  
ATOM   5005  N   SER A 623     169.290 155.725  90.586  1.00  0.80           N  
ATOM   5006  CA  SER A 623     169.981 156.573  89.624  1.00  0.80           C  
ATOM   5007  C   SER A 623     168.994 157.136  88.624  1.00  0.80           C  
ATOM   5008  O   SER A 623     168.018 156.495  88.228  1.00  0.80           O  
ATOM   5009  CB  SER A 623     171.046 155.823  88.774  1.00  0.80           C  
ATOM   5010  OG  SER A 623     172.128 155.332  89.566  1.00  0.80           O  
ATOM   5011  N   SER A 624     169.236 158.374  88.156  1.00  0.80           N  
ATOM   5012  CA  SER A 624     168.462 159.009  87.105  1.00  0.80           C  
ATOM   5013  C   SER A 624     168.800 158.451  85.738  1.00  0.80           C  
ATOM   5014  O   SER A 624     169.760 158.819  85.071  1.00  0.80           O  
ATOM   5015  CB  SER A 624     168.622 160.547  87.106  1.00  0.80           C  
ATOM   5016  OG  SER A 624     169.985 160.915  87.313  1.00  0.80           O  
ATOM   5017  N   TYR A 625     167.963 157.507  85.291  1.00  0.74           N  
ATOM   5018  CA  TYR A 625     168.054 156.842  84.014  1.00  0.74           C  
ATOM   5019  C   TYR A 625     167.830 157.785  82.831  1.00  0.74           C  
ATOM   5020  O   TYR A 625     168.501 157.706  81.806  1.00  0.74           O  
ATOM   5021  CB  TYR A 625     167.041 155.666  84.046  1.00  0.74           C  
ATOM   5022  CG  TYR A 625     167.115 154.870  82.780  1.00  0.74           C  
ATOM   5023  CD1 TYR A 625     168.260 154.110  82.491  1.00  0.74           C  
ATOM   5024  CD2 TYR A 625     166.118 155.012  81.806  1.00  0.74           C  
ATOM   5025  CE1 TYR A 625     168.416 153.515  81.230  1.00  0.74           C  
ATOM   5026  CE2 TYR A 625     166.287 154.446  80.542  1.00  0.74           C  
ATOM   5027  CZ  TYR A 625     167.422 153.679  80.266  1.00  0.74           C  
ATOM   5028  OH  TYR A 625     167.595 153.097  79.007  1.00  0.74           O  
ATOM   5029  N   PHE A 626     166.864 158.708  82.960  1.00  0.75           N  
ATOM   5030  CA  PHE A 626     166.592 159.702  81.948  1.00  0.75           C  
ATOM   5031  C   PHE A 626     166.022 160.922  82.653  1.00  0.75           C  
ATOM   5032  O   PHE A 626     165.291 160.797  83.636  1.00  0.75           O  
ATOM   5033  CB  PHE A 626     165.602 159.130  80.894  1.00  0.75           C  
ATOM   5034  CG  PHE A 626     165.130 160.147  79.894  1.00  0.75           C  
ATOM   5035  CD1 PHE A 626     165.932 160.509  78.801  1.00  0.75           C  
ATOM   5036  CD2 PHE A 626     163.895 160.792  80.084  1.00  0.75           C  
ATOM   5037  CE1 PHE A 626     165.514 161.515  77.920  1.00  0.75           C  
ATOM   5038  CE2 PHE A 626     163.477 161.799  79.208  1.00  0.75           C  
ATOM   5039  CZ  PHE A 626     164.290 162.161  78.127  1.00  0.75           C  
ATOM   5040  N   TYR A 627     166.336 162.124  82.143  1.00  0.79           N  
ATOM   5041  CA  TYR A 627     165.707 163.361  82.542  1.00  0.79           C  
ATOM   5042  C   TYR A 627     165.571 164.183  81.274  1.00  0.79           C  
ATOM   5043  O   TYR A 627     166.556 164.387  80.574  1.00  0.79           O  
ATOM   5044  CB  TYR A 627     166.568 164.117  83.591  1.00  0.79           C  
ATOM   5045  CG  TYR A 627     165.972 165.446  83.977  1.00  0.79           C  
ATOM   5046  CD1 TYR A 627     164.703 165.515  84.575  1.00  0.79           C  
ATOM   5047  CD2 TYR A 627     166.665 166.637  83.701  1.00  0.79           C  
ATOM   5048  CE1 TYR A 627     164.137 166.757  84.889  1.00  0.79           C  
ATOM   5049  CE2 TYR A 627     166.101 167.881  84.018  1.00  0.79           C  
ATOM   5050  CZ  TYR A 627     164.837 167.936  84.614  1.00  0.79           C  
ATOM   5051  OH  TYR A 627     164.253 169.169  84.952  1.00  0.79           O  
ATOM   5052  N   GLY A 628     164.358 164.673  80.953  1.00  0.82           N  
ATOM   5053  CA  GLY A 628     164.162 165.471  79.750  1.00  0.82           C  
ATOM   5054  C   GLY A 628     162.705 165.595  79.412  1.00  0.82           C  
ATOM   5055  O   GLY A 628     161.838 165.483  80.281  1.00  0.82           O  
ATOM   5056  N   THR A 629     162.377 165.869  78.137  1.00  0.78           N  
ATOM   5057  CA  THR A 629     160.988 165.974  77.668  1.00  0.78           C  
ATOM   5058  C   THR A 629     160.494 164.669  77.057  1.00  0.78           C  
ATOM   5059  O   THR A 629     161.263 163.753  76.771  1.00  0.78           O  
ATOM   5060  CB  THR A 629     160.724 167.125  76.689  1.00  0.78           C  
ATOM   5061  OG1 THR A 629     161.434 166.981  75.466  1.00  0.78           O  
ATOM   5062  CG2 THR A 629     161.165 168.449  77.329  1.00  0.78           C  
ATOM   5063  N   PHE A 630     159.166 164.532  76.824  1.00  0.77           N  
ATOM   5064  CA  PHE A 630     158.598 163.362  76.157  1.00  0.77           C  
ATOM   5065  C   PHE A 630     159.159 163.140  74.746  1.00  0.77           C  
ATOM   5066  O   PHE A 630     159.563 162.041  74.376  1.00  0.77           O  
ATOM   5067  CB  PHE A 630     157.045 163.492  76.123  1.00  0.77           C  
ATOM   5068  CG  PHE A 630     156.384 162.241  75.603  1.00  0.77           C  
ATOM   5069  CD1 PHE A 630     156.163 161.141  76.448  1.00  0.77           C  
ATOM   5070  CD2 PHE A 630     156.038 162.136  74.245  1.00  0.77           C  
ATOM   5071  CE1 PHE A 630     155.641 159.944  75.941  1.00  0.77           C  
ATOM   5072  CE2 PHE A 630     155.529 160.938  73.731  1.00  0.77           C  
ATOM   5073  CZ  PHE A 630     155.338 159.839  74.578  1.00  0.77           C  
ATOM   5074  N   SER A 631     159.256 164.206  73.931  1.00  0.78           N  
ATOM   5075  CA  SER A 631     159.823 164.150  72.589  1.00  0.78           C  
ATOM   5076  C   SER A 631     161.288 163.757  72.544  1.00  0.78           C  
ATOM   5077  O   SER A 631     161.727 163.040  71.649  1.00  0.78           O  
ATOM   5078  CB  SER A 631     159.669 165.486  71.829  1.00  0.78           C  
ATOM   5079  OG  SER A 631     158.304 165.900  71.841  1.00  0.78           O  
ATOM   5080  N   GLU A 632     162.094 164.207  73.521  1.00  0.68           N  
ATOM   5081  CA  GLU A 632     163.473 163.773  73.667  1.00  0.68           C  
ATOM   5082  C   GLU A 632     163.605 162.275  73.951  1.00  0.68           C  
ATOM   5083  O   GLU A 632     164.352 161.561  73.279  1.00  0.68           O  
ATOM   5084  CB  GLU A 632     164.099 164.604  74.798  1.00  0.68           C  
ATOM   5085  CG  GLU A 632     165.586 164.325  75.088  1.00  0.68           C  
ATOM   5086  CD  GLU A 632     166.101 165.232  76.200  1.00  0.68           C  
ATOM   5087  OE1 GLU A 632     165.277 165.984  76.796  1.00  0.68           O  
ATOM   5088  OE2 GLU A 632     167.328 165.176  76.455  1.00  0.68           O  
ATOM   5089  N   LEU A 633     162.782 161.752  74.888  1.00  0.71           N  
ATOM   5090  CA  LEU A 633     162.663 160.329  75.191  1.00  0.71           C  
ATOM   5091  C   LEU A 633     162.207 159.491  74.001  1.00  0.71           C  
ATOM   5092  O   LEU A 633     162.664 158.374  73.782  1.00  0.71           O  
ATOM   5093  CB  LEU A 633     161.677 160.102  76.368  1.00  0.71           C  
ATOM   5094  CG  LEU A 633     161.504 158.636  76.832  1.00  0.71           C  
ATOM   5095  CD1 LEU A 633     162.830 157.992  77.260  1.00  0.71           C  
ATOM   5096  CD2 LEU A 633     160.471 158.537  77.963  1.00  0.71           C  
ATOM   5097  N   GLN A 634     161.288 160.023  73.176  1.00  0.58           N  
ATOM   5098  CA  GLN A 634     160.804 159.372  71.971  1.00  0.58           C  
ATOM   5099  C   GLN A 634     161.893 159.078  70.938  1.00  0.58           C  
ATOM   5100  O   GLN A 634     161.867 158.037  70.278  1.00  0.58           O  
ATOM   5101  CB  GLN A 634     159.676 160.218  71.331  1.00  0.58           C  
ATOM   5102  CG  GLN A 634     158.861 159.501  70.230  1.00  0.58           C  
ATOM   5103  CD  GLN A 634     158.096 158.300  70.791  1.00  0.58           C  
ATOM   5104  OE1 GLN A 634     157.275 158.413  71.698  1.00  0.58           O  
ATOM   5105  NE2 GLN A 634     158.362 157.100  70.228  1.00  0.58           N  
ATOM   5106  N   ASN A 635     162.871 159.997  70.782  1.00  0.48           N  
ATOM   5107  CA  ASN A 635     164.029 159.812  69.919  1.00  0.48           C  
ATOM   5108  C   ASN A 635     165.114 158.943  70.555  1.00  0.48           C  
ATOM   5109  O   ASN A 635     165.651 158.026  69.938  1.00  0.48           O  
ATOM   5110  CB  ASN A 635     164.674 161.175  69.570  1.00  0.48           C  
ATOM   5111  CG  ASN A 635     163.656 162.065  68.868  1.00  0.48           C  
ATOM   5112  OD1 ASN A 635     162.872 161.628  68.029  1.00  0.48           O  
ATOM   5113  ND2 ASN A 635     163.668 163.377  69.200  1.00  0.48           N  
ATOM   5114  N   LEU A 636     165.456 159.212  71.828  1.00  0.53           N  
ATOM   5115  CA  LEU A 636     166.460 158.470  72.568  1.00  0.53           C  
ATOM   5116  C   LEU A 636     165.763 157.549  73.557  1.00  0.53           C  
ATOM   5117  O   LEU A 636     165.721 157.782  74.764  1.00  0.53           O  
ATOM   5118  CB  LEU A 636     167.443 159.402  73.314  1.00  0.53           C  
ATOM   5119  CG  LEU A 636     168.256 160.364  72.419  1.00  0.53           C  
ATOM   5120  CD1 LEU A 636     169.048 161.343  73.297  1.00  0.53           C  
ATOM   5121  CD2 LEU A 636     169.198 159.635  71.449  1.00  0.53           C  
ATOM   5122  N   GLN A 637     165.163 156.470  73.027  1.00  0.51           N  
ATOM   5123  CA  GLN A 637     164.452 155.464  73.790  1.00  0.51           C  
ATOM   5124  C   GLN A 637     165.383 154.571  74.609  1.00  0.51           C  
ATOM   5125  O   GLN A 637     166.592 154.581  74.378  1.00  0.51           O  
ATOM   5126  CB  GLN A 637     163.585 154.620  72.834  1.00  0.51           C  
ATOM   5127  CG  GLN A 637     162.436 155.448  72.230  1.00  0.51           C  
ATOM   5128  CD  GLN A 637     161.477 154.574  71.432  1.00  0.51           C  
ATOM   5129  OE1 GLN A 637     161.275 153.388  71.695  1.00  0.51           O  
ATOM   5130  NE2 GLN A 637     160.836 155.185  70.412  1.00  0.51           N  
ATOM   5131  N   PRO A 638     164.917 153.813  75.603  1.00  0.35           N  
ATOM   5132  CA  PRO A 638     165.805 152.953  76.369  1.00  0.35           C  
ATOM   5133  C   PRO A 638     166.194 151.656  75.672  1.00  0.35           C  
ATOM   5134  O   PRO A 638     165.544 151.268  74.705  1.00  0.35           O  
ATOM   5135  CB  PRO A 638     164.964 152.630  77.618  1.00  0.35           C  
ATOM   5136  CG  PRO A 638     163.511 152.701  77.173  1.00  0.35           C  
ATOM   5137  CD  PRO A 638     163.529 153.779  76.092  1.00  0.35           C  
ATOM   5138  N   ASP A 639     167.200 150.940  76.229  1.00  0.35           N  
ATOM   5139  CA  ASP A 639     167.635 149.620  75.791  1.00  0.35           C  
ATOM   5140  C   ASP A 639     166.911 148.514  76.567  1.00  0.35           C  
ATOM   5141  O   ASP A 639     167.120 147.318  76.375  1.00  0.35           O  
ATOM   5142  CB  ASP A 639     169.152 149.437  76.052  1.00  0.35           C  
ATOM   5143  CG  ASP A 639     169.973 150.510  75.363  1.00  0.35           C  
ATOM   5144  OD1 ASP A 639     169.760 150.737  74.148  1.00  0.35           O  
ATOM   5145  OD2 ASP A 639     170.838 151.101  76.059  1.00  0.35           O  
ATOM   5146  N   PHE A 640     165.995 148.908  77.477  1.00  0.28           N  
ATOM   5147  CA  PHE A 640     165.158 148.033  78.285  1.00  0.28           C  
ATOM   5148  C   PHE A 640     164.272 147.142  77.418  1.00  0.28           C  
ATOM   5149  O   PHE A 640     164.013 145.976  77.706  1.00  0.28           O  
ATOM   5150  CB  PHE A 640     164.263 148.922  79.191  1.00  0.28           C  
ATOM   5151  CG  PHE A 640     163.546 148.104  80.233  1.00  0.28           C  
ATOM   5152  CD1 PHE A 640     162.272 147.562  79.980  1.00  0.28           C  
ATOM   5153  CD2 PHE A 640     164.187 147.806  81.445  1.00  0.28           C  
ATOM   5154  CE1 PHE A 640     161.684 146.677  80.891  1.00  0.28           C  
ATOM   5155  CE2 PHE A 640     163.597 146.933  82.366  1.00  0.28           C  
ATOM   5156  CZ  PHE A 640     162.355 146.360  82.077  1.00  0.28           C  
ATOM   5157  N   SER A 641     163.787 147.719  76.313  1.00  0.26           N  
ATOM   5158  CA  SER A 641     163.056 147.027  75.287  1.00  0.26           C  
ATOM   5159  C   SER A 641     163.783 147.299  73.990  1.00  0.26           C  
ATOM   5160  O   SER A 641     164.518 148.272  73.856  1.00  0.26           O  
ATOM   5161  CB  SER A 641     161.578 147.478  75.184  1.00  0.26           C  
ATOM   5162  OG  SER A 641     161.454 148.894  75.034  1.00  0.26           O  
ATOM   5163  N   SER A 642     163.633 146.414  72.996  1.00  0.26           N  
ATOM   5164  CA  SER A 642     164.319 146.534  71.726  1.00  0.26           C  
ATOM   5165  C   SER A 642     163.549 145.688  70.737  1.00  0.26           C  
ATOM   5166  O   SER A 642     162.512 145.116  71.074  1.00  0.26           O  
ATOM   5167  CB  SER A 642     165.829 146.157  71.753  1.00  0.26           C  
ATOM   5168  OG  SER A 642     166.053 144.764  71.971  1.00  0.26           O  
ATOM   5169  N   LYS A 643     163.988 145.614  69.465  1.00  0.23           N  
ATOM   5170  CA  LYS A 643     163.436 144.662  68.517  1.00  0.23           C  
ATOM   5171  C   LYS A 643     163.637 143.193  68.917  1.00  0.23           C  
ATOM   5172  O   LYS A 643     164.683 142.798  69.428  1.00  0.23           O  
ATOM   5173  CB  LYS A 643     164.035 144.881  67.109  1.00  0.23           C  
ATOM   5174  CG  LYS A 643     163.747 146.274  66.523  1.00  0.23           C  
ATOM   5175  CD  LYS A 643     164.385 146.458  65.134  1.00  0.23           C  
ATOM   5176  CE  LYS A 643     164.151 147.847  64.532  1.00  0.23           C  
ATOM   5177  NZ  LYS A 643     164.894 147.977  63.259  1.00  0.23           N  
ATOM   5178  N   LEU A 644     162.620 142.338  68.677  1.00  0.17           N  
ATOM   5179  CA  LEU A 644     162.701 140.909  68.926  1.00  0.17           C  
ATOM   5180  C   LEU A 644     163.618 140.206  67.968  1.00  0.17           C  
ATOM   5181  O   LEU A 644     163.443 140.349  66.758  1.00  0.17           O  
ATOM   5182  CB  LEU A 644     161.352 140.196  68.741  1.00  0.17           C  
ATOM   5183  CG  LEU A 644     160.236 140.664  69.673  1.00  0.17           C  
ATOM   5184  CD1 LEU A 644     158.934 139.987  69.230  1.00  0.17           C  
ATOM   5185  CD2 LEU A 644     160.569 140.355  71.138  1.00  0.17           C  
ATOM   5186  N   MET A 645     164.588 139.429  68.510  1.00  0.15           N  
ATOM   5187  CA  MET A 645     165.707 138.896  67.759  1.00  0.15           C  
ATOM   5188  C   MET A 645     166.609 140.057  67.340  1.00  0.15           C  
ATOM   5189  O   MET A 645     166.171 140.972  66.657  1.00  0.15           O  
ATOM   5190  CB  MET A 645     165.287 138.002  66.556  1.00  0.15           C  
ATOM   5191  CG  MET A 645     164.404 136.787  66.925  1.00  0.15           C  
ATOM   5192  SD  MET A 645     165.245 135.496  67.890  1.00  0.15           S  
ATOM   5193  CE  MET A 645     166.331 134.925  66.549  1.00  0.15           C  
ATOM   5194  N   GLY A 646     167.898 140.088  67.766  1.00  0.20           N  
ATOM   5195  CA  GLY A 646     168.824 141.170  67.394  1.00  0.20           C  
ATOM   5196  C   GLY A 646     169.137 141.271  65.905  1.00  0.20           C  
ATOM   5197  O   GLY A 646     170.218 140.928  65.434  1.00  0.20           O  
ATOM   5198  N   CYS A 647     168.161 141.789  65.144  1.00  0.24           N  
ATOM   5199  CA  CYS A 647     168.051 141.921  63.704  1.00  0.24           C  
ATOM   5200  C   CYS A 647     168.316 143.351  63.329  1.00  0.24           C  
ATOM   5201  O   CYS A 647     167.755 143.925  62.397  1.00  0.24           O  
ATOM   5202  CB  CYS A 647     166.630 141.548  63.238  1.00  0.24           C  
ATOM   5203  SG  CYS A 647     166.385 139.748  63.271  1.00  0.24           S  
ATOM   5204  N   ASP A 648     169.196 143.954  64.111  1.00  0.29           N  
ATOM   5205  CA  ASP A 648     169.770 145.226  63.874  1.00  0.29           C  
ATOM   5206  C   ASP A 648     171.204 144.918  64.222  1.00  0.29           C  
ATOM   5207  O   ASP A 648     171.493 144.363  65.283  1.00  0.29           O  
ATOM   5208  CB  ASP A 648     169.091 146.257  64.797  1.00  0.29           C  
ATOM   5209  CG  ASP A 648     169.236 147.649  64.234  1.00  0.29           C  
ATOM   5210  OD1 ASP A 648     170.355 147.989  63.769  1.00  0.29           O  
ATOM   5211  OD2 ASP A 648     168.189 148.363  64.197  1.00  0.29           O  
ATOM   5212  N   SER A 649     172.151 145.191  63.315  1.00  0.29           N  
ATOM   5213  CA  SER A 649     173.558 145.091  63.641  1.00  0.29           C  
ATOM   5214  C   SER A 649     173.915 146.178  64.616  1.00  0.29           C  
ATOM   5215  O   SER A 649     174.834 146.012  65.418  1.00  0.29           O  
ATOM   5216  CB  SER A 649     174.451 145.178  62.378  1.00  0.29           C  
ATOM   5217  OG  SER A 649     174.102 146.306  61.571  1.00  0.29           O  
ATOM   5218  N   PHE A 650     173.228 147.346  64.510  1.00  0.26           N  
ATOM   5219  CA  PHE A 650     173.483 148.588  65.234  1.00  0.26           C  
ATOM   5220  C   PHE A 650     174.855 149.169  64.852  1.00  0.26           C  
ATOM   5221  O   PHE A 650     175.259 150.263  65.240  1.00  0.26           O  
ATOM   5222  CB  PHE A 650     173.234 148.423  66.765  1.00  0.26           C  
ATOM   5223  CG  PHE A 650     173.336 149.723  67.531  1.00  0.26           C  
ATOM   5224  CD1 PHE A 650     174.525 150.047  68.207  1.00  0.26           C  
ATOM   5225  CD2 PHE A 650     172.262 150.629  67.578  1.00  0.26           C  
ATOM   5226  CE1 PHE A 650     174.652 151.261  68.894  1.00  0.26           C  
ATOM   5227  CE2 PHE A 650     172.381 151.841  68.274  1.00  0.26           C  
ATOM   5228  CZ  PHE A 650     173.579 152.159  68.927  1.00  0.26           C  
ATOM   5229  N   ASP A 651     175.587 148.429  64.005  1.00  0.31           N  
ATOM   5230  CA  ASP A 651     176.906 148.681  63.533  1.00  0.31           C  
ATOM   5231  C   ASP A 651     176.780 149.632  62.354  1.00  0.31           C  
ATOM   5232  O   ASP A 651     176.191 149.362  61.306  1.00  0.31           O  
ATOM   5233  CB  ASP A 651     177.571 147.332  63.184  1.00  0.31           C  
ATOM   5234  CG  ASP A 651     179.050 147.458  62.869  1.00  0.31           C  
ATOM   5235  OD1 ASP A 651     179.598 148.583  62.979  1.00  0.31           O  
ATOM   5236  OD2 ASP A 651     179.639 146.403  62.517  1.00  0.31           O  
ATOM   5237  N   GLN A 652     177.301 150.836  62.592  1.00  0.26           N  
ATOM   5238  CA  GLN A 652     177.238 151.986  61.750  1.00  0.26           C  
ATOM   5239  C   GLN A 652     178.469 151.994  60.896  1.00  0.26           C  
ATOM   5240  O   GLN A 652     179.469 152.594  61.217  1.00  0.26           O  
ATOM   5241  CB  GLN A 652     177.193 153.193  62.712  1.00  0.26           C  
ATOM   5242  CG  GLN A 652     175.830 153.197  63.424  1.00  0.26           C  
ATOM   5243  CD  GLN A 652     175.481 154.581  63.940  1.00  0.26           C  
ATOM   5244  OE1 GLN A 652     174.644 155.258  63.333  1.00  0.26           O  
ATOM   5245  NE2 GLN A 652     176.151 155.012  65.025  1.00  0.26           N  
ATOM   5246  N   PHE A 653     178.427 151.304  59.740  1.00  0.26           N  
ATOM   5247  CA  PHE A 653     179.578 151.293  58.856  1.00  0.26           C  
ATOM   5248  C   PHE A 653     179.885 152.666  58.279  1.00  0.26           C  
ATOM   5249  O   PHE A 653     179.040 153.569  58.217  1.00  0.26           O  
ATOM   5250  CB  PHE A 653     179.506 150.258  57.706  1.00  0.26           C  
ATOM   5251  CG  PHE A 653     179.519 148.861  58.264  1.00  0.26           C  
ATOM   5252  CD1 PHE A 653     180.737 148.236  58.588  1.00  0.26           C  
ATOM   5253  CD2 PHE A 653     178.318 148.177  58.515  1.00  0.26           C  
ATOM   5254  CE1 PHE A 653     180.754 146.961  59.169  1.00  0.26           C  
ATOM   5255  CE2 PHE A 653     178.331 146.903  59.099  1.00  0.26           C  
ATOM   5256  CZ  PHE A 653     179.550 146.294  59.422  1.00  0.26           C  
ATOM   5257  N   SER A 654     181.131 152.891  57.817  1.00  0.28           N  
ATOM   5258  CA  SER A 654     181.487 154.163  57.236  1.00  0.28           C  
ATOM   5259  C   SER A 654     181.184 154.236  55.776  1.00  0.28           C  
ATOM   5260  O   SER A 654     181.433 155.245  55.120  1.00  0.28           O  
ATOM   5261  CB  SER A 654     182.944 154.550  57.466  1.00  0.28           C  
ATOM   5262  OG  SER A 654     183.810 153.600  56.853  1.00  0.28           O  
ATOM   5263  N   ALA A 655     180.544 153.179  55.279  1.00  0.26           N  
ATOM   5264  CA  ALA A 655     179.920 153.091  53.993  1.00  0.26           C  
ATOM   5265  C   ALA A 655     178.948 154.253  53.703  1.00  0.26           C  
ATOM   5266  O   ALA A 655     179.257 155.163  52.937  1.00  0.26           O  
ATOM   5267  CB  ALA A 655     179.251 151.705  54.033  1.00  0.26           C  
ATOM   5268  N   GLU A 656     177.777 154.298  54.368  1.00  0.28           N  
ATOM   5269  CA  GLU A 656     176.759 155.307  54.116  1.00  0.28           C  
ATOM   5270  C   GLU A 656     176.893 156.561  54.972  1.00  0.28           C  
ATOM   5271  O   GLU A 656     176.894 157.692  54.489  1.00  0.28           O  
ATOM   5272  CB  GLU A 656     175.352 154.721  54.390  1.00  0.28           C  
ATOM   5273  CG  GLU A 656     175.063 153.424  53.590  1.00  0.28           C  
ATOM   5274  CD  GLU A 656     175.642 152.166  54.242  1.00  0.28           C  
ATOM   5275  OE1 GLU A 656     175.594 151.091  53.599  1.00  0.28           O  
ATOM   5276  OE2 GLU A 656     176.157 152.280  55.392  1.00  0.28           O  
ATOM   5277  N   ARG A 657     176.998 156.406  56.312  1.00  0.28           N  
ATOM   5278  CA  ARG A 657     176.962 157.546  57.224  1.00  0.28           C  
ATOM   5279  C   ARG A 657     178.342 158.006  57.624  1.00  0.28           C  
ATOM   5280  O   ARG A 657     178.515 159.024  58.285  1.00  0.28           O  
ATOM   5281  CB  ARG A 657     176.147 157.221  58.497  1.00  0.28           C  
ATOM   5282  CG  ARG A 657     176.631 156.039  59.353  1.00  0.28           C  
ATOM   5283  CD  ARG A 657     175.540 155.487  60.273  1.00  0.28           C  
ATOM   5284  NE  ARG A 657     174.541 154.761  59.433  1.00  0.28           N  
ATOM   5285  CZ  ARG A 657     173.466 154.154  59.953  1.00  0.28           C  
ATOM   5286  NH1 ARG A 657     172.709 153.400  59.158  1.00  0.28           N  
ATOM   5287  NH2 ARG A 657     173.142 154.260  61.238  1.00  0.28           N  
ATOM   5288  N   ARG A 658     179.358 157.247  57.187  1.00  0.27           N  
ATOM   5289  CA  ARG A 658     180.760 157.453  57.505  1.00  0.27           C  
ATOM   5290  C   ARG A 658     181.130 157.047  58.934  1.00  0.27           C  
ATOM   5291  O   ARG A 658     182.163 157.468  59.452  1.00  0.27           O  
ATOM   5292  CB  ARG A 658     181.276 158.855  57.158  1.00  0.27           C  
ATOM   5293  CG  ARG A 658     181.001 159.225  55.690  1.00  0.27           C  
ATOM   5294  CD  ARG A 658     181.616 160.563  55.311  1.00  0.27           C  
ATOM   5295  NE  ARG A 658     181.156 160.925  53.933  1.00  0.27           N  
ATOM   5296  CZ  ARG A 658     181.537 162.065  53.342  1.00  0.27           C  
ATOM   5297  NH1 ARG A 658     181.155 162.344  52.101  1.00  0.27           N  
ATOM   5298  NH2 ARG A 658     182.317 162.928  53.990  1.00  0.27           N  
ATOM   5299  N   ASN A 659     180.312 156.170  59.581  1.00  0.25           N  
ATOM   5300  CA  ASN A 659     180.452 155.695  60.960  1.00  0.25           C  
ATOM   5301  C   ASN A 659     180.382 156.883  61.897  1.00  0.25           C  
ATOM   5302  O   ASN A 659     181.073 157.019  62.903  1.00  0.25           O  
ATOM   5303  CB  ASN A 659     181.684 154.768  61.145  1.00  0.25           C  
ATOM   5304  CG  ASN A 659     181.727 154.092  62.521  1.00  0.25           C  
ATOM   5305  OD1 ASN A 659     180.769 154.027  63.278  1.00  0.25           O  
ATOM   5306  ND2 ASN A 659     182.917 153.542  62.868  1.00  0.25           N  
ATOM   5307  N   SER A 660     179.510 157.825  61.521  1.00  0.23           N  
ATOM   5308  CA  SER A 660     179.386 159.068  62.208  1.00  0.23           C  
ATOM   5309  C   SER A 660     178.475 158.903  63.387  1.00  0.23           C  
ATOM   5310  O   SER A 660     177.508 158.145  63.379  1.00  0.23           O  
ATOM   5311  CB  SER A 660     178.901 160.188  61.271  1.00  0.23           C  
ATOM   5312  OG  SER A 660     177.530 160.038  60.897  1.00  0.23           O  
ATOM   5313  N   ILE A 661     178.796 159.630  64.457  1.00  0.23           N  
ATOM   5314  CA  ILE A 661     178.021 159.606  65.671  1.00  0.23           C  
ATOM   5315  C   ILE A 661     177.143 160.847  65.723  1.00  0.23           C  
ATOM   5316  O   ILE A 661     176.420 161.110  66.680  1.00  0.23           O  
ATOM   5317  CB  ILE A 661     178.967 159.537  66.849  1.00  0.23           C  
ATOM   5318  CG1 ILE A 661     179.897 160.770  66.918  1.00  0.23           C  
ATOM   5319  CG2 ILE A 661     179.759 158.212  66.732  1.00  0.23           C  
ATOM   5320  CD1 ILE A 661     180.631 160.862  68.254  1.00  0.23           C  
ATOM   5321  N   LEU A 662     177.200 161.652  64.642  1.00  0.24           N  
ATOM   5322  CA  LEU A 662     176.382 162.822  64.446  1.00  0.24           C  
ATOM   5323  C   LEU A 662     174.989 162.400  64.038  1.00  0.24           C  
ATOM   5324  O   LEU A 662     174.735 161.252  63.702  1.00  0.24           O  
ATOM   5325  CB  LEU A 662     176.905 163.743  63.317  1.00  0.24           C  
ATOM   5326  CG  LEU A 662     178.211 164.511  63.586  1.00  0.24           C  
ATOM   5327  CD1 LEU A 662     179.481 163.684  63.349  1.00  0.24           C  
ATOM   5328  CD2 LEU A 662     178.231 165.791  62.737  1.00  0.24           C  
ATOM   5329  N   THR A 663     174.041 163.338  64.049  1.00  0.29           N  
ATOM   5330  CA  THR A 663     172.649 163.068  63.757  1.00  0.29           C  
ATOM   5331  C   THR A 663     172.243 163.665  62.415  1.00  0.29           C  
ATOM   5332  O   THR A 663     171.094 163.545  62.009  1.00  0.29           O  
ATOM   5333  CB  THR A 663     171.806 163.612  64.895  1.00  0.29           C  
ATOM   5334  OG1 THR A 663     172.239 164.922  65.255  1.00  0.29           O  
ATOM   5335  CG2 THR A 663     172.068 162.700  66.113  1.00  0.29           C  
ATOM   5336  N   GLU A 664     173.218 164.257  61.679  1.00  0.29           N  
ATOM   5337  CA  GLU A 664     173.004 164.982  60.424  1.00  0.29           C  
ATOM   5338  C   GLU A 664     173.912 164.499  59.295  1.00  0.29           C  
ATOM   5339  O   GLU A 664     173.571 164.482  58.114  1.00  0.29           O  
ATOM   5340  CB  GLU A 664     173.398 166.469  60.594  1.00  0.29           C  
ATOM   5341  CG  GLU A 664     172.671 167.238  61.719  1.00  0.29           C  
ATOM   5342  CD  GLU A 664     171.153 167.253  61.551  1.00  0.29           C  
ATOM   5343  OE1 GLU A 664     170.460 167.112  62.591  1.00  0.29           O  
ATOM   5344  OE2 GLU A 664     170.687 167.447  60.400  1.00  0.29           O  
ATOM   5345  N   THR A 665     175.140 164.036  59.631  1.00  0.26           N  
ATOM   5346  CA  THR A 665     176.016 163.357  58.681  1.00  0.26           C  
ATOM   5347  C   THR A 665     175.645 161.891  58.646  1.00  0.26           C  
ATOM   5348  O   THR A 665     176.121 161.112  57.823  1.00  0.26           O  
ATOM   5349  CB  THR A 665     177.506 163.474  59.000  1.00  0.26           C  
ATOM   5350  OG1 THR A 665     177.845 162.938  60.258  1.00  0.26           O  
ATOM   5351  CG2 THR A 665     177.948 164.938  59.039  1.00  0.26           C  
ATOM   5352  N   LEU A 666     174.748 161.499  59.557  1.00  0.25           N  
ATOM   5353  CA  LEU A 666     174.084 160.231  59.567  1.00  0.25           C  
ATOM   5354  C   LEU A 666     173.090 160.126  58.431  1.00  0.25           C  
ATOM   5355  O   LEU A 666     172.303 161.037  58.207  1.00  0.25           O  
ATOM   5356  CB  LEU A 666     173.442 159.997  60.937  1.00  0.25           C  
ATOM   5357  CG  LEU A 666     173.388 158.517  61.344  1.00  0.25           C  
ATOM   5358  CD1 LEU A 666     173.424 158.344  62.864  1.00  0.25           C  
ATOM   5359  CD2 LEU A 666     172.217 157.750  60.734  1.00  0.25           C  
ATOM   5360  N   HIS A 667     173.144 159.027  57.641  1.00  0.24           N  
ATOM   5361  CA  HIS A 667     172.244 158.812  56.516  1.00  0.24           C  
ATOM   5362  C   HIS A 667     172.385 159.900  55.439  1.00  0.24           C  
ATOM   5363  O   HIS A 667     171.439 160.261  54.749  1.00  0.24           O  
ATOM   5364  CB  HIS A 667     170.775 158.635  56.991  1.00  0.24           C  
ATOM   5365  CG  HIS A 667     170.500 157.394  57.805  1.00  0.24           C  
ATOM   5366  ND1 HIS A 667     169.488 157.425  58.743  1.00  0.24           N  
ATOM   5367  CD2 HIS A 667     170.914 156.112  57.622  1.00  0.24           C  
ATOM   5368  CE1 HIS A 667     169.302 156.178  59.110  1.00  0.24           C  
ATOM   5369  NE2 HIS A 667     170.136 155.335  58.456  1.00  0.24           N  
ATOM   5370  N   ARG A 668     173.629 160.402  55.234  1.00  0.29           N  
ATOM   5371  CA  ARG A 668     173.929 161.541  54.368  1.00  0.29           C  
ATOM   5372  C   ARG A 668     174.236 161.106  52.950  1.00  0.29           C  
ATOM   5373  O   ARG A 668     174.634 161.886  52.085  1.00  0.29           O  
ATOM   5374  CB  ARG A 668     175.172 162.310  54.890  1.00  0.29           C  
ATOM   5375  CG  ARG A 668     176.529 161.591  54.680  1.00  0.29           C  
ATOM   5376  CD  ARG A 668     177.741 162.318  55.265  1.00  0.29           C  
ATOM   5377  NE  ARG A 668     177.853 163.647  54.580  1.00  0.29           N  
ATOM   5378  CZ  ARG A 668     178.664 164.642  54.965  1.00  0.29           C  
ATOM   5379  NH1 ARG A 668     178.624 165.809  54.326  1.00  0.29           N  
ATOM   5380  NH2 ARG A 668     179.508 164.500  55.983  1.00  0.29           N  
ATOM   5381  N   PHE A 669     174.062 159.808  52.716  1.00  0.20           N  
ATOM   5382  CA  PHE A 669     174.198 159.138  51.460  1.00  0.20           C  
ATOM   5383  C   PHE A 669     172.843 158.522  51.230  1.00  0.20           C  
ATOM   5384  O   PHE A 669     172.327 157.850  52.119  1.00  0.20           O  
ATOM   5385  CB  PHE A 669     175.286 158.046  51.571  1.00  0.20           C  
ATOM   5386  CG  PHE A 669     175.562 157.395  50.249  1.00  0.20           C  
ATOM   5387  CD1 PHE A 669     175.095 156.099  49.984  1.00  0.20           C  
ATOM   5388  CD2 PHE A 669     176.285 158.081  49.261  1.00  0.20           C  
ATOM   5389  CE1 PHE A 669     175.341 155.497  48.744  1.00  0.20           C  
ATOM   5390  CE2 PHE A 669     176.533 157.482  48.019  1.00  0.20           C  
ATOM   5391  CZ  PHE A 669     176.061 156.189  47.762  1.00  0.20           C  
ATOM   5392  N   SER A 670     172.226 158.781  50.059  1.00  0.24           N  
ATOM   5393  CA  SER A 670     170.992 158.150  49.594  1.00  0.24           C  
ATOM   5394  C   SER A 670     170.819 156.678  49.971  1.00  0.24           C  
ATOM   5395  O   SER A 670     171.738 155.868  49.850  1.00  0.24           O  
ATOM   5396  CB  SER A 670     170.845 158.297  48.064  1.00  0.24           C  
ATOM   5397  OG  SER A 670     169.530 157.971  47.617  1.00  0.24           O  
ATOM   5398  N   LEU A 671     169.628 156.312  50.460  1.00  0.26           N  
ATOM   5399  CA  LEU A 671     169.343 154.991  50.969  1.00  0.26           C  
ATOM   5400  C   LEU A 671     168.116 154.460  50.287  1.00  0.26           C  
ATOM   5401  O   LEU A 671     167.128 155.166  50.104  1.00  0.26           O  
ATOM   5402  CB  LEU A 671     169.032 154.997  52.483  1.00  0.26           C  
ATOM   5403  CG  LEU A 671     170.179 155.529  53.351  1.00  0.26           C  
ATOM   5404  CD1 LEU A 671     169.676 155.854  54.758  1.00  0.26           C  
ATOM   5405  CD2 LEU A 671     171.383 154.579  53.380  1.00  0.26           C  
ATOM   5406  N   GLU A 672     168.138 153.179  49.905  1.00  0.24           N  
ATOM   5407  CA  GLU A 672     166.976 152.509  49.374  1.00  0.24           C  
ATOM   5408  C   GLU A 672     165.956 152.177  50.454  1.00  0.24           C  
ATOM   5409  O   GLU A 672     164.754 152.364  50.299  1.00  0.24           O  
ATOM   5410  CB  GLU A 672     167.464 151.248  48.644  1.00  0.24           C  
ATOM   5411  CG  GLU A 672     168.443 151.621  47.501  1.00  0.24           C  
ATOM   5412  CD  GLU A 672     169.031 150.410  46.785  1.00  0.24           C  
ATOM   5413  OE1 GLU A 672     168.854 149.276  47.292  1.00  0.24           O  
ATOM   5414  OE2 GLU A 672     169.699 150.635  45.743  1.00  0.24           O  
ATOM   5415  N   GLY A 673     166.431 151.664  51.614  1.00  0.28           N  
ATOM   5416  CA  GLY A 673     165.555 151.181  52.684  1.00  0.28           C  
ATOM   5417  C   GLY A 673     165.015 149.804  52.403  1.00  0.28           C  
ATOM   5418  O   GLY A 673     164.232 149.257  53.174  1.00  0.28           O  
ATOM   5419  N   ASP A 674     165.459 149.200  51.289  1.00  0.24           N  
ATOM   5420  CA  ASP A 674     165.082 147.878  50.867  1.00  0.24           C  
ATOM   5421  C   ASP A 674     165.881 146.858  51.680  1.00  0.24           C  
ATOM   5422  O   ASP A 674     167.019 146.494  51.386  1.00  0.24           O  
ATOM   5423  CB  ASP A 674     165.282 147.770  49.336  1.00  0.24           C  
ATOM   5424  CG  ASP A 674     164.526 146.596  48.734  1.00  0.24           C  
ATOM   5425  OD1 ASP A 674     163.838 145.874  49.501  1.00  0.24           O  
ATOM   5426  OD2 ASP A 674     164.595 146.427  47.492  1.00  0.24           O  
ATOM   5427  N   ALA A 675     165.279 146.428  52.802  1.00  0.24           N  
ATOM   5428  CA  ALA A 675     165.838 145.462  53.717  1.00  0.24           C  
ATOM   5429  C   ALA A 675     164.779 144.441  54.145  1.00  0.24           C  
ATOM   5430  O   ALA A 675     164.462 144.353  55.334  1.00  0.24           O  
ATOM   5431  CB  ALA A 675     166.437 146.200  54.935  1.00  0.24           C  
ATOM   5432  N   PRO A 676     164.185 143.635  53.240  1.00  0.22           N  
ATOM   5433  CA  PRO A 676     163.191 142.624  53.596  1.00  0.22           C  
ATOM   5434  C   PRO A 676     163.827 141.502  54.381  1.00  0.22           C  
ATOM   5435  O   PRO A 676     163.147 140.777  55.103  1.00  0.22           O  
ATOM   5436  CB  PRO A 676     162.662 142.110  52.243  1.00  0.22           C  
ATOM   5437  CG  PRO A 676     163.765 142.420  51.227  1.00  0.22           C  
ATOM   5438  CD  PRO A 676     164.414 143.681  51.791  1.00  0.22           C  
ATOM   5439  N   VAL A 677     165.137 141.327  54.195  1.00  0.19           N  
ATOM   5440  CA  VAL A 677     165.959 140.358  54.861  1.00  0.19           C  
ATOM   5441  C   VAL A 677     167.202 141.114  55.287  1.00  0.19           C  
ATOM   5442  O   VAL A 677     167.528 142.169  54.745  1.00  0.19           O  
ATOM   5443  CB  VAL A 677     166.309 139.180  53.955  1.00  0.19           C  
ATOM   5444  CG1 VAL A 677     165.027 138.393  53.623  1.00  0.19           C  
ATOM   5445  CG2 VAL A 677     166.964 139.654  52.647  1.00  0.19           C  
ATOM   5446  N   SER A 678     167.957 140.597  56.273  1.00  0.22           N  
ATOM   5447  CA  SER A 678     169.213 141.201  56.702  1.00  0.22           C  
ATOM   5448  C   SER A 678     170.337 140.915  55.718  1.00  0.22           C  
ATOM   5449  O   SER A 678     171.391 141.543  55.741  1.00  0.22           O  
ATOM   5450  CB  SER A 678     169.635 140.691  58.097  1.00  0.22           C  
ATOM   5451  OG  SER A 678     169.647 139.262  58.136  1.00  0.22           O  
ATOM   5452  N   TRP A 679     170.108 139.950  54.810  1.00  0.18           N  
ATOM   5453  CA  TRP A 679     170.943 139.659  53.668  1.00  0.18           C  
ATOM   5454  C   TRP A 679     170.973 140.784  52.635  1.00  0.18           C  
ATOM   5455  O   TRP A 679     170.092 140.908  51.787  1.00  0.18           O  
ATOM   5456  CB  TRP A 679     170.441 138.370  52.979  1.00  0.18           C  
ATOM   5457  CG  TRP A 679     170.480 137.141  53.866  1.00  0.18           C  
ATOM   5458  CD1 TRP A 679     169.488 136.511  54.570  1.00  0.18           C  
ATOM   5459  CD2 TRP A 679     171.684 136.395  54.104  1.00  0.18           C  
ATOM   5460  NE1 TRP A 679     169.999 135.416  55.239  1.00  0.18           N  
ATOM   5461  CE2 TRP A 679     171.347 135.329  54.958  1.00  0.18           C  
ATOM   5462  CE3 TRP A 679     172.986 136.573  53.641  1.00  0.18           C  
ATOM   5463  CZ2 TRP A 679     172.310 134.414  55.369  1.00  0.18           C  
ATOM   5464  CZ3 TRP A 679     173.956 135.649  54.052  1.00  0.18           C  
ATOM   5465  CH2 TRP A 679     173.625 134.584  54.902  1.00  0.18           C  
ATOM   5466  N   THR A 680     172.022 141.618  52.671  1.00  0.18           N  
ATOM   5467  CA  THR A 680     172.213 142.739  51.768  1.00  0.18           C  
ATOM   5468  C   THR A 680     173.511 142.527  51.022  1.00  0.18           C  
ATOM   5469  O   THR A 680     174.438 141.887  51.517  1.00  0.18           O  
ATOM   5470  CB  THR A 680     172.246 144.097  52.466  1.00  0.18           C  
ATOM   5471  OG1 THR A 680     173.244 144.164  53.479  1.00  0.18           O  
ATOM   5472  CG2 THR A 680     170.896 144.333  53.158  1.00  0.18           C  
ATOM   5473  N   GLU A 681     173.614 143.039  49.781  1.00  0.18           N  
ATOM   5474  CA  GLU A 681     174.829 142.915  49.001  1.00  0.18           C  
ATOM   5475  C   GLU A 681     175.556 144.250  49.004  1.00  0.18           C  
ATOM   5476  O   GLU A 681     175.141 145.224  48.381  1.00  0.18           O  
ATOM   5477  CB  GLU A 681     174.523 142.459  47.560  1.00  0.18           C  
ATOM   5478  CG  GLU A 681     175.788 142.237  46.693  1.00  0.18           C  
ATOM   5479  CD  GLU A 681     175.478 141.794  45.263  1.00  0.18           C  
ATOM   5480  OE1 GLU A 681     174.292 141.512  44.956  1.00  0.18           O  
ATOM   5481  OE2 GLU A 681     176.454 141.739  44.468  1.00  0.18           O  
ATOM   5482  N   THR A 682     176.677 144.325  49.745  1.00  0.23           N  
ATOM   5483  CA  THR A 682     177.411 145.569  49.945  1.00  0.23           C  
ATOM   5484  C   THR A 682     178.878 145.218  49.973  1.00  0.23           C  
ATOM   5485  O   THR A 682     179.302 144.287  50.657  1.00  0.23           O  
ATOM   5486  CB  THR A 682     177.087 146.301  51.252  1.00  0.23           C  
ATOM   5487  OG1 THR A 682     175.711 146.640  51.323  1.00  0.23           O  
ATOM   5488  CG2 THR A 682     177.845 147.631  51.362  1.00  0.23           C  
ATOM   5489  N   LYS A 683     179.724 145.958  49.231  1.00  0.18           N  
ATOM   5490  CA  LYS A 683     181.152 145.715  49.211  1.00  0.18           C  
ATOM   5491  C   LYS A 683     181.834 146.319  50.428  1.00  0.18           C  
ATOM   5492  O   LYS A 683     181.613 147.475  50.779  1.00  0.18           O  
ATOM   5493  CB  LYS A 683     181.821 146.291  47.941  1.00  0.18           C  
ATOM   5494  CG  LYS A 683     181.322 145.651  46.636  1.00  0.18           C  
ATOM   5495  CD  LYS A 683     181.979 146.272  45.390  1.00  0.18           C  
ATOM   5496  CE  LYS A 683     181.473 145.654  44.082  1.00  0.18           C  
ATOM   5497  NZ  LYS A 683     182.097 146.324  42.918  1.00  0.18           N  
ATOM   5498  N   LYS A 684     182.703 145.546  51.096  1.00  0.17           N  
ATOM   5499  CA  LYS A 684     183.418 146.008  52.264  1.00  0.17           C  
ATOM   5500  C   LYS A 684     184.900 145.959  51.962  1.00  0.17           C  
ATOM   5501  O   LYS A 684     185.469 144.897  51.732  1.00  0.17           O  
ATOM   5502  CB  LYS A 684     183.098 145.131  53.497  1.00  0.17           C  
ATOM   5503  CG  LYS A 684     181.616 145.188  53.909  1.00  0.17           C  
ATOM   5504  CD  LYS A 684     181.307 144.302  55.128  1.00  0.17           C  
ATOM   5505  CE  LYS A 684     179.830 144.345  55.530  1.00  0.17           C  
ATOM   5506  NZ  LYS A 684     179.603 143.499  56.722  1.00  0.17           N  
ATOM   5507  N   GLN A 685     185.558 147.132  51.938  1.00  0.32           N  
ATOM   5508  CA  GLN A 685     186.995 147.231  51.732  1.00  0.32           C  
ATOM   5509  C   GLN A 685     187.698 147.444  53.069  1.00  0.32           C  
ATOM   5510  O   GLN A 685     188.919 147.520  53.166  1.00  0.32           O  
ATOM   5511  CB  GLN A 685     187.317 148.427  50.804  1.00  0.32           C  
ATOM   5512  CG  GLN A 685     186.635 148.369  49.415  1.00  0.32           C  
ATOM   5513  CD  GLN A 685     187.114 147.168  48.596  1.00  0.32           C  
ATOM   5514  OE1 GLN A 685     188.305 146.957  48.385  1.00  0.32           O  
ATOM   5515  NE2 GLN A 685     186.158 146.353  48.091  1.00  0.32           N  
ATOM   5516  N   SER A 686     186.910 147.528  54.150  1.00  0.31           N  
ATOM   5517  CA  SER A 686     187.371 147.741  55.501  1.00  0.31           C  
ATOM   5518  C   SER A 686     186.250 147.274  56.413  1.00  0.31           C  
ATOM   5519  O   SER A 686     185.151 146.971  55.946  1.00  0.31           O  
ATOM   5520  CB  SER A 686     187.771 149.214  55.801  1.00  0.31           C  
ATOM   5521  OG  SER A 686     186.673 150.117  55.654  1.00  0.31           O  
ATOM   5522  N   PHE A 687     186.509 147.153  57.731  1.00  0.23           N  
ATOM   5523  CA  PHE A 687     185.498 146.793  58.714  1.00  0.23           C  
ATOM   5524  C   PHE A 687     185.206 148.022  59.571  1.00  0.23           C  
ATOM   5525  O   PHE A 687     184.380 148.869  59.244  1.00  0.23           O  
ATOM   5526  CB  PHE A 687     186.006 145.585  59.567  1.00  0.23           C  
ATOM   5527  CG  PHE A 687     185.018 145.132  60.621  1.00  0.23           C  
ATOM   5528  CD1 PHE A 687     185.219 145.426  61.984  1.00  0.23           C  
ATOM   5529  CD2 PHE A 687     183.857 144.440  60.245  1.00  0.23           C  
ATOM   5530  CE1 PHE A 687     184.241 145.115  62.936  1.00  0.23           C  
ATOM   5531  CE2 PHE A 687     182.889 144.101  61.199  1.00  0.23           C  
ATOM   5532  CZ  PHE A 687     183.071 144.460  62.540  1.00  0.23           C  
ATOM   5533  N   LYS A 688     185.926 148.159  60.701  1.00  0.23           N  
ATOM   5534  CA  LYS A 688     185.825 149.286  61.594  1.00  0.23           C  
ATOM   5535  C   LYS A 688     186.470 150.514  60.988  1.00  0.23           C  
ATOM   5536  O   LYS A 688     187.640 150.505  60.607  1.00  0.23           O  
ATOM   5537  CB  LYS A 688     186.512 148.985  62.948  1.00  0.23           C  
ATOM   5538  CG  LYS A 688     186.334 150.082  64.015  1.00  0.23           C  
ATOM   5539  CD  LYS A 688     187.019 149.718  65.343  1.00  0.23           C  
ATOM   5540  CE  LYS A 688     186.860 150.798  66.418  1.00  0.23           C  
ATOM   5541  NZ  LYS A 688     187.531 150.376  67.670  1.00  0.23           N  
ATOM   5542  N   GLN A 689     185.721 151.620  60.920  1.00  0.23           N  
ATOM   5543  CA  GLN A 689     186.263 152.888  60.500  1.00  0.23           C  
ATOM   5544  C   GLN A 689     186.803 153.640  61.676  1.00  0.23           C  
ATOM   5545  O   GLN A 689     186.259 153.623  62.780  1.00  0.23           O  
ATOM   5546  CB  GLN A 689     185.185 153.747  59.829  1.00  0.23           C  
ATOM   5547  CG  GLN A 689     185.509 155.243  59.521  1.00  0.23           C  
ATOM   5548  CD  GLN A 689     186.446 155.398  58.322  1.00  0.23           C  
ATOM   5549  OE1 GLN A 689     186.282 154.714  57.311  1.00  0.23           O  
ATOM   5550  NE2 GLN A 689     187.424 156.322  58.399  1.00  0.23           N  
ATOM   5551  N   THR A 690     187.898 154.351  61.430  1.00  0.20           N  
ATOM   5552  CA  THR A 690     188.474 155.261  62.380  1.00  0.20           C  
ATOM   5553  C   THR A 690     189.064 156.378  61.564  1.00  0.20           C  
ATOM   5554  O   THR A 690     189.436 156.187  60.409  1.00  0.20           O  
ATOM   5555  CB  THR A 690     189.491 154.567  63.255  1.00  0.20           C  
ATOM   5556  OG1 THR A 690     189.980 155.429  64.270  1.00  0.20           O  
ATOM   5557  CG2 THR A 690     190.666 154.026  62.432  1.00  0.20           C  
ATOM   5558  N   GLY A 691     189.074 157.604  62.106  1.00  0.27           N  
ATOM   5559  CA  GLY A 691     189.620 158.765  61.420  1.00  0.27           C  
ATOM   5560  C   GLY A 691     191.068 158.952  61.764  1.00  0.27           C  
ATOM   5561  O   GLY A 691     191.869 158.025  61.752  1.00  0.27           O  
ATOM   5562  N   GLU A 692     191.456 160.193  62.087  1.00  0.25           N  
ATOM   5563  CA  GLU A 692     192.751 160.444  62.677  1.00  0.25           C  
ATOM   5564  C   GLU A 692     192.793 159.953  64.126  1.00  0.25           C  
ATOM   5565  O   GLU A 692     191.800 160.019  64.847  1.00  0.25           O  
ATOM   5566  CB  GLU A 692     193.101 161.937  62.529  1.00  0.25           C  
ATOM   5567  CG  GLU A 692     194.567 162.300  62.853  1.00  0.25           C  
ATOM   5568  CD  GLU A 692     194.934 163.723  62.431  1.00  0.25           C  
ATOM   5569  OE1 GLU A 692     196.028 164.166  62.863  1.00  0.25           O  
ATOM   5570  OE2 GLU A 692     194.156 164.349  61.663  1.00  0.25           O  
ATOM   5571  N   PHE A 693     193.935 159.388  64.573  1.00  0.20           N  
ATOM   5572  CA  PHE A 693     194.151 158.998  65.960  1.00  0.20           C  
ATOM   5573  C   PHE A 693     194.203 160.207  66.893  1.00  0.20           C  
ATOM   5574  O   PHE A 693     193.682 160.188  68.005  1.00  0.20           O  
ATOM   5575  CB  PHE A 693     195.466 158.176  66.051  1.00  0.20           C  
ATOM   5576  CG  PHE A 693     195.743 157.677  67.448  1.00  0.20           C  
ATOM   5577  CD1 PHE A 693     196.616 158.386  68.292  1.00  0.20           C  
ATOM   5578  CD2 PHE A 693     195.106 156.527  67.939  1.00  0.20           C  
ATOM   5579  CE1 PHE A 693     196.840 157.960  69.607  1.00  0.20           C  
ATOM   5580  CE2 PHE A 693     195.334 156.093  69.252  1.00  0.20           C  
ATOM   5581  CZ  PHE A 693     196.200 156.811  70.086  1.00  0.20           C  
ATOM   5582  N   GLY A 694     194.878 161.286  66.444  1.00  0.30           N  
ATOM   5583  CA  GLY A 694     194.857 162.569  67.123  1.00  0.30           C  
ATOM   5584  C   GLY A 694     193.687 163.421  66.700  1.00  0.30           C  
ATOM   5585  O   GLY A 694     192.898 163.068  65.830  1.00  0.30           O  
ATOM   5586  N   GLU A 695     193.586 164.610  67.308  1.00  0.26           N  
ATOM   5587  CA  GLU A 695     192.607 165.614  66.960  1.00  0.26           C  
ATOM   5588  C   GLU A 695     193.025 166.399  65.737  1.00  0.26           C  
ATOM   5589  O   GLU A 695     194.211 166.590  65.472  1.00  0.26           O  
ATOM   5590  CB  GLU A 695     192.449 166.642  68.097  1.00  0.26           C  
ATOM   5591  CG  GLU A 695     192.001 166.031  69.443  1.00  0.26           C  
ATOM   5592  CD  GLU A 695     190.561 165.526  69.404  1.00  0.26           C  
ATOM   5593  OE1 GLU A 695     189.716 166.211  68.772  1.00  0.26           O  
ATOM   5594  OE2 GLU A 695     190.294 164.476  70.041  1.00  0.26           O  
ATOM   5595  N   LYS A 696     192.049 166.939  64.995  1.00  0.28           N  
ATOM   5596  CA  LYS A 696     192.327 167.665  63.780  1.00  0.28           C  
ATOM   5597  C   LYS A 696     191.643 169.016  63.824  1.00  0.28           C  
ATOM   5598  O   LYS A 696     190.787 169.305  64.656  1.00  0.28           O  
ATOM   5599  CB  LYS A 696     191.911 166.852  62.533  1.00  0.28           C  
ATOM   5600  CG  LYS A 696     190.409 166.558  62.424  1.00  0.28           C  
ATOM   5601  CD  LYS A 696     190.102 165.649  61.226  1.00  0.28           C  
ATOM   5602  CE  LYS A 696     188.613 165.362  61.076  1.00  0.28           C  
ATOM   5603  NZ  LYS A 696     188.406 164.502  59.892  1.00  0.28           N  
ATOM   5604  N   ARG A 697     192.038 169.940  62.931  1.00  0.19           N  
ATOM   5605  CA  ARG A 697     191.325 171.190  62.774  1.00  0.19           C  
ATOM   5606  C   ARG A 697     190.053 171.001  61.967  1.00  0.19           C  
ATOM   5607  O   ARG A 697     189.959 170.090  61.146  1.00  0.19           O  
ATOM   5608  CB  ARG A 697     192.195 172.278  62.110  1.00  0.19           C  
ATOM   5609  CG  ARG A 697     193.454 172.628  62.924  1.00  0.19           C  
ATOM   5610  CD  ARG A 697     194.311 173.693  62.240  1.00  0.19           C  
ATOM   5611  NE  ARG A 697     195.518 173.891  63.098  1.00  0.19           N  
ATOM   5612  CZ  ARG A 697     196.528 174.710  62.779  1.00  0.19           C  
ATOM   5613  NH1 ARG A 697     197.575 174.805  63.594  1.00  0.19           N  
ATOM   5614  NH2 ARG A 697     196.512 175.431  61.662  1.00  0.19           N  
ATOM   5615  N   LYS A 698     189.054 171.886  62.191  1.00  0.25           N  
ATOM   5616  CA  LYS A 698     187.743 171.801  61.564  1.00  0.25           C  
ATOM   5617  C   LYS A 698     186.945 170.622  62.093  1.00  0.25           C  
ATOM   5618  O   LYS A 698     186.397 169.810  61.349  1.00  0.25           O  
ATOM   5619  CB  LYS A 698     187.776 171.816  60.016  1.00  0.25           C  
ATOM   5620  CG  LYS A 698     188.593 172.971  59.417  1.00  0.25           C  
ATOM   5621  CD  LYS A 698     188.720 172.841  57.892  1.00  0.25           C  
ATOM   5622  CE  LYS A 698     189.532 173.970  57.257  1.00  0.25           C  
ATOM   5623  NZ  LYS A 698     189.604 173.771  55.794  1.00  0.25           N  
ATOM   5624  N   ASN A 699     186.877 170.513  63.435  1.00  0.26           N  
ATOM   5625  CA  ASN A 699     186.042 169.543  64.111  1.00  0.26           C  
ATOM   5626  C   ASN A 699     184.583 169.686  63.756  1.00  0.26           C  
ATOM   5627  O   ASN A 699     184.048 170.776  63.558  1.00  0.26           O  
ATOM   5628  CB  ASN A 699     186.167 169.591  65.648  1.00  0.26           C  
ATOM   5629  CG  ASN A 699     187.597 169.203  65.972  1.00  0.26           C  
ATOM   5630  OD1 ASN A 699     188.065 168.175  65.488  1.00  0.26           O  
ATOM   5631  ND2 ASN A 699     188.316 170.041  66.750  1.00  0.26           N  
ATOM   5632  N   SER A 700     183.899 168.540  63.662  1.00  0.25           N  
ATOM   5633  CA  SER A 700     182.488 168.530  63.397  1.00  0.25           C  
ATOM   5634  C   SER A 700     181.703 168.933  64.616  1.00  0.25           C  
ATOM   5635  O   SER A 700     182.175 168.921  65.752  1.00  0.25           O  
ATOM   5636  CB  SER A 700     181.964 167.175  62.877  1.00  0.25           C  
ATOM   5637  OG  SER A 700     182.118 166.135  63.842  1.00  0.25           O  
ATOM   5638  N   ILE A 701     180.450 169.325  64.384  1.00  0.24           N  
ATOM   5639  CA  ILE A 701     179.588 169.767  65.442  1.00  0.24           C  
ATOM   5640  C   ILE A 701     178.391 168.825  65.448  1.00  0.24           C  
ATOM   5641  O   ILE A 701     177.546 168.853  64.557  1.00  0.24           O  
ATOM   5642  CB  ILE A 701     179.182 171.221  65.227  1.00  0.24           C  
ATOM   5643  CG1 ILE A 701     180.393 172.170  65.020  1.00  0.24           C  
ATOM   5644  CG2 ILE A 701     178.397 171.661  66.460  1.00  0.24           C  
ATOM   5645  CD1 ILE A 701     179.984 173.592  64.616  1.00  0.24           C  
ATOM   5646  N   LEU A 702     178.292 167.935  66.463  1.00  0.24           N  
ATOM   5647  CA  LEU A 702     177.167 167.018  66.620  1.00  0.24           C  
ATOM   5648  C   LEU A 702     175.949 167.701  67.237  1.00  0.24           C  
ATOM   5649  O   LEU A 702     174.837 167.186  67.210  1.00  0.24           O  
ATOM   5650  CB  LEU A 702     177.573 165.728  67.396  1.00  0.24           C  
ATOM   5651  CG  LEU A 702     178.038 165.856  68.865  1.00  0.24           C  
ATOM   5652  CD1 LEU A 702     176.874 165.950  69.857  1.00  0.24           C  
ATOM   5653  CD2 LEU A 702     178.894 164.645  69.267  1.00  0.24           C  
ATOM   5654  N   ASN A 703     176.160 168.900  67.812  1.00  0.21           N  
ATOM   5655  CA  ASN A 703     175.160 169.715  68.475  1.00  0.21           C  
ATOM   5656  C   ASN A 703     175.323 171.149  67.976  1.00  0.21           C  
ATOM   5657  O   ASN A 703     176.269 171.781  68.449  1.00  0.21           O  
ATOM   5658  CB  ASN A 703     175.446 169.648  70.001  1.00  0.21           C  
ATOM   5659  CG  ASN A 703     174.393 170.360  70.841  1.00  0.21           C  
ATOM   5660  OD1 ASN A 703     173.352 170.794  70.355  1.00  0.21           O  
ATOM   5661  ND2 ASN A 703     174.660 170.462  72.165  1.00  0.21           N  
ATOM   5662  N   PRO A 704     174.521 171.687  67.042  1.00  0.30           N  
ATOM   5663  CA  PRO A 704     174.720 172.994  66.417  1.00  0.30           C  
ATOM   5664  C   PRO A 704     175.144 174.143  67.322  1.00  0.30           C  
ATOM   5665  O   PRO A 704     174.666 174.263  68.448  1.00  0.30           O  
ATOM   5666  CB  PRO A 704     173.395 173.288  65.706  1.00  0.30           C  
ATOM   5667  CG  PRO A 704     172.817 171.911  65.363  1.00  0.30           C  
ATOM   5668  CD  PRO A 704     173.393 170.976  66.434  1.00  0.30           C  
ATOM   5669  N   ILE A 705     176.029 175.023  66.833  1.00  0.27           N  
ATOM   5670  CA  ILE A 705     176.539 176.145  67.598  1.00  0.27           C  
ATOM   5671  C   ILE A 705     175.903 177.381  66.997  1.00  0.27           C  
ATOM   5672  O   ILE A 705     175.802 177.518  65.778  1.00  0.27           O  
ATOM   5673  CB  ILE A 705     178.073 176.217  67.581  1.00  0.27           C  
ATOM   5674  CG1 ILE A 705     178.669 174.976  68.286  1.00  0.27           C  
ATOM   5675  CG2 ILE A 705     178.605 177.492  68.273  1.00  0.27           C  
ATOM   5676  CD1 ILE A 705     180.187 174.845  68.121  1.00  0.27           C  
ATOM   5677  N   ASN A 706     175.414 178.313  67.846  1.00  0.22           N  
ATOM   5678  CA  ASN A 706     174.952 179.623  67.415  1.00  0.22           C  
ATOM   5679  C   ASN A 706     176.014 180.393  66.639  1.00  0.22           C  
ATOM   5680  O   ASN A 706     177.211 180.159  66.773  1.00  0.22           O  
ATOM   5681  CB  ASN A 706     174.522 180.521  68.600  1.00  0.22           C  
ATOM   5682  CG  ASN A 706     173.293 179.951  69.285  1.00  0.22           C  
ATOM   5683  OD1 ASN A 706     172.386 179.405  68.669  1.00  0.22           O  
ATOM   5684  ND2 ASN A 706     173.226 180.100  70.630  1.00  0.22           N  
ATOM   5685  N   SER A 707     175.612 181.369  65.811  1.00  0.26           N  
ATOM   5686  CA  SER A 707     176.581 182.223  65.146  1.00  0.26           C  
ATOM   5687  C   SER A 707     177.523 182.961  66.101  1.00  0.26           C  
ATOM   5688  O   SER A 707     177.162 183.361  67.210  1.00  0.26           O  
ATOM   5689  CB  SER A 707     175.928 183.226  64.164  1.00  0.26           C  
ATOM   5690  OG  SER A 707     175.052 184.134  64.831  1.00  0.26           O  
ATOM   5691  N   ILE A 708     178.791 183.109  65.678  1.00  0.21           N  
ATOM   5692  CA  ILE A 708     179.854 183.698  66.466  1.00  0.21           C  
ATOM   5693  C   ILE A 708     180.324 184.940  65.748  1.00  0.21           C  
ATOM   5694  O   ILE A 708     180.313 185.009  64.519  1.00  0.21           O  
ATOM   5695  CB  ILE A 708     181.062 182.781  66.683  1.00  0.21           C  
ATOM   5696  CG1 ILE A 708     181.622 182.169  65.376  1.00  0.21           C  
ATOM   5697  CG2 ILE A 708     180.658 181.683  67.683  1.00  0.21           C  
ATOM   5698  CD1 ILE A 708     182.991 181.502  65.555  1.00  0.21           C  
ATOM   5699  N   ARG A 709     180.761 185.973  66.491  1.00  0.16           N  
ATOM   5700  CA  ARG A 709     181.243 187.203  65.878  1.00  0.16           C  
ATOM   5701  C   ARG A 709     182.553 187.063  65.101  1.00  0.16           C  
ATOM   5702  O   ARG A 709     182.810 187.825  64.176  1.00  0.16           O  
ATOM   5703  CB  ARG A 709     181.427 188.322  66.929  1.00  0.16           C  
ATOM   5704  CG  ARG A 709     180.118 188.712  67.642  1.00  0.16           C  
ATOM   5705  CD  ARG A 709     180.329 189.753  68.743  1.00  0.16           C  
ATOM   5706  NE  ARG A 709     178.975 190.069  69.293  1.00  0.16           N  
ATOM   5707  CZ  ARG A 709     178.767 190.887  70.332  1.00  0.16           C  
ATOM   5708  NH1 ARG A 709     177.523 191.108  70.752  1.00  0.16           N  
ATOM   5709  NH2 ARG A 709     179.775 191.483  70.961  1.00  0.16           N  
ATOM   5710  N   LYS A 710     183.423 186.104  65.504  1.00  0.23           N  
ATOM   5711  CA  LYS A 710     184.750 185.870  64.935  1.00  0.23           C  
ATOM   5712  C   LYS A 710     185.692 187.060  65.078  1.00  0.23           C  
ATOM   5713  O   LYS A 710     186.561 187.304  64.248  1.00  0.23           O  
ATOM   5714  CB  LYS A 710     184.703 185.401  63.460  1.00  0.23           C  
ATOM   5715  CG  LYS A 710     183.794 184.185  63.248  1.00  0.23           C  
ATOM   5716  CD  LYS A 710     183.748 183.691  61.795  1.00  0.23           C  
ATOM   5717  CE  LYS A 710     182.824 182.483  61.629  1.00  0.23           C  
ATOM   5718  NZ  LYS A 710     182.803 182.045  60.217  1.00  0.23           N  
ATOM   5719  N   PHE A 711     185.534 187.817  66.175  1.00  0.17           N  
ATOM   5720  CA  PHE A 711     186.252 189.052  66.393  1.00  0.17           C  
ATOM   5721  C   PHE A 711     186.921 188.951  67.749  1.00  0.17           C  
ATOM   5722  O   PHE A 711     188.016 188.423  67.911  1.00  0.17           O  
ATOM   5723  CB  PHE A 711     185.234 190.233  66.312  1.00  0.17           C  
ATOM   5724  CG  PHE A 711     185.886 191.576  66.516  1.00  0.17           C  
ATOM   5725  CD1 PHE A 711     185.589 192.390  67.627  1.00  0.17           C  
ATOM   5726  CD2 PHE A 711     186.853 192.005  65.597  1.00  0.17           C  
ATOM   5727  CE1 PHE A 711     186.284 193.590  67.833  1.00  0.17           C  
ATOM   5728  CE2 PHE A 711     187.540 193.207  65.794  1.00  0.17           C  
ATOM   5729  CZ  PHE A 711     187.262 193.995  66.917  1.00  0.17           C  
ATOM   5730  N   SER A 712     186.229 189.433  68.790  1.00  0.21           N  
ATOM   5731  CA  SER A 712     186.651 189.286  70.164  1.00  0.21           C  
ATOM   5732  C   SER A 712     186.221 187.933  70.686  1.00  0.21           C  
ATOM   5733  O   SER A 712     185.189 187.393  70.289  1.00  0.21           O  
ATOM   5734  CB  SER A 712     186.050 190.411  71.042  1.00  0.21           C  
ATOM   5735  OG  SER A 712     186.539 190.374  72.382  1.00  0.21           O  
ATOM   5736  N   ILE A 713     186.985 187.356  71.634  1.00  0.18           N  
ATOM   5737  CA  ILE A 713     186.644 186.104  72.295  1.00  0.18           C  
ATOM   5738  C   ILE A 713     185.446 186.284  73.217  1.00  0.18           C  
ATOM   5739  O   ILE A 713     184.771 185.334  73.606  1.00  0.18           O  
ATOM   5740  CB  ILE A 713     187.824 185.532  73.071  1.00  0.18           C  
ATOM   5741  CG1 ILE A 713     188.300 186.455  74.220  1.00  0.18           C  
ATOM   5742  CG2 ILE A 713     188.949 185.225  72.061  1.00  0.18           C  
ATOM   5743  CD1 ILE A 713     189.343 185.805  75.134  1.00  0.18           C  
ATOM   5744  N   VAL A 714     185.129 187.553  73.545  1.00  0.17           N  
ATOM   5745  CA  VAL A 714     183.922 187.972  74.228  1.00  0.17           C  
ATOM   5746  C   VAL A 714     182.671 187.661  73.399  1.00  0.17           C  
ATOM   5747  O   VAL A 714     182.270 188.407  72.502  1.00  0.17           O  
ATOM   5748  CB  VAL A 714     183.980 189.459  74.557  1.00  0.17           C  
ATOM   5749  CG1 VAL A 714     182.777 189.882  75.421  1.00  0.17           C  
ATOM   5750  CG2 VAL A 714     185.289 189.780  75.308  1.00  0.17           C  
ATOM   5751  N   GLN A 715     182.036 186.513  73.696  1.00  0.19           N  
ATOM   5752  CA  GLN A 715     180.832 186.042  73.046  1.00  0.19           C  
ATOM   5753  C   GLN A 715     179.723 185.964  74.080  1.00  0.19           C  
ATOM   5754  O   GLN A 715     178.874 186.845  74.192  1.00  0.19           O  
ATOM   5755  CB  GLN A 715     181.057 184.642  72.417  1.00  0.19           C  
ATOM   5756  CG  GLN A 715     182.112 184.609  71.284  1.00  0.19           C  
ATOM   5757  CD  GLN A 715     181.730 185.469  70.081  1.00  0.19           C  
ATOM   5758  OE1 GLN A 715     180.680 185.337  69.449  1.00  0.19           O  
ATOM   5759  NE2 GLN A 715     182.635 186.394  69.692  1.00  0.19           N  
ATOM   5760  N   LYS A 716     179.721 184.882  74.879  1.00  0.19           N  
ATOM   5761  CA  LYS A 716     178.792 184.656  75.954  1.00  0.19           C  
ATOM   5762  C   LYS A 716     179.603 184.100  77.109  1.00  0.19           C  
ATOM   5763  O   LYS A 716     180.471 183.250  76.930  1.00  0.19           O  
ATOM   5764  CB  LYS A 716     177.681 183.657  75.542  1.00  0.19           C  
ATOM   5765  CG  LYS A 716     176.790 184.196  74.408  1.00  0.19           C  
ATOM   5766  CD  LYS A 716     175.634 183.261  74.025  1.00  0.19           C  
ATOM   5767  CE  LYS A 716     174.801 183.820  72.869  1.00  0.19           C  
ATOM   5768  NZ  LYS A 716     173.668 182.915  72.587  1.00  0.19           N  
ATOM   5769  N   THR A 717     179.366 184.603  78.332  1.00  0.42           N  
ATOM   5770  CA  THR A 717     179.954 184.108  79.571  1.00  0.42           C  
ATOM   5771  C   THR A 717     179.615 182.638  79.852  1.00  0.42           C  
ATOM   5772  O   THR A 717     178.560 182.176  79.408  1.00  0.42           O  
ATOM   5773  CB  THR A 717     179.517 184.945  80.770  1.00  0.42           C  
ATOM   5774  OG1 THR A 717     178.100 184.980  80.874  1.00  0.42           O  
ATOM   5775  CG2 THR A 717     179.997 186.396  80.622  1.00  0.42           C  
ATOM   5776  N   PRO A 718     180.399 181.837  80.595  1.00  0.43           N  
ATOM   5777  CA  PRO A 718     180.022 180.469  80.965  1.00  0.43           C  
ATOM   5778  C   PRO A 718     178.820 180.413  81.909  1.00  0.43           C  
ATOM   5779  O   PRO A 718     178.383 179.340  82.284  1.00  0.43           O  
ATOM   5780  CB  PRO A 718     181.310 179.887  81.549  1.00  0.43           C  
ATOM   5781  CG  PRO A 718     181.978 181.084  82.220  1.00  0.43           C  
ATOM   5782  CD  PRO A 718     181.648 182.238  81.264  1.00  0.43           C  
ATOM   5783  N   LEU A 719     178.225 181.560  82.289  1.00  0.43           N  
ATOM   5784  CA  LEU A 719     176.915 181.634  82.914  1.00  0.43           C  
ATOM   5785  C   LEU A 719     175.812 181.153  81.965  1.00  0.43           C  
ATOM   5786  O   LEU A 719     174.761 180.679  82.388  1.00  0.43           O  
ATOM   5787  CB  LEU A 719     176.615 183.089  83.339  1.00  0.43           C  
ATOM   5788  CG  LEU A 719     177.645 183.696  84.312  1.00  0.43           C  
ATOM   5789  CD1 LEU A 719     177.402 185.204  84.466  1.00  0.43           C  
ATOM   5790  CD2 LEU A 719     177.605 182.997  85.677  1.00  0.43           C  
ATOM   5791  N   GLN A 720     176.060 181.205  80.637  1.00  0.41           N  
ATOM   5792  CA  GLN A 720     175.156 180.684  79.626  1.00  0.41           C  
ATOM   5793  C   GLN A 720     175.462 179.216  79.307  1.00  0.41           C  
ATOM   5794  O   GLN A 720     174.916 178.630  78.377  1.00  0.41           O  
ATOM   5795  CB  GLN A 720     175.272 181.503  78.317  1.00  0.41           C  
ATOM   5796  CG  GLN A 720     175.030 183.028  78.452  1.00  0.41           C  
ATOM   5797  CD  GLN A 720     173.585 183.368  78.822  1.00  0.41           C  
ATOM   5798  OE1 GLN A 720     172.646 182.961  78.141  1.00  0.41           O  
ATOM   5799  NE2 GLN A 720     173.400 184.181  79.888  1.00  0.41           N  
ATOM   5800  N   MET A 721     176.330 178.570  80.114  1.00  0.39           N  
ATOM   5801  CA  MET A 721     176.565 177.134  80.089  1.00  0.39           C  
ATOM   5802  C   MET A 721     175.427 176.380  80.770  1.00  0.39           C  
ATOM   5803  O   MET A 721     175.229 175.181  80.589  1.00  0.39           O  
ATOM   5804  CB  MET A 721     177.880 176.841  80.840  1.00  0.39           C  
ATOM   5805  CG  MET A 721     178.509 175.456  80.607  1.00  0.39           C  
ATOM   5806  SD  MET A 721     179.115 175.149  78.920  1.00  0.39           S  
ATOM   5807  CE  MET A 721     180.487 176.338  78.957  1.00  0.39           C  
ATOM   5808  N   ASN A 722     174.614 177.102  81.571  1.00  0.42           N  
ATOM   5809  CA  ASN A 722     173.366 176.602  82.107  1.00  0.42           C  
ATOM   5810  C   ASN A 722     172.373 176.223  81.014  1.00  0.42           C  
ATOM   5811  O   ASN A 722     171.763 177.082  80.383  1.00  0.42           O  
ATOM   5812  CB  ASN A 722     172.670 177.657  83.000  1.00  0.42           C  
ATOM   5813  CG  ASN A 722     173.481 177.913  84.261  1.00  0.42           C  
ATOM   5814  OD1 ASN A 722     173.900 176.983  84.947  1.00  0.42           O  
ATOM   5815  ND2 ASN A 722     173.658 179.201  84.626  1.00  0.42           N  
ATOM   5816  N   GLY A 723     172.122 174.912  80.812  1.00  0.23           N  
ATOM   5817  CA  GLY A 723     171.176 174.415  79.810  1.00  0.23           C  
ATOM   5818  C   GLY A 723     169.746 174.450  80.281  1.00  0.23           C  
ATOM   5819  O   GLY A 723     168.945 173.568  79.990  1.00  0.23           O  
ATOM   5820  N   ILE A 724     169.404 175.478  81.065  1.00  0.19           N  
ATOM   5821  CA  ILE A 724     168.111 175.670  81.675  1.00  0.19           C  
ATOM   5822  C   ILE A 724     167.322 176.599  80.776  1.00  0.19           C  
ATOM   5823  O   ILE A 724     167.772 177.690  80.433  1.00  0.19           O  
ATOM   5824  CB  ILE A 724     168.251 176.261  83.076  1.00  0.19           C  
ATOM   5825  CG1 ILE A 724     169.141 175.364  83.984  1.00  0.19           C  
ATOM   5826  CG2 ILE A 724     166.851 176.544  83.662  1.00  0.19           C  
ATOM   5827  CD1 ILE A 724     168.589 173.961  84.255  1.00  0.19           C  
ATOM   5828  N   GLU A 725     166.121 176.173  80.360  1.00  0.19           N  
ATOM   5829  CA  GLU A 725     165.276 176.929  79.465  1.00  0.19           C  
ATOM   5830  C   GLU A 725     164.181 177.619  80.246  1.00  0.19           C  
ATOM   5831  O   GLU A 725     163.399 176.980  80.941  1.00  0.19           O  
ATOM   5832  CB  GLU A 725     164.626 175.992  78.431  1.00  0.19           C  
ATOM   5833  CG  GLU A 725     163.714 176.701  77.400  1.00  0.19           C  
ATOM   5834  CD  GLU A 725     163.030 175.715  76.454  1.00  0.19           C  
ATOM   5835  OE1 GLU A 725     163.191 174.479  76.640  1.00  0.19           O  
ATOM   5836  OE2 GLU A 725     162.320 176.206  75.539  1.00  0.19           O  
ATOM   5837  N   GLU A 726     164.094 178.949  80.119  1.00  0.22           N  
ATOM   5838  CA  GLU A 726     163.147 179.746  80.857  1.00  0.22           C  
ATOM   5839  C   GLU A 726     163.317 181.152  80.349  1.00  0.22           C  
ATOM   5840  O   GLU A 726     164.426 181.683  80.290  1.00  0.22           O  
ATOM   5841  CB  GLU A 726     163.388 179.743  82.388  1.00  0.22           C  
ATOM   5842  CG  GLU A 726     162.360 180.572  83.198  1.00  0.22           C  
ATOM   5843  CD  GLU A 726     162.652 180.649  84.697  1.00  0.22           C  
ATOM   5844  OE1 GLU A 726     161.698 181.019  85.432  1.00  0.22           O  
ATOM   5845  OE2 GLU A 726     163.816 180.409  85.109  1.00  0.22           O  
ATOM   5846  N   ASP A 727     162.218 181.778  79.902  1.00  0.25           N  
ATOM   5847  CA  ASP A 727     162.240 183.162  79.490  1.00  0.25           C  
ATOM   5848  C   ASP A 727     162.138 184.040  80.743  1.00  0.25           C  
ATOM   5849  O   ASP A 727     161.223 183.896  81.554  1.00  0.25           O  
ATOM   5850  CB  ASP A 727     161.121 183.381  78.446  1.00  0.25           C  
ATOM   5851  CG  ASP A 727     161.380 184.583  77.550  1.00  0.25           C  
ATOM   5852  OD1 ASP A 727     162.455 185.220  77.688  1.00  0.25           O  
ATOM   5853  OD2 ASP A 727     160.535 184.802  76.646  1.00  0.25           O  
ATOM   5854  N   SER A 728     163.147 184.900  80.990  1.00  0.24           N  
ATOM   5855  CA  SER A 728     163.192 185.749  82.166  1.00  0.24           C  
ATOM   5856  C   SER A 728     162.561 187.098  81.886  1.00  0.24           C  
ATOM   5857  O   SER A 728     162.972 187.836  80.992  1.00  0.24           O  
ATOM   5858  CB  SER A 728     164.618 185.960  82.764  1.00  0.24           C  
ATOM   5859  OG  SER A 728     165.555 186.504  81.830  1.00  0.24           O  
ATOM   5860  N   ASP A 729     161.559 187.478  82.701  1.00  0.26           N  
ATOM   5861  CA  ASP A 729     160.848 188.726  82.566  1.00  0.26           C  
ATOM   5862  C   ASP A 729     161.058 189.504  83.858  1.00  0.26           C  
ATOM   5863  O   ASP A 729     160.463 189.227  84.900  1.00  0.26           O  
ATOM   5864  CB  ASP A 729     159.328 188.497  82.407  1.00  0.26           C  
ATOM   5865  CG  ASP A 729     158.966 187.776  81.121  1.00  0.26           C  
ATOM   5866  OD1 ASP A 729     159.057 188.417  80.047  1.00  0.26           O  
ATOM   5867  OD2 ASP A 729     158.497 186.614  81.231  1.00  0.26           O  
ATOM   5868  N   GLU A 730     161.941 190.511  83.830  1.00  0.23           N  
ATOM   5869  CA  GLU A 730     162.182 191.406  84.945  1.00  0.23           C  
ATOM   5870  C   GLU A 730     160.987 192.324  85.223  1.00  0.23           C  
ATOM   5871  O   GLU A 730     160.404 192.828  84.261  1.00  0.23           O  
ATOM   5872  CB  GLU A 730     163.415 192.250  84.593  1.00  0.23           C  
ATOM   5873  CG  GLU A 730     163.985 193.147  85.714  1.00  0.23           C  
ATOM   5874  CD  GLU A 730     164.780 192.399  86.777  1.00  0.23           C  
ATOM   5875  OE1 GLU A 730     165.078 193.059  87.802  1.00  0.23           O  
ATOM   5876  OE2 GLU A 730     165.119 191.214  86.560  1.00  0.23           O  
ATOM   5877  N   PRO A 731     160.574 192.623  86.460  1.00  0.23           N  
ATOM   5878  CA  PRO A 731     159.449 193.515  86.707  1.00  0.23           C  
ATOM   5879  C   PRO A 731     159.862 194.985  86.576  1.00  0.23           C  
ATOM   5880  O   PRO A 731     159.000 195.856  86.646  1.00  0.23           O  
ATOM   5881  CB  PRO A 731     159.028 193.131  88.135  1.00  0.23           C  
ATOM   5882  CG  PRO A 731     160.330 192.732  88.837  1.00  0.23           C  
ATOM   5883  CD  PRO A 731     161.193 192.154  87.709  1.00  0.23           C  
ATOM   5884  N   LEU A 732     161.169 195.285  86.421  1.00  0.33           N  
ATOM   5885  CA  LEU A 732     161.721 196.619  86.242  1.00  0.33           C  
ATOM   5886  C   LEU A 732     161.615 197.157  84.828  1.00  0.33           C  
ATOM   5887  O   LEU A 732     161.809 196.450  83.834  1.00  0.33           O  
ATOM   5888  CB  LEU A 732     163.243 196.669  86.522  1.00  0.33           C  
ATOM   5889  CG  LEU A 732     163.713 196.271  87.927  1.00  0.33           C  
ATOM   5890  CD1 LEU A 732     165.252 196.256  87.931  1.00  0.33           C  
ATOM   5891  CD2 LEU A 732     163.154 197.231  88.983  1.00  0.33           C  
ATOM   5892  N   GLU A 733     161.438 198.487  84.696  1.00  0.24           N  
ATOM   5893  CA  GLU A 733     161.224 199.129  83.433  1.00  0.24           C  
ATOM   5894  C   GLU A 733     162.462 199.162  82.536  1.00  0.24           C  
ATOM   5895  O   GLU A 733     162.401 199.300  81.310  1.00  0.24           O  
ATOM   5896  CB  GLU A 733     160.551 200.522  83.607  1.00  0.24           C  
ATOM   5897  CG  GLU A 733     161.431 201.650  84.200  1.00  0.24           C  
ATOM   5898  CD  GLU A 733     161.852 201.538  85.668  1.00  0.24           C  
ATOM   5899  OE1 GLU A 733     162.625 202.435  86.100  1.00  0.24           O  
ATOM   5900  OE2 GLU A 733     161.494 200.544  86.347  1.00  0.24           O  
ATOM   5901  N   ARG A 734     163.635 198.959  83.149  1.00  0.22           N  
ATOM   5902  CA  ARG A 734     164.942 198.955  82.526  1.00  0.22           C  
ATOM   5903  C   ARG A 734     165.241 197.718  81.695  1.00  0.22           C  
ATOM   5904  O   ARG A 734     166.073 197.739  80.794  1.00  0.22           O  
ATOM   5905  CB  ARG A 734     165.996 199.057  83.650  1.00  0.22           C  
ATOM   5906  CG  ARG A 734     165.808 200.351  84.461  1.00  0.22           C  
ATOM   5907  CD  ARG A 734     166.776 200.486  85.626  1.00  0.22           C  
ATOM   5908  NE  ARG A 734     166.478 201.790  86.283  1.00  0.22           N  
ATOM   5909  CZ  ARG A 734     167.149 202.227  87.353  1.00  0.22           C  
ATOM   5910  NH1 ARG A 734     166.848 203.403  87.891  1.00  0.22           N  
ATOM   5911  NH2 ARG A 734     168.119 201.492  87.895  1.00  0.22           N  
ATOM   5912  N   ARG A 735     164.577 196.594  82.019  1.00  0.24           N  
ATOM   5913  CA  ARG A 735     164.735 195.334  81.316  1.00  0.24           C  
ATOM   5914  C   ARG A 735     163.488 195.049  80.484  1.00  0.24           C  
ATOM   5915  O   ARG A 735     163.593 194.781  79.291  1.00  0.24           O  
ATOM   5916  CB  ARG A 735     164.953 194.179  82.320  1.00  0.24           C  
ATOM   5917  CG  ARG A 735     166.363 193.995  82.937  1.00  0.24           C  
ATOM   5918  CD  ARG A 735     166.820 195.113  83.876  1.00  0.24           C  
ATOM   5919  NE  ARG A 735     168.079 194.648  84.548  1.00  0.24           N  
ATOM   5920  CZ  ARG A 735     168.758 195.364  85.452  1.00  0.24           C  
ATOM   5921  NH1 ARG A 735     169.895 194.892  85.956  1.00  0.24           N  
ATOM   5922  NH2 ARG A 735     168.294 196.527  85.894  1.00  0.24           N  
ATOM   5923  N   LEU A 736     162.268 195.133  81.065  1.00  0.25           N  
ATOM   5924  CA  LEU A 736     161.060 194.828  80.310  1.00  0.25           C  
ATOM   5925  C   LEU A 736     159.924 195.795  80.605  1.00  0.25           C  
ATOM   5926  O   LEU A 736     158.975 195.517  81.329  1.00  0.25           O  
ATOM   5927  CB  LEU A 736     160.601 193.368  80.515  1.00  0.25           C  
ATOM   5928  CG  LEU A 736     159.440 192.920  79.599  1.00  0.25           C  
ATOM   5929  CD1 LEU A 736     159.810 192.924  78.109  1.00  0.25           C  
ATOM   5930  CD2 LEU A 736     158.961 191.530  80.010  1.00  0.25           C  
ATOM   5931  N   SER A 737     159.989 196.981  79.979  1.00  0.27           N  
ATOM   5932  CA  SER A 737     158.886 197.938  79.953  1.00  0.27           C  
ATOM   5933  C   SER A 737     159.126 198.922  78.826  1.00  0.27           C  
ATOM   5934  O   SER A 737     158.311 199.788  78.522  1.00  0.27           O  
ATOM   5935  CB  SER A 737     158.771 198.703  81.289  1.00  0.27           C  
ATOM   5936  OG  SER A 737     157.674 199.606  81.409  1.00  0.27           O  
ATOM   5937  N   LEU A 738     160.249 198.776  78.086  1.00  0.25           N  
ATOM   5938  CA  LEU A 738     160.518 199.571  76.910  1.00  0.25           C  
ATOM   5939  C   LEU A 738     159.769 198.993  75.724  1.00  0.25           C  
ATOM   5940  O   LEU A 738     160.306 198.255  74.899  1.00  0.25           O  
ATOM   5941  CB  LEU A 738     162.025 199.628  76.583  1.00  0.25           C  
ATOM   5942  CG  LEU A 738     162.933 200.251  77.663  1.00  0.25           C  
ATOM   5943  CD1 LEU A 738     164.391 200.120  77.199  1.00  0.25           C  
ATOM   5944  CD2 LEU A 738     162.591 201.717  77.975  1.00  0.25           C  
ATOM   5945  N   VAL A 739     158.480 199.319  75.641  1.00  0.27           N  
ATOM   5946  CA  VAL A 739     157.548 198.727  74.725  1.00  0.27           C  
ATOM   5947  C   VAL A 739     156.300 199.545  74.964  1.00  0.27           C  
ATOM   5948  O   VAL A 739     155.995 199.837  76.122  1.00  0.27           O  
ATOM   5949  CB  VAL A 739     157.337 197.217  74.945  1.00  0.27           C  
ATOM   5950  CG1 VAL A 739     156.773 196.845  76.333  1.00  0.27           C  
ATOM   5951  CG2 VAL A 739     156.464 196.639  73.820  1.00  0.27           C  
ATOM   5952  N   PRO A 740     155.559 200.024  73.968  1.00  0.22           N  
ATOM   5953  CA  PRO A 740     154.176 200.412  74.167  1.00  0.22           C  
ATOM   5954  C   PRO A 740     153.345 199.318  74.819  1.00  0.22           C  
ATOM   5955  O   PRO A 740     153.423 198.161  74.412  1.00  0.22           O  
ATOM   5956  CB  PRO A 740     153.648 200.801  72.777  1.00  0.22           C  
ATOM   5957  CG  PRO A 740     154.907 200.988  71.921  1.00  0.22           C  
ATOM   5958  CD  PRO A 740     155.917 200.032  72.554  1.00  0.22           C  
ATOM   5959  N   ASP A 741     152.554 199.648  75.837  1.00  0.27           N  
ATOM   5960  CA  ASP A 741     151.479 198.820  76.324  1.00  0.27           C  
ATOM   5961  C   ASP A 741     150.413 198.499  75.265  1.00  0.27           C  
ATOM   5962  O   ASP A 741     150.494 198.850  74.088  1.00  0.27           O  
ATOM   5963  CB  ASP A 741     150.850 199.577  77.503  1.00  0.27           C  
ATOM   5964  CG  ASP A 741     150.212 198.690  78.558  1.00  0.27           C  
ATOM   5965  OD1 ASP A 741     149.900 197.509  78.252  1.00  0.27           O  
ATOM   5966  OD2 ASP A 741     150.128 199.182  79.707  1.00  0.27           O  
ATOM   5967  N   SER A 742     149.311 197.877  75.673  1.00  0.23           N  
ATOM   5968  CA  SER A 742     148.075 197.987  74.924  1.00  0.23           C  
ATOM   5969  C   SER A 742     147.490 199.390  74.908  1.00  0.23           C  
ATOM   5970  O   SER A 742     146.646 199.687  75.693  1.00  0.23           O  
ATOM   5971  CB  SER A 742     147.002 197.013  75.452  1.00  0.23           C  
ATOM   5972  OG  SER A 742     147.400 195.658  75.286  1.00  0.23           O  
ATOM   5973  N   GLU A 743     147.906 200.274  73.967  1.00  0.22           N  
ATOM   5974  CA  GLU A 743     147.385 201.624  73.696  1.00  0.22           C  
ATOM   5975  C   GLU A 743     148.433 202.429  72.987  1.00  0.22           C  
ATOM   5976  O   GLU A 743     149.628 202.161  73.046  1.00  0.22           O  
ATOM   5977  CB  GLU A 743     146.811 202.458  74.871  1.00  0.22           C  
ATOM   5978  CG  GLU A 743     146.189 203.870  74.662  1.00  0.22           C  
ATOM   5979  CD  GLU A 743     145.798 204.498  76.002  1.00  0.22           C  
ATOM   5980  OE1 GLU A 743     144.926 203.888  76.651  1.00  0.22           O  
ATOM   5981  OE2 GLU A 743     146.376 205.549  76.381  1.00  0.22           O  
ATOM   5982  N   GLN A 744     147.993 203.479  72.275  1.00  0.22           N  
ATOM   5983  CA  GLN A 744     148.841 204.488  71.691  1.00  0.22           C  
ATOM   5984  C   GLN A 744     149.724 205.162  72.749  1.00  0.22           C  
ATOM   5985  O   GLN A 744     150.907 205.400  72.513  1.00  0.22           O  
ATOM   5986  CB  GLN A 744     147.900 205.491  70.993  1.00  0.22           C  
ATOM   5987  CG  GLN A 744     148.586 206.557  70.112  1.00  0.22           C  
ATOM   5988  CD  GLN A 744     149.226 207.660  70.955  1.00  0.22           C  
ATOM   5989  OE1 GLN A 744     148.630 208.138  71.925  1.00  0.22           O  
ATOM   5990  NE2 GLN A 744     150.465 208.056  70.585  1.00  0.22           N  
ATOM   5991  N   GLY A 745     149.173 205.415  73.967  1.00  0.26           N  
ATOM   5992  CA  GLY A 745     149.945 205.905  75.100  1.00  0.26           C  
ATOM   5993  C   GLY A 745     149.619 205.387  76.503  1.00  0.26           C  
ATOM   5994  O   GLY A 745     150.049 206.032  77.448  1.00  0.26           O  
ATOM   5995  N   GLU A 746     148.954 204.212  76.713  1.00  0.24           N  
ATOM   5996  CA  GLU A 746     148.622 203.606  78.038  1.00  0.24           C  
ATOM   5997  C   GLU A 746     149.913 203.201  78.740  1.00  0.24           C  
ATOM   5998  O   GLU A 746     150.020 203.159  79.961  1.00  0.24           O  
ATOM   5999  CB  GLU A 746     147.675 202.351  77.955  1.00  0.24           C  
ATOM   6000  CG  GLU A 746     147.088 201.674  79.212  1.00  0.24           C  
ATOM   6001  CD  GLU A 746     146.063 200.589  78.819  1.00  0.24           C  
ATOM   6002  OE1 GLU A 746     146.377 199.381  78.968  1.00  0.24           O  
ATOM   6003  OE2 GLU A 746     144.937 200.952  78.391  1.00  0.24           O  
ATOM   6004  N   ALA A 747     150.983 203.010  77.926  1.00  0.26           N  
ATOM   6005  CA  ALA A 747     152.346 202.655  78.291  1.00  0.26           C  
ATOM   6006  C   ALA A 747     152.998 203.609  79.273  1.00  0.26           C  
ATOM   6007  O   ALA A 747     153.733 203.217  80.177  1.00  0.26           O  
ATOM   6008  CB  ALA A 747     153.204 202.615  77.004  1.00  0.26           C  
ATOM   6009  N   ILE A 748     152.729 204.915  79.108  1.00  0.24           N  
ATOM   6010  CA  ILE A 748     153.271 205.966  79.942  1.00  0.24           C  
ATOM   6011  C   ILE A 748     152.277 206.353  81.023  1.00  0.24           C  
ATOM   6012  O   ILE A 748     152.498 207.370  81.674  1.00  0.24           O  
ATOM   6013  CB  ILE A 748     153.652 207.195  79.119  1.00  0.24           C  
ATOM   6014  CG1 ILE A 748     152.439 207.816  78.396  1.00  0.24           C  
ATOM   6015  CG2 ILE A 748     154.753 206.794  78.112  1.00  0.24           C  
ATOM   6016  CD1 ILE A 748     152.704 209.235  77.892  1.00  0.24           C  
ATOM   6017  N   LEU A 749     151.195 205.530  81.185  1.00  0.28           N  
ATOM   6018  CA  LEU A 749     150.032 205.616  82.079  1.00  0.28           C  
ATOM   6019  C   LEU A 749     148.779 205.918  81.252  1.00  0.28           C  
ATOM   6020  O   LEU A 749     148.971 206.393  80.136  1.00  0.28           O  
ATOM   6021  CB  LEU A 749     150.161 206.600  83.261  1.00  0.28           C  
ATOM   6022  CG  LEU A 749     150.874 206.052  84.512  1.00  0.28           C  
ATOM   6023  CD1 LEU A 749     152.250 205.410  84.267  1.00  0.28           C  
ATOM   6024  CD2 LEU A 749     150.986 207.224  85.490  1.00  0.28           C  
ATOM   6025  N   PRO A 750     147.507 205.678  81.676  1.00  0.37           N  
ATOM   6026  CA  PRO A 750     146.300 206.077  80.936  1.00  0.37           C  
ATOM   6027  C   PRO A 750     146.349 207.465  80.309  1.00  0.37           C  
ATOM   6028  O   PRO A 750     146.748 208.425  80.976  1.00  0.37           O  
ATOM   6029  CB  PRO A 750     145.147 205.977  81.961  1.00  0.37           C  
ATOM   6030  CG  PRO A 750     145.633 204.987  83.022  1.00  0.37           C  
ATOM   6031  CD  PRO A 750     147.153 205.180  83.012  1.00  0.37           C  
ATOM   6032  N   ARG A 751     145.948 207.610  79.037  1.00  0.23           N  
ATOM   6033  CA  ARG A 751     145.959 208.890  78.362  1.00  0.23           C  
ATOM   6034  C   ARG A 751     144.560 209.258  77.867  1.00  0.23           C  
ATOM   6035  O   ARG A 751     143.547 208.733  78.312  1.00  0.23           O  
ATOM   6036  CB  ARG A 751     147.022 208.873  77.229  1.00  0.23           C  
ATOM   6037  CG  ARG A 751     148.478 208.819  77.754  1.00  0.23           C  
ATOM   6038  CD  ARG A 751     148.966 210.043  78.534  1.00  0.23           C  
ATOM   6039  NE  ARG A 751     149.041 211.158  77.533  1.00  0.23           N  
ATOM   6040  CZ  ARG A 751     149.311 212.436  77.825  1.00  0.23           C  
ATOM   6041  NH1 ARG A 751     149.330 213.335  76.841  1.00  0.23           N  
ATOM   6042  NH2 ARG A 751     149.563 212.832  79.067  1.00  0.23           N  
ATOM   6043  N   ILE A 752     144.465 210.262  76.965  1.00  0.24           N  
ATOM   6044  CA  ILE A 752     143.255 210.604  76.218  1.00  0.24           C  
ATOM   6045  C   ILE A 752     142.834 209.482  75.284  1.00  0.24           C  
ATOM   6046  O   ILE A 752     141.655 209.189  75.096  1.00  0.24           O  
ATOM   6047  CB  ILE A 752     143.511 211.848  75.369  1.00  0.24           C  
ATOM   6048  CG1 ILE A 752     143.752 213.075  76.274  1.00  0.24           C  
ATOM   6049  CG2 ILE A 752     142.349 212.111  74.379  1.00  0.24           C  
ATOM   6050  CD1 ILE A 752     144.277 214.288  75.501  1.00  0.24           C  
ATOM   6051  N   SER A 753     143.831 208.853  74.631  1.00  0.26           N  
ATOM   6052  CA  SER A 753     143.640 207.713  73.765  1.00  0.26           C  
ATOM   6053  C   SER A 753     143.208 206.505  74.579  1.00  0.26           C  
ATOM   6054  O   SER A 753     143.261 206.512  75.802  1.00  0.26           O  
ATOM   6055  CB  SER A 753     144.894 207.445  72.877  1.00  0.26           C  
ATOM   6056  OG  SER A 753     146.104 207.323  73.635  1.00  0.26           O  
ATOM   6057  N   VAL A 754     142.688 205.459  73.923  1.00  0.26           N  
ATOM   6058  CA  VAL A 754     142.367 204.231  74.611  1.00  0.26           C  
ATOM   6059  C   VAL A 754     142.609 203.143  73.601  1.00  0.26           C  
ATOM   6060  O   VAL A 754     142.367 203.326  72.403  1.00  0.26           O  
ATOM   6061  CB  VAL A 754     140.964 204.212  75.220  1.00  0.26           C  
ATOM   6062  CG1 VAL A 754     139.850 204.348  74.161  1.00  0.26           C  
ATOM   6063  CG2 VAL A 754     140.801 202.978  76.130  1.00  0.26           C  
ATOM   6064  N   ILE A 755     143.165 201.997  74.025  1.00  0.31           N  
ATOM   6065  CA  ILE A 755     143.293 200.824  73.176  1.00  0.31           C  
ATOM   6066  C   ILE A 755     141.976 200.067  73.092  1.00  0.31           C  
ATOM   6067  O   ILE A 755     141.006 200.354  73.787  1.00  0.31           O  
ATOM   6068  CB  ILE A 755     144.384 199.889  73.667  1.00  0.31           C  
ATOM   6069  CG1 ILE A 755     144.966 198.857  72.661  1.00  0.31           C  
ATOM   6070  CG2 ILE A 755     143.977 199.211  74.978  1.00  0.31           C  
ATOM   6071  CD1 ILE A 755     145.652 199.425  71.421  1.00  0.31           C  
ATOM   6072  N   SER A 756     141.905 199.047  72.221  1.00  0.45           N  
ATOM   6073  CA  SER A 756     140.891 198.010  72.239  1.00  0.45           C  
ATOM   6074  C   SER A 756     141.398 196.834  73.068  1.00  0.45           C  
ATOM   6075  O   SER A 756     142.206 196.036  72.592  1.00  0.45           O  
ATOM   6076  CB  SER A 756     140.607 197.547  70.785  1.00  0.45           C  
ATOM   6077  OG  SER A 756     139.480 196.676  70.693  1.00  0.45           O  
ATOM   6078  N   THR A 757     140.976 196.740  74.350  1.00  0.47           N  
ATOM   6079  CA  THR A 757     141.311 195.665  75.285  1.00  0.47           C  
ATOM   6080  C   THR A 757     140.419 195.801  76.517  1.00  0.47           C  
ATOM   6081  O   THR A 757     139.524 196.644  76.530  1.00  0.47           O  
ATOM   6082  CB  THR A 757     142.784 195.535  75.650  1.00  0.47           C  
ATOM   6083  OG1 THR A 757     143.052 194.231  76.148  1.00  0.47           O  
ATOM   6084  CG2 THR A 757     143.257 196.524  76.716  1.00  0.47           C  
ATOM   6085  N   GLY A 758     140.575 194.958  77.570  1.00  0.37           N  
ATOM   6086  CA  GLY A 758     139.884 195.150  78.856  1.00  0.37           C  
ATOM   6087  C   GLY A 758     140.544 196.156  79.791  1.00  0.37           C  
ATOM   6088  O   GLY A 758     141.619 196.642  79.476  1.00  0.37           O  
ATOM   6089  N   PRO A 759     140.005 196.476  80.974  1.00  0.42           N  
ATOM   6090  CA  PRO A 759     140.506 197.614  81.752  1.00  0.42           C  
ATOM   6091  C   PRO A 759     141.764 197.289  82.545  1.00  0.42           C  
ATOM   6092  O   PRO A 759     142.819 197.844  82.275  1.00  0.42           O  
ATOM   6093  CB  PRO A 759     139.340 197.973  82.693  1.00  0.42           C  
ATOM   6094  CG  PRO A 759     138.471 196.711  82.771  1.00  0.42           C  
ATOM   6095  CD  PRO A 759     138.663 196.068  81.396  1.00  0.42           C  
ATOM   6096  N   THR A 760     141.710 196.372  83.529  1.00  0.42           N  
ATOM   6097  CA  THR A 760     142.882 195.948  84.296  1.00  0.42           C  
ATOM   6098  C   THR A 760     143.497 194.711  83.666  1.00  0.42           C  
ATOM   6099  O   THR A 760     144.457 194.132  84.161  1.00  0.42           O  
ATOM   6100  CB  THR A 760     142.506 195.564  85.716  1.00  0.42           C  
ATOM   6101  OG1 THR A 760     141.613 194.468  85.713  1.00  0.42           O  
ATOM   6102  CG2 THR A 760     141.755 196.700  86.426  1.00  0.42           C  
ATOM   6103  N   LEU A 761     142.861 194.267  82.566  1.00  0.40           N  
ATOM   6104  CA  LEU A 761     143.158 193.078  81.800  1.00  0.40           C  
ATOM   6105  C   LEU A 761     143.049 191.774  82.603  1.00  0.40           C  
ATOM   6106  O   LEU A 761     143.786 190.808  82.430  1.00  0.40           O  
ATOM   6107  CB  LEU A 761     144.480 193.273  81.027  1.00  0.40           C  
ATOM   6108  CG  LEU A 761     144.687 192.371  79.802  1.00  0.40           C  
ATOM   6109  CD1 LEU A 761     143.603 192.615  78.749  1.00  0.40           C  
ATOM   6110  CD2 LEU A 761     146.075 192.650  79.217  1.00  0.40           C  
ATOM   6111  N   GLN A 762     142.044 191.714  83.501  1.00  0.40           N  
ATOM   6112  CA  GLN A 762     141.815 190.606  84.414  1.00  0.40           C  
ATOM   6113  C   GLN A 762     140.329 190.294  84.445  1.00  0.40           C  
ATOM   6114  O   GLN A 762     139.767 189.841  85.436  1.00  0.40           O  
ATOM   6115  CB  GLN A 762     142.256 191.018  85.838  1.00  0.40           C  
ATOM   6116  CG  GLN A 762     143.777 191.228  86.023  1.00  0.40           C  
ATOM   6117  CD  GLN A 762     144.556 189.915  85.964  1.00  0.40           C  
ATOM   6118  OE1 GLN A 762     144.783 189.272  86.988  1.00  0.40           O  
ATOM   6119  NE2 GLN A 762     144.981 189.486  84.755  1.00  0.40           N  
ATOM   6120  N   ALA A 763     139.607 190.611  83.353  1.00  0.42           N  
ATOM   6121  CA  ALA A 763     138.165 190.423  83.254  1.00  0.42           C  
ATOM   6122  C   ALA A 763     137.805 188.982  82.928  1.00  0.42           C  
ATOM   6123  O   ALA A 763     136.655 188.559  82.984  1.00  0.42           O  
ATOM   6124  CB  ALA A 763     137.614 191.362  82.165  1.00  0.42           C  
ATOM   6125  N   ARG A 764     138.830 188.198  82.576  1.00  0.37           N  
ATOM   6126  CA  ARG A 764     138.725 186.801  82.261  1.00  0.37           C  
ATOM   6127  C   ARG A 764     139.235 185.969  83.408  1.00  0.37           C  
ATOM   6128  O   ARG A 764     139.996 186.431  84.253  1.00  0.37           O  
ATOM   6129  CB  ARG A 764     139.614 186.448  81.055  1.00  0.37           C  
ATOM   6130  CG  ARG A 764     139.193 187.169  79.770  1.00  0.37           C  
ATOM   6131  CD  ARG A 764     140.041 186.742  78.578  1.00  0.37           C  
ATOM   6132  NE  ARG A 764     139.523 187.503  77.404  1.00  0.37           N  
ATOM   6133  CZ  ARG A 764     140.036 187.400  76.173  1.00  0.37           C  
ATOM   6134  NH1 ARG A 764     139.504 188.108  75.180  1.00  0.37           N  
ATOM   6135  NH2 ARG A 764     141.068 186.601  75.918  1.00  0.37           N  
ATOM   6136  N   ARG A 765     138.863 184.681  83.418  1.00  0.38           N  
ATOM   6137  CA  ARG A 765     139.330 183.746  84.404  1.00  0.38           C  
ATOM   6138  C   ARG A 765     139.950 182.561  83.690  1.00  0.38           C  
ATOM   6139  O   ARG A 765     139.328 181.911  82.855  1.00  0.38           O  
ATOM   6140  CB  ARG A 765     138.158 183.351  85.340  1.00  0.38           C  
ATOM   6141  CG  ARG A 765     137.079 182.397  84.773  1.00  0.38           C  
ATOM   6142  CD  ARG A 765     137.239 180.882  85.025  1.00  0.38           C  
ATOM   6143  NE  ARG A 765     136.864 180.568  86.447  1.00  0.38           N  
ATOM   6144  CZ  ARG A 765     137.165 179.400  87.037  1.00  0.38           C  
ATOM   6145  NH1 ARG A 765     137.016 179.226  88.350  1.00  0.38           N  
ATOM   6146  NH2 ARG A 765     137.706 178.397  86.359  1.00  0.38           N  
ATOM   6147  N   ARG A 766     141.230 182.249  83.968  1.00  0.39           N  
ATOM   6148  CA  ARG A 766     141.835 181.053  83.403  1.00  0.39           C  
ATOM   6149  C   ARG A 766     141.450 179.830  84.228  1.00  0.39           C  
ATOM   6150  O   ARG A 766     140.792 178.919  83.742  1.00  0.39           O  
ATOM   6151  CB  ARG A 766     143.375 181.208  83.358  1.00  0.39           C  
ATOM   6152  CG  ARG A 766     144.115 180.061  82.638  1.00  0.39           C  
ATOM   6153  CD  ARG A 766     145.642 180.159  82.752  1.00  0.39           C  
ATOM   6154  NE  ARG A 766     146.034 181.372  81.975  1.00  0.39           N  
ATOM   6155  CZ  ARG A 766     147.205 182.009  82.096  1.00  0.39           C  
ATOM   6156  NH1 ARG A 766     147.424 183.082  81.336  1.00  0.39           N  
ATOM   6157  NH2 ARG A 766     148.148 181.615  82.947  1.00  0.39           N  
ATOM   6158  N   GLN A 767     141.798 179.827  85.532  1.00  0.46           N  
ATOM   6159  CA  GLN A 767     141.459 178.747  86.451  1.00  0.46           C  
ATOM   6160  C   GLN A 767     141.072 179.318  87.810  1.00  0.46           C  
ATOM   6161  O   GLN A 767     140.420 178.672  88.627  1.00  0.46           O  
ATOM   6162  CB  GLN A 767     142.647 177.784  86.688  1.00  0.46           C  
ATOM   6163  CG  GLN A 767     143.302 177.191  85.419  1.00  0.46           C  
ATOM   6164  CD  GLN A 767     142.337 176.401  84.526  1.00  0.46           C  
ATOM   6165  OE1 GLN A 767     141.267 175.929  84.908  1.00  0.46           O  
ATOM   6166  NE2 GLN A 767     142.756 176.254  83.245  1.00  0.46           N  
ATOM   6167  N   SER A 768     141.426 180.602  88.046  1.00  0.39           N  
ATOM   6168  CA  SER A 768     140.967 181.419  89.168  1.00  0.39           C  
ATOM   6169  C   SER A 768     139.488 181.680  88.943  1.00  0.39           C  
ATOM   6170  O   SER A 768     139.050 181.562  87.819  1.00  0.39           O  
ATOM   6171  CB  SER A 768     141.725 182.770  89.242  1.00  0.39           C  
ATOM   6172  OG  SER A 768     141.412 183.472  90.442  1.00  0.39           O  
ATOM   6173  N   VAL A 769     138.633 181.981  89.938  1.00  0.39           N  
ATOM   6174  CA  VAL A 769     137.195 182.236  89.692  1.00  0.39           C  
ATOM   6175  C   VAL A 769     136.993 183.675  89.284  1.00  0.39           C  
ATOM   6176  O   VAL A 769     137.813 184.531  89.587  1.00  0.39           O  
ATOM   6177  CB  VAL A 769     136.321 181.926  90.899  1.00  0.39           C  
ATOM   6178  CG1 VAL A 769     134.785 181.988  90.833  1.00  0.39           C  
ATOM   6179  CG2 VAL A 769     136.667 180.527  91.421  1.00  0.39           C  
ATOM   6180  N   LEU A 770     135.878 184.017  88.616  1.00  0.46           N  
ATOM   6181  CA  LEU A 770     135.493 185.406  88.509  1.00  0.46           C  
ATOM   6182  C   LEU A 770     135.171 186.017  89.870  1.00  0.46           C  
ATOM   6183  O   LEU A 770     135.602 187.099  90.174  1.00  0.46           O  
ATOM   6184  CB  LEU A 770     134.346 185.547  87.484  1.00  0.46           C  
ATOM   6185  CG  LEU A 770     134.736 185.186  86.027  1.00  0.46           C  
ATOM   6186  CD1 LEU A 770     133.503 185.094  85.117  1.00  0.46           C  
ATOM   6187  CD2 LEU A 770     135.772 186.134  85.400  1.00  0.46           C  
ATOM   6188  N   ASN A 771     134.480 185.346  90.795  1.00  0.46           N  
ATOM   6189  CA  ASN A 771     134.334 185.889  92.129  1.00  0.46           C  
ATOM   6190  C   ASN A 771     135.163 185.168  93.273  1.00  0.46           C  
ATOM   6191  O   ASN A 771     134.726 185.103  94.406  1.00  0.46           O  
ATOM   6192  CB  ASN A 771     132.825 185.999  92.379  1.00  0.46           C  
ATOM   6193  CG  ASN A 771     132.168 186.917  91.329  1.00  0.46           C  
ATOM   6194  OD1 ASN A 771     132.237 188.136  91.448  1.00  0.46           O  
ATOM   6195  ND2 ASN A 771     131.537 186.379  90.255  1.00  0.46           N  
ATOM   6196  N   LEU A 772     136.388 184.596  93.016  1.00  0.42           N  
ATOM   6197  CA  LEU A 772     137.271 183.950  94.030  1.00  0.42           C  
ATOM   6198  C   LEU A 772     138.345 184.841  94.626  1.00  0.42           C  
ATOM   6199  O   LEU A 772     139.299 185.120  93.906  1.00  0.42           O  
ATOM   6200  CB  LEU A 772     138.174 182.852  93.387  1.00  0.42           C  
ATOM   6201  CG  LEU A 772     139.258 182.113  94.172  1.00  0.42           C  
ATOM   6202  CD1 LEU A 772     138.615 181.141  95.165  1.00  0.42           C  
ATOM   6203  CD2 LEU A 772     140.125 181.342  93.165  1.00  0.42           C  
ATOM   6204  N   MET A 773     138.262 185.210  95.932  1.00  0.40           N  
ATOM   6205  CA  MET A 773     139.161 186.086  96.693  1.00  0.40           C  
ATOM   6206  C   MET A 773     138.237 187.192  97.141  1.00  0.40           C  
ATOM   6207  O   MET A 773     137.049 186.974  97.358  1.00  0.40           O  
ATOM   6208  CB  MET A 773     140.424 186.612  95.934  1.00  0.40           C  
ATOM   6209  CG  MET A 773     141.636 187.208  96.678  1.00  0.40           C  
ATOM   6210  SD  MET A 773     142.954 187.715  95.520  1.00  0.40           S  
ATOM   6211  CE  MET A 773     143.390 186.083  94.831  1.00  0.40           C  
ATOM   6212  N   THR A 774     138.758 188.405  97.293  1.00  0.35           N  
ATOM   6213  CA  THR A 774     138.036 189.611  97.611  1.00  0.35           C  
ATOM   6214  C   THR A 774     137.674 190.395  96.337  1.00  0.35           C  
ATOM   6215  O   THR A 774     136.622 191.024  96.255  1.00  0.35           O  
ATOM   6216  CB  THR A 774     138.970 190.450  98.468  1.00  0.35           C  
ATOM   6217  OG1 THR A 774     140.256 190.551  97.851  1.00  0.35           O  
ATOM   6218  CG2 THR A 774     139.209 189.734  99.814  1.00  0.35           C  
ATOM   6219  N   HIS A 775     138.559 190.327  95.306  1.00  0.38           N  
ATOM   6220  CA  HIS A 775     138.522 191.099  94.050  1.00  0.38           C  
ATOM   6221  C   HIS A 775     139.196 190.374  92.904  1.00  0.38           C  
ATOM   6222  O   HIS A 775     140.131 190.827  92.252  1.00  0.38           O  
ATOM   6223  CB  HIS A 775     139.218 192.473  94.079  1.00  0.38           C  
ATOM   6224  CG  HIS A 775     138.721 193.412  95.104  1.00  0.38           C  
ATOM   6225  ND1 HIS A 775     139.203 193.338  96.396  1.00  0.38           N  
ATOM   6226  CD2 HIS A 775     137.938 194.506  94.943  1.00  0.38           C  
ATOM   6227  CE1 HIS A 775     138.700 194.389  96.999  1.00  0.38           C  
ATOM   6228  NE2 HIS A 775     137.928 195.134  96.168  1.00  0.38           N  
ATOM   6229  N   SER A 776     138.666 189.197  92.659  1.00  0.40           N  
ATOM   6230  CA  SER A 776     138.839 188.268  91.567  1.00  0.40           C  
ATOM   6231  C   SER A 776     138.410 188.799  90.218  1.00  0.40           C  
ATOM   6232  O   SER A 776     139.176 188.796  89.265  1.00  0.40           O  
ATOM   6233  CB  SER A 776     137.937 187.139  92.032  1.00  0.40           C  
ATOM   6234  OG  SER A 776     136.704 187.703  92.447  1.00  0.40           O  
ATOM   6235  N   VAL A 777     137.187 189.384  90.131  1.00  0.44           N  
ATOM   6236  CA  VAL A 777     136.819 190.148  88.964  1.00  0.44           C  
ATOM   6237  C   VAL A 777     137.211 191.522  89.414  1.00  0.44           C  
ATOM   6238  O   VAL A 777     136.766 192.025  90.441  1.00  0.44           O  
ATOM   6239  CB  VAL A 777     135.357 190.266  88.464  1.00  0.44           C  
ATOM   6240  CG1 VAL A 777     135.400 190.670  86.979  1.00  0.44           C  
ATOM   6241  CG2 VAL A 777     134.488 189.012  88.502  1.00  0.44           C  
ATOM   6242  N   ASN A 778     138.066 192.173  88.631  1.00  0.44           N  
ATOM   6243  CA  ASN A 778     138.407 193.563  88.812  1.00  0.44           C  
ATOM   6244  C   ASN A 778     137.190 194.481  88.696  1.00  0.44           C  
ATOM   6245  O   ASN A 778     137.127 195.556  89.284  1.00  0.44           O  
ATOM   6246  CB  ASN A 778     139.473 193.936  87.769  1.00  0.44           C  
ATOM   6247  CG  ASN A 778     138.922 193.830  86.342  1.00  0.44           C  
ATOM   6248  OD1 ASN A 778     138.447 194.809  85.775  1.00  0.44           O  
ATOM   6249  ND2 ASN A 778     138.976 192.627  85.735  1.00  0.44           N  
ATOM   6250  N   GLN A 779     136.202 194.029  87.895  1.00  0.43           N  
ATOM   6251  CA  GLN A 779     134.936 194.672  87.664  1.00  0.43           C  
ATOM   6252  C   GLN A 779     134.214 194.955  88.957  1.00  0.43           C  
ATOM   6253  O   GLN A 779     133.820 194.044  89.688  1.00  0.43           O  
ATOM   6254  CB  GLN A 779     134.034 193.765  86.806  1.00  0.43           C  
ATOM   6255  CG  GLN A 779     132.680 194.383  86.391  1.00  0.43           C  
ATOM   6256  CD  GLN A 779     131.879 193.383  85.557  1.00  0.43           C  
ATOM   6257  OE1 GLN A 779     132.352 192.308  85.194  1.00  0.43           O  
ATOM   6258  NE2 GLN A 779     130.617 193.749  85.232  1.00  0.43           N  
ATOM   6259  N   GLY A 780     134.042 196.254  89.270  1.00  0.49           N  
ATOM   6260  CA  GLY A 780     133.364 196.676  90.478  1.00  0.49           C  
ATOM   6261  C   GLY A 780     131.954 196.165  90.589  1.00  0.49           C  
ATOM   6262  O   GLY A 780     131.304 195.815  89.607  1.00  0.49           O  
ATOM   6263  N   GLN A 781     131.451 196.133  91.823  1.00  0.33           N  
ATOM   6264  CA  GLN A 781     130.128 195.622  92.118  1.00  0.33           C  
ATOM   6265  C   GLN A 781     129.404 196.631  92.974  1.00  0.33           C  
ATOM   6266  O   GLN A 781     128.189 196.792  92.930  1.00  0.33           O  
ATOM   6267  CB  GLN A 781     130.230 194.325  92.953  1.00  0.33           C  
ATOM   6268  CG  GLN A 781     130.988 193.165  92.266  1.00  0.33           C  
ATOM   6269  CD  GLN A 781     130.266 192.676  91.009  1.00  0.33           C  
ATOM   6270  OE1 GLN A 781     129.065 192.401  91.023  1.00  0.33           O  
ATOM   6271  NE2 GLN A 781     131.016 192.531  89.894  1.00  0.33           N  
ATOM   6272  N   ASN A 782     130.174 197.391  93.763  1.00  0.36           N  
ATOM   6273  CA  ASN A 782     129.680 198.470  94.556  1.00  0.36           C  
ATOM   6274  C   ASN A 782     130.681 199.591  94.386  1.00  0.36           C  
ATOM   6275  O   ASN A 782     131.686 199.453  93.690  1.00  0.36           O  
ATOM   6276  CB  ASN A 782     129.420 198.068  96.037  1.00  0.36           C  
ATOM   6277  CG  ASN A 782     130.663 197.568  96.777  1.00  0.36           C  
ATOM   6278  OD1 ASN A 782     131.759 198.114  96.683  1.00  0.36           O  
ATOM   6279  ND2 ASN A 782     130.493 196.504  97.592  1.00  0.36           N  
ATOM   6280  N   ILE A 783     130.405 200.741  95.007  1.00  0.28           N  
ATOM   6281  CA  ILE A 783     131.322 201.857  95.016  1.00  0.28           C  
ATOM   6282  C   ILE A 783     132.205 201.753  96.243  1.00  0.28           C  
ATOM   6283  O   ILE A 783     131.707 201.815  97.365  1.00  0.28           O  
ATOM   6284  CB  ILE A 783     130.559 203.173  95.084  1.00  0.28           C  
ATOM   6285  CG1 ILE A 783     129.552 203.332  93.921  1.00  0.28           C  
ATOM   6286  CG2 ILE A 783     131.535 204.366  95.124  1.00  0.28           C  
ATOM   6287  CD1 ILE A 783     130.195 203.328  92.532  1.00  0.28           C  
ATOM   6288  N   HIS A 784     133.540 201.669  96.085  1.00  0.26           N  
ATOM   6289  CA  HIS A 784     134.450 201.510  97.213  1.00  0.26           C  
ATOM   6290  C   HIS A 784     134.605 202.754  98.089  1.00  0.26           C  
ATOM   6291  O   HIS A 784     135.210 202.709  99.150  1.00  0.26           O  
ATOM   6292  CB  HIS A 784     135.854 201.079  96.763  1.00  0.26           C  
ATOM   6293  CG  HIS A 784     136.586 202.173  96.062  1.00  0.26           C  
ATOM   6294  ND1 HIS A 784     136.224 202.533  94.780  1.00  0.26           N  
ATOM   6295  CD2 HIS A 784     137.572 202.980  96.523  1.00  0.26           C  
ATOM   6296  CE1 HIS A 784     137.012 203.540  94.475  1.00  0.26           C  
ATOM   6297  NE2 HIS A 784     137.848 203.856  95.496  1.00  0.26           N  
ATOM   6298  N   ARG A 785     134.100 203.902  97.597  1.00  0.25           N  
ATOM   6299  CA  ARG A 785     133.974 205.174  98.294  1.00  0.25           C  
ATOM   6300  C   ARG A 785     132.659 205.372  99.019  1.00  0.25           C  
ATOM   6301  O   ARG A 785     132.573 206.079 100.017  1.00  0.25           O  
ATOM   6302  CB  ARG A 785     133.924 206.312  97.263  1.00  0.25           C  
ATOM   6303  CG  ARG A 785     135.115 206.379  96.312  1.00  0.25           C  
ATOM   6304  CD  ARG A 785     134.864 207.439  95.250  1.00  0.25           C  
ATOM   6305  NE  ARG A 785     136.116 207.502  94.456  1.00  0.25           N  
ATOM   6306  CZ  ARG A 785     136.274 208.280  93.381  1.00  0.25           C  
ATOM   6307  NH1 ARG A 785     137.448 208.286  92.759  1.00  0.25           N  
ATOM   6308  NH2 ARG A 785     135.288 209.048  92.927  1.00  0.25           N  
ATOM   6309  N   LYS A 786     131.564 204.762  98.510  1.00  0.25           N  
ATOM   6310  CA  LYS A 786     130.382 204.572  99.316  1.00  0.25           C  
ATOM   6311  C   LYS A 786     130.754 203.586 100.418  1.00  0.25           C  
ATOM   6312  O   LYS A 786     130.319 203.761 101.536  1.00  0.25           O  
ATOM   6313  CB  LYS A 786     129.107 204.141  98.518  1.00  0.25           C  
ATOM   6314  CG  LYS A 786     128.541 205.160  97.489  1.00  0.25           C  
ATOM   6315  CD  LYS A 786     127.346 204.603  96.674  1.00  0.25           C  
ATOM   6316  CE  LYS A 786     126.870 205.558  95.566  1.00  0.25           C  
ATOM   6317  NZ  LYS A 786     125.843 204.924  94.700  1.00  0.25           N  
ATOM   6318  N   THR A 787     131.607 202.563 100.107  1.00  0.17           N  
ATOM   6319  CA  THR A 787     132.293 201.710 101.066  1.00  0.17           C  
ATOM   6320  C   THR A 787     133.523 202.270 101.742  1.00  0.17           C  
ATOM   6321  O   THR A 787     133.843 203.459 101.622  1.00  0.17           O  
ATOM   6322  CB  THR A 787     132.311 200.207 100.763  1.00  0.17           C  
ATOM   6323  OG1 THR A 787     133.295 199.842  99.825  1.00  0.17           O  
ATOM   6324  CG2 THR A 787     130.969 199.763 100.164  1.00  0.17           C  
ATOM   6325  N   THR A 788     134.096 201.483 102.672  1.00  0.47           N  
ATOM   6326  CA  THR A 788     135.187 201.823 103.574  1.00  0.47           C  
ATOM   6327  C   THR A 788     135.678 200.507 104.130  1.00  0.47           C  
ATOM   6328  O   THR A 788     135.138 199.447 103.802  1.00  0.47           O  
ATOM   6329  CB  THR A 788     134.940 202.831 104.717  1.00  0.47           C  
ATOM   6330  OG1 THR A 788     136.164 203.421 105.150  1.00  0.47           O  
ATOM   6331  CG2 THR A 788     134.299 202.230 105.976  1.00  0.47           C  
ATOM   6332  N   ALA A 789     136.703 200.524 104.990  1.00  0.48           N  
ATOM   6333  CA  ALA A 789     137.386 199.361 105.505  1.00  0.48           C  
ATOM   6334  C   ALA A 789     136.813 198.755 106.805  1.00  0.48           C  
ATOM   6335  O   ALA A 789     137.463 197.940 107.447  1.00  0.48           O  
ATOM   6336  CB  ALA A 789     138.840 199.822 105.734  1.00  0.48           C  
ATOM   6337  N   SER A 790     135.595 199.152 107.246  1.00  0.46           N  
ATOM   6338  CA  SER A 790     134.961 198.700 108.488  1.00  0.46           C  
ATOM   6339  C   SER A 790     133.543 199.298 108.501  1.00  0.46           C  
ATOM   6340  O   SER A 790     133.201 200.120 107.666  1.00  0.46           O  
ATOM   6341  CB  SER A 790     135.796 199.083 109.743  1.00  0.46           C  
ATOM   6342  OG  SER A 790     135.091 198.925 110.979  1.00  0.46           O  
ATOM   6343  N   THR A 791     132.675 198.918 109.464  1.00  0.48           N  
ATOM   6344  CA  THR A 791     131.329 199.483 109.644  1.00  0.48           C  
ATOM   6345  C   THR A 791     131.385 200.792 110.427  1.00  0.48           C  
ATOM   6346  O   THR A 791     131.435 200.811 111.651  1.00  0.48           O  
ATOM   6347  CB  THR A 791     130.356 198.561 110.395  1.00  0.48           C  
ATOM   6348  OG1 THR A 791     130.277 197.289 109.768  1.00  0.48           O  
ATOM   6349  CG2 THR A 791     128.925 199.135 110.401  1.00  0.48           C  
ATOM   6350  N   ARG A 792     131.359 201.941 109.724  1.00  0.42           N  
ATOM   6351  CA  ARG A 792     131.417 203.274 110.318  1.00  0.42           C  
ATOM   6352  C   ARG A 792     132.724 203.682 111.011  1.00  0.42           C  
ATOM   6353  O   ARG A 792     132.751 204.370 112.027  1.00  0.42           O  
ATOM   6354  CB  ARG A 792     130.143 203.696 111.100  1.00  0.42           C  
ATOM   6355  CG  ARG A 792     128.806 203.577 110.320  1.00  0.42           C  
ATOM   6356  CD  ARG A 792     127.628 204.290 111.017  1.00  0.42           C  
ATOM   6357  NE  ARG A 792     126.335 204.026 110.285  1.00  0.42           N  
ATOM   6358  CZ  ARG A 792     125.519 202.985 110.510  1.00  0.42           C  
ATOM   6359  NH1 ARG A 792     124.317 202.956 109.930  1.00  0.42           N  
ATOM   6360  NH2 ARG A 792     125.899 201.953 111.254  1.00  0.42           N  
ATOM   6361  N   LYS A 793     133.860 203.305 110.393  1.00  0.51           N  
ATOM   6362  CA  LYS A 793     135.222 203.640 110.788  1.00  0.51           C  
ATOM   6363  C   LYS A 793     135.694 205.020 110.345  1.00  0.51           C  
ATOM   6364  O   LYS A 793     136.694 205.556 110.830  1.00  0.51           O  
ATOM   6365  CB  LYS A 793     136.111 202.566 110.132  1.00  0.51           C  
ATOM   6366  CG  LYS A 793     137.638 202.751 110.171  1.00  0.51           C  
ATOM   6367  CD  LYS A 793     138.195 202.647 111.600  1.00  0.51           C  
ATOM   6368  CE  LYS A 793     139.715 202.776 111.710  1.00  0.51           C  
ATOM   6369  NZ  LYS A 793     140.123 204.106 111.215  1.00  0.51           N  
ATOM   6370  N   VAL A 794     134.979 205.618 109.386  1.00  0.55           N  
ATOM   6371  CA  VAL A 794     135.220 206.954 108.891  1.00  0.55           C  
ATOM   6372  C   VAL A 794     133.908 207.675 109.141  1.00  0.55           C  
ATOM   6373  O   VAL A 794     132.875 207.023 109.265  1.00  0.55           O  
ATOM   6374  CB  VAL A 794     135.653 206.994 107.417  1.00  0.55           C  
ATOM   6375  CG1 VAL A 794     136.800 205.991 107.168  1.00  0.55           C  
ATOM   6376  CG2 VAL A 794     134.505 206.707 106.437  1.00  0.55           C  
ATOM   6377  N   SER A 795     133.893 209.017 109.256  1.00  0.51           N  
ATOM   6378  CA  SER A 795     132.694 209.818 109.498  1.00  0.51           C  
ATOM   6379  C   SER A 795     131.455 209.453 108.679  1.00  0.51           C  
ATOM   6380  O   SER A 795     130.456 208.952 109.190  1.00  0.51           O  
ATOM   6381  CB  SER A 795     133.037 211.281 109.143  1.00  0.51           C  
ATOM   6382  OG  SER A 795     134.158 211.714 109.911  1.00  0.51           O  
ATOM   6383  N   LEU A 796     131.528 209.643 107.347  1.00  0.46           N  
ATOM   6384  CA  LEU A 796     130.516 209.207 106.409  1.00  0.46           C  
ATOM   6385  C   LEU A 796     131.005 207.939 105.757  1.00  0.46           C  
ATOM   6386  O   LEU A 796     131.617 207.926 104.695  1.00  0.46           O  
ATOM   6387  CB  LEU A 796     130.231 210.245 105.310  1.00  0.46           C  
ATOM   6388  CG  LEU A 796     129.696 211.593 105.813  1.00  0.46           C  
ATOM   6389  CD1 LEU A 796     129.617 212.552 104.619  1.00  0.46           C  
ATOM   6390  CD2 LEU A 796     128.338 211.454 106.515  1.00  0.46           C  
ATOM   6391  N   ALA A 797     130.774 206.829 106.442  1.00  0.57           N  
ATOM   6392  CA  ALA A 797     131.176 205.516 106.006  1.00  0.57           C  
ATOM   6393  C   ALA A 797     130.043 204.752 105.340  1.00  0.57           C  
ATOM   6394  O   ALA A 797     128.890 205.172 105.497  1.00  0.57           O  
ATOM   6395  CB  ALA A 797     131.607 204.813 107.280  1.00  0.57           C  
ATOM   6396  N   PRO A 798     130.258 203.634 104.609  1.00  0.50           N  
ATOM   6397  CA  PRO A 798     129.196 202.761 104.139  1.00  0.50           C  
ATOM   6398  C   PRO A 798     128.331 202.334 105.265  1.00  0.50           C  
ATOM   6399  O   PRO A 798     128.737 201.679 106.233  1.00  0.50           O  
ATOM   6400  CB  PRO A 798     129.812 201.495 103.535  1.00  0.50           C  
ATOM   6401  CG  PRO A 798     131.149 201.526 104.275  1.00  0.50           C  
ATOM   6402  CD  PRO A 798     131.528 203.020 104.339  1.00  0.50           C  
ATOM   6403  N   GLN A 799     127.093 202.701 105.112  1.00  0.45           N  
ATOM   6404  CA  GLN A 799     126.056 202.305 105.972  1.00  0.45           C  
ATOM   6405  C   GLN A 799     124.805 202.510 105.162  1.00  0.45           C  
ATOM   6406  O   GLN A 799     123.689 202.550 105.673  1.00  0.45           O  
ATOM   6407  CB  GLN A 799     126.182 203.222 107.183  1.00  0.45           C  
ATOM   6408  CG  GLN A 799     126.050 204.739 106.910  1.00  0.45           C  
ATOM   6409  CD  GLN A 799     124.588 205.168 106.877  1.00  0.45           C  
ATOM   6410  OE1 GLN A 799     123.876 204.930 107.857  1.00  0.45           O  
ATOM   6411  NE2 GLN A 799     124.153 205.773 105.747  1.00  0.45           N  
ATOM   6412  N   ALA A 800     125.042 202.688 103.834  1.00  0.51           N  
ATOM   6413  CA  ALA A 800     124.104 202.865 102.761  1.00  0.51           C  
ATOM   6414  C   ALA A 800     122.898 202.000 102.963  1.00  0.51           C  
ATOM   6415  O   ALA A 800     122.989 200.775 103.069  1.00  0.51           O  
ATOM   6416  CB  ALA A 800     124.739 202.554 101.383  1.00  0.51           C  
ATOM   6417  N   ASN A 801     121.713 202.599 102.996  1.00  0.41           N  
ATOM   6418  CA  ASN A 801     120.496 201.837 103.010  1.00  0.41           C  
ATOM   6419  C   ASN A 801     120.220 201.375 101.589  1.00  0.41           C  
ATOM   6420  O   ASN A 801     119.227 201.769 100.980  1.00  0.41           O  
ATOM   6421  CB  ASN A 801     119.386 202.647 103.714  1.00  0.41           C  
ATOM   6422  CG  ASN A 801     119.019 203.902 102.936  1.00  0.41           C  
ATOM   6423  OD1 ASN A 801     119.864 204.602 102.372  1.00  0.41           O  
ATOM   6424  ND2 ASN A 801     117.710 204.219 102.915  1.00  0.41           N  
ATOM   6425  N   LEU A 802     121.154 200.585 101.018  1.00  0.39           N  
ATOM   6426  CA  LEU A 802     121.096 199.975  99.718  1.00  0.39           C  
ATOM   6427  C   LEU A 802     121.267 198.471  99.896  1.00  0.39           C  
ATOM   6428  O   LEU A 802     121.247 197.688  98.951  1.00  0.39           O  
ATOM   6429  CB  LEU A 802     122.145 200.509  98.713  1.00  0.39           C  
ATOM   6430  CG  LEU A 802     122.216 202.037  98.489  1.00  0.39           C  
ATOM   6431  CD1 LEU A 802     123.439 202.357  97.610  1.00  0.39           C  
ATOM   6432  CD2 LEU A 802     120.938 202.633  97.882  1.00  0.39           C  
ATOM   6433  N   THR A 803     121.388 198.028 101.162  1.00  0.41           N  
ATOM   6434  CA  THR A 803     121.395 196.630 101.556  1.00  0.41           C  
ATOM   6435  C   THR A 803     119.950 196.211 101.741  1.00  0.41           C  
ATOM   6436  O   THR A 803     119.229 196.859 102.496  1.00  0.41           O  
ATOM   6437  CB  THR A 803     122.142 196.418 102.875  1.00  0.41           C  
ATOM   6438  OG1 THR A 803     123.503 196.811 102.744  1.00  0.41           O  
ATOM   6439  CG2 THR A 803     122.144 194.953 103.332  1.00  0.41           C  
ATOM   6440  N   GLU A 804     119.494 195.147 101.035  1.00  0.36           N  
ATOM   6441  CA  GLU A 804     118.137 194.615 101.130  1.00  0.36           C  
ATOM   6442  C   GLU A 804     117.038 195.538 100.552  1.00  0.36           C  
ATOM   6443  O   GLU A 804     115.975 195.738 101.132  1.00  0.36           O  
ATOM   6444  CB  GLU A 804     117.809 194.110 102.564  1.00  0.36           C  
ATOM   6445  CG  GLU A 804     118.642 192.890 103.057  1.00  0.36           C  
ATOM   6446  CD  GLU A 804     118.232 192.473 104.458  1.00  0.36           C  
ATOM   6447  OE1 GLU A 804     117.575 193.288 105.152  1.00  0.36           O  
ATOM   6448  OE2 GLU A 804     118.551 191.343 104.907  1.00  0.36           O  
ATOM   6449  N   LEU A 805     117.235 196.118  99.344  1.00  0.36           N  
ATOM   6450  CA  LEU A 805     116.315 197.126  98.793  1.00  0.36           C  
ATOM   6451  C   LEU A 805     115.292 196.557  97.845  1.00  0.36           C  
ATOM   6452  O   LEU A 805     114.444 197.238  97.270  1.00  0.36           O  
ATOM   6453  CB  LEU A 805     117.110 198.254  98.116  1.00  0.36           C  
ATOM   6454  CG  LEU A 805     117.218 199.475  99.039  1.00  0.36           C  
ATOM   6455  CD1 LEU A 805     117.783 199.081 100.420  1.00  0.36           C  
ATOM   6456  CD2 LEU A 805     117.970 200.577  98.284  1.00  0.36           C  
ATOM   6457  N   ASP A 806     115.339 195.249  97.717  1.00  0.35           N  
ATOM   6458  CA  ASP A 806     114.559 194.464  96.827  1.00  0.35           C  
ATOM   6459  C   ASP A 806     114.328 193.131  97.537  1.00  0.35           C  
ATOM   6460  O   ASP A 806     113.703 192.203  97.025  1.00  0.35           O  
ATOM   6461  CB  ASP A 806     115.387 194.372  95.518  1.00  0.35           C  
ATOM   6462  CG  ASP A 806     116.838 193.906  95.698  1.00  0.35           C  
ATOM   6463  OD1 ASP A 806     117.474 193.668  94.644  1.00  0.35           O  
ATOM   6464  OD2 ASP A 806     117.345 193.806  96.851  1.00  0.35           O  
ATOM   6465  N   ILE A 807     114.789 193.047  98.806  1.00  0.33           N  
ATOM   6466  CA  ILE A 807     114.745 191.857  99.624  1.00  0.33           C  
ATOM   6467  C   ILE A 807     114.187 192.254 100.979  1.00  0.33           C  
ATOM   6468  O   ILE A 807     114.886 192.731 101.859  1.00  0.33           O  
ATOM   6469  CB  ILE A 807     116.135 191.227  99.778  1.00  0.33           C  
ATOM   6470  CG1 ILE A 807     116.661 190.725  98.411  1.00  0.33           C  
ATOM   6471  CG2 ILE A 807     116.128 190.077 100.809  1.00  0.33           C  
ATOM   6472  CD1 ILE A 807     118.123 190.263  98.426  1.00  0.33           C  
ATOM   6473  N   TYR A 808     112.887 192.024 101.231  1.00  0.27           N  
ATOM   6474  CA  TYR A 808     112.296 192.309 102.537  1.00  0.27           C  
ATOM   6475  C   TYR A 808     112.200 191.024 103.353  1.00  0.27           C  
ATOM   6476  O   TYR A 808     111.544 190.953 104.388  1.00  0.27           O  
ATOM   6477  CB  TYR A 808     110.899 192.965 102.409  1.00  0.27           C  
ATOM   6478  CG  TYR A 808     111.030 194.303 101.734  1.00  0.27           C  
ATOM   6479  CD1 TYR A 808     111.486 195.420 102.456  1.00  0.27           C  
ATOM   6480  CD2 TYR A 808     110.708 194.457 100.376  1.00  0.27           C  
ATOM   6481  CE1 TYR A 808     111.585 196.675 101.838  1.00  0.27           C  
ATOM   6482  CE2 TYR A 808     110.817 195.710  99.753  1.00  0.27           C  
ATOM   6483  CZ  TYR A 808     111.240 196.822 100.491  1.00  0.27           C  
ATOM   6484  OH  TYR A 808     111.314 198.091  99.884  1.00  0.27           O  
ATOM   6485  N   SER A 809     112.869 189.957 102.878  1.00  0.34           N  
ATOM   6486  CA  SER A 809     112.840 188.632 103.473  1.00  0.34           C  
ATOM   6487  C   SER A 809     114.248 188.106 103.608  1.00  0.34           C  
ATOM   6488  O   SER A 809     114.927 187.880 102.612  1.00  0.34           O  
ATOM   6489  CB  SER A 809     112.077 187.619 102.587  1.00  0.34           C  
ATOM   6490  OG  SER A 809     111.888 186.376 103.265  1.00  0.34           O  
ATOM   6491  N   ARG A 810     114.719 187.881 104.847  1.00  0.32           N  
ATOM   6492  CA  ARG A 810     116.070 187.400 105.087  1.00  0.32           C  
ATOM   6493  C   ARG A 810     116.082 186.172 105.982  1.00  0.32           C  
ATOM   6494  O   ARG A 810     117.124 185.692 106.420  1.00  0.32           O  
ATOM   6495  CB  ARG A 810     116.914 188.525 105.726  1.00  0.32           C  
ATOM   6496  CG  ARG A 810     116.644 188.812 107.220  1.00  0.32           C  
ATOM   6497  CD  ARG A 810     117.540 189.917 107.789  1.00  0.32           C  
ATOM   6498  NE  ARG A 810     117.088 191.209 107.209  1.00  0.32           N  
ATOM   6499  CZ  ARG A 810     116.096 191.994 107.650  1.00  0.32           C  
ATOM   6500  NH1 ARG A 810     115.817 193.106 106.986  1.00  0.32           N  
ATOM   6501  NH2 ARG A 810     115.376 191.696 108.726  1.00  0.32           N  
ATOM   6502  N   ARG A 811     114.894 185.630 106.298  1.00  0.30           N  
ATOM   6503  CA  ARG A 811     114.745 184.530 107.231  1.00  0.30           C  
ATOM   6504  C   ARG A 811     114.001 183.412 106.541  1.00  0.30           C  
ATOM   6505  O   ARG A 811     112.812 183.199 106.759  1.00  0.30           O  
ATOM   6506  CB  ARG A 811     113.974 184.939 108.510  1.00  0.30           C  
ATOM   6507  CG  ARG A 811     114.707 185.971 109.390  1.00  0.30           C  
ATOM   6508  CD  ARG A 811     113.953 186.289 110.684  1.00  0.30           C  
ATOM   6509  NE  ARG A 811     114.766 187.301 111.436  1.00  0.30           N  
ATOM   6510  CZ  ARG A 811     114.343 187.910 112.553  1.00  0.30           C  
ATOM   6511  NH1 ARG A 811     115.140 188.779 113.172  1.00  0.30           N  
ATOM   6512  NH2 ARG A 811     113.142 187.666 113.067  1.00  0.30           N  
ATOM   6513  N   LEU A 812     114.703 182.671 105.677  1.00  0.15           N  
ATOM   6514  CA  LEU A 812     114.124 181.598 104.907  1.00  0.15           C  
ATOM   6515  C   LEU A 812     115.163 180.507 104.857  1.00  0.15           C  
ATOM   6516  O   LEU A 812     116.362 180.772 104.835  1.00  0.15           O  
ATOM   6517  CB  LEU A 812     113.800 182.009 103.449  1.00  0.15           C  
ATOM   6518  CG  LEU A 812     112.658 183.031 103.279  1.00  0.15           C  
ATOM   6519  CD1 LEU A 812     112.613 183.519 101.822  1.00  0.15           C  
ATOM   6520  CD2 LEU A 812     111.296 182.460 103.699  1.00  0.15           C  
ATOM   6521  N   SER A 813     114.722 179.243 104.869  1.00  0.22           N  
ATOM   6522  CA  SER A 813     115.607 178.102 104.770  1.00  0.22           C  
ATOM   6523  C   SER A 813     114.723 176.926 104.429  1.00  0.22           C  
ATOM   6524  O   SER A 813     113.565 176.883 104.841  1.00  0.22           O  
ATOM   6525  CB  SER A 813     116.362 177.835 106.098  1.00  0.22           C  
ATOM   6526  OG  SER A 813     117.271 176.739 105.994  1.00  0.22           O  
ATOM   6527  N   GLN A 814     115.225 175.944 103.664  1.00  0.21           N  
ATOM   6528  CA  GLN A 814     114.454 174.767 103.315  1.00  0.21           C  
ATOM   6529  C   GLN A 814     114.756 173.662 104.304  1.00  0.21           C  
ATOM   6530  O   GLN A 814     115.847 173.094 104.323  1.00  0.21           O  
ATOM   6531  CB  GLN A 814     114.783 174.279 101.886  1.00  0.21           C  
ATOM   6532  CG  GLN A 814     114.024 173.007 101.426  1.00  0.21           C  
ATOM   6533  CD  GLN A 814     112.519 173.252 101.307  1.00  0.21           C  
ATOM   6534  OE1 GLN A 814     112.070 174.109 100.548  1.00  0.21           O  
ATOM   6535  NE2 GLN A 814     111.705 172.484 102.068  1.00  0.21           N  
ATOM   6536  N   GLU A 815     113.788 173.325 105.172  1.00  0.25           N  
ATOM   6537  CA  GLU A 815     113.937 172.216 106.090  1.00  0.25           C  
ATOM   6538  C   GLU A 815     113.907 170.864 105.374  1.00  0.25           C  
ATOM   6539  O   GLU A 815     113.204 170.666 104.378  1.00  0.25           O  
ATOM   6540  CB  GLU A 815     112.912 172.323 107.234  1.00  0.25           C  
ATOM   6541  CG  GLU A 815     113.143 171.377 108.438  1.00  0.25           C  
ATOM   6542  CD  GLU A 815     112.127 171.615 109.558  1.00  0.25           C  
ATOM   6543  OE1 GLU A 815     112.241 170.910 110.592  1.00  0.25           O  
ATOM   6544  OE2 GLU A 815     111.246 172.498 109.394  1.00  0.25           O  
ATOM   6545  N   THR A 816     114.731 169.915 105.848  1.00  0.24           N  
ATOM   6546  CA  THR A 816     114.872 168.574 105.300  1.00  0.24           C  
ATOM   6547  C   THR A 816     115.272 167.681 106.457  1.00  0.24           C  
ATOM   6548  O   THR A 816     115.130 168.060 107.614  1.00  0.24           O  
ATOM   6549  CB  THR A 816     115.834 168.471 104.110  1.00  0.24           C  
ATOM   6550  OG1 THR A 816     115.801 167.187 103.485  1.00  0.24           O  
ATOM   6551  CG2 THR A 816     117.289 168.774 104.495  1.00  0.24           C  
ATOM   6552  N   GLY A 817     115.784 166.466 106.188  1.00  0.29           N  
ATOM   6553  CA  GLY A 817     116.119 165.486 107.215  1.00  0.29           C  
ATOM   6554  C   GLY A 817     115.013 164.491 107.410  1.00  0.29           C  
ATOM   6555  O   GLY A 817     114.828 163.927 108.480  1.00  0.29           O  
ATOM   6556  N   LEU A 818     114.238 164.252 106.340  1.00  0.25           N  
ATOM   6557  CA  LEU A 818     113.251 163.198 106.253  1.00  0.25           C  
ATOM   6558  C   LEU A 818     113.879 161.804 106.225  1.00  0.25           C  
ATOM   6559  O   LEU A 818     114.949 161.607 105.653  1.00  0.25           O  
ATOM   6560  CB  LEU A 818     112.412 163.366 104.967  1.00  0.25           C  
ATOM   6561  CG  LEU A 818     111.669 164.703 104.793  1.00  0.25           C  
ATOM   6562  CD1 LEU A 818     111.029 164.752 103.397  1.00  0.25           C  
ATOM   6563  CD2 LEU A 818     110.601 164.911 105.872  1.00  0.25           C  
ATOM   6564  N   GLU A 819     113.201 160.776 106.776  1.00  0.29           N  
ATOM   6565  CA  GLU A 819     113.681 159.397 106.806  1.00  0.29           C  
ATOM   6566  C   GLU A 819     113.538 158.664 105.461  1.00  0.29           C  
ATOM   6567  O   GLU A 819     113.127 157.512 105.373  1.00  0.29           O  
ATOM   6568  CB  GLU A 819     112.942 158.617 107.919  1.00  0.29           C  
ATOM   6569  CG  GLU A 819     113.145 159.210 109.339  1.00  0.29           C  
ATOM   6570  CD  GLU A 819     112.376 158.459 110.431  1.00  0.29           C  
ATOM   6571  OE1 GLU A 819     111.581 157.547 110.095  1.00  0.29           O  
ATOM   6572  OE2 GLU A 819     112.577 158.822 111.618  1.00  0.29           O  
ATOM   6573  N   ILE A 820     113.898 159.338 104.353  1.00  0.24           N  
ATOM   6574  CA  ILE A 820     113.766 158.860 102.985  1.00  0.24           C  
ATOM   6575  C   ILE A 820     115.082 159.075 102.267  1.00  0.24           C  
ATOM   6576  O   ILE A 820     115.141 159.332 101.065  1.00  0.24           O  
ATOM   6577  CB  ILE A 820     112.630 159.527 102.210  1.00  0.24           C  
ATOM   6578  CG1 ILE A 820     112.671 161.068 102.296  1.00  0.24           C  
ATOM   6579  CG2 ILE A 820     111.298 158.962 102.738  1.00  0.24           C  
ATOM   6580  CD1 ILE A 820     111.746 161.779 101.303  1.00  0.24           C  
ATOM   6581  N   SER A 821     116.199 158.991 103.009  1.00  0.30           N  
ATOM   6582  CA  SER A 821     117.539 159.132 102.467  1.00  0.30           C  
ATOM   6583  C   SER A 821     118.326 157.840 102.550  1.00  0.30           C  
ATOM   6584  O   SER A 821     119.350 157.705 101.893  1.00  0.30           O  
ATOM   6585  CB  SER A 821     118.310 160.238 103.223  1.00  0.30           C  
ATOM   6586  OG  SER A 821     118.255 160.041 104.637  1.00  0.30           O  
ATOM   6587  N   GLU A 822     117.811 156.856 103.309  1.00  0.28           N  
ATOM   6588  CA  GLU A 822     118.430 155.579 103.606  1.00  0.28           C  
ATOM   6589  C   GLU A 822     117.627 155.017 104.759  1.00  0.28           C  
ATOM   6590  O   GLU A 822     117.240 155.754 105.665  1.00  0.28           O  
ATOM   6591  CB  GLU A 822     119.928 155.616 104.034  1.00  0.28           C  
ATOM   6592  CG  GLU A 822     120.543 154.202 104.154  1.00  0.28           C  
ATOM   6593  CD  GLU A 822     122.057 154.142 104.373  1.00  0.28           C  
ATOM   6594  OE1 GLU A 822     122.463 153.457 105.351  1.00  0.28           O  
ATOM   6595  OE2 GLU A 822     122.823 154.718 103.568  1.00  0.28           O  
ATOM   6596  N   GLU A 823     117.317 153.711 104.764  1.00  0.22           N  
ATOM   6597  CA  GLU A 823     116.596 153.119 105.871  1.00  0.22           C  
ATOM   6598  C   GLU A 823     117.532 152.232 106.652  1.00  0.22           C  
ATOM   6599  O   GLU A 823     117.917 151.152 106.214  1.00  0.22           O  
ATOM   6600  CB  GLU A 823     115.408 152.273 105.396  1.00  0.22           C  
ATOM   6601  CG  GLU A 823     114.251 153.118 104.827  1.00  0.22           C  
ATOM   6602  CD  GLU A 823     113.086 152.222 104.429  1.00  0.22           C  
ATOM   6603  OE1 GLU A 823     112.614 151.459 105.314  1.00  0.22           O  
ATOM   6604  OE2 GLU A 823     112.671 152.284 103.244  1.00  0.22           O  
ATOM   6605  N   ILE A 824     117.961 152.666 107.846  1.00  0.20           N  
ATOM   6606  CA  ILE A 824     118.826 151.842 108.668  1.00  0.20           C  
ATOM   6607  C   ILE A 824     118.058 150.682 109.328  1.00  0.20           C  
ATOM   6608  O   ILE A 824     118.454 149.540 109.248  1.00  0.20           O  
ATOM   6609  CB  ILE A 824     119.582 152.728 109.660  1.00  0.20           C  
ATOM   6610  CG1 ILE A 824     120.588 153.647 108.916  1.00  0.20           C  
ATOM   6611  CG2 ILE A 824     120.333 151.859 110.679  1.00  0.20           C  
ATOM   6612  CD1 ILE A 824     121.240 154.709 109.813  1.00  0.20           C  
ATOM   6613  N   ASN A 825     116.902 150.990 109.988  1.00  0.23           N  
ATOM   6614  CA  ASN A 825     116.007 150.070 110.707  1.00  0.23           C  
ATOM   6615  C   ASN A 825     116.713 149.010 111.548  1.00  0.23           C  
ATOM   6616  O   ASN A 825     116.266 147.874 111.693  1.00  0.23           O  
ATOM   6617  CB  ASN A 825     114.964 149.418 109.769  1.00  0.23           C  
ATOM   6618  CG  ASN A 825     114.159 150.507 109.069  1.00  0.23           C  
ATOM   6619  OD1 ASN A 825     113.957 151.588 109.626  1.00  0.23           O  
ATOM   6620  ND2 ASN A 825     113.687 150.221 107.837  1.00  0.23           N  
ATOM   6621  N   GLU A 826     117.845 149.399 112.144  1.00  0.21           N  
ATOM   6622  CA  GLU A 826     118.774 148.505 112.777  1.00  0.21           C  
ATOM   6623  C   GLU A 826     118.732 148.872 114.226  1.00  0.21           C  
ATOM   6624  O   GLU A 826     118.769 150.051 114.583  1.00  0.21           O  
ATOM   6625  CB  GLU A 826     120.204 148.707 112.214  1.00  0.21           C  
ATOM   6626  CG  GLU A 826     121.332 147.921 112.923  1.00  0.21           C  
ATOM   6627  CD  GLU A 826     122.681 147.948 112.204  1.00  0.21           C  
ATOM   6628  OE1 GLU A 826     122.770 148.400 111.029  1.00  0.21           O  
ATOM   6629  OE2 GLU A 826     123.656 147.453 112.824  1.00  0.21           O  
ATOM   6630  N   GLU A 827     118.626 147.879 115.118  1.00  0.20           N  
ATOM   6631  CA  GLU A 827     118.633 148.104 116.543  1.00  0.20           C  
ATOM   6632  C   GLU A 827     120.060 148.363 117.055  1.00  0.20           C  
ATOM   6633  O   GLU A 827     120.570 147.673 117.934  1.00  0.20           O  
ATOM   6634  CB  GLU A 827     117.956 146.899 117.231  1.00  0.20           C  
ATOM   6635  CG  GLU A 827     116.466 146.716 116.824  1.00  0.20           C  
ATOM   6636  CD  GLU A 827     115.799 145.521 117.510  1.00  0.20           C  
ATOM   6637  OE1 GLU A 827     116.524 144.685 118.102  1.00  0.20           O  
ATOM   6638  OE2 GLU A 827     114.545 145.443 117.432  1.00  0.20           O  
ATOM   6639  N   ASP A 828     120.728 149.403 116.506  1.00  0.20           N  
ATOM   6640  CA  ASP A 828     122.061 149.833 116.878  1.00  0.20           C  
ATOM   6641  C   ASP A 828     121.889 151.084 117.718  1.00  0.20           C  
ATOM   6642  O   ASP A 828     121.307 152.092 117.309  1.00  0.20           O  
ATOM   6643  CB  ASP A 828     122.997 150.104 115.665  1.00  0.20           C  
ATOM   6644  CG  ASP A 828     124.434 150.438 116.071  1.00  0.20           C  
ATOM   6645  OD1 ASP A 828     124.761 150.355 117.287  1.00  0.20           O  
ATOM   6646  OD2 ASP A 828     125.233 150.812 115.176  1.00  0.20           O  
ATOM   6647  N   LEU A 829     122.362 150.994 118.961  1.00  0.17           N  
ATOM   6648  CA  LEU A 829     122.301 152.044 119.928  1.00  0.17           C  
ATOM   6649  C   LEU A 829     123.251 151.672 121.033  1.00  0.17           C  
ATOM   6650  O   LEU A 829     123.758 150.554 121.108  1.00  0.17           O  
ATOM   6651  CB  LEU A 829     120.869 152.313 120.454  1.00  0.17           C  
ATOM   6652  CG  LEU A 829     120.087 151.104 121.010  1.00  0.17           C  
ATOM   6653  CD1 LEU A 829     120.535 150.649 122.402  1.00  0.17           C  
ATOM   6654  CD2 LEU A 829     118.588 151.418 121.023  1.00  0.17           C  
ATOM   6655  N   LYS A 830     123.517 152.610 121.950  1.00  0.19           N  
ATOM   6656  CA  LYS A 830     124.314 152.334 123.124  1.00  0.19           C  
ATOM   6657  C   LYS A 830     123.685 153.065 124.286  1.00  0.19           C  
ATOM   6658  O   LYS A 830     124.253 153.997 124.851  1.00  0.19           O  
ATOM   6659  CB  LYS A 830     125.794 152.753 122.961  1.00  0.19           C  
ATOM   6660  CG  LYS A 830     126.523 151.992 121.843  1.00  0.19           C  
ATOM   6661  CD  LYS A 830     127.993 152.394 121.702  1.00  0.19           C  
ATOM   6662  CE  LYS A 830     128.677 151.625 120.574  1.00  0.19           C  
ATOM   6663  NZ  LYS A 830     130.078 152.077 120.467  1.00  0.19           N  
ATOM   6664  N   GLU A 831     122.447 152.681 124.647  1.00  0.19           N  
ATOM   6665  CA  GLU A 831     121.756 153.224 125.797  1.00  0.19           C  
ATOM   6666  C   GLU A 831     122.501 152.985 127.107  1.00  0.19           C  
ATOM   6667  O   GLU A 831     123.113 151.945 127.338  1.00  0.19           O  
ATOM   6668  CB  GLU A 831     120.326 152.656 125.929  1.00  0.19           C  
ATOM   6669  CG  GLU A 831     119.309 153.211 124.903  1.00  0.19           C  
ATOM   6670  CD  GLU A 831     117.955 152.509 125.017  1.00  0.19           C  
ATOM   6671  OE1 GLU A 831     117.755 151.771 126.014  1.00  0.19           O  
ATOM   6672  OE2 GLU A 831     117.110 152.737 124.116  1.00  0.19           O  
ATOM   6673  N   CYS A 832     122.432 153.970 128.026  1.00  0.18           N  
ATOM   6674  CA  CYS A 832     123.048 153.897 129.345  1.00  0.18           C  
ATOM   6675  C   CYS A 832     122.245 152.998 130.277  1.00  0.18           C  
ATOM   6676  O   CYS A 832     122.690 152.611 131.357  1.00  0.18           O  
ATOM   6677  CB  CYS A 832     123.191 155.299 129.985  1.00  0.18           C  
ATOM   6678  SG  CYS A 832     124.208 156.430 128.979  1.00  0.18           S  
ATOM   6679  N   PHE A 833     121.034 152.615 129.837  1.00  0.17           N  
ATOM   6680  CA  PHE A 833     120.244 151.522 130.360  1.00  0.17           C  
ATOM   6681  C   PHE A 833     120.833 150.183 129.917  1.00  0.17           C  
ATOM   6682  O   PHE A 833     120.221 149.407 129.187  1.00  0.17           O  
ATOM   6683  CB  PHE A 833     118.773 151.647 129.880  1.00  0.17           C  
ATOM   6684  CG  PHE A 833     118.168 152.971 130.291  1.00  0.17           C  
ATOM   6685  CD1 PHE A 833     117.607 153.141 131.569  1.00  0.17           C  
ATOM   6686  CD2 PHE A 833     118.126 154.050 129.389  1.00  0.17           C  
ATOM   6687  CE1 PHE A 833     117.024 154.362 131.941  1.00  0.17           C  
ATOM   6688  CE2 PHE A 833     117.561 155.278 129.762  1.00  0.17           C  
ATOM   6689  CZ  PHE A 833     117.010 155.433 131.039  1.00  0.17           C  
ATOM   6690  N   PHE A 834     122.073 149.886 130.361  1.00  0.19           N  
ATOM   6691  CA  PHE A 834     122.707 148.587 130.247  1.00  0.19           C  
ATOM   6692  C   PHE A 834     121.832 147.434 130.734  1.00  0.19           C  
ATOM   6693  O   PHE A 834     120.893 147.601 131.509  1.00  0.19           O  
ATOM   6694  CB  PHE A 834     124.043 148.532 131.028  1.00  0.19           C  
ATOM   6695  CG  PHE A 834     125.060 149.492 130.475  1.00  0.19           C  
ATOM   6696  CD1 PHE A 834     125.811 149.153 129.337  1.00  0.19           C  
ATOM   6697  CD2 PHE A 834     125.315 150.713 131.120  1.00  0.19           C  
ATOM   6698  CE1 PHE A 834     126.812 150.011 128.862  1.00  0.19           C  
ATOM   6699  CE2 PHE A 834     126.310 151.577 130.646  1.00  0.19           C  
ATOM   6700  CZ  PHE A 834     127.063 151.222 129.519  1.00  0.19           C  
ATOM   6701  N   ASP A 835     122.151 146.210 130.293  1.00  0.20           N  
ATOM   6702  CA  ASP A 835     121.474 145.027 130.764  1.00  0.20           C  
ATOM   6703  C   ASP A 835     122.178 144.529 132.033  1.00  0.20           C  
ATOM   6704  O   ASP A 835     123.202 143.842 132.004  1.00  0.20           O  
ATOM   6705  CB  ASP A 835     121.381 144.000 129.610  1.00  0.20           C  
ATOM   6706  CG  ASP A 835     120.360 142.909 129.893  1.00  0.20           C  
ATOM   6707  OD1 ASP A 835     119.721 142.949 130.975  1.00  0.20           O  
ATOM   6708  OD2 ASP A 835     120.197 142.043 128.996  1.00  0.20           O  
ATOM   6709  N   ASP A 836     121.636 144.959 133.187  1.00  0.27           N  
ATOM   6710  CA  ASP A 836     122.064 144.609 134.527  1.00  0.27           C  
ATOM   6711  C   ASP A 836     120.819 144.300 135.368  1.00  0.27           C  
ATOM   6712  O   ASP A 836     120.808 144.358 136.603  1.00  0.27           O  
ATOM   6713  CB  ASP A 836     123.015 145.678 135.155  1.00  0.27           C  
ATOM   6714  CG  ASP A 836     122.408 147.053 135.428  1.00  0.27           C  
ATOM   6715  OD1 ASP A 836     121.221 147.282 135.092  1.00  0.27           O  
ATOM   6716  OD2 ASP A 836     123.151 147.906 135.999  1.00  0.27           O  
ATOM   6717  N   MET A 837     119.711 143.918 134.685  1.00  0.20           N  
ATOM   6718  CA  MET A 837     118.476 143.499 135.321  1.00  0.20           C  
ATOM   6719  C   MET A 837     118.686 142.330 136.276  1.00  0.20           C  
ATOM   6720  O   MET A 837     119.528 141.479 136.021  1.00  0.20           O  
ATOM   6721  CB  MET A 837     117.376 143.091 134.306  1.00  0.20           C  
ATOM   6722  CG  MET A 837     116.871 144.201 133.360  1.00  0.20           C  
ATOM   6723  SD  MET A 837     115.582 143.626 132.203  1.00  0.20           S  
ATOM   6724  CE  MET A 837     114.256 143.246 133.388  1.00  0.20           C  
ATOM   6725  N   GLU A 838     117.929 142.359 137.408  1.00  0.22           N  
ATOM   6726  CA  GLU A 838     117.968 141.478 138.574  1.00  0.22           C  
ATOM   6727  C   GLU A 838     118.685 142.204 139.700  1.00  0.22           C  
ATOM   6728  O   GLU A 838     118.457 141.924 140.878  1.00  0.22           O  
ATOM   6729  CB  GLU A 838     118.506 140.039 138.322  1.00  0.22           C  
ATOM   6730  CG  GLU A 838     117.599 139.236 137.338  1.00  0.22           C  
ATOM   6731  CD  GLU A 838     118.113 137.858 136.906  1.00  0.22           C  
ATOM   6732  OE1 GLU A 838     119.256 137.476 137.257  1.00  0.22           O  
ATOM   6733  OE2 GLU A 838     117.319 137.167 136.211  1.00  0.22           O  
ATOM   6734  N   SER A 839     119.499 143.239 139.364  1.00  0.30           N  
ATOM   6735  CA  SER A 839     120.427 143.899 140.280  1.00  0.30           C  
ATOM   6736  C   SER A 839     121.486 142.923 140.788  1.00  0.30           C  
ATOM   6737  O   SER A 839     121.401 141.704 140.658  1.00  0.30           O  
ATOM   6738  CB  SER A 839     119.756 144.692 141.450  1.00  0.30           C  
ATOM   6739  OG  SER A 839     120.668 145.585 142.103  1.00  0.30           O  
ATOM   6740  N   ILE A 840     122.568 143.443 141.365  1.00  0.31           N  
ATOM   6741  CA  ILE A 840     123.605 142.638 141.979  1.00  0.31           C  
ATOM   6742  C   ILE A 840     123.373 142.702 143.488  1.00  0.31           C  
ATOM   6743  O   ILE A 840     122.654 143.613 143.905  1.00  0.31           O  
ATOM   6744  CB  ILE A 840     125.002 143.104 141.538  1.00  0.31           C  
ATOM   6745  CG1 ILE A 840     125.349 144.566 141.915  1.00  0.31           C  
ATOM   6746  CG2 ILE A 840     125.121 142.893 140.010  1.00  0.31           C  
ATOM   6747  CD1 ILE A 840     126.846 144.854 141.790  1.00  0.31           C  
ATOM   6748  N   PRO A 841     123.883 141.862 144.401  1.00  0.35           N  
ATOM   6749  CA  PRO A 841     123.718 142.071 145.842  1.00  0.35           C  
ATOM   6750  C   PRO A 841     124.615 143.190 146.348  1.00  0.35           C  
ATOM   6751  O   PRO A 841     125.267 143.023 147.380  1.00  0.35           O  
ATOM   6752  CB  PRO A 841     124.137 140.715 146.418  1.00  0.35           C  
ATOM   6753  CG  PRO A 841     125.280 140.281 145.510  1.00  0.35           C  
ATOM   6754  CD  PRO A 841     124.924 140.875 144.135  1.00  0.35           C  
ATOM   6755  N   ALA A 842     124.665 144.330 145.626  1.00  0.35           N  
ATOM   6756  CA  ALA A 842     125.302 145.579 145.976  1.00  0.35           C  
ATOM   6757  C   ALA A 842     126.796 145.525 145.769  1.00  0.35           C  
ATOM   6758  O   ALA A 842     127.406 146.309 145.061  1.00  0.35           O  
ATOM   6759  CB  ALA A 842     124.940 146.027 147.405  1.00  0.35           C  
ATOM   6760  N   VAL A 843     127.415 144.507 146.371  1.00  0.34           N  
ATOM   6761  CA  VAL A 843     128.778 144.132 146.141  1.00  0.34           C  
ATOM   6762  C   VAL A 843     129.001 143.745 144.657  1.00  0.34           C  
ATOM   6763  O   VAL A 843     128.528 142.702 144.191  1.00  0.34           O  
ATOM   6764  CB  VAL A 843     129.140 143.034 147.150  1.00  0.34           C  
ATOM   6765  CG1 VAL A 843     130.639 142.827 147.136  1.00  0.34           C  
ATOM   6766  CG2 VAL A 843     128.757 143.428 148.595  1.00  0.34           C  
ATOM   6767  N   THR A 844     129.758 144.542 143.843  1.00  0.54           N  
ATOM   6768  CA  THR A 844     130.164 144.230 142.470  1.00  0.54           C  
ATOM   6769  C   THR A 844     130.919 142.923 142.456  1.00  0.54           C  
ATOM   6770  O   THR A 844     130.854 142.132 141.528  1.00  0.54           O  
ATOM   6771  CB  THR A 844     131.094 145.254 141.844  1.00  0.54           C  
ATOM   6772  OG1 THR A 844     132.264 145.493 142.612  1.00  0.54           O  
ATOM   6773  CG2 THR A 844     130.466 146.575 141.438  1.00  0.54           C  
ATOM   6774  N   THR A 845     131.662 142.705 143.553  1.00  0.54           N  
ATOM   6775  CA  THR A 845     132.513 141.578 143.879  1.00  0.54           C  
ATOM   6776  C   THR A 845     131.676 140.452 144.484  1.00  0.54           C  
ATOM   6777  O   THR A 845     132.000 139.799 145.462  1.00  0.54           O  
ATOM   6778  CB  THR A 845     133.700 142.010 144.812  1.00  0.54           C  
ATOM   6779  OG1 THR A 845     133.210 142.636 146.015  1.00  0.54           O  
ATOM   6780  CG2 THR A 845     134.567 143.045 144.101  1.00  0.54           C  
ATOM   6781  N   TRP A 846     130.545 140.207 143.788  1.00  0.57           N  
ATOM   6782  CA  TRP A 846     129.597 139.134 143.985  1.00  0.57           C  
ATOM   6783  C   TRP A 846     130.072 137.904 143.231  1.00  0.57           C  
ATOM   6784  O   TRP A 846     130.838 137.068 143.719  1.00  0.57           O  
ATOM   6785  CB  TRP A 846     128.192 139.551 143.421  1.00  0.57           C  
ATOM   6786  CG  TRP A 846     127.083 138.489 143.400  1.00  0.57           C  
ATOM   6787  CD1 TRP A 846     126.764 137.589 144.378  1.00  0.57           C  
ATOM   6788  CD2 TRP A 846     126.160 138.237 142.309  1.00  0.57           C  
ATOM   6789  NE1 TRP A 846     125.616 136.904 144.045  1.00  0.57           N  
ATOM   6790  CE2 TRP A 846     125.254 137.262 142.763  1.00  0.57           C  
ATOM   6791  CE3 TRP A 846     126.063 138.770 141.014  1.00  0.57           C  
ATOM   6792  CZ2 TRP A 846     124.233 136.793 141.943  1.00  0.57           C  
ATOM   6793  CZ3 TRP A 846     125.058 138.258 140.172  1.00  0.57           C  
ATOM   6794  CH2 TRP A 846     124.152 137.295 140.633  1.00  0.57           C  
ATOM   6795  N   ASN A 847     129.631 137.774 141.967  1.00  0.59           N  
ATOM   6796  CA  ASN A 847     129.807 136.589 141.165  1.00  0.59           C  
ATOM   6797  C   ASN A 847     131.169 136.620 140.499  1.00  0.59           C  
ATOM   6798  O   ASN A 847     131.715 135.602 140.086  1.00  0.59           O  
ATOM   6799  CB  ASN A 847     128.656 136.529 140.132  1.00  0.59           C  
ATOM   6800  CG  ASN A 847     128.608 135.161 139.466  1.00  0.59           C  
ATOM   6801  OD1 ASN A 847     128.300 134.158 140.103  1.00  0.59           O  
ATOM   6802  ND2 ASN A 847     128.943 135.101 138.157  1.00  0.59           N  
ATOM   6803  N   THR A 848     131.790 137.815 140.453  1.00  0.74           N  
ATOM   6804  CA  THR A 848     133.170 138.008 140.028  1.00  0.74           C  
ATOM   6805  C   THR A 848     134.134 137.255 140.925  1.00  0.74           C  
ATOM   6806  O   THR A 848     135.091 136.656 140.449  1.00  0.74           O  
ATOM   6807  CB  THR A 848     133.570 139.482 139.937  1.00  0.74           C  
ATOM   6808  OG1 THR A 848     132.653 140.183 139.111  1.00  0.74           O  
ATOM   6809  CG2 THR A 848     134.949 139.654 139.289  1.00  0.74           C  
ATOM   6810  N   TYR A 849     133.899 137.221 142.257  1.00  0.73           N  
ATOM   6811  CA  TYR A 849     134.773 136.503 143.182  1.00  0.73           C  
ATOM   6812  C   TYR A 849     134.663 135.042 143.025  1.00  0.73           C  
ATOM   6813  O   TYR A 849     135.656 134.335 142.893  1.00  0.73           O  
ATOM   6814  CB  TYR A 849     134.467 136.814 144.670  1.00  0.73           C  
ATOM   6815  CG  TYR A 849     135.322 137.978 145.027  1.00  0.73           C  
ATOM   6816  CD1 TYR A 849     135.290 139.089 144.201  1.00  0.73           C  
ATOM   6817  CD2 TYR A 849     136.128 138.031 146.178  1.00  0.73           C  
ATOM   6818  CE1 TYR A 849     136.083 140.192 144.483  1.00  0.73           C  
ATOM   6819  CE2 TYR A 849     136.676 139.268 146.583  1.00  0.73           C  
ATOM   6820  CZ  TYR A 849     136.572 140.382 145.767  1.00  0.73           C  
ATOM   6821  OH  TYR A 849     136.847 141.669 146.299  1.00  0.73           O  
ATOM   6822  N   LEU A 850     133.418 134.570 142.972  1.00  0.72           N  
ATOM   6823  CA  LEU A 850     133.159 133.169 142.832  1.00  0.72           C  
ATOM   6824  C   LEU A 850     133.767 132.609 141.548  1.00  0.72           C  
ATOM   6825  O   LEU A 850     134.503 131.629 141.576  1.00  0.72           O  
ATOM   6826  CB  LEU A 850     131.634 132.969 142.876  1.00  0.72           C  
ATOM   6827  CG  LEU A 850     131.196 131.512 142.681  1.00  0.72           C  
ATOM   6828  CD1 LEU A 850     131.801 130.583 143.739  1.00  0.72           C  
ATOM   6829  CD2 LEU A 850     129.669 131.414 142.663  1.00  0.72           C  
ATOM   6830  N   ARG A 851     133.553 133.305 140.414  1.00  0.74           N  
ATOM   6831  CA  ARG A 851     134.114 132.959 139.117  1.00  0.74           C  
ATOM   6832  C   ARG A 851     135.639 133.045 139.038  1.00  0.74           C  
ATOM   6833  O   ARG A 851     136.290 132.216 138.408  1.00  0.74           O  
ATOM   6834  CB  ARG A 851     133.440 133.834 138.024  1.00  0.74           C  
ATOM   6835  CG  ARG A 851     133.613 133.349 136.562  1.00  0.74           C  
ATOM   6836  CD  ARG A 851     132.769 134.164 135.557  1.00  0.74           C  
ATOM   6837  NE  ARG A 851     133.019 133.694 134.151  1.00  0.74           N  
ATOM   6838  CZ  ARG A 851     132.523 134.289 133.053  1.00  0.74           C  
ATOM   6839  NH1 ARG A 851     131.694 135.325 133.098  1.00  0.74           N  
ATOM   6840  NH2 ARG A 851     132.872 133.841 131.853  1.00  0.74           N  
ATOM   6841  N   TYR A 852     136.261 134.056 139.684  1.00  0.80           N  
ATOM   6842  CA  TYR A 852     137.709 134.162 139.813  1.00  0.80           C  
ATOM   6843  C   TYR A 852     138.336 133.015 140.613  1.00  0.80           C  
ATOM   6844  O   TYR A 852     139.359 132.456 140.228  1.00  0.80           O  
ATOM   6845  CB  TYR A 852     138.052 135.531 140.466  1.00  0.80           C  
ATOM   6846  CG  TYR A 852     139.529 135.815 140.519  1.00  0.80           C  
ATOM   6847  CD1 TYR A 852     140.210 136.286 139.386  1.00  0.80           C  
ATOM   6848  CD2 TYR A 852     140.248 135.594 141.706  1.00  0.80           C  
ATOM   6849  CE1 TYR A 852     141.587 136.543 139.441  1.00  0.80           C  
ATOM   6850  CE2 TYR A 852     141.629 135.829 141.757  1.00  0.80           C  
ATOM   6851  CZ  TYR A 852     142.296 136.307 140.622  1.00  0.80           C  
ATOM   6852  OH  TYR A 852     143.684 136.536 140.646  1.00  0.80           O  
ATOM   6853  N   ILE A 853     137.728 132.628 141.752  1.00  0.80           N  
ATOM   6854  CA  ILE A 853     138.200 131.524 142.583  1.00  0.80           C  
ATOM   6855  C   ILE A 853     138.096 130.168 141.889  1.00  0.80           C  
ATOM   6856  O   ILE A 853     139.001 129.336 141.963  1.00  0.80           O  
ATOM   6857  CB  ILE A 853     137.494 131.502 143.945  1.00  0.80           C  
ATOM   6858  CG1 ILE A 853     137.796 132.802 144.730  1.00  0.80           C  
ATOM   6859  CG2 ILE A 853     137.928 130.275 144.781  1.00  0.80           C  
ATOM   6860  CD1 ILE A 853     136.929 132.989 145.980  1.00  0.80           C  
ATOM   6861  N   THR A 854     136.988 129.899 141.172  1.00  0.81           N  
ATOM   6862  CA  THR A 854     136.679 128.550 140.700  1.00  0.81           C  
ATOM   6863  C   THR A 854     137.213 128.242 139.320  1.00  0.81           C  
ATOM   6864  O   THR A 854     137.074 127.119 138.834  1.00  0.81           O  
ATOM   6865  CB  THR A 854     135.181 128.249 140.700  1.00  0.81           C  
ATOM   6866  OG1 THR A 854     134.454 129.190 139.920  1.00  0.81           O  
ATOM   6867  CG2 THR A 854     134.656 128.330 142.141  1.00  0.81           C  
ATOM   6868  N   VAL A 855     137.907 129.200 138.673  1.00  0.84           N  
ATOM   6869  CA  VAL A 855     138.485 129.018 137.346  1.00  0.84           C  
ATOM   6870  C   VAL A 855     139.676 128.061 137.340  1.00  0.84           C  
ATOM   6871  O   VAL A 855     139.995 127.425 136.335  1.00  0.84           O  
ATOM   6872  CB  VAL A 855     138.843 130.365 136.714  1.00  0.84           C  
ATOM   6873  CG1 VAL A 855     140.152 130.946 137.271  1.00  0.84           C  
ATOM   6874  CG2 VAL A 855     138.909 130.245 135.180  1.00  0.84           C  
ATOM   6875  N   HIS A 856     140.355 127.907 138.497  1.00  0.82           N  
ATOM   6876  CA  HIS A 856     141.463 126.986 138.649  1.00  0.82           C  
ATOM   6877  C   HIS A 856     141.325 126.183 139.933  1.00  0.82           C  
ATOM   6878  O   HIS A 856     141.339 126.716 141.038  1.00  0.82           O  
ATOM   6879  CB  HIS A 856     142.820 127.733 138.650  1.00  0.82           C  
ATOM   6880  CG  HIS A 856     144.025 126.842 138.523  1.00  0.82           C  
ATOM   6881  ND1 HIS A 856     145.266 127.261 138.975  1.00  0.82           N  
ATOM   6882  CD2 HIS A 856     144.132 125.617 137.945  1.00  0.82           C  
ATOM   6883  CE1 HIS A 856     146.094 126.284 138.670  1.00  0.82           C  
ATOM   6884  NE2 HIS A 856     145.461 125.264 138.044  1.00  0.82           N  
ATOM   6885  N   LYS A 857     141.228 124.840 139.829  1.00  0.75           N  
ATOM   6886  CA  LYS A 857     141.042 123.959 140.978  1.00  0.75           C  
ATOM   6887  C   LYS A 857     142.181 123.946 141.983  1.00  0.75           C  
ATOM   6888  O   LYS A 857     141.965 123.728 143.172  1.00  0.75           O  
ATOM   6889  CB  LYS A 857     140.741 122.507 140.540  1.00  0.75           C  
ATOM   6890  CG  LYS A 857     139.235 122.256 140.383  1.00  0.75           C  
ATOM   6891  CD  LYS A 857     138.939 120.790 140.037  1.00  0.75           C  
ATOM   6892  CE  LYS A 857     137.462 120.398 140.134  1.00  0.75           C  
ATOM   6893  NZ  LYS A 857     136.649 121.232 139.221  1.00  0.75           N  
ATOM   6894  N   SER A 858     143.424 124.206 141.535  1.00  0.80           N  
ATOM   6895  CA  SER A 858     144.588 124.275 142.414  1.00  0.80           C  
ATOM   6896  C   SER A 858     144.442 125.353 143.483  1.00  0.80           C  
ATOM   6897  O   SER A 858     144.810 125.167 144.641  1.00  0.80           O  
ATOM   6898  CB  SER A 858     145.890 124.504 141.604  1.00  0.80           C  
ATOM   6899  OG  SER A 858     147.057 124.339 142.408  1.00  0.80           O  
ATOM   6900  N   LEU A 859     143.827 126.505 143.127  1.00  0.81           N  
ATOM   6901  CA  LEU A 859     143.586 127.597 144.059  1.00  0.81           C  
ATOM   6902  C   LEU A 859     142.689 127.208 145.223  1.00  0.81           C  
ATOM   6903  O   LEU A 859     142.972 127.515 146.378  1.00  0.81           O  
ATOM   6904  CB  LEU A 859     142.992 128.830 143.330  1.00  0.81           C  
ATOM   6905  CG  LEU A 859     142.845 130.098 144.202  1.00  0.81           C  
ATOM   6906  CD1 LEU A 859     144.182 130.574 144.785  1.00  0.81           C  
ATOM   6907  CD2 LEU A 859     142.187 131.226 143.400  1.00  0.81           C  
ATOM   6908  N   ILE A 860     141.605 126.457 144.944  1.00  0.78           N  
ATOM   6909  CA  ILE A 860     140.671 125.961 145.945  1.00  0.78           C  
ATOM   6910  C   ILE A 860     141.356 125.060 146.968  1.00  0.78           C  
ATOM   6911  O   ILE A 860     141.199 125.227 148.177  1.00  0.78           O  
ATOM   6912  CB  ILE A 860     139.506 125.234 145.263  1.00  0.78           C  
ATOM   6913  CG1 ILE A 860     138.719 126.202 144.344  1.00  0.78           C  
ATOM   6914  CG2 ILE A 860     138.570 124.596 146.313  1.00  0.78           C  
ATOM   6915  CD1 ILE A 860     137.742 125.500 143.394  1.00  0.78           C  
ATOM   6916  N   PHE A 861     142.203 124.116 146.513  1.00  0.72           N  
ATOM   6917  CA  PHE A 861     142.970 123.241 147.386  1.00  0.72           C  
ATOM   6918  C   PHE A 861     143.973 123.975 148.279  1.00  0.72           C  
ATOM   6919  O   PHE A 861     144.087 123.685 149.470  1.00  0.72           O  
ATOM   6920  CB  PHE A 861     143.681 122.132 146.565  1.00  0.72           C  
ATOM   6921  CG  PHE A 861     142.722 121.277 145.764  1.00  0.72           C  
ATOM   6922  CD1 PHE A 861     141.432 120.946 146.226  1.00  0.72           C  
ATOM   6923  CD2 PHE A 861     143.144 120.756 144.528  1.00  0.72           C  
ATOM   6924  CE1 PHE A 861     140.578 120.146 145.457  1.00  0.72           C  
ATOM   6925  CE2 PHE A 861     142.297 119.945 143.761  1.00  0.72           C  
ATOM   6926  CZ  PHE A 861     141.011 119.645 144.224  1.00  0.72           C  
ATOM   6927  N   VAL A 862     144.689 124.989 147.747  1.00  0.81           N  
ATOM   6928  CA  VAL A 862     145.555 125.865 148.537  1.00  0.81           C  
ATOM   6929  C   VAL A 862     144.798 126.652 149.609  1.00  0.81           C  
ATOM   6930  O   VAL A 862     145.227 126.746 150.758  1.00  0.81           O  
ATOM   6931  CB  VAL A 862     146.358 126.807 147.641  1.00  0.81           C  
ATOM   6932  CG1 VAL A 862     147.188 127.809 148.465  1.00  0.81           C  
ATOM   6933  CG2 VAL A 862     147.314 125.970 146.773  1.00  0.81           C  
ATOM   6934  N   LEU A 863     143.613 127.206 149.287  1.00  0.80           N  
ATOM   6935  CA  LEU A 863     142.762 127.875 150.261  1.00  0.80           C  
ATOM   6936  C   LEU A 863     142.263 126.965 151.387  1.00  0.80           C  
ATOM   6937  O   LEU A 863     142.284 127.343 152.559  1.00  0.80           O  
ATOM   6938  CB  LEU A 863     141.563 128.560 149.566  1.00  0.80           C  
ATOM   6939  CG  LEU A 863     141.941 129.735 148.638  1.00  0.80           C  
ATOM   6940  CD1 LEU A 863     140.699 130.248 147.897  1.00  0.80           C  
ATOM   6941  CD2 LEU A 863     142.632 130.882 149.386  1.00  0.80           C  
ATOM   6942  N   ILE A 864     141.851 125.716 151.073  1.00  0.74           N  
ATOM   6943  CA  ILE A 864     141.512 124.703 152.075  1.00  0.74           C  
ATOM   6944  C   ILE A 864     142.702 124.356 152.968  1.00  0.74           C  
ATOM   6945  O   ILE A 864     142.583 124.306 154.192  1.00  0.74           O  
ATOM   6946  CB  ILE A 864     140.926 123.442 151.435  1.00  0.74           C  
ATOM   6947  CG1 ILE A 864     139.590 123.784 150.734  1.00  0.74           C  
ATOM   6948  CG2 ILE A 864     140.718 122.334 152.494  1.00  0.74           C  
ATOM   6949  CD1 ILE A 864     138.973 122.623 149.948  1.00  0.74           C  
ATOM   6950  N   TRP A 865     143.907 124.184 152.387  1.00  0.64           N  
ATOM   6951  CA  TRP A 865     145.145 123.988 153.135  1.00  0.64           C  
ATOM   6952  C   TRP A 865     145.431 125.129 154.114  1.00  0.64           C  
ATOM   6953  O   TRP A 865     145.736 124.911 155.288  1.00  0.64           O  
ATOM   6954  CB  TRP A 865     146.316 123.820 152.121  1.00  0.64           C  
ATOM   6955  CG  TRP A 865     147.737 123.972 152.643  1.00  0.64           C  
ATOM   6956  CD1 TRP A 865     148.582 125.039 152.502  1.00  0.64           C  
ATOM   6957  CD2 TRP A 865     148.440 122.996 153.428  1.00  0.64           C  
ATOM   6958  NE1 TRP A 865     149.778 124.792 153.142  1.00  0.64           N  
ATOM   6959  CE2 TRP A 865     149.700 123.550 153.736  1.00  0.64           C  
ATOM   6960  CE3 TRP A 865     148.079 121.724 153.867  1.00  0.64           C  
ATOM   6961  CZ2 TRP A 865     150.617 122.848 154.507  1.00  0.64           C  
ATOM   6962  CZ3 TRP A 865     149.013 121.010 154.631  1.00  0.64           C  
ATOM   6963  CH2 TRP A 865     150.261 121.566 154.953  1.00  0.64           C  
ATOM   6964  N   CYS A 866     145.277 126.392 153.672  1.00  0.81           N  
ATOM   6965  CA  CYS A 866     145.431 127.549 154.534  1.00  0.81           C  
ATOM   6966  C   CYS A 866     144.447 127.596 155.700  1.00  0.81           C  
ATOM   6967  O   CYS A 866     144.836 127.913 156.828  1.00  0.81           O  
ATOM   6968  CB  CYS A 866     145.340 128.878 153.741  1.00  0.81           C  
ATOM   6969  SG  CYS A 866     146.731 129.096 152.580  1.00  0.81           S  
ATOM   6970  N   LEU A 867     143.166 127.257 155.445  1.00  0.76           N  
ATOM   6971  CA  LEU A 867     142.110 127.156 156.442  1.00  0.76           C  
ATOM   6972  C   LEU A 867     142.346 126.095 157.514  1.00  0.76           C  
ATOM   6973  O   LEU A 867     142.207 126.367 158.705  1.00  0.76           O  
ATOM   6974  CB  LEU A 867     140.762 126.896 155.721  1.00  0.76           C  
ATOM   6975  CG  LEU A 867     139.504 126.868 156.620  1.00  0.76           C  
ATOM   6976  CD1 LEU A 867     138.335 127.611 155.959  1.00  0.76           C  
ATOM   6977  CD2 LEU A 867     139.068 125.440 156.973  1.00  0.76           C  
ATOM   6978  N   VAL A 868     142.754 124.864 157.135  1.00  0.74           N  
ATOM   6979  CA  VAL A 868     143.001 123.772 158.080  1.00  0.74           C  
ATOM   6980  C   VAL A 868     144.104 124.088 159.086  1.00  0.74           C  
ATOM   6981  O   VAL A 868     143.959 123.870 160.290  1.00  0.74           O  
ATOM   6982  CB  VAL A 868     143.304 122.466 157.343  1.00  0.74           C  
ATOM   6983  CG1 VAL A 868     143.726 121.338 158.304  1.00  0.74           C  
ATOM   6984  CG2 VAL A 868     142.042 122.021 156.583  1.00  0.74           C  
ATOM   6985  N   ILE A 869     145.229 124.671 158.623  1.00  0.77           N  
ATOM   6986  CA  ILE A 869     146.321 125.105 159.489  1.00  0.77           C  
ATOM   6987  C   ILE A 869     145.896 126.200 160.466  1.00  0.77           C  
ATOM   6988  O   ILE A 869     146.218 126.146 161.650  1.00  0.77           O  
ATOM   6989  CB  ILE A 869     147.535 125.526 158.665  1.00  0.77           C  
ATOM   6990  CG1 ILE A 869     148.042 124.372 157.762  1.00  0.77           C  
ATOM   6991  CG2 ILE A 869     148.669 126.056 159.567  1.00  0.77           C  
ATOM   6992  CD1 ILE A 869     148.474 123.102 158.504  1.00  0.77           C  
ATOM   6993  N   PHE A 870     145.086 127.178 160.008  1.00  0.77           N  
ATOM   6994  CA  PHE A 870     144.535 128.234 160.850  1.00  0.77           C  
ATOM   6995  C   PHE A 870     143.694 127.707 162.018  1.00  0.77           C  
ATOM   6996  O   PHE A 870     143.812 128.157 163.158  1.00  0.77           O  
ATOM   6997  CB  PHE A 870     143.722 129.201 159.943  1.00  0.77           C  
ATOM   6998  CG  PHE A 870     142.969 130.246 160.713  1.00  0.77           C  
ATOM   6999  CD1 PHE A 870     143.643 131.272 161.394  1.00  0.77           C  
ATOM   7000  CD2 PHE A 870     141.572 130.149 160.817  1.00  0.77           C  
ATOM   7001  CE1 PHE A 870     142.925 132.190 162.171  1.00  0.77           C  
ATOM   7002  CE2 PHE A 870     140.854 131.059 161.597  1.00  0.77           C  
ATOM   7003  CZ  PHE A 870     141.532 132.082 162.267  1.00  0.77           C  
ATOM   7004  N   LEU A 871     142.841 126.696 161.773  1.00  0.74           N  
ATOM   7005  CA  LEU A 871     142.064 126.047 162.816  1.00  0.74           C  
ATOM   7006  C   LEU A 871     142.922 125.379 163.889  1.00  0.74           C  
ATOM   7007  O   LEU A 871     142.639 125.477 165.083  1.00  0.74           O  
ATOM   7008  CB  LEU A 871     141.103 124.998 162.212  1.00  0.74           C  
ATOM   7009  CG  LEU A 871     140.021 125.573 161.276  1.00  0.74           C  
ATOM   7010  CD1 LEU A 871     139.226 124.431 160.631  1.00  0.74           C  
ATOM   7011  CD2 LEU A 871     139.075 126.543 161.996  1.00  0.74           C  
ATOM   7012  N   ALA A 872     144.025 124.715 163.490  1.00  0.75           N  
ATOM   7013  CA  ALA A 872     145.006 124.172 164.411  1.00  0.75           C  
ATOM   7014  C   ALA A 872     145.713 125.233 165.263  1.00  0.75           C  
ATOM   7015  O   ALA A 872     145.880 125.050 166.469  1.00  0.75           O  
ATOM   7016  CB  ALA A 872     146.024 123.317 163.635  1.00  0.75           C  
ATOM   7017  N   GLU A 873     146.094 126.391 164.669  1.00  0.73           N  
ATOM   7018  CA  GLU A 873     146.659 127.540 165.376  1.00  0.73           C  
ATOM   7019  C   GLU A 873     145.698 128.088 166.447  1.00  0.73           C  
ATOM   7020  O   GLU A 873     146.067 128.266 167.607  1.00  0.73           O  
ATOM   7021  CB  GLU A 873     147.058 128.682 164.372  1.00  0.73           C  
ATOM   7022  CG  GLU A 873     148.174 128.300 163.352  1.00  0.73           C  
ATOM   7023  CD  GLU A 873     148.392 129.175 162.110  1.00  0.73           C  
ATOM   7024  OE1 GLU A 873     147.455 129.659 161.417  1.00  0.73           O  
ATOM   7025  OE2 GLU A 873     149.585 129.267 161.722  1.00  0.73           O  
ATOM   7026  N   VAL A 874     144.403 128.284 166.109  1.00  0.77           N  
ATOM   7027  CA  VAL A 874     143.362 128.702 167.054  1.00  0.77           C  
ATOM   7028  C   VAL A 874     143.128 127.697 168.183  1.00  0.77           C  
ATOM   7029  O   VAL A 874     143.054 128.060 169.359  1.00  0.77           O  
ATOM   7030  CB  VAL A 874     142.047 129.005 166.328  1.00  0.77           C  
ATOM   7031  CG1 VAL A 874     140.905 129.349 167.304  1.00  0.77           C  
ATOM   7032  CG2 VAL A 874     142.262 130.197 165.378  1.00  0.77           C  
ATOM   7033  N   ALA A 875     143.048 126.390 167.862  1.00  0.74           N  
ATOM   7034  CA  ALA A 875     142.919 125.325 168.840  1.00  0.74           C  
ATOM   7035  C   ALA A 875     144.101 125.214 169.805  1.00  0.74           C  
ATOM   7036  O   ALA A 875     143.926 125.086 171.017  1.00  0.74           O  
ATOM   7037  CB  ALA A 875     142.714 123.991 168.099  1.00  0.74           C  
ATOM   7038  N   ALA A 876     145.344 125.315 169.291  1.00  0.73           N  
ATOM   7039  CA  ALA A 876     146.551 125.345 170.096  1.00  0.73           C  
ATOM   7040  C   ALA A 876     146.613 126.533 171.055  1.00  0.73           C  
ATOM   7041  O   ALA A 876     146.912 126.375 172.240  1.00  0.73           O  
ATOM   7042  CB  ALA A 876     147.776 125.356 169.166  1.00  0.73           C  
ATOM   7043  N   SER A 877     146.250 127.744 170.573  1.00  0.73           N  
ATOM   7044  CA  SER A 877     146.126 128.947 171.393  1.00  0.73           C  
ATOM   7045  C   SER A 877     145.124 128.802 172.521  1.00  0.73           C  
ATOM   7046  O   SER A 877     145.383 129.214 173.647  1.00  0.73           O  
ATOM   7047  CB  SER A 877     145.707 130.201 170.588  1.00  0.73           C  
ATOM   7048  OG  SER A 877     146.753 130.629 169.720  1.00  0.73           O  
ATOM   7049  N   LEU A 878     143.962 128.169 172.270  1.00  0.70           N  
ATOM   7050  CA  LEU A 878     142.980 127.873 173.306  1.00  0.70           C  
ATOM   7051  C   LEU A 878     143.511 127.000 174.434  1.00  0.70           C  
ATOM   7052  O   LEU A 878     143.333 127.312 175.610  1.00  0.70           O  
ATOM   7053  CB  LEU A 878     141.760 127.153 172.677  1.00  0.70           C  
ATOM   7054  CG  LEU A 878     140.446 127.941 172.744  1.00  0.70           C  
ATOM   7055  CD1 LEU A 878     140.557 129.253 171.970  1.00  0.70           C  
ATOM   7056  CD2 LEU A 878     139.307 127.076 172.190  1.00  0.70           C  
ATOM   7057  N   VAL A 879     144.211 125.896 174.095  1.00  0.65           N  
ATOM   7058  CA  VAL A 879     144.776 124.978 175.076  1.00  0.65           C  
ATOM   7059  C   VAL A 879     145.811 125.640 175.963  1.00  0.65           C  
ATOM   7060  O   VAL A 879     145.719 125.577 177.186  1.00  0.65           O  
ATOM   7061  CB  VAL A 879     145.402 123.762 174.394  1.00  0.65           C  
ATOM   7062  CG1 VAL A 879     146.172 122.866 175.387  1.00  0.65           C  
ATOM   7063  CG2 VAL A 879     144.287 122.940 173.729  1.00  0.65           C  
ATOM   7064  N   VAL A 880     146.797 126.349 175.375  1.00  0.68           N  
ATOM   7065  CA  VAL A 880     147.827 127.030 176.152  1.00  0.68           C  
ATOM   7066  C   VAL A 880     147.270 128.165 177.006  1.00  0.68           C  
ATOM   7067  O   VAL A 880     147.622 128.312 178.173  1.00  0.68           O  
ATOM   7068  CB  VAL A 880     149.024 127.452 175.298  1.00  0.68           C  
ATOM   7069  CG1 VAL A 880     148.660 128.538 174.275  1.00  0.68           C  
ATOM   7070  CG2 VAL A 880     150.194 127.901 176.192  1.00  0.68           C  
ATOM   7071  N   LEU A 881     146.337 128.974 176.468  1.00  0.68           N  
ATOM   7072  CA  LEU A 881     145.725 130.074 177.192  1.00  0.68           C  
ATOM   7073  C   LEU A 881     144.841 129.644 178.357  1.00  0.68           C  
ATOM   7074  O   LEU A 881     144.903 130.208 179.445  1.00  0.68           O  
ATOM   7075  CB  LEU A 881     144.926 130.951 176.207  1.00  0.68           C  
ATOM   7076  CG  LEU A 881     144.523 132.340 176.730  1.00  0.68           C  
ATOM   7077  CD1 LEU A 881     145.747 133.204 177.047  1.00  0.68           C  
ATOM   7078  CD2 LEU A 881     143.640 133.055 175.701  1.00  0.68           C  
ATOM   7079  N   TRP A 882     144.020 128.590 178.167  1.00  0.48           N  
ATOM   7080  CA  TRP A 882     143.262 127.949 179.233  1.00  0.48           C  
ATOM   7081  C   TRP A 882     144.158 127.318 180.301  1.00  0.48           C  
ATOM   7082  O   TRP A 882     143.853 127.348 181.491  1.00  0.48           O  
ATOM   7083  CB  TRP A 882     142.297 126.896 178.623  1.00  0.48           C  
ATOM   7084  CG  TRP A 882     141.506 126.063 179.619  1.00  0.48           C  
ATOM   7085  CD1 TRP A 882     140.382 126.369 180.335  1.00  0.48           C  
ATOM   7086  CD2 TRP A 882     141.931 124.763 180.063  1.00  0.48           C  
ATOM   7087  NE1 TRP A 882     140.065 125.334 181.193  1.00  0.48           N  
ATOM   7088  CE2 TRP A 882     141.013 124.344 181.044  1.00  0.48           C  
ATOM   7089  CE3 TRP A 882     143.023 123.974 179.704  1.00  0.48           C  
ATOM   7090  CZ2 TRP A 882     141.167 123.124 181.690  1.00  0.48           C  
ATOM   7091  CZ3 TRP A 882     143.181 122.745 180.360  1.00  0.48           C  
ATOM   7092  CH2 TRP A 882     142.267 122.325 181.337  1.00  0.48           C  
ATOM   7093  N   LEU A 883     145.306 126.739 179.889  1.00  0.52           N  
ATOM   7094  CA  LEU A 883     146.270 126.113 180.778  1.00  0.52           C  
ATOM   7095  C   LEU A 883     146.902 127.072 181.778  1.00  0.52           C  
ATOM   7096  O   LEU A 883     147.250 126.693 182.894  1.00  0.52           O  
ATOM   7097  CB  LEU A 883     147.378 125.399 179.971  1.00  0.52           C  
ATOM   7098  CG  LEU A 883     148.221 124.385 180.764  1.00  0.52           C  
ATOM   7099  CD1 LEU A 883     147.363 123.232 181.303  1.00  0.52           C  
ATOM   7100  CD2 LEU A 883     149.358 123.846 179.888  1.00  0.52           C  
ATOM   7101  N   LEU A 884     146.992 128.373 181.435  1.00  0.58           N  
ATOM   7102  CA  LEU A 884     147.385 129.435 182.348  1.00  0.58           C  
ATOM   7103  C   LEU A 884     146.254 129.820 183.301  1.00  0.58           C  
ATOM   7104  O   LEU A 884     146.054 130.993 183.612  1.00  0.58           O  
ATOM   7105  CB  LEU A 884     147.810 130.706 181.574  1.00  0.58           C  
ATOM   7106  CG  LEU A 884     148.949 130.529 180.552  1.00  0.58           C  
ATOM   7107  CD1 LEU A 884     149.117 131.842 179.774  1.00  0.58           C  
ATOM   7108  CD2 LEU A 884     150.269 130.097 181.208  1.00  0.58           C  
ATOM   7109  N   GLY A 885     145.478 128.819 183.780  1.00  0.47           N  
ATOM   7110  CA  GLY A 885     144.362 128.944 184.707  1.00  0.47           C  
ATOM   7111  C   GLY A 885     144.626 129.882 185.855  1.00  0.47           C  
ATOM   7112  O   GLY A 885     145.601 129.737 186.588  1.00  0.47           O  
ATOM   7113  N   ASN A 886     143.746 130.884 186.046  1.00  0.30           N  
ATOM   7114  CA  ASN A 886     143.935 131.887 187.076  1.00  0.30           C  
ATOM   7115  C   ASN A 886     143.867 131.288 188.470  1.00  0.30           C  
ATOM   7116  O   ASN A 886     142.845 130.730 188.869  1.00  0.30           O  
ATOM   7117  CB  ASN A 886     142.901 133.041 186.998  1.00  0.30           C  
ATOM   7118  CG  ASN A 886     143.069 133.799 185.690  1.00  0.30           C  
ATOM   7119  OD1 ASN A 886     144.173 134.180 185.312  1.00  0.30           O  
ATOM   7120  ND2 ASN A 886     141.948 134.075 184.984  1.00  0.30           N  
ATOM   7121  N   THR A 887     144.962 131.404 189.249  1.00  0.29           N  
ATOM   7122  CA  THR A 887     145.021 130.949 190.634  1.00  0.29           C  
ATOM   7123  C   THR A 887     143.918 131.584 191.465  1.00  0.29           C  
ATOM   7124  O   THR A 887     143.793 132.813 191.402  1.00  0.29           O  
ATOM   7125  CB  THR A 887     146.342 131.294 191.310  1.00  0.29           C  
ATOM   7126  OG1 THR A 887     147.428 130.757 190.571  1.00  0.29           O  
ATOM   7127  CG2 THR A 887     146.431 130.710 192.726  1.00  0.29           C  
ATOM   7128  N   PRO A 888     143.092 130.837 192.215  1.00  0.35           N  
ATOM   7129  CA  PRO A 888     142.000 131.389 192.995  1.00  0.35           C  
ATOM   7130  C   PRO A 888     142.315 132.616 193.841  1.00  0.35           C  
ATOM   7131  O   PRO A 888     143.408 132.789 194.388  1.00  0.35           O  
ATOM   7132  CB  PRO A 888     141.445 130.214 193.799  1.00  0.35           C  
ATOM   7133  CG  PRO A 888     141.798 128.962 192.994  1.00  0.35           C  
ATOM   7134  CD  PRO A 888     143.043 129.368 192.201  1.00  0.35           C  
ATOM   7135  N   LEU A 889     141.336 133.518 193.935  1.00  0.32           N  
ATOM   7136  CA  LEU A 889     141.443 134.764 194.642  1.00  0.32           C  
ATOM   7137  C   LEU A 889     141.086 134.488 196.081  1.00  0.32           C  
ATOM   7138  O   LEU A 889     140.141 133.750 196.336  1.00  0.32           O  
ATOM   7139  CB  LEU A 889     140.482 135.819 194.041  1.00  0.32           C  
ATOM   7140  CG  LEU A 889     140.938 136.353 192.666  1.00  0.32           C  
ATOM   7141  CD1 LEU A 889     140.945 135.365 191.489  1.00  0.32           C  
ATOM   7142  CD2 LEU A 889     140.224 137.646 192.254  1.00  0.32           C  
ATOM   7143  N   GLN A 890     141.865 135.040 197.046  1.00  0.29           N  
ATOM   7144  CA  GLN A 890     141.634 134.830 198.471  1.00  0.29           C  
ATOM   7145  C   GLN A 890     141.968 133.394 198.914  1.00  0.29           C  
ATOM   7146  O   GLN A 890     141.471 132.901 199.921  1.00  0.29           O  
ATOM   7147  CB  GLN A 890     140.210 135.289 198.896  1.00  0.29           C  
ATOM   7148  CG  GLN A 890     139.836 136.736 198.469  1.00  0.29           C  
ATOM   7149  CD  GLN A 890     140.580 137.768 199.318  1.00  0.29           C  
ATOM   7150  OE1 GLN A 890     140.626 137.663 200.541  1.00  0.29           O  
ATOM   7151  NE2 GLN A 890     141.174 138.800 198.673  1.00  0.29           N  
ATOM   7152  N   ASP A 891     142.868 132.719 198.161  1.00  0.31           N  
ATOM   7153  CA  ASP A 891     143.293 131.344 198.380  1.00  0.31           C  
ATOM   7154  C   ASP A 891     144.791 131.307 198.681  1.00  0.31           C  
ATOM   7155  O   ASP A 891     145.244 130.797 199.701  1.00  0.31           O  
ATOM   7156  CB  ASP A 891     142.994 130.620 197.054  1.00  0.31           C  
ATOM   7157  CG  ASP A 891     143.274 129.127 197.066  1.00  0.31           C  
ATOM   7158  OD1 ASP A 891     144.224 128.723 196.347  1.00  0.31           O  
ATOM   7159  OD2 ASP A 891     142.524 128.389 197.748  1.00  0.31           O  
ATOM   7160  N   LYS A 892     145.602 131.984 197.833  1.00  0.38           N  
ATOM   7161  CA  LYS A 892     147.027 132.183 198.064  1.00  0.38           C  
ATOM   7162  C   LYS A 892     147.302 133.090 199.262  1.00  0.38           C  
ATOM   7163  O   LYS A 892     148.385 133.093 199.840  1.00  0.38           O  
ATOM   7164  CB  LYS A 892     147.701 132.793 196.804  1.00  0.38           C  
ATOM   7165  CG  LYS A 892     147.361 134.270 196.542  1.00  0.38           C  
ATOM   7166  CD  LYS A 892     148.037 134.840 195.289  1.00  0.38           C  
ATOM   7167  CE  LYS A 892     147.786 136.341 195.160  1.00  0.38           C  
ATOM   7168  NZ  LYS A 892     148.472 136.851 193.959  1.00  0.38           N  
ATOM   7169  N   GLY A 893     146.287 133.896 199.639  1.00  0.38           N  
ATOM   7170  CA  GLY A 893     146.350 134.873 200.709  1.00  0.38           C  
ATOM   7171  C   GLY A 893     146.345 136.287 200.189  1.00  0.38           C  
ATOM   7172  O   GLY A 893     146.223 136.544 198.992  1.00  0.38           O  
ATOM   7173  N   ASN A 894     146.464 137.257 201.118  1.00  0.40           N  
ATOM   7174  CA  ASN A 894     146.634 138.667 200.793  1.00  0.40           C  
ATOM   7175  C   ASN A 894     148.108 138.995 200.606  1.00  0.40           C  
ATOM   7176  O   ASN A 894     148.496 139.929 199.913  1.00  0.40           O  
ATOM   7177  CB  ASN A 894     146.122 139.552 201.955  1.00  0.40           C  
ATOM   7178  CG  ASN A 894     144.626 139.337 202.138  1.00  0.40           C  
ATOM   7179  OD1 ASN A 894     143.877 139.161 201.181  1.00  0.40           O  
ATOM   7180  ND2 ASN A 894     144.161 139.356 203.410  1.00  0.40           N  
ATOM   7181  N   SER A 895     148.979 138.196 201.244  1.00  0.39           N  
ATOM   7182  CA  SER A 895     150.412 138.257 201.072  1.00  0.39           C  
ATOM   7183  C   SER A 895     150.883 137.831 199.688  1.00  0.39           C  
ATOM   7184  O   SER A 895     150.215 137.137 198.922  1.00  0.39           O  
ATOM   7185  CB  SER A 895     151.176 137.458 202.158  1.00  0.39           C  
ATOM   7186  OG  SER A 895     150.856 136.070 202.102  1.00  0.39           O  
ATOM   7187  N   THR A 896     152.089 138.283 199.315  1.00  0.45           N  
ATOM   7188  CA  THR A 896     152.679 137.982 198.022  1.00  0.45           C  
ATOM   7189  C   THR A 896     153.443 136.677 198.054  1.00  0.45           C  
ATOM   7190  O   THR A 896     154.314 136.460 198.895  1.00  0.45           O  
ATOM   7191  CB  THR A 896     153.631 139.074 197.565  1.00  0.45           C  
ATOM   7192  OG1 THR A 896     152.942 140.309 197.491  1.00  0.45           O  
ATOM   7193  CG2 THR A 896     154.186 138.804 196.164  1.00  0.45           C  
ATOM   7194  N   HIS A 897     153.160 135.763 197.102  1.00  0.44           N  
ATOM   7195  CA  HIS A 897     153.806 134.461 197.026  1.00  0.44           C  
ATOM   7196  C   HIS A 897     155.178 134.571 196.373  1.00  0.44           C  
ATOM   7197  O   HIS A 897     156.142 133.922 196.761  1.00  0.44           O  
ATOM   7198  CB  HIS A 897     152.903 133.459 196.274  1.00  0.44           C  
ATOM   7199  CG  HIS A 897     153.062 132.034 196.712  1.00  0.44           C  
ATOM   7200  ND1 HIS A 897     152.764 131.741 198.023  1.00  0.44           N  
ATOM   7201  CD2 HIS A 897     153.370 130.898 196.035  1.00  0.44           C  
ATOM   7202  CE1 HIS A 897     152.889 130.435 198.127  1.00  0.44           C  
ATOM   7203  NE2 HIS A 897     153.258 129.872 196.950  1.00  0.44           N  
ATOM   7204  N   SER A 898     155.305 135.513 195.413  1.00  0.48           N  
ATOM   7205  CA  SER A 898     156.537 135.936 194.747  1.00  0.48           C  
ATOM   7206  C   SER A 898     157.540 136.616 195.668  1.00  0.48           C  
ATOM   7207  O   SER A 898     158.660 136.926 195.285  1.00  0.48           O  
ATOM   7208  CB  SER A 898     156.268 136.940 193.599  1.00  0.48           C  
ATOM   7209  OG  SER A 898     155.154 136.521 192.812  1.00  0.48           O  
ATOM   7210  N   ARG A 899     157.140 136.890 196.923  1.00  0.29           N  
ATOM   7211  CA  ARG A 899     157.988 137.481 197.940  1.00  0.29           C  
ATOM   7212  C   ARG A 899     158.529 136.402 198.871  1.00  0.29           C  
ATOM   7213  O   ARG A 899     159.450 136.627 199.648  1.00  0.29           O  
ATOM   7214  CB  ARG A 899     157.101 138.454 198.755  1.00  0.29           C  
ATOM   7215  CG  ARG A 899     157.805 139.322 199.820  1.00  0.29           C  
ATOM   7216  CD  ARG A 899     156.868 139.846 200.913  1.00  0.29           C  
ATOM   7217  NE  ARG A 899     156.393 138.640 201.664  1.00  0.29           N  
ATOM   7218  CZ  ARG A 899     155.398 138.634 202.557  1.00  0.29           C  
ATOM   7219  NH1 ARG A 899     155.112 137.491 203.175  1.00  0.29           N  
ATOM   7220  NH2 ARG A 899     154.709 139.735 202.846  1.00  0.29           N  
ATOM   7221  N   ASN A 900     157.977 135.177 198.788  1.00  0.40           N  
ATOM   7222  CA  ASN A 900     158.444 134.053 199.578  1.00  0.40           C  
ATOM   7223  C   ASN A 900     159.132 133.041 198.663  1.00  0.40           C  
ATOM   7224  O   ASN A 900     159.860 132.156 199.102  1.00  0.40           O  
ATOM   7225  CB  ASN A 900     157.243 133.369 200.274  1.00  0.40           C  
ATOM   7226  CG  ASN A 900     156.432 134.355 201.121  1.00  0.40           C  
ATOM   7227  OD1 ASN A 900     156.887 135.306 201.765  1.00  0.40           O  
ATOM   7228  ND2 ASN A 900     155.097 134.126 201.131  1.00  0.40           N  
ATOM   7229  N   ASN A 901     158.919 133.186 197.344  1.00  0.38           N  
ATOM   7230  CA  ASN A 901     159.495 132.366 196.306  1.00  0.38           C  
ATOM   7231  C   ASN A 901     159.568 133.249 195.066  1.00  0.38           C  
ATOM   7232  O   ASN A 901     158.596 133.379 194.329  1.00  0.38           O  
ATOM   7233  CB  ASN A 901     158.578 131.139 196.071  1.00  0.38           C  
ATOM   7234  CG  ASN A 901     159.228 130.092 195.177  1.00  0.38           C  
ATOM   7235  OD1 ASN A 901     160.391 130.185 194.791  1.00  0.38           O  
ATOM   7236  ND2 ASN A 901     158.460 129.022 194.863  1.00  0.38           N  
ATOM   7237  N   SER A 902     160.701 133.946 194.846  1.00  0.52           N  
ATOM   7238  CA  SER A 902     160.866 134.885 193.735  1.00  0.52           C  
ATOM   7239  C   SER A 902     160.703 134.248 192.357  1.00  0.52           C  
ATOM   7240  O   SER A 902     161.323 133.238 192.035  1.00  0.52           O  
ATOM   7241  CB  SER A 902     162.233 135.618 193.801  1.00  0.52           C  
ATOM   7242  OG  SER A 902     162.358 136.649 192.817  1.00  0.52           O  
ATOM   7243  N   TYR A 903     159.859 134.853 191.499  1.00  0.53           N  
ATOM   7244  CA  TYR A 903     159.537 134.327 190.188  1.00  0.53           C  
ATOM   7245  C   TYR A 903     159.990 135.314 189.134  1.00  0.53           C  
ATOM   7246  O   TYR A 903     159.951 136.527 189.328  1.00  0.53           O  
ATOM   7247  CB  TYR A 903     158.013 134.074 189.976  1.00  0.53           C  
ATOM   7248  CG  TYR A 903     157.431 133.111 190.985  1.00  0.53           C  
ATOM   7249  CD1 TYR A 903     158.094 131.919 191.327  1.00  0.53           C  
ATOM   7250  CD2 TYR A 903     156.194 133.388 191.598  1.00  0.53           C  
ATOM   7251  CE1 TYR A 903     157.554 131.051 192.284  1.00  0.53           C  
ATOM   7252  CE2 TYR A 903     155.650 132.516 192.555  1.00  0.53           C  
ATOM   7253  CZ  TYR A 903     156.340 131.351 192.905  1.00  0.53           C  
ATOM   7254  OH  TYR A 903     155.827 130.503 193.908  1.00  0.53           O  
ATOM   7255  N   ALA A 904     160.421 134.805 187.963  1.00  0.64           N  
ATOM   7256  CA  ALA A 904     160.868 135.614 186.843  1.00  0.64           C  
ATOM   7257  C   ALA A 904     159.794 136.562 186.302  1.00  0.64           C  
ATOM   7258  O   ALA A 904     160.054 137.708 185.936  1.00  0.64           O  
ATOM   7259  CB  ALA A 904     161.353 134.667 185.730  1.00  0.64           C  
ATOM   7260  N   VAL A 905     158.536 136.086 186.271  1.00  0.68           N  
ATOM   7261  CA  VAL A 905     157.395 136.871 185.849  1.00  0.68           C  
ATOM   7262  C   VAL A 905     156.440 136.959 187.023  1.00  0.68           C  
ATOM   7263  O   VAL A 905     156.008 135.951 187.583  1.00  0.68           O  
ATOM   7264  CB  VAL A 905     156.703 136.276 184.628  1.00  0.68           C  
ATOM   7265  CG1 VAL A 905     155.502 137.141 184.205  1.00  0.68           C  
ATOM   7266  CG2 VAL A 905     157.724 136.205 183.477  1.00  0.68           C  
ATOM   7267  N   ILE A 906     156.100 138.189 187.449  1.00  0.61           N  
ATOM   7268  CA  ILE A 906     155.225 138.421 188.583  1.00  0.61           C  
ATOM   7269  C   ILE A 906     153.801 138.566 188.094  1.00  0.61           C  
ATOM   7270  O   ILE A 906     153.451 139.480 187.344  1.00  0.61           O  
ATOM   7271  CB  ILE A 906     155.621 139.636 189.422  1.00  0.61           C  
ATOM   7272  CG1 ILE A 906     157.017 139.447 190.055  1.00  0.61           C  
ATOM   7273  CG2 ILE A 906     154.583 139.905 190.540  1.00  0.61           C  
ATOM   7274  CD1 ILE A 906     158.163 139.994 189.204  1.00  0.61           C  
ATOM   7275  N   ILE A 907     152.934 137.643 188.549  1.00  0.55           N  
ATOM   7276  CA  ILE A 907     151.515 137.658 188.280  1.00  0.55           C  
ATOM   7277  C   ILE A 907     150.798 137.771 189.605  1.00  0.55           C  
ATOM   7278  O   ILE A 907     151.212 137.231 190.634  1.00  0.55           O  
ATOM   7279  CB  ILE A 907     151.016 136.465 187.465  1.00  0.55           C  
ATOM   7280  CG1 ILE A 907     151.043 135.110 188.210  1.00  0.55           C  
ATOM   7281  CG2 ILE A 907     151.872 136.419 186.187  1.00  0.55           C  
ATOM   7282  CD1 ILE A 907     150.411 133.972 187.400  1.00  0.55           C  
ATOM   7283  N   THR A 908     149.682 138.509 189.636  1.00  0.60           N  
ATOM   7284  CA  THR A 908     148.855 138.624 190.822  1.00  0.60           C  
ATOM   7285  C   THR A 908     147.466 138.299 190.370  1.00  0.60           C  
ATOM   7286  O   THR A 908     147.188 138.156 189.185  1.00  0.60           O  
ATOM   7287  CB  THR A 908     148.877 139.946 191.599  1.00  0.60           C  
ATOM   7288  OG1 THR A 908     148.307 141.010 190.857  1.00  0.60           O  
ATOM   7289  CG2 THR A 908     150.330 140.293 191.941  1.00  0.60           C  
ATOM   7290  N   SER A 909     146.541 138.114 191.313  1.00  0.58           N  
ATOM   7291  CA  SER A 909     145.172 137.805 190.978  1.00  0.58           C  
ATOM   7292  C   SER A 909     144.434 138.995 190.394  1.00  0.58           C  
ATOM   7293  O   SER A 909     143.602 138.849 189.510  1.00  0.58           O  
ATOM   7294  CB  SER A 909     144.432 137.297 192.221  1.00  0.58           C  
ATOM   7295  OG  SER A 909     144.837 137.974 193.414  1.00  0.58           O  
ATOM   7296  N   THR A 910     144.751 140.202 190.881  1.00  0.58           N  
ATOM   7297  CA  THR A 910     144.184 141.468 190.438  1.00  0.58           C  
ATOM   7298  C   THR A 910     144.791 141.958 189.128  1.00  0.58           C  
ATOM   7299  O   THR A 910     144.186 142.738 188.403  1.00  0.58           O  
ATOM   7300  CB  THR A 910     144.391 142.521 191.521  1.00  0.58           C  
ATOM   7301  OG1 THR A 910     145.754 142.526 191.956  1.00  0.58           O  
ATOM   7302  CG2 THR A 910     143.511 142.128 192.728  1.00  0.58           C  
ATOM   7303  N   SER A 911     145.988 141.448 188.758  1.00  0.66           N  
ATOM   7304  CA  SER A 911     146.733 141.813 187.549  1.00  0.66           C  
ATOM   7305  C   SER A 911     146.647 140.734 186.465  1.00  0.66           C  
ATOM   7306  O   SER A 911     147.227 140.827 185.384  1.00  0.66           O  
ATOM   7307  CB  SER A 911     148.221 142.071 187.940  1.00  0.66           C  
ATOM   7308  OG  SER A 911     149.099 142.437 186.872  1.00  0.66           O  
ATOM   7309  N   SER A 912     145.856 139.660 186.678  1.00  0.68           N  
ATOM   7310  CA  SER A 912     145.780 138.529 185.748  1.00  0.68           C  
ATOM   7311  C   SER A 912     145.077 138.849 184.441  1.00  0.68           C  
ATOM   7312  O   SER A 912     145.242 138.159 183.437  1.00  0.68           O  
ATOM   7313  CB  SER A 912     145.096 137.279 186.363  1.00  0.68           C  
ATOM   7314  OG  SER A 912     143.732 137.527 186.708  1.00  0.68           O  
ATOM   7315  N   TYR A 913     144.316 139.960 184.391  1.00  0.74           N  
ATOM   7316  CA  TYR A 913     143.645 140.434 183.194  1.00  0.74           C  
ATOM   7317  C   TYR A 913     144.590 140.745 182.036  1.00  0.74           C  
ATOM   7318  O   TYR A 913     144.240 140.575 180.868  1.00  0.74           O  
ATOM   7319  CB  TYR A 913     142.674 141.608 183.495  1.00  0.74           C  
ATOM   7320  CG  TYR A 913     143.341 142.889 183.927  1.00  0.74           C  
ATOM   7321  CD1 TYR A 913     143.771 143.825 182.970  1.00  0.74           C  
ATOM   7322  CD2 TYR A 913     143.501 143.191 185.289  1.00  0.74           C  
ATOM   7323  CE1 TYR A 913     144.389 145.020 183.365  1.00  0.74           C  
ATOM   7324  CE2 TYR A 913     144.113 144.389 185.686  1.00  0.74           C  
ATOM   7325  CZ  TYR A 913     144.565 145.296 184.725  1.00  0.74           C  
ATOM   7326  OH  TYR A 913     145.197 146.482 185.143  1.00  0.74           O  
ATOM   7327  N   TYR A 914     145.841 141.154 182.344  1.00  0.78           N  
ATOM   7328  CA  TYR A 914     146.880 141.444 181.371  1.00  0.78           C  
ATOM   7329  C   TYR A 914     147.212 140.291 180.428  1.00  0.78           C  
ATOM   7330  O   TYR A 914     147.648 140.525 179.304  1.00  0.78           O  
ATOM   7331  CB  TYR A 914     148.194 141.899 182.055  1.00  0.78           C  
ATOM   7332  CG  TYR A 914     148.171 143.361 182.396  1.00  0.78           C  
ATOM   7333  CD1 TYR A 914     148.327 144.324 181.382  1.00  0.78           C  
ATOM   7334  CD2 TYR A 914     148.062 143.789 183.728  1.00  0.78           C  
ATOM   7335  CE1 TYR A 914     148.387 145.689 181.700  1.00  0.78           C  
ATOM   7336  CE2 TYR A 914     148.108 145.153 184.046  1.00  0.78           C  
ATOM   7337  CZ  TYR A 914     148.272 146.101 183.030  1.00  0.78           C  
ATOM   7338  OH  TYR A 914     148.304 147.467 183.363  1.00  0.78           O  
ATOM   7339  N   VAL A 915     146.983 139.021 180.827  1.00  0.79           N  
ATOM   7340  CA  VAL A 915     147.237 137.838 180.006  1.00  0.79           C  
ATOM   7341  C   VAL A 915     146.524 137.886 178.650  1.00  0.79           C  
ATOM   7342  O   VAL A 915     147.117 137.649 177.597  1.00  0.79           O  
ATOM   7343  CB  VAL A 915     146.815 136.580 180.769  1.00  0.79           C  
ATOM   7344  CG1 VAL A 915     146.953 135.311 179.909  1.00  0.79           C  
ATOM   7345  CG2 VAL A 915     147.672 136.425 182.038  1.00  0.79           C  
ATOM   7346  N   PHE A 916     145.233 138.268 178.636  1.00  0.79           N  
ATOM   7347  CA  PHE A 916     144.460 138.438 177.416  1.00  0.79           C  
ATOM   7348  C   PHE A 916     144.956 139.591 176.541  1.00  0.79           C  
ATOM   7349  O   PHE A 916     145.056 139.470 175.321  1.00  0.79           O  
ATOM   7350  CB  PHE A 916     142.956 138.618 177.733  1.00  0.79           C  
ATOM   7351  CG  PHE A 916     142.388 137.366 178.344  1.00  0.79           C  
ATOM   7352  CD1 PHE A 916     142.371 137.184 179.738  1.00  0.79           C  
ATOM   7353  CD2 PHE A 916     141.862 136.357 177.520  1.00  0.79           C  
ATOM   7354  CE1 PHE A 916     141.855 136.007 180.297  1.00  0.79           C  
ATOM   7355  CE2 PHE A 916     141.332 135.186 178.076  1.00  0.79           C  
ATOM   7356  CZ  PHE A 916     141.331 135.010 179.465  1.00  0.79           C  
ATOM   7357  N   TYR A 917     145.330 140.733 177.152  1.00  0.76           N  
ATOM   7358  CA  TYR A 917     145.921 141.872 176.459  1.00  0.76           C  
ATOM   7359  C   TYR A 917     147.245 141.547 175.774  1.00  0.76           C  
ATOM   7360  O   TYR A 917     147.482 141.929 174.628  1.00  0.76           O  
ATOM   7361  CB  TYR A 917     146.180 143.041 177.439  1.00  0.76           C  
ATOM   7362  CG  TYR A 917     144.915 143.770 177.773  1.00  0.76           C  
ATOM   7363  CD1 TYR A 917     144.099 143.338 178.827  1.00  0.76           C  
ATOM   7364  CD2 TYR A 917     144.558 144.930 177.065  1.00  0.76           C  
ATOM   7365  CE1 TYR A 917     142.965 144.071 179.197  1.00  0.76           C  
ATOM   7366  CE2 TYR A 917     143.424 145.667 177.433  1.00  0.76           C  
ATOM   7367  CZ  TYR A 917     142.646 145.249 178.517  1.00  0.76           C  
ATOM   7368  OH  TYR A 917     141.546 146.014 178.930  1.00  0.76           O  
ATOM   7369  N   ILE A 918     148.130 140.790 176.454  1.00  0.77           N  
ATOM   7370  CA  ILE A 918     149.379 140.299 175.886  1.00  0.77           C  
ATOM   7371  C   ILE A 918     149.134 139.390 174.685  1.00  0.77           C  
ATOM   7372  O   ILE A 918     149.766 139.556 173.647  1.00  0.77           O  
ATOM   7373  CB  ILE A 918     150.245 139.606 176.944  1.00  0.77           C  
ATOM   7374  CG1 ILE A 918     150.683 140.622 178.028  1.00  0.77           C  
ATOM   7375  CG2 ILE A 918     151.483 138.948 176.297  1.00  0.77           C  
ATOM   7376  CD1 ILE A 918     151.361 139.985 179.246  1.00  0.77           C  
ATOM   7377  N   TYR A 919     148.156 138.455 174.765  1.00  0.75           N  
ATOM   7378  CA  TYR A 919     147.785 137.585 173.650  1.00  0.75           C  
ATOM   7379  C   TYR A 919     147.344 138.353 172.401  1.00  0.75           C  
ATOM   7380  O   TYR A 919     147.787 138.059 171.294  1.00  0.75           O  
ATOM   7381  CB  TYR A 919     146.670 136.583 174.087  1.00  0.75           C  
ATOM   7382  CG  TYR A 919     146.246 135.660 172.962  1.00  0.75           C  
ATOM   7383  CD1 TYR A 919     147.036 134.559 172.591  1.00  0.75           C  
ATOM   7384  CD2 TYR A 919     145.098 135.958 172.204  1.00  0.75           C  
ATOM   7385  CE1 TYR A 919     146.705 133.794 171.462  1.00  0.75           C  
ATOM   7386  CE2 TYR A 919     144.774 135.202 171.068  1.00  0.75           C  
ATOM   7387  CZ  TYR A 919     145.583 134.122 170.696  1.00  0.75           C  
ATOM   7388  OH  TYR A 919     145.269 133.367 169.548  1.00  0.75           O  
ATOM   7389  N   VAL A 920     146.494 139.388 172.546  1.00  0.76           N  
ATOM   7390  CA  VAL A 920     146.044 140.217 171.430  1.00  0.76           C  
ATOM   7391  C   VAL A 920     147.194 140.938 170.735  1.00  0.76           C  
ATOM   7392  O   VAL A 920     147.255 141.004 169.508  1.00  0.76           O  
ATOM   7393  CB  VAL A 920     144.952 141.193 171.866  1.00  0.76           C  
ATOM   7394  CG1 VAL A 920     144.540 142.151 170.731  1.00  0.76           C  
ATOM   7395  CG2 VAL A 920     143.722 140.375 172.293  1.00  0.76           C  
ATOM   7396  N   GLY A 921     148.178 141.444 171.506  1.00  0.77           N  
ATOM   7397  CA  GLY A 921     149.318 142.165 170.949  1.00  0.77           C  
ATOM   7398  C   GLY A 921     150.380 141.325 170.275  1.00  0.77           C  
ATOM   7399  O   GLY A 921     151.266 141.872 169.625  1.00  0.77           O  
ATOM   7400  N   VAL A 922     150.318 139.983 170.407  1.00  0.82           N  
ATOM   7401  CA  VAL A 922     151.236 139.061 169.736  1.00  0.82           C  
ATOM   7402  C   VAL A 922     150.512 138.100 168.798  1.00  0.82           C  
ATOM   7403  O   VAL A 922     151.119 137.210 168.196  1.00  0.82           O  
ATOM   7404  CB  VAL A 922     152.082 138.249 170.722  1.00  0.82           C  
ATOM   7405  CG1 VAL A 922     152.867 139.215 171.629  1.00  0.82           C  
ATOM   7406  CG2 VAL A 922     151.218 137.292 171.563  1.00  0.82           C  
ATOM   7407  N   ALA A 923     149.183 138.265 168.620  1.00  0.82           N  
ATOM   7408  CA  ALA A 923     148.349 137.392 167.812  1.00  0.82           C  
ATOM   7409  C   ALA A 923     148.692 137.439 166.326  1.00  0.82           C  
ATOM   7410  O   ALA A 923     148.498 136.465 165.600  1.00  0.82           O  
ATOM   7411  CB  ALA A 923     146.859 137.730 168.030  1.00  0.82           C  
ATOM   7412  N   ASP A 924     149.257 138.573 165.855  1.00  0.80           N  
ATOM   7413  CA  ASP A 924     149.716 138.773 164.494  1.00  0.80           C  
ATOM   7414  C   ASP A 924     150.809 137.780 164.092  1.00  0.80           C  
ATOM   7415  O   ASP A 924     150.753 137.180 163.021  1.00  0.80           O  
ATOM   7416  CB  ASP A 924     150.084 140.282 164.235  1.00  0.80           C  
ATOM   7417  CG  ASP A 924     151.266 140.855 165.020  1.00  0.80           C  
ATOM   7418  OD1 ASP A 924     151.573 140.305 166.106  1.00  0.80           O  
ATOM   7419  OD2 ASP A 924     151.864 141.877 164.566  1.00  0.80           O  
ATOM   7420  N   THR A 925     151.785 137.544 164.989  1.00  0.79           N  
ATOM   7421  CA  THR A 925     152.847 136.552 164.825  1.00  0.79           C  
ATOM   7422  C   THR A 925     152.365 135.104 164.898  1.00  0.79           C  
ATOM   7423  O   THR A 925     152.741 134.265 164.083  1.00  0.79           O  
ATOM   7424  CB  THR A 925     153.979 136.680 165.852  1.00  0.79           C  
ATOM   7425  OG1 THR A 925     154.514 137.991 165.928  1.00  0.79           O  
ATOM   7426  CG2 THR A 925     155.161 135.791 165.449  1.00  0.79           C  
ATOM   7427  N   LEU A 926     151.506 134.750 165.883  1.00  0.77           N  
ATOM   7428  CA  LEU A 926     151.045 133.375 166.099  1.00  0.77           C  
ATOM   7429  C   LEU A 926     150.191 132.829 164.960  1.00  0.77           C  
ATOM   7430  O   LEU A 926     150.182 131.635 164.683  1.00  0.77           O  
ATOM   7431  CB  LEU A 926     150.235 133.228 167.416  1.00  0.77           C  
ATOM   7432  CG  LEU A 926     150.948 133.682 168.707  1.00  0.77           C  
ATOM   7433  CD1 LEU A 926     149.970 133.626 169.889  1.00  0.77           C  
ATOM   7434  CD2 LEU A 926     152.200 132.854 169.023  1.00  0.77           C  
ATOM   7435  N   LEU A 927     149.446 133.724 164.288  1.00  0.80           N  
ATOM   7436  CA  LEU A 927     148.560 133.409 163.184  1.00  0.80           C  
ATOM   7437  C   LEU A 927     149.154 133.858 161.849  1.00  0.80           C  
ATOM   7438  O   LEU A 927     148.462 133.952 160.832  1.00  0.80           O  
ATOM   7439  CB  LEU A 927     147.217 134.158 163.397  1.00  0.80           C  
ATOM   7440  CG  LEU A 927     146.516 133.880 164.745  1.00  0.80           C  
ATOM   7441  CD1 LEU A 927     145.359 134.867 164.961  1.00  0.80           C  
ATOM   7442  CD2 LEU A 927     146.039 132.428 164.862  1.00  0.80           C  
ATOM   7443  N   ALA A 928     150.462 134.191 161.810  1.00  0.84           N  
ATOM   7444  CA  ALA A 928     151.137 134.576 160.589  1.00  0.84           C  
ATOM   7445  C   ALA A 928     151.222 133.451 159.556  1.00  0.84           C  
ATOM   7446  O   ALA A 928     151.542 132.294 159.838  1.00  0.84           O  
ATOM   7447  CB  ALA A 928     152.539 135.146 160.876  1.00  0.84           C  
ATOM   7448  N   MET A 929     150.954 133.762 158.278  1.00  0.78           N  
ATOM   7449  CA  MET A 929     151.036 132.773 157.231  1.00  0.78           C  
ATOM   7450  C   MET A 929     152.479 132.526 156.830  1.00  0.78           C  
ATOM   7451  O   MET A 929     153.099 133.334 156.150  1.00  0.78           O  
ATOM   7452  CB  MET A 929     150.224 133.192 155.988  1.00  0.78           C  
ATOM   7453  CG  MET A 929     148.715 133.337 156.267  1.00  0.78           C  
ATOM   7454  SD  MET A 929     147.756 133.978 154.861  1.00  0.78           S  
ATOM   7455  CE  MET A 929     148.002 132.554 153.764  1.00  0.78           C  
ATOM   7456  N   GLY A 930     153.063 131.385 157.259  1.00  0.77           N  
ATOM   7457  CA  GLY A 930     154.411 130.987 156.857  1.00  0.77           C  
ATOM   7458  C   GLY A 930     154.575 130.664 155.394  1.00  0.77           C  
ATOM   7459  O   GLY A 930     153.625 130.614 154.616  1.00  0.77           O  
ATOM   7460  N   PHE A 931     155.817 130.363 154.968  1.00  0.72           N  
ATOM   7461  CA  PHE A 931     156.153 130.163 153.564  1.00  0.72           C  
ATOM   7462  C   PHE A 931     155.506 128.920 152.943  1.00  0.72           C  
ATOM   7463  O   PHE A 931     155.279 128.854 151.740  1.00  0.72           O  
ATOM   7464  CB  PHE A 931     157.691 130.220 153.351  1.00  0.72           C  
ATOM   7465  CG  PHE A 931     158.421 129.125 154.071  1.00  0.72           C  
ATOM   7466  CD1 PHE A 931     158.824 129.272 155.410  1.00  0.72           C  
ATOM   7467  CD2 PHE A 931     158.716 127.931 153.394  1.00  0.72           C  
ATOM   7468  CE1 PHE A 931     159.477 128.224 156.072  1.00  0.72           C  
ATOM   7469  CE2 PHE A 931     159.378 126.888 154.049  1.00  0.72           C  
ATOM   7470  CZ  PHE A 931     159.755 127.034 155.389  1.00  0.72           C  
ATOM   7471  N   PHE A 932     155.094 127.958 153.796  1.00  0.70           N  
ATOM   7472  CA  PHE A 932     154.269 126.809 153.454  1.00  0.70           C  
ATOM   7473  C   PHE A 932     152.835 127.166 153.053  1.00  0.70           C  
ATOM   7474  O   PHE A 932     152.103 126.332 152.529  1.00  0.70           O  
ATOM   7475  CB  PHE A 932     154.163 125.847 154.668  1.00  0.70           C  
ATOM   7476  CG  PHE A 932     155.406 125.024 154.833  1.00  0.70           C  
ATOM   7477  CD1 PHE A 932     155.565 123.869 154.051  1.00  0.70           C  
ATOM   7478  CD2 PHE A 932     156.386 125.339 155.791  1.00  0.70           C  
ATOM   7479  CE1 PHE A 932     156.686 123.046 154.210  1.00  0.70           C  
ATOM   7480  CE2 PHE A 932     157.508 124.514 155.956  1.00  0.70           C  
ATOM   7481  CZ  PHE A 932     157.659 123.370 155.162  1.00  0.70           C  
ATOM   7482  N   ARG A 933     152.389 128.412 153.303  1.00  0.69           N  
ATOM   7483  CA  ARG A 933     151.078 128.884 152.892  1.00  0.69           C  
ATOM   7484  C   ARG A 933     151.165 130.117 152.007  1.00  0.69           C  
ATOM   7485  O   ARG A 933     150.428 130.242 151.032  1.00  0.69           O  
ATOM   7486  CB  ARG A 933     150.223 129.247 154.135  1.00  0.69           C  
ATOM   7487  CG  ARG A 933     149.782 128.019 154.953  1.00  0.69           C  
ATOM   7488  CD  ARG A 933     148.745 128.312 156.052  1.00  0.69           C  
ATOM   7489  NE  ARG A 933     149.358 129.088 157.177  1.00  0.69           N  
ATOM   7490  CZ  ARG A 933     148.679 129.470 158.273  1.00  0.69           C  
ATOM   7491  NH1 ARG A 933     147.374 129.283 158.437  1.00  0.69           N  
ATOM   7492  NH2 ARG A 933     149.307 130.076 159.272  1.00  0.69           N  
ATOM   7493  N   GLY A 934     152.089 131.060 152.288  1.00  0.77           N  
ATOM   7494  CA  GLY A 934     152.156 132.316 151.541  1.00  0.77           C  
ATOM   7495  C   GLY A 934     152.700 132.189 150.139  1.00  0.77           C  
ATOM   7496  O   GLY A 934     152.135 132.726 149.190  1.00  0.77           O  
ATOM   7497  N   LEU A 935     153.796 131.432 149.948  1.00  0.78           N  
ATOM   7498  CA  LEU A 935     154.329 131.148 148.623  1.00  0.78           C  
ATOM   7499  C   LEU A 935     153.418 130.329 147.701  1.00  0.78           C  
ATOM   7500  O   LEU A 935     153.267 130.745 146.547  1.00  0.78           O  
ATOM   7501  CB  LEU A 935     155.718 130.469 148.703  1.00  0.78           C  
ATOM   7502  CG  LEU A 935     156.839 131.325 149.321  1.00  0.78           C  
ATOM   7503  CD1 LEU A 935     158.105 130.475 149.469  1.00  0.78           C  
ATOM   7504  CD2 LEU A 935     157.146 132.570 148.481  1.00  0.78           C  
ATOM   7505  N   PRO A 936     152.749 129.224 148.069  1.00  0.84           N  
ATOM   7506  CA  PRO A 936     151.828 128.553 147.157  1.00  0.84           C  
ATOM   7507  C   PRO A 936     150.602 129.393 146.868  1.00  0.84           C  
ATOM   7508  O   PRO A 936     150.086 129.309 145.759  1.00  0.84           O  
ATOM   7509  CB  PRO A 936     151.493 127.219 147.844  1.00  0.84           C  
ATOM   7510  CG  PRO A 936     151.814 127.452 149.319  1.00  0.84           C  
ATOM   7511  CD  PRO A 936     153.004 128.406 149.262  1.00  0.84           C  
ATOM   7512  N   LEU A 937     150.116 130.221 147.816  1.00  0.84           N  
ATOM   7513  CA  LEU A 937     149.003 131.120 147.551  1.00  0.84           C  
ATOM   7514  C   LEU A 937     149.302 132.141 146.460  1.00  0.84           C  
ATOM   7515  O   LEU A 937     148.547 132.292 145.500  1.00  0.84           O  
ATOM   7516  CB  LEU A 937     148.594 131.870 148.843  1.00  0.84           C  
ATOM   7517  CG  LEU A 937     147.415 132.855 148.689  1.00  0.84           C  
ATOM   7518  CD1 LEU A 937     146.125 132.165 148.230  1.00  0.84           C  
ATOM   7519  CD2 LEU A 937     147.179 133.612 149.999  1.00  0.84           C  
ATOM   7520  N   VAL A 938     150.457 132.831 146.546  1.00  0.83           N  
ATOM   7521  CA  VAL A 938     150.884 133.782 145.530  1.00  0.83           C  
ATOM   7522  C   VAL A 938     151.161 133.120 144.182  1.00  0.83           C  
ATOM   7523  O   VAL A 938     150.725 133.610 143.142  1.00  0.83           O  
ATOM   7524  CB  VAL A 938     152.077 134.606 146.002  1.00  0.83           C  
ATOM   7525  CG1 VAL A 938     152.538 135.582 144.909  1.00  0.83           C  
ATOM   7526  CG2 VAL A 938     151.667 135.425 147.240  1.00  0.83           C  
ATOM   7527  N   HIS A 939     151.836 131.948 144.161  1.00  0.82           N  
ATOM   7528  CA  HIS A 939     152.096 131.200 142.931  1.00  0.82           C  
ATOM   7529  C   HIS A 939     150.835 130.821 142.163  1.00  0.82           C  
ATOM   7530  O   HIS A 939     150.743 131.004 140.946  1.00  0.82           O  
ATOM   7531  CB  HIS A 939     152.849 129.887 143.250  1.00  0.82           C  
ATOM   7532  CG  HIS A 939     153.024 128.945 142.089  1.00  0.82           C  
ATOM   7533  ND1 HIS A 939     153.869 129.249 141.034  1.00  0.82           N  
ATOM   7534  CD2 HIS A 939     152.477 127.717 141.910  1.00  0.82           C  
ATOM   7535  CE1 HIS A 939     153.836 128.190 140.255  1.00  0.82           C  
ATOM   7536  NE2 HIS A 939     153.005 127.235 140.733  1.00  0.82           N  
ATOM   7537  N   THR A 940     149.812 130.311 142.873  1.00  0.84           N  
ATOM   7538  CA  THR A 940     148.560 129.885 142.258  1.00  0.84           C  
ATOM   7539  C   THR A 940     147.668 131.051 141.848  1.00  0.84           C  
ATOM   7540  O   THR A 940     146.844 130.961 140.945  1.00  0.84           O  
ATOM   7541  CB  THR A 940     147.769 128.941 143.153  1.00  0.84           C  
ATOM   7542  OG1 THR A 940     148.612 127.913 143.658  1.00  0.84           O  
ATOM   7543  CG2 THR A 940     146.693 128.213 142.349  1.00  0.84           C  
ATOM   7544  N   LEU A 941     147.823 132.246 142.444  1.00  0.86           N  
ATOM   7545  CA  LEU A 941     147.162 133.440 141.928  1.00  0.86           C  
ATOM   7546  C   LEU A 941     147.675 133.874 140.548  1.00  0.86           C  
ATOM   7547  O   LEU A 941     146.918 134.317 139.687  1.00  0.86           O  
ATOM   7548  CB  LEU A 941     147.215 134.593 142.960  1.00  0.86           C  
ATOM   7549  CG  LEU A 941     146.262 134.382 144.158  1.00  0.86           C  
ATOM   7550  CD1 LEU A 941     146.544 135.378 145.286  1.00  0.86           C  
ATOM   7551  CD2 LEU A 941     144.786 134.488 143.756  1.00  0.86           C  
ATOM   7552  N   ILE A 942     148.985 133.716 140.279  1.00  0.84           N  
ATOM   7553  CA  ILE A 942     149.599 134.007 138.984  1.00  0.84           C  
ATOM   7554  C   ILE A 942     149.132 133.057 137.879  1.00  0.84           C  
ATOM   7555  O   ILE A 942     148.953 133.429 136.715  1.00  0.84           O  
ATOM   7556  CB  ILE A 942     151.124 134.024 139.094  1.00  0.84           C  
ATOM   7557  CG1 ILE A 942     151.544 135.072 140.150  1.00  0.84           C  
ATOM   7558  CG2 ILE A 942     151.771 134.345 137.728  1.00  0.84           C  
ATOM   7559  CD1 ILE A 942     153.036 135.068 140.484  1.00  0.84           C  
ATOM   7560  N   THR A 943     148.897 131.768 138.212  1.00  0.85           N  
ATOM   7561  CA  THR A 943     148.363 130.777 137.278  1.00  0.85           C  
ATOM   7562  C   THR A 943     146.975 131.128 136.765  1.00  0.85           C  
ATOM   7563  O   THR A 943     146.692 130.930 135.583  1.00  0.85           O  
ATOM   7564  CB  THR A 943     148.391 129.323 137.765  1.00  0.85           C  
ATOM   7565  OG1 THR A 943     147.762 129.144 139.018  1.00  0.85           O  
ATOM   7566  CG2 THR A 943     149.848 128.886 137.982  1.00  0.85           C  
ATOM   7567  N   VAL A 944     146.106 131.710 137.617  1.00  0.86           N  
ATOM   7568  CA  VAL A 944     144.803 132.256 137.238  1.00  0.86           C  
ATOM   7569  C   VAL A 944     144.892 133.340 136.163  1.00  0.86           C  
ATOM   7570  O   VAL A 944     144.221 133.266 135.134  1.00  0.86           O  
ATOM   7571  CB  VAL A 944     144.079 132.818 138.463  1.00  0.86           C  
ATOM   7572  CG1 VAL A 944     142.742 133.480 138.089  1.00  0.86           C  
ATOM   7573  CG2 VAL A 944     143.812 131.682 139.463  1.00  0.86           C  
ATOM   7574  N   SER A 945     145.793 134.335 136.324  1.00  0.86           N  
ATOM   7575  CA  SER A 945     146.034 135.379 135.319  1.00  0.86           C  
ATOM   7576  C   SER A 945     146.513 134.827 133.976  1.00  0.86           C  
ATOM   7577  O   SER A 945     146.079 135.236 132.896  1.00  0.86           O  
ATOM   7578  CB  SER A 945     147.060 136.430 135.803  1.00  0.86           C  
ATOM   7579  OG  SER A 945     147.159 137.507 134.872  1.00  0.86           O  
ATOM   7580  N   LYS A 946     147.402 133.811 134.009  1.00  0.82           N  
ATOM   7581  CA  LYS A 946     147.829 133.086 132.822  1.00  0.82           C  
ATOM   7582  C   LYS A 946     146.686 132.405 132.063  1.00  0.82           C  
ATOM   7583  O   LYS A 946     146.611 132.476 130.837  1.00  0.82           O  
ATOM   7584  CB  LYS A 946     148.879 132.008 133.208  1.00  0.82           C  
ATOM   7585  CG  LYS A 946     149.481 131.248 132.011  1.00  0.82           C  
ATOM   7586  CD  LYS A 946     150.409 130.085 132.404  1.00  0.82           C  
ATOM   7587  CE  LYS A 946     149.712 128.878 133.044  1.00  0.82           C  
ATOM   7588  NZ  LYS A 946     148.763 128.252 132.094  1.00  0.82           N  
ATOM   7589  N   ILE A 947     145.760 131.729 132.775  1.00  0.83           N  
ATOM   7590  CA  ILE A 947     144.579 131.111 132.173  1.00  0.83           C  
ATOM   7591  C   ILE A 947     143.630 132.148 131.579  1.00  0.83           C  
ATOM   7592  O   ILE A 947     143.161 132.011 130.447  1.00  0.83           O  
ATOM   7593  CB  ILE A 947     143.844 130.218 133.181  1.00  0.83           C  
ATOM   7594  CG1 ILE A 947     144.734 129.027 133.616  1.00  0.83           C  
ATOM   7595  CG2 ILE A 947     142.510 129.701 132.597  1.00  0.83           C  
ATOM   7596  CD1 ILE A 947     144.167 128.235 134.800  1.00  0.83           C  
ATOM   7597  N   LEU A 948     143.349 133.240 132.316  1.00  0.84           N  
ATOM   7598  CA  LEU A 948     142.471 134.306 131.863  1.00  0.84           C  
ATOM   7599  C   LEU A 948     142.962 135.037 130.621  1.00  0.84           C  
ATOM   7600  O   LEU A 948     142.180 135.299 129.711  1.00  0.84           O  
ATOM   7601  CB  LEU A 948     142.186 135.322 132.993  1.00  0.84           C  
ATOM   7602  CG  LEU A 948     141.350 134.769 134.168  1.00  0.84           C  
ATOM   7603  CD1 LEU A 948     141.161 135.851 135.238  1.00  0.84           C  
ATOM   7604  CD2 LEU A 948     139.983 134.235 133.722  1.00  0.84           C  
ATOM   7605  N   HIS A 949     144.276 135.337 130.518  1.00  0.82           N  
ATOM   7606  CA  HIS A 949     144.865 135.929 129.319  1.00  0.82           C  
ATOM   7607  C   HIS A 949     144.683 135.070 128.066  1.00  0.82           C  
ATOM   7608  O   HIS A 949     144.296 135.570 127.010  1.00  0.82           O  
ATOM   7609  CB  HIS A 949     146.372 136.220 129.553  1.00  0.82           C  
ATOM   7610  CG  HIS A 949     147.066 136.913 128.410  1.00  0.82           C  
ATOM   7611  ND1 HIS A 949     147.620 136.151 127.402  1.00  0.82           N  
ATOM   7612  CD2 HIS A 949     147.111 138.229 128.076  1.00  0.82           C  
ATOM   7613  CE1 HIS A 949     147.971 137.007 126.468  1.00  0.82           C  
ATOM   7614  NE2 HIS A 949     147.688 138.284 126.823  1.00  0.82           N  
ATOM   7615  N   HIS A 950     144.898 133.740 128.178  1.00  0.79           N  
ATOM   7616  CA  HIS A 950     144.683 132.799 127.083  1.00  0.79           C  
ATOM   7617  C   HIS A 950     143.231 132.756 126.605  1.00  0.79           C  
ATOM   7618  O   HIS A 950     142.940 132.893 125.418  1.00  0.79           O  
ATOM   7619  CB  HIS A 950     145.159 131.387 127.514  1.00  0.79           C  
ATOM   7620  CG  HIS A 950     145.286 130.402 126.388  1.00  0.79           C  
ATOM   7621  ND1 HIS A 950     144.169 129.706 125.968  1.00  0.79           N  
ATOM   7622  CD2 HIS A 950     146.349 130.123 125.588  1.00  0.79           C  
ATOM   7623  CE1 HIS A 950     144.573 129.026 124.908  1.00  0.79           C  
ATOM   7624  NE2 HIS A 950     145.884 129.241 124.638  1.00  0.79           N  
ATOM   7625  N   LYS A 951     142.265 132.669 127.548  1.00  0.80           N  
ATOM   7626  CA  LYS A 951     140.842 132.710 127.241  1.00  0.80           C  
ATOM   7627  C   LYS A 951     140.382 134.008 126.592  1.00  0.80           C  
ATOM   7628  O   LYS A 951     139.626 133.996 125.623  1.00  0.80           O  
ATOM   7629  CB  LYS A 951     140.001 132.496 128.524  1.00  0.80           C  
ATOM   7630  CG  LYS A 951     140.100 131.073 129.090  1.00  0.80           C  
ATOM   7631  CD  LYS A 951     139.228 130.896 130.344  1.00  0.80           C  
ATOM   7632  CE  LYS A 951     139.166 129.462 130.875  1.00  0.80           C  
ATOM   7633  NZ  LYS A 951     138.515 128.579 129.881  1.00  0.80           N  
ATOM   7634  N   MET A 952     140.850 135.155 127.115  1.00  0.81           N  
ATOM   7635  CA  MET A 952     140.556 136.475 126.591  1.00  0.81           C  
ATOM   7636  C   MET A 952     141.083 136.705 125.185  1.00  0.81           C  
ATOM   7637  O   MET A 952     140.406 137.258 124.324  1.00  0.81           O  
ATOM   7638  CB  MET A 952     141.184 137.514 127.543  1.00  0.81           C  
ATOM   7639  CG  MET A 952     140.761 138.968 127.299  1.00  0.81           C  
ATOM   7640  SD  MET A 952     141.731 140.125 128.309  1.00  0.81           S  
ATOM   7641  CE  MET A 952     140.540 141.468 128.113  1.00  0.81           C  
ATOM   7642  N   LEU A 953     142.325 136.277 124.896  1.00  0.83           N  
ATOM   7643  CA  LEU A 953     142.870 136.376 123.552  1.00  0.83           C  
ATOM   7644  C   LEU A 953     142.152 135.464 122.550  1.00  0.83           C  
ATOM   7645  O   LEU A 953     141.772 135.893 121.459  1.00  0.83           O  
ATOM   7646  CB  LEU A 953     144.404 136.157 123.611  1.00  0.83           C  
ATOM   7647  CG  LEU A 953     145.233 136.495 122.351  1.00  0.83           C  
ATOM   7648  CD1 LEU A 953     145.331 135.303 121.401  1.00  0.83           C  
ATOM   7649  CD2 LEU A 953     144.749 137.743 121.604  1.00  0.83           C  
ATOM   7650  N   HIS A 954     141.874 134.201 122.940  1.00  0.80           N  
ATOM   7651  CA  HIS A 954     141.129 133.231 122.142  1.00  0.80           C  
ATOM   7652  C   HIS A 954     139.723 133.680 121.748  1.00  0.80           C  
ATOM   7653  O   HIS A 954     139.291 133.549 120.601  1.00  0.80           O  
ATOM   7654  CB  HIS A 954     140.989 131.917 122.949  1.00  0.80           C  
ATOM   7655  CG  HIS A 954     140.242 130.829 122.234  1.00  0.80           C  
ATOM   7656  ND1 HIS A 954     140.905 130.179 121.231  1.00  0.80           N  
ATOM   7657  CD2 HIS A 954     138.961 130.382 122.307  1.00  0.80           C  
ATOM   7658  CE1 HIS A 954     140.045 129.351 120.699  1.00  0.80           C  
ATOM   7659  NE2 HIS A 954     138.840 129.428 121.314  1.00  0.80           N  
ATOM   7660  N   SER A 955     138.950 134.257 122.694  1.00  0.82           N  
ATOM   7661  CA  SER A 955     137.617 134.781 122.407  1.00  0.82           C  
ATOM   7662  C   SER A 955     137.609 135.945 121.424  1.00  0.82           C  
ATOM   7663  O   SER A 955     136.788 135.982 120.508  1.00  0.82           O  
ATOM   7664  CB  SER A 955     136.794 135.147 123.674  1.00  0.82           C  
ATOM   7665  OG  SER A 955     137.394 136.198 124.432  1.00  0.82           O  
ATOM   7666  N   VAL A 956     138.563 136.893 121.541  1.00  0.83           N  
ATOM   7667  CA  VAL A 956     138.719 138.030 120.633  1.00  0.83           C  
ATOM   7668  C   VAL A 956     138.961 137.620 119.183  1.00  0.83           C  
ATOM   7669  O   VAL A 956     138.341 138.152 118.262  1.00  0.83           O  
ATOM   7670  CB  VAL A 956     139.824 138.974 121.112  1.00  0.83           C  
ATOM   7671  CG1 VAL A 956     140.155 140.080 120.089  1.00  0.83           C  
ATOM   7672  CG2 VAL A 956     139.358 139.637 122.420  1.00  0.83           C  
ATOM   7673  N   LEU A 957     139.819 136.613 118.926  1.00  0.82           N  
ATOM   7674  CA  LEU A 957     140.077 136.146 117.570  1.00  0.82           C  
ATOM   7675  C   LEU A 957     138.896 135.395 116.957  1.00  0.82           C  
ATOM   7676  O   LEU A 957     138.732 135.322 115.737  1.00  0.82           O  
ATOM   7677  CB  LEU A 957     141.339 135.250 117.534  1.00  0.82           C  
ATOM   7678  CG  LEU A 957     142.660 135.979 117.866  1.00  0.82           C  
ATOM   7679  CD1 LEU A 957     143.824 134.985 117.854  1.00  0.82           C  
ATOM   7680  CD2 LEU A 957     142.965 137.136 116.908  1.00  0.82           C  
ATOM   7681  N   GLN A 958     137.989 134.873 117.800  1.00  0.80           N  
ATOM   7682  CA  GLN A 958     136.848 134.100 117.366  1.00  0.80           C  
ATOM   7683  C   GLN A 958     135.574 134.914 117.226  1.00  0.80           C  
ATOM   7684  O   GLN A 958     134.592 134.430 116.668  1.00  0.80           O  
ATOM   7685  CB  GLN A 958     136.611 132.955 118.380  1.00  0.80           C  
ATOM   7686  CG  GLN A 958     137.037 131.570 117.851  1.00  0.80           C  
ATOM   7687  CD  GLN A 958     138.508 131.452 117.425  1.00  0.80           C  
ATOM   7688  OE1 GLN A 958     138.743 130.967 116.319  1.00  0.80           O  
ATOM   7689  NE2 GLN A 958     139.471 131.838 118.286  1.00  0.80           N  
ATOM   7690  N   ALA A 959     135.546 136.176 117.683  1.00  0.84           N  
ATOM   7691  CA  ALA A 959     134.387 137.040 117.573  1.00  0.84           C  
ATOM   7692  C   ALA A 959     133.954 137.337 116.129  1.00  0.84           C  
ATOM   7693  O   ALA A 959     134.814 137.362 115.239  1.00  0.84           O  
ATOM   7694  CB  ALA A 959     134.636 138.335 118.358  1.00  0.84           C  
ATOM   7695  N   PRO A 960     132.662 137.527 115.818  1.00  0.80           N  
ATOM   7696  CA  PRO A 960     132.214 137.986 114.510  1.00  0.80           C  
ATOM   7697  C   PRO A 960     132.737 139.368 114.181  1.00  0.80           C  
ATOM   7698  O   PRO A 960     132.935 140.198 115.070  1.00  0.80           O  
ATOM   7699  CB  PRO A 960     130.677 137.956 114.603  1.00  0.80           C  
ATOM   7700  CG  PRO A 960     130.377 138.147 116.088  1.00  0.80           C  
ATOM   7701  CD  PRO A 960     131.550 137.456 116.769  1.00  0.80           C  
ATOM   7702  N   MET A 961     132.972 139.640 112.885  1.00  0.72           N  
ATOM   7703  CA  MET A 961     133.556 140.887 112.425  1.00  0.72           C  
ATOM   7704  C   MET A 961     132.737 142.125 112.776  1.00  0.72           C  
ATOM   7705  O   MET A 961     133.268 143.186 113.093  1.00  0.72           O  
ATOM   7706  CB  MET A 961     133.811 140.819 110.903  1.00  0.72           C  
ATOM   7707  CG  MET A 961     134.736 141.931 110.365  1.00  0.72           C  
ATOM   7708  SD  MET A 961     136.351 142.079 111.197  1.00  0.72           S  
ATOM   7709  CE  MET A 961     136.955 140.408 110.838  1.00  0.72           C  
ATOM   7710  N   SER A 962     131.394 142.003 112.783  1.00  0.69           N  
ATOM   7711  CA  SER A 962     130.476 143.073 113.155  1.00  0.69           C  
ATOM   7712  C   SER A 962     130.698 143.614 114.566  1.00  0.69           C  
ATOM   7713  O   SER A 962     130.748 144.824 114.770  1.00  0.69           O  
ATOM   7714  CB  SER A 962     129.001 142.612 113.012  1.00  0.69           C  
ATOM   7715  OG  SER A 962     128.765 141.411 113.751  1.00  0.69           O  
ATOM   7716  N   THR A 963     130.905 142.723 115.557  1.00  0.68           N  
ATOM   7717  CA  THR A 963     131.301 143.059 116.929  1.00  0.68           C  
ATOM   7718  C   THR A 963     132.655 143.738 117.008  1.00  0.68           C  
ATOM   7719  O   THR A 963     132.839 144.719 117.721  1.00  0.68           O  
ATOM   7720  CB  THR A 963     131.340 141.826 117.838  1.00  0.68           C  
ATOM   7721  OG1 THR A 963     130.043 141.261 117.944  1.00  0.68           O  
ATOM   7722  CG2 THR A 963     131.782 142.144 119.275  1.00  0.68           C  
ATOM   7723  N   LEU A 964     133.659 143.251 116.260  1.00  0.72           N  
ATOM   7724  CA  LEU A 964     135.009 143.788 116.335  1.00  0.72           C  
ATOM   7725  C   LEU A 964     135.176 145.164 115.704  1.00  0.72           C  
ATOM   7726  O   LEU A 964     136.029 145.945 116.114  1.00  0.72           O  
ATOM   7727  CB  LEU A 964     136.010 142.796 115.709  1.00  0.72           C  
ATOM   7728  CG  LEU A 964     136.067 141.433 116.425  1.00  0.72           C  
ATOM   7729  CD1 LEU A 964     137.010 140.499 115.671  1.00  0.72           C  
ATOM   7730  CD2 LEU A 964     136.533 141.567 117.880  1.00  0.72           C  
ATOM   7731  N   ASN A 965     134.310 145.532 114.740  1.00  0.64           N  
ATOM   7732  CA  ASN A 965     134.318 146.845 114.114  1.00  0.64           C  
ATOM   7733  C   ASN A 965     133.863 147.972 115.046  1.00  0.64           C  
ATOM   7734  O   ASN A 965     134.098 149.149 114.778  1.00  0.64           O  
ATOM   7735  CB  ASN A 965     133.374 146.852 112.881  1.00  0.64           C  
ATOM   7736  CG  ASN A 965     133.983 146.073 111.720  1.00  0.64           C  
ATOM   7737  OD1 ASN A 965     135.194 145.991 111.538  1.00  0.64           O  
ATOM   7738  ND2 ASN A 965     133.104 145.522 110.847  1.00  0.64           N  
ATOM   7739  N   THR A 966     133.191 147.653 116.174  1.00  0.60           N  
ATOM   7740  CA  THR A 966     132.744 148.672 117.124  1.00  0.60           C  
ATOM   7741  C   THR A 966     133.808 149.001 118.157  1.00  0.60           C  
ATOM   7742  O   THR A 966     133.729 150.024 118.849  1.00  0.60           O  
ATOM   7743  CB  THR A 966     131.444 148.317 117.859  1.00  0.60           C  
ATOM   7744  OG1 THR A 966     131.594 147.271 118.807  1.00  0.60           O  
ATOM   7745  CG2 THR A 966     130.376 147.863 116.859  1.00  0.60           C  
ATOM   7746  N   LEU A 967     134.847 148.147 118.259  1.00  0.66           N  
ATOM   7747  CA  LEU A 967     135.909 148.254 119.235  1.00  0.66           C  
ATOM   7748  C   LEU A 967     137.035 149.147 118.734  1.00  0.66           C  
ATOM   7749  O   LEU A 967     137.568 149.010 117.638  1.00  0.66           O  
ATOM   7750  CB  LEU A 967     136.482 146.863 119.622  1.00  0.66           C  
ATOM   7751  CG  LEU A 967     135.486 145.921 120.336  1.00  0.66           C  
ATOM   7752  CD1 LEU A 967     136.065 144.510 120.516  1.00  0.66           C  
ATOM   7753  CD2 LEU A 967     135.051 146.462 121.703  1.00  0.66           C  
ATOM   7754  N   LYS A 968     137.432 150.136 119.555  1.00  0.65           N  
ATOM   7755  CA  LYS A 968     138.491 151.059 119.210  1.00  0.65           C  
ATOM   7756  C   LYS A 968     139.844 150.530 119.649  1.00  0.65           C  
ATOM   7757  O   LYS A 968     139.967 149.881 120.686  1.00  0.65           O  
ATOM   7758  CB  LYS A 968     138.257 152.435 119.880  1.00  0.65           C  
ATOM   7759  CG  LYS A 968     136.925 153.086 119.474  1.00  0.65           C  
ATOM   7760  CD  LYS A 968     136.700 154.425 120.191  1.00  0.65           C  
ATOM   7761  CE  LYS A 968     135.342 155.070 119.904  1.00  0.65           C  
ATOM   7762  NZ  LYS A 968     135.217 155.372 118.461  1.00  0.65           N  
ATOM   7763  N   ALA A 969     140.913 150.849 118.891  1.00  0.71           N  
ATOM   7764  CA  ALA A 969     142.261 150.364 119.132  1.00  0.71           C  
ATOM   7765  C   ALA A 969     142.798 150.639 120.541  1.00  0.71           C  
ATOM   7766  O   ALA A 969     143.370 149.768 121.194  1.00  0.71           O  
ATOM   7767  CB  ALA A 969     143.193 150.987 118.076  1.00  0.71           C  
ATOM   7768  N   GLY A 970     142.547 151.849 121.091  1.00  0.75           N  
ATOM   7769  CA  GLY A 970     142.928 152.172 122.463  1.00  0.75           C  
ATOM   7770  C   GLY A 970     142.126 151.487 123.538  1.00  0.75           C  
ATOM   7771  O   GLY A 970     142.582 151.344 124.668  1.00  0.75           O  
ATOM   7772  N   GLY A 971     140.912 151.002 123.211  1.00  0.78           N  
ATOM   7773  CA  GLY A 971     140.079 150.239 124.137  1.00  0.78           C  
ATOM   7774  C   GLY A 971     140.519 148.804 124.254  1.00  0.78           C  
ATOM   7775  O   GLY A 971     140.414 148.182 125.313  1.00  0.78           O  
ATOM   7776  N   ILE A 972     141.049 148.248 123.148  1.00  0.77           N  
ATOM   7777  CA  ILE A 972     141.721 146.956 123.126  1.00  0.77           C  
ATOM   7778  C   ILE A 972     143.025 146.999 123.914  1.00  0.77           C  
ATOM   7779  O   ILE A 972     143.266 146.191 124.813  1.00  0.77           O  
ATOM   7780  CB  ILE A 972     141.994 146.519 121.685  1.00  0.77           C  
ATOM   7781  CG1 ILE A 972     140.695 146.399 120.853  1.00  0.77           C  
ATOM   7782  CG2 ILE A 972     142.781 145.195 121.637  1.00  0.77           C  
ATOM   7783  CD1 ILE A 972     139.673 145.402 121.404  1.00  0.77           C  
ATOM   7784  N   LEU A 973     143.873 148.014 123.652  1.00  0.75           N  
ATOM   7785  CA  LEU A 973     145.122 148.216 124.369  1.00  0.75           C  
ATOM   7786  C   LEU A 973     144.957 148.469 125.863  1.00  0.75           C  
ATOM   7787  O   LEU A 973     145.730 147.948 126.663  1.00  0.75           O  
ATOM   7788  CB  LEU A 973     145.990 149.308 123.700  1.00  0.75           C  
ATOM   7789  CG  LEU A 973     147.186 148.742 122.903  1.00  0.75           C  
ATOM   7790  CD1 LEU A 973     146.775 147.776 121.785  1.00  0.75           C  
ATOM   7791  CD2 LEU A 973     148.016 149.892 122.327  1.00  0.75           C  
ATOM   7792  N   ASN A 974     143.921 149.226 126.295  1.00  0.77           N  
ATOM   7793  CA  ASN A 974     143.622 149.466 127.705  1.00  0.77           C  
ATOM   7794  C   ASN A 974     143.449 148.163 128.493  1.00  0.77           C  
ATOM   7795  O   ASN A 974     144.062 147.964 129.536  1.00  0.77           O  
ATOM   7796  CB  ASN A 974     142.327 150.335 127.782  1.00  0.77           C  
ATOM   7797  CG  ASN A 974     141.959 150.873 129.169  1.00  0.77           C  
ATOM   7798  OD1 ASN A 974     142.717 150.879 130.140  1.00  0.77           O  
ATOM   7799  ND2 ASN A 974     140.696 151.354 129.271  1.00  0.77           N  
ATOM   7800  N   ARG A 975     142.656 147.209 127.971  1.00  0.77           N  
ATOM   7801  CA  ARG A 975     142.500 145.906 128.596  1.00  0.77           C  
ATOM   7802  C   ARG A 975     143.735 144.993 128.534  1.00  0.77           C  
ATOM   7803  O   ARG A 975     144.149 144.414 129.536  1.00  0.77           O  
ATOM   7804  CB  ARG A 975     141.277 145.187 127.979  1.00  0.77           C  
ATOM   7805  CG  ARG A 975     139.923 145.748 128.465  1.00  0.77           C  
ATOM   7806  CD  ARG A 975     138.726 144.995 127.872  1.00  0.77           C  
ATOM   7807  NE  ARG A 975     137.459 145.491 128.509  1.00  0.77           N  
ATOM   7808  CZ  ARG A 975     136.841 146.645 128.204  1.00  0.77           C  
ATOM   7809  NH1 ARG A 975     137.287 147.479 127.272  1.00  0.77           N  
ATOM   7810  NH2 ARG A 975     135.765 147.007 128.901  1.00  0.77           N  
ATOM   7811  N   PHE A 976     144.392 144.853 127.363  1.00  0.80           N  
ATOM   7812  CA  PHE A 976     145.507 143.919 127.200  1.00  0.80           C  
ATOM   7813  C   PHE A 976     146.833 144.392 127.795  1.00  0.80           C  
ATOM   7814  O   PHE A 976     147.758 143.593 127.995  1.00  0.80           O  
ATOM   7815  CB  PHE A 976     145.749 143.606 125.700  1.00  0.80           C  
ATOM   7816  CG  PHE A 976     144.830 142.520 125.221  1.00  0.80           C  
ATOM   7817  CD1 PHE A 976     145.119 141.177 125.520  1.00  0.80           C  
ATOM   7818  CD2 PHE A 976     143.704 142.814 124.438  1.00  0.80           C  
ATOM   7819  CE1 PHE A 976     144.306 140.147 125.030  1.00  0.80           C  
ATOM   7820  CE2 PHE A 976     142.885 141.789 123.949  1.00  0.80           C  
ATOM   7821  CZ  PHE A 976     143.191 140.454 124.241  1.00  0.80           C  
ATOM   7822  N   SER A 977     146.952 145.702 128.085  1.00  0.83           N  
ATOM   7823  CA  SER A 977     148.095 146.285 128.776  1.00  0.83           C  
ATOM   7824  C   SER A 977     147.792 146.472 130.251  1.00  0.83           C  
ATOM   7825  O   SER A 977     148.411 145.846 131.109  1.00  0.83           O  
ATOM   7826  CB  SER A 977     148.490 147.662 128.153  1.00  0.83           C  
ATOM   7827  OG  SER A 977     149.633 148.264 128.771  1.00  0.83           O  
ATOM   7828  N   LYS A 978     146.812 147.335 130.598  1.00  0.78           N  
ATOM   7829  CA  LYS A 978     146.627 147.758 131.975  1.00  0.78           C  
ATOM   7830  C   LYS A 978     145.989 146.712 132.868  1.00  0.78           C  
ATOM   7831  O   LYS A 978     146.508 146.402 133.940  1.00  0.78           O  
ATOM   7832  CB  LYS A 978     145.773 149.051 132.031  1.00  0.78           C  
ATOM   7833  CG  LYS A 978     145.630 149.695 133.421  1.00  0.78           C  
ATOM   7834  CD  LYS A 978     146.959 150.189 134.006  1.00  0.78           C  
ATOM   7835  CE  LYS A 978     146.782 150.946 135.321  1.00  0.78           C  
ATOM   7836  NZ  LYS A 978     148.106 151.328 135.846  1.00  0.78           N  
ATOM   7837  N   ASP A 979     144.858 146.124 132.435  1.00  0.84           N  
ATOM   7838  CA  ASP A 979     144.110 145.172 133.231  1.00  0.84           C  
ATOM   7839  C   ASP A 979     144.915 143.878 133.477  1.00  0.84           C  
ATOM   7840  O   ASP A 979     144.967 143.379 134.598  1.00  0.84           O  
ATOM   7841  CB  ASP A 979     142.689 144.930 132.635  1.00  0.84           C  
ATOM   7842  CG  ASP A 979     141.781 146.162 132.604  1.00  0.84           C  
ATOM   7843  OD1 ASP A 979     142.181 147.292 132.987  1.00  0.84           O  
ATOM   7844  OD2 ASP A 979     140.609 145.992 132.166  1.00  0.84           O  
ATOM   7845  N   ILE A 980     145.639 143.352 132.457  1.00  0.83           N  
ATOM   7846  CA  ILE A 980     146.555 142.208 132.588  1.00  0.83           C  
ATOM   7847  C   ILE A 980     147.710 142.447 133.567  1.00  0.83           C  
ATOM   7848  O   ILE A 980     147.988 141.618 134.431  1.00  0.83           O  
ATOM   7849  CB  ILE A 980     147.087 141.771 131.215  1.00  0.83           C  
ATOM   7850  CG1 ILE A 980     145.928 141.324 130.289  1.00  0.83           C  
ATOM   7851  CG2 ILE A 980     148.163 140.663 131.318  1.00  0.83           C  
ATOM   7852  CD1 ILE A 980     145.134 140.106 130.780  1.00  0.83           C  
ATOM   7853  N   ALA A 981     148.377 143.621 133.519  1.00  0.84           N  
ATOM   7854  CA  ALA A 981     149.418 143.982 134.472  1.00  0.84           C  
ATOM   7855  C   ALA A 981     148.941 144.031 135.930  1.00  0.84           C  
ATOM   7856  O   ALA A 981     149.637 143.616 136.855  1.00  0.84           O  
ATOM   7857  CB  ALA A 981     150.026 145.336 134.063  1.00  0.84           C  
ATOM   7858  N   ILE A 982     147.702 144.511 136.170  1.00  0.82           N  
ATOM   7859  CA  ILE A 982     147.062 144.500 137.485  1.00  0.82           C  
ATOM   7860  C   ILE A 982     146.884 143.093 138.054  1.00  0.82           C  
ATOM   7861  O   ILE A 982     147.166 142.846 139.230  1.00  0.82           O  
ATOM   7862  CB  ILE A 982     145.719 145.245 137.446  1.00  0.82           C  
ATOM   7863  CG1 ILE A 982     145.971 146.752 137.203  1.00  0.82           C  
ATOM   7864  CG2 ILE A 982     144.919 145.016 138.747  1.00  0.82           C  
ATOM   7865  CD1 ILE A 982     144.704 147.590 137.005  1.00  0.82           C  
ATOM   7866  N   LEU A 983     146.433 142.133 137.221  1.00  0.84           N  
ATOM   7867  CA  LEU A 983     146.277 140.737 137.597  1.00  0.84           C  
ATOM   7868  C   LEU A 983     147.603 140.050 137.909  1.00  0.84           C  
ATOM   7869  O   LEU A 983     147.691 139.253 138.841  1.00  0.84           O  
ATOM   7870  CB  LEU A 983     145.508 139.933 136.518  1.00  0.84           C  
ATOM   7871  CG  LEU A 983     144.102 140.458 136.151  1.00  0.84           C  
ATOM   7872  CD1 LEU A 983     143.389 139.477 135.209  1.00  0.84           C  
ATOM   7873  CD2 LEU A 983     143.220 140.745 137.368  1.00  0.84           C  
ATOM   7874  N   ASP A 984     148.666 140.350 137.138  1.00  0.83           N  
ATOM   7875  CA  ASP A 984     149.995 139.811 137.355  1.00  0.83           C  
ATOM   7876  C   ASP A 984     150.727 140.420 138.584  1.00  0.83           C  
ATOM   7877  O   ASP A 984     151.252 139.696 139.434  1.00  0.83           O  
ATOM   7878  CB  ASP A 984     150.837 140.002 136.046  1.00  0.83           C  
ATOM   7879  CG  ASP A 984     150.398 139.141 134.861  1.00  0.83           C  
ATOM   7880  OD1 ASP A 984     149.611 138.181 135.035  1.00  0.83           O  
ATOM   7881  OD2 ASP A 984     150.888 139.384 133.725  1.00  0.83           O  
ATOM   7882  N   ASP A 985     150.773 141.769 138.737  1.00  0.82           N  
ATOM   7883  CA  ASP A 985     151.597 142.421 139.754  1.00  0.82           C  
ATOM   7884  C   ASP A 985     150.877 142.801 141.061  1.00  0.82           C  
ATOM   7885  O   ASP A 985     151.403 142.528 142.143  1.00  0.82           O  
ATOM   7886  CB  ASP A 985     152.311 143.691 139.184  1.00  0.82           C  
ATOM   7887  CG  ASP A 985     153.477 143.374 138.251  1.00  0.82           C  
ATOM   7888  OD1 ASP A 985     154.001 142.230 138.279  1.00  0.82           O  
ATOM   7889  OD2 ASP A 985     153.951 144.285 137.523  1.00  0.82           O  
ATOM   7890  N   LEU A 986     149.709 143.485 141.015  1.00  0.82           N  
ATOM   7891  CA  LEU A 986     149.050 144.036 142.201  1.00  0.82           C  
ATOM   7892  C   LEU A 986     148.145 143.046 142.908  1.00  0.82           C  
ATOM   7893  O   LEU A 986     148.225 142.858 144.121  1.00  0.82           O  
ATOM   7894  CB  LEU A 986     148.188 145.277 141.836  1.00  0.82           C  
ATOM   7895  CG  LEU A 986     148.978 146.451 141.228  1.00  0.82           C  
ATOM   7896  CD1 LEU A 986     148.031 147.577 140.794  1.00  0.82           C  
ATOM   7897  CD2 LEU A 986     150.028 147.004 142.198  1.00  0.82           C  
ATOM   7898  N   LEU A 987     147.263 142.360 142.157  1.00  0.84           N  
ATOM   7899  CA  LEU A 987     146.241 141.502 142.736  1.00  0.84           C  
ATOM   7900  C   LEU A 987     146.751 140.350 143.616  1.00  0.84           C  
ATOM   7901  O   LEU A 987     146.163 140.162 144.686  1.00  0.84           O  
ATOM   7902  CB  LEU A 987     145.255 141.014 141.642  1.00  0.84           C  
ATOM   7903  CG  LEU A 987     143.905 140.466 142.152  1.00  0.84           C  
ATOM   7904  CD1 LEU A 987     143.096 141.509 142.931  1.00  0.84           C  
ATOM   7905  CD2 LEU A 987     143.060 139.960 140.979  1.00  0.84           C  
ATOM   7906  N   PRO A 988     147.816 139.583 143.321  1.00  0.87           N  
ATOM   7907  CA  PRO A 988     148.287 138.520 144.208  1.00  0.87           C  
ATOM   7908  C   PRO A 988     148.697 138.974 145.599  1.00  0.87           C  
ATOM   7909  O   PRO A 988     148.397 138.294 146.578  1.00  0.87           O  
ATOM   7910  CB  PRO A 988     149.448 137.874 143.435  1.00  0.87           C  
ATOM   7911  CG  PRO A 988     149.102 138.127 141.968  1.00  0.87           C  
ATOM   7912  CD  PRO A 988     148.477 139.517 142.011  1.00  0.87           C  
ATOM   7913  N   LEU A 989     149.394 140.118 145.715  1.00  0.82           N  
ATOM   7914  CA  LEU A 989     149.806 140.659 146.996  1.00  0.82           C  
ATOM   7915  C   LEU A 989     148.683 141.305 147.783  1.00  0.82           C  
ATOM   7916  O   LEU A 989     148.564 141.100 148.990  1.00  0.82           O  
ATOM   7917  CB  LEU A 989     150.951 141.673 146.822  1.00  0.82           C  
ATOM   7918  CG  LEU A 989     152.270 141.044 146.344  1.00  0.82           C  
ATOM   7919  CD1 LEU A 989     153.310 142.146 146.166  1.00  0.82           C  
ATOM   7920  CD2 LEU A 989     152.808 139.968 147.298  1.00  0.82           C  
ATOM   7921  N   THR A 990     147.806 142.082 147.118  1.00  0.82           N  
ATOM   7922  CA  THR A 990     146.653 142.716 147.759  1.00  0.82           C  
ATOM   7923  C   THR A 990     145.690 141.693 148.347  1.00  0.82           C  
ATOM   7924  O   THR A 990     145.204 141.837 149.467  1.00  0.82           O  
ATOM   7925  CB  THR A 990     145.899 143.645 146.815  1.00  0.82           C  
ATOM   7926  OG1 THR A 990     146.803 144.544 146.191  1.00  0.82           O  
ATOM   7927  CG2 THR A 990     144.894 144.514 147.574  1.00  0.82           C  
ATOM   7928  N   ILE A 991     145.432 140.573 147.629  1.00  0.83           N  
ATOM   7929  CA  ILE A 991     144.687 139.438 148.175  1.00  0.83           C  
ATOM   7930  C   ILE A 991     145.374 138.801 149.384  1.00  0.83           C  
ATOM   7931  O   ILE A 991     144.732 138.539 150.400  1.00  0.83           O  
ATOM   7932  CB  ILE A 991     144.385 138.390 147.095  1.00  0.83           C  
ATOM   7933  CG1 ILE A 991     143.361 138.969 146.089  1.00  0.83           C  
ATOM   7934  CG2 ILE A 991     143.861 137.072 147.711  1.00  0.83           C  
ATOM   7935  CD1 ILE A 991     143.025 138.037 144.919  1.00  0.83           C  
ATOM   7936  N   PHE A 992     146.705 138.577 149.336  1.00  0.84           N  
ATOM   7937  CA  PHE A 992     147.460 138.023 150.456  1.00  0.84           C  
ATOM   7938  C   PHE A 992     147.370 138.863 151.742  1.00  0.84           C  
ATOM   7939  O   PHE A 992     147.093 138.323 152.813  1.00  0.84           O  
ATOM   7940  CB  PHE A 992     148.940 137.802 150.005  1.00  0.84           C  
ATOM   7941  CG  PHE A 992     149.886 137.465 151.131  1.00  0.84           C  
ATOM   7942  CD1 PHE A 992     149.848 136.217 151.774  1.00  0.84           C  
ATOM   7943  CD2 PHE A 992     150.771 138.448 151.604  1.00  0.84           C  
ATOM   7944  CE1 PHE A 992     150.656 135.967 152.891  1.00  0.84           C  
ATOM   7945  CE2 PHE A 992     151.577 138.204 152.722  1.00  0.84           C  
ATOM   7946  CZ  PHE A 992     151.512 136.965 153.370  1.00  0.84           C  
ATOM   7947  N   ASP A 993     147.551 140.202 151.660  1.00  0.83           N  
ATOM   7948  CA  ASP A 993     147.463 141.094 152.815  1.00  0.83           C  
ATOM   7949  C   ASP A 993     146.048 141.108 153.422  1.00  0.83           C  
ATOM   7950  O   ASP A 993     145.857 140.991 154.633  1.00  0.83           O  
ATOM   7951  CB  ASP A 993     147.972 142.518 152.418  1.00  0.83           C  
ATOM   7952  CG  ASP A 993     148.636 143.305 153.552  1.00  0.83           C  
ATOM   7953  OD1 ASP A 993     148.942 142.718 154.619  1.00  0.83           O  
ATOM   7954  OD2 ASP A 993     148.966 144.505 153.340  1.00  0.83           O  
ATOM   7955  N   PHE A 994     144.994 141.159 152.571  1.00  0.81           N  
ATOM   7956  CA  PHE A 994     143.603 141.039 152.997  1.00  0.81           C  
ATOM   7957  C   PHE A 994     143.279 139.720 153.714  1.00  0.81           C  
ATOM   7958  O   PHE A 994     142.673 139.719 154.787  1.00  0.81           O  
ATOM   7959  CB  PHE A 994     142.674 141.238 151.761  1.00  0.81           C  
ATOM   7960  CG  PHE A 994     141.210 141.071 152.088  1.00  0.81           C  
ATOM   7961  CD1 PHE A 994     140.581 141.928 153.005  1.00  0.81           C  
ATOM   7962  CD2 PHE A 994     140.488 139.990 151.555  1.00  0.81           C  
ATOM   7963  CE1 PHE A 994     139.265 141.682 153.418  1.00  0.81           C  
ATOM   7964  CE2 PHE A 994     139.165 139.755 151.948  1.00  0.81           C  
ATOM   7965  CZ  PHE A 994     138.555 140.599 152.885  1.00  0.81           C  
ATOM   7966  N   ILE A 995     143.711 138.562 153.165  1.00  0.83           N  
ATOM   7967  CA  ILE A 995     143.534 137.257 153.802  1.00  0.83           C  
ATOM   7968  C   ILE A 995     144.259 137.173 155.141  1.00  0.83           C  
ATOM   7969  O   ILE A 995     143.696 136.721 156.140  1.00  0.83           O  
ATOM   7970  CB  ILE A 995     143.948 136.109 152.871  1.00  0.83           C  
ATOM   7971  CG1 ILE A 995     142.966 136.030 151.676  1.00  0.83           C  
ATOM   7972  CG2 ILE A 995     144.003 134.759 153.624  1.00  0.83           C  
ATOM   7973  CD1 ILE A 995     143.304 134.955 150.636  1.00  0.83           C  
ATOM   7974  N   GLN A 996     145.516 137.661 155.218  1.00  0.83           N  
ATOM   7975  CA  GLN A 996     146.283 137.674 156.454  1.00  0.83           C  
ATOM   7976  C   GLN A 996     145.633 138.485 157.567  1.00  0.83           C  
ATOM   7977  O   GLN A 996     145.493 138.013 158.696  1.00  0.83           O  
ATOM   7978  CB  GLN A 996     147.704 138.234 156.202  1.00  0.83           C  
ATOM   7979  CG  GLN A 996     148.636 138.300 157.440  1.00  0.83           C  
ATOM   7980  CD  GLN A 996     148.994 136.931 158.021  1.00  0.83           C  
ATOM   7981  OE1 GLN A 996     149.976 136.302 157.626  1.00  0.83           O  
ATOM   7982  NE2 GLN A 996     148.199 136.458 159.009  1.00  0.83           N  
ATOM   7983  N   LEU A 997     145.170 139.714 157.269  1.00  0.84           N  
ATOM   7984  CA  LEU A 997     144.458 140.547 158.223  1.00  0.84           C  
ATOM   7985  C   LEU A 997     143.136 139.953 158.680  1.00  0.84           C  
ATOM   7986  O   LEU A 997     142.805 139.981 159.867  1.00  0.84           O  
ATOM   7987  CB  LEU A 997     144.204 141.957 157.642  1.00  0.84           C  
ATOM   7988  CG  LEU A 997     145.479 142.800 157.447  1.00  0.84           C  
ATOM   7989  CD1 LEU A 997     145.166 144.085 156.671  1.00  0.84           C  
ATOM   7990  CD2 LEU A 997     146.158 143.141 158.779  1.00  0.84           C  
ATOM   7991  N   LEU A 998     142.350 139.368 157.754  1.00  0.85           N  
ATOM   7992  CA  LEU A 998     141.079 138.747 158.083  1.00  0.85           C  
ATOM   7993  C   LEU A 998     141.202 137.565 159.044  1.00  0.85           C  
ATOM   7994  O   LEU A 998     140.486 137.477 160.040  1.00  0.85           O  
ATOM   7995  CB  LEU A 998     140.355 138.320 156.784  1.00  0.85           C  
ATOM   7996  CG  LEU A 998     138.858 137.989 156.943  1.00  0.85           C  
ATOM   7997  CD1 LEU A 998     138.049 139.195 157.439  1.00  0.85           C  
ATOM   7998  CD2 LEU A 998     138.272 137.483 155.619  1.00  0.85           C  
ATOM   7999  N   LEU A 999     142.184 136.668 158.814  1.00  0.85           N  
ATOM   8000  CA  LEU A 999     142.506 135.558 159.703  1.00  0.85           C  
ATOM   8001  C   LEU A 999     142.920 136.005 161.105  1.00  0.85           C  
ATOM   8002  O   LEU A 999     142.482 135.438 162.106  1.00  0.85           O  
ATOM   8003  CB  LEU A 999     143.623 134.683 159.076  1.00  0.85           C  
ATOM   8004  CG  LEU A 999     143.130 133.459 158.271  1.00  0.85           C  
ATOM   8005  CD1 LEU A 999     142.049 133.789 157.233  1.00  0.85           C  
ATOM   8006  CD2 LEU A 999     144.315 132.757 157.592  1.00  0.85           C  
ATOM   8007  N   ILE A1000     143.743 137.070 161.224  1.00  0.84           N  
ATOM   8008  CA  ILE A1000     144.126 137.641 162.514  1.00  0.84           C  
ATOM   8009  C   ILE A1000     142.931 138.154 163.310  1.00  0.84           C  
ATOM   8010  O   ILE A1000     142.778 137.841 164.490  1.00  0.84           O  
ATOM   8011  CB  ILE A1000     145.171 138.749 162.347  1.00  0.84           C  
ATOM   8012  CG1 ILE A1000     146.480 138.149 161.788  1.00  0.84           C  
ATOM   8013  CG2 ILE A1000     145.447 139.472 163.685  1.00  0.84           C  
ATOM   8014  CD1 ILE A1000     147.514 139.196 161.363  1.00  0.84           C  
ATOM   8015  N   VAL A1001     142.014 138.919 162.678  1.00  0.83           N  
ATOM   8016  CA  VAL A1001     140.809 139.402 163.347  1.00  0.83           C  
ATOM   8017  C   VAL A1001     139.871 138.275 163.765  1.00  0.83           C  
ATOM   8018  O   VAL A1001     139.424 138.219 164.911  1.00  0.83           O  
ATOM   8019  CB  VAL A1001     140.056 140.426 162.500  1.00  0.83           C  
ATOM   8020  CG1 VAL A1001     138.758 140.873 163.199  1.00  0.83           C  
ATOM   8021  CG2 VAL A1001     140.954 141.654 162.279  1.00  0.83           C  
ATOM   8022  N   ILE A1002     139.597 137.305 162.866  1.00  0.81           N  
ATOM   8023  CA  ILE A1002     138.749 136.151 163.159  1.00  0.81           C  
ATOM   8024  C   ILE A1002     139.309 135.305 164.297  1.00  0.81           C  
ATOM   8025  O   ILE A1002     138.596 134.932 165.230  1.00  0.81           O  
ATOM   8026  CB  ILE A1002     138.520 135.304 161.898  1.00  0.81           C  
ATOM   8027  CG1 ILE A1002     137.635 136.086 160.897  1.00  0.81           C  
ATOM   8028  CG2 ILE A1002     137.882 133.936 162.236  1.00  0.81           C  
ATOM   8029  CD1 ILE A1002     137.442 135.393 159.543  1.00  0.81           C  
ATOM   8030  N   GLY A1003     140.629 135.025 164.282  1.00  0.85           N  
ATOM   8031  CA  GLY A1003     141.272 134.219 165.313  1.00  0.85           C  
ATOM   8032  C   GLY A1003     141.368 134.896 166.650  1.00  0.85           C  
ATOM   8033  O   GLY A1003     141.194 134.263 167.688  1.00  0.85           O  
ATOM   8034  N   ALA A1004     141.620 136.216 166.679  1.00  0.85           N  
ATOM   8035  CA  ALA A1004     141.619 136.978 167.911  1.00  0.85           C  
ATOM   8036  C   ALA A1004     140.261 137.010 168.608  1.00  0.85           C  
ATOM   8037  O   ALA A1004     140.172 136.747 169.806  1.00  0.85           O  
ATOM   8038  CB  ALA A1004     142.094 138.413 167.628  1.00  0.85           C  
ATOM   8039  N   ILE A1005     139.162 137.272 167.860  1.00  0.79           N  
ATOM   8040  CA  ILE A1005     137.801 137.251 168.398  1.00  0.79           C  
ATOM   8041  C   ILE A1005     137.395 135.865 168.871  1.00  0.79           C  
ATOM   8042  O   ILE A1005     136.873 135.704 169.973  1.00  0.79           O  
ATOM   8043  CB  ILE A1005     136.761 137.789 167.407  1.00  0.79           C  
ATOM   8044  CG1 ILE A1005     137.086 139.250 167.025  1.00  0.79           C  
ATOM   8045  CG2 ILE A1005     135.337 137.710 168.006  1.00  0.79           C  
ATOM   8046  CD1 ILE A1005     136.192 139.834 165.925  1.00  0.79           C  
ATOM   8047  N   ALA A1006     137.668 134.813 168.073  1.00  0.83           N  
ATOM   8048  CA  ALA A1006     137.307 133.451 168.414  1.00  0.83           C  
ATOM   8049  C   ALA A1006     137.939 132.943 169.707  1.00  0.83           C  
ATOM   8050  O   ALA A1006     137.259 132.356 170.545  1.00  0.83           O  
ATOM   8051  CB  ALA A1006     137.678 132.521 167.245  1.00  0.83           C  
ATOM   8052  N   VAL A1007     139.247 133.203 169.922  1.00  0.80           N  
ATOM   8053  CA  VAL A1007     139.954 132.823 171.141  1.00  0.80           C  
ATOM   8054  C   VAL A1007     139.433 133.504 172.395  1.00  0.80           C  
ATOM   8055  O   VAL A1007     139.208 132.868 173.425  1.00  0.80           O  
ATOM   8056  CB  VAL A1007     141.459 133.060 170.994  1.00  0.80           C  
ATOM   8057  CG1 VAL A1007     142.231 132.847 172.312  1.00  0.80           C  
ATOM   8058  CG2 VAL A1007     141.991 132.083 169.934  1.00  0.80           C  
ATOM   8059  N   VAL A1008     139.198 134.828 172.350  1.00  0.77           N  
ATOM   8060  CA  VAL A1008     138.740 135.550 173.528  1.00  0.77           C  
ATOM   8061  C   VAL A1008     137.263 135.328 173.822  1.00  0.77           C  
ATOM   8062  O   VAL A1008     136.845 135.360 174.972  1.00  0.77           O  
ATOM   8063  CB  VAL A1008     139.084 137.036 173.487  1.00  0.77           C  
ATOM   8064  CG1 VAL A1008     140.607 137.191 173.296  1.00  0.77           C  
ATOM   8065  CG2 VAL A1008     138.307 137.762 172.380  1.00  0.77           C  
ATOM   8066  N   ALA A1009     136.426 135.055 172.799  1.00  0.82           N  
ATOM   8067  CA  ALA A1009     135.003 134.821 172.964  1.00  0.82           C  
ATOM   8068  C   ALA A1009     134.638 133.584 173.771  1.00  0.82           C  
ATOM   8069  O   ALA A1009     133.755 133.618 174.620  1.00  0.82           O  
ATOM   8070  CB  ALA A1009     134.340 134.718 171.580  1.00  0.82           C  
ATOM   8071  N   VAL A1010     135.314 132.449 173.529  1.00  0.78           N  
ATOM   8072  CA  VAL A1010     135.107 131.223 174.287  1.00  0.78           C  
ATOM   8073  C   VAL A1010     135.552 131.318 175.747  1.00  0.78           C  
ATOM   8074  O   VAL A1010     134.854 130.869 176.653  1.00  0.78           O  
ATOM   8075  CB  VAL A1010     135.720 130.036 173.552  1.00  0.78           C  
ATOM   8076  CG1 VAL A1010     137.196 130.286 173.226  1.00  0.78           C  
ATOM   8077  CG2 VAL A1010     135.513 128.714 174.312  1.00  0.78           C  
ATOM   8078  N   LEU A1011     136.718 131.936 176.030  1.00  0.76           N  
ATOM   8079  CA  LEU A1011     137.180 132.137 177.397  1.00  0.76           C  
ATOM   8080  C   LEU A1011     136.434 133.257 178.131  1.00  0.76           C  
ATOM   8081  O   LEU A1011     136.270 133.213 179.350  1.00  0.76           O  
ATOM   8082  CB  LEU A1011     138.714 132.380 177.466  1.00  0.76           C  
ATOM   8083  CG  LEU A1011     139.586 131.099 177.494  1.00  0.76           C  
ATOM   8084  CD1 LEU A1011     139.724 130.412 176.130  1.00  0.76           C  
ATOM   8085  CD2 LEU A1011     140.983 131.394 178.063  1.00  0.76           C  
ATOM   8086  N   GLN A1012     135.976 134.301 177.415  1.00  0.73           N  
ATOM   8087  CA  GLN A1012     135.288 135.443 177.993  1.00  0.73           C  
ATOM   8088  C   GLN A1012     134.132 135.909 177.099  1.00  0.73           C  
ATOM   8089  O   GLN A1012     134.313 136.822 176.283  1.00  0.73           O  
ATOM   8090  CB  GLN A1012     136.274 136.623 178.189  1.00  0.73           C  
ATOM   8091  CG  GLN A1012     137.313 136.386 179.308  1.00  0.73           C  
ATOM   8092  CD  GLN A1012     138.253 137.580 179.473  1.00  0.73           C  
ATOM   8093  OE1 GLN A1012     138.522 138.353 178.557  1.00  0.73           O  
ATOM   8094  NE2 GLN A1012     138.784 137.745 180.709  1.00  0.73           N  
ATOM   8095  N   PRO A1013     132.909 135.377 177.222  1.00  0.77           N  
ATOM   8096  CA  PRO A1013     131.856 135.568 176.216  1.00  0.77           C  
ATOM   8097  C   PRO A1013     131.107 136.887 176.365  1.00  0.77           C  
ATOM   8098  O   PRO A1013     129.896 136.949 176.175  1.00  0.77           O  
ATOM   8099  CB  PRO A1013     130.953 134.337 176.427  1.00  0.77           C  
ATOM   8100  CG  PRO A1013     131.124 133.973 177.900  1.00  0.77           C  
ATOM   8101  CD  PRO A1013     132.597 134.280 178.146  1.00  0.77           C  
ATOM   8102  N   TYR A1014     131.843 137.983 176.601  1.00  0.71           N  
ATOM   8103  CA  TYR A1014     131.326 139.335 176.639  1.00  0.71           C  
ATOM   8104  C   TYR A1014     132.109 140.246 175.706  1.00  0.71           C  
ATOM   8105  O   TYR A1014     131.576 141.243 175.227  1.00  0.71           O  
ATOM   8106  CB  TYR A1014     131.372 139.930 178.076  1.00  0.71           C  
ATOM   8107  CG  TYR A1014     130.255 139.424 178.959  1.00  0.71           C  
ATOM   8108  CD1 TYR A1014     128.929 139.370 178.489  1.00  0.71           C  
ATOM   8109  CD2 TYR A1014     130.506 139.066 180.298  1.00  0.71           C  
ATOM   8110  CE1 TYR A1014     127.890 138.930 179.319  1.00  0.71           C  
ATOM   8111  CE2 TYR A1014     129.462 138.641 181.136  1.00  0.71           C  
ATOM   8112  CZ  TYR A1014     128.155 138.567 180.640  1.00  0.71           C  
ATOM   8113  OH  TYR A1014     127.091 138.144 181.461  1.00  0.71           O  
ATOM   8114  N   ILE A1015     133.372 139.915 175.347  1.00  0.70           N  
ATOM   8115  CA  ILE A1015     134.136 140.663 174.344  1.00  0.70           C  
ATOM   8116  C   ILE A1015     133.487 140.550 172.969  1.00  0.70           C  
ATOM   8117  O   ILE A1015     133.338 141.530 172.242  1.00  0.70           O  
ATOM   8118  CB  ILE A1015     135.612 140.255 174.306  1.00  0.70           C  
ATOM   8119  CG1 ILE A1015     136.381 140.815 175.526  1.00  0.70           C  
ATOM   8120  CG2 ILE A1015     136.303 140.781 173.027  1.00  0.70           C  
ATOM   8121  CD1 ILE A1015     136.235 140.006 176.814  1.00  0.70           C  
ATOM   8122  N   PHE A1016     133.012 139.338 172.612  1.00  0.75           N  
ATOM   8123  CA  PHE A1016     132.227 139.104 171.410  1.00  0.75           C  
ATOM   8124  C   PHE A1016     130.936 139.925 171.383  1.00  0.75           C  
ATOM   8125  O   PHE A1016     130.600 140.523 170.371  1.00  0.75           O  
ATOM   8126  CB  PHE A1016     131.944 137.584 171.256  1.00  0.75           C  
ATOM   8127  CG  PHE A1016     131.054 137.263 170.081  1.00  0.75           C  
ATOM   8128  CD1 PHE A1016     131.491 137.474 168.763  1.00  0.75           C  
ATOM   8129  CD2 PHE A1016     129.743 136.810 170.302  1.00  0.75           C  
ATOM   8130  CE1 PHE A1016     130.624 137.256 167.684  1.00  0.75           C  
ATOM   8131  CE2 PHE A1016     128.873 136.594 169.227  1.00  0.75           C  
ATOM   8132  CZ  PHE A1016     129.314 136.819 167.917  1.00  0.75           C  
ATOM   8133  N   VAL A1017     130.205 140.018 172.507  1.00  0.77           N  
ATOM   8134  CA  VAL A1017     129.011 140.847 172.611  1.00  0.77           C  
ATOM   8135  C   VAL A1017     129.306 142.342 172.463  1.00  0.77           C  
ATOM   8136  O   VAL A1017     128.642 143.064 171.721  1.00  0.77           O  
ATOM   8137  CB  VAL A1017     128.287 140.562 173.924  1.00  0.77           C  
ATOM   8138  CG1 VAL A1017     126.991 141.384 174.028  1.00  0.77           C  
ATOM   8139  CG2 VAL A1017     127.954 139.059 174.002  1.00  0.77           C  
ATOM   8140  N   ALA A1018     130.367 142.837 173.131  1.00  0.77           N  
ATOM   8141  CA  ALA A1018     130.763 144.233 173.131  1.00  0.77           C  
ATOM   8142  C   ALA A1018     131.252 144.760 171.787  1.00  0.77           C  
ATOM   8143  O   ALA A1018     131.173 145.952 171.502  1.00  0.77           O  
ATOM   8144  CB  ALA A1018     131.871 144.431 174.182  1.00  0.77           C  
ATOM   8145  N   THR A1019     131.777 143.874 170.921  1.00  0.71           N  
ATOM   8146  CA  THR A1019     132.324 144.270 169.627  1.00  0.71           C  
ATOM   8147  C   THR A1019     131.281 144.329 168.509  1.00  0.71           C  
ATOM   8148  O   THR A1019     131.489 144.969 167.478  1.00  0.71           O  
ATOM   8149  CB  THR A1019     133.508 143.387 169.241  1.00  0.71           C  
ATOM   8150  OG1 THR A1019     134.225 143.917 168.148  1.00  0.71           O  
ATOM   8151  CG2 THR A1019     133.103 141.968 168.848  1.00  0.71           C  
ATOM   8152  N   VAL A1020     130.076 143.736 168.701  1.00  0.79           N  
ATOM   8153  CA  VAL A1020     129.008 143.719 167.690  1.00  0.79           C  
ATOM   8154  C   VAL A1020     128.583 145.101 167.182  1.00  0.79           C  
ATOM   8155  O   VAL A1020     128.497 145.239 165.958  1.00  0.79           O  
ATOM   8156  CB  VAL A1020     127.769 142.910 168.118  1.00  0.79           C  
ATOM   8157  CG1 VAL A1020     126.653 142.939 167.052  1.00  0.79           C  
ATOM   8158  CG2 VAL A1020     128.164 141.447 168.362  1.00  0.79           C  
ATOM   8159  N   PRO A1021     128.360 146.166 167.972  1.00  0.85           N  
ATOM   8160  CA  PRO A1021     128.029 147.491 167.446  1.00  0.85           C  
ATOM   8161  C   PRO A1021     129.088 148.089 166.538  1.00  0.85           C  
ATOM   8162  O   PRO A1021     128.746 148.812 165.605  1.00  0.85           O  
ATOM   8163  CB  PRO A1021     127.823 148.350 168.704  1.00  0.85           C  
ATOM   8164  CG  PRO A1021     127.405 147.348 169.779  1.00  0.85           C  
ATOM   8165  CD  PRO A1021     128.250 146.129 169.436  1.00  0.85           C  
ATOM   8166  N   VAL A1022     130.378 147.823 166.805  1.00  0.79           N  
ATOM   8167  CA  VAL A1022     131.474 148.324 165.994  1.00  0.79           C  
ATOM   8168  C   VAL A1022     131.577 147.592 164.660  1.00  0.79           C  
ATOM   8169  O   VAL A1022     131.699 148.205 163.598  1.00  0.79           O  
ATOM   8170  CB  VAL A1022     132.809 148.255 166.731  1.00  0.79           C  
ATOM   8171  CG1 VAL A1022     133.850 149.102 165.977  1.00  0.79           C  
ATOM   8172  CG2 VAL A1022     132.659 148.779 168.172  1.00  0.79           C  
ATOM   8173  N   ILE A1023     131.470 146.242 164.676  1.00  0.76           N  
ATOM   8174  CA  ILE A1023     131.509 145.414 163.471  1.00  0.76           C  
ATOM   8175  C   ILE A1023     130.376 145.745 162.505  1.00  0.76           C  
ATOM   8176  O   ILE A1023     130.602 145.965 161.314  1.00  0.76           O  
ATOM   8177  CB  ILE A1023     131.492 143.914 163.808  1.00  0.76           C  
ATOM   8178  CG1 ILE A1023     132.757 143.530 164.610  1.00  0.76           C  
ATOM   8179  CG2 ILE A1023     131.381 143.057 162.525  1.00  0.76           C  
ATOM   8180  CD1 ILE A1023     132.816 142.065 165.060  1.00  0.76           C  
ATOM   8181  N   VAL A1024     129.123 145.852 162.999  1.00  0.79           N  
ATOM   8182  CA  VAL A1024     127.974 146.193 162.163  1.00  0.79           C  
ATOM   8183  C   VAL A1024     128.084 147.578 161.525  1.00  0.79           C  
ATOM   8184  O   VAL A1024     127.791 147.756 160.343  1.00  0.79           O  
ATOM   8185  CB  VAL A1024     126.641 145.971 162.881  1.00  0.79           C  
ATOM   8186  CG1 VAL A1024     126.424 146.958 164.035  1.00  0.79           C  
ATOM   8187  CG2 VAL A1024     125.470 146.036 161.886  1.00  0.79           C  
ATOM   8188  N   ALA A1025     128.587 148.584 162.273  1.00  0.82           N  
ATOM   8189  CA  ALA A1025     128.807 149.932 161.784  1.00  0.82           C  
ATOM   8190  C   ALA A1025     129.787 150.016 160.613  1.00  0.82           C  
ATOM   8191  O   ALA A1025     129.533 150.675 159.603  1.00  0.82           O  
ATOM   8192  CB  ALA A1025     129.307 150.794 162.958  1.00  0.82           C  
ATOM   8193  N   PHE A1026     130.920 149.292 160.701  1.00  0.78           N  
ATOM   8194  CA  PHE A1026     131.881 149.171 159.618  1.00  0.78           C  
ATOM   8195  C   PHE A1026     131.324 148.476 158.372  1.00  0.78           C  
ATOM   8196  O   PHE A1026     131.542 148.924 157.245  1.00  0.78           O  
ATOM   8197  CB  PHE A1026     133.152 148.426 160.111  1.00  0.78           C  
ATOM   8198  CG  PHE A1026     134.005 149.188 161.104  1.00  0.78           C  
ATOM   8199  CD1 PHE A1026     133.906 150.576 161.328  1.00  0.78           C  
ATOM   8200  CD2 PHE A1026     134.996 148.472 161.801  1.00  0.78           C  
ATOM   8201  CE1 PHE A1026     134.777 151.226 162.212  1.00  0.78           C  
ATOM   8202  CE2 PHE A1026     135.863 149.114 162.694  1.00  0.78           C  
ATOM   8203  CZ  PHE A1026     135.754 150.495 162.895  1.00  0.78           C  
ATOM   8204  N   ILE A1027     130.562 147.373 158.534  1.00  0.74           N  
ATOM   8205  CA  ILE A1027     129.915 146.675 157.424  1.00  0.74           C  
ATOM   8206  C   ILE A1027     128.856 147.521 156.716  1.00  0.74           C  
ATOM   8207  O   ILE A1027     128.838 147.610 155.486  1.00  0.74           O  
ATOM   8208  CB  ILE A1027     129.332 145.333 157.874  1.00  0.74           C  
ATOM   8209  CG1 ILE A1027     130.467 144.413 158.386  1.00  0.74           C  
ATOM   8210  CG2 ILE A1027     128.563 144.650 156.721  1.00  0.74           C  
ATOM   8211  CD1 ILE A1027     129.975 143.121 159.044  1.00  0.74           C  
ATOM   8212  N   MET A1028     127.973 148.209 157.471  1.00  0.74           N  
ATOM   8213  CA  MET A1028     126.951 149.083 156.908  1.00  0.74           C  
ATOM   8214  C   MET A1028     127.515 150.256 156.113  1.00  0.74           C  
ATOM   8215  O   MET A1028     127.069 150.542 155.001  1.00  0.74           O  
ATOM   8216  CB  MET A1028     126.022 149.641 158.014  1.00  0.74           C  
ATOM   8217  CG  MET A1028     125.017 148.612 158.566  1.00  0.74           C  
ATOM   8218  SD  MET A1028     123.877 149.322 159.792  1.00  0.74           S  
ATOM   8219  CE  MET A1028     122.782 147.876 159.885  1.00  0.74           C  
ATOM   8220  N   LEU A1029     128.553 150.945 156.636  1.00  0.79           N  
ATOM   8221  CA  LEU A1029     129.209 152.022 155.907  1.00  0.79           C  
ATOM   8222  C   LEU A1029     129.889 151.550 154.625  1.00  0.79           C  
ATOM   8223  O   LEU A1029     129.811 152.196 153.579  1.00  0.79           O  
ATOM   8224  CB  LEU A1029     130.229 152.782 156.791  1.00  0.79           C  
ATOM   8225  CG  LEU A1029     130.797 154.066 156.140  1.00  0.79           C  
ATOM   8226  CD1 LEU A1029     129.715 155.113 155.848  1.00  0.79           C  
ATOM   8227  CD2 LEU A1029     131.906 154.695 156.989  1.00  0.79           C  
ATOM   8228  N   ARG A1030     130.548 150.372 154.665  1.00  0.74           N  
ATOM   8229  CA  ARG A1030     131.158 149.751 153.501  1.00  0.74           C  
ATOM   8230  C   ARG A1030     130.159 149.447 152.390  1.00  0.74           C  
ATOM   8231  O   ARG A1030     130.396 149.768 151.229  1.00  0.74           O  
ATOM   8232  CB  ARG A1030     131.882 148.447 153.935  1.00  0.74           C  
ATOM   8233  CG  ARG A1030     132.648 147.717 152.811  1.00  0.74           C  
ATOM   8234  CD  ARG A1030     133.348 146.430 153.268  1.00  0.74           C  
ATOM   8235  NE  ARG A1030     134.018 145.812 152.075  1.00  0.74           N  
ATOM   8236  CZ  ARG A1030     133.439 144.992 151.187  1.00  0.74           C  
ATOM   8237  NH1 ARG A1030     132.148 144.687 151.234  1.00  0.74           N  
ATOM   8238  NH2 ARG A1030     134.188 144.479 150.214  1.00  0.74           N  
ATOM   8239  N   ALA A1031     128.988 148.872 152.726  1.00  0.78           N  
ATOM   8240  CA  ALA A1031     127.922 148.626 151.770  1.00  0.78           C  
ATOM   8241  C   ALA A1031     127.360 149.897 151.127  1.00  0.78           C  
ATOM   8242  O   ALA A1031     127.168 149.962 149.915  1.00  0.78           O  
ATOM   8243  CB  ALA A1031     126.801 147.827 152.458  1.00  0.78           C  
ATOM   8244  N   TYR A1032     127.140 150.962 151.928  1.00  0.77           N  
ATOM   8245  CA  TYR A1032     126.716 152.264 151.431  1.00  0.77           C  
ATOM   8246  C   TYR A1032     127.718 152.913 150.469  1.00  0.77           C  
ATOM   8247  O   TYR A1032     127.363 153.379 149.388  1.00  0.77           O  
ATOM   8248  CB  TYR A1032     126.480 153.196 152.655  1.00  0.77           C  
ATOM   8249  CG  TYR A1032     125.914 154.542 152.274  1.00  0.77           C  
ATOM   8250  CD1 TYR A1032     124.530 154.723 152.128  1.00  0.77           C  
ATOM   8251  CD2 TYR A1032     126.772 155.631 152.040  1.00  0.77           C  
ATOM   8252  CE1 TYR A1032     124.012 155.969 151.744  1.00  0.77           C  
ATOM   8253  CE2 TYR A1032     126.257 156.873 151.643  1.00  0.77           C  
ATOM   8254  CZ  TYR A1032     124.875 157.041 151.499  1.00  0.77           C  
ATOM   8255  OH  TYR A1032     124.359 158.289 151.096  1.00  0.77           O  
ATOM   8256  N   PHE A1033     129.016 152.936 150.839  1.00  0.79           N  
ATOM   8257  CA  PHE A1033     130.080 153.510 150.031  1.00  0.79           C  
ATOM   8258  C   PHE A1033     130.292 152.792 148.711  1.00  0.79           C  
ATOM   8259  O   PHE A1033     130.486 153.423 147.667  1.00  0.79           O  
ATOM   8260  CB  PHE A1033     131.401 153.511 150.850  1.00  0.79           C  
ATOM   8261  CG  PHE A1033     132.614 153.947 150.061  1.00  0.79           C  
ATOM   8262  CD1 PHE A1033     132.683 155.229 149.491  1.00  0.79           C  
ATOM   8263  CD2 PHE A1033     133.662 153.040 149.832  1.00  0.79           C  
ATOM   8264  CE1 PHE A1033     133.782 155.595 148.703  1.00  0.79           C  
ATOM   8265  CE2 PHE A1033     134.765 153.406 149.053  1.00  0.79           C  
ATOM   8266  CZ  PHE A1033     134.824 154.685 148.488  1.00  0.79           C  
ATOM   8267  N   LEU A1034     130.264 151.445 148.735  1.00  0.76           N  
ATOM   8268  CA  LEU A1034     130.559 150.641 147.571  1.00  0.76           C  
ATOM   8269  C   LEU A1034     129.665 150.952 146.379  1.00  0.76           C  
ATOM   8270  O   LEU A1034     130.200 151.174 145.292  1.00  0.76           O  
ATOM   8271  CB  LEU A1034     130.665 149.141 147.932  1.00  0.76           C  
ATOM   8272  CG  LEU A1034     132.021 148.778 148.591  1.00  0.76           C  
ATOM   8273  CD1 LEU A1034     132.067 147.294 148.957  1.00  0.76           C  
ATOM   8274  CD2 LEU A1034     133.250 149.101 147.726  1.00  0.76           C  
ATOM   8275  N   GLN A1035     128.336 151.146 146.583  1.00  0.71           N  
ATOM   8276  CA  GLN A1035     127.353 151.491 145.558  1.00  0.71           C  
ATOM   8277  C   GLN A1035     127.777 152.611 144.614  1.00  0.71           C  
ATOM   8278  O   GLN A1035     127.568 152.556 143.402  1.00  0.71           O  
ATOM   8279  CB  GLN A1035     126.018 151.949 146.214  1.00  0.71           C  
ATOM   8280  CG  GLN A1035     125.174 150.808 146.816  1.00  0.71           C  
ATOM   8281  CD  GLN A1035     124.755 149.787 145.763  1.00  0.71           C  
ATOM   8282  OE1 GLN A1035     124.872 148.590 145.965  1.00  0.71           O  
ATOM   8283  NE2 GLN A1035     124.257 150.250 144.595  1.00  0.71           N  
ATOM   8284  N   THR A1036     128.408 153.656 145.171  1.00  0.79           N  
ATOM   8285  CA  THR A1036     128.951 154.776 144.414  1.00  0.79           C  
ATOM   8286  C   THR A1036     130.376 154.537 143.930  1.00  0.79           C  
ATOM   8287  O   THR A1036     130.709 154.844 142.783  1.00  0.79           O  
ATOM   8288  CB  THR A1036     128.889 156.067 145.217  1.00  0.79           C  
ATOM   8289  OG1 THR A1036     127.551 156.277 145.647  1.00  0.79           O  
ATOM   8290  CG2 THR A1036     129.254 157.274 144.347  1.00  0.79           C  
ATOM   8291  N   SER A1037     131.267 153.953 144.770  1.00  0.83           N  
ATOM   8292  CA  SER A1037     132.701 153.771 144.483  1.00  0.83           C  
ATOM   8293  C   SER A1037     132.958 152.975 143.211  1.00  0.83           C  
ATOM   8294  O   SER A1037     133.750 153.323 142.335  1.00  0.83           O  
ATOM   8295  CB  SER A1037     133.395 153.002 145.648  1.00  0.83           C  
ATOM   8296  OG  SER A1037     134.810 152.899 145.472  1.00  0.83           O  
ATOM   8297  N   GLN A1038     132.200 151.884 143.079  1.00  0.75           N  
ATOM   8298  CA  GLN A1038     132.250 150.917 142.016  1.00  0.75           C  
ATOM   8299  C   GLN A1038     131.859 151.457 140.642  1.00  0.75           C  
ATOM   8300  O   GLN A1038     132.443 151.100 139.615  1.00  0.75           O  
ATOM   8301  CB  GLN A1038     131.337 149.770 142.487  1.00  0.75           C  
ATOM   8302  CG  GLN A1038     131.959 148.999 143.722  1.00  0.75           C  
ATOM   8303  CD  GLN A1038     130.885 148.044 144.361  1.00  0.75           C  
ATOM   8304  OE1 GLN A1038     129.789 148.270 144.238  1.00  0.75           O  
ATOM   8305  NE2 GLN A1038     131.332 146.965 145.088  1.00  0.75           N  
ATOM   8306  N   GLN A1039     130.851 152.348 140.593  1.00  0.72           N  
ATOM   8307  CA  GLN A1039     130.478 153.085 139.401  1.00  0.72           C  
ATOM   8308  C   GLN A1039     131.547 154.082 138.965  1.00  0.72           C  
ATOM   8309  O   GLN A1039     131.934 154.121 137.799  1.00  0.72           O  
ATOM   8310  CB  GLN A1039     129.129 153.806 139.625  1.00  0.72           C  
ATOM   8311  CG  GLN A1039     127.986 152.845 140.035  1.00  0.72           C  
ATOM   8312  CD  GLN A1039     126.617 153.534 140.026  1.00  0.72           C  
ATOM   8313  OE1 GLN A1039     126.171 154.029 138.987  1.00  0.72           O  
ATOM   8314  NE2 GLN A1039     125.924 153.547 141.186  1.00  0.72           N  
ATOM   8315  N   LEU A1040     132.111 154.862 139.910  1.00  0.81           N  
ATOM   8316  CA  LEU A1040     133.195 155.796 139.635  1.00  0.81           C  
ATOM   8317  C   LEU A1040     134.461 155.120 139.124  1.00  0.81           C  
ATOM   8318  O   LEU A1040     135.083 155.567 138.162  1.00  0.81           O  
ATOM   8319  CB  LEU A1040     133.536 156.632 140.893  1.00  0.81           C  
ATOM   8320  CG  LEU A1040     132.447 157.639 141.314  1.00  0.81           C  
ATOM   8321  CD1 LEU A1040     132.807 158.282 142.660  1.00  0.81           C  
ATOM   8322  CD2 LEU A1040     132.236 158.729 140.255  1.00  0.81           C  
ATOM   8323  N   LYS A1041     134.852 153.977 139.723  1.00  0.78           N  
ATOM   8324  CA  LYS A1041     135.978 153.194 139.247  1.00  0.78           C  
ATOM   8325  C   LYS A1041     135.815 152.641 137.828  1.00  0.78           C  
ATOM   8326  O   LYS A1041     136.751 152.618 137.029  1.00  0.78           O  
ATOM   8327  CB  LYS A1041     136.293 152.038 140.226  1.00  0.78           C  
ATOM   8328  CG  LYS A1041     137.624 151.317 139.944  1.00  0.78           C  
ATOM   8329  CD  LYS A1041     138.837 152.250 140.042  1.00  0.78           C  
ATOM   8330  CE  LYS A1041     140.160 151.587 139.674  1.00  0.78           C  
ATOM   8331  NZ  LYS A1041     141.208 152.615 139.707  1.00  0.78           N  
ATOM   8332  N   GLN A1042     134.596 152.190 137.467  1.00  0.75           N  
ATOM   8333  CA  GLN A1042     134.255 151.772 136.116  1.00  0.75           C  
ATOM   8334  C   GLN A1042     134.394 152.887 135.081  1.00  0.75           C  
ATOM   8335  O   GLN A1042     135.005 152.700 134.028  1.00  0.75           O  
ATOM   8336  CB  GLN A1042     132.805 151.217 136.124  1.00  0.75           C  
ATOM   8337  CG  GLN A1042     132.258 150.783 134.742  1.00  0.75           C  
ATOM   8338  CD  GLN A1042     130.867 150.138 134.772  1.00  0.75           C  
ATOM   8339  OE1 GLN A1042     130.366 149.692 133.740  1.00  0.75           O  
ATOM   8340  NE2 GLN A1042     130.232 150.036 135.962  1.00  0.75           N  
ATOM   8341  N   LEU A1043     133.880 154.091 135.397  1.00  0.78           N  
ATOM   8342  CA  LEU A1043     134.025 155.290 134.584  1.00  0.78           C  
ATOM   8343  C   LEU A1043     135.484 155.732 134.428  1.00  0.78           C  
ATOM   8344  O   LEU A1043     135.934 156.054 133.330  1.00  0.78           O  
ATOM   8345  CB  LEU A1043     133.174 156.436 135.192  1.00  0.78           C  
ATOM   8346  CG  LEU A1043     131.716 156.541 134.683  1.00  0.78           C  
ATOM   8347  CD1 LEU A1043     130.924 155.227 134.717  1.00  0.78           C  
ATOM   8348  CD2 LEU A1043     130.963 157.623 135.470  1.00  0.78           C  
ATOM   8349  N   GLU A1044     136.287 155.712 135.515  1.00  0.79           N  
ATOM   8350  CA  GLU A1044     137.721 155.987 135.451  1.00  0.79           C  
ATOM   8351  C   GLU A1044     138.506 155.022 134.576  1.00  0.79           C  
ATOM   8352  O   GLU A1044     139.264 155.429 133.697  1.00  0.79           O  
ATOM   8353  CB  GLU A1044     138.343 155.990 136.868  1.00  0.79           C  
ATOM   8354  CG  GLU A1044     139.843 156.400 136.921  1.00  0.79           C  
ATOM   8355  CD  GLU A1044     140.872 155.289 137.080  1.00  0.79           C  
ATOM   8356  OE1 GLU A1044     140.747 154.494 138.044  1.00  0.79           O  
ATOM   8357  OE2 GLU A1044     141.847 155.218 136.280  1.00  0.79           O  
ATOM   8358  N   SER A1045     138.273 153.704 134.730  1.00  0.81           N  
ATOM   8359  CA  SER A1045     138.909 152.681 133.907  1.00  0.81           C  
ATOM   8360  C   SER A1045     138.599 152.792 132.430  1.00  0.81           C  
ATOM   8361  O   SER A1045     139.460 152.552 131.583  1.00  0.81           O  
ATOM   8362  CB  SER A1045     138.551 151.240 134.342  1.00  0.81           C  
ATOM   8363  OG  SER A1045     139.241 150.873 135.539  1.00  0.81           O  
ATOM   8364  N   GLU A1046     137.359 153.166 132.064  1.00  0.76           N  
ATOM   8365  CA  GLU A1046     137.018 153.371 130.668  1.00  0.76           C  
ATOM   8366  C   GLU A1046     137.516 154.709 130.115  1.00  0.76           C  
ATOM   8367  O   GLU A1046     137.736 154.879 128.916  1.00  0.76           O  
ATOM   8368  CB  GLU A1046     135.499 153.173 130.464  1.00  0.76           C  
ATOM   8369  CG  GLU A1046     135.140 152.594 129.070  1.00  0.76           C  
ATOM   8370  CD  GLU A1046     135.810 151.250 128.785  1.00  0.76           C  
ATOM   8371  OE1 GLU A1046     135.604 150.280 129.577  1.00  0.76           O  
ATOM   8372  OE2 GLU A1046     136.591 151.132 127.801  1.00  0.76           O  
ATOM   8373  N   GLY A1047     137.827 155.674 131.009  1.00  0.85           N  
ATOM   8374  CA  GLY A1047     138.365 156.986 130.660  1.00  0.85           C  
ATOM   8375  C   GLY A1047     139.820 156.983 130.266  1.00  0.85           C  
ATOM   8376  O   GLY A1047     140.355 157.988 129.810  1.00  0.85           O  
ATOM   8377  N   ARG A1048     140.501 155.833 130.402  1.00  0.76           N  
ATOM   8378  CA  ARG A1048     141.851 155.635 129.906  1.00  0.76           C  
ATOM   8379  C   ARG A1048     141.901 155.326 128.410  1.00  0.76           C  
ATOM   8380  O   ARG A1048     142.881 155.614 127.724  1.00  0.76           O  
ATOM   8381  CB  ARG A1048     142.529 154.469 130.663  1.00  0.76           C  
ATOM   8382  CG  ARG A1048     142.455 154.591 132.198  1.00  0.76           C  
ATOM   8383  CD  ARG A1048     143.329 153.574 132.940  1.00  0.76           C  
ATOM   8384  NE  ARG A1048     142.759 152.200 132.759  1.00  0.76           N  
ATOM   8385  CZ  ARG A1048     142.302 151.428 133.753  1.00  0.76           C  
ATOM   8386  NH1 ARG A1048     142.200 151.862 135.009  1.00  0.76           N  
ATOM   8387  NH2 ARG A1048     141.928 150.180 133.472  1.00  0.76           N  
ATOM   8388  N   SER A1049     140.818 154.751 127.847  1.00  0.80           N  
ATOM   8389  CA  SER A1049     140.740 154.353 126.443  1.00  0.80           C  
ATOM   8390  C   SER A1049     140.916 155.488 125.422  1.00  0.80           C  
ATOM   8391  O   SER A1049     141.617 155.260 124.431  1.00  0.80           O  
ATOM   8392  CB  SER A1049     139.433 153.562 126.120  1.00  0.80           C  
ATOM   8393  OG  SER A1049     139.273 152.421 126.975  1.00  0.80           O  
ATOM   8394  N   PRO A1050     140.381 156.715 125.549  1.00  0.83           N  
ATOM   8395  CA  PRO A1050     140.655 157.805 124.609  1.00  0.83           C  
ATOM   8396  C   PRO A1050     142.113 158.227 124.534  1.00  0.83           C  
ATOM   8397  O   PRO A1050     142.568 158.602 123.455  1.00  0.83           O  
ATOM   8398  CB  PRO A1050     139.758 158.956 125.095  1.00  0.83           C  
ATOM   8399  CG  PRO A1050     138.618 158.258 125.836  1.00  0.83           C  
ATOM   8400  CD  PRO A1050     139.327 157.088 126.500  1.00  0.83           C  
ATOM   8401  N   ILE A1051     142.858 158.178 125.660  1.00  0.83           N  
ATOM   8402  CA  ILE A1051     144.268 158.554 125.727  1.00  0.83           C  
ATOM   8403  C   ILE A1051     145.122 157.648 124.848  1.00  0.83           C  
ATOM   8404  O   ILE A1051     145.920 158.099 124.026  1.00  0.83           O  
ATOM   8405  CB  ILE A1051     144.782 158.524 127.176  1.00  0.83           C  
ATOM   8406  CG1 ILE A1051     143.938 159.458 128.082  1.00  0.83           C  
ATOM   8407  CG2 ILE A1051     146.278 158.909 127.226  1.00  0.83           C  
ATOM   8408  CD1 ILE A1051     144.344 159.461 129.562  1.00  0.83           C  
ATOM   8409  N   PHE A1052     144.912 156.322 124.956  1.00  0.80           N  
ATOM   8410  CA  PHE A1052     145.569 155.341 124.111  1.00  0.80           C  
ATOM   8411  C   PHE A1052     145.152 155.424 122.644  1.00  0.80           C  
ATOM   8412  O   PHE A1052     145.993 155.342 121.752  1.00  0.80           O  
ATOM   8413  CB  PHE A1052     145.371 153.902 124.656  1.00  0.80           C  
ATOM   8414  CG  PHE A1052     145.908 153.721 126.058  1.00  0.80           C  
ATOM   8415  CD1 PHE A1052     147.118 154.303 126.488  1.00  0.80           C  
ATOM   8416  CD2 PHE A1052     145.190 152.923 126.965  1.00  0.80           C  
ATOM   8417  CE1 PHE A1052     147.571 154.125 127.802  1.00  0.80           C  
ATOM   8418  CE2 PHE A1052     145.642 152.737 128.278  1.00  0.80           C  
ATOM   8419  CZ  PHE A1052     146.831 153.345 128.698  1.00  0.80           C  
ATOM   8420  N   THR A1053     143.849 155.637 122.340  1.00  0.80           N  
ATOM   8421  CA  THR A1053     143.355 155.794 120.962  1.00  0.80           C  
ATOM   8422  C   THR A1053     144.002 156.966 120.245  1.00  0.80           C  
ATOM   8423  O   THR A1053     144.446 156.846 119.104  1.00  0.80           O  
ATOM   8424  CB  THR A1053     141.835 155.990 120.891  1.00  0.80           C  
ATOM   8425  OG1 THR A1053     141.152 154.831 121.357  1.00  0.80           O  
ATOM   8426  CG2 THR A1053     141.329 156.216 119.457  1.00  0.80           C  
ATOM   8427  N   HIS A1054     144.114 158.130 120.920  1.00  0.81           N  
ATOM   8428  CA  HIS A1054     144.775 159.308 120.371  1.00  0.81           C  
ATOM   8429  C   HIS A1054     146.267 159.110 120.101  1.00  0.81           C  
ATOM   8430  O   HIS A1054     146.810 159.557 119.093  1.00  0.81           O  
ATOM   8431  CB  HIS A1054     144.566 160.538 121.275  1.00  0.81           C  
ATOM   8432  CG  HIS A1054     144.846 161.832 120.569  1.00  0.81           C  
ATOM   8433  ND1 HIS A1054     143.909 162.319 119.678  1.00  0.81           N  
ATOM   8434  CD2 HIS A1054     145.898 162.685 120.655  1.00  0.81           C  
ATOM   8435  CE1 HIS A1054     144.403 163.460 119.247  1.00  0.81           C  
ATOM   8436  NE2 HIS A1054     145.601 163.735 119.812  1.00  0.81           N  
ATOM   8437  N   LEU A1055     146.967 158.400 121.004  1.00  0.82           N  
ATOM   8438  CA  LEU A1055     148.369 158.047 120.850  1.00  0.82           C  
ATOM   8439  C   LEU A1055     148.686 157.127 119.665  1.00  0.82           C  
ATOM   8440  O   LEU A1055     149.686 157.296 118.972  1.00  0.82           O  
ATOM   8441  CB  LEU A1055     148.870 157.414 122.169  1.00  0.82           C  
ATOM   8442  CG  LEU A1055     150.400 157.321 122.329  1.00  0.82           C  
ATOM   8443  CD1 LEU A1055     151.075 158.700 122.314  1.00  0.82           C  
ATOM   8444  CD2 LEU A1055     150.740 156.588 123.631  1.00  0.82           C  
ATOM   8445  N   VAL A1056     147.835 156.115 119.393  1.00  0.80           N  
ATOM   8446  CA  VAL A1056     147.993 155.231 118.238  1.00  0.80           C  
ATOM   8447  C   VAL A1056     147.834 155.949 116.897  1.00  0.80           C  
ATOM   8448  O   VAL A1056     148.662 155.814 115.995  1.00  0.80           O  
ATOM   8449  CB  VAL A1056     147.008 154.063 118.327  1.00  0.80           C  
ATOM   8450  CG1 VAL A1056     147.021 153.188 117.059  1.00  0.80           C  
ATOM   8451  CG2 VAL A1056     147.372 153.190 119.540  1.00  0.80           C  
ATOM   8452  N   THR A1057     146.773 156.772 116.743  1.00  0.80           N  
ATOM   8453  CA  THR A1057     146.485 157.502 115.501  1.00  0.80           C  
ATOM   8454  C   THR A1057     147.556 158.515 115.128  1.00  0.80           C  
ATOM   8455  O   THR A1057     147.980 158.603 113.974  1.00  0.80           O  
ATOM   8456  CB  THR A1057     145.080 158.116 115.485  1.00  0.80           C  
ATOM   8457  OG1 THR A1057     144.750 158.718 114.241  1.00  0.80           O  
ATOM   8458  CG2 THR A1057     144.856 159.168 116.572  1.00  0.80           C  
ATOM   8459  N   SER A1058     148.081 159.268 116.118  1.00  0.83           N  
ATOM   8460  CA  SER A1058     149.106 160.283 115.909  1.00  0.83           C  
ATOM   8461  C   SER A1058     150.410 159.753 115.343  1.00  0.83           C  
ATOM   8462  O   SER A1058     151.001 160.356 114.450  1.00  0.83           O  
ATOM   8463  CB  SER A1058     149.392 161.100 117.196  1.00  0.83           C  
ATOM   8464  OG  SER A1058     149.984 160.315 118.230  1.00  0.83           O  
ATOM   8465  N   LEU A1059     150.875 158.587 115.822  1.00  0.81           N  
ATOM   8466  CA  LEU A1059     152.031 157.905 115.269  1.00  0.81           C  
ATOM   8467  C   LEU A1059     151.851 157.412 113.838  1.00  0.81           C  
ATOM   8468  O   LEU A1059     152.717 157.616 112.990  1.00  0.81           O  
ATOM   8469  CB  LEU A1059     152.446 156.732 116.181  1.00  0.81           C  
ATOM   8470  CG  LEU A1059     153.013 157.179 117.541  1.00  0.81           C  
ATOM   8471  CD1 LEU A1059     153.372 155.952 118.377  1.00  0.81           C  
ATOM   8472  CD2 LEU A1059     154.249 158.078 117.405  1.00  0.81           C  
ATOM   8473  N   LYS A1060     150.695 156.798 113.509  1.00  0.77           N  
ATOM   8474  CA  LYS A1060     150.397 156.289 112.174  1.00  0.77           C  
ATOM   8475  C   LYS A1060     150.327 157.382 111.112  1.00  0.77           C  
ATOM   8476  O   LYS A1060     150.657 157.171 109.947  1.00  0.77           O  
ATOM   8477  CB  LYS A1060     149.064 155.488 112.173  1.00  0.77           C  
ATOM   8478  CG  LYS A1060     149.124 154.212 113.031  1.00  0.77           C  
ATOM   8479  CD  LYS A1060     147.772 153.520 113.315  1.00  0.77           C  
ATOM   8480  CE  LYS A1060     147.030 152.915 112.119  1.00  0.77           C  
ATOM   8481  NZ  LYS A1060     146.145 153.925 111.522  1.00  0.77           N  
ATOM   8482  N   GLY A1061     149.871 158.585 111.506  1.00  0.81           N  
ATOM   8483  CA  GLY A1061     149.741 159.738 110.627  1.00  0.81           C  
ATOM   8484  C   GLY A1061     150.813 160.786 110.767  1.00  0.81           C  
ATOM   8485  O   GLY A1061     150.641 161.895 110.266  1.00  0.81           O  
ATOM   8486  N   LEU A1062     151.941 160.505 111.454  1.00  0.81           N  
ATOM   8487  CA  LEU A1062     152.903 161.516 111.899  1.00  0.81           C  
ATOM   8488  C   LEU A1062     153.473 162.419 110.802  1.00  0.81           C  
ATOM   8489  O   LEU A1062     153.526 163.642 110.936  1.00  0.81           O  
ATOM   8490  CB  LEU A1062     154.071 160.835 112.665  1.00  0.81           C  
ATOM   8491  CG  LEU A1062     155.114 161.785 113.297  1.00  0.81           C  
ATOM   8492  CD1 LEU A1062     154.482 162.793 114.262  1.00  0.81           C  
ATOM   8493  CD2 LEU A1062     156.210 160.995 114.025  1.00  0.81           C  
ATOM   8494  N   TRP A1063     153.862 161.839 109.652  1.00  0.76           N  
ATOM   8495  CA  TRP A1063     154.319 162.573 108.481  1.00  0.76           C  
ATOM   8496  C   TRP A1063     153.239 163.476 107.879  1.00  0.76           C  
ATOM   8497  O   TRP A1063     153.476 164.632 107.533  1.00  0.76           O  
ATOM   8498  CB  TRP A1063     154.872 161.567 107.437  1.00  0.76           C  
ATOM   8499  CG  TRP A1063     156.116 160.811 107.894  1.00  0.76           C  
ATOM   8500  CD1 TRP A1063     156.900 161.043 108.993  1.00  0.76           C  
ATOM   8501  CD2 TRP A1063     156.751 159.732 107.176  1.00  0.76           C  
ATOM   8502  NE1 TRP A1063     157.960 160.167 109.027  1.00  0.76           N  
ATOM   8503  CE2 TRP A1063     157.896 159.365 107.914  1.00  0.76           C  
ATOM   8504  CE3 TRP A1063     156.435 159.097 105.975  1.00  0.76           C  
ATOM   8505  CZ2 TRP A1063     158.751 158.366 107.465  1.00  0.76           C  
ATOM   8506  CZ3 TRP A1063     157.299 158.084 105.524  1.00  0.76           C  
ATOM   8507  CH2 TRP A1063     158.442 157.728 106.254  1.00  0.76           C  
ATOM   8508  N   THR A1064     151.985 162.986 107.801  1.00  0.78           N  
ATOM   8509  CA  THR A1064     150.817 163.764 107.383  1.00  0.78           C  
ATOM   8510  C   THR A1064     150.511 164.919 108.329  1.00  0.78           C  
ATOM   8511  O   THR A1064     150.222 166.036 107.906  1.00  0.78           O  
ATOM   8512  CB  THR A1064     149.564 162.906 107.205  1.00  0.78           C  
ATOM   8513  OG1 THR A1064     149.870 161.776 106.397  1.00  0.78           O  
ATOM   8514  CG2 THR A1064     148.467 163.685 106.465  1.00  0.78           C  
ATOM   8515  N   LEU A1065     150.618 164.707 109.656  1.00  0.79           N  
ATOM   8516  CA  LEU A1065     150.470 165.756 110.662  1.00  0.79           C  
ATOM   8517  C   LEU A1065     151.457 166.904 110.496  1.00  0.79           C  
ATOM   8518  O   LEU A1065     151.076 168.074 110.532  1.00  0.79           O  
ATOM   8519  CB  LEU A1065     150.669 165.165 112.084  1.00  0.79           C  
ATOM   8520  CG  LEU A1065     149.377 164.839 112.851  1.00  0.79           C  
ATOM   8521  CD1 LEU A1065     148.419 163.965 112.049  1.00  0.79           C  
ATOM   8522  CD2 LEU A1065     149.711 164.148 114.178  1.00  0.79           C  
ATOM   8523  N   ARG A1066     152.751 166.588 110.287  1.00  0.75           N  
ATOM   8524  CA  ARG A1066     153.768 167.589 110.024  1.00  0.75           C  
ATOM   8525  C   ARG A1066     153.612 168.322 108.700  1.00  0.75           C  
ATOM   8526  O   ARG A1066     153.725 169.544 108.648  1.00  0.75           O  
ATOM   8527  CB  ARG A1066     155.190 166.996 110.138  1.00  0.75           C  
ATOM   8528  CG  ARG A1066     155.517 166.509 111.562  1.00  0.75           C  
ATOM   8529  CD  ARG A1066     157.012 166.553 111.880  1.00  0.75           C  
ATOM   8530  NE  ARG A1066     157.644 165.299 111.364  1.00  0.75           N  
ATOM   8531  CZ  ARG A1066     158.128 164.344 112.165  1.00  0.75           C  
ATOM   8532  NH1 ARG A1066     157.940 164.339 113.483  1.00  0.75           N  
ATOM   8533  NH2 ARG A1066     158.846 163.354 111.653  1.00  0.75           N  
ATOM   8534  N   ALA A1067     153.303 167.604 107.604  1.00  0.83           N  
ATOM   8535  CA  ALA A1067     153.122 168.177 106.282  1.00  0.83           C  
ATOM   8536  C   ALA A1067     151.992 169.200 106.169  1.00  0.83           C  
ATOM   8537  O   ALA A1067     152.097 170.208 105.471  1.00  0.83           O  
ATOM   8538  CB  ALA A1067     152.871 167.033 105.285  1.00  0.83           C  
ATOM   8539  N   PHE A1068     150.867 168.960 106.868  1.00  0.74           N  
ATOM   8540  CA  PHE A1068     149.720 169.850 106.826  1.00  0.74           C  
ATOM   8541  C   PHE A1068     149.708 170.837 107.990  1.00  0.74           C  
ATOM   8542  O   PHE A1068     148.831 171.694 108.064  1.00  0.74           O  
ATOM   8543  CB  PHE A1068     148.393 169.042 106.827  1.00  0.74           C  
ATOM   8544  CG  PHE A1068     148.144 168.400 105.484  1.00  0.74           C  
ATOM   8545  CD1 PHE A1068     148.793 167.211 105.112  1.00  0.74           C  
ATOM   8546  CD2 PHE A1068     147.246 168.985 104.575  1.00  0.74           C  
ATOM   8547  CE1 PHE A1068     148.569 166.627 103.861  1.00  0.74           C  
ATOM   8548  CE2 PHE A1068     147.031 168.418 103.312  1.00  0.74           C  
ATOM   8549  CZ  PHE A1068     147.692 167.235 102.958  1.00  0.74           C  
ATOM   8550  N   GLY A1069     150.702 170.775 108.906  1.00  0.78           N  
ATOM   8551  CA  GLY A1069     150.872 171.742 109.994  1.00  0.78           C  
ATOM   8552  C   GLY A1069     149.827 171.694 111.077  1.00  0.78           C  
ATOM   8553  O   GLY A1069     149.500 172.697 111.705  1.00  0.78           O  
ATOM   8554  N   ARG A1070     149.256 170.508 111.342  1.00  0.74           N  
ATOM   8555  CA  ARG A1070     148.123 170.394 112.239  1.00  0.74           C  
ATOM   8556  C   ARG A1070     148.482 170.012 113.651  1.00  0.74           C  
ATOM   8557  O   ARG A1070     147.605 169.639 114.433  1.00  0.74           O  
ATOM   8558  CB  ARG A1070     147.100 169.368 111.737  1.00  0.74           C  
ATOM   8559  CG  ARG A1070     146.447 169.814 110.429  1.00  0.74           C  
ATOM   8560  CD  ARG A1070     145.087 169.160 110.228  1.00  0.74           C  
ATOM   8561  NE  ARG A1070     144.125 169.753 111.220  1.00  0.74           N  
ATOM   8562  CZ  ARG A1070     142.907 169.240 111.432  1.00  0.74           C  
ATOM   8563  NH1 ARG A1070     142.592 168.027 111.007  1.00  0.74           N  
ATOM   8564  NH2 ARG A1070     142.010 169.965 112.086  1.00  0.74           N  
ATOM   8565  N   GLN A1071     149.757 170.128 114.047  1.00  0.80           N  
ATOM   8566  CA  GLN A1071     150.183 169.817 115.398  1.00  0.80           C  
ATOM   8567  C   GLN A1071     149.400 170.531 116.513  1.00  0.80           C  
ATOM   8568  O   GLN A1071     148.972 169.812 117.419  1.00  0.80           O  
ATOM   8569  CB  GLN A1071     151.710 170.024 115.586  1.00  0.80           C  
ATOM   8570  CG  GLN A1071     152.591 169.130 114.674  1.00  0.80           C  
ATOM   8571  CD  GLN A1071     153.031 169.858 113.402  1.00  0.80           C  
ATOM   8572  OE1 GLN A1071     152.263 170.576 112.769  1.00  0.80           O  
ATOM   8573  NE2 GLN A1071     154.314 169.679 113.006  1.00  0.80           N  
ATOM   8574  N   PRO A1072     149.075 171.838 116.506  1.00  0.84           N  
ATOM   8575  CA  PRO A1072     148.294 172.458 117.580  1.00  0.84           C  
ATOM   8576  C   PRO A1072     146.912 171.860 117.767  1.00  0.84           C  
ATOM   8577  O   PRO A1072     146.425 171.774 118.889  1.00  0.84           O  
ATOM   8578  CB  PRO A1072     148.209 173.942 117.181  1.00  0.84           C  
ATOM   8579  CG  PRO A1072     149.421 174.168 116.276  1.00  0.84           C  
ATOM   8580  CD  PRO A1072     149.553 172.840 115.541  1.00  0.84           C  
ATOM   8581  N   TYR A1073     146.248 171.432 116.674  1.00  0.80           N  
ATOM   8582  CA  TYR A1073     144.946 170.790 116.731  1.00  0.80           C  
ATOM   8583  C   TYR A1073     144.999 169.457 117.483  1.00  0.80           C  
ATOM   8584  O   TYR A1073     144.191 169.176 118.368  1.00  0.80           O  
ATOM   8585  CB  TYR A1073     144.424 170.607 115.272  1.00  0.80           C  
ATOM   8586  CG  TYR A1073     143.075 169.937 115.207  1.00  0.80           C  
ATOM   8587  CD1 TYR A1073     141.916 170.653 115.539  1.00  0.80           C  
ATOM   8588  CD2 TYR A1073     142.963 168.579 114.852  1.00  0.80           C  
ATOM   8589  CE1 TYR A1073     140.672 170.009 115.568  1.00  0.80           C  
ATOM   8590  CE2 TYR A1073     141.713 167.937 114.865  1.00  0.80           C  
ATOM   8591  CZ  TYR A1073     140.570 168.654 115.245  1.00  0.80           C  
ATOM   8592  OH  TYR A1073     139.300 168.060 115.372  1.00  0.80           O  
ATOM   8593  N   PHE A1074     146.001 168.619 117.163  1.00  0.83           N  
ATOM   8594  CA  PHE A1074     146.224 167.340 117.814  1.00  0.83           C  
ATOM   8595  C   PHE A1074     146.632 167.442 119.277  1.00  0.83           C  
ATOM   8596  O   PHE A1074     146.223 166.613 120.092  1.00  0.83           O  
ATOM   8597  CB  PHE A1074     147.259 166.489 117.038  1.00  0.83           C  
ATOM   8598  CG  PHE A1074     146.572 165.737 115.939  1.00  0.83           C  
ATOM   8599  CD1 PHE A1074     146.302 166.353 114.707  1.00  0.83           C  
ATOM   8600  CD2 PHE A1074     146.167 164.406 116.144  1.00  0.83           C  
ATOM   8601  CE1 PHE A1074     145.636 165.653 113.695  1.00  0.83           C  
ATOM   8602  CE2 PHE A1074     145.507 163.700 115.136  1.00  0.83           C  
ATOM   8603  CZ  PHE A1074     145.255 164.323 113.915  1.00  0.83           C  
ATOM   8604  N   GLU A1075     147.444 168.450 119.650  1.00  0.83           N  
ATOM   8605  CA  GLU A1075     147.785 168.742 121.036  1.00  0.83           C  
ATOM   8606  C   GLU A1075     146.561 169.097 121.892  1.00  0.83           C  
ATOM   8607  O   GLU A1075     146.341 168.521 122.958  1.00  0.83           O  
ATOM   8608  CB  GLU A1075     148.844 169.874 121.087  1.00  0.83           C  
ATOM   8609  CG  GLU A1075     150.232 169.453 120.536  1.00  0.83           C  
ATOM   8610  CD  GLU A1075     151.302 170.546 120.606  1.00  0.83           C  
ATOM   8611  OE1 GLU A1075     151.094 171.575 121.302  1.00  0.83           O  
ATOM   8612  OE2 GLU A1075     152.386 170.317 120.008  1.00  0.83           O  
ATOM   8613  N   THR A1076     145.673 169.983 121.392  1.00  0.83           N  
ATOM   8614  CA  THR A1076     144.400 170.344 122.030  1.00  0.83           C  
ATOM   8615  C   THR A1076     143.444 169.171 122.204  1.00  0.83           C  
ATOM   8616  O   THR A1076     142.744 169.035 123.209  1.00  0.83           O  
ATOM   8617  CB  THR A1076     143.666 171.439 121.257  1.00  0.83           C  
ATOM   8618  OG1 THR A1076     144.506 172.572 121.127  1.00  0.83           O  
ATOM   8619  CG2 THR A1076     142.415 171.928 122.002  1.00  0.83           C  
ATOM   8620  N   LEU A1077     143.358 168.259 121.217  1.00  0.83           N  
ATOM   8621  CA  LEU A1077     142.607 167.015 121.349  1.00  0.83           C  
ATOM   8622  C   LEU A1077     143.145 166.082 122.436  1.00  0.83           C  
ATOM   8623  O   LEU A1077     142.378 165.511 123.209  1.00  0.83           O  
ATOM   8624  CB  LEU A1077     142.508 166.286 119.989  1.00  0.83           C  
ATOM   8625  CG  LEU A1077     141.242 166.625 119.169  1.00  0.83           C  
ATOM   8626  CD1 LEU A1077     141.030 168.122 118.911  1.00  0.83           C  
ATOM   8627  CD2 LEU A1077     141.267 165.877 117.831  1.00  0.83           C  
ATOM   8628  N   PHE A1078     144.479 165.950 122.568  1.00  0.86           N  
ATOM   8629  CA  PHE A1078     145.100 165.194 123.648  1.00  0.86           C  
ATOM   8630  C   PHE A1078     144.777 165.739 125.046  1.00  0.86           C  
ATOM   8631  O   PHE A1078     144.485 164.990 125.978  1.00  0.86           O  
ATOM   8632  CB  PHE A1078     146.630 165.140 123.413  1.00  0.86           C  
ATOM   8633  CG  PHE A1078     147.308 164.162 124.331  1.00  0.86           C  
ATOM   8634  CD1 PHE A1078     147.076 162.785 124.189  1.00  0.86           C  
ATOM   8635  CD2 PHE A1078     148.169 164.612 125.345  1.00  0.86           C  
ATOM   8636  CE1 PHE A1078     147.690 161.868 125.050  1.00  0.86           C  
ATOM   8637  CE2 PHE A1078     148.784 163.697 126.209  1.00  0.86           C  
ATOM   8638  CZ  PHE A1078     148.542 162.325 126.063  1.00  0.86           C  
ATOM   8639  N   HIS A1079     144.765 167.076 125.217  1.00  0.86           N  
ATOM   8640  CA  HIS A1079     144.335 167.719 126.454  1.00  0.86           C  
ATOM   8641  C   HIS A1079     142.891 167.422 126.847  1.00  0.86           C  
ATOM   8642  O   HIS A1079     142.588 167.230 128.022  1.00  0.86           O  
ATOM   8643  CB  HIS A1079     144.592 169.237 126.423  1.00  0.86           C  
ATOM   8644  CG  HIS A1079     146.057 169.556 126.398  1.00  0.86           C  
ATOM   8645  ND1 HIS A1079     146.455 170.872 126.352  1.00  0.86           N  
ATOM   8646  CD2 HIS A1079     147.147 168.747 126.451  1.00  0.86           C  
ATOM   8647  CE1 HIS A1079     147.762 170.850 126.376  1.00  0.86           C  
ATOM   8648  NE2 HIS A1079     148.243 169.585 126.433  1.00  0.86           N  
ATOM   8649  N   LYS A1080     141.960 167.303 125.875  1.00  0.82           N  
ATOM   8650  CA  LYS A1080     140.610 166.820 126.146  1.00  0.82           C  
ATOM   8651  C   LYS A1080     140.560 165.410 126.729  1.00  0.82           C  
ATOM   8652  O   LYS A1080     139.841 165.158 127.693  1.00  0.82           O  
ATOM   8653  CB  LYS A1080     139.721 166.832 124.880  1.00  0.82           C  
ATOM   8654  CG  LYS A1080     139.433 168.235 124.332  1.00  0.82           C  
ATOM   8655  CD  LYS A1080     138.316 168.196 123.278  1.00  0.82           C  
ATOM   8656  CE  LYS A1080     137.961 169.557 122.683  1.00  0.82           C  
ATOM   8657  NZ  LYS A1080     139.111 170.064 121.907  1.00  0.82           N  
ATOM   8658  N   ALA A1081     141.355 164.466 126.186  1.00  0.88           N  
ATOM   8659  CA  ALA A1081     141.467 163.119 126.718  1.00  0.88           C  
ATOM   8660  C   ALA A1081     142.012 163.076 128.148  1.00  0.88           C  
ATOM   8661  O   ALA A1081     141.483 162.380 129.016  1.00  0.88           O  
ATOM   8662  CB  ALA A1081     142.341 162.270 125.775  1.00  0.88           C  
ATOM   8663  N   LEU A1082     143.059 163.877 128.444  1.00  0.87           N  
ATOM   8664  CA  LEU A1082     143.572 164.038 129.796  1.00  0.87           C  
ATOM   8665  C   LEU A1082     142.568 164.639 130.776  1.00  0.87           C  
ATOM   8666  O   LEU A1082     142.330 164.083 131.845  1.00  0.87           O  
ATOM   8667  CB  LEU A1082     144.834 164.939 129.804  1.00  0.87           C  
ATOM   8668  CG  LEU A1082     146.083 164.331 129.138  1.00  0.87           C  
ATOM   8669  CD1 LEU A1082     147.211 165.371 129.085  1.00  0.87           C  
ATOM   8670  CD2 LEU A1082     146.568 163.069 129.863  1.00  0.87           C  
ATOM   8671  N   ASN A1083     141.899 165.754 130.412  1.00  0.86           N  
ATOM   8672  CA  ASN A1083     140.892 166.404 131.242  1.00  0.86           C  
ATOM   8673  C   ASN A1083     139.696 165.483 131.531  1.00  0.86           C  
ATOM   8674  O   ASN A1083     139.182 165.434 132.649  1.00  0.86           O  
ATOM   8675  CB  ASN A1083     140.424 167.745 130.599  1.00  0.86           C  
ATOM   8676  CG  ASN A1083     141.547 168.795 130.599  1.00  0.86           C  
ATOM   8677  OD1 ASN A1083     142.489 168.744 131.388  1.00  0.86           O  
ATOM   8678  ND2 ASN A1083     141.423 169.817 129.716  1.00  0.86           N  
ATOM   8679  N   LEU A1084     139.254 164.690 130.531  1.00  0.83           N  
ATOM   8680  CA  LEU A1084     138.212 163.684 130.689  1.00  0.83           C  
ATOM   8681  C   LEU A1084     138.549 162.562 131.675  1.00  0.83           C  
ATOM   8682  O   LEU A1084     137.741 162.202 132.533  1.00  0.83           O  
ATOM   8683  CB  LEU A1084     137.888 163.059 129.309  1.00  0.83           C  
ATOM   8684  CG  LEU A1084     136.629 162.169 129.259  1.00  0.83           C  
ATOM   8685  CD1 LEU A1084     135.352 162.971 129.538  1.00  0.83           C  
ATOM   8686  CD2 LEU A1084     136.520 161.460 127.902  1.00  0.83           C  
ATOM   8687  N   HIS A1085     139.774 161.991 131.614  1.00  0.84           N  
ATOM   8688  CA  HIS A1085     140.241 161.020 132.604  1.00  0.84           C  
ATOM   8689  C   HIS A1085     140.352 161.616 134.007  1.00  0.84           C  
ATOM   8690  O   HIS A1085     139.855 161.040 134.978  1.00  0.84           O  
ATOM   8691  CB  HIS A1085     141.597 160.387 132.190  1.00  0.84           C  
ATOM   8692  CG  HIS A1085     142.151 159.382 133.177  1.00  0.84           C  
ATOM   8693  ND1 HIS A1085     143.216 159.742 133.986  1.00  0.84           N  
ATOM   8694  CD2 HIS A1085     141.684 158.155 133.540  1.00  0.84           C  
ATOM   8695  CE1 HIS A1085     143.368 158.732 134.825  1.00  0.84           C  
ATOM   8696  NE2 HIS A1085     142.466 157.744 134.602  1.00  0.84           N  
ATOM   8697  N   THR A1086     140.933 162.832 134.124  1.00  0.87           N  
ATOM   8698  CA  THR A1086     141.120 163.557 135.385  1.00  0.87           C  
ATOM   8699  C   THR A1086     139.821 163.809 136.124  1.00  0.87           C  
ATOM   8700  O   THR A1086     139.754 163.610 137.334  1.00  0.87           O  
ATOM   8701  CB  THR A1086     141.853 164.890 135.212  1.00  0.87           C  
ATOM   8702  OG1 THR A1086     143.133 164.667 134.638  1.00  0.87           O  
ATOM   8703  CG2 THR A1086     142.114 165.602 136.547  1.00  0.87           C  
ATOM   8704  N   ALA A1087     138.725 164.182 135.424  1.00  0.89           N  
ATOM   8705  CA  ALA A1087     137.424 164.400 136.042  1.00  0.89           C  
ATOM   8706  C   ALA A1087     136.877 163.198 136.818  1.00  0.89           C  
ATOM   8707  O   ALA A1087     136.453 163.314 137.966  1.00  0.89           O  
ATOM   8708  CB  ALA A1087     136.414 164.797 134.947  1.00  0.89           C  
ATOM   8709  N   ASN A1088     136.933 161.991 136.223  1.00  0.84           N  
ATOM   8710  CA  ASN A1088     136.539 160.766 136.904  1.00  0.84           C  
ATOM   8711  C   ASN A1088     137.509 160.340 138.004  1.00  0.84           C  
ATOM   8712  O   ASN A1088     137.103 159.987 139.112  1.00  0.84           O  
ATOM   8713  CB  ASN A1088     136.393 159.595 135.907  1.00  0.84           C  
ATOM   8714  CG  ASN A1088     135.354 159.948 134.852  1.00  0.84           C  
ATOM   8715  OD1 ASN A1088     134.161 160.017 135.139  1.00  0.84           O  
ATOM   8716  ND2 ASN A1088     135.799 160.182 133.597  1.00  0.84           N  
ATOM   8717  N   TRP A1089     138.830 160.381 137.727  1.00  0.84           N  
ATOM   8718  CA  TRP A1089     139.856 159.978 138.681  1.00  0.84           C  
ATOM   8719  C   TRP A1089     139.904 160.837 139.938  1.00  0.84           C  
ATOM   8720  O   TRP A1089     139.932 160.320 141.054  1.00  0.84           O  
ATOM   8721  CB  TRP A1089     141.251 159.946 137.998  1.00  0.84           C  
ATOM   8722  CG  TRP A1089     142.458 159.674 138.898  1.00  0.84           C  
ATOM   8723  CD1 TRP A1089     143.539 160.485 139.098  1.00  0.84           C  
ATOM   8724  CD2 TRP A1089     142.667 158.517 139.736  1.00  0.84           C  
ATOM   8725  NE1 TRP A1089     144.437 159.886 139.948  1.00  0.84           N  
ATOM   8726  CE2 TRP A1089     143.895 158.708 140.399  1.00  0.84           C  
ATOM   8727  CE3 TRP A1089     141.910 157.366 139.954  1.00  0.84           C  
ATOM   8728  CZ2 TRP A1089     144.377 157.767 141.300  1.00  0.84           C  
ATOM   8729  CZ3 TRP A1089     142.414 156.398 140.833  1.00  0.84           C  
ATOM   8730  CH2 TRP A1089     143.626 156.599 141.507  1.00  0.84           C  
ATOM   8731  N   PHE A1090     139.848 162.177 139.796  1.00  0.86           N  
ATOM   8732  CA  PHE A1090     139.794 163.095 140.923  1.00  0.86           C  
ATOM   8733  C   PHE A1090     138.557 162.861 141.787  1.00  0.86           C  
ATOM   8734  O   PHE A1090     138.615 162.820 143.016  1.00  0.86           O  
ATOM   8735  CB  PHE A1090     139.834 164.557 140.391  1.00  0.86           C  
ATOM   8736  CG  PHE A1090     139.751 165.592 141.480  1.00  0.86           C  
ATOM   8737  CD1 PHE A1090     140.866 165.876 142.283  1.00  0.86           C  
ATOM   8738  CD2 PHE A1090     138.543 166.269 141.720  1.00  0.86           C  
ATOM   8739  CE1 PHE A1090     140.769 166.795 143.333  1.00  0.86           C  
ATOM   8740  CE2 PHE A1090     138.439 167.188 142.771  1.00  0.86           C  
ATOM   8741  CZ  PHE A1090     139.553 167.442 143.581  1.00  0.86           C  
ATOM   8742  N   LEU A1091     137.393 162.663 141.145  1.00  0.86           N  
ATOM   8743  CA  LEU A1091     136.154 162.393 141.841  1.00  0.86           C  
ATOM   8744  C   LEU A1091     136.135 161.080 142.624  1.00  0.86           C  
ATOM   8745  O   LEU A1091     135.709 161.050 143.778  1.00  0.86           O  
ATOM   8746  CB  LEU A1091     134.991 162.481 140.836  1.00  0.86           C  
ATOM   8747  CG  LEU A1091     133.576 162.584 141.430  1.00  0.86           C  
ATOM   8748  CD1 LEU A1091     133.458 163.620 142.555  1.00  0.86           C  
ATOM   8749  CD2 LEU A1091     132.610 162.938 140.296  1.00  0.86           C  
ATOM   8750  N   TYR A1092     136.664 159.979 142.045  1.00  0.86           N  
ATOM   8751  CA  TYR A1092     136.881 158.712 142.737  1.00  0.86           C  
ATOM   8752  C   TYR A1092     137.816 158.844 143.947  1.00  0.86           C  
ATOM   8753  O   TYR A1092     137.552 158.336 145.037  1.00  0.86           O  
ATOM   8754  CB  TYR A1092     137.460 157.695 141.701  1.00  0.86           C  
ATOM   8755  CG  TYR A1092     137.885 156.378 142.305  1.00  0.86           C  
ATOM   8756  CD1 TYR A1092     136.953 155.381 142.640  1.00  0.86           C  
ATOM   8757  CD2 TYR A1092     139.241 156.174 142.610  1.00  0.86           C  
ATOM   8758  CE1 TYR A1092     137.373 154.211 143.293  1.00  0.86           C  
ATOM   8759  CE2 TYR A1092     139.659 155.018 143.280  1.00  0.86           C  
ATOM   8760  CZ  TYR A1092     138.721 154.041 143.629  1.00  0.86           C  
ATOM   8761  OH  TYR A1092     139.141 152.905 144.346  1.00  0.86           O  
ATOM   8762  N   LEU A1093     138.943 159.557 143.783  1.00  0.84           N  
ATOM   8763  CA  LEU A1093     139.923 159.733 144.838  1.00  0.84           C  
ATOM   8764  C   LEU A1093     139.403 160.525 146.040  1.00  0.84           C  
ATOM   8765  O   LEU A1093     139.642 160.185 147.201  1.00  0.84           O  
ATOM   8766  CB  LEU A1093     141.205 160.353 144.235  1.00  0.84           C  
ATOM   8767  CG  LEU A1093     142.518 159.967 144.940  1.00  0.84           C  
ATOM   8768  CD1 LEU A1093     142.784 158.458 144.875  1.00  0.84           C  
ATOM   8769  CD2 LEU A1093     143.694 160.696 144.284  1.00  0.84           C  
ATOM   8770  N   SER A1094     138.625 161.594 145.781  1.00  0.86           N  
ATOM   8771  CA  SER A1094     137.935 162.387 146.793  1.00  0.86           C  
ATOM   8772  C   SER A1094     136.883 161.631 147.601  1.00  0.86           C  
ATOM   8773  O   SER A1094     136.804 161.759 148.824  1.00  0.86           O  
ATOM   8774  CB  SER A1094     137.237 163.606 146.144  1.00  0.86           C  
ATOM   8775  OG  SER A1094     138.201 164.511 145.611  1.00  0.86           O  
ATOM   8776  N   THR A1095     136.035 160.799 146.958  1.00  0.86           N  
ATOM   8777  CA  THR A1095     135.034 159.985 147.660  1.00  0.86           C  
ATOM   8778  C   THR A1095     135.647 158.898 148.524  1.00  0.86           C  
ATOM   8779  O   THR A1095     135.180 158.624 149.630  1.00  0.86           O  
ATOM   8780  CB  THR A1095     133.958 159.371 146.773  1.00  0.86           C  
ATOM   8781  OG1 THR A1095     134.511 158.521 145.782  1.00  0.86           O  
ATOM   8782  CG2 THR A1095     133.189 160.485 146.052  1.00  0.86           C  
ATOM   8783  N   LEU A1096     136.749 158.279 148.063  1.00  0.84           N  
ATOM   8784  CA  LEU A1096     137.542 157.348 148.850  1.00  0.84           C  
ATOM   8785  C   LEU A1096     138.113 157.967 150.120  1.00  0.84           C  
ATOM   8786  O   LEU A1096     138.080 157.380 151.204  1.00  0.84           O  
ATOM   8787  CB  LEU A1096     138.710 156.808 147.991  1.00  0.84           C  
ATOM   8788  CG  LEU A1096     139.611 155.761 148.678  1.00  0.84           C  
ATOM   8789  CD1 LEU A1096     138.829 154.515 149.112  1.00  0.84           C  
ATOM   8790  CD2 LEU A1096     140.777 155.363 147.766  1.00  0.84           C  
ATOM   8791  N   ARG A1097     138.622 159.214 150.033  1.00  0.81           N  
ATOM   8792  CA  ARG A1097     139.097 159.939 151.197  1.00  0.81           C  
ATOM   8793  C   ARG A1097     138.018 160.210 152.236  1.00  0.81           C  
ATOM   8794  O   ARG A1097     138.259 160.081 153.436  1.00  0.81           O  
ATOM   8795  CB  ARG A1097     139.789 161.262 150.806  1.00  0.81           C  
ATOM   8796  CG  ARG A1097     140.484 161.988 151.979  1.00  0.81           C  
ATOM   8797  CD  ARG A1097     141.431 161.155 152.856  1.00  0.81           C  
ATOM   8798  NE  ARG A1097     142.357 160.401 151.961  1.00  0.81           N  
ATOM   8799  CZ  ARG A1097     143.176 159.435 152.391  1.00  0.81           C  
ATOM   8800  NH1 ARG A1097     143.285 159.102 153.675  1.00  0.81           N  
ATOM   8801  NH2 ARG A1097     143.891 158.765 151.487  1.00  0.81           N  
ATOM   8802  N   TRP A1098     136.786 160.537 151.795  1.00  0.85           N  
ATOM   8803  CA  TRP A1098     135.636 160.653 152.680  1.00  0.85           C  
ATOM   8804  C   TRP A1098     135.366 159.372 153.470  1.00  0.85           C  
ATOM   8805  O   TRP A1098     135.230 159.409 154.692  1.00  0.85           O  
ATOM   8806  CB  TRP A1098     134.371 161.031 151.853  1.00  0.85           C  
ATOM   8807  CG  TRP A1098     133.067 161.153 152.630  1.00  0.85           C  
ATOM   8808  CD1 TRP A1098     132.554 162.236 153.284  1.00  0.85           C  
ATOM   8809  CD2 TRP A1098     132.132 160.074 152.841  1.00  0.85           C  
ATOM   8810  NE1 TRP A1098     131.364 161.906 153.903  1.00  0.85           N  
ATOM   8811  CE2 TRP A1098     131.104 160.576 153.660  1.00  0.85           C  
ATOM   8812  CE3 TRP A1098     132.116 158.751 152.395  1.00  0.85           C  
ATOM   8813  CZ2 TRP A1098     130.055 159.765 154.074  1.00  0.85           C  
ATOM   8814  CZ3 TRP A1098     131.067 157.925 152.828  1.00  0.85           C  
ATOM   8815  CH2 TRP A1098     130.054 158.424 153.659  1.00  0.85           C  
ATOM   8816  N   PHE A1099     135.351 158.201 152.799  1.00  0.87           N  
ATOM   8817  CA  PHE A1099     135.092 156.915 153.435  1.00  0.87           C  
ATOM   8818  C   PHE A1099     136.122 156.567 154.507  1.00  0.87           C  
ATOM   8819  O   PHE A1099     135.780 156.227 155.639  1.00  0.87           O  
ATOM   8820  CB  PHE A1099     135.039 155.805 152.341  1.00  0.87           C  
ATOM   8821  CG  PHE A1099     134.933 154.409 152.907  1.00  0.87           C  
ATOM   8822  CD1 PHE A1099     133.725 153.923 153.430  1.00  0.87           C  
ATOM   8823  CD2 PHE A1099     136.082 153.604 152.987  1.00  0.87           C  
ATOM   8824  CE1 PHE A1099     133.666 152.653 154.020  1.00  0.87           C  
ATOM   8825  CE2 PHE A1099     136.035 152.353 153.612  1.00  0.87           C  
ATOM   8826  CZ  PHE A1099     134.823 151.871 154.116  1.00  0.87           C  
ATOM   8827  N   GLN A1100     137.419 156.702 154.179  1.00  0.83           N  
ATOM   8828  CA  GLN A1100     138.497 156.378 155.092  1.00  0.83           C  
ATOM   8829  C   GLN A1100     138.621 157.346 156.256  1.00  0.83           C  
ATOM   8830  O   GLN A1100     139.064 156.982 157.339  1.00  0.83           O  
ATOM   8831  CB  GLN A1100     139.843 156.314 154.342  1.00  0.83           C  
ATOM   8832  CG  GLN A1100     139.869 155.211 153.258  1.00  0.83           C  
ATOM   8833  CD  GLN A1100     141.207 155.086 152.530  1.00  0.83           C  
ATOM   8834  OE1 GLN A1100     141.430 154.170 151.749  1.00  0.83           O  
ATOM   8835  NE2 GLN A1100     142.147 156.028 152.772  1.00  0.83           N  
ATOM   8836  N   MET A1101     138.218 158.616 156.076  1.00  0.83           N  
ATOM   8837  CA  MET A1101     138.092 159.538 157.188  1.00  0.83           C  
ATOM   8838  C   MET A1101     136.922 159.193 158.107  1.00  0.83           C  
ATOM   8839  O   MET A1101     137.031 159.192 159.332  1.00  0.83           O  
ATOM   8840  CB  MET A1101     137.965 160.978 156.643  1.00  0.83           C  
ATOM   8841  CG  MET A1101     138.127 162.068 157.715  1.00  0.83           C  
ATOM   8842  SD  MET A1101     138.051 163.750 157.042  1.00  0.83           S  
ATOM   8843  CE  MET A1101     138.446 164.590 158.601  1.00  0.83           C  
ATOM   8844  N   ARG A1102     135.749 158.855 157.531  1.00  0.81           N  
ATOM   8845  CA  ARG A1102     134.582 158.436 158.290  1.00  0.81           C  
ATOM   8846  C   ARG A1102     134.751 157.135 159.061  1.00  0.81           C  
ATOM   8847  O   ARG A1102     134.293 157.040 160.198  1.00  0.81           O  
ATOM   8848  CB  ARG A1102     133.304 158.385 157.415  1.00  0.81           C  
ATOM   8849  CG  ARG A1102     132.837 159.760 156.889  1.00  0.81           C  
ATOM   8850  CD  ARG A1102     132.559 160.795 157.984  1.00  0.81           C  
ATOM   8851  NE  ARG A1102     132.095 162.064 157.337  1.00  0.81           N  
ATOM   8852  CZ  ARG A1102     132.901 163.010 156.837  1.00  0.81           C  
ATOM   8853  NH1 ARG A1102     134.226 162.926 156.853  1.00  0.81           N  
ATOM   8854  NH2 ARG A1102     132.372 164.098 156.280  1.00  0.81           N  
ATOM   8855  N   ILE A1103     135.439 156.118 158.500  1.00  0.83           N  
ATOM   8856  CA  ILE A1103     135.725 154.865 159.199  1.00  0.83           C  
ATOM   8857  C   ILE A1103     136.528 155.087 160.492  1.00  0.83           C  
ATOM   8858  O   ILE A1103     136.214 154.527 161.545  1.00  0.83           O  
ATOM   8859  CB  ILE A1103     136.325 153.816 158.247  1.00  0.83           C  
ATOM   8860  CG1 ILE A1103     135.859 152.379 158.571  1.00  0.83           C  
ATOM   8861  CG2 ILE A1103     137.863 153.865 158.173  1.00  0.83           C  
ATOM   8862  CD1 ILE A1103     134.395 152.121 158.211  1.00  0.83           C  
ATOM   8863  N   GLU A1104     137.532 155.995 160.459  1.00  0.82           N  
ATOM   8864  CA  GLU A1104     138.276 156.442 161.628  1.00  0.82           C  
ATOM   8865  C   GLU A1104     137.438 157.256 162.617  1.00  0.82           C  
ATOM   8866  O   GLU A1104     137.454 157.014 163.822  1.00  0.82           O  
ATOM   8867  CB  GLU A1104     139.559 157.205 161.201  1.00  0.82           C  
ATOM   8868  CG  GLU A1104     140.549 157.491 162.368  1.00  0.82           C  
ATOM   8869  CD  GLU A1104     141.956 157.929 161.945  1.00  0.82           C  
ATOM   8870  OE1 GLU A1104     142.166 158.204 160.735  1.00  0.82           O  
ATOM   8871  OE2 GLU A1104     142.847 157.989 162.841  1.00  0.82           O  
ATOM   8872  N   MET A1105     136.605 158.208 162.145  1.00  0.81           N  
ATOM   8873  CA  MET A1105     135.683 158.972 162.986  1.00  0.81           C  
ATOM   8874  C   MET A1105     134.650 158.118 163.730  1.00  0.81           C  
ATOM   8875  O   MET A1105     134.364 158.357 164.904  1.00  0.81           O  
ATOM   8876  CB  MET A1105     134.956 160.067 162.164  1.00  0.81           C  
ATOM   8877  CG  MET A1105     135.894 161.191 161.676  1.00  0.81           C  
ATOM   8878  SD  MET A1105     135.263 162.199 160.298  1.00  0.81           S  
ATOM   8879  CE  MET A1105     133.769 162.864 161.077  1.00  0.81           C  
ATOM   8880  N   ILE A1106     134.099 157.068 163.081  1.00  0.81           N  
ATOM   8881  CA  ILE A1106     133.278 156.044 163.730  1.00  0.81           C  
ATOM   8882  C   ILE A1106     134.048 155.306 164.821  1.00  0.81           C  
ATOM   8883  O   ILE A1106     133.559 155.117 165.932  1.00  0.81           O  
ATOM   8884  CB  ILE A1106     132.701 155.055 162.712  1.00  0.81           C  
ATOM   8885  CG1 ILE A1106     131.650 155.773 161.834  1.00  0.81           C  
ATOM   8886  CG2 ILE A1106     132.075 153.821 163.403  1.00  0.81           C  
ATOM   8887  CD1 ILE A1106     131.085 154.906 160.706  1.00  0.81           C  
ATOM   8888  N   PHE A1107     135.313 154.919 164.568  1.00  0.81           N  
ATOM   8889  CA  PHE A1107     136.162 154.317 165.586  1.00  0.81           C  
ATOM   8890  C   PHE A1107     136.384 155.235 166.800  1.00  0.81           C  
ATOM   8891  O   PHE A1107     136.266 154.808 167.949  1.00  0.81           O  
ATOM   8892  CB  PHE A1107     137.507 153.896 164.933  1.00  0.81           C  
ATOM   8893  CG  PHE A1107     138.420 153.191 165.893  1.00  0.81           C  
ATOM   8894  CD1 PHE A1107     138.245 151.832 166.195  1.00  0.81           C  
ATOM   8895  CD2 PHE A1107     139.449 153.910 166.523  1.00  0.81           C  
ATOM   8896  CE1 PHE A1107     139.091 151.200 167.115  1.00  0.81           C  
ATOM   8897  CE2 PHE A1107     140.287 153.284 167.452  1.00  0.81           C  
ATOM   8898  CZ  PHE A1107     140.110 151.926 167.742  1.00  0.81           C  
ATOM   8899  N   VAL A1108     136.654 156.537 166.565  1.00  0.81           N  
ATOM   8900  CA  VAL A1108     136.846 157.536 167.612  1.00  0.81           C  
ATOM   8901  C   VAL A1108     135.654 157.689 168.550  1.00  0.81           C  
ATOM   8902  O   VAL A1108     135.827 157.660 169.764  1.00  0.81           O  
ATOM   8903  CB  VAL A1108     137.219 158.896 167.017  1.00  0.81           C  
ATOM   8904  CG1 VAL A1108     137.218 160.024 168.067  1.00  0.81           C  
ATOM   8905  CG2 VAL A1108     138.623 158.796 166.400  1.00  0.81           C  
ATOM   8906  N   ILE A1109     134.405 157.804 168.048  1.00  0.77           N  
ATOM   8907  CA  ILE A1109     133.229 157.944 168.911  1.00  0.77           C  
ATOM   8908  C   ILE A1109     132.986 156.745 169.824  1.00  0.77           C  
ATOM   8909  O   ILE A1109     132.684 156.900 171.007  1.00  0.77           O  
ATOM   8910  CB  ILE A1109     131.951 158.318 168.159  1.00  0.77           C  
ATOM   8911  CG1 ILE A1109     131.577 157.294 167.067  1.00  0.77           C  
ATOM   8912  CG2 ILE A1109     132.154 159.729 167.575  1.00  0.77           C  
ATOM   8913  CD1 ILE A1109     130.184 157.483 166.461  1.00  0.77           C  
ATOM   8914  N   PHE A1110     133.175 155.511 169.313  1.00  0.76           N  
ATOM   8915  CA  PHE A1110     133.127 154.299 170.109  1.00  0.76           C  
ATOM   8916  C   PHE A1110     134.234 154.257 171.155  1.00  0.76           C  
ATOM   8917  O   PHE A1110     133.990 153.931 172.314  1.00  0.76           O  
ATOM   8918  CB  PHE A1110     133.199 153.044 169.199  1.00  0.76           C  
ATOM   8919  CG  PHE A1110     131.837 152.693 168.659  1.00  0.76           C  
ATOM   8920  CD1 PHE A1110     130.887 152.111 169.514  1.00  0.76           C  
ATOM   8921  CD2 PHE A1110     131.494 152.901 167.312  1.00  0.76           C  
ATOM   8922  CE1 PHE A1110     129.617 151.758 169.040  1.00  0.76           C  
ATOM   8923  CE2 PHE A1110     130.222 152.558 166.833  1.00  0.76           C  
ATOM   8924  CZ  PHE A1110     129.284 151.984 167.699  1.00  0.76           C  
ATOM   8925  N   PHE A1111     135.475 154.642 170.794  1.00  0.78           N  
ATOM   8926  CA  PHE A1111     136.573 154.749 171.745  1.00  0.78           C  
ATOM   8927  C   PHE A1111     136.334 155.797 172.838  1.00  0.78           C  
ATOM   8928  O   PHE A1111     136.550 155.535 174.017  1.00  0.78           O  
ATOM   8929  CB  PHE A1111     137.907 155.024 171.000  1.00  0.78           C  
ATOM   8930  CG  PHE A1111     139.066 154.331 171.673  1.00  0.78           C  
ATOM   8931  CD1 PHE A1111     139.610 154.813 172.875  1.00  0.78           C  
ATOM   8932  CD2 PHE A1111     139.600 153.159 171.114  1.00  0.78           C  
ATOM   8933  CE1 PHE A1111     140.653 154.128 173.512  1.00  0.78           C  
ATOM   8934  CE2 PHE A1111     140.655 152.480 171.736  1.00  0.78           C  
ATOM   8935  CZ  PHE A1111     141.179 152.964 172.940  1.00  0.78           C  
ATOM   8936  N   ILE A1112     135.822 156.999 172.489  1.00  0.78           N  
ATOM   8937  CA  ILE A1112     135.435 158.039 173.446  1.00  0.78           C  
ATOM   8938  C   ILE A1112     134.352 157.561 174.408  1.00  0.78           C  
ATOM   8939  O   ILE A1112     134.468 157.723 175.625  1.00  0.78           O  
ATOM   8940  CB  ILE A1112     134.983 159.325 172.731  1.00  0.78           C  
ATOM   8941  CG1 ILE A1112     136.183 159.987 172.010  1.00  0.78           C  
ATOM   8942  CG2 ILE A1112     134.323 160.321 173.714  1.00  0.78           C  
ATOM   8943  CD1 ILE A1112     135.840 161.250 171.211  1.00  0.78           C  
ATOM   8944  N   ALA A1113     133.292 156.904 173.892  1.00  0.80           N  
ATOM   8945  CA  ALA A1113     132.245 156.322 174.710  1.00  0.80           C  
ATOM   8946  C   ALA A1113     132.752 155.237 175.660  1.00  0.80           C  
ATOM   8947  O   ALA A1113     132.443 155.242 176.850  1.00  0.80           O  
ATOM   8948  CB  ALA A1113     131.140 155.761 173.796  1.00  0.80           C  
ATOM   8949  N   VAL A1114     133.608 154.318 175.168  1.00  0.76           N  
ATOM   8950  CA  VAL A1114     134.283 153.321 175.991  1.00  0.76           C  
ATOM   8951  C   VAL A1114     135.171 153.932 177.072  1.00  0.76           C  
ATOM   8952  O   VAL A1114     135.065 153.563 178.238  1.00  0.76           O  
ATOM   8953  CB  VAL A1114     135.088 152.358 175.114  1.00  0.76           C  
ATOM   8954  CG1 VAL A1114     136.123 151.542 175.915  1.00  0.76           C  
ATOM   8955  CG2 VAL A1114     134.110 151.407 174.400  1.00  0.76           C  
ATOM   8956  N   THR A1115     136.027 154.924 176.743  1.00  0.77           N  
ATOM   8957  CA  THR A1115     136.970 155.543 177.685  1.00  0.77           C  
ATOM   8958  C   THR A1115     136.300 156.146 178.902  1.00  0.77           C  
ATOM   8959  O   THR A1115     136.668 155.852 180.038  1.00  0.77           O  
ATOM   8960  CB  THR A1115     137.794 156.656 177.025  1.00  0.77           C  
ATOM   8961  OG1 THR A1115     138.665 156.105 176.048  1.00  0.77           O  
ATOM   8962  CG2 THR A1115     138.702 157.417 178.005  1.00  0.77           C  
ATOM   8963  N   PHE A1116     135.258 156.981 178.718  1.00  0.75           N  
ATOM   8964  CA  PHE A1116     134.552 157.566 179.848  1.00  0.75           C  
ATOM   8965  C   PHE A1116     133.777 156.554 180.684  1.00  0.75           C  
ATOM   8966  O   PHE A1116     133.833 156.587 181.912  1.00  0.75           O  
ATOM   8967  CB  PHE A1116     133.625 158.722 179.409  1.00  0.75           C  
ATOM   8968  CG  PHE A1116     134.450 159.941 179.111  1.00  0.75           C  
ATOM   8969  CD1 PHE A1116     134.977 160.691 180.175  1.00  0.75           C  
ATOM   8970  CD2 PHE A1116     134.698 160.359 177.794  1.00  0.75           C  
ATOM   8971  CE1 PHE A1116     135.740 161.836 179.928  1.00  0.75           C  
ATOM   8972  CE2 PHE A1116     135.457 161.510 177.544  1.00  0.75           C  
ATOM   8973  CZ  PHE A1116     135.985 162.246 178.612  1.00  0.75           C  
ATOM   8974  N   ILE A1117     133.074 155.594 180.047  1.00  0.73           N  
ATOM   8975  CA  ILE A1117     132.371 154.523 180.751  1.00  0.73           C  
ATOM   8976  C   ILE A1117     133.314 153.641 181.560  1.00  0.73           C  
ATOM   8977  O   ILE A1117     133.060 153.332 182.722  1.00  0.73           O  
ATOM   8978  CB  ILE A1117     131.547 153.680 179.776  1.00  0.73           C  
ATOM   8979  CG1 ILE A1117     130.365 154.487 179.186  1.00  0.73           C  
ATOM   8980  CG2 ILE A1117     131.047 152.362 180.410  1.00  0.73           C  
ATOM   8981  CD1 ILE A1117     129.334 154.993 180.201  1.00  0.73           C  
ATOM   8982  N   SER A1118     134.466 153.246 180.992  1.00  0.74           N  
ATOM   8983  CA  SER A1118     135.477 152.468 181.694  1.00  0.74           C  
ATOM   8984  C   SER A1118     136.042 153.156 182.921  1.00  0.74           C  
ATOM   8985  O   SER A1118     136.177 152.546 183.974  1.00  0.74           O  
ATOM   8986  CB  SER A1118     136.683 152.136 180.782  1.00  0.74           C  
ATOM   8987  OG  SER A1118     136.273 151.321 179.685  1.00  0.74           O  
ATOM   8988  N   ILE A1119     136.375 154.458 182.833  1.00  0.74           N  
ATOM   8989  CA  ILE A1119     136.871 155.219 183.975  1.00  0.74           C  
ATOM   8990  C   ILE A1119     135.827 155.434 185.069  1.00  0.74           C  
ATOM   8991  O   ILE A1119     136.094 155.206 186.245  1.00  0.74           O  
ATOM   8992  CB  ILE A1119     137.459 156.552 183.509  1.00  0.74           C  
ATOM   8993  CG1 ILE A1119     138.683 156.283 182.601  1.00  0.74           C  
ATOM   8994  CG2 ILE A1119     137.851 157.443 184.710  1.00  0.74           C  
ATOM   8995  CD1 ILE A1119     139.228 157.533 181.908  1.00  0.74           C  
ATOM   8996  N   LEU A1120     134.599 155.860 184.714  1.00  0.76           N  
ATOM   8997  CA  LEU A1120     133.558 156.164 185.687  1.00  0.76           C  
ATOM   8998  C   LEU A1120     132.964 154.944 186.383  1.00  0.76           C  
ATOM   8999  O   LEU A1120     132.599 154.999 187.554  1.00  0.76           O  
ATOM   9000  CB  LEU A1120     132.430 157.005 185.044  1.00  0.76           C  
ATOM   9001  CG  LEU A1120     132.866 158.398 184.541  1.00  0.76           C  
ATOM   9002  CD1 LEU A1120     131.710 159.070 183.789  1.00  0.76           C  
ATOM   9003  CD2 LEU A1120     133.363 159.310 185.670  1.00  0.76           C  
ATOM   9004  N   THR A1121     132.848 153.800 185.679  1.00  0.75           N  
ATOM   9005  CA  THR A1121     132.318 152.560 186.252  1.00  0.75           C  
ATOM   9006  C   THR A1121     133.349 151.836 187.119  1.00  0.75           C  
ATOM   9007  O   THR A1121     133.015 150.984 187.942  1.00  0.75           O  
ATOM   9008  CB  THR A1121     131.817 151.601 185.166  1.00  0.75           C  
ATOM   9009  OG1 THR A1121     130.898 152.258 184.302  1.00  0.75           O  
ATOM   9010  CG2 THR A1121     131.041 150.408 185.738  1.00  0.75           C  
ATOM   9011  N   THR A1122     134.657 152.155 186.993  1.00  0.70           N  
ATOM   9012  CA  THR A1122     135.691 151.656 187.908  1.00  0.70           C  
ATOM   9013  C   THR A1122     135.516 152.203 189.316  1.00  0.70           C  
ATOM   9014  O   THR A1122     135.887 153.331 189.633  1.00  0.70           O  
ATOM   9015  CB  THR A1122     137.116 151.937 187.435  1.00  0.70           C  
ATOM   9016  OG1 THR A1122     137.377 151.196 186.250  1.00  0.70           O  
ATOM   9017  CG2 THR A1122     138.190 151.484 188.436  1.00  0.70           C  
ATOM   9018  N   GLY A1123     134.940 151.372 190.210  1.00  0.68           N  
ATOM   9019  CA  GLY A1123     134.726 151.686 191.617  1.00  0.68           C  
ATOM   9020  C   GLY A1123     135.976 151.606 192.457  1.00  0.68           C  
ATOM   9021  O   GLY A1123     137.112 151.579 191.975  1.00  0.68           O  
ATOM   9022  N   GLU A1124     135.799 151.532 193.782  1.00  0.56           N  
ATOM   9023  CA  GLU A1124     136.851 151.461 194.773  1.00  0.56           C  
ATOM   9024  C   GLU A1124     137.731 150.231 194.606  1.00  0.56           C  
ATOM   9025  O   GLU A1124     138.954 150.294 194.709  1.00  0.56           O  
ATOM   9026  CB  GLU A1124     136.260 151.482 196.208  1.00  0.56           C  
ATOM   9027  CG  GLU A1124     135.347 152.701 196.506  1.00  0.56           C  
ATOM   9028  CD  GLU A1124     133.921 152.589 195.959  1.00  0.56           C  
ATOM   9029  OE1 GLU A1124     133.604 151.582 195.270  1.00  0.56           O  
ATOM   9030  OE2 GLU A1124     133.139 153.536 196.212  1.00  0.56           O  
ATOM   9031  N   GLY A1125     137.111 149.077 194.292  1.00  0.54           N  
ATOM   9032  CA  GLY A1125     137.816 147.836 194.015  1.00  0.54           C  
ATOM   9033  C   GLY A1125     137.532 147.361 192.623  1.00  0.54           C  
ATOM   9034  O   GLY A1125     136.404 147.459 192.148  1.00  0.54           O  
ATOM   9035  N   GLU A1126     138.547 146.772 191.950  1.00  0.55           N  
ATOM   9036  CA  GLU A1126     138.388 146.146 190.640  1.00  0.55           C  
ATOM   9037  C   GLU A1126     137.794 147.069 189.571  1.00  0.55           C  
ATOM   9038  O   GLU A1126     138.270 148.186 189.388  1.00  0.55           O  
ATOM   9039  CB  GLU A1126     137.624 144.809 190.814  1.00  0.55           C  
ATOM   9040  CG  GLU A1126     138.488 143.722 191.494  1.00  0.55           C  
ATOM   9041  CD  GLU A1126     139.237 142.841 190.520  1.00  0.55           C  
ATOM   9042  OE1 GLU A1126     138.817 142.753 189.340  1.00  0.55           O  
ATOM   9043  OE2 GLU A1126     140.178 142.146 190.931  1.00  0.55           O  
ATOM   9044  N   GLY A1127     136.752 146.614 188.837  1.00  0.63           N  
ATOM   9045  CA  GLY A1127     136.163 147.311 187.694  1.00  0.63           C  
ATOM   9046  C   GLY A1127     136.279 146.486 186.440  1.00  0.63           C  
ATOM   9047  O   GLY A1127     137.272 146.512 185.725  1.00  0.63           O  
ATOM   9048  N   ARG A1128     135.233 145.702 186.112  1.00  0.63           N  
ATOM   9049  CA  ARG A1128     135.348 144.679 185.082  1.00  0.63           C  
ATOM   9050  C   ARG A1128     134.868 145.155 183.724  1.00  0.63           C  
ATOM   9051  O   ARG A1128     135.257 144.622 182.689  1.00  0.63           O  
ATOM   9052  CB  ARG A1128     134.515 143.437 185.493  1.00  0.63           C  
ATOM   9053  CG  ARG A1128     134.844 142.905 186.905  1.00  0.63           C  
ATOM   9054  CD  ARG A1128     136.264 142.341 187.050  1.00  0.63           C  
ATOM   9055  NE  ARG A1128     136.541 142.088 188.486  1.00  0.63           N  
ATOM   9056  CZ  ARG A1128     136.055 141.109 189.251  1.00  0.63           C  
ATOM   9057  NH1 ARG A1128     135.190 140.231 188.766  1.00  0.63           N  
ATOM   9058  NH2 ARG A1128     136.455 140.994 190.515  1.00  0.63           N  
ATOM   9059  N   VAL A1129     134.048 146.225 183.697  1.00  0.68           N  
ATOM   9060  CA  VAL A1129     133.547 146.837 182.474  1.00  0.68           C  
ATOM   9061  C   VAL A1129     134.687 147.403 181.639  1.00  0.68           C  
ATOM   9062  O   VAL A1129     134.781 147.171 180.436  1.00  0.68           O  
ATOM   9063  CB  VAL A1129     132.503 147.908 182.794  1.00  0.68           C  
ATOM   9064  CG1 VAL A1129     131.967 148.563 181.510  1.00  0.68           C  
ATOM   9065  CG2 VAL A1129     131.333 147.256 183.553  1.00  0.68           C  
ATOM   9066  N   GLY A1130     135.643 148.098 182.295  1.00  0.70           N  
ATOM   9067  CA  GLY A1130     136.805 148.659 181.616  1.00  0.70           C  
ATOM   9068  C   GLY A1130     137.782 147.665 181.053  1.00  0.70           C  
ATOM   9069  O   GLY A1130     138.388 147.894 180.007  1.00  0.70           O  
ATOM   9070  N   ILE A1131     137.932 146.508 181.720  1.00  0.66           N  
ATOM   9071  CA  ILE A1131     138.733 145.399 181.228  1.00  0.66           C  
ATOM   9072  C   ILE A1131     138.150 144.814 179.938  1.00  0.66           C  
ATOM   9073  O   ILE A1131     138.839 144.646 178.934  1.00  0.66           O  
ATOM   9074  CB  ILE A1131     138.874 144.323 182.313  1.00  0.66           C  
ATOM   9075  CG1 ILE A1131     139.526 144.917 183.590  1.00  0.66           C  
ATOM   9076  CG2 ILE A1131     139.704 143.140 181.776  1.00  0.66           C  
ATOM   9077  CD1 ILE A1131     139.629 143.948 184.775  1.00  0.66           C  
ATOM   9078  N   ILE A1132     136.828 144.537 179.908  1.00  0.66           N  
ATOM   9079  CA  ILE A1132     136.165 143.971 178.736  1.00  0.66           C  
ATOM   9080  C   ILE A1132     136.101 144.931 177.551  1.00  0.66           C  
ATOM   9081  O   ILE A1132     136.462 144.590 176.422  1.00  0.66           O  
ATOM   9082  CB  ILE A1132     134.758 143.484 179.108  1.00  0.66           C  
ATOM   9083  CG1 ILE A1132     134.865 142.322 180.125  1.00  0.66           C  
ATOM   9084  CG2 ILE A1132     133.955 143.056 177.858  1.00  0.66           C  
ATOM   9085  CD1 ILE A1132     133.526 141.903 180.741  1.00  0.66           C  
ATOM   9086  N   LEU A1133     135.660 146.185 177.775  1.00  0.68           N  
ATOM   9087  CA  LEU A1133     135.462 147.142 176.699  1.00  0.68           C  
ATOM   9088  C   LEU A1133     136.743 147.587 176.010  1.00  0.68           C  
ATOM   9089  O   LEU A1133     136.826 147.659 174.784  1.00  0.68           O  
ATOM   9090  CB  LEU A1133     134.693 148.386 177.195  1.00  0.68           C  
ATOM   9091  CG  LEU A1133     133.235 148.136 177.628  1.00  0.68           C  
ATOM   9092  CD1 LEU A1133     132.588 149.464 178.039  1.00  0.68           C  
ATOM   9093  CD2 LEU A1133     132.405 147.463 176.530  1.00  0.68           C  
ATOM   9094  N   THR A1134     137.808 147.867 176.783  1.00  0.67           N  
ATOM   9095  CA  THR A1134     139.106 148.261 176.244  1.00  0.67           C  
ATOM   9096  C   THR A1134     139.756 147.131 175.445  1.00  0.67           C  
ATOM   9097  O   THR A1134     140.398 147.363 174.419  1.00  0.67           O  
ATOM   9098  CB  THR A1134     140.027 148.818 177.329  1.00  0.67           C  
ATOM   9099  OG1 THR A1134     139.432 149.960 177.940  1.00  0.67           O  
ATOM   9100  CG2 THR A1134     141.363 149.301 176.754  1.00  0.67           C  
ATOM   9101  N   LEU A1135     139.568 145.852 175.844  1.00  0.70           N  
ATOM   9102  CA  LEU A1135     139.963 144.709 175.022  1.00  0.70           C  
ATOM   9103  C   LEU A1135     139.274 144.661 173.659  1.00  0.70           C  
ATOM   9104  O   LEU A1135     139.916 144.475 172.626  1.00  0.70           O  
ATOM   9105  CB  LEU A1135     139.670 143.376 175.757  1.00  0.70           C  
ATOM   9106  CG  LEU A1135     140.918 142.578 176.170  1.00  0.70           C  
ATOM   9107  CD1 LEU A1135     140.491 141.367 177.004  1.00  0.70           C  
ATOM   9108  CD2 LEU A1135     141.758 142.126 174.969  1.00  0.70           C  
ATOM   9109  N   ALA A1136     137.946 144.892 173.620  1.00  0.73           N  
ATOM   9110  CA  ALA A1136     137.173 144.924 172.392  1.00  0.73           C  
ATOM   9111  C   ALA A1136     137.641 145.991 171.401  1.00  0.73           C  
ATOM   9112  O   ALA A1136     137.835 145.727 170.214  1.00  0.73           O  
ATOM   9113  CB  ALA A1136     135.689 145.136 172.747  1.00  0.73           C  
ATOM   9114  N   MET A1137     137.914 147.218 171.887  1.00  0.70           N  
ATOM   9115  CA  MET A1137     138.470 148.291 171.077  1.00  0.70           C  
ATOM   9116  C   MET A1137     139.863 148.012 170.512  1.00  0.70           C  
ATOM   9117  O   MET A1137     140.152 148.361 169.371  1.00  0.70           O  
ATOM   9118  CB  MET A1137     138.445 149.642 171.826  1.00  0.70           C  
ATOM   9119  CG  MET A1137     137.028 150.119 172.212  1.00  0.70           C  
ATOM   9120  SD  MET A1137     135.786 150.106 170.875  1.00  0.70           S  
ATOM   9121  CE  MET A1137     136.586 151.290 169.758  1.00  0.70           C  
ATOM   9122  N   ASN A1138     140.749 147.325 171.270  1.00  0.74           N  
ATOM   9123  CA  ASN A1138     142.047 146.873 170.774  1.00  0.74           C  
ATOM   9124  C   ASN A1138     141.933 145.928 169.570  1.00  0.74           C  
ATOM   9125  O   ASN A1138     142.677 146.045 168.599  1.00  0.74           O  
ATOM   9126  CB  ASN A1138     142.869 146.188 171.901  1.00  0.74           C  
ATOM   9127  CG  ASN A1138     143.660 147.217 172.703  1.00  0.74           C  
ATOM   9128  OD1 ASN A1138     144.825 147.479 172.414  1.00  0.74           O  
ATOM   9129  ND2 ASN A1138     143.048 147.825 173.742  1.00  0.74           N  
ATOM   9130  N   ILE A1139     140.963 144.993 169.580  1.00  0.74           N  
ATOM   9131  CA  ILE A1139     140.656 144.136 168.436  1.00  0.74           C  
ATOM   9132  C   ILE A1139     140.156 144.928 167.218  1.00  0.74           C  
ATOM   9133  O   ILE A1139     140.541 144.685 166.071  1.00  0.74           O  
ATOM   9134  CB  ILE A1139     139.661 143.036 168.822  1.00  0.74           C  
ATOM   9135  CG1 ILE A1139     140.199 142.197 170.010  1.00  0.74           C  
ATOM   9136  CG2 ILE A1139     139.383 142.128 167.607  1.00  0.74           C  
ATOM   9137  CD1 ILE A1139     139.204 141.172 170.566  1.00  0.74           C  
ATOM   9138  N   MET A1140     139.294 145.940 167.438  1.00  0.74           N  
ATOM   9139  CA  MET A1140     138.710 146.744 166.376  1.00  0.74           C  
ATOM   9140  C   MET A1140     139.672 147.691 165.676  1.00  0.74           C  
ATOM   9141  O   MET A1140     139.445 148.079 164.529  1.00  0.74           O  
ATOM   9142  CB  MET A1140     137.478 147.503 166.902  1.00  0.74           C  
ATOM   9143  CG  MET A1140     136.303 146.565 167.236  1.00  0.74           C  
ATOM   9144  SD  MET A1140     135.585 145.731 165.785  1.00  0.74           S  
ATOM   9145  CE  MET A1140     136.452 144.132 165.877  1.00  0.74           C  
ATOM   9146  N   SER A1141     140.819 148.017 166.301  1.00  0.76           N  
ATOM   9147  CA  SER A1141     141.927 148.703 165.641  1.00  0.76           C  
ATOM   9148  C   SER A1141     142.461 147.937 164.434  1.00  0.76           C  
ATOM   9149  O   SER A1141     142.681 148.498 163.362  1.00  0.76           O  
ATOM   9150  CB  SER A1141     143.122 148.927 166.604  1.00  0.76           C  
ATOM   9151  OG  SER A1141     142.769 149.825 167.654  1.00  0.76           O  
ATOM   9152  N   THR A1142     142.634 146.605 164.559  1.00  0.78           N  
ATOM   9153  CA  THR A1142     143.029 145.722 163.457  1.00  0.78           C  
ATOM   9154  C   THR A1142     141.961 145.599 162.382  1.00  0.78           C  
ATOM   9155  O   THR A1142     142.248 145.604 161.184  1.00  0.78           O  
ATOM   9156  CB  THR A1142     143.413 144.318 163.918  1.00  0.78           C  
ATOM   9157  OG1 THR A1142     144.341 144.401 164.988  1.00  0.78           O  
ATOM   9158  CG2 THR A1142     144.113 143.539 162.794  1.00  0.78           C  
ATOM   9159  N   LEU A1143     140.667 145.514 162.772  1.00  0.74           N  
ATOM   9160  CA  LEU A1143     139.554 145.437 161.827  1.00  0.74           C  
ATOM   9161  C   LEU A1143     139.441 146.657 160.921  1.00  0.74           C  
ATOM   9162  O   LEU A1143     139.156 146.535 159.734  1.00  0.74           O  
ATOM   9163  CB  LEU A1143     138.195 145.161 162.516  1.00  0.74           C  
ATOM   9164  CG  LEU A1143     137.007 144.904 161.552  1.00  0.74           C  
ATOM   9165  CD1 LEU A1143     137.225 143.722 160.599  1.00  0.74           C  
ATOM   9166  CD2 LEU A1143     135.707 144.678 162.326  1.00  0.74           C  
ATOM   9167  N   GLN A1144     139.731 147.867 161.439  1.00  0.73           N  
ATOM   9168  CA  GLN A1144     139.823 149.083 160.644  1.00  0.73           C  
ATOM   9169  C   GLN A1144     140.836 148.983 159.499  1.00  0.73           C  
ATOM   9170  O   GLN A1144     140.562 149.371 158.364  1.00  0.73           O  
ATOM   9171  CB  GLN A1144     140.202 150.254 161.585  1.00  0.73           C  
ATOM   9172  CG  GLN A1144     140.294 151.636 160.898  1.00  0.73           C  
ATOM   9173  CD  GLN A1144     140.667 152.794 161.833  1.00  0.73           C  
ATOM   9174  OE1 GLN A1144     140.919 153.898 161.359  1.00  0.73           O  
ATOM   9175  NE2 GLN A1144     140.710 152.566 163.164  1.00  0.73           N  
ATOM   9176  N   TRP A1145     142.024 148.391 159.752  1.00  0.75           N  
ATOM   9177  CA  TRP A1145     142.982 148.084 158.698  1.00  0.75           C  
ATOM   9178  C   TRP A1145     142.449 147.067 157.677  1.00  0.75           C  
ATOM   9179  O   TRP A1145     142.542 147.268 156.466  1.00  0.75           O  
ATOM   9180  CB  TRP A1145     144.334 147.599 159.299  1.00  0.75           C  
ATOM   9181  CG  TRP A1145     145.530 147.577 158.349  1.00  0.75           C  
ATOM   9182  CD1 TRP A1145     145.615 148.034 157.061  1.00  0.75           C  
ATOM   9183  CD2 TRP A1145     146.829 147.030 158.663  1.00  0.75           C  
ATOM   9184  NE1 TRP A1145     146.864 147.784 156.540  1.00  0.75           N  
ATOM   9185  CE2 TRP A1145     147.628 147.180 157.510  1.00  0.75           C  
ATOM   9186  CE3 TRP A1145     147.340 146.435 159.818  1.00  0.75           C  
ATOM   9187  CZ2 TRP A1145     148.945 146.742 157.485  1.00  0.75           C  
ATOM   9188  CZ3 TRP A1145     148.675 145.997 159.792  1.00  0.75           C  
ATOM   9189  CH2 TRP A1145     149.467 146.149 158.645  1.00  0.75           C  
ATOM   9190  N   ALA A1146     141.814 145.974 158.148  1.00  0.83           N  
ATOM   9191  CA  ALA A1146     141.186 144.969 157.304  1.00  0.83           C  
ATOM   9192  C   ALA A1146     140.056 145.496 156.406  1.00  0.83           C  
ATOM   9193  O   ALA A1146     139.957 145.141 155.231  1.00  0.83           O  
ATOM   9194  CB  ALA A1146     140.669 143.813 158.183  1.00  0.83           C  
ATOM   9195  N   VAL A1147     139.185 146.388 156.924  1.00  0.79           N  
ATOM   9196  CA  VAL A1147     138.153 147.073 156.147  1.00  0.79           C  
ATOM   9197  C   VAL A1147     138.717 147.954 155.044  1.00  0.79           C  
ATOM   9198  O   VAL A1147     138.251 147.891 153.907  1.00  0.79           O  
ATOM   9199  CB  VAL A1147     137.213 147.883 157.038  1.00  0.79           C  
ATOM   9200  CG1 VAL A1147     136.252 148.780 156.230  1.00  0.79           C  
ATOM   9201  CG2 VAL A1147     136.390 146.901 157.887  1.00  0.79           C  
ATOM   9202  N   ASN A1148     139.766 148.757 155.321  1.00  0.75           N  
ATOM   9203  CA  ASN A1148     140.435 149.540 154.288  1.00  0.75           C  
ATOM   9204  C   ASN A1148     141.069 148.654 153.200  1.00  0.75           C  
ATOM   9205  O   ASN A1148     140.826 148.846 152.014  1.00  0.75           O  
ATOM   9206  CB  ASN A1148     141.474 150.503 154.927  1.00  0.75           C  
ATOM   9207  CG  ASN A1148     140.760 151.581 155.748  1.00  0.75           C  
ATOM   9208  OD1 ASN A1148     139.633 151.984 155.463  1.00  0.75           O  
ATOM   9209  ND2 ASN A1148     141.436 152.104 156.800  1.00  0.75           N  
ATOM   9210  N   SER A1149     141.777 147.570 153.594  1.00  0.80           N  
ATOM   9211  CA  SER A1149     142.340 146.559 152.681  1.00  0.80           C  
ATOM   9212  C   SER A1149     141.296 145.888 151.776  1.00  0.80           C  
ATOM   9213  O   SER A1149     141.504 145.640 150.589  1.00  0.80           O  
ATOM   9214  CB  SER A1149     143.107 145.482 153.507  1.00  0.80           C  
ATOM   9215  OG  SER A1149     143.730 144.476 152.706  1.00  0.80           O  
ATOM   9216  N   SER A1150     140.086 145.624 152.312  1.00  0.78           N  
ATOM   9217  CA  SER A1150     138.933 145.127 151.558  1.00  0.78           C  
ATOM   9218  C   SER A1150     138.487 146.034 150.409  1.00  0.78           C  
ATOM   9219  O   SER A1150     138.111 145.564 149.334  1.00  0.78           O  
ATOM   9220  CB  SER A1150     137.733 144.889 152.518  1.00  0.78           C  
ATOM   9221  OG  SER A1150     136.599 144.282 151.892  1.00  0.78           O  
ATOM   9222  N   ILE A1151     138.523 147.369 150.600  1.00  0.76           N  
ATOM   9223  CA  ILE A1151     138.244 148.352 149.554  1.00  0.76           C  
ATOM   9224  C   ILE A1151     139.272 148.307 148.424  1.00  0.76           C  
ATOM   9225  O   ILE A1151     138.917 148.306 147.242  1.00  0.76           O  
ATOM   9226  CB  ILE A1151     138.128 149.758 150.140  1.00  0.76           C  
ATOM   9227  CG1 ILE A1151     137.015 149.847 151.211  1.00  0.76           C  
ATOM   9228  CG2 ILE A1151     137.907 150.820 149.044  1.00  0.76           C  
ATOM   9229  CD1 ILE A1151     135.597 149.540 150.717  1.00  0.76           C  
ATOM   9230  N   ASP A1152     140.573 148.188 148.760  1.00  0.76           N  
ATOM   9231  CA  ASP A1152     141.651 148.027 147.795  1.00  0.76           C  
ATOM   9232  C   ASP A1152     141.475 146.778 146.914  1.00  0.76           C  
ATOM   9233  O   ASP A1152     141.619 146.826 145.691  1.00  0.76           O  
ATOM   9234  CB  ASP A1152     143.023 147.989 148.519  1.00  0.76           C  
ATOM   9235  CG  ASP A1152     143.280 149.263 149.314  1.00  0.76           C  
ATOM   9236  OD1 ASP A1152     142.704 150.319 148.952  1.00  0.76           O  
ATOM   9237  OD2 ASP A1152     144.073 149.178 150.287  1.00  0.76           O  
ATOM   9238  N   VAL A1153     141.074 145.628 147.503  1.00  0.78           N  
ATOM   9239  CA  VAL A1153     140.701 144.423 146.760  1.00  0.78           C  
ATOM   9240  C   VAL A1153     139.521 144.622 145.798  1.00  0.78           C  
ATOM   9241  O   VAL A1153     139.586 144.204 144.643  1.00  0.78           O  
ATOM   9242  CB  VAL A1153     140.402 143.250 147.699  1.00  0.78           C  
ATOM   9243  CG1 VAL A1153     139.912 142.007 146.945  1.00  0.78           C  
ATOM   9244  CG2 VAL A1153     141.667 142.845 148.463  1.00  0.78           C  
ATOM   9245  N   ASP A1154     138.415 145.289 146.211  1.00  0.75           N  
ATOM   9246  CA  ASP A1154     137.266 145.570 145.339  1.00  0.75           C  
ATOM   9247  C   ASP A1154     137.647 146.436 144.134  1.00  0.75           C  
ATOM   9248  O   ASP A1154     137.315 146.119 142.987  1.00  0.75           O  
ATOM   9249  CB  ASP A1154     136.100 146.175 146.180  1.00  0.75           C  
ATOM   9250  CG  ASP A1154     134.721 146.309 145.525  1.00  0.75           C  
ATOM   9251  OD1 ASP A1154     134.592 146.522 144.295  1.00  0.75           O  
ATOM   9252  OD2 ASP A1154     133.733 146.223 146.303  1.00  0.75           O  
ATOM   9253  N   SER A1155     138.467 147.488 144.367  1.00  0.76           N  
ATOM   9254  CA  SER A1155     138.999 148.385 143.338  1.00  0.76           C  
ATOM   9255  C   SER A1155     139.742 147.658 142.220  1.00  0.76           C  
ATOM   9256  O   SER A1155     139.531 147.913 141.034  1.00  0.76           O  
ATOM   9257  CB  SER A1155     139.956 149.443 143.967  1.00  0.76           C  
ATOM   9258  OG  SER A1155     140.441 150.406 143.021  1.00  0.76           O  
ATOM   9259  N   LEU A1156     140.593 146.676 142.573  1.00  0.78           N  
ATOM   9260  CA  LEU A1156     141.299 145.843 141.611  1.00  0.78           C  
ATOM   9261  C   LEU A1156     140.427 144.797 140.917  1.00  0.78           C  
ATOM   9262  O   LEU A1156     140.679 144.384 139.786  1.00  0.78           O  
ATOM   9263  CB  LEU A1156     142.470 145.122 142.312  1.00  0.78           C  
ATOM   9264  CG  LEU A1156     143.523 146.049 142.950  1.00  0.78           C  
ATOM   9265  CD1 LEU A1156     144.575 145.212 143.684  1.00  0.78           C  
ATOM   9266  CD2 LEU A1156     144.196 146.974 141.931  1.00  0.78           C  
ATOM   9267  N   MET A1157     139.325 144.363 141.547  1.00  0.74           N  
ATOM   9268  CA  MET A1157     138.419 143.370 140.993  1.00  0.74           C  
ATOM   9269  C   MET A1157     137.530 143.907 139.882  1.00  0.74           C  
ATOM   9270  O   MET A1157     136.870 143.157 139.160  1.00  0.74           O  
ATOM   9271  CB  MET A1157     137.577 142.770 142.125  1.00  0.74           C  
ATOM   9272  CG  MET A1157     138.417 141.793 142.957  1.00  0.74           C  
ATOM   9273  SD  MET A1157     138.547 140.172 142.153  1.00  0.74           S  
ATOM   9274  CE  MET A1157     139.375 139.338 143.527  1.00  0.74           C  
ATOM   9275  N   ARG A1158     137.523 145.238 139.683  1.00  0.68           N  
ATOM   9276  CA  ARG A1158     137.003 145.867 138.481  1.00  0.68           C  
ATOM   9277  C   ARG A1158     137.738 145.445 137.223  1.00  0.68           C  
ATOM   9278  O   ARG A1158     137.132 145.214 136.183  1.00  0.68           O  
ATOM   9279  CB  ARG A1158     137.021 147.410 138.603  1.00  0.68           C  
ATOM   9280  CG  ARG A1158     136.201 147.993 139.777  1.00  0.68           C  
ATOM   9281  CD  ARG A1158     134.693 147.711 139.755  1.00  0.68           C  
ATOM   9282  NE  ARG A1158     134.515 146.339 140.336  1.00  0.68           N  
ATOM   9283  CZ  ARG A1158     133.699 145.390 139.862  1.00  0.68           C  
ATOM   9284  NH1 ARG A1158     132.757 145.685 138.964  1.00  0.68           N  
ATOM   9285  NH2 ARG A1158     133.792 144.143 140.323  1.00  0.68           N  
ATOM   9286  N   SER A1159     139.068 145.284 137.288  1.00  0.79           N  
ATOM   9287  CA  SER A1159     139.863 144.762 136.184  1.00  0.79           C  
ATOM   9288  C   SER A1159     139.477 143.333 135.819  1.00  0.79           C  
ATOM   9289  O   SER A1159     139.347 142.980 134.650  1.00  0.79           O  
ATOM   9290  CB  SER A1159     141.376 144.853 136.489  1.00  0.79           C  
ATOM   9291  OG  SER A1159     141.719 146.201 136.818  1.00  0.79           O  
ATOM   9292  N   VAL A1160     139.199 142.481 136.831  1.00  0.80           N  
ATOM   9293  CA  VAL A1160     138.721 141.113 136.641  1.00  0.80           C  
ATOM   9294  C   VAL A1160     137.374 141.042 135.914  1.00  0.80           C  
ATOM   9295  O   VAL A1160     137.182 140.263 134.980  1.00  0.80           O  
ATOM   9296  CB  VAL A1160     138.615 140.366 137.974  1.00  0.80           C  
ATOM   9297  CG1 VAL A1160     138.249 138.890 137.747  1.00  0.80           C  
ATOM   9298  CG2 VAL A1160     139.954 140.420 138.726  1.00  0.80           C  
ATOM   9299  N   SER A1161     136.397 141.896 136.294  1.00  0.79           N  
ATOM   9300  CA  SER A1161     135.103 141.969 135.612  1.00  0.79           C  
ATOM   9301  C   SER A1161     135.184 142.440 134.163  1.00  0.79           C  
ATOM   9302  O   SER A1161     134.489 141.935 133.280  1.00  0.79           O  
ATOM   9303  CB  SER A1161     134.031 142.779 136.400  1.00  0.79           C  
ATOM   9304  OG  SER A1161     134.314 144.178 136.473  1.00  0.79           O  
ATOM   9305  N   ARG A1162     136.063 143.417 133.868  1.00  0.75           N  
ATOM   9306  CA  ARG A1162     136.352 143.873 132.519  1.00  0.75           C  
ATOM   9307  C   ARG A1162     136.996 142.835 131.607  1.00  0.75           C  
ATOM   9308  O   ARG A1162     136.686 142.804 130.413  1.00  0.75           O  
ATOM   9309  CB  ARG A1162     137.227 145.143 132.522  1.00  0.75           C  
ATOM   9310  CG  ARG A1162     136.563 146.349 133.204  1.00  0.75           C  
ATOM   9311  CD  ARG A1162     137.494 147.562 133.294  1.00  0.75           C  
ATOM   9312  NE  ARG A1162     137.303 148.357 132.032  1.00  0.75           N  
ATOM   9313  CZ  ARG A1162     138.277 148.646 131.160  1.00  0.75           C  
ATOM   9314  NH1 ARG A1162     139.504 148.152 131.208  1.00  0.75           N  
ATOM   9315  NH2 ARG A1162     138.004 149.498 130.176  1.00  0.75           N  
ATOM   9316  N   VAL A1163     137.901 141.983 132.139  1.00  0.83           N  
ATOM   9317  CA  VAL A1163     138.446 140.819 131.443  1.00  0.83           C  
ATOM   9318  C   VAL A1163     137.382 139.784 131.111  1.00  0.83           C  
ATOM   9319  O   VAL A1163     137.260 139.359 129.962  1.00  0.83           O  
ATOM   9320  CB  VAL A1163     139.573 140.171 132.249  1.00  0.83           C  
ATOM   9321  CG1 VAL A1163     139.997 138.796 131.691  1.00  0.83           C  
ATOM   9322  CG2 VAL A1163     140.788 141.114 132.236  1.00  0.83           C  
ATOM   9323  N   PHE A1164     136.522 139.408 132.087  1.00  0.78           N  
ATOM   9324  CA  PHE A1164     135.445 138.446 131.874  1.00  0.78           C  
ATOM   9325  C   PHE A1164     134.458 138.877 130.795  1.00  0.78           C  
ATOM   9326  O   PHE A1164     134.047 138.079 129.964  1.00  0.78           O  
ATOM   9327  CB  PHE A1164     134.666 138.115 133.183  1.00  0.78           C  
ATOM   9328  CG  PHE A1164     135.387 137.110 134.048  1.00  0.78           C  
ATOM   9329  CD1 PHE A1164     135.838 135.896 133.500  1.00  0.78           C  
ATOM   9330  CD2 PHE A1164     135.564 137.331 135.427  1.00  0.78           C  
ATOM   9331  CE1 PHE A1164     136.504 134.953 134.292  1.00  0.78           C  
ATOM   9332  CE2 PHE A1164     136.207 136.377 136.230  1.00  0.78           C  
ATOM   9333  CZ  PHE A1164     136.695 135.197 135.657  1.00  0.78           C  
ATOM   9334  N   LYS A1165     134.119 140.175 130.727  1.00  0.73           N  
ATOM   9335  CA  LYS A1165     133.274 140.735 129.684  1.00  0.73           C  
ATOM   9336  C   LYS A1165     133.768 140.516 128.246  1.00  0.73           C  
ATOM   9337  O   LYS A1165     132.983 140.316 127.324  1.00  0.73           O  
ATOM   9338  CB  LYS A1165     133.095 142.244 129.979  1.00  0.73           C  
ATOM   9339  CG  LYS A1165     132.030 142.938 129.118  1.00  0.73           C  
ATOM   9340  CD  LYS A1165     131.515 144.259 129.720  1.00  0.73           C  
ATOM   9341  CE  LYS A1165     132.597 145.299 130.019  1.00  0.73           C  
ATOM   9342  NZ  LYS A1165     131.982 146.498 130.640  1.00  0.73           N  
ATOM   9343  N   PHE A1166     135.097 140.542 128.015  1.00  0.80           N  
ATOM   9344  CA  PHE A1166     135.688 140.151 126.739  1.00  0.80           C  
ATOM   9345  C   PHE A1166     135.696 138.634 126.504  1.00  0.80           C  
ATOM   9346  O   PHE A1166     135.578 138.153 125.378  1.00  0.80           O  
ATOM   9347  CB  PHE A1166     137.136 140.702 126.615  1.00  0.80           C  
ATOM   9348  CG  PHE A1166     137.227 142.052 125.937  1.00  0.80           C  
ATOM   9349  CD1 PHE A1166     136.207 143.023 125.996  1.00  0.80           C  
ATOM   9350  CD2 PHE A1166     138.373 142.332 125.170  1.00  0.80           C  
ATOM   9351  CE1 PHE A1166     136.311 144.215 125.265  1.00  0.80           C  
ATOM   9352  CE2 PHE A1166     138.486 143.526 124.449  1.00  0.80           C  
ATOM   9353  CZ  PHE A1166     137.448 144.464 124.487  1.00  0.80           C  
ATOM   9354  N   ILE A1167     135.830 137.817 127.565  1.00  0.79           N  
ATOM   9355  CA  ILE A1167     135.702 136.361 127.484  1.00  0.79           C  
ATOM   9356  C   ILE A1167     134.300 135.933 127.059  1.00  0.79           C  
ATOM   9357  O   ILE A1167     134.127 135.022 126.251  1.00  0.79           O  
ATOM   9358  CB  ILE A1167     136.153 135.660 128.766  1.00  0.79           C  
ATOM   9359  CG1 ILE A1167     137.635 136.014 129.031  1.00  0.79           C  
ATOM   9360  CG2 ILE A1167     135.978 134.133 128.616  1.00  0.79           C  
ATOM   9361  CD1 ILE A1167     138.230 135.421 130.310  1.00  0.79           C  
ATOM   9362  N   ASP A1168     133.270 136.647 127.546  1.00  0.74           N  
ATOM   9363  CA  ASP A1168     131.878 136.327 127.315  1.00  0.74           C  
ATOM   9364  C   ASP A1168     131.367 136.924 125.975  1.00  0.74           C  
ATOM   9365  O   ASP A1168     130.184 136.825 125.639  1.00  0.74           O  
ATOM   9366  CB  ASP A1168     131.042 136.837 128.544  1.00  0.74           C  
ATOM   9367  CG  ASP A1168     131.361 136.118 129.844  1.00  0.74           C  
ATOM   9368  OD1 ASP A1168     131.937 135.004 129.784  1.00  0.74           O  
ATOM   9369  OD2 ASP A1168     131.016 136.622 130.949  1.00  0.74           O  
ATOM   9370  N   MET A1169     132.261 137.501 125.122  1.00  0.76           N  
ATOM   9371  CA  MET A1169     131.956 137.898 123.746  1.00  0.76           C  
ATOM   9372  C   MET A1169     131.476 136.722 122.877  1.00  0.76           C  
ATOM   9373  O   MET A1169     132.009 135.613 122.974  1.00  0.76           O  
ATOM   9374  CB  MET A1169     133.164 138.577 123.026  1.00  0.76           C  
ATOM   9375  CG  MET A1169     133.411 140.041 123.456  1.00  0.76           C  
ATOM   9376  SD  MET A1169     135.059 140.731 123.070  1.00  0.76           S  
ATOM   9377  CE  MET A1169     135.154 140.400 121.292  1.00  0.76           C  
ATOM   9378  N   PRO A1170     130.481 136.864 121.998  1.00  0.75           N  
ATOM   9379  CA  PRO A1170     130.049 135.757 121.157  1.00  0.75           C  
ATOM   9380  C   PRO A1170     131.086 135.453 120.089  1.00  0.75           C  
ATOM   9381  O   PRO A1170     131.680 136.364 119.530  1.00  0.75           O  
ATOM   9382  CB  PRO A1170     128.712 136.262 120.581  1.00  0.75           C  
ATOM   9383  CG  PRO A1170     128.890 137.780 120.500  1.00  0.75           C  
ATOM   9384  CD  PRO A1170     129.708 138.090 121.754  1.00  0.75           C  
ATOM   9385  N   THR A1171     131.333 134.160 119.804  1.00  0.68           N  
ATOM   9386  CA  THR A1171     132.164 133.694 118.700  1.00  0.68           C  
ATOM   9387  C   THR A1171     131.298 133.600 117.473  1.00  0.68           C  
ATOM   9388  O   THR A1171     130.090 133.380 117.569  1.00  0.68           O  
ATOM   9389  CB  THR A1171     132.876 132.361 118.990  1.00  0.68           C  
ATOM   9390  OG1 THR A1171     133.376 131.658 117.849  1.00  0.68           O  
ATOM   9391  CG2 THR A1171     131.931 131.390 119.656  1.00  0.68           C  
ATOM   9392  N   GLU A1172     131.903 133.767 116.289  1.00  0.67           N  
ATOM   9393  CA  GLU A1172     131.256 133.843 115.002  1.00  0.67           C  
ATOM   9394  C   GLU A1172     130.541 132.541 114.639  1.00  0.67           C  
ATOM   9395  O   GLU A1172     131.098 131.644 114.014  1.00  0.67           O  
ATOM   9396  CB  GLU A1172     132.386 134.199 114.008  1.00  0.67           C  
ATOM   9397  CG  GLU A1172     132.001 134.659 112.587  1.00  0.67           C  
ATOM   9398  CD  GLU A1172     133.248 135.039 111.779  1.00  0.67           C  
ATOM   9399  OE1 GLU A1172     133.077 135.639 110.694  1.00  0.67           O  
ATOM   9400  OE2 GLU A1172     134.414 134.747 112.182  1.00  0.67           O  
ATOM   9401  N   GLY A1173     129.290 132.341 115.103  1.00  0.59           N  
ATOM   9402  CA  GLY A1173     128.585 131.083 114.917  1.00  0.59           C  
ATOM   9403  C   GLY A1173     128.921 129.967 115.886  1.00  0.59           C  
ATOM   9404  O   GLY A1173     128.724 128.833 115.530  1.00  0.59           O  
ATOM   9405  N   LYS A1174     129.452 130.188 117.113  1.00  0.36           N  
ATOM   9406  CA  LYS A1174     129.605 129.160 118.192  1.00  0.36           C  
ATOM   9407  C   LYS A1174     129.806 127.645 117.808  1.00  0.36           C  
ATOM   9408  O   LYS A1174     130.629 127.455 116.906  1.00  0.36           O  
ATOM   9409  CB  LYS A1174     128.609 129.410 119.350  1.00  0.36           C  
ATOM   9410  CG  LYS A1174     128.610 130.796 119.954  1.00  0.36           C  
ATOM   9411  CD  LYS A1174     127.814 130.816 121.256  1.00  0.36           C  
ATOM   9412  CE  LYS A1174     128.031 132.142 121.990  1.00  0.36           C  
ATOM   9413  NZ  LYS A1174     127.375 132.245 123.318  1.00  0.36           N  
ATOM   9414  N   PRO A1175     129.202 126.531 118.346  1.00  0.36           N  
ATOM   9415  CA  PRO A1175     129.045 125.270 117.616  1.00  0.36           C  
ATOM   9416  C   PRO A1175     127.744 125.316 116.805  1.00  0.36           C  
ATOM   9417  O   PRO A1175     127.058 124.306 116.684  1.00  0.36           O  
ATOM   9418  CB  PRO A1175     128.937 124.225 118.751  1.00  0.36           C  
ATOM   9419  CG  PRO A1175     128.192 124.941 119.873  1.00  0.36           C  
ATOM   9420  CD  PRO A1175     128.586 126.402 119.674  1.00  0.36           C  
ATOM   9421  N   THR A1176     127.406 126.480 116.214  1.00  0.32           N  
ATOM   9422  CA  THR A1176     126.298 126.693 115.278  1.00  0.32           C  
ATOM   9423  C   THR A1176     126.846 126.950 113.873  1.00  0.32           C  
ATOM   9424  O   THR A1176     126.095 127.137 112.920  1.00  0.32           O  
ATOM   9425  CB  THR A1176     125.325 127.827 115.663  1.00  0.32           C  
ATOM   9426  OG1 THR A1176     125.913 129.123 115.688  1.00  0.32           O  
ATOM   9427  CG2 THR A1176     124.753 127.604 117.072  1.00  0.32           C  
ATOM   9428  N   LYS A1177     128.196 126.908 113.709  1.00  0.40           N  
ATOM   9429  CA  LYS A1177     128.957 127.067 112.472  1.00  0.40           C  
ATOM   9430  C   LYS A1177     128.612 125.952 111.509  1.00  0.40           C  
ATOM   9431  O   LYS A1177     128.674 126.115 110.296  1.00  0.40           O  
ATOM   9432  CB  LYS A1177     130.502 127.028 112.698  1.00  0.40           C  
ATOM   9433  CG  LYS A1177     131.096 128.244 113.435  1.00  0.40           C  
ATOM   9434  CD  LYS A1177     132.612 128.174 113.699  1.00  0.40           C  
ATOM   9435  CE  LYS A1177     133.212 129.458 114.292  1.00  0.40           C  
ATOM   9436  NZ  LYS A1177     132.628 129.699 115.622  1.00  0.40           N  
ATOM   9437  N   SER A1178     128.255 124.792 112.079  1.00  0.33           N  
ATOM   9438  CA  SER A1178     127.645 123.684 111.392  1.00  0.33           C  
ATOM   9439  C   SER A1178     126.964 122.839 112.435  1.00  0.33           C  
ATOM   9440  O   SER A1178     127.104 123.074 113.633  1.00  0.33           O  
ATOM   9441  CB  SER A1178     128.630 122.762 110.648  1.00  0.33           C  
ATOM   9442  OG  SER A1178     129.609 122.184 111.518  1.00  0.33           O  
ATOM   9443  N   THR A1179     126.212 121.815 111.994  1.00  0.29           N  
ATOM   9444  CA  THR A1179     125.635 120.796 112.864  1.00  0.29           C  
ATOM   9445  C   THR A1179     126.345 119.467 112.722  1.00  0.29           C  
ATOM   9446  O   THR A1179     126.127 118.524 113.479  1.00  0.29           O  
ATOM   9447  CB  THR A1179     124.181 120.557 112.509  1.00  0.29           C  
ATOM   9448  OG1 THR A1179     124.012 120.198 111.138  1.00  0.29           O  
ATOM   9449  CG2 THR A1179     123.434 121.878 112.717  1.00  0.29           C  
ATOM   9450  N   LYS A1180     127.236 119.377 111.726  1.00  0.38           N  
ATOM   9451  CA  LYS A1180     128.057 118.235 111.442  1.00  0.38           C  
ATOM   9452  C   LYS A1180     129.486 118.773 111.333  1.00  0.38           C  
ATOM   9453  O   LYS A1180     129.712 119.725 110.585  1.00  0.38           O  
ATOM   9454  CB  LYS A1180     127.610 117.556 110.117  1.00  0.38           C  
ATOM   9455  CG  LYS A1180     126.178 116.982 110.198  1.00  0.38           C  
ATOM   9456  CD  LYS A1180     125.690 116.260 108.929  1.00  0.38           C  
ATOM   9457  CE  LYS A1180     124.257 115.735 109.079  1.00  0.38           C  
ATOM   9458  NZ  LYS A1180     123.827 115.058 107.836  1.00  0.38           N  
ATOM   9459  N   PRO A1181     130.505 118.292 112.022  1.00  0.26           N  
ATOM   9460  CA  PRO A1181     131.896 118.456 111.569  1.00  0.26           C  
ATOM   9461  C   PRO A1181     132.147 118.143 110.077  1.00  0.26           C  
ATOM   9462  O   PRO A1181     131.523 117.229 109.578  1.00  0.26           O  
ATOM   9463  CB  PRO A1181     132.700 117.625 112.601  1.00  0.26           C  
ATOM   9464  CG  PRO A1181     131.717 117.080 113.662  1.00  0.26           C  
ATOM   9465  CD  PRO A1181     130.351 117.232 113.020  1.00  0.26           C  
ATOM   9466  N   TYR A1182     133.087 118.862 109.375  1.00  0.20           N  
ATOM   9467  CA  TYR A1182     133.519 118.689 107.985  1.00  0.20           C  
ATOM   9468  C   TYR A1182     133.195 117.346 107.354  1.00  0.20           C  
ATOM   9469  O   TYR A1182     132.573 117.182 106.306  1.00  0.20           O  
ATOM   9470  CB  TYR A1182     135.048 118.715 108.079  1.00  0.20           C  
ATOM   9471  CG  TYR A1182     135.794 119.082 106.809  1.00  0.20           C  
ATOM   9472  CD1 TYR A1182     135.244 119.047 105.492  1.00  0.20           C  
ATOM   9473  CD2 TYR A1182     137.199 119.141 106.867  1.00  0.20           C  
ATOM   9474  CE1 TYR A1182     136.041 119.259 104.342  1.00  0.20           C  
ATOM   9475  CE2 TYR A1182     138.006 119.293 105.732  1.00  0.20           C  
ATOM   9476  CZ  TYR A1182     137.428 119.372 104.470  1.00  0.20           C  
ATOM   9477  OH  TYR A1182     138.268 119.389 103.339  1.00  0.20           O  
ATOM   9478  N   LYS A1183     133.756 116.374 108.072  1.00  0.26           N  
ATOM   9479  CA  LYS A1183     133.972 115.015 107.805  1.00  0.26           C  
ATOM   9480  C   LYS A1183     133.408 114.277 109.006  1.00  0.26           C  
ATOM   9481  O   LYS A1183     132.817 113.221 108.873  1.00  0.26           O  
ATOM   9482  CB  LYS A1183     135.510 114.775 107.746  1.00  0.26           C  
ATOM   9483  CG  LYS A1183     136.284 115.514 106.634  1.00  0.26           C  
ATOM   9484  CD  LYS A1183     135.674 115.542 105.218  1.00  0.26           C  
ATOM   9485  CE  LYS A1183     136.629 116.030 104.110  1.00  0.26           C  
ATOM   9486  NZ  LYS A1183     135.910 116.158 102.811  1.00  0.26           N  
ATOM   9487  N   ASN A1184     133.551 114.786 110.251  1.00  0.26           N  
ATOM   9488  CA  ASN A1184     133.022 114.112 111.446  1.00  0.26           C  
ATOM   9489  C   ASN A1184     133.732 112.762 111.648  1.00  0.26           C  
ATOM   9490  O   ASN A1184     133.140 111.735 111.948  1.00  0.26           O  
ATOM   9491  CB  ASN A1184     131.467 114.012 111.395  1.00  0.26           C  
ATOM   9492  CG  ASN A1184     130.807 113.670 112.727  1.00  0.26           C  
ATOM   9493  OD1 ASN A1184     131.407 113.635 113.799  1.00  0.26           O  
ATOM   9494  ND2 ASN A1184     129.470 113.471 112.644  1.00  0.26           N  
ATOM   9495  N   GLY A1185     135.063 112.758 111.402  1.00  0.25           N  
ATOM   9496  CA  GLY A1185     135.886 111.559 111.294  1.00  0.25           C  
ATOM   9497  C   GLY A1185     135.826 110.850 109.964  1.00  0.25           C  
ATOM   9498  O   GLY A1185     136.638 109.958 109.740  1.00  0.25           O  
ATOM   9499  N   GLN A1186     134.948 111.271 109.013  1.00  0.21           N  
ATOM   9500  CA  GLN A1186     134.772 110.669 107.675  1.00  0.21           C  
ATOM   9501  C   GLN A1186     136.105 110.574 106.967  1.00  0.21           C  
ATOM   9502  O   GLN A1186     136.447 109.561 106.371  1.00  0.21           O  
ATOM   9503  CB  GLN A1186     133.823 111.551 106.799  1.00  0.21           C  
ATOM   9504  CG  GLN A1186     133.475 111.226 105.321  1.00  0.21           C  
ATOM   9505  CD  GLN A1186     132.544 110.021 105.177  1.00  0.21           C  
ATOM   9506  OE1 GLN A1186     131.989 109.519 106.157  1.00  0.21           O  
ATOM   9507  NE2 GLN A1186     132.320 109.562 103.926  1.00  0.21           N  
ATOM   9508  N   LEU A1187     136.886 111.666 107.110  1.00  0.17           N  
ATOM   9509  CA  LEU A1187     138.204 111.932 106.597  1.00  0.17           C  
ATOM   9510  C   LEU A1187     138.861 112.853 107.613  1.00  0.17           C  
ATOM   9511  O   LEU A1187     138.233 113.286 108.582  1.00  0.17           O  
ATOM   9512  CB  LEU A1187     138.193 112.668 105.229  1.00  0.17           C  
ATOM   9513  CG  LEU A1187     137.256 112.015 104.213  1.00  0.17           C  
ATOM   9514  CD1 LEU A1187     136.891 112.885 103.020  1.00  0.17           C  
ATOM   9515  CD2 LEU A1187     137.838 110.678 103.774  1.00  0.17           C  
ATOM   9516  N   SER A1188     140.146 113.200 107.410  1.00  0.19           N  
ATOM   9517  CA  SER A1188     140.864 114.180 108.219  1.00  0.19           C  
ATOM   9518  C   SER A1188     140.175 115.552 108.303  1.00  0.19           C  
ATOM   9519  O   SER A1188     139.395 115.946 107.438  1.00  0.19           O  
ATOM   9520  CB  SER A1188     142.330 114.321 107.728  1.00  0.19           C  
ATOM   9521  OG  SER A1188     143.139 115.110 108.606  1.00  0.19           O  
ATOM   9522  N   LYS A1189     140.427 116.314 109.391  1.00  0.24           N  
ATOM   9523  CA  LYS A1189     139.908 117.666 109.585  1.00  0.24           C  
ATOM   9524  C   LYS A1189     140.686 118.679 108.771  1.00  0.24           C  
ATOM   9525  O   LYS A1189     140.245 119.799 108.515  1.00  0.24           O  
ATOM   9526  CB  LYS A1189     140.034 118.112 111.058  1.00  0.24           C  
ATOM   9527  CG  LYS A1189     139.131 117.329 112.015  1.00  0.24           C  
ATOM   9528  CD  LYS A1189     139.297 117.831 113.459  1.00  0.24           C  
ATOM   9529  CE  LYS A1189     138.417 117.086 114.466  1.00  0.24           C  
ATOM   9530  NZ  LYS A1189     138.665 117.595 115.834  1.00  0.24           N  
ATOM   9531  N   VAL A1190     141.880 118.265 108.345  1.00  0.16           N  
ATOM   9532  CA  VAL A1190     142.688 118.941 107.361  1.00  0.16           C  
ATOM   9533  C   VAL A1190     142.181 118.525 105.988  1.00  0.16           C  
ATOM   9534  O   VAL A1190     141.494 117.513 105.832  1.00  0.16           O  
ATOM   9535  CB  VAL A1190     144.160 118.610 107.617  1.00  0.16           C  
ATOM   9536  CG1 VAL A1190     145.124 119.269 106.615  1.00  0.16           C  
ATOM   9537  CG2 VAL A1190     144.522 119.058 109.051  1.00  0.16           C  
ATOM   9538  N   MET A1191     142.466 119.288 104.912  1.00  0.19           N  
ATOM   9539  CA  MET A1191     142.431 118.721 103.579  1.00  0.19           C  
ATOM   9540  C   MET A1191     143.150 117.388 103.450  1.00  0.19           C  
ATOM   9541  O   MET A1191     143.945 116.947 104.284  1.00  0.19           O  
ATOM   9542  CB  MET A1191     143.049 119.633 102.507  1.00  0.19           C  
ATOM   9543  CG  MET A1191     142.516 121.069 102.449  1.00  0.19           C  
ATOM   9544  SD  MET A1191     143.523 122.098 101.337  1.00  0.19           S  
ATOM   9545  CE  MET A1191     143.097 121.308  99.756  1.00  0.19           C  
ATOM   9546  N   ILE A1192     142.864 116.693 102.364  1.00  0.17           N  
ATOM   9547  CA  ILE A1192     143.360 115.362 102.186  1.00  0.17           C  
ATOM   9548  C   ILE A1192     144.828 115.380 101.816  1.00  0.17           C  
ATOM   9549  O   ILE A1192     145.315 116.166 101.007  1.00  0.17           O  
ATOM   9550  CB  ILE A1192     142.597 114.695 101.086  1.00  0.17           C  
ATOM   9551  CG1 ILE A1192     141.063 114.807 101.162  1.00  0.17           C  
ATOM   9552  CG2 ILE A1192     142.932 113.210 100.882  1.00  0.17           C  
ATOM   9553  CD1 ILE A1192     140.413 114.395 102.477  1.00  0.17           C  
ATOM   9554  N   ILE A1193     145.565 114.485 102.457  1.00  0.14           N  
ATOM   9555  CA  ILE A1193     146.973 114.277 102.269  1.00  0.14           C  
ATOM   9556  C   ILE A1193     147.286 113.704 100.888  1.00  0.14           C  
ATOM   9557  O   ILE A1193     148.194 114.140 100.180  1.00  0.14           O  
ATOM   9558  CB  ILE A1193     147.401 113.346 103.386  1.00  0.14           C  
ATOM   9559  CG1 ILE A1193     147.143 114.019 104.761  1.00  0.14           C  
ATOM   9560  CG2 ILE A1193     148.878 112.969 103.189  1.00  0.14           C  
ATOM   9561  CD1 ILE A1193     147.357 113.083 105.953  1.00  0.14           C  
ATOM   9562  N   GLU A1194     146.495 112.703 100.458  1.00  0.21           N  
ATOM   9563  CA  GLU A1194     146.666 112.037  99.191  1.00  0.21           C  
ATOM   9564  C   GLU A1194     145.925 112.790  98.088  1.00  0.21           C  
ATOM   9565  O   GLU A1194     144.762 112.546  97.804  1.00  0.21           O  
ATOM   9566  CB  GLU A1194     146.155 110.577  99.285  1.00  0.21           C  
ATOM   9567  CG  GLU A1194     146.400 109.741  97.999  1.00  0.21           C  
ATOM   9568  CD  GLU A1194     145.986 108.268  98.089  1.00  0.21           C  
ATOM   9569  OE1 GLU A1194     145.469 107.836  99.148  1.00  0.21           O  
ATOM   9570  OE2 GLU A1194     146.221 107.557  97.075  1.00  0.21           O  
ATOM   9571  N   ASN A1195     146.599 113.729  97.388  1.00  0.24           N  
ATOM   9572  CA  ASN A1195     145.996 114.432  96.252  1.00  0.24           C  
ATOM   9573  C   ASN A1195     146.160 113.665  94.937  1.00  0.24           C  
ATOM   9574  O   ASN A1195     145.974 114.196  93.844  1.00  0.24           O  
ATOM   9575  CB  ASN A1195     146.609 115.836  96.023  1.00  0.24           C  
ATOM   9576  CG  ASN A1195     146.332 116.742  97.213  1.00  0.24           C  
ATOM   9577  OD1 ASN A1195     145.189 116.923  97.624  1.00  0.24           O  
ATOM   9578  ND2 ASN A1195     147.400 117.372  97.756  1.00  0.24           N  
ATOM   9579  N   SER A1196     146.509 112.375  95.026  1.00  0.25           N  
ATOM   9580  CA  SER A1196     146.705 111.464  93.915  1.00  0.25           C  
ATOM   9581  C   SER A1196     145.466 110.598  93.862  1.00  0.25           C  
ATOM   9582  O   SER A1196     145.010 110.138  94.897  1.00  0.25           O  
ATOM   9583  CB  SER A1196     147.927 110.552  94.171  1.00  0.25           C  
ATOM   9584  OG  SER A1196     148.248 109.755  93.032  1.00  0.25           O  
ATOM   9585  N   HIS A1197     144.845 110.397  92.681  1.00  0.23           N  
ATOM   9586  CA  HIS A1197     143.587 109.658  92.548  1.00  0.23           C  
ATOM   9587  C   HIS A1197     142.422 110.223  93.348  1.00  0.23           C  
ATOM   9588  O   HIS A1197     141.623 109.471  93.907  1.00  0.23           O  
ATOM   9589  CB  HIS A1197     143.714 108.164  92.899  1.00  0.23           C  
ATOM   9590  CG  HIS A1197     144.827 107.508  92.168  1.00  0.23           C  
ATOM   9591  ND1 HIS A1197     144.721 107.292  90.807  1.00  0.23           N  
ATOM   9592  CD2 HIS A1197     146.022 107.065  92.629  1.00  0.23           C  
ATOM   9593  CE1 HIS A1197     145.854 106.715  90.467  1.00  0.23           C  
ATOM   9594  NE2 HIS A1197     146.679 106.553  91.531  1.00  0.23           N  
ATOM   9595  N   VAL A1198     142.311 111.567  93.406  1.00  0.25           N  
ATOM   9596  CA  VAL A1198     141.266 112.316  94.086  1.00  0.25           C  
ATOM   9597  C   VAL A1198     139.857 111.710  94.053  1.00  0.25           C  
ATOM   9598  O   VAL A1198     139.355 111.296  93.008  1.00  0.25           O  
ATOM   9599  CB  VAL A1198     141.245 113.798  93.664  1.00  0.25           C  
ATOM   9600  CG1 VAL A1198     142.600 114.491  93.925  1.00  0.25           C  
ATOM   9601  CG2 VAL A1198     140.850 113.937  92.187  1.00  0.25           C  
ATOM   9602  N   LYS A1199     139.163 111.624  95.207  1.00  0.28           N  
ATOM   9603  CA  LYS A1199     137.850 111.000  95.254  1.00  0.28           C  
ATOM   9604  C   LYS A1199     136.813 112.038  95.626  1.00  0.28           C  
ATOM   9605  O   LYS A1199     137.093 112.987  96.330  1.00  0.28           O  
ATOM   9606  CB  LYS A1199     137.757 109.848  96.280  1.00  0.28           C  
ATOM   9607  CG  LYS A1199     138.911 108.841  96.154  1.00  0.28           C  
ATOM   9608  CD  LYS A1199     138.860 107.745  97.225  1.00  0.28           C  
ATOM   9609  CE  LYS A1199     139.960 106.694  97.138  1.00  0.28           C  
ATOM   9610  NZ  LYS A1199     139.896 105.875  98.369  1.00  0.28           N  
ATOM   9611  N   LYS A1200     135.549 111.897  95.190  1.00  0.30           N  
ATOM   9612  CA  LYS A1200     134.514 112.889  95.481  1.00  0.30           C  
ATOM   9613  C   LYS A1200     134.021 112.871  96.933  1.00  0.30           C  
ATOM   9614  O   LYS A1200     133.343 113.784  97.397  1.00  0.30           O  
ATOM   9615  CB  LYS A1200     133.315 112.664  94.537  1.00  0.30           C  
ATOM   9616  CG  LYS A1200     133.669 112.889  93.061  1.00  0.30           C  
ATOM   9617  CD  LYS A1200     132.485 112.527  92.159  1.00  0.30           C  
ATOM   9618  CE  LYS A1200     132.767 112.744  90.675  1.00  0.30           C  
ATOM   9619  NZ  LYS A1200     131.579 112.336  89.898  1.00  0.30           N  
ATOM   9620  N   ASP A1201     134.371 111.803  97.668  1.00  0.40           N  
ATOM   9621  CA  ASP A1201     134.152 111.614  99.085  1.00  0.40           C  
ATOM   9622  C   ASP A1201     135.446 112.038  99.784  1.00  0.40           C  
ATOM   9623  O   ASP A1201     135.615 113.172 100.247  1.00  0.40           O  
ATOM   9624  CB  ASP A1201     133.822 110.114  99.291  1.00  0.40           C  
ATOM   9625  CG  ASP A1201     133.464 109.759 100.725  1.00  0.40           C  
ATOM   9626  OD1 ASP A1201     133.359 108.537 100.983  1.00  0.40           O  
ATOM   9627  OD2 ASP A1201     133.311 110.676 101.571  1.00  0.40           O  
ATOM   9628  N   ASP A1202     136.426 111.120  99.822  1.00  0.36           N  
ATOM   9629  CA  ASP A1202     137.822 111.376 100.119  1.00  0.36           C  
ATOM   9630  C   ASP A1202     138.524 112.299  99.128  1.00  0.36           C  
ATOM   9631  O   ASP A1202     139.205 111.794  98.228  1.00  0.36           O  
ATOM   9632  CB  ASP A1202     138.515 110.015 100.227  1.00  0.36           C  
ATOM   9633  CG  ASP A1202     139.825 110.004 100.988  1.00  0.36           C  
ATOM   9634  OD1 ASP A1202     140.390 108.880 101.061  1.00  0.36           O  
ATOM   9635  OD2 ASP A1202     140.249 111.071 101.498  1.00  0.36           O  
ATOM   9636  N   ILE A1203     138.336 113.628  99.308  1.00  0.45           N  
ATOM   9637  CA  ILE A1203     138.772 114.854  98.605  1.00  0.45           C  
ATOM   9638  C   ILE A1203     137.549 115.732  98.391  1.00  0.45           C  
ATOM   9639  O   ILE A1203     136.828 115.622  97.407  1.00  0.45           O  
ATOM   9640  CB  ILE A1203     139.553 114.800  97.278  1.00  0.45           C  
ATOM   9641  CG1 ILE A1203     140.874 114.000  97.231  1.00  0.45           C  
ATOM   9642  CG2 ILE A1203     139.871 116.221  96.781  1.00  0.45           C  
ATOM   9643  CD1 ILE A1203     142.197 114.639  97.558  1.00  0.45           C  
ATOM   9644  N   TRP A1204     137.258 116.684  99.316  1.00  0.46           N  
ATOM   9645  CA  TRP A1204     136.220 117.673  99.011  1.00  0.46           C  
ATOM   9646  C   TRP A1204     136.630 118.701  97.954  1.00  0.46           C  
ATOM   9647  O   TRP A1204     135.875 118.847  96.996  1.00  0.46           O  
ATOM   9648  CB  TRP A1204     135.647 118.394 100.275  1.00  0.46           C  
ATOM   9649  CG  TRP A1204     134.763 119.613 100.004  1.00  0.46           C  
ATOM   9650  CD1 TRP A1204     133.789 119.746  99.051  1.00  0.46           C  
ATOM   9651  CD2 TRP A1204     134.906 120.912 100.614  1.00  0.46           C  
ATOM   9652  NE1 TRP A1204     133.324 121.038  99.020  1.00  0.46           N  
ATOM   9653  CE2 TRP A1204     133.969 121.761  99.990  1.00  0.46           C  
ATOM   9654  CE3 TRP A1204     135.758 121.395 101.605  1.00  0.46           C  
ATOM   9655  CZ2 TRP A1204     133.842 123.086 100.371  1.00  0.46           C  
ATOM   9656  CZ3 TRP A1204     135.622 122.734 101.996  1.00  0.46           C  
ATOM   9657  CH2 TRP A1204     134.677 123.568 101.385  1.00  0.46           C  
ATOM   9658  N   PRO A1205     137.758 119.410  97.992  1.00  0.64           N  
ATOM   9659  CA  PRO A1205     137.962 120.427  96.978  1.00  0.64           C  
ATOM   9660  C   PRO A1205     138.747 119.756  95.881  1.00  0.64           C  
ATOM   9661  O   PRO A1205     139.955 119.548  95.985  1.00  0.64           O  
ATOM   9662  CB  PRO A1205     138.724 121.535  97.721  1.00  0.64           C  
ATOM   9663  CG  PRO A1205     139.504 120.806  98.816  1.00  0.64           C  
ATOM   9664  CD  PRO A1205     138.610 119.619  99.171  1.00  0.64           C  
ATOM   9665  N   SER A1206     138.053 119.396  94.797  1.00  0.59           N  
ATOM   9666  CA  SER A1206     138.659 118.606  93.741  1.00  0.59           C  
ATOM   9667  C   SER A1206     138.449 119.303  92.427  1.00  0.59           C  
ATOM   9668  O   SER A1206     139.383 119.495  91.643  1.00  0.59           O  
ATOM   9669  CB  SER A1206     138.037 117.185  93.677  1.00  0.59           C  
ATOM   9670  OG  SER A1206     138.781 116.323  92.817  1.00  0.59           O  
ATOM   9671  N   GLY A1207     137.214 119.793  92.196  1.00  0.67           N  
ATOM   9672  CA  GLY A1207     136.845 120.398  90.931  1.00  0.67           C  
ATOM   9673  C   GLY A1207     136.968 121.882  91.002  1.00  0.67           C  
ATOM   9674  O   GLY A1207     137.538 122.516  90.117  1.00  0.67           O  
ATOM   9675  N   GLY A1208     136.470 122.487  92.092  1.00  0.81           N  
ATOM   9676  CA  GLY A1208     136.444 123.938  92.212  1.00  0.81           C  
ATOM   9677  C   GLY A1208     135.257 124.547  91.516  1.00  0.81           C  
ATOM   9678  O   GLY A1208     135.227 125.752  91.259  1.00  0.81           O  
ATOM   9679  N   GLN A1209     134.256 123.712  91.172  1.00  0.76           N  
ATOM   9680  CA  GLN A1209     132.971 124.149  90.671  1.00  0.76           C  
ATOM   9681  C   GLN A1209     132.154 124.761  91.786  1.00  0.76           C  
ATOM   9682  O   GLN A1209     132.066 124.235  92.896  1.00  0.76           O  
ATOM   9683  CB  GLN A1209     132.159 122.989  90.036  1.00  0.76           C  
ATOM   9684  CG  GLN A1209     130.751 123.398  89.530  1.00  0.76           C  
ATOM   9685  CD  GLN A1209     130.050 122.271  88.770  1.00  0.76           C  
ATOM   9686  OE1 GLN A1209     130.630 121.585  87.932  1.00  0.76           O  
ATOM   9687  NE2 GLN A1209     128.733 122.094  89.038  1.00  0.76           N  
ATOM   9688  N   MET A1210     131.509 125.904  91.513  1.00  0.80           N  
ATOM   9689  CA  MET A1210     130.758 126.577  92.540  1.00  0.80           C  
ATOM   9690  C   MET A1210     129.530 127.252  91.973  1.00  0.80           C  
ATOM   9691  O   MET A1210     129.563 127.895  90.922  1.00  0.80           O  
ATOM   9692  CB  MET A1210     131.660 127.535  93.354  1.00  0.80           C  
ATOM   9693  CG  MET A1210     132.454 128.559  92.523  1.00  0.80           C  
ATOM   9694  SD  MET A1210     133.770 129.424  93.440  1.00  0.80           S  
ATOM   9695  CE  MET A1210     132.774 130.094  94.802  1.00  0.80           C  
ATOM   9696  N   THR A1211     128.398 127.076  92.680  1.00  0.83           N  
ATOM   9697  CA  THR A1211     127.085 127.581  92.297  1.00  0.83           C  
ATOM   9698  C   THR A1211     126.598 128.466  93.418  1.00  0.83           C  
ATOM   9699  O   THR A1211     126.653 128.088  94.590  1.00  0.83           O  
ATOM   9700  CB  THR A1211     126.046 126.479  92.085  1.00  0.83           C  
ATOM   9701  OG1 THR A1211     126.451 125.600  91.042  1.00  0.83           O  
ATOM   9702  CG2 THR A1211     124.685 127.053  91.662  1.00  0.83           C  
ATOM   9703  N   VAL A1212     126.116 129.677  93.087  1.00  0.85           N  
ATOM   9704  CA  VAL A1212     125.648 130.662  94.048  1.00  0.85           C  
ATOM   9705  C   VAL A1212     124.174 130.889  93.804  1.00  0.85           C  
ATOM   9706  O   VAL A1212     123.743 131.047  92.665  1.00  0.85           O  
ATOM   9707  CB  VAL A1212     126.385 131.991  93.899  1.00  0.85           C  
ATOM   9708  CG1 VAL A1212     125.881 133.030  94.918  1.00  0.85           C  
ATOM   9709  CG2 VAL A1212     127.892 131.754  94.087  1.00  0.85           C  
ATOM   9710  N   LYS A1213     123.355 130.888  94.869  1.00  0.80           N  
ATOM   9711  CA  LYS A1213     121.934 131.142  94.782  1.00  0.80           C  
ATOM   9712  C   LYS A1213     121.532 132.167  95.816  1.00  0.80           C  
ATOM   9713  O   LYS A1213     121.844 132.030  97.000  1.00  0.80           O  
ATOM   9714  CB  LYS A1213     121.127 129.842  95.013  1.00  0.80           C  
ATOM   9715  CG  LYS A1213     121.126 128.909  93.792  1.00  0.80           C  
ATOM   9716  CD  LYS A1213     120.307 129.435  92.598  1.00  0.80           C  
ATOM   9717  CE  LYS A1213     118.821 129.687  92.873  1.00  0.80           C  
ATOM   9718  NZ  LYS A1213     118.189 128.435  93.340  1.00  0.80           N  
ATOM   9719  N   ASP A1214     120.830 133.224  95.363  1.00  0.80           N  
ATOM   9720  CA  ASP A1214     120.126 134.201  96.172  1.00  0.80           C  
ATOM   9721  C   ASP A1214     120.993 134.855  97.248  1.00  0.80           C  
ATOM   9722  O   ASP A1214     120.593 135.097  98.385  1.00  0.80           O  
ATOM   9723  CB  ASP A1214     118.775 133.605  96.655  1.00  0.80           C  
ATOM   9724  CG  ASP A1214     118.029 133.041  95.448  1.00  0.80           C  
ATOM   9725  OD1 ASP A1214     118.143 133.647  94.350  1.00  0.80           O  
ATOM   9726  OD2 ASP A1214     117.411 131.948  95.565  1.00  0.80           O  
ATOM   9727  N   LEU A1215     122.253 135.184  96.890  1.00  0.81           N  
ATOM   9728  CA  LEU A1215     123.192 135.749  97.832  1.00  0.81           C  
ATOM   9729  C   LEU A1215     122.935 137.221  98.056  1.00  0.81           C  
ATOM   9730  O   LEU A1215     123.063 138.055  97.159  1.00  0.81           O  
ATOM   9731  CB  LEU A1215     124.667 135.497  97.431  1.00  0.81           C  
ATOM   9732  CG  LEU A1215     125.740 136.180  98.312  1.00  0.81           C  
ATOM   9733  CD1 LEU A1215     125.724 135.682  99.763  1.00  0.81           C  
ATOM   9734  CD2 LEU A1215     127.132 135.993  97.696  1.00  0.81           C  
ATOM   9735  N   THR A1216     122.598 137.552  99.309  1.00  0.81           N  
ATOM   9736  CA  THR A1216     122.428 138.909  99.782  1.00  0.81           C  
ATOM   9737  C   THR A1216     123.505 139.125 100.815  1.00  0.81           C  
ATOM   9738  O   THR A1216     123.742 138.273 101.675  1.00  0.81           O  
ATOM   9739  CB  THR A1216     121.046 139.179 100.359  1.00  0.81           C  
ATOM   9740  OG1 THR A1216     120.076 138.972  99.341  1.00  0.81           O  
ATOM   9741  CG2 THR A1216     120.881 140.629 100.835  1.00  0.81           C  
ATOM   9742  N   ALA A1217     124.238 140.249 100.702  1.00  0.81           N  
ATOM   9743  CA  ALA A1217     125.377 140.565 101.538  1.00  0.81           C  
ATOM   9744  C   ALA A1217     125.178 141.908 102.208  1.00  0.81           C  
ATOM   9745  O   ALA A1217     124.905 142.919 101.556  1.00  0.81           O  
ATOM   9746  CB  ALA A1217     126.678 140.632 100.712  1.00  0.81           C  
ATOM   9747  N   LYS A1218     125.335 141.953 103.539  1.00  0.74           N  
ATOM   9748  CA  LYS A1218     125.210 143.177 104.298  1.00  0.74           C  
ATOM   9749  C   LYS A1218     126.199 143.162 105.449  1.00  0.74           C  
ATOM   9750  O   LYS A1218     126.465 142.142 106.083  1.00  0.74           O  
ATOM   9751  CB  LYS A1218     123.760 143.399 104.795  1.00  0.74           C  
ATOM   9752  CG  LYS A1218     123.183 142.236 105.614  1.00  0.74           C  
ATOM   9753  CD  LYS A1218     121.676 142.367 105.891  1.00  0.74           C  
ATOM   9754  CE  LYS A1218     120.813 142.265 104.629  1.00  0.74           C  
ATOM   9755  NZ  LYS A1218     119.385 142.228 105.001  1.00  0.74           N  
ATOM   9756  N   TYR A1219     126.833 144.314 105.732  1.00  0.75           N  
ATOM   9757  CA  TYR A1219     127.822 144.421 106.791  1.00  0.75           C  
ATOM   9758  C   TYR A1219     127.230 144.321 108.186  1.00  0.75           C  
ATOM   9759  O   TYR A1219     127.799 143.691 109.075  1.00  0.75           O  
ATOM   9760  CB  TYR A1219     128.638 145.727 106.654  1.00  0.75           C  
ATOM   9761  CG  TYR A1219     129.647 145.560 105.552  1.00  0.75           C  
ATOM   9762  CD1 TYR A1219     130.832 144.857 105.820  1.00  0.75           C  
ATOM   9763  CD2 TYR A1219     129.435 146.072 104.260  1.00  0.75           C  
ATOM   9764  CE1 TYR A1219     131.796 144.674 104.821  1.00  0.75           C  
ATOM   9765  CE2 TYR A1219     130.399 145.882 103.255  1.00  0.75           C  
ATOM   9766  CZ  TYR A1219     131.575 145.175 103.535  1.00  0.75           C  
ATOM   9767  OH  TYR A1219     132.530 144.930 102.527  1.00  0.75           O  
ATOM   9768  N   THR A1220     126.055 144.931 108.400  1.00  0.63           N  
ATOM   9769  CA  THR A1220     125.385 144.972 109.690  1.00  0.63           C  
ATOM   9770  C   THR A1220     124.017 144.318 109.579  1.00  0.63           C  
ATOM   9771  O   THR A1220     123.359 144.365 108.538  1.00  0.63           O  
ATOM   9772  CB  THR A1220     125.250 146.379 110.257  1.00  0.63           C  
ATOM   9773  OG1 THR A1220     124.469 147.221 109.416  1.00  0.63           O  
ATOM   9774  CG2 THR A1220     126.643 147.019 110.381  1.00  0.63           C  
ATOM   9775  N   GLU A1221     123.558 143.620 110.639  1.00  0.57           N  
ATOM   9776  CA  GLU A1221     122.218 143.054 110.690  1.00  0.57           C  
ATOM   9777  C   GLU A1221     121.162 144.137 110.815  1.00  0.57           C  
ATOM   9778  O   GLU A1221     121.219 144.973 111.699  1.00  0.57           O  
ATOM   9779  CB  GLU A1221     122.033 142.092 111.880  1.00  0.57           C  
ATOM   9780  CG  GLU A1221     122.832 140.774 111.776  1.00  0.57           C  
ATOM   9781  CD  GLU A1221     122.536 139.836 112.949  1.00  0.57           C  
ATOM   9782  OE1 GLU A1221     121.681 140.191 113.799  1.00  0.57           O  
ATOM   9783  OE2 GLU A1221     123.167 138.751 112.993  1.00  0.57           O  
ATOM   9784  N   GLY A1222     120.164 144.168 109.912  1.00  0.53           N  
ATOM   9785  CA  GLY A1222     119.240 145.294 109.819  1.00  0.53           C  
ATOM   9786  C   GLY A1222     119.637 146.273 108.752  1.00  0.53           C  
ATOM   9787  O   GLY A1222     118.798 146.891 108.129  1.00  0.53           O  
ATOM   9788  N   GLY A1223     120.963 146.418 108.531  1.00  0.64           N  
ATOM   9789  CA  GLY A1223     121.519 147.389 107.605  1.00  0.64           C  
ATOM   9790  C   GLY A1223     121.199 147.190 106.147  1.00  0.64           C  
ATOM   9791  O   GLY A1223     120.709 146.151 105.695  1.00  0.64           O  
ATOM   9792  N   ASN A1224     121.541 148.210 105.338  1.00  0.65           N  
ATOM   9793  CA  ASN A1224     121.399 148.166 103.896  1.00  0.65           C  
ATOM   9794  C   ASN A1224     122.230 147.063 103.251  1.00  0.65           C  
ATOM   9795  O   ASN A1224     123.358 146.758 103.646  1.00  0.65           O  
ATOM   9796  CB  ASN A1224     121.708 149.528 103.226  1.00  0.65           C  
ATOM   9797  CG  ASN A1224     120.665 150.538 103.683  1.00  0.65           C  
ATOM   9798  OD1 ASN A1224     119.642 150.734 103.027  1.00  0.65           O  
ATOM   9799  ND2 ASN A1224     120.898 151.173 104.848  1.00  0.65           N  
ATOM   9800  N   ALA A1225     121.665 146.405 102.226  1.00  0.77           N  
ATOM   9801  CA  ALA A1225     122.384 145.398 101.493  1.00  0.77           C  
ATOM   9802  C   ALA A1225     123.333 146.030 100.486  1.00  0.77           C  
ATOM   9803  O   ALA A1225     123.078 147.090  99.923  1.00  0.77           O  
ATOM   9804  CB  ALA A1225     121.409 144.422 100.819  1.00  0.77           C  
ATOM   9805  N   ILE A1226     124.490 145.389 100.256  1.00  0.76           N  
ATOM   9806  CA  ILE A1226     125.447 145.866  99.270  1.00  0.76           C  
ATOM   9807  C   ILE A1226     125.281 145.048  98.006  1.00  0.76           C  
ATOM   9808  O   ILE A1226     125.485 145.534  96.896  1.00  0.76           O  
ATOM   9809  CB  ILE A1226     126.882 145.728  99.776  1.00  0.76           C  
ATOM   9810  CG1 ILE A1226     127.085 146.411 101.149  1.00  0.76           C  
ATOM   9811  CG2 ILE A1226     127.880 146.282  98.735  1.00  0.76           C  
ATOM   9812  CD1 ILE A1226     126.862 147.927 101.156  1.00  0.76           C  
ATOM   9813  N   LEU A1227     124.855 143.783  98.153  1.00  0.78           N  
ATOM   9814  CA  LEU A1227     124.579 142.892  97.049  1.00  0.78           C  
ATOM   9815  C   LEU A1227     123.266 142.219  97.366  1.00  0.78           C  
ATOM   9816  O   LEU A1227     123.043 141.827  98.511  1.00  0.78           O  
ATOM   9817  CB  LEU A1227     125.628 141.761  96.852  1.00  0.78           C  
ATOM   9818  CG  LEU A1227     127.013 142.129  96.274  1.00  0.78           C  
ATOM   9819  CD1 LEU A1227     126.920 143.051  95.053  1.00  0.78           C  
ATOM   9820  CD2 LEU A1227     127.965 142.680  97.337  1.00  0.78           C  
ATOM   9821  N   GLU A1228     122.382 142.097  96.361  1.00  0.77           N  
ATOM   9822  CA  GLU A1228     121.044 141.555  96.509  1.00  0.77           C  
ATOM   9823  C   GLU A1228     120.763 140.498  95.460  1.00  0.77           C  
ATOM   9824  O   GLU A1228     120.916 140.737  94.260  1.00  0.77           O  
ATOM   9825  CB  GLU A1228     120.001 142.674  96.328  1.00  0.77           C  
ATOM   9826  CG  GLU A1228     120.026 143.711  97.471  1.00  0.77           C  
ATOM   9827  CD  GLU A1228     119.046 144.859  97.249  1.00  0.77           C  
ATOM   9828  OE1 GLU A1228     118.484 144.968  96.129  1.00  0.77           O  
ATOM   9829  OE2 GLU A1228     118.858 145.631  98.225  1.00  0.77           O  
ATOM   9830  N   ASN A1229     120.334 139.292  95.894  1.00  0.80           N  
ATOM   9831  CA  ASN A1229     119.894 138.194  95.037  1.00  0.80           C  
ATOM   9832  C   ASN A1229     120.907 137.786  93.968  1.00  0.80           C  
ATOM   9833  O   ASN A1229     120.583 137.583  92.797  1.00  0.80           O  
ATOM   9834  CB  ASN A1229     118.502 138.455  94.396  1.00  0.80           C  
ATOM   9835  CG  ASN A1229     117.414 138.537  95.462  1.00  0.80           C  
ATOM   9836  OD1 ASN A1229     117.639 138.560  96.668  1.00  0.80           O  
ATOM   9837  ND2 ASN A1229     116.142 138.572  94.996  1.00  0.80           N  
ATOM   9838  N   ILE A1230     122.187 137.654  94.355  1.00  0.80           N  
ATOM   9839  CA  ILE A1230     123.250 137.308  93.430  1.00  0.80           C  
ATOM   9840  C   ILE A1230     123.231 135.819  93.141  1.00  0.80           C  
ATOM   9841  O   ILE A1230     123.187 134.990  94.050  1.00  0.80           O  
ATOM   9842  CB  ILE A1230     124.615 137.740  93.948  1.00  0.80           C  
ATOM   9843  CG1 ILE A1230     124.638 139.238  94.315  1.00  0.80           C  
ATOM   9844  CG2 ILE A1230     125.737 137.397  92.951  1.00  0.80           C  
ATOM   9845  CD1 ILE A1230     124.239 140.209  93.202  1.00  0.80           C  
ATOM   9846  N   SER A1231     123.242 135.452  91.848  1.00  0.81           N  
ATOM   9847  CA  SER A1231     123.184 134.075  91.400  1.00  0.81           C  
ATOM   9848  C   SER A1231     124.054 133.964  90.167  1.00  0.81           C  
ATOM   9849  O   SER A1231     123.968 134.802  89.271  1.00  0.81           O  
ATOM   9850  CB  SER A1231     121.728 133.665  91.057  1.00  0.81           C  
ATOM   9851  OG  SER A1231     121.607 132.300  90.654  1.00  0.81           O  
ATOM   9852  N   PHE A1232     124.950 132.964  90.132  1.00  0.79           N  
ATOM   9853  CA  PHE A1232     125.815 132.661  89.008  1.00  0.79           C  
ATOM   9854  C   PHE A1232     126.412 131.286  89.254  1.00  0.79           C  
ATOM   9855  O   PHE A1232     126.289 130.727  90.347  1.00  0.79           O  
ATOM   9856  CB  PHE A1232     126.916 133.721  88.691  1.00  0.79           C  
ATOM   9857  CG  PHE A1232     127.830 134.000  89.849  1.00  0.79           C  
ATOM   9858  CD1 PHE A1232     128.971 133.210  90.064  1.00  0.79           C  
ATOM   9859  CD2 PHE A1232     127.553 135.055  90.730  1.00  0.79           C  
ATOM   9860  CE1 PHE A1232     129.794 133.438  91.173  1.00  0.79           C  
ATOM   9861  CE2 PHE A1232     128.385 135.298  91.829  1.00  0.79           C  
ATOM   9862  CZ  PHE A1232     129.499 134.483  92.054  1.00  0.79           C  
ATOM   9863  N   SER A1233     127.101 130.725  88.245  1.00  0.82           N  
ATOM   9864  CA  SER A1233     127.761 129.436  88.373  1.00  0.82           C  
ATOM   9865  C   SER A1233     129.088 129.485  87.657  1.00  0.82           C  
ATOM   9866  O   SER A1233     129.189 129.963  86.528  1.00  0.82           O  
ATOM   9867  CB  SER A1233     126.986 128.258  87.732  1.00  0.82           C  
ATOM   9868  OG  SER A1233     125.758 128.011  88.413  1.00  0.82           O  
ATOM   9869  N   ILE A1234     130.149 128.963  88.295  1.00  0.82           N  
ATOM   9870  CA  ILE A1234     131.489 128.942  87.736  1.00  0.82           C  
ATOM   9871  C   ILE A1234     131.847 127.486  87.482  1.00  0.82           C  
ATOM   9872  O   ILE A1234     131.776 126.642  88.377  1.00  0.82           O  
ATOM   9873  CB  ILE A1234     132.514 129.608  88.660  1.00  0.82           C  
ATOM   9874  CG1 ILE A1234     132.106 131.068  88.981  1.00  0.82           C  
ATOM   9875  CG2 ILE A1234     133.910 129.565  88.010  1.00  0.82           C  
ATOM   9876  CD1 ILE A1234     133.005 131.761  90.012  1.00  0.82           C  
ATOM   9877  N   SER A1235     132.202 127.141  86.223  1.00  0.81           N  
ATOM   9878  CA  SER A1235     132.665 125.811  85.841  1.00  0.81           C  
ATOM   9879  C   SER A1235     134.031 125.477  86.461  1.00  0.81           C  
ATOM   9880  O   SER A1235     134.811 126.392  86.732  1.00  0.81           O  
ATOM   9881  CB  SER A1235     132.659 125.615  84.297  1.00  0.81           C  
ATOM   9882  OG  SER A1235     133.605 126.459  83.655  1.00  0.81           O  
ATOM   9883  N   PRO A1236     134.369 124.229  86.776  1.00  0.81           N  
ATOM   9884  CA  PRO A1236     135.674 123.888  87.344  1.00  0.81           C  
ATOM   9885  C   PRO A1236     136.880 124.262  86.476  1.00  0.81           C  
ATOM   9886  O   PRO A1236     136.952 123.853  85.319  1.00  0.81           O  
ATOM   9887  CB  PRO A1236     135.565 122.374  87.602  1.00  0.81           C  
ATOM   9888  CG  PRO A1236     134.567 121.867  86.564  1.00  0.81           C  
ATOM   9889  CD  PRO A1236     133.598 123.034  86.409  1.00  0.81           C  
ATOM   9890  N   GLY A1237     137.867 125.010  87.026  1.00  0.80           N  
ATOM   9891  CA  GLY A1237     139.164 125.233  86.375  1.00  0.80           C  
ATOM   9892  C   GLY A1237     139.284 126.452  85.499  1.00  0.80           C  
ATOM   9893  O   GLY A1237     140.355 126.743  84.976  1.00  0.80           O  
ATOM   9894  N   GLN A1238     138.201 127.223  85.317  1.00  0.76           N  
ATOM   9895  CA  GLN A1238     138.258 128.451  84.547  1.00  0.76           C  
ATOM   9896  C   GLN A1238     138.619 129.665  85.395  1.00  0.76           C  
ATOM   9897  O   GLN A1238     138.534 129.674  86.624  1.00  0.76           O  
ATOM   9898  CB  GLN A1238     136.941 128.726  83.785  1.00  0.76           C  
ATOM   9899  CG  GLN A1238     135.707 128.825  84.701  1.00  0.76           C  
ATOM   9900  CD  GLN A1238     134.634 129.717  84.089  1.00  0.76           C  
ATOM   9901  OE1 GLN A1238     133.835 129.362  83.227  1.00  0.76           O  
ATOM   9902  NE2 GLN A1238     134.614 130.981  84.568  1.00  0.76           N  
ATOM   9903  N   ARG A1239     139.031 130.759  84.731  1.00  0.78           N  
ATOM   9904  CA  ARG A1239     139.387 131.997  85.389  1.00  0.78           C  
ATOM   9905  C   ARG A1239     138.302 133.036  85.155  1.00  0.78           C  
ATOM   9906  O   ARG A1239     137.705 133.122  84.080  1.00  0.78           O  
ATOM   9907  CB  ARG A1239     140.765 132.535  84.926  1.00  0.78           C  
ATOM   9908  CG  ARG A1239     141.810 131.422  84.695  1.00  0.78           C  
ATOM   9909  CD  ARG A1239     143.242 131.938  84.510  1.00  0.78           C  
ATOM   9910  NE  ARG A1239     144.091 130.805  83.998  1.00  0.78           N  
ATOM   9911  CZ  ARG A1239     144.631 129.826  84.744  1.00  0.78           C  
ATOM   9912  NH1 ARG A1239     144.424 129.712  86.046  1.00  0.78           N  
ATOM   9913  NH2 ARG A1239     145.391 128.901  84.157  1.00  0.78           N  
ATOM   9914  N   VAL A1240     138.000 133.832  86.194  1.00  0.84           N  
ATOM   9915  CA  VAL A1240     136.926 134.810  86.190  1.00  0.84           C  
ATOM   9916  C   VAL A1240     137.509 136.186  86.438  1.00  0.84           C  
ATOM   9917  O   VAL A1240     138.319 136.379  87.345  1.00  0.84           O  
ATOM   9918  CB  VAL A1240     135.874 134.511  87.256  1.00  0.84           C  
ATOM   9919  CG1 VAL A1240     134.721 135.531  87.215  1.00  0.84           C  
ATOM   9920  CG2 VAL A1240     135.300 133.108  87.014  1.00  0.84           C  
ATOM   9921  N   GLY A1241     137.106 137.187  85.628  1.00  0.85           N  
ATOM   9922  CA  GLY A1241     137.452 138.585  85.855  1.00  0.85           C  
ATOM   9923  C   GLY A1241     136.322 139.324  86.518  1.00  0.85           C  
ATOM   9924  O   GLY A1241     135.249 139.502  85.946  1.00  0.85           O  
ATOM   9925  N   LEU A1242     136.532 139.797  87.754  1.00  0.84           N  
ATOM   9926  CA  LEU A1242     135.565 140.596  88.477  1.00  0.84           C  
ATOM   9927  C   LEU A1242     135.821 142.075  88.235  1.00  0.84           C  
ATOM   9928  O   LEU A1242     136.841 142.634  88.632  1.00  0.84           O  
ATOM   9929  CB  LEU A1242     135.635 140.272  89.988  1.00  0.84           C  
ATOM   9930  CG  LEU A1242     134.646 141.027  90.896  1.00  0.84           C  
ATOM   9931  CD1 LEU A1242     133.188 140.801  90.491  1.00  0.84           C  
ATOM   9932  CD2 LEU A1242     134.852 140.608  92.356  1.00  0.84           C  
ATOM   9933  N   LEU A1243     134.876 142.751  87.561  1.00  0.79           N  
ATOM   9934  CA  LEU A1243     135.003 144.133  87.159  1.00  0.79           C  
ATOM   9935  C   LEU A1243     133.942 144.978  87.835  1.00  0.79           C  
ATOM   9936  O   LEU A1243     132.970 144.503  88.422  1.00  0.79           O  
ATOM   9937  CB  LEU A1243     134.851 144.314  85.628  1.00  0.79           C  
ATOM   9938  CG  LEU A1243     135.972 143.677  84.786  1.00  0.79           C  
ATOM   9939  CD1 LEU A1243     135.656 143.811  83.292  1.00  0.79           C  
ATOM   9940  CD2 LEU A1243     137.340 144.297  85.083  1.00  0.79           C  
ATOM   9941  N   GLY A1244     134.125 146.309  87.783  1.00  0.81           N  
ATOM   9942  CA  GLY A1244     133.193 147.245  88.385  1.00  0.81           C  
ATOM   9943  C   GLY A1244     133.926 148.393  88.995  1.00  0.81           C  
ATOM   9944  O   GLY A1244     135.042 148.249  89.505  1.00  0.81           O  
ATOM   9945  N   ARG A1245     133.294 149.581  88.968  1.00  0.74           N  
ATOM   9946  CA  ARG A1245     133.792 150.828  89.529  1.00  0.74           C  
ATOM   9947  C   ARG A1245     134.336 150.685  90.958  1.00  0.74           C  
ATOM   9948  O   ARG A1245     134.029 149.756  91.710  1.00  0.74           O  
ATOM   9949  CB  ARG A1245     132.694 151.934  89.426  1.00  0.74           C  
ATOM   9950  CG  ARG A1245     133.199 153.385  89.616  1.00  0.74           C  
ATOM   9951  CD  ARG A1245     132.121 154.485  89.614  1.00  0.74           C  
ATOM   9952  NE  ARG A1245     132.821 155.762  89.979  1.00  0.74           N  
ATOM   9953  CZ  ARG A1245     132.841 156.311  91.204  1.00  0.74           C  
ATOM   9954  NH1 ARG A1245     132.424 155.671  92.291  1.00  0.74           N  
ATOM   9955  NH2 ARG A1245     133.331 157.542  91.338  1.00  0.74           N  
ATOM   9956  N   THR A1246     135.216 151.582  91.408  1.00  0.80           N  
ATOM   9957  CA  THR A1246     135.574 151.653  92.818  1.00  0.80           C  
ATOM   9958  C   THR A1246     134.370 151.938  93.725  1.00  0.80           C  
ATOM   9959  O   THR A1246     133.524 152.772  93.426  1.00  0.80           O  
ATOM   9960  CB  THR A1246     136.677 152.662  93.065  1.00  0.80           C  
ATOM   9961  OG1 THR A1246     136.415 153.902  92.431  1.00  0.80           O  
ATOM   9962  CG2 THR A1246     137.956 152.190  92.404  1.00  0.80           C  
ATOM   9963  N   GLY A1247     134.238 151.199  94.855  1.00  0.83           N  
ATOM   9964  CA  GLY A1247     133.082 151.331  95.754  1.00  0.83           C  
ATOM   9965  C   GLY A1247     131.841 150.560  95.358  1.00  0.83           C  
ATOM   9966  O   GLY A1247     130.832 150.599  96.050  1.00  0.83           O  
ATOM   9967  N   SER A1248     131.880 149.792  94.253  1.00  0.81           N  
ATOM   9968  CA  SER A1248     130.731 149.020  93.785  1.00  0.81           C  
ATOM   9969  C   SER A1248     130.359 147.799  94.616  1.00  0.81           C  
ATOM   9970  O   SER A1248     129.209 147.371  94.600  1.00  0.81           O  
ATOM   9971  CB  SER A1248     130.913 148.544  92.319  1.00  0.81           C  
ATOM   9972  OG  SER A1248     132.034 147.665  92.162  1.00  0.81           O  
ATOM   9973  N   GLY A1249     131.316 147.223  95.378  1.00  0.82           N  
ATOM   9974  CA  GLY A1249     131.087 146.027  96.190  1.00  0.82           C  
ATOM   9975  C   GLY A1249     131.877 144.806  95.784  1.00  0.82           C  
ATOM   9976  O   GLY A1249     131.567 143.694  96.201  1.00  0.82           O  
ATOM   9977  N   LYS A1250     132.954 144.962  94.989  1.00  0.80           N  
ATOM   9978  CA  LYS A1250     133.826 143.854  94.601  1.00  0.80           C  
ATOM   9979  C   LYS A1250     134.514 143.126  95.765  1.00  0.80           C  
ATOM   9980  O   LYS A1250     134.407 141.909  95.902  1.00  0.80           O  
ATOM   9981  CB  LYS A1250     134.925 144.340  93.621  1.00  0.80           C  
ATOM   9982  CG  LYS A1250     134.425 144.981  92.316  1.00  0.80           C  
ATOM   9983  CD  LYS A1250     135.550 145.245  91.291  1.00  0.80           C  
ATOM   9984  CE  LYS A1250     136.648 146.216  91.725  1.00  0.80           C  
ATOM   9985  NZ  LYS A1250     136.033 147.530  91.980  1.00  0.80           N  
ATOM   9986  N   SER A1251     135.155 143.879  96.691  1.00  0.82           N  
ATOM   9987  CA  SER A1251     135.738 143.364  97.933  1.00  0.82           C  
ATOM   9988  C   SER A1251     134.687 142.705  98.825  1.00  0.82           C  
ATOM   9989  O   SER A1251     134.907 141.666  99.443  1.00  0.82           O  
ATOM   9990  CB  SER A1251     136.453 144.459  98.774  1.00  0.82           C  
ATOM   9991  OG  SER A1251     137.205 145.341  97.940  1.00  0.82           O  
ATOM   9992  N   THR A1252     133.466 143.292  98.869  1.00  0.81           N  
ATOM   9993  CA  THR A1252     132.297 142.775  99.592  1.00  0.81           C  
ATOM   9994  C   THR A1252     131.890 141.392  99.115  1.00  0.81           C  
ATOM   9995  O   THR A1252     131.616 140.502  99.916  1.00  0.81           O  
ATOM   9996  CB  THR A1252     131.060 143.676  99.479  1.00  0.81           C  
ATOM   9997  OG1 THR A1252     131.342 145.002  99.909  1.00  0.81           O  
ATOM   9998  CG2 THR A1252     129.913 143.188 100.370  1.00  0.81           C  
ATOM   9999  N   LEU A1253     131.878 141.155  97.786  1.00  0.81           N  
ATOM  10000  CA  LEU A1253     131.612 139.845  97.206  1.00  0.81           C  
ATOM  10001  C   LEU A1253     132.636 138.784  97.609  1.00  0.81           C  
ATOM  10002  O   LEU A1253     132.285 137.678  98.014  1.00  0.81           O  
ATOM  10003  CB  LEU A1253     131.543 139.955  95.659  1.00  0.81           C  
ATOM  10004  CG  LEU A1253     131.212 138.650  94.901  1.00  0.81           C  
ATOM  10005  CD1 LEU A1253     129.861 138.051  95.310  1.00  0.81           C  
ATOM  10006  CD2 LEU A1253     131.256 138.873  93.382  1.00  0.81           C  
ATOM  10007  N   LEU A1254     133.940 139.118  97.572  1.00  0.83           N  
ATOM  10008  CA  LEU A1254     135.006 138.233  98.027  1.00  0.83           C  
ATOM  10009  C   LEU A1254     134.914 137.877  99.519  1.00  0.83           C  
ATOM  10010  O   LEU A1254     135.026 136.715  99.910  1.00  0.83           O  
ATOM  10011  CB  LEU A1254     136.382 138.853  97.672  1.00  0.83           C  
ATOM  10012  CG  LEU A1254     136.979 138.395  96.319  1.00  0.83           C  
ATOM  10013  CD1 LEU A1254     136.013 138.507  95.133  1.00  0.83           C  
ATOM  10014  CD2 LEU A1254     138.267 139.168  96.011  1.00  0.83           C  
ATOM  10015  N   SER A1255     134.631 138.867 100.390  1.00  0.83           N  
ATOM  10016  CA  SER A1255     134.350 138.669 101.815  1.00  0.83           C  
ATOM  10017  C   SER A1255     133.117 137.820 102.105  1.00  0.83           C  
ATOM  10018  O   SER A1255     133.074 137.067 103.080  1.00  0.83           O  
ATOM  10019  CB  SER A1255     134.183 140.014 102.565  1.00  0.83           C  
ATOM  10020  OG  SER A1255     135.419 140.724 102.604  1.00  0.83           O  
ATOM  10021  N   ALA A1256     132.071 137.908 101.258  1.00  0.84           N  
ATOM  10022  CA  ALA A1256     130.864 137.104 101.349  1.00  0.84           C  
ATOM  10023  C   ALA A1256     131.106 135.599 101.223  1.00  0.84           C  
ATOM  10024  O   ALA A1256     130.517 134.805 101.956  1.00  0.84           O  
ATOM  10025  CB  ALA A1256     129.832 137.576 100.307  1.00  0.84           C  
ATOM  10026  N   PHE A1257     132.029 135.171 100.332  1.00  0.80           N  
ATOM  10027  CA  PHE A1257     132.428 133.775 100.173  1.00  0.80           C  
ATOM  10028  C   PHE A1257     132.996 133.150 101.439  1.00  0.80           C  
ATOM  10029  O   PHE A1257     132.737 131.991 101.748  1.00  0.80           O  
ATOM  10030  CB  PHE A1257     133.507 133.597  99.068  1.00  0.80           C  
ATOM  10031  CG  PHE A1257     133.023 133.991  97.701  1.00  0.80           C  
ATOM  10032  CD1 PHE A1257     131.778 133.560  97.218  1.00  0.80           C  
ATOM  10033  CD2 PHE A1257     133.843 134.760  96.859  1.00  0.80           C  
ATOM  10034  CE1 PHE A1257     131.333 133.931  95.944  1.00  0.80           C  
ATOM  10035  CE2 PHE A1257     133.410 135.130  95.580  1.00  0.80           C  
ATOM  10036  CZ  PHE A1257     132.151 134.722  95.128  1.00  0.80           C  
ATOM  10037  N   LEU A1258     133.769 133.919 102.223  1.00  0.79           N  
ATOM  10038  CA  LEU A1258     134.449 133.429 103.407  1.00  0.79           C  
ATOM  10039  C   LEU A1258     133.616 133.617 104.663  1.00  0.79           C  
ATOM  10040  O   LEU A1258     134.045 133.272 105.767  1.00  0.79           O  
ATOM  10041  CB  LEU A1258     135.763 134.223 103.591  1.00  0.79           C  
ATOM  10042  CG  LEU A1258     136.740 134.102 102.407  1.00  0.79           C  
ATOM  10043  CD1 LEU A1258     137.906 135.081 102.580  1.00  0.79           C  
ATOM  10044  CD2 LEU A1258     137.256 132.669 102.235  1.00  0.79           C  
ATOM  10045  N   ARG A1259     132.390 134.160 104.505  1.00  0.73           N  
ATOM  10046  CA  ARG A1259     131.472 134.498 105.577  1.00  0.73           C  
ATOM  10047  C   ARG A1259     132.062 135.500 106.564  1.00  0.73           C  
ATOM  10048  O   ARG A1259     132.059 135.268 107.766  1.00  0.73           O  
ATOM  10049  CB  ARG A1259     130.899 133.254 106.323  1.00  0.73           C  
ATOM  10050  CG  ARG A1259     130.265 132.185 105.404  1.00  0.73           C  
ATOM  10051  CD  ARG A1259     129.630 130.985 106.132  1.00  0.73           C  
ATOM  10052  NE  ARG A1259     128.282 131.405 106.641  1.00  0.73           N  
ATOM  10053  CZ  ARG A1259     127.142 130.724 106.448  1.00  0.73           C  
ATOM  10054  NH1 ARG A1259     127.085 129.609 105.744  1.00  0.73           N  
ATOM  10055  NH2 ARG A1259     126.007 131.188 106.966  1.00  0.73           N  
ATOM  10056  N   LEU A1260     132.602 136.636 106.074  1.00  0.78           N  
ATOM  10057  CA  LEU A1260     133.170 137.679 106.926  1.00  0.78           C  
ATOM  10058  C   LEU A1260     132.166 138.799 107.177  1.00  0.78           C  
ATOM  10059  O   LEU A1260     132.479 139.845 107.743  1.00  0.78           O  
ATOM  10060  CB  LEU A1260     134.435 138.281 106.265  1.00  0.78           C  
ATOM  10061  CG  LEU A1260     135.661 137.349 106.236  1.00  0.78           C  
ATOM  10062  CD1 LEU A1260     136.734 137.930 105.309  1.00  0.78           C  
ATOM  10063  CD2 LEU A1260     136.235 137.119 107.639  1.00  0.78           C  
ATOM  10064  N   LEU A1261     130.911 138.583 106.762  1.00  0.78           N  
ATOM  10065  CA  LEU A1261     129.823 139.516 106.901  1.00  0.78           C  
ATOM  10066  C   LEU A1261     128.535 138.726 106.902  1.00  0.78           C  
ATOM  10067  O   LEU A1261     128.528 137.517 106.669  1.00  0.78           O  
ATOM  10068  CB  LEU A1261     129.824 140.628 105.816  1.00  0.78           C  
ATOM  10069  CG  LEU A1261     130.045 140.201 104.348  1.00  0.78           C  
ATOM  10070  CD1 LEU A1261     128.829 139.535 103.697  1.00  0.78           C  
ATOM  10071  CD2 LEU A1261     130.453 141.424 103.519  1.00  0.78           C  
ATOM  10072  N   ASN A1262     127.408 139.393 107.200  1.00  0.74           N  
ATOM  10073  CA  ASN A1262     126.105 138.767 107.283  1.00  0.74           C  
ATOM  10074  C   ASN A1262     125.593 138.345 105.910  1.00  0.74           C  
ATOM  10075  O   ASN A1262     125.437 139.154 104.991  1.00  0.74           O  
ATOM  10076  CB  ASN A1262     125.100 139.699 107.993  1.00  0.74           C  
ATOM  10077  CG  ASN A1262     125.668 140.030 109.365  1.00  0.74           C  
ATOM  10078  OD1 ASN A1262     125.806 139.166 110.225  1.00  0.74           O  
ATOM  10079  ND2 ASN A1262     126.079 141.300 109.575  1.00  0.74           N  
ATOM  10080  N   THR A1263     125.360 137.030 105.750  1.00  0.78           N  
ATOM  10081  CA  THR A1263     124.988 136.404 104.493  1.00  0.78           C  
ATOM  10082  C   THR A1263     123.663 135.695 104.642  1.00  0.78           C  
ATOM  10083  O   THR A1263     123.381 135.078 105.667  1.00  0.78           O  
ATOM  10084  CB  THR A1263     126.003 135.391 103.955  1.00  0.78           C  
ATOM  10085  OG1 THR A1263     126.333 134.376 104.902  1.00  0.78           O  
ATOM  10086  CG2 THR A1263     127.311 136.106 103.597  1.00  0.78           C  
ATOM  10087  N   GLU A1264     122.801 135.794 103.609  1.00  0.74           N  
ATOM  10088  CA  GLU A1264     121.453 135.240 103.644  1.00  0.74           C  
ATOM  10089  C   GLU A1264     121.185 134.275 102.470  1.00  0.74           C  
ATOM  10090  O   GLU A1264     120.053 133.858 102.250  1.00  0.74           O  
ATOM  10091  CB  GLU A1264     120.413 136.413 103.616  1.00  0.74           C  
ATOM  10092  CG  GLU A1264     120.491 137.441 104.797  1.00  0.74           C  
ATOM  10093  CD  GLU A1264     119.819 138.801 104.544  1.00  0.74           C  
ATOM  10094  OE1 GLU A1264     119.387 139.084 103.400  1.00  0.74           O  
ATOM  10095  OE2 GLU A1264     119.756 139.635 105.496  1.00  0.74           O  
ATOM  10096  N   GLY A1265     122.221 133.886 101.680  1.00  0.80           N  
ATOM  10097  CA  GLY A1265     122.053 133.053 100.477  1.00  0.80           C  
ATOM  10098  C   GLY A1265     122.418 131.596 100.648  1.00  0.80           C  
ATOM  10099  O   GLY A1265     122.443 131.064 101.750  1.00  0.80           O  
ATOM  10100  N   GLU A1266     122.771 130.926  99.534  1.00  0.79           N  
ATOM  10101  CA  GLU A1266     123.260 129.555  99.525  1.00  0.79           C  
ATOM  10102  C   GLU A1266     124.407 129.462  98.533  1.00  0.79           C  
ATOM  10103  O   GLU A1266     124.353 130.017  97.431  1.00  0.79           O  
ATOM  10104  CB  GLU A1266     122.120 128.570  99.158  1.00  0.79           C  
ATOM  10105  CG  GLU A1266     122.494 127.134  98.687  1.00  0.79           C  
ATOM  10106  CD  GLU A1266     123.115 126.163  99.697  1.00  0.79           C  
ATOM  10107  OE1 GLU A1266     123.714 126.580 100.715  1.00  0.79           O  
ATOM  10108  OE2 GLU A1266     123.034 124.939  99.402  1.00  0.79           O  
ATOM  10109  N   ILE A1267     125.508 128.784  98.915  1.00  0.82           N  
ATOM  10110  CA  ILE A1267     126.654 128.550  98.047  1.00  0.82           C  
ATOM  10111  C   ILE A1267     127.042 127.095  98.154  1.00  0.82           C  
ATOM  10112  O   ILE A1267     127.290 126.570  99.241  1.00  0.82           O  
ATOM  10113  CB  ILE A1267     127.879 129.426  98.338  1.00  0.82           C  
ATOM  10114  CG1 ILE A1267     127.495 130.908  98.138  1.00  0.82           C  
ATOM  10115  CG2 ILE A1267     129.070 129.028  97.427  1.00  0.82           C  
ATOM  10116  CD1 ILE A1267     128.636 131.901  98.347  1.00  0.82           C  
ATOM  10117  N   GLN A1268     127.135 126.410  96.998  1.00  0.77           N  
ATOM  10118  CA  GLN A1268     127.553 125.028  96.939  1.00  0.77           C  
ATOM  10119  C   GLN A1268     128.847 124.892  96.159  1.00  0.77           C  
ATOM  10120  O   GLN A1268     128.905 125.187  94.965  1.00  0.77           O  
ATOM  10121  CB  GLN A1268     126.457 124.127  96.328  1.00  0.77           C  
ATOM  10122  CG  GLN A1268     125.171 124.146  97.180  1.00  0.77           C  
ATOM  10123  CD  GLN A1268     124.113 123.166  96.677  1.00  0.77           C  
ATOM  10124  OE1 GLN A1268     124.231 122.542  95.622  1.00  0.77           O  
ATOM  10125  NE2 GLN A1268     123.033 123.033  97.478  1.00  0.77           N  
ATOM  10126  N   ILE A1269     129.924 124.433  96.833  1.00  0.77           N  
ATOM  10127  CA  ILE A1269     131.215 124.132  96.217  1.00  0.77           C  
ATOM  10128  C   ILE A1269     131.319 122.631  96.086  1.00  0.77           C  
ATOM  10129  O   ILE A1269     131.218 121.902  97.074  1.00  0.77           O  
ATOM  10130  CB  ILE A1269     132.420 124.671  96.991  1.00  0.77           C  
ATOM  10131  CG1 ILE A1269     132.426 126.212  96.924  1.00  0.77           C  
ATOM  10132  CG2 ILE A1269     133.742 124.092  96.429  1.00  0.77           C  
ATOM  10133  CD1 ILE A1269     133.534 126.890  97.731  1.00  0.77           C  
ATOM  10134  N   ASP A1270     131.480 122.141  94.837  1.00  0.70           N  
ATOM  10135  CA  ASP A1270     131.578 120.734  94.478  1.00  0.70           C  
ATOM  10136  C   ASP A1270     130.433 119.861  95.064  1.00  0.70           C  
ATOM  10137  O   ASP A1270     130.589 118.689  95.393  1.00  0.70           O  
ATOM  10138  CB  ASP A1270     133.032 120.205  94.723  1.00  0.70           C  
ATOM  10139  CG  ASP A1270     134.060 120.759  93.735  1.00  0.70           C  
ATOM  10140  OD1 ASP A1270     133.678 121.194  92.618  1.00  0.70           O  
ATOM  10141  OD2 ASP A1270     135.287 120.730  94.044  1.00  0.70           O  
ATOM  10142  N   GLY A1271     129.205 120.439  95.154  1.00  0.74           N  
ATOM  10143  CA  GLY A1271     127.983 119.787  95.634  1.00  0.74           C  
ATOM  10144  C   GLY A1271     127.718 119.857  97.120  1.00  0.74           C  
ATOM  10145  O   GLY A1271     126.658 119.439  97.578  1.00  0.74           O  
ATOM  10146  N   VAL A1272     128.637 120.423  97.924  1.00  0.70           N  
ATOM  10147  CA  VAL A1272     128.435 120.552  99.364  1.00  0.70           C  
ATOM  10148  C   VAL A1272     128.002 121.970  99.691  1.00  0.70           C  
ATOM  10149  O   VAL A1272     128.582 122.952  99.225  1.00  0.70           O  
ATOM  10150  CB  VAL A1272     129.617 120.098 100.236  1.00  0.70           C  
ATOM  10151  CG1 VAL A1272     130.369 118.950  99.539  1.00  0.70           C  
ATOM  10152  CG2 VAL A1272     130.580 121.238 100.609  1.00  0.70           C  
ATOM  10153  N   SER A1273     126.932 122.124 100.494  1.00  0.75           N  
ATOM  10154  CA  SER A1273     126.506 123.420 100.998  1.00  0.75           C  
ATOM  10155  C   SER A1273     127.417 123.970 102.082  1.00  0.75           C  
ATOM  10156  O   SER A1273     127.999 123.239 102.886  1.00  0.75           O  
ATOM  10157  CB  SER A1273     125.037 123.436 101.498  1.00  0.75           C  
ATOM  10158  OG  SER A1273     124.801 122.528 102.583  1.00  0.75           O  
ATOM  10159  N   TRP A1274     127.549 125.307 102.144  1.00  0.69           N  
ATOM  10160  CA  TRP A1274     128.366 126.000 103.127  1.00  0.69           C  
ATOM  10161  C   TRP A1274     127.872 125.932 104.569  1.00  0.69           C  
ATOM  10162  O   TRP A1274     128.637 126.155 105.500  1.00  0.69           O  
ATOM  10163  CB  TRP A1274     128.548 127.482 102.708  1.00  0.69           C  
ATOM  10164  CG  TRP A1274     127.307 128.349 102.561  1.00  0.69           C  
ATOM  10165  CD1 TRP A1274     125.979 128.023 102.597  1.00  0.69           C  
ATOM  10166  CD2 TRP A1274     127.361 129.771 102.361  1.00  0.69           C  
ATOM  10167  NE1 TRP A1274     125.208 129.153 102.501  1.00  0.69           N  
ATOM  10168  CE2 TRP A1274     126.029 130.233 102.336  1.00  0.69           C  
ATOM  10169  CE3 TRP A1274     128.432 130.648 102.207  1.00  0.69           C  
ATOM  10170  CZ2 TRP A1274     125.741 131.575 102.155  1.00  0.69           C  
ATOM  10171  CZ3 TRP A1274     128.137 132.001 101.987  1.00  0.69           C  
ATOM  10172  CH2 TRP A1274     126.811 132.456 101.951  1.00  0.69           C  
ATOM  10173  N   ASP A1275     126.579 125.634 104.767  1.00  0.69           N  
ATOM  10174  CA  ASP A1275     125.953 125.479 106.065  1.00  0.69           C  
ATOM  10175  C   ASP A1275     126.126 124.071 106.663  1.00  0.69           C  
ATOM  10176  O   ASP A1275     126.232 123.891 107.875  1.00  0.69           O  
ATOM  10177  CB  ASP A1275     124.447 125.808 105.900  1.00  0.69           C  
ATOM  10178  CG  ASP A1275     124.169 127.278 105.647  1.00  0.69           C  
ATOM  10179  OD1 ASP A1275     125.075 128.117 105.844  1.00  0.69           O  
ATOM  10180  OD2 ASP A1275     123.018 127.612 105.294  1.00  0.69           O  
ATOM  10181  N   SER A1276     126.158 123.005 105.824  1.00  0.66           N  
ATOM  10182  CA  SER A1276     126.396 121.632 106.289  1.00  0.66           C  
ATOM  10183  C   SER A1276     127.790 121.421 106.858  1.00  0.66           C  
ATOM  10184  O   SER A1276     127.973 120.740 107.865  1.00  0.66           O  
ATOM  10185  CB  SER A1276     126.253 120.562 105.167  1.00  0.66           C  
ATOM  10186  OG  SER A1276     124.897 120.342 104.781  1.00  0.66           O  
ATOM  10187  N   ILE A1277     128.813 121.982 106.194  1.00  0.59           N  
ATOM  10188  CA  ILE A1277     130.206 121.893 106.603  1.00  0.59           C  
ATOM  10189  C   ILE A1277     130.539 122.993 107.617  1.00  0.59           C  
ATOM  10190  O   ILE A1277     129.991 124.087 107.565  1.00  0.59           O  
ATOM  10191  CB  ILE A1277     131.099 121.945 105.360  1.00  0.59           C  
ATOM  10192  CG1 ILE A1277     132.512 121.404 105.635  1.00  0.59           C  
ATOM  10193  CG2 ILE A1277     131.110 123.356 104.762  1.00  0.59           C  
ATOM  10194  CD1 ILE A1277     133.482 121.418 104.453  1.00  0.59           C  
ATOM  10195  N   THR A1278     131.428 122.760 108.619  1.00  0.63           N  
ATOM  10196  CA  THR A1278     131.849 123.835 109.518  1.00  0.63           C  
ATOM  10197  C   THR A1278     132.679 124.899 108.809  1.00  0.63           C  
ATOM  10198  O   THR A1278     133.475 124.633 107.903  1.00  0.63           O  
ATOM  10199  CB  THR A1278     132.522 123.387 110.837  1.00  0.63           C  
ATOM  10200  OG1 THR A1278     133.071 124.500 111.540  1.00  0.63           O  
ATOM  10201  CG2 THR A1278     133.704 122.500 110.657  1.00  0.63           C  
ATOM  10202  N   LEU A1279     132.558 126.152 109.290  1.00  0.66           N  
ATOM  10203  CA  LEU A1279     133.218 127.341 108.810  1.00  0.66           C  
ATOM  10204  C   LEU A1279     134.735 127.239 108.715  1.00  0.66           C  
ATOM  10205  O   LEU A1279     135.358 127.744 107.778  1.00  0.66           O  
ATOM  10206  CB  LEU A1279     132.853 128.470 109.795  1.00  0.66           C  
ATOM  10207  CG  LEU A1279     133.488 129.839 109.510  1.00  0.66           C  
ATOM  10208  CD1 LEU A1279     133.049 130.365 108.144  1.00  0.66           C  
ATOM  10209  CD2 LEU A1279     133.149 130.838 110.621  1.00  0.66           C  
ATOM  10210  N   GLN A1280     135.368 126.545 109.681  1.00  0.62           N  
ATOM  10211  CA  GLN A1280     136.810 126.464 109.844  1.00  0.62           C  
ATOM  10212  C   GLN A1280     137.542 125.883 108.627  1.00  0.62           C  
ATOM  10213  O   GLN A1280     138.700 126.183 108.349  1.00  0.62           O  
ATOM  10214  CB  GLN A1280     137.169 125.588 111.073  1.00  0.62           C  
ATOM  10215  CG  GLN A1280     136.541 126.058 112.404  1.00  0.62           C  
ATOM  10216  CD  GLN A1280     136.657 127.570 112.617  1.00  0.62           C  
ATOM  10217  OE1 GLN A1280     135.647 128.233 112.836  1.00  0.62           O  
ATOM  10218  NE2 GLN A1280     137.881 128.134 112.522  1.00  0.62           N  
ATOM  10219  N   GLN A1281     136.824 124.996 107.904  1.00  0.56           N  
ATOM  10220  CA  GLN A1281     137.281 124.183 106.780  1.00  0.56           C  
ATOM  10221  C   GLN A1281     136.700 124.678 105.492  1.00  0.56           C  
ATOM  10222  O   GLN A1281     137.346 124.575 104.453  1.00  0.56           O  
ATOM  10223  CB  GLN A1281     136.789 122.719 106.936  1.00  0.56           C  
ATOM  10224  CG  GLN A1281     137.379 122.095 108.218  1.00  0.56           C  
ATOM  10225  CD  GLN A1281     136.295 121.458 109.031  1.00  0.56           C  
ATOM  10226  OE1 GLN A1281     135.167 121.507 108.584  1.00  0.56           O  
ATOM  10227  NE2 GLN A1281     136.577 120.988 110.219  1.00  0.56           N  
ATOM  10228  N   TRP A1282     135.522 125.333 105.534  1.00  0.69           N  
ATOM  10229  CA  TRP A1282     134.986 126.087 104.406  1.00  0.69           C  
ATOM  10230  C   TRP A1282     135.945 127.180 103.951  1.00  0.69           C  
ATOM  10231  O   TRP A1282     136.232 127.329 102.771  1.00  0.69           O  
ATOM  10232  CB  TRP A1282     133.622 126.714 104.791  1.00  0.69           C  
ATOM  10233  CG  TRP A1282     132.997 127.582 103.710  1.00  0.69           C  
ATOM  10234  CD1 TRP A1282     133.090 128.936 103.551  1.00  0.69           C  
ATOM  10235  CD2 TRP A1282     132.321 127.083 102.546  1.00  0.69           C  
ATOM  10236  NE1 TRP A1282     132.501 129.317 102.367  1.00  0.69           N  
ATOM  10237  CE2 TRP A1282     132.028 128.195 101.731  1.00  0.69           C  
ATOM  10238  CE3 TRP A1282     131.980 125.795 102.154  1.00  0.69           C  
ATOM  10239  CZ2 TRP A1282     131.382 128.036 100.512  1.00  0.69           C  
ATOM  10240  CZ3 TRP A1282     131.279 125.635 100.951  1.00  0.69           C  
ATOM  10241  CH2 TRP A1282     130.980 126.741 100.143  1.00  0.69           C  
ATOM  10242  N   ARG A1283     136.528 127.921 104.912  1.00  0.70           N  
ATOM  10243  CA  ARG A1283     137.578 128.891 104.656  1.00  0.70           C  
ATOM  10244  C   ARG A1283     138.901 128.259 104.204  1.00  0.70           C  
ATOM  10245  O   ARG A1283     139.699 128.886 103.517  1.00  0.70           O  
ATOM  10246  CB  ARG A1283     137.825 129.746 105.925  1.00  0.70           C  
ATOM  10247  CG  ARG A1283     136.678 130.722 106.283  1.00  0.70           C  
ATOM  10248  CD  ARG A1283     137.013 131.590 107.510  1.00  0.70           C  
ATOM  10249  NE  ARG A1283     135.909 132.590 107.741  1.00  0.70           N  
ATOM  10250  CZ  ARG A1283     135.716 133.216 108.914  1.00  0.70           C  
ATOM  10251  NH1 ARG A1283     136.570 133.073 109.923  1.00  0.70           N  
ATOM  10252  NH2 ARG A1283     134.653 133.998 109.092  1.00  0.70           N  
ATOM  10253  N   LYS A1284     139.167 126.977 104.538  1.00  0.69           N  
ATOM  10254  CA  LYS A1284     140.430 126.311 104.242  1.00  0.69           C  
ATOM  10255  C   LYS A1284     140.550 125.848 102.792  1.00  0.69           C  
ATOM  10256  O   LYS A1284     141.624 125.492 102.318  1.00  0.69           O  
ATOM  10257  CB  LYS A1284     140.643 125.118 105.212  1.00  0.69           C  
ATOM  10258  CG  LYS A1284     142.113 124.685 105.368  1.00  0.69           C  
ATOM  10259  CD  LYS A1284     142.393 123.841 106.626  1.00  0.69           C  
ATOM  10260  CE  LYS A1284     142.180 124.563 107.966  1.00  0.69           C  
ATOM  10261  NZ  LYS A1284     143.068 125.744 108.082  1.00  0.69           N  
ATOM  10262  N   ALA A1285     139.434 125.873 102.041  1.00  0.71           N  
ATOM  10263  CA  ALA A1285     139.404 125.572 100.624  1.00  0.71           C  
ATOM  10264  C   ALA A1285     139.879 126.733  99.745  1.00  0.71           C  
ATOM  10265  O   ALA A1285     140.124 126.568  98.546  1.00  0.71           O  
ATOM  10266  CB  ALA A1285     137.964 125.169 100.254  1.00  0.71           C  
ATOM  10267  N   PHE A1286     140.035 127.932 100.341  1.00  0.77           N  
ATOM  10268  CA  PHE A1286     140.327 129.163  99.636  1.00  0.77           C  
ATOM  10269  C   PHE A1286     141.742 129.660  99.878  1.00  0.77           C  
ATOM  10270  O   PHE A1286     142.270 129.650 100.987  1.00  0.77           O  
ATOM  10271  CB  PHE A1286     139.391 130.314 100.072  1.00  0.77           C  
ATOM  10272  CG  PHE A1286     137.968 130.025  99.713  1.00  0.77           C  
ATOM  10273  CD1 PHE A1286     137.469 130.350  98.442  1.00  0.77           C  
ATOM  10274  CD2 PHE A1286     137.103 129.468 100.663  1.00  0.77           C  
ATOM  10275  CE1 PHE A1286     136.114 130.160  98.142  1.00  0.77           C  
ATOM  10276  CE2 PHE A1286     135.750 129.270 100.368  1.00  0.77           C  
ATOM  10277  CZ  PHE A1286     135.253 129.634  99.113  1.00  0.77           C  
ATOM  10278  N   GLY A1287     142.392 130.154  98.808  1.00  0.78           N  
ATOM  10279  CA  GLY A1287     143.648 130.885  98.896  1.00  0.78           C  
ATOM  10280  C   GLY A1287     143.372 132.319  98.575  1.00  0.78           C  
ATOM  10281  O   GLY A1287     142.864 132.648  97.507  1.00  0.78           O  
ATOM  10282  N   VAL A1288     143.686 133.225  99.507  1.00  0.79           N  
ATOM  10283  CA  VAL A1288     143.221 134.595  99.438  1.00  0.79           C  
ATOM  10284  C   VAL A1288     144.412 135.524  99.340  1.00  0.79           C  
ATOM  10285  O   VAL A1288     145.403 135.364 100.050  1.00  0.79           O  
ATOM  10286  CB  VAL A1288     142.380 134.952 100.665  1.00  0.79           C  
ATOM  10287  CG1 VAL A1288     141.730 136.338 100.501  1.00  0.79           C  
ATOM  10288  CG2 VAL A1288     141.280 133.892 100.863  1.00  0.79           C  
ATOM  10289  N   ILE A1289     144.343 136.539  98.457  1.00  0.73           N  
ATOM  10290  CA  ILE A1289     145.246 137.679  98.500  1.00  0.73           C  
ATOM  10291  C   ILE A1289     144.383 138.860  98.933  1.00  0.73           C  
ATOM  10292  O   ILE A1289     143.540 139.298  98.146  1.00  0.73           O  
ATOM  10293  CB  ILE A1289     145.950 137.949  97.167  1.00  0.73           C  
ATOM  10294  CG1 ILE A1289     146.855 136.744  96.810  1.00  0.73           C  
ATOM  10295  CG2 ILE A1289     146.764 139.261  97.237  1.00  0.73           C  
ATOM  10296  CD1 ILE A1289     147.715 136.947  95.557  1.00  0.73           C  
ATOM  10297  N   PRO A1290     144.506 139.384 100.157  1.00  0.71           N  
ATOM  10298  CA  PRO A1290     143.727 140.536 100.597  1.00  0.71           C  
ATOM  10299  C   PRO A1290     144.199 141.826  99.959  1.00  0.71           C  
ATOM  10300  O   PRO A1290     145.401 141.990  99.763  1.00  0.71           O  
ATOM  10301  CB  PRO A1290     143.973 140.604 102.120  1.00  0.71           C  
ATOM  10302  CG  PRO A1290     144.448 139.205 102.514  1.00  0.71           C  
ATOM  10303  CD  PRO A1290     145.212 138.750 101.277  1.00  0.71           C  
ATOM  10304  N   GLN A1291     143.279 142.773  99.681  1.00  0.60           N  
ATOM  10305  CA  GLN A1291     143.622 144.111  99.221  1.00  0.60           C  
ATOM  10306  C   GLN A1291     144.490 144.900 100.207  1.00  0.60           C  
ATOM  10307  O   GLN A1291     145.394 145.643  99.834  1.00  0.60           O  
ATOM  10308  CB  GLN A1291     142.335 144.922  98.930  1.00  0.60           C  
ATOM  10309  CG  GLN A1291     142.604 146.210  98.118  1.00  0.60           C  
ATOM  10310  CD  GLN A1291     141.341 147.011  97.802  1.00  0.60           C  
ATOM  10311  OE1 GLN A1291     140.305 146.973  98.465  1.00  0.60           O  
ATOM  10312  NE2 GLN A1291     141.456 147.851  96.744  1.00  0.60           N  
ATOM  10313  N   LYS A1292     144.229 144.746 101.523  1.00  0.66           N  
ATOM  10314  CA  LYS A1292     145.054 145.319 102.571  1.00  0.66           C  
ATOM  10315  C   LYS A1292     146.107 144.310 103.004  1.00  0.66           C  
ATOM  10316  O   LYS A1292     145.827 143.322 103.687  1.00  0.66           O  
ATOM  10317  CB  LYS A1292     144.207 145.749 103.803  1.00  0.66           C  
ATOM  10318  CG  LYS A1292     145.010 146.442 104.926  1.00  0.66           C  
ATOM  10319  CD  LYS A1292     144.186 146.739 106.202  1.00  0.66           C  
ATOM  10320  CE  LYS A1292     145.033 147.383 107.321  1.00  0.66           C  
ATOM  10321  NZ  LYS A1292     144.309 147.499 108.616  1.00  0.66           N  
ATOM  10322  N   VAL A1293     147.370 144.546 102.606  1.00  0.76           N  
ATOM  10323  CA  VAL A1293     148.508 143.738 103.004  1.00  0.76           C  
ATOM  10324  C   VAL A1293     148.755 143.722 104.515  1.00  0.76           C  
ATOM  10325  O   VAL A1293     148.629 144.727 105.211  1.00  0.76           O  
ATOM  10326  CB  VAL A1293     149.774 144.098 102.228  1.00  0.76           C  
ATOM  10327  CG1 VAL A1293     149.489 143.942 100.723  1.00  0.76           C  
ATOM  10328  CG2 VAL A1293     150.243 145.533 102.529  1.00  0.76           C  
ATOM  10329  N   PHE A1294     149.106 142.540 105.065  1.00  0.78           N  
ATOM  10330  CA  PHE A1294     149.369 142.364 106.483  1.00  0.78           C  
ATOM  10331  C   PHE A1294     150.768 141.791 106.661  1.00  0.78           C  
ATOM  10332  O   PHE A1294     151.073 140.670 106.237  1.00  0.78           O  
ATOM  10333  CB  PHE A1294     148.291 141.455 107.152  1.00  0.78           C  
ATOM  10334  CG  PHE A1294     148.593 141.066 108.584  1.00  0.78           C  
ATOM  10335  CD1 PHE A1294     149.059 142.005 109.523  1.00  0.78           C  
ATOM  10336  CD2 PHE A1294     148.436 139.729 108.988  1.00  0.78           C  
ATOM  10337  CE1 PHE A1294     149.376 141.613 110.829  1.00  0.78           C  
ATOM  10338  CE2 PHE A1294     148.761 139.333 110.290  1.00  0.78           C  
ATOM  10339  CZ  PHE A1294     149.231 140.275 111.212  1.00  0.78           C  
ATOM  10340  N   ILE A1295     151.634 142.581 107.317  1.00  0.80           N  
ATOM  10341  CA  ILE A1295     152.978 142.230 107.727  1.00  0.80           C  
ATOM  10342  C   ILE A1295     153.034 142.561 109.203  1.00  0.80           C  
ATOM  10343  O   ILE A1295     152.618 143.643 109.612  1.00  0.80           O  
ATOM  10344  CB  ILE A1295     154.051 142.998 106.953  1.00  0.80           C  
ATOM  10345  CG1 ILE A1295     153.951 142.651 105.448  1.00  0.80           C  
ATOM  10346  CG2 ILE A1295     155.453 142.691 107.525  1.00  0.80           C  
ATOM  10347  CD1 ILE A1295     154.951 143.385 104.553  1.00  0.80           C  
ATOM  10348  N   PHE A1296     153.510 141.620 110.035  1.00  0.71           N  
ATOM  10349  CA  PHE A1296     153.659 141.801 111.467  1.00  0.71           C  
ATOM  10350  C   PHE A1296     155.141 141.902 111.807  1.00  0.71           C  
ATOM  10351  O   PHE A1296     155.994 141.454 111.035  1.00  0.71           O  
ATOM  10352  CB  PHE A1296     152.969 140.658 112.273  1.00  0.71           C  
ATOM  10353  CG  PHE A1296     153.396 139.270 111.865  1.00  0.71           C  
ATOM  10354  CD1 PHE A1296     152.746 138.596 110.816  1.00  0.71           C  
ATOM  10355  CD2 PHE A1296     154.431 138.617 112.555  1.00  0.71           C  
ATOM  10356  CE1 PHE A1296     153.134 137.301 110.451  1.00  0.71           C  
ATOM  10357  CE2 PHE A1296     154.824 137.323 112.192  1.00  0.71           C  
ATOM  10358  CZ  PHE A1296     154.172 136.665 111.143  1.00  0.71           C  
ATOM  10359  N   SER A1297     155.499 142.494 112.971  1.00  0.77           N  
ATOM  10360  CA  SER A1297     156.877 142.513 113.468  1.00  0.77           C  
ATOM  10361  C   SER A1297     157.407 141.098 113.685  1.00  0.77           C  
ATOM  10362  O   SER A1297     156.973 140.365 114.570  1.00  0.77           O  
ATOM  10363  CB  SER A1297     157.087 143.269 114.816  1.00  0.77           C  
ATOM  10364  OG  SER A1297     157.051 144.697 114.688  1.00  0.77           O  
ATOM  10365  N   GLY A1298     158.375 140.664 112.859  1.00  0.81           N  
ATOM  10366  CA  GLY A1298     158.867 139.304 112.917  1.00  0.81           C  
ATOM  10367  C   GLY A1298     159.754 139.005 111.751  1.00  0.81           C  
ATOM  10368  O   GLY A1298     159.896 139.778 110.808  1.00  0.81           O  
ATOM  10369  N   THR A1299     160.401 137.837 111.785  1.00  0.80           N  
ATOM  10370  CA  THR A1299     161.280 137.337 110.741  1.00  0.80           C  
ATOM  10371  C   THR A1299     160.631 137.202 109.363  1.00  0.80           C  
ATOM  10372  O   THR A1299     159.447 136.875 109.247  1.00  0.80           O  
ATOM  10373  CB  THR A1299     161.851 135.977 111.133  1.00  0.80           C  
ATOM  10374  OG1 THR A1299     162.161 135.924 112.515  1.00  0.80           O  
ATOM  10375  CG2 THR A1299     163.157 135.732 110.406  1.00  0.80           C  
ATOM  10376  N   PHE A1300     161.399 137.398 108.263  1.00  0.79           N  
ATOM  10377  CA  PHE A1300     160.970 137.110 106.891  1.00  0.79           C  
ATOM  10378  C   PHE A1300     160.375 135.717 106.704  1.00  0.79           C  
ATOM  10379  O   PHE A1300     159.288 135.558 106.155  1.00  0.79           O  
ATOM  10380  CB  PHE A1300     162.180 137.192 105.922  1.00  0.79           C  
ATOM  10381  CG  PHE A1300     162.188 138.496 105.199  1.00  0.79           C  
ATOM  10382  CD1 PHE A1300     161.341 138.682 104.093  1.00  0.79           C  
ATOM  10383  CD2 PHE A1300     163.051 139.528 105.589  1.00  0.79           C  
ATOM  10384  CE1 PHE A1300     161.365 139.884 103.379  1.00  0.79           C  
ATOM  10385  CE2 PHE A1300     163.087 140.726 104.869  1.00  0.79           C  
ATOM  10386  CZ  PHE A1300     162.244 140.900 103.765  1.00  0.79           C  
ATOM  10387  N   ARG A1301     161.061 134.676 107.224  1.00  0.76           N  
ATOM  10388  CA  ARG A1301     160.560 133.311 107.240  1.00  0.76           C  
ATOM  10389  C   ARG A1301     159.230 133.170 107.978  1.00  0.76           C  
ATOM  10390  O   ARG A1301     158.305 132.538 107.484  1.00  0.76           O  
ATOM  10391  CB  ARG A1301     161.636 132.380 107.861  1.00  0.76           C  
ATOM  10392  CG  ARG A1301     161.224 130.900 108.016  1.00  0.76           C  
ATOM  10393  CD  ARG A1301     162.380 129.899 108.226  1.00  0.76           C  
ATOM  10394  NE  ARG A1301     163.244 130.332 109.384  1.00  0.76           N  
ATOM  10395  CZ  ARG A1301     164.503 130.777 109.229  1.00  0.76           C  
ATOM  10396  NH1 ARG A1301     165.183 130.611 108.102  1.00  0.76           N  
ATOM  10397  NH2 ARG A1301     165.100 131.397 110.243  1.00  0.76           N  
ATOM  10398  N   LYS A1302     159.073 133.818 109.152  1.00  0.79           N  
ATOM  10399  CA  LYS A1302     157.844 133.766 109.937  1.00  0.79           C  
ATOM  10400  C   LYS A1302     156.634 134.404 109.246  1.00  0.79           C  
ATOM  10401  O   LYS A1302     155.510 133.919 109.317  1.00  0.79           O  
ATOM  10402  CB  LYS A1302     158.054 134.396 111.342  1.00  0.79           C  
ATOM  10403  CG  LYS A1302     156.980 134.021 112.386  1.00  0.79           C  
ATOM  10404  CD  LYS A1302     157.016 132.527 112.772  1.00  0.79           C  
ATOM  10405  CE  LYS A1302     155.978 132.126 113.829  1.00  0.79           C  
ATOM  10406  NZ  LYS A1302     155.976 130.683 114.061  1.00  0.79           N  
ATOM  10407  N   ASN A1303     156.847 135.532 108.541  1.00  0.80           N  
ATOM  10408  CA  ASN A1303     155.836 136.189 107.723  1.00  0.80           C  
ATOM  10409  C   ASN A1303     155.356 135.386 106.511  1.00  0.80           C  
ATOM  10410  O   ASN A1303     154.202 135.506 106.093  1.00  0.80           O  
ATOM  10411  CB  ASN A1303     156.356 137.558 107.221  1.00  0.80           C  
ATOM  10412  CG  ASN A1303     156.071 138.640 108.257  1.00  0.80           C  
ATOM  10413  OD1 ASN A1303     154.991 139.236 108.207  1.00  0.80           O  
ATOM  10414  ND2 ASN A1303     157.021 138.911 109.176  1.00  0.80           N  
ATOM  10415  N   LEU A1304     156.250 134.611 105.874  1.00  0.79           N  
ATOM  10416  CA  LEU A1304     155.909 133.686 104.806  1.00  0.79           C  
ATOM  10417  C   LEU A1304     155.284 132.387 105.311  1.00  0.79           C  
ATOM  10418  O   LEU A1304     154.329 131.884 104.721  1.00  0.79           O  
ATOM  10419  CB  LEU A1304     157.158 133.393 103.943  1.00  0.79           C  
ATOM  10420  CG  LEU A1304     157.685 134.622 103.169  1.00  0.79           C  
ATOM  10421  CD1 LEU A1304     159.056 134.324 102.552  1.00  0.79           C  
ATOM  10422  CD2 LEU A1304     156.711 135.083 102.076  1.00  0.79           C  
ATOM  10423  N   ASP A1305     155.796 131.833 106.426  1.00  0.78           N  
ATOM  10424  CA  ASP A1305     155.282 130.626 107.040  1.00  0.78           C  
ATOM  10425  C   ASP A1305     155.148 130.824 108.557  1.00  0.78           C  
ATOM  10426  O   ASP A1305     156.150 130.803 109.281  1.00  0.78           O  
ATOM  10427  CB  ASP A1305     156.228 129.439 106.718  1.00  0.78           C  
ATOM  10428  CG  ASP A1305     155.680 128.102 107.192  1.00  0.78           C  
ATOM  10429  OD1 ASP A1305     154.559 128.058 107.771  1.00  0.78           O  
ATOM  10430  OD2 ASP A1305     156.380 127.080 106.992  1.00  0.78           O  
ATOM  10431  N   PRO A1306     153.948 130.982 109.114  1.00  0.81           N  
ATOM  10432  CA  PRO A1306     153.823 131.176 110.551  1.00  0.81           C  
ATOM  10433  C   PRO A1306     153.667 129.839 111.247  1.00  0.81           C  
ATOM  10434  O   PRO A1306     153.876 129.787 112.462  1.00  0.81           O  
ATOM  10435  CB  PRO A1306     152.582 132.070 110.697  1.00  0.81           C  
ATOM  10436  CG  PRO A1306     151.738 131.763 109.463  1.00  0.81           C  
ATOM  10437  CD  PRO A1306     152.787 131.504 108.385  1.00  0.81           C  
ATOM  10438  N   TYR A1307     153.303 128.763 110.523  1.00  0.73           N  
ATOM  10439  CA  TYR A1307     153.035 127.455 111.104  1.00  0.73           C  
ATOM  10440  C   TYR A1307     154.255 126.545 111.059  1.00  0.73           C  
ATOM  10441  O   TYR A1307     154.270 125.516 111.731  1.00  0.73           O  
ATOM  10442  CB  TYR A1307     151.865 126.735 110.366  1.00  0.73           C  
ATOM  10443  CG  TYR A1307     150.517 127.283 110.765  1.00  0.73           C  
ATOM  10444  CD1 TYR A1307     149.983 126.969 112.027  1.00  0.73           C  
ATOM  10445  CD2 TYR A1307     149.748 128.067 109.884  1.00  0.73           C  
ATOM  10446  CE1 TYR A1307     148.733 127.467 112.421  1.00  0.73           C  
ATOM  10447  CE2 TYR A1307     148.492 128.563 110.277  1.00  0.73           C  
ATOM  10448  CZ  TYR A1307     147.994 128.278 111.555  1.00  0.73           C  
ATOM  10449  OH  TYR A1307     146.775 128.828 112.008  1.00  0.73           O  
ATOM  10450  N   GLU A1308     155.307 126.939 110.309  1.00  0.73           N  
ATOM  10451  CA  GLU A1308     156.614 126.291 110.273  1.00  0.73           C  
ATOM  10452  C   GLU A1308     156.516 124.904 109.643  1.00  0.73           C  
ATOM  10453  O   GLU A1308     157.113 123.924 110.088  1.00  0.73           O  
ATOM  10454  CB  GLU A1308     157.331 126.315 111.662  1.00  0.73           C  
ATOM  10455  CG  GLU A1308     157.481 127.755 112.237  1.00  0.73           C  
ATOM  10456  CD  GLU A1308     157.828 127.861 113.727  1.00  0.73           C  
ATOM  10457  OE1 GLU A1308     158.093 126.860 114.423  1.00  0.73           O  
ATOM  10458  OE2 GLU A1308     157.819 129.020 114.224  1.00  0.73           O  
ATOM  10459  N   GLN A1309     155.725 124.807 108.556  1.00  0.70           N  
ATOM  10460  CA  GLN A1309     155.342 123.551 107.941  1.00  0.70           C  
ATOM  10461  C   GLN A1309     156.011 123.341 106.595  1.00  0.70           C  
ATOM  10462  O   GLN A1309     155.882 122.276 105.992  1.00  0.70           O  
ATOM  10463  CB  GLN A1309     153.797 123.456 107.808  1.00  0.70           C  
ATOM  10464  CG  GLN A1309     153.141 124.624 107.039  1.00  0.70           C  
ATOM  10465  CD  GLN A1309     151.614 124.551 107.081  1.00  0.70           C  
ATOM  10466  OE1 GLN A1309     150.983 123.690 107.689  1.00  0.70           O  
ATOM  10467  NE2 GLN A1309     150.969 125.522 106.391  1.00  0.70           N  
ATOM  10468  N   TRP A1310     156.789 124.330 106.115  1.00  0.72           N  
ATOM  10469  CA  TRP A1310     157.555 124.221 104.887  1.00  0.72           C  
ATOM  10470  C   TRP A1310     159.049 124.407 105.145  1.00  0.72           C  
ATOM  10471  O   TRP A1310     159.483 125.080 106.077  1.00  0.72           O  
ATOM  10472  CB  TRP A1310     157.041 125.230 103.831  1.00  0.72           C  
ATOM  10473  CG  TRP A1310     155.614 124.934 103.384  1.00  0.72           C  
ATOM  10474  CD1 TRP A1310     155.127 123.804 102.787  1.00  0.72           C  
ATOM  10475  CD2 TRP A1310     154.480 125.794 103.598  1.00  0.72           C  
ATOM  10476  NE1 TRP A1310     153.757 123.898 102.608  1.00  0.72           N  
ATOM  10477  CE2 TRP A1310     153.353 125.132 103.072  1.00  0.72           C  
ATOM  10478  CE3 TRP A1310     154.366 127.046 104.197  1.00  0.72           C  
ATOM  10479  CZ2 TRP A1310     152.096 125.723 103.112  1.00  0.72           C  
ATOM  10480  CZ3 TRP A1310     153.098 127.643 104.242  1.00  0.72           C  
ATOM  10481  CH2 TRP A1310     151.981 126.998 103.693  1.00  0.72           C  
ATOM  10482  N   SER A1311     159.911 123.760 104.327  1.00  0.81           N  
ATOM  10483  CA  SER A1311     161.361 123.877 104.476  1.00  0.81           C  
ATOM  10484  C   SER A1311     161.918 125.171 103.897  1.00  0.81           C  
ATOM  10485  O   SER A1311     161.319 125.798 103.023  1.00  0.81           O  
ATOM  10486  CB  SER A1311     162.158 122.645 103.932  1.00  0.81           C  
ATOM  10487  OG  SER A1311     162.325 122.624 102.511  1.00  0.81           O  
ATOM  10488  N   ASP A1312     163.128 125.591 104.335  1.00  0.79           N  
ATOM  10489  CA  ASP A1312     163.833 126.729 103.762  1.00  0.79           C  
ATOM  10490  C   ASP A1312     164.050 126.590 102.244  1.00  0.79           C  
ATOM  10491  O   ASP A1312     163.934 127.552 101.487  1.00  0.79           O  
ATOM  10492  CB  ASP A1312     165.205 126.935 104.457  1.00  0.79           C  
ATOM  10493  CG  ASP A1312     165.073 127.464 105.876  1.00  0.79           C  
ATOM  10494  OD1 ASP A1312     164.340 128.463 106.103  1.00  0.79           O  
ATOM  10495  OD2 ASP A1312     165.744 126.894 106.769  1.00  0.79           O  
ATOM  10496  N   GLN A1313     164.323 125.363 101.741  1.00  0.77           N  
ATOM  10497  CA  GLN A1313     164.479 125.099 100.316  1.00  0.77           C  
ATOM  10498  C   GLN A1313     163.230 125.400  99.491  1.00  0.77           C  
ATOM  10499  O   GLN A1313     163.304 126.003  98.419  1.00  0.77           O  
ATOM  10500  CB  GLN A1313     164.929 123.637 100.072  1.00  0.77           C  
ATOM  10501  CG  GLN A1313     165.299 123.338  98.597  1.00  0.77           C  
ATOM  10502  CD  GLN A1313     165.874 121.930  98.425  1.00  0.77           C  
ATOM  10503  OE1 GLN A1313     165.907 121.112  99.339  1.00  0.77           O  
ATOM  10504  NE2 GLN A1313     166.354 121.633  97.193  1.00  0.77           N  
ATOM  10505  N   GLU A1314     162.038 125.022  99.989  1.00  0.78           N  
ATOM  10506  CA  GLU A1314     160.768 125.387  99.383  1.00  0.78           C  
ATOM  10507  C   GLU A1314     160.496 126.889  99.399  1.00  0.78           C  
ATOM  10508  O   GLU A1314     160.056 127.462  98.404  1.00  0.78           O  
ATOM  10509  CB  GLU A1314     159.598 124.644 100.058  1.00  0.78           C  
ATOM  10510  CG  GLU A1314     159.726 123.105  99.997  1.00  0.78           C  
ATOM  10511  CD  GLU A1314     158.545 122.397 100.653  1.00  0.78           C  
ATOM  10512  OE1 GLU A1314     157.440 122.992 100.713  1.00  0.78           O  
ATOM  10513  OE2 GLU A1314     158.755 121.242 101.101  1.00  0.78           O  
ATOM  10514  N   ILE A1315     160.804 127.583 100.516  1.00  0.82           N  
ATOM  10515  CA  ILE A1315     160.683 129.039 100.623  1.00  0.82           C  
ATOM  10516  C   ILE A1315     161.548 129.776  99.606  1.00  0.82           C  
ATOM  10517  O   ILE A1315     161.079 130.673  98.903  1.00  0.82           O  
ATOM  10518  CB  ILE A1315     161.012 129.527 102.038  1.00  0.82           C  
ATOM  10519  CG1 ILE A1315     159.965 128.977 103.034  1.00  0.82           C  
ATOM  10520  CG2 ILE A1315     161.085 131.072 102.098  1.00  0.82           C  
ATOM  10521  CD1 ILE A1315     160.208 129.374 104.494  1.00  0.82           C  
ATOM  10522  N   TRP A1316     162.830 129.380  99.452  1.00  0.76           N  
ATOM  10523  CA  TRP A1316     163.697 129.935  98.425  1.00  0.76           C  
ATOM  10524  C   TRP A1316     163.203 129.656  97.014  1.00  0.76           C  
ATOM  10525  O   TRP A1316     163.224 130.542  96.169  1.00  0.76           O  
ATOM  10526  CB  TRP A1316     165.162 129.460  98.563  1.00  0.76           C  
ATOM  10527  CG  TRP A1316     165.919 130.087  99.720  1.00  0.76           C  
ATOM  10528  CD1 TRP A1316     166.352 129.502 100.877  1.00  0.76           C  
ATOM  10529  CD2 TRP A1316     166.330 131.468  99.791  1.00  0.76           C  
ATOM  10530  NE1 TRP A1316     167.006 130.422 101.667  1.00  0.76           N  
ATOM  10531  CE2 TRP A1316     166.999 131.634 101.021  1.00  0.76           C  
ATOM  10532  CE3 TRP A1316     166.164 132.539  98.912  1.00  0.76           C  
ATOM  10533  CZ2 TRP A1316     167.511 132.867 101.400  1.00  0.76           C  
ATOM  10534  CZ3 TRP A1316     166.684 133.785  99.297  1.00  0.76           C  
ATOM  10535  CH2 TRP A1316     167.348 133.948 100.522  1.00  0.76           C  
ATOM  10536  N   LYS A1317     162.687 128.440  96.745  1.00  0.76           N  
ATOM  10537  CA  LYS A1317     162.105 128.093  95.458  1.00  0.76           C  
ATOM  10538  C   LYS A1317     160.934 128.991  95.047  1.00  0.76           C  
ATOM  10539  O   LYS A1317     160.889 129.498  93.930  1.00  0.76           O  
ATOM  10540  CB  LYS A1317     161.648 126.613  95.493  1.00  0.76           C  
ATOM  10541  CG  LYS A1317     161.146 126.075  94.146  1.00  0.76           C  
ATOM  10542  CD  LYS A1317     160.745 124.594  94.211  1.00  0.76           C  
ATOM  10543  CE  LYS A1317     160.214 124.095  92.867  1.00  0.76           C  
ATOM  10544  NZ  LYS A1317     159.812 122.676  92.983  1.00  0.76           N  
ATOM  10545  N   VAL A1318     159.991 129.279  95.970  1.00  0.82           N  
ATOM  10546  CA  VAL A1318     158.925 130.258  95.750  1.00  0.82           C  
ATOM  10547  C   VAL A1318     159.466 131.669  95.536  1.00  0.82           C  
ATOM  10548  O   VAL A1318     159.016 132.406  94.659  1.00  0.82           O  
ATOM  10549  CB  VAL A1318     157.902 130.240  96.887  1.00  0.82           C  
ATOM  10550  CG1 VAL A1318     156.802 131.300  96.687  1.00  0.82           C  
ATOM  10551  CG2 VAL A1318     157.235 128.856  96.914  1.00  0.82           C  
ATOM  10552  N   ALA A1319     160.493 132.075  96.311  1.00  0.82           N  
ATOM  10553  CA  ALA A1319     161.173 133.352  96.177  1.00  0.82           C  
ATOM  10554  C   ALA A1319     161.816 133.583  94.810  1.00  0.82           C  
ATOM  10555  O   ALA A1319     161.840 134.713  94.319  1.00  0.82           O  
ATOM  10556  CB  ALA A1319     162.214 133.527  97.299  1.00  0.82           C  
ATOM  10557  N   ASP A1320     162.335 132.521  94.163  1.00  0.75           N  
ATOM  10558  CA  ASP A1320     162.760 132.541  92.776  1.00  0.75           C  
ATOM  10559  C   ASP A1320     161.616 132.825  91.777  1.00  0.75           C  
ATOM  10560  O   ASP A1320     161.735 133.698  90.918  1.00  0.75           O  
ATOM  10561  CB  ASP A1320     163.498 131.205  92.459  1.00  0.75           C  
ATOM  10562  CG  ASP A1320     164.866 131.207  93.111  1.00  0.75           C  
ATOM  10563  OD1 ASP A1320     165.615 132.158  92.780  1.00  0.75           O  
ATOM  10564  OD2 ASP A1320     165.250 130.331  93.935  1.00  0.75           O  
ATOM  10565  N   GLU A1321     160.448 132.155  91.903  1.00  0.73           N  
ATOM  10566  CA  GLU A1321     159.285 132.352  91.036  1.00  0.73           C  
ATOM  10567  C   GLU A1321     158.674 133.751  91.106  1.00  0.73           C  
ATOM  10568  O   GLU A1321     158.327 134.356  90.092  1.00  0.73           O  
ATOM  10569  CB  GLU A1321     158.172 131.308  91.338  1.00  0.73           C  
ATOM  10570  CG  GLU A1321     158.657 129.835  91.255  1.00  0.73           C  
ATOM  10571  CD  GLU A1321     157.584 128.784  91.558  1.00  0.73           C  
ATOM  10572  OE1 GLU A1321     156.374 129.125  91.522  1.00  0.73           O  
ATOM  10573  OE2 GLU A1321     157.980 127.611  91.806  1.00  0.73           O  
ATOM  10574  N   VAL A1322     158.549 134.321  92.322  1.00  0.79           N  
ATOM  10575  CA  VAL A1322     157.892 135.609  92.525  1.00  0.79           C  
ATOM  10576  C   VAL A1322     158.863 136.786  92.539  1.00  0.79           C  
ATOM  10577  O   VAL A1322     158.455 137.936  92.679  1.00  0.79           O  
ATOM  10578  CB  VAL A1322     157.055 135.639  93.804  1.00  0.79           C  
ATOM  10579  CG1 VAL A1322     156.050 134.473  93.787  1.00  0.79           C  
ATOM  10580  CG2 VAL A1322     157.943 135.576  95.057  1.00  0.79           C  
ATOM  10581  N   GLY A1323     160.180 136.543  92.364  1.00  0.81           N  
ATOM  10582  CA  GLY A1323     161.178 137.607  92.260  1.00  0.81           C  
ATOM  10583  C   GLY A1323     161.561 138.294  93.547  1.00  0.81           C  
ATOM  10584  O   GLY A1323     161.743 139.510  93.582  1.00  0.81           O  
ATOM  10585  N   LEU A1324     161.728 137.540  94.650  1.00  0.80           N  
ATOM  10586  CA  LEU A1324     162.038 138.124  95.948  1.00  0.80           C  
ATOM  10587  C   LEU A1324     163.467 137.913  96.418  1.00  0.80           C  
ATOM  10588  O   LEU A1324     163.860 138.470  97.441  1.00  0.80           O  
ATOM  10589  CB  LEU A1324     161.094 137.572  97.046  1.00  0.80           C  
ATOM  10590  CG  LEU A1324     159.718 138.263  97.101  1.00  0.80           C  
ATOM  10591  CD1 LEU A1324     158.802 137.517  98.078  1.00  0.80           C  
ATOM  10592  CD2 LEU A1324     159.820 139.739  97.508  1.00  0.80           C  
ATOM  10593  N   ARG A1325     164.322 137.157  95.695  1.00  0.73           N  
ATOM  10594  CA  ARG A1325     165.700 136.936  96.134  1.00  0.73           C  
ATOM  10595  C   ARG A1325     166.515 138.211  96.314  1.00  0.73           C  
ATOM  10596  O   ARG A1325     167.116 138.431  97.359  1.00  0.73           O  
ATOM  10597  CB  ARG A1325     166.484 136.039  95.149  1.00  0.73           C  
ATOM  10598  CG  ARG A1325     166.358 134.537  95.429  1.00  0.73           C  
ATOM  10599  CD  ARG A1325     167.387 133.745  94.625  1.00  0.73           C  
ATOM  10600  NE  ARG A1325     167.190 132.317  94.971  1.00  0.73           N  
ATOM  10601  CZ  ARG A1325     167.873 131.621  95.879  1.00  0.73           C  
ATOM  10602  NH1 ARG A1325     168.781 132.191  96.667  1.00  0.73           N  
ATOM  10603  NH2 ARG A1325     167.613 130.322  95.974  1.00  0.73           N  
ATOM  10604  N   SER A1326     166.486 139.122  95.328  1.00  0.80           N  
ATOM  10605  CA  SER A1326     167.204 140.390  95.374  1.00  0.80           C  
ATOM  10606  C   SER A1326     166.775 141.275  96.537  1.00  0.80           C  
ATOM  10607  O   SER A1326     167.594 141.900  97.205  1.00  0.80           O  
ATOM  10608  CB  SER A1326     167.040 141.154  94.036  1.00  0.80           C  
ATOM  10609  OG  SER A1326     165.661 141.245  93.665  1.00  0.80           O  
ATOM  10610  N   VAL A1327     165.463 141.291  96.836  1.00  0.80           N  
ATOM  10611  CA  VAL A1327     164.878 141.977  97.979  1.00  0.80           C  
ATOM  10612  C   VAL A1327     165.338 141.423  99.324  1.00  0.80           C  
ATOM  10613  O   VAL A1327     165.637 142.171 100.247  1.00  0.80           O  
ATOM  10614  CB  VAL A1327     163.349 141.962  97.929  1.00  0.80           C  
ATOM  10615  CG1 VAL A1327     162.773 142.907  99.001  1.00  0.80           C  
ATOM  10616  CG2 VAL A1327     162.861 142.409  96.539  1.00  0.80           C  
ATOM  10617  N   ILE A1328     165.409 140.088  99.490  1.00  0.80           N  
ATOM  10618  CA  ILE A1328     165.883 139.460 100.722  1.00  0.80           C  
ATOM  10619  C   ILE A1328     167.388 139.637 100.928  1.00  0.80           C  
ATOM  10620  O   ILE A1328     167.858 139.913 102.031  1.00  0.80           O  
ATOM  10621  CB  ILE A1328     165.469 137.985 100.803  1.00  0.80           C  
ATOM  10622  CG1 ILE A1328     163.925 137.863 100.749  1.00  0.80           C  
ATOM  10623  CG2 ILE A1328     166.009 137.337 102.098  1.00  0.80           C  
ATOM  10624  CD1 ILE A1328     163.419 136.424 100.607  1.00  0.80           C  
ATOM  10625  N   GLU A1329     168.198 139.497  99.860  1.00  0.74           N  
ATOM  10626  CA  GLU A1329     169.651 139.474  99.948  1.00  0.74           C  
ATOM  10627  C   GLU A1329     170.317 140.812 100.205  1.00  0.74           C  
ATOM  10628  O   GLU A1329     171.485 140.863 100.585  1.00  0.74           O  
ATOM  10629  CB  GLU A1329     170.266 138.840  98.682  1.00  0.74           C  
ATOM  10630  CG  GLU A1329     169.904 137.342  98.569  1.00  0.74           C  
ATOM  10631  CD  GLU A1329     170.785 136.575  97.597  1.00  0.74           C  
ATOM  10632  OE1 GLU A1329     171.269 137.145  96.602  1.00  0.74           O  
ATOM  10633  OE2 GLU A1329     171.090 135.399  97.954  1.00  0.74           O  
ATOM  10634  N   GLN A1330     169.583 141.927 100.051  1.00  0.71           N  
ATOM  10635  CA  GLN A1330     170.070 143.249 100.402  1.00  0.71           C  
ATOM  10636  C   GLN A1330     170.077 143.497 101.912  1.00  0.71           C  
ATOM  10637  O   GLN A1330     170.638 144.477 102.397  1.00  0.71           O  
ATOM  10638  CB  GLN A1330     169.241 144.330  99.663  1.00  0.71           C  
ATOM  10639  CG  GLN A1330     167.850 144.594 100.279  1.00  0.71           C  
ATOM  10640  CD  GLN A1330     166.933 145.407  99.367  1.00  0.71           C  
ATOM  10641  OE1 GLN A1330     167.323 146.005  98.368  1.00  0.71           O  
ATOM  10642  NE2 GLN A1330     165.633 145.446  99.744  1.00  0.71           N  
ATOM  10643  N   PHE A1331     169.442 142.601 102.697  1.00  0.71           N  
ATOM  10644  CA  PHE A1331     169.358 142.702 104.138  1.00  0.71           C  
ATOM  10645  C   PHE A1331     170.378 141.791 104.828  1.00  0.71           C  
ATOM  10646  O   PHE A1331     170.783 140.782 104.250  1.00  0.71           O  
ATOM  10647  CB  PHE A1331     167.936 142.326 104.629  1.00  0.71           C  
ATOM  10648  CG  PHE A1331     166.886 143.224 104.031  1.00  0.71           C  
ATOM  10649  CD1 PHE A1331     167.034 144.623 104.008  1.00  0.71           C  
ATOM  10650  CD2 PHE A1331     165.731 142.658 103.470  1.00  0.71           C  
ATOM  10651  CE1 PHE A1331     166.057 145.432 103.416  1.00  0.71           C  
ATOM  10652  CE2 PHE A1331     164.743 143.468 102.897  1.00  0.71           C  
ATOM  10653  CZ  PHE A1331     164.903 144.856 102.873  1.00  0.71           C  
ATOM  10654  N   PRO A1332     170.820 142.067 106.066  1.00  0.72           N  
ATOM  10655  CA  PRO A1332     171.874 141.282 106.717  1.00  0.72           C  
ATOM  10656  C   PRO A1332     171.536 139.822 106.949  1.00  0.72           C  
ATOM  10657  O   PRO A1332     172.414 138.968 106.868  1.00  0.72           O  
ATOM  10658  CB  PRO A1332     172.088 142.002 108.059  1.00  0.72           C  
ATOM  10659  CG  PRO A1332     171.714 143.457 107.781  1.00  0.72           C  
ATOM  10660  CD  PRO A1332     170.595 143.350 106.749  1.00  0.72           C  
ATOM  10661  N   GLY A1333     170.268 139.525 107.283  1.00  0.71           N  
ATOM  10662  CA  GLY A1333     169.814 138.174 107.568  1.00  0.71           C  
ATOM  10663  C   GLY A1333     168.980 137.629 106.443  1.00  0.71           C  
ATOM  10664  O   GLY A1333     167.841 138.040 106.229  1.00  0.71           O  
ATOM  10665  N   LYS A1334     169.499 136.630 105.715  1.00  0.68           N  
ATOM  10666  CA  LYS A1334     168.827 136.038 104.573  1.00  0.68           C  
ATOM  10667  C   LYS A1334     167.773 135.035 105.037  1.00  0.68           C  
ATOM  10668  O   LYS A1334     168.085 133.878 105.286  1.00  0.68           O  
ATOM  10669  CB  LYS A1334     169.844 135.306 103.658  1.00  0.68           C  
ATOM  10670  CG  LYS A1334     171.046 136.146 103.184  1.00  0.68           C  
ATOM  10671  CD  LYS A1334     172.143 135.262 102.552  1.00  0.68           C  
ATOM  10672  CE  LYS A1334     171.958 134.888 101.072  1.00  0.68           C  
ATOM  10673  NZ  LYS A1334     172.406 135.971 100.169  1.00  0.68           N  
ATOM  10674  N   LEU A1335     166.516 135.508 105.201  1.00  0.78           N  
ATOM  10675  CA  LEU A1335     165.398 134.830 105.850  1.00  0.78           C  
ATOM  10676  C   LEU A1335     165.430 134.921 107.368  1.00  0.78           C  
ATOM  10677  O   LEU A1335     164.481 134.487 108.015  1.00  0.78           O  
ATOM  10678  CB  LEU A1335     165.131 133.364 105.415  1.00  0.78           C  
ATOM  10679  CG  LEU A1335     164.733 133.181 103.941  1.00  0.78           C  
ATOM  10680  CD1 LEU A1335     164.549 131.691 103.634  1.00  0.78           C  
ATOM  10681  CD2 LEU A1335     163.458 133.951 103.577  1.00  0.78           C  
ATOM  10682  N   ASP A1336     166.463 135.568 107.950  1.00  0.76           N  
ATOM  10683  CA  ASP A1336     166.591 135.764 109.384  1.00  0.76           C  
ATOM  10684  C   ASP A1336     166.469 137.235 109.786  1.00  0.76           C  
ATOM  10685  O   ASP A1336     166.372 137.568 110.964  1.00  0.76           O  
ATOM  10686  CB  ASP A1336     167.944 135.212 109.889  1.00  0.76           C  
ATOM  10687  CG  ASP A1336     168.040 133.725 109.612  1.00  0.76           C  
ATOM  10688  OD1 ASP A1336     167.092 132.983 109.976  1.00  0.76           O  
ATOM  10689  OD2 ASP A1336     169.061 133.307 109.022  1.00  0.76           O  
ATOM  10690  N   PHE A1337     166.416 138.178 108.817  1.00  0.74           N  
ATOM  10691  CA  PHE A1337     166.136 139.580 109.095  1.00  0.74           C  
ATOM  10692  C   PHE A1337     164.742 139.786 109.697  1.00  0.74           C  
ATOM  10693  O   PHE A1337     163.738 139.253 109.215  1.00  0.74           O  
ATOM  10694  CB  PHE A1337     166.358 140.452 107.824  1.00  0.74           C  
ATOM  10695  CG  PHE A1337     166.208 141.933 108.056  1.00  0.74           C  
ATOM  10696  CD1 PHE A1337     167.276 142.696 108.559  1.00  0.74           C  
ATOM  10697  CD2 PHE A1337     165.001 142.578 107.741  1.00  0.74           C  
ATOM  10698  CE1 PHE A1337     167.142 144.080 108.733  1.00  0.74           C  
ATOM  10699  CE2 PHE A1337     164.861 143.960 107.917  1.00  0.74           C  
ATOM  10700  CZ  PHE A1337     165.934 144.712 108.410  1.00  0.74           C  
ATOM  10701  N   VAL A1338     164.678 140.581 110.781  1.00  0.77           N  
ATOM  10702  CA  VAL A1338     163.455 140.908 111.484  1.00  0.77           C  
ATOM  10703  C   VAL A1338     162.851 142.150 110.871  1.00  0.77           C  
ATOM  10704  O   VAL A1338     163.434 143.233 110.866  1.00  0.77           O  
ATOM  10705  CB  VAL A1338     163.683 141.102 112.983  1.00  0.77           C  
ATOM  10706  CG1 VAL A1338     162.404 141.571 113.704  1.00  0.77           C  
ATOM  10707  CG2 VAL A1338     164.151 139.765 113.583  1.00  0.77           C  
ATOM  10708  N   LEU A1339     161.632 142.017 110.325  1.00  0.75           N  
ATOM  10709  CA  LEU A1339     160.855 143.136 109.855  1.00  0.75           C  
ATOM  10710  C   LEU A1339     160.242 143.845 111.044  1.00  0.75           C  
ATOM  10711  O   LEU A1339     159.758 143.214 111.980  1.00  0.75           O  
ATOM  10712  CB  LEU A1339     159.741 142.660 108.894  1.00  0.75           C  
ATOM  10713  CG  LEU A1339     160.269 141.997 107.605  1.00  0.75           C  
ATOM  10714  CD1 LEU A1339     159.142 141.266 106.863  1.00  0.75           C  
ATOM  10715  CD2 LEU A1339     160.953 143.013 106.683  1.00  0.75           C  
ATOM  10716  N   VAL A1340     160.270 145.185 111.038  1.00  0.72           N  
ATOM  10717  CA  VAL A1340     159.788 145.998 112.137  1.00  0.72           C  
ATOM  10718  C   VAL A1340     158.863 147.034 111.542  1.00  0.72           C  
ATOM  10719  O   VAL A1340     158.927 147.302 110.339  1.00  0.72           O  
ATOM  10720  CB  VAL A1340     160.908 146.674 112.927  1.00  0.72           C  
ATOM  10721  CG1 VAL A1340     161.710 145.592 113.671  1.00  0.72           C  
ATOM  10722  CG2 VAL A1340     161.830 147.496 112.008  1.00  0.72           C  
ATOM  10723  N   ASP A1341     157.944 147.586 112.365  1.00  0.70           N  
ATOM  10724  CA  ASP A1341     157.011 148.649 111.997  1.00  0.70           C  
ATOM  10725  C   ASP A1341     156.184 148.319 110.745  1.00  0.70           C  
ATOM  10726  O   ASP A1341     156.151 149.039 109.747  1.00  0.70           O  
ATOM  10727  CB  ASP A1341     157.764 150.003 111.927  1.00  0.70           C  
ATOM  10728  CG  ASP A1341     156.834 151.199 112.050  1.00  0.70           C  
ATOM  10729  OD1 ASP A1341     155.765 151.051 112.696  1.00  0.70           O  
ATOM  10730  OD2 ASP A1341     157.209 152.277 111.526  1.00  0.70           O  
ATOM  10731  N   GLY A1342     155.561 147.117 110.733  1.00  0.77           N  
ATOM  10732  CA  GLY A1342     154.790 146.616 109.594  1.00  0.77           C  
ATOM  10733  C   GLY A1342     155.569 146.408 108.311  1.00  0.77           C  
ATOM  10734  O   GLY A1342     155.006 146.347 107.219  1.00  0.77           O  
ATOM  10735  N   GLY A1343     156.910 146.287 108.395  1.00  0.78           N  
ATOM  10736  CA  GLY A1343     157.762 146.139 107.223  1.00  0.78           C  
ATOM  10737  C   GLY A1343     158.013 147.428 106.482  1.00  0.78           C  
ATOM  10738  O   GLY A1343     158.001 147.465 105.251  1.00  0.78           O  
ATOM  10739  N   CYS A1344     158.277 148.526 107.219  1.00  0.72           N  
ATOM  10740  CA  CYS A1344     158.557 149.857 106.681  1.00  0.72           C  
ATOM  10741  C   CYS A1344     159.761 149.919 105.745  1.00  0.72           C  
ATOM  10742  O   CYS A1344     159.792 150.699 104.799  1.00  0.72           O  
ATOM  10743  CB  CYS A1344     158.700 150.917 107.806  1.00  0.72           C  
ATOM  10744  SG  CYS A1344     160.098 150.623 108.946  1.00  0.72           S  
ATOM  10745  N   VAL A1345     160.756 149.042 105.978  1.00  0.74           N  
ATOM  10746  CA  VAL A1345     161.958 148.857 105.176  1.00  0.74           C  
ATOM  10747  C   VAL A1345     161.656 148.489 103.717  1.00  0.74           C  
ATOM  10748  O   VAL A1345     162.346 148.891 102.783  1.00  0.74           O  
ATOM  10749  CB  VAL A1345     162.844 147.778 105.808  1.00  0.74           C  
ATOM  10750  CG1 VAL A1345     164.210 147.724 105.108  1.00  0.74           C  
ATOM  10751  CG2 VAL A1345     163.067 148.064 107.306  1.00  0.74           C  
ATOM  10752  N   LEU A1346     160.596 147.690 103.485  1.00  0.77           N  
ATOM  10753  CA  LEU A1346     160.163 147.295 102.158  1.00  0.77           C  
ATOM  10754  C   LEU A1346     159.406 148.368 101.403  1.00  0.77           C  
ATOM  10755  O   LEU A1346     158.595 149.106 101.966  1.00  0.77           O  
ATOM  10756  CB  LEU A1346     159.201 146.087 102.235  1.00  0.77           C  
ATOM  10757  CG  LEU A1346     159.829 144.791 102.759  1.00  0.77           C  
ATOM  10758  CD1 LEU A1346     158.755 143.700 102.840  1.00  0.77           C  
ATOM  10759  CD2 LEU A1346     160.990 144.343 101.869  1.00  0.77           C  
ATOM  10760  N   SER A1347     159.564 148.415 100.059  1.00  0.76           N  
ATOM  10761  CA  SER A1347     158.736 149.274  99.221  1.00  0.76           C  
ATOM  10762  C   SER A1347     157.264 148.886  99.261  1.00  0.76           C  
ATOM  10763  O   SER A1347     156.871 147.863  99.827  1.00  0.76           O  
ATOM  10764  CB  SER A1347     159.254 149.449  97.754  1.00  0.76           C  
ATOM  10765  OG  SER A1347     158.812 148.458  96.819  1.00  0.76           O  
ATOM  10766  N   HIS A1348     156.372 149.697  98.676  1.00  0.69           N  
ATOM  10767  CA  HIS A1348     154.980 149.305  98.534  1.00  0.69           C  
ATOM  10768  C   HIS A1348     154.783 148.062  97.663  1.00  0.69           C  
ATOM  10769  O   HIS A1348     154.043 147.144  98.001  1.00  0.69           O  
ATOM  10770  CB  HIS A1348     154.185 150.480  97.955  1.00  0.69           C  
ATOM  10771  CG  HIS A1348     152.708 150.274  98.008  1.00  0.69           C  
ATOM  10772  ND1 HIS A1348     152.001 150.726  99.101  1.00  0.69           N  
ATOM  10773  CD2 HIS A1348     151.880 149.674  97.120  1.00  0.69           C  
ATOM  10774  CE1 HIS A1348     150.748 150.402  98.850  1.00  0.69           C  
ATOM  10775  NE2 HIS A1348     150.619 149.763  97.664  1.00  0.69           N  
ATOM  10776  N   GLY A1349     155.506 147.972  96.523  1.00  0.73           N  
ATOM  10777  CA  GLY A1349     155.347 146.857  95.589  1.00  0.73           C  
ATOM  10778  C   GLY A1349     155.968 145.565  96.050  1.00  0.73           C  
ATOM  10779  O   GLY A1349     155.562 144.482  95.647  1.00  0.73           O  
ATOM  10780  N   HIS A1350     156.955 145.639  96.958  1.00  0.72           N  
ATOM  10781  CA  HIS A1350     157.527 144.471  97.611  1.00  0.72           C  
ATOM  10782  C   HIS A1350     156.542 143.725  98.507  1.00  0.72           C  
ATOM  10783  O   HIS A1350     156.547 142.498  98.579  1.00  0.72           O  
ATOM  10784  CB  HIS A1350     158.786 144.863  98.406  1.00  0.72           C  
ATOM  10785  CG  HIS A1350     159.886 145.387  97.527  1.00  0.72           C  
ATOM  10786  ND1 HIS A1350     160.864 146.200  98.072  1.00  0.72           N  
ATOM  10787  CD2 HIS A1350     160.197 145.077  96.241  1.00  0.72           C  
ATOM  10788  CE1 HIS A1350     161.758 146.354  97.110  1.00  0.72           C  
ATOM  10789  NE2 HIS A1350     161.398 145.702  95.979  1.00  0.72           N  
ATOM  10790  N   LYS A1351     155.641 144.454  99.196  1.00  0.75           N  
ATOM  10791  CA  LYS A1351     154.593 143.878 100.029  1.00  0.75           C  
ATOM  10792  C   LYS A1351     153.587 143.042  99.237  1.00  0.75           C  
ATOM  10793  O   LYS A1351     153.123 141.995  99.685  1.00  0.75           O  
ATOM  10794  CB  LYS A1351     153.878 144.975 100.859  1.00  0.75           C  
ATOM  10795  CG  LYS A1351     154.852 145.799 101.723  1.00  0.75           C  
ATOM  10796  CD  LYS A1351     154.151 146.804 102.654  1.00  0.75           C  
ATOM  10797  CE  LYS A1351     155.104 147.594 103.564  1.00  0.75           C  
ATOM  10798  NZ  LYS A1351     155.987 148.476 102.771  1.00  0.75           N  
ATOM  10799  N   GLN A1352     153.269 143.466  97.997  1.00  0.72           N  
ATOM  10800  CA  GLN A1352     152.430 142.718  97.072  1.00  0.72           C  
ATOM  10801  C   GLN A1352     153.006 141.348  96.706  1.00  0.72           C  
ATOM  10802  O   GLN A1352     152.315 140.330  96.716  1.00  0.72           O  
ATOM  10803  CB  GLN A1352     152.222 143.533  95.769  1.00  0.72           C  
ATOM  10804  CG  GLN A1352     151.563 144.918  95.972  1.00  0.72           C  
ATOM  10805  CD  GLN A1352     150.169 144.846  96.599  1.00  0.72           C  
ATOM  10806  OE1 GLN A1352     149.912 145.484  97.617  1.00  0.72           O  
ATOM  10807  NE2 GLN A1352     149.246 144.076  95.978  1.00  0.72           N  
ATOM  10808  N   LEU A1353     154.323 141.290  96.422  1.00  0.76           N  
ATOM  10809  CA  LEU A1353     155.054 140.062  96.147  1.00  0.76           C  
ATOM  10810  C   LEU A1353     155.104 139.104  97.337  1.00  0.76           C  
ATOM  10811  O   LEU A1353     154.979 137.891  97.181  1.00  0.76           O  
ATOM  10812  CB  LEU A1353     156.478 140.370  95.623  1.00  0.76           C  
ATOM  10813  CG  LEU A1353     156.524 141.223  94.335  1.00  0.76           C  
ATOM  10814  CD1 LEU A1353     157.980 141.515  93.948  1.00  0.76           C  
ATOM  10815  CD2 LEU A1353     155.799 140.560  93.156  1.00  0.76           C  
ATOM  10816  N   MET A1354     155.232 139.627  98.575  1.00  0.80           N  
ATOM  10817  CA  MET A1354     155.105 138.846  99.801  1.00  0.80           C  
ATOM  10818  C   MET A1354     153.743 138.169  99.959  1.00  0.80           C  
ATOM  10819  O   MET A1354     153.649 136.990 100.296  1.00  0.80           O  
ATOM  10820  CB  MET A1354     155.343 139.754 101.035  1.00  0.80           C  
ATOM  10821  CG  MET A1354     156.803 140.216 101.204  1.00  0.80           C  
ATOM  10822  SD  MET A1354     157.968 138.900 101.672  1.00  0.80           S  
ATOM  10823  CE  MET A1354     157.355 138.627 103.361  1.00  0.80           C  
ATOM  10824  N   CYS A1355     152.638 138.888  99.681  1.00  0.79           N  
ATOM  10825  CA  CYS A1355     151.301 138.308  99.658  1.00  0.79           C  
ATOM  10826  C   CYS A1355     151.095 137.275  98.550  1.00  0.79           C  
ATOM  10827  O   CYS A1355     150.482 136.232  98.776  1.00  0.79           O  
ATOM  10828  CB  CYS A1355     150.206 139.400  99.624  1.00  0.79           C  
ATOM  10829  SG  CYS A1355     150.117 140.307 101.210  1.00  0.79           S  
ATOM  10830  N   LEU A1356     151.646 137.503  97.337  1.00  0.76           N  
ATOM  10831  CA  LEU A1356     151.693 136.493  96.281  1.00  0.76           C  
ATOM  10832  C   LEU A1356     152.465 135.229  96.663  1.00  0.76           C  
ATOM  10833  O   LEU A1356     152.034 134.109  96.400  1.00  0.76           O  
ATOM  10834  CB  LEU A1356     152.312 137.079  94.987  1.00  0.76           C  
ATOM  10835  CG  LEU A1356     152.346 136.123  93.773  1.00  0.76           C  
ATOM  10836  CD1 LEU A1356     150.940 135.780  93.264  1.00  0.76           C  
ATOM  10837  CD2 LEU A1356     153.204 136.723  92.655  1.00  0.76           C  
ATOM  10838  N   ALA A1357     153.623 135.362  97.336  1.00  0.83           N  
ATOM  10839  CA  ALA A1357     154.406 134.229  97.797  1.00  0.83           C  
ATOM  10840  C   ALA A1357     153.639 133.290  98.735  1.00  0.83           C  
ATOM  10841  O   ALA A1357     153.699 132.068  98.605  1.00  0.83           O  
ATOM  10842  CB  ALA A1357     155.680 134.750  98.487  1.00  0.83           C  
ATOM  10843  N   ARG A1358     152.847 133.851  99.671  1.00  0.72           N  
ATOM  10844  CA  ARG A1358     151.967 133.092 100.548  1.00  0.72           C  
ATOM  10845  C   ARG A1358     150.872 132.301  99.819  1.00  0.72           C  
ATOM  10846  O   ARG A1358     150.596 131.149 100.150  1.00  0.72           O  
ATOM  10847  CB  ARG A1358     151.260 134.033 101.558  1.00  0.72           C  
ATOM  10848  CG  ARG A1358     152.181 134.825 102.513  1.00  0.72           C  
ATOM  10849  CD  ARG A1358     151.384 135.891 103.277  1.00  0.72           C  
ATOM  10850  NE  ARG A1358     152.273 136.581 104.265  1.00  0.72           N  
ATOM  10851  CZ  ARG A1358     151.926 137.718 104.880  1.00  0.72           C  
ATOM  10852  NH1 ARG A1358     150.760 138.316 104.657  1.00  0.72           N  
ATOM  10853  NH2 ARG A1358     152.728 138.253 105.795  1.00  0.72           N  
ATOM  10854  N   SER A1359     150.210 132.900  98.805  1.00  0.75           N  
ATOM  10855  CA  SER A1359     149.158 132.242  98.025  1.00  0.75           C  
ATOM  10856  C   SER A1359     149.648 131.090  97.165  1.00  0.75           C  
ATOM  10857  O   SER A1359     148.995 130.055  97.043  1.00  0.75           O  
ATOM  10858  CB  SER A1359     148.324 133.222  97.159  1.00  0.75           C  
ATOM  10859  OG  SER A1359     149.085 133.809  96.106  1.00  0.75           O  
ATOM  10860  N   VAL A1360     150.840 131.233  96.558  1.00  0.75           N  
ATOM  10861  CA  VAL A1360     151.528 130.150  95.865  1.00  0.75           C  
ATOM  10862  C   VAL A1360     151.897 129.017  96.814  1.00  0.75           C  
ATOM  10863  O   VAL A1360     151.692 127.839  96.530  1.00  0.75           O  
ATOM  10864  CB  VAL A1360     152.764 130.669  95.136  1.00  0.75           C  
ATOM  10865  CG1 VAL A1360     153.554 129.527  94.470  1.00  0.75           C  
ATOM  10866  CG2 VAL A1360     152.308 131.665  94.057  1.00  0.75           C  
ATOM  10867  N   LEU A1361     152.419 129.349  98.010  1.00  0.75           N  
ATOM  10868  CA  LEU A1361     152.792 128.370  99.014  1.00  0.75           C  
ATOM  10869  C   LEU A1361     151.618 127.584  99.608  1.00  0.75           C  
ATOM  10870  O   LEU A1361     151.703 126.365  99.809  1.00  0.75           O  
ATOM  10871  CB  LEU A1361     153.644 129.065 100.102  1.00  0.75           C  
ATOM  10872  CG  LEU A1361     154.629 128.178 100.890  1.00  0.75           C  
ATOM  10873  CD1 LEU A1361     155.477 127.239 100.025  1.00  0.75           C  
ATOM  10874  CD2 LEU A1361     155.571 129.065 101.714  1.00  0.75           C  
ATOM  10875  N   SER A1362     150.466 128.257  99.857  1.00  0.73           N  
ATOM  10876  CA  SER A1362     149.247 127.653 100.400  1.00  0.73           C  
ATOM  10877  C   SER A1362     148.683 126.526  99.550  1.00  0.73           C  
ATOM  10878  O   SER A1362     148.335 125.470 100.074  1.00  0.73           O  
ATOM  10879  CB  SER A1362     148.110 128.685 100.697  1.00  0.73           C  
ATOM  10880  OG  SER A1362     147.509 129.236  99.523  1.00  0.73           O  
ATOM  10881  N   LYS A1363     148.644 126.722  98.216  1.00  0.60           N  
ATOM  10882  CA  LYS A1363     148.220 125.742  97.224  1.00  0.60           C  
ATOM  10883  C   LYS A1363     146.757 125.340  97.332  1.00  0.60           C  
ATOM  10884  O   LYS A1363     146.390 124.167  97.256  1.00  0.60           O  
ATOM  10885  CB  LYS A1363     149.120 124.481  97.176  1.00  0.60           C  
ATOM  10886  CG  LYS A1363     150.597 124.788  96.899  1.00  0.60           C  
ATOM  10887  CD  LYS A1363     151.483 123.534  96.874  1.00  0.60           C  
ATOM  10888  CE  LYS A1363     151.570 122.787  98.210  1.00  0.60           C  
ATOM  10889  NZ  LYS A1363     152.220 123.625  99.247  1.00  0.60           N  
ATOM  10890  N   ALA A1364     145.869 126.331  97.496  1.00  0.66           N  
ATOM  10891  CA  ALA A1364     144.449 126.094  97.569  1.00  0.66           C  
ATOM  10892  C   ALA A1364     143.799 125.897  96.200  1.00  0.66           C  
ATOM  10893  O   ALA A1364     144.270 126.368  95.166  1.00  0.66           O  
ATOM  10894  CB  ALA A1364     143.772 127.248  98.312  1.00  0.66           C  
ATOM  10895  N   LYS A1365     142.672 125.162  96.161  1.00  0.71           N  
ATOM  10896  CA  LYS A1365     141.973 124.861  94.925  1.00  0.71           C  
ATOM  10897  C   LYS A1365     141.149 126.000  94.353  1.00  0.71           C  
ATOM  10898  O   LYS A1365     140.915 126.057  93.145  1.00  0.71           O  
ATOM  10899  CB  LYS A1365     141.039 123.654  95.142  1.00  0.71           C  
ATOM  10900  CG  LYS A1365     141.789 122.321  95.291  1.00  0.71           C  
ATOM  10901  CD  LYS A1365     142.543 121.850  94.031  1.00  0.71           C  
ATOM  10902  CE  LYS A1365     141.644 121.649  92.804  1.00  0.71           C  
ATOM  10903  NZ  LYS A1365     142.421 121.152  91.644  1.00  0.71           N  
ATOM  10904  N   ILE A1366     140.682 126.927  95.205  1.00  0.80           N  
ATOM  10905  CA  ILE A1366     139.904 128.071  94.773  1.00  0.80           C  
ATOM  10906  C   ILE A1366     140.638 129.304  95.245  1.00  0.80           C  
ATOM  10907  O   ILE A1366     141.044 129.413  96.401  1.00  0.80           O  
ATOM  10908  CB  ILE A1366     138.467 128.035  95.279  1.00  0.80           C  
ATOM  10909  CG1 ILE A1366     137.788 126.733  94.789  1.00  0.80           C  
ATOM  10910  CG2 ILE A1366     137.709 129.287  94.788  1.00  0.80           C  
ATOM  10911  CD1 ILE A1366     136.351 126.562  95.274  1.00  0.80           C  
ATOM  10912  N   LEU A1367     140.880 130.261  94.335  1.00  0.79           N  
ATOM  10913  CA  LEU A1367     141.749 131.385  94.604  1.00  0.79           C  
ATOM  10914  C   LEU A1367     140.997 132.687  94.421  1.00  0.79           C  
ATOM  10915  O   LEU A1367     140.388 132.942  93.381  1.00  0.79           O  
ATOM  10916  CB  LEU A1367     142.982 131.345  93.674  1.00  0.79           C  
ATOM  10917  CG  LEU A1367     143.874 130.105  93.894  1.00  0.79           C  
ATOM  10918  CD1 LEU A1367     144.742 129.831  92.666  1.00  0.79           C  
ATOM  10919  CD2 LEU A1367     144.748 130.234  95.146  1.00  0.79           C  
ATOM  10920  N   LEU A1368     141.030 133.550  95.452  1.00  0.82           N  
ATOM  10921  CA  LEU A1368     140.359 134.834  95.457  1.00  0.82           C  
ATOM  10922  C   LEU A1368     141.425 135.913  95.521  1.00  0.82           C  
ATOM  10923  O   LEU A1368     142.107 136.085  96.534  1.00  0.82           O  
ATOM  10924  CB  LEU A1368     139.409 134.960  96.677  1.00  0.82           C  
ATOM  10925  CG  LEU A1368     138.301 133.886  96.747  1.00  0.82           C  
ATOM  10926  CD1 LEU A1368     137.482 134.018  98.038  1.00  0.82           C  
ATOM  10927  CD2 LEU A1368     137.370 133.923  95.532  1.00  0.82           C  
ATOM  10928  N   LEU A1369     141.630 136.654  94.416  1.00  0.77           N  
ATOM  10929  CA  LEU A1369     142.743 137.579  94.310  1.00  0.77           C  
ATOM  10930  C   LEU A1369     142.215 138.999  94.213  1.00  0.77           C  
ATOM  10931  O   LEU A1369     141.719 139.421  93.166  1.00  0.77           O  
ATOM  10932  CB  LEU A1369     143.616 137.289  93.058  1.00  0.77           C  
ATOM  10933  CG  LEU A1369     144.060 135.825  92.833  1.00  0.77           C  
ATOM  10934  CD1 LEU A1369     145.018 135.751  91.637  1.00  0.77           C  
ATOM  10935  CD2 LEU A1369     144.725 135.174  94.049  1.00  0.77           C  
ATOM  10936  N   ASP A1370     142.329 139.787  95.299  1.00  0.77           N  
ATOM  10937  CA  ASP A1370     141.767 141.123  95.360  1.00  0.77           C  
ATOM  10938  C   ASP A1370     142.820 142.146  94.914  1.00  0.77           C  
ATOM  10939  O   ASP A1370     143.650 142.578  95.713  1.00  0.77           O  
ATOM  10940  CB  ASP A1370     141.257 141.359  96.811  1.00  0.77           C  
ATOM  10941  CG  ASP A1370     140.149 142.398  96.931  1.00  0.77           C  
ATOM  10942  OD1 ASP A1370     139.606 142.848  95.889  1.00  0.77           O  
ATOM  10943  OD2 ASP A1370     139.794 142.728  98.095  1.00  0.77           O  
ATOM  10944  N   GLU A1371     142.847 142.507  93.604  1.00  0.74           N  
ATOM  10945  CA  GLU A1371     143.815 143.429  93.002  1.00  0.74           C  
ATOM  10946  C   GLU A1371     145.302 143.163  93.334  1.00  0.74           C  
ATOM  10947  O   GLU A1371     145.956 143.978  93.998  1.00  0.74           O  
ATOM  10948  CB  GLU A1371     143.391 144.893  93.289  1.00  0.74           C  
ATOM  10949  CG  GLU A1371     144.132 145.998  92.478  1.00  0.74           C  
ATOM  10950  CD  GLU A1371     143.504 146.343  91.128  1.00  0.74           C  
ATOM  10951  OE1 GLU A1371     144.219 146.922  90.270  1.00  0.74           O  
ATOM  10952  OE2 GLU A1371     142.307 146.037  90.920  1.00  0.74           O  
ATOM  10953  N   PRO A1372     145.925 142.037  92.952  1.00  0.72           N  
ATOM  10954  CA  PRO A1372     147.291 141.728  93.369  1.00  0.72           C  
ATOM  10955  C   PRO A1372     148.342 142.666  92.786  1.00  0.72           C  
ATOM  10956  O   PRO A1372     149.467 142.651  93.289  1.00  0.72           O  
ATOM  10957  CB  PRO A1372     147.484 140.268  92.910  1.00  0.72           C  
ATOM  10958  CG  PRO A1372     146.558 140.134  91.702  1.00  0.72           C  
ATOM  10959  CD  PRO A1372     145.350 140.977  92.115  1.00  0.72           C  
ATOM  10960  N   SER A1373     148.045 143.490  91.759  1.00  0.75           N  
ATOM  10961  CA  SER A1373     149.044 144.331  91.124  1.00  0.75           C  
ATOM  10962  C   SER A1373     148.855 145.842  91.285  1.00  0.75           C  
ATOM  10963  O   SER A1373     149.325 146.619  90.450  1.00  0.75           O  
ATOM  10964  CB  SER A1373     149.325 143.887  89.690  1.00  0.75           C  
ATOM  10965  OG  SER A1373     148.226 144.234  88.804  1.00  0.75           O  
ATOM  10966  N   ALA A1374     148.223 146.287  92.412  1.00  0.75           N  
ATOM  10967  CA  ALA A1374     147.755 147.647  92.730  1.00  0.75           C  
ATOM  10968  C   ALA A1374     148.629 148.831  92.301  1.00  0.75           C  
ATOM  10969  O   ALA A1374     148.186 149.778  91.660  1.00  0.75           O  
ATOM  10970  CB  ALA A1374     147.530 147.770  94.261  1.00  0.75           C  
ATOM  10971  N   HIS A1375     149.932 148.806  92.635  1.00  0.64           N  
ATOM  10972  CA  HIS A1375     150.837 149.885  92.276  1.00  0.64           C  
ATOM  10973  C   HIS A1375     151.992 149.389  91.429  1.00  0.64           C  
ATOM  10974  O   HIS A1375     152.968 150.108  91.218  1.00  0.64           O  
ATOM  10975  CB  HIS A1375     151.410 150.572  93.536  1.00  0.64           C  
ATOM  10976  CG  HIS A1375     150.407 151.422  94.261  1.00  0.64           C  
ATOM  10977  ND1 HIS A1375     149.393 150.856  95.006  1.00  0.64           N  
ATOM  10978  CD2 HIS A1375     150.298 152.773  94.278  1.00  0.64           C  
ATOM  10979  CE1 HIS A1375     148.682 151.874  95.454  1.00  0.64           C  
ATOM  10980  NE2 HIS A1375     149.191 153.062  95.044  1.00  0.64           N  
ATOM  10981  N   LEU A1376     151.927 148.144  90.917  1.00  0.69           N  
ATOM  10982  CA  LEU A1376     152.968 147.611  90.055  1.00  0.69           C  
ATOM  10983  C   LEU A1376     152.968 148.252  88.675  1.00  0.69           C  
ATOM  10984  O   LEU A1376     151.928 148.512  88.054  1.00  0.69           O  
ATOM  10985  CB  LEU A1376     152.901 146.068  89.896  1.00  0.69           C  
ATOM  10986  CG  LEU A1376     152.979 145.262  91.212  1.00  0.69           C  
ATOM  10987  CD1 LEU A1376     152.859 143.754  90.950  1.00  0.69           C  
ATOM  10988  CD2 LEU A1376     154.271 145.515  91.995  1.00  0.69           C  
ATOM  10989  N   ASP A1377     154.172 148.491  88.139  1.00  0.70           N  
ATOM  10990  CA  ASP A1377     154.378 148.910  86.784  1.00  0.70           C  
ATOM  10991  C   ASP A1377     154.126 147.738  85.814  1.00  0.70           C  
ATOM  10992  O   ASP A1377     154.074 146.586  86.258  1.00  0.70           O  
ATOM  10993  CB  ASP A1377     155.785 149.543  86.689  1.00  0.70           C  
ATOM  10994  CG  ASP A1377     156.888 148.540  86.951  1.00  0.70           C  
ATOM  10995  OD1 ASP A1377     156.971 147.945  88.056  1.00  0.70           O  
ATOM  10996  OD2 ASP A1377     157.649 148.302  85.991  1.00  0.70           O  
ATOM  10997  N   PRO A1378     153.921 147.932  84.511  1.00  0.72           N  
ATOM  10998  CA  PRO A1378     153.691 146.829  83.574  1.00  0.72           C  
ATOM  10999  C   PRO A1378     154.802 145.787  83.527  1.00  0.72           C  
ATOM  11000  O   PRO A1378     154.527 144.628  83.216  1.00  0.72           O  
ATOM  11001  CB  PRO A1378     153.487 147.531  82.225  1.00  0.72           C  
ATOM  11002  CG  PRO A1378     152.925 148.903  82.603  1.00  0.72           C  
ATOM  11003  CD  PRO A1378     153.672 149.239  83.890  1.00  0.72           C  
ATOM  11004  N   VAL A1379     156.063 146.164  83.823  1.00  0.65           N  
ATOM  11005  CA  VAL A1379     157.181 145.230  83.875  1.00  0.65           C  
ATOM  11006  C   VAL A1379     157.045 144.229  85.017  1.00  0.65           C  
ATOM  11007  O   VAL A1379     157.101 143.014  84.820  1.00  0.65           O  
ATOM  11008  CB  VAL A1379     158.504 145.977  84.034  1.00  0.65           C  
ATOM  11009  CG1 VAL A1379     159.713 145.027  84.088  1.00  0.65           C  
ATOM  11010  CG2 VAL A1379     158.669 147.009  82.902  1.00  0.65           C  
ATOM  11011  N   THR A1380     156.791 144.716  86.252  1.00  0.68           N  
ATOM  11012  CA  THR A1380     156.658 143.868  87.437  1.00  0.68           C  
ATOM  11013  C   THR A1380     155.355 143.052  87.389  1.00  0.68           C  
ATOM  11014  O   THR A1380     155.269 141.928  87.886  1.00  0.68           O  
ATOM  11015  CB  THR A1380     156.768 144.631  88.766  1.00  0.68           C  
ATOM  11016  OG1 THR A1380     157.887 145.532  88.805  1.00  0.68           O  
ATOM  11017  CG2 THR A1380     156.871 143.616  89.935  1.00  0.68           C  
ATOM  11018  N   TYR A1381     154.307 143.543  86.680  1.00  0.69           N  
ATOM  11019  CA  TYR A1381     153.068 142.807  86.399  1.00  0.69           C  
ATOM  11020  C   TYR A1381     153.303 141.451  85.704  1.00  0.69           C  
ATOM  11021  O   TYR A1381     152.589 140.477  85.942  1.00  0.69           O  
ATOM  11022  CB  TYR A1381     152.059 143.714  85.616  1.00  0.69           C  
ATOM  11023  CG  TYR A1381     150.906 142.963  84.982  1.00  0.69           C  
ATOM  11024  CD1 TYR A1381     149.916 142.337  85.760  1.00  0.69           C  
ATOM  11025  CD2 TYR A1381     150.888 142.778  83.588  1.00  0.69           C  
ATOM  11026  CE1 TYR A1381     148.983 141.477  85.160  1.00  0.69           C  
ATOM  11027  CE2 TYR A1381     149.950 141.925  82.988  1.00  0.69           C  
ATOM  11028  CZ  TYR A1381     149.010 141.259  83.779  1.00  0.69           C  
ATOM  11029  OH  TYR A1381     148.100 140.337  83.227  1.00  0.69           O  
ATOM  11030  N   GLN A1382     154.351 141.321  84.867  1.00  0.69           N  
ATOM  11031  CA  GLN A1382     154.678 140.077  84.188  1.00  0.69           C  
ATOM  11032  C   GLN A1382     155.090 138.933  85.111  1.00  0.69           C  
ATOM  11033  O   GLN A1382     155.088 137.766  84.716  1.00  0.69           O  
ATOM  11034  CB  GLN A1382     155.825 140.291  83.176  1.00  0.69           C  
ATOM  11035  CG  GLN A1382     155.523 141.349  82.091  1.00  0.69           C  
ATOM  11036  CD  GLN A1382     154.260 141.022  81.284  1.00  0.69           C  
ATOM  11037  OE1 GLN A1382     154.017 139.876  80.884  1.00  0.69           O  
ATOM  11038  NE2 GLN A1382     153.437 142.070  81.041  1.00  0.69           N  
ATOM  11039  N   ILE A1383     155.464 139.218  86.372  1.00  0.71           N  
ATOM  11040  CA  ILE A1383     155.597 138.205  87.413  1.00  0.71           C  
ATOM  11041  C   ILE A1383     154.240 137.604  87.774  1.00  0.71           C  
ATOM  11042  O   ILE A1383     154.072 136.389  87.802  1.00  0.71           O  
ATOM  11043  CB  ILE A1383     156.293 138.778  88.645  1.00  0.71           C  
ATOM  11044  CG1 ILE A1383     157.676 139.356  88.251  1.00  0.71           C  
ATOM  11045  CG2 ILE A1383     156.421 137.697  89.737  1.00  0.71           C  
ATOM  11046  CD1 ILE A1383     158.465 139.970  89.412  1.00  0.71           C  
ATOM  11047  N   ILE A1384     153.202 138.448  87.966  1.00  0.69           N  
ATOM  11048  CA  ILE A1384     151.838 138.019  88.272  1.00  0.69           C  
ATOM  11049  C   ILE A1384     151.259 137.166  87.148  1.00  0.69           C  
ATOM  11050  O   ILE A1384     150.733 136.077  87.368  1.00  0.69           O  
ATOM  11051  CB  ILE A1384     150.897 139.205  88.538  1.00  0.69           C  
ATOM  11052  CG1 ILE A1384     151.492 140.260  89.503  1.00  0.69           C  
ATOM  11053  CG2 ILE A1384     149.540 138.690  89.067  1.00  0.69           C  
ATOM  11054  CD1 ILE A1384     151.774 139.755  90.916  1.00  0.69           C  
ATOM  11055  N   ARG A1385     151.426 137.625  85.893  1.00  0.64           N  
ATOM  11056  CA  ARG A1385     150.995 136.940  84.686  1.00  0.64           C  
ATOM  11057  C   ARG A1385     151.643 135.578  84.436  1.00  0.64           C  
ATOM  11058  O   ARG A1385     150.989 134.615  84.029  1.00  0.64           O  
ATOM  11059  CB  ARG A1385     151.276 137.865  83.483  1.00  0.64           C  
ATOM  11060  CG  ARG A1385     150.756 137.323  82.143  1.00  0.64           C  
ATOM  11061  CD  ARG A1385     150.843 138.348  81.015  1.00  0.64           C  
ATOM  11062  NE  ARG A1385     150.497 137.615  79.759  1.00  0.64           N  
ATOM  11063  CZ  ARG A1385     151.418 137.112  78.927  1.00  0.64           C  
ATOM  11064  NH1 ARG A1385     152.721 137.139  79.213  1.00  0.64           N  
ATOM  11065  NH2 ARG A1385     151.034 136.538  77.789  1.00  0.64           N  
ATOM  11066  N   ARG A1386     152.967 135.450  84.657  1.00  0.67           N  
ATOM  11067  CA  ARG A1386     153.643 134.164  84.600  1.00  0.67           C  
ATOM  11068  C   ARG A1386     153.239 133.217  85.727  1.00  0.67           C  
ATOM  11069  O   ARG A1386     152.906 132.059  85.479  1.00  0.67           O  
ATOM  11070  CB  ARG A1386     155.175 134.358  84.529  1.00  0.67           C  
ATOM  11071  CG  ARG A1386     155.608 134.895  83.149  1.00  0.67           C  
ATOM  11072  CD  ARG A1386     157.111 135.133  82.993  1.00  0.67           C  
ATOM  11073  NE  ARG A1386     157.433 136.399  83.719  1.00  0.67           N  
ATOM  11074  CZ  ARG A1386     158.637 136.984  83.681  1.00  0.67           C  
ATOM  11075  NH1 ARG A1386     159.643 136.453  82.990  1.00  0.67           N  
ATOM  11076  NH2 ARG A1386     158.839 138.121  84.340  1.00  0.67           N  
ATOM  11077  N   THR A1387     153.167 133.700  86.985  1.00  0.71           N  
ATOM  11078  CA  THR A1387     152.707 132.923  88.142  1.00  0.71           C  
ATOM  11079  C   THR A1387     151.286 132.406  87.971  1.00  0.71           C  
ATOM  11080  O   THR A1387     150.991 131.245  88.259  1.00  0.71           O  
ATOM  11081  CB  THR A1387     152.811 133.715  89.443  1.00  0.71           C  
ATOM  11082  OG1 THR A1387     154.173 134.032  89.685  1.00  0.71           O  
ATOM  11083  CG2 THR A1387     152.338 132.912  90.660  1.00  0.71           C  
ATOM  11084  N   LEU A1388     150.385 133.236  87.403  1.00  0.65           N  
ATOM  11085  CA  LEU A1388     149.007 132.897  87.069  1.00  0.65           C  
ATOM  11086  C   LEU A1388     148.855 131.669  86.177  1.00  0.65           C  
ATOM  11087  O   LEU A1388     147.884 130.931  86.293  1.00  0.65           O  
ATOM  11088  CB  LEU A1388     148.311 134.109  86.389  1.00  0.65           C  
ATOM  11089  CG  LEU A1388     146.802 133.961  86.079  1.00  0.65           C  
ATOM  11090  CD1 LEU A1388     145.967 133.770  87.350  1.00  0.65           C  
ATOM  11091  CD2 LEU A1388     146.284 135.169  85.285  1.00  0.65           C  
ATOM  11092  N   LYS A1389     149.807 131.409  85.261  1.00  0.67           N  
ATOM  11093  CA  LYS A1389     149.727 130.256  84.381  1.00  0.67           C  
ATOM  11094  C   LYS A1389     150.683 129.123  84.710  1.00  0.67           C  
ATOM  11095  O   LYS A1389     150.587 128.056  84.111  1.00  0.67           O  
ATOM  11096  CB  LYS A1389     150.016 130.715  82.938  1.00  0.67           C  
ATOM  11097  CG  LYS A1389     148.834 131.494  82.353  1.00  0.67           C  
ATOM  11098  CD  LYS A1389     149.085 131.960  80.916  1.00  0.67           C  
ATOM  11099  CE  LYS A1389     150.083 133.113  80.840  1.00  0.67           C  
ATOM  11100  NZ  LYS A1389     150.168 133.571  79.440  1.00  0.67           N  
ATOM  11101  N   GLN A1390     151.614 129.301  85.664  1.00  0.67           N  
ATOM  11102  CA  GLN A1390     152.542 128.248  86.056  1.00  0.67           C  
ATOM  11103  C   GLN A1390     152.157 127.652  87.398  1.00  0.67           C  
ATOM  11104  O   GLN A1390     151.813 126.479  87.496  1.00  0.67           O  
ATOM  11105  CB  GLN A1390     154.003 128.767  86.095  1.00  0.67           C  
ATOM  11106  CG  GLN A1390     154.524 129.196  84.699  1.00  0.67           C  
ATOM  11107  CD  GLN A1390     155.953 129.753  84.682  1.00  0.67           C  
ATOM  11108  OE1 GLN A1390     156.473 130.121  83.629  1.00  0.67           O  
ATOM  11109  NE2 GLN A1390     156.613 129.835  85.859  1.00  0.67           N  
ATOM  11110  N   ALA A1391     152.178 128.460  88.476  1.00  0.73           N  
ATOM  11111  CA  ALA A1391     151.777 128.037  89.806  1.00  0.73           C  
ATOM  11112  C   ALA A1391     150.286 127.746  89.894  1.00  0.73           C  
ATOM  11113  O   ALA A1391     149.837 126.813  90.554  1.00  0.73           O  
ATOM  11114  CB  ALA A1391     152.169 129.113  90.834  1.00  0.73           C  
ATOM  11115  N   PHE A1392     149.482 128.557  89.185  1.00  0.66           N  
ATOM  11116  CA  PHE A1392     148.040 128.433  89.150  1.00  0.66           C  
ATOM  11117  C   PHE A1392     147.580 127.994  87.769  1.00  0.66           C  
ATOM  11118  O   PHE A1392     146.594 128.494  87.230  1.00  0.66           O  
ATOM  11119  CB  PHE A1392     147.335 129.757  89.551  1.00  0.66           C  
ATOM  11120  CG  PHE A1392     147.807 130.309  90.875  1.00  0.66           C  
ATOM  11121  CD1 PHE A1392     148.076 129.488  91.988  1.00  0.66           C  
ATOM  11122  CD2 PHE A1392     147.957 131.700  91.015  1.00  0.66           C  
ATOM  11123  CE1 PHE A1392     148.505 130.044  93.200  1.00  0.66           C  
ATOM  11124  CE2 PHE A1392     148.388 132.259  92.223  1.00  0.66           C  
ATOM  11125  CZ  PHE A1392     148.665 131.429  93.315  1.00  0.66           C  
ATOM  11126  N   ALA A1393     148.291 127.028  87.144  1.00  0.68           N  
ATOM  11127  CA  ALA A1393     147.905 126.474  85.856  1.00  0.68           C  
ATOM  11128  C   ALA A1393     146.509 125.853  85.876  1.00  0.68           C  
ATOM  11129  O   ALA A1393     145.665 126.198  85.047  1.00  0.68           O  
ATOM  11130  CB  ALA A1393     148.937 125.422  85.414  1.00  0.68           C  
ATOM  11131  N   ASP A1394     146.238 125.032  86.912  1.00  0.68           N  
ATOM  11132  CA  ASP A1394     144.932 124.492  87.225  1.00  0.68           C  
ATOM  11133  C   ASP A1394     144.154 125.506  88.081  1.00  0.68           C  
ATOM  11134  O   ASP A1394     144.474 126.692  88.130  1.00  0.68           O  
ATOM  11135  CB  ASP A1394     145.075 123.189  88.072  1.00  0.68           C  
ATOM  11136  CG  ASP A1394     145.877 122.070  87.423  1.00  0.68           C  
ATOM  11137  OD1 ASP A1394     146.150 122.115  86.204  1.00  0.68           O  
ATOM  11138  OD2 ASP A1394     146.173 121.121  88.196  1.00  0.68           O  
ATOM  11139  N   CYS A1395     143.135 125.025  88.835  1.00  0.75           N  
ATOM  11140  CA  CYS A1395     142.440 125.777  89.873  1.00  0.75           C  
ATOM  11141  C   CYS A1395     141.508 126.877  89.376  1.00  0.75           C  
ATOM  11142  O   CYS A1395     141.656 127.452  88.302  1.00  0.75           O  
ATOM  11143  CB  CYS A1395     143.380 126.310  90.990  1.00  0.75           C  
ATOM  11144  SG  CYS A1395     144.277 124.963  91.840  1.00  0.75           S  
ATOM  11145  N   THR A1396     140.466 127.187  90.170  1.00  0.82           N  
ATOM  11146  CA  THR A1396     139.480 128.198  89.793  1.00  0.82           C  
ATOM  11147  C   THR A1396     139.941 129.529  90.353  1.00  0.82           C  
ATOM  11148  O   THR A1396     140.045 129.710  91.568  1.00  0.82           O  
ATOM  11149  CB  THR A1396     138.062 127.902  90.286  1.00  0.82           C  
ATOM  11150  OG1 THR A1396     137.605 126.642  89.799  1.00  0.82           O  
ATOM  11151  CG2 THR A1396     137.074 128.949  89.760  1.00  0.82           C  
ATOM  11152  N   VAL A1397     140.262 130.501  89.474  1.00  0.82           N  
ATOM  11153  CA  VAL A1397     140.902 131.748  89.878  1.00  0.82           C  
ATOM  11154  C   VAL A1397     139.963 132.909  89.640  1.00  0.82           C  
ATOM  11155  O   VAL A1397     139.574 133.203  88.509  1.00  0.82           O  
ATOM  11156  CB  VAL A1397     142.210 132.039  89.138  1.00  0.82           C  
ATOM  11157  CG1 VAL A1397     142.918 133.256  89.767  1.00  0.82           C  
ATOM  11158  CG2 VAL A1397     143.139 130.818  89.215  1.00  0.82           C  
ATOM  11159  N   ILE A1398     139.584 133.622  90.713  1.00  0.84           N  
ATOM  11160  CA  ILE A1398     138.775 134.820  90.615  1.00  0.84           C  
ATOM  11161  C   ILE A1398     139.701 136.015  90.781  1.00  0.84           C  
ATOM  11162  O   ILE A1398     140.237 136.286  91.858  1.00  0.84           O  
ATOM  11163  CB  ILE A1398     137.613 134.813  91.610  1.00  0.84           C  
ATOM  11164  CG1 ILE A1398     136.762 133.532  91.393  1.00  0.84           C  
ATOM  11165  CG2 ILE A1398     136.774 136.100  91.453  1.00  0.84           C  
ATOM  11166  CD1 ILE A1398     135.538 133.390  92.303  1.00  0.84           C  
ATOM  11167  N   LEU A1399     139.931 136.749  89.675  1.00  0.82           N  
ATOM  11168  CA  LEU A1399     140.696 137.978  89.654  1.00  0.82           C  
ATOM  11169  C   LEU A1399     139.768 139.153  89.858  1.00  0.82           C  
ATOM  11170  O   LEU A1399     138.625 139.152  89.417  1.00  0.82           O  
ATOM  11171  CB  LEU A1399     141.439 138.191  88.303  1.00  0.82           C  
ATOM  11172  CG  LEU A1399     142.894 137.686  88.261  1.00  0.82           C  
ATOM  11173  CD1 LEU A1399     143.457 137.776  86.837  1.00  0.82           C  
ATOM  11174  CD2 LEU A1399     143.795 138.497  89.199  1.00  0.82           C  
ATOM  11175  N   CYS A1400     140.269 140.205  90.516  1.00  0.82           N  
ATOM  11176  CA  CYS A1400     139.533 141.417  90.808  1.00  0.82           C  
ATOM  11177  C   CYS A1400     140.430 142.596  90.467  1.00  0.82           C  
ATOM  11178  O   CYS A1400     140.688 143.451  91.299  1.00  0.82           O  
ATOM  11179  CB  CYS A1400     139.180 141.419  92.319  1.00  0.82           C  
ATOM  11180  SG  CYS A1400     138.003 142.692  92.863  1.00  0.82           S  
ATOM  11181  N   GLU A1401     140.982 142.609  89.237  1.00  0.76           N  
ATOM  11182  CA  GLU A1401     141.909 143.633  88.768  1.00  0.76           C  
ATOM  11183  C   GLU A1401     141.218 144.802  88.074  1.00  0.76           C  
ATOM  11184  O   GLU A1401     140.189 144.660  87.409  1.00  0.76           O  
ATOM  11185  CB  GLU A1401     142.942 143.038  87.771  1.00  0.76           C  
ATOM  11186  CG  GLU A1401     144.199 142.391  88.419  1.00  0.76           C  
ATOM  11187  CD  GLU A1401     145.343 143.330  88.806  1.00  0.76           C  
ATOM  11188  OE1 GLU A1401     145.595 144.330  88.096  1.00  0.76           O  
ATOM  11189  OE2 GLU A1401     146.051 143.001  89.803  1.00  0.76           O  
ATOM  11190  N   HIS A1402     141.814 146.003  88.186  1.00  0.75           N  
ATOM  11191  CA  HIS A1402     141.389 147.193  87.482  1.00  0.75           C  
ATOM  11192  C   HIS A1402     142.121 147.424  86.173  1.00  0.75           C  
ATOM  11193  O   HIS A1402     141.587 148.066  85.266  1.00  0.75           O  
ATOM  11194  CB  HIS A1402     141.617 148.428  88.384  1.00  0.75           C  
ATOM  11195  CG  HIS A1402     140.496 148.651  89.351  1.00  0.75           C  
ATOM  11196  ND1 HIS A1402     140.723 149.295  90.550  1.00  0.75           N  
ATOM  11197  CD2 HIS A1402     139.162 148.466  89.173  1.00  0.75           C  
ATOM  11198  CE1 HIS A1402     139.546 149.474  91.083  1.00  0.75           C  
ATOM  11199  NE2 HIS A1402     138.552 149.003  90.289  1.00  0.75           N  
ATOM  11200  N   ARG A1403     143.358 146.914  85.996  1.00  0.71           N  
ATOM  11201  CA  ARG A1403     144.029 147.013  84.709  1.00  0.71           C  
ATOM  11202  C   ARG A1403     143.411 146.149  83.611  1.00  0.71           C  
ATOM  11203  O   ARG A1403     143.031 144.994  83.802  1.00  0.71           O  
ATOM  11204  CB  ARG A1403     145.551 146.770  84.788  1.00  0.71           C  
ATOM  11205  CG  ARG A1403     145.944 145.313  85.063  1.00  0.71           C  
ATOM  11206  CD  ARG A1403     147.452 145.059  85.140  1.00  0.71           C  
ATOM  11207  NE  ARG A1403     147.976 145.826  86.304  1.00  0.71           N  
ATOM  11208  CZ  ARG A1403     148.950 146.742  86.281  1.00  0.71           C  
ATOM  11209  NH1 ARG A1403     149.496 147.176  85.145  1.00  0.71           N  
ATOM  11210  NH2 ARG A1403     149.417 147.179  87.447  1.00  0.71           N  
ATOM  11211  N   ILE A1404     143.322 146.693  82.384  1.00  0.72           N  
ATOM  11212  CA  ILE A1404     142.669 146.023  81.267  1.00  0.72           C  
ATOM  11213  C   ILE A1404     143.511 144.866  80.727  1.00  0.72           C  
ATOM  11214  O   ILE A1404     143.001 143.852  80.255  1.00  0.72           O  
ATOM  11215  CB  ILE A1404     142.306 147.026  80.174  1.00  0.72           C  
ATOM  11216  CG1 ILE A1404     141.624 148.298  80.746  1.00  0.72           C  
ATOM  11217  CG2 ILE A1404     141.400 146.355  79.124  1.00  0.72           C  
ATOM  11218  CD1 ILE A1404     140.335 148.060  81.543  1.00  0.72           C  
ATOM  11219  N   GLU A1405     144.849 144.958  80.878  1.00  0.72           N  
ATOM  11220  CA  GLU A1405     145.812 143.939  80.483  1.00  0.72           C  
ATOM  11221  C   GLU A1405     145.664 142.589  81.202  1.00  0.72           C  
ATOM  11222  O   GLU A1405     146.087 141.551  80.703  1.00  0.72           O  
ATOM  11223  CB  GLU A1405     147.253 144.484  80.669  1.00  0.72           C  
ATOM  11224  CG  GLU A1405     148.325 143.636  79.937  1.00  0.72           C  
ATOM  11225  CD  GLU A1405     149.784 144.007  80.208  1.00  0.72           C  
ATOM  11226  OE1 GLU A1405     150.066 144.832  81.114  1.00  0.72           O  
ATOM  11227  OE2 GLU A1405     150.637 143.381  79.516  1.00  0.72           O  
ATOM  11228  N   ALA A1406     145.010 142.559  82.380  1.00  0.72           N  
ATOM  11229  CA  ALA A1406     144.801 141.349  83.160  1.00  0.72           C  
ATOM  11230  C   ALA A1406     143.455 140.690  82.888  1.00  0.72           C  
ATOM  11231  O   ALA A1406     143.036 139.765  83.582  1.00  0.72           O  
ATOM  11232  CB  ALA A1406     144.874 141.712  84.654  1.00  0.72           C  
ATOM  11233  N   MET A1407     142.730 141.162  81.857  1.00  0.69           N  
ATOM  11234  CA  MET A1407     141.453 140.597  81.468  1.00  0.69           C  
ATOM  11235  C   MET A1407     141.572 139.721  80.232  1.00  0.69           C  
ATOM  11236  O   MET A1407     140.584 139.161  79.763  1.00  0.69           O  
ATOM  11237  CB  MET A1407     140.419 141.727  81.227  1.00  0.69           C  
ATOM  11238  CG  MET A1407     140.036 142.470  82.521  1.00  0.69           C  
ATOM  11239  SD  MET A1407     139.305 141.386  83.792  1.00  0.69           S  
ATOM  11240  CE  MET A1407     140.285 142.049  85.166  1.00  0.69           C  
ATOM  11241  N   LEU A1408     142.791 139.536  79.684  1.00  0.71           N  
ATOM  11242  CA  LEU A1408     142.993 138.708  78.504  1.00  0.71           C  
ATOM  11243  C   LEU A1408     143.042 137.218  78.845  1.00  0.71           C  
ATOM  11244  O   LEU A1408     142.822 136.363  77.989  1.00  0.71           O  
ATOM  11245  CB  LEU A1408     144.293 139.094  77.738  1.00  0.71           C  
ATOM  11246  CG  LEU A1408     144.267 140.393  76.891  1.00  0.71           C  
ATOM  11247  CD1 LEU A1408     143.059 140.473  75.950  1.00  0.71           C  
ATOM  11248  CD2 LEU A1408     144.399 141.670  77.725  1.00  0.71           C  
ATOM  11249  N   GLU A1409     143.300 136.865  80.116  1.00  0.70           N  
ATOM  11250  CA  GLU A1409     143.402 135.488  80.550  1.00  0.70           C  
ATOM  11251  C   GLU A1409     142.111 134.933  81.156  1.00  0.70           C  
ATOM  11252  O   GLU A1409     142.037 133.754  81.512  1.00  0.70           O  
ATOM  11253  CB  GLU A1409     144.534 135.381  81.608  1.00  0.70           C  
ATOM  11254  CG  GLU A1409     145.969 135.650  81.061  1.00  0.70           C  
ATOM  11255  CD  GLU A1409     146.440 137.102  80.901  1.00  0.70           C  
ATOM  11256  OE1 GLU A1409     145.675 138.047  81.211  1.00  0.70           O  
ATOM  11257  OE2 GLU A1409     147.610 137.246  80.422  1.00  0.70           O  
ATOM  11258  N   CYS A1410     141.050 135.753  81.271  1.00  0.80           N  
ATOM  11259  CA  CYS A1410     139.803 135.368  81.913  1.00  0.80           C  
ATOM  11260  C   CYS A1410     138.767 134.886  80.915  1.00  0.80           C  
ATOM  11261  O   CYS A1410     138.594 135.453  79.840  1.00  0.80           O  
ATOM  11262  CB  CYS A1410     139.205 136.526  82.746  1.00  0.80           C  
ATOM  11263  SG  CYS A1410     140.332 137.036  84.089  1.00  0.80           S  
ATOM  11264  N   GLN A1411     138.044 133.798  81.252  1.00  0.77           N  
ATOM  11265  CA  GLN A1411     136.991 133.276  80.397  1.00  0.77           C  
ATOM  11266  C   GLN A1411     135.684 133.996  80.683  1.00  0.77           C  
ATOM  11267  O   GLN A1411     135.097 134.634  79.816  1.00  0.77           O  
ATOM  11268  CB  GLN A1411     136.792 131.751  80.629  1.00  0.77           C  
ATOM  11269  CG  GLN A1411     137.877 130.840  79.999  1.00  0.77           C  
ATOM  11270  CD  GLN A1411     139.224 130.945  80.714  1.00  0.77           C  
ATOM  11271  OE1 GLN A1411     139.323 130.787  81.931  1.00  0.77           O  
ATOM  11272  NE2 GLN A1411     140.301 131.210  79.941  1.00  0.77           N  
ATOM  11273  N   GLN A1412     135.228 133.965  81.949  1.00  0.79           N  
ATOM  11274  CA  GLN A1412     134.013 134.654  82.331  1.00  0.79           C  
ATOM  11275  C   GLN A1412     134.319 135.989  82.967  1.00  0.79           C  
ATOM  11276  O   GLN A1412     135.382 136.227  83.545  1.00  0.79           O  
ATOM  11277  CB  GLN A1412     133.148 133.867  83.340  1.00  0.79           C  
ATOM  11278  CG  GLN A1412     132.407 132.648  82.750  1.00  0.79           C  
ATOM  11279  CD  GLN A1412     131.534 132.029  83.844  1.00  0.79           C  
ATOM  11280  OE1 GLN A1412     131.218 132.670  84.846  1.00  0.79           O  
ATOM  11281  NE2 GLN A1412     131.149 130.746  83.682  1.00  0.79           N  
ATOM  11282  N   PHE A1413     133.337 136.894  82.893  1.00  0.79           N  
ATOM  11283  CA  PHE A1413     133.436 138.216  83.452  1.00  0.79           C  
ATOM  11284  C   PHE A1413     132.207 138.488  84.284  1.00  0.79           C  
ATOM  11285  O   PHE A1413     131.077 138.240  83.860  1.00  0.79           O  
ATOM  11286  CB  PHE A1413     133.547 139.300  82.361  1.00  0.79           C  
ATOM  11287  CG  PHE A1413     134.794 139.090  81.559  1.00  0.79           C  
ATOM  11288  CD1 PHE A1413     136.009 139.645  81.991  1.00  0.79           C  
ATOM  11289  CD2 PHE A1413     134.777 138.286  80.407  1.00  0.79           C  
ATOM  11290  CE1 PHE A1413     137.190 139.390  81.285  1.00  0.79           C  
ATOM  11291  CE2 PHE A1413     135.962 138.010  79.717  1.00  0.79           C  
ATOM  11292  CZ  PHE A1413     137.168 138.569  80.152  1.00  0.79           C  
ATOM  11293  N   LEU A1414     132.411 139.019  85.497  1.00  0.80           N  
ATOM  11294  CA  LEU A1414     131.338 139.406  86.384  1.00  0.80           C  
ATOM  11295  C   LEU A1414     131.446 140.901  86.584  1.00  0.80           C  
ATOM  11296  O   LEU A1414     132.498 141.421  86.949  1.00  0.80           O  
ATOM  11297  CB  LEU A1414     131.437 138.700  87.759  1.00  0.80           C  
ATOM  11298  CG  LEU A1414     131.230 137.171  87.722  1.00  0.80           C  
ATOM  11299  CD1 LEU A1414     131.526 136.552  89.095  1.00  0.80           C  
ATOM  11300  CD2 LEU A1414     129.823 136.770  87.266  1.00  0.80           C  
ATOM  11301  N   VAL A1415     130.359 141.640  86.322  1.00  0.80           N  
ATOM  11302  CA  VAL A1415     130.344 143.090  86.412  1.00  0.80           C  
ATOM  11303  C   VAL A1415     129.388 143.486  87.514  1.00  0.80           C  
ATOM  11304  O   VAL A1415     128.217 143.113  87.493  1.00  0.80           O  
ATOM  11305  CB  VAL A1415     129.917 143.747  85.103  1.00  0.80           C  
ATOM  11306  CG1 VAL A1415     130.039 145.278  85.197  1.00  0.80           C  
ATOM  11307  CG2 VAL A1415     130.810 143.224  83.968  1.00  0.80           C  
ATOM  11308  N   ILE A1416     129.881 144.238  88.521  1.00  0.79           N  
ATOM  11309  CA  ILE A1416     129.059 144.756  89.607  1.00  0.79           C  
ATOM  11310  C   ILE A1416     128.677 146.200  89.334  1.00  0.79           C  
ATOM  11311  O   ILE A1416     129.529 147.095  89.308  1.00  0.79           O  
ATOM  11312  CB  ILE A1416     129.747 144.678  90.971  1.00  0.79           C  
ATOM  11313  CG1 ILE A1416     130.100 143.215  91.304  1.00  0.79           C  
ATOM  11314  CG2 ILE A1416     128.834 145.270  92.071  1.00  0.79           C  
ATOM  11315  CD1 ILE A1416     130.855 143.048  92.622  1.00  0.79           C  
ATOM  11316  N   GLU A1417     127.364 146.450  89.182  1.00  0.74           N  
ATOM  11317  CA  GLU A1417     126.780 147.763  88.984  1.00  0.74           C  
ATOM  11318  C   GLU A1417     125.425 147.746  89.696  1.00  0.74           C  
ATOM  11319  O   GLU A1417     124.809 146.693  89.840  1.00  0.74           O  
ATOM  11320  CB  GLU A1417     126.730 148.179  87.477  1.00  0.74           C  
ATOM  11321  CG  GLU A1417     126.011 147.166  86.540  1.00  0.74           C  
ATOM  11322  CD  GLU A1417     126.287 147.229  85.029  1.00  0.74           C  
ATOM  11323  OE1 GLU A1417     127.428 147.501  84.559  1.00  0.74           O  
ATOM  11324  OE2 GLU A1417     125.344 146.871  84.275  1.00  0.74           O  
ATOM  11325  N   GLU A1418     125.001 148.887  90.299  1.00  0.72           N  
ATOM  11326  CA  GLU A1418     123.772 149.048  91.091  1.00  0.72           C  
ATOM  11327  C   GLU A1418     123.323 147.897  92.013  1.00  0.72           C  
ATOM  11328  O   GLU A1418     122.151 147.535  92.075  1.00  0.72           O  
ATOM  11329  CB  GLU A1418     122.593 149.611  90.261  1.00  0.72           C  
ATOM  11330  CG  GLU A1418     122.078 148.684  89.129  1.00  0.72           C  
ATOM  11331  CD  GLU A1418     122.601 149.009  87.731  1.00  0.72           C  
ATOM  11332  OE1 GLU A1418     123.428 149.947  87.595  1.00  0.72           O  
ATOM  11333  OE2 GLU A1418     122.139 148.305  86.788  1.00  0.72           O  
ATOM  11334  N   ASN A1419     124.280 147.301  92.767  1.00  0.70           N  
ATOM  11335  CA  ASN A1419     124.057 146.268  93.777  1.00  0.70           C  
ATOM  11336  C   ASN A1419     123.774 144.886  93.178  1.00  0.70           C  
ATOM  11337  O   ASN A1419     123.411 143.931  93.867  1.00  0.70           O  
ATOM  11338  CB  ASN A1419     123.032 146.697  94.868  1.00  0.70           C  
ATOM  11339  CG  ASN A1419     123.439 148.062  95.417  1.00  0.70           C  
ATOM  11340  OD1 ASN A1419     122.931 149.129  95.066  1.00  0.70           O  
ATOM  11341  ND2 ASN A1419     124.480 148.055  96.281  1.00  0.70           N  
ATOM  11342  N   LYS A1420     124.007 144.743  91.859  1.00  0.71           N  
ATOM  11343  CA  LYS A1420     123.670 143.576  91.078  1.00  0.71           C  
ATOM  11344  C   LYS A1420     124.869 143.113  90.266  1.00  0.71           C  
ATOM  11345  O   LYS A1420     125.731 143.888  89.860  1.00  0.71           O  
ATOM  11346  CB  LYS A1420     122.496 143.901  90.115  1.00  0.71           C  
ATOM  11347  CG  LYS A1420     121.201 144.280  90.857  1.00  0.71           C  
ATOM  11348  CD  LYS A1420     120.120 144.887  89.948  1.00  0.71           C  
ATOM  11349  CE  LYS A1420     119.522 143.933  88.920  1.00  0.71           C  
ATOM  11350  NZ  LYS A1420     118.834 142.834  89.630  1.00  0.71           N  
ATOM  11351  N   VAL A1421     124.948 141.796  90.008  1.00  0.79           N  
ATOM  11352  CA  VAL A1421     126.003 141.193  89.215  1.00  0.79           C  
ATOM  11353  C   VAL A1421     125.443 140.849  87.851  1.00  0.79           C  
ATOM  11354  O   VAL A1421     124.366 140.267  87.723  1.00  0.79           O  
ATOM  11355  CB  VAL A1421     126.571 139.948  89.894  1.00  0.79           C  
ATOM  11356  CG1 VAL A1421     127.519 139.151  88.982  1.00  0.79           C  
ATOM  11357  CG2 VAL A1421     127.361 140.392  91.133  1.00  0.79           C  
ATOM  11358  N   ARG A1422     126.175 141.219  86.786  1.00  0.72           N  
ATOM  11359  CA  ARG A1422     125.884 140.812  85.430  1.00  0.72           C  
ATOM  11360  C   ARG A1422     127.018 139.944  84.918  1.00  0.72           C  
ATOM  11361  O   ARG A1422     128.194 140.241  85.121  1.00  0.72           O  
ATOM  11362  CB  ARG A1422     125.714 142.026  84.497  1.00  0.72           C  
ATOM  11363  CG  ARG A1422     124.501 142.890  84.876  1.00  0.72           C  
ATOM  11364  CD  ARG A1422     124.274 144.023  83.880  1.00  0.72           C  
ATOM  11365  NE  ARG A1422     123.034 144.761  84.284  1.00  0.72           N  
ATOM  11366  CZ  ARG A1422     121.800 144.398  83.917  1.00  0.72           C  
ATOM  11367  NH1 ARG A1422     121.590 143.280  83.221  1.00  0.72           N  
ATOM  11368  NH2 ARG A1422     120.762 145.163  84.240  1.00  0.72           N  
ATOM  11369  N   GLN A1423     126.677 138.829  84.249  1.00  0.76           N  
ATOM  11370  CA  GLN A1423     127.632 137.848  83.775  1.00  0.76           C  
ATOM  11371  C   GLN A1423     127.805 137.942  82.267  1.00  0.76           C  
ATOM  11372  O   GLN A1423     126.837 138.060  81.518  1.00  0.76           O  
ATOM  11373  CB  GLN A1423     127.163 136.424  84.168  1.00  0.76           C  
ATOM  11374  CG  GLN A1423     128.159 135.295  83.809  1.00  0.76           C  
ATOM  11375  CD  GLN A1423     127.690 133.930  84.325  1.00  0.76           C  
ATOM  11376  OE1 GLN A1423     126.863 133.802  85.226  1.00  0.76           O  
ATOM  11377  NE2 GLN A1423     128.251 132.854  83.728  1.00  0.76           N  
ATOM  11378  N   TYR A1424     129.064 137.895  81.795  1.00  0.75           N  
ATOM  11379  CA  TYR A1424     129.409 137.926  80.387  1.00  0.75           C  
ATOM  11380  C   TYR A1424     130.437 136.834  80.117  1.00  0.75           C  
ATOM  11381  O   TYR A1424     131.150 136.403  81.023  1.00  0.75           O  
ATOM  11382  CB  TYR A1424     130.058 139.274  79.973  1.00  0.75           C  
ATOM  11383  CG  TYR A1424     129.112 140.437  80.082  1.00  0.75           C  
ATOM  11384  CD1 TYR A1424     128.998 141.172  81.277  1.00  0.75           C  
ATOM  11385  CD2 TYR A1424     128.377 140.851  78.960  1.00  0.75           C  
ATOM  11386  CE1 TYR A1424     128.185 142.315  81.339  1.00  0.75           C  
ATOM  11387  CE2 TYR A1424     127.567 141.989  79.022  1.00  0.75           C  
ATOM  11388  CZ  TYR A1424     127.486 142.735  80.200  1.00  0.75           C  
ATOM  11389  OH  TYR A1424     126.736 143.930  80.212  1.00  0.75           O  
ATOM  11390  N   ASP A1425     130.537 136.377  78.850  1.00  0.76           N  
ATOM  11391  CA  ASP A1425     131.403 135.275  78.449  1.00  0.76           C  
ATOM  11392  C   ASP A1425     132.551 135.747  77.548  1.00  0.76           C  
ATOM  11393  O   ASP A1425     133.415 134.992  77.114  1.00  0.76           O  
ATOM  11394  CB  ASP A1425     130.501 134.270  77.687  1.00  0.76           C  
ATOM  11395  CG  ASP A1425     130.944 132.823  77.858  1.00  0.76           C  
ATOM  11396  OD1 ASP A1425     131.353 132.454  78.988  1.00  0.76           O  
ATOM  11397  OD2 ASP A1425     130.795 132.065  76.866  1.00  0.76           O  
ATOM  11398  N   SER A1426     132.605 137.056  77.220  1.00  0.75           N  
ATOM  11399  CA  SER A1426     133.718 137.591  76.454  1.00  0.75           C  
ATOM  11400  C   SER A1426     133.932 139.056  76.771  1.00  0.75           C  
ATOM  11401  O   SER A1426     132.988 139.814  76.999  1.00  0.75           O  
ATOM  11402  CB  SER A1426     133.614 137.357  74.911  1.00  0.75           C  
ATOM  11403  OG  SER A1426     132.654 138.181  74.240  1.00  0.75           O  
ATOM  11404  N   ILE A1427     135.206 139.506  76.798  1.00  0.72           N  
ATOM  11405  CA  ILE A1427     135.555 140.895  77.075  1.00  0.72           C  
ATOM  11406  C   ILE A1427     135.057 141.864  76.008  1.00  0.72           C  
ATOM  11407  O   ILE A1427     134.562 142.952  76.296  1.00  0.72           O  
ATOM  11408  CB  ILE A1427     137.046 141.077  77.366  1.00  0.72           C  
ATOM  11409  CG1 ILE A1427     137.358 142.471  77.963  1.00  0.72           C  
ATOM  11410  CG2 ILE A1427     137.916 140.781  76.125  1.00  0.72           C  
ATOM  11411  CD1 ILE A1427     136.678 142.728  79.313  1.00  0.72           C  
ATOM  11412  N   GLN A1428     135.122 141.455  74.723  1.00  0.69           N  
ATOM  11413  CA  GLN A1428     134.682 142.246  73.588  1.00  0.69           C  
ATOM  11414  C   GLN A1428     133.208 142.608  73.653  1.00  0.69           C  
ATOM  11415  O   GLN A1428     132.822 143.747  73.406  1.00  0.69           O  
ATOM  11416  CB  GLN A1428     135.065 141.546  72.256  1.00  0.69           C  
ATOM  11417  CG  GLN A1428     134.406 140.175  71.953  1.00  0.69           C  
ATOM  11418  CD  GLN A1428     133.052 140.288  71.242  1.00  0.69           C  
ATOM  11419  OE1 GLN A1428     132.645 141.320  70.719  1.00  0.69           O  
ATOM  11420  NE2 GLN A1428     132.307 139.158  71.214  1.00  0.69           N  
ATOM  11421  N   LYS A1429     132.344 141.656  74.068  1.00  0.67           N  
ATOM  11422  CA  LYS A1429     130.928 141.918  74.224  1.00  0.67           C  
ATOM  11423  C   LYS A1429     130.625 142.901  75.350  1.00  0.67           C  
ATOM  11424  O   LYS A1429     129.809 143.806  75.200  1.00  0.67           O  
ATOM  11425  CB  LYS A1429     130.134 140.598  74.377  1.00  0.67           C  
ATOM  11426  CG  LYS A1429     128.613 140.739  74.182  1.00  0.67           C  
ATOM  11427  CD  LYS A1429     128.230 141.202  72.763  1.00  0.67           C  
ATOM  11428  CE  LYS A1429     126.719 141.295  72.545  1.00  0.67           C  
ATOM  11429  NZ  LYS A1429     126.445 141.692  71.144  1.00  0.67           N  
ATOM  11430  N   LEU A1430     131.347 142.783  76.481  1.00  0.73           N  
ATOM  11431  CA  LEU A1430     131.245 143.662  77.639  1.00  0.73           C  
ATOM  11432  C   LEU A1430     131.552 145.128  77.315  1.00  0.73           C  
ATOM  11433  O   LEU A1430     130.845 146.054  77.723  1.00  0.73           O  
ATOM  11434  CB  LEU A1430     132.239 143.120  78.700  1.00  0.73           C  
ATOM  11435  CG  LEU A1430     132.012 143.517  80.172  1.00  0.73           C  
ATOM  11436  CD1 LEU A1430     132.821 142.568  81.062  1.00  0.73           C  
ATOM  11437  CD2 LEU A1430     132.394 144.959  80.520  1.00  0.73           C  
ATOM  11438  N   LEU A1431     132.628 145.356  76.535  1.00  0.73           N  
ATOM  11439  CA  LEU A1431     133.075 146.671  76.103  1.00  0.73           C  
ATOM  11440  C   LEU A1431     132.300 147.209  74.908  1.00  0.73           C  
ATOM  11441  O   LEU A1431     132.241 148.418  74.689  1.00  0.73           O  
ATOM  11442  CB  LEU A1431     134.579 146.621  75.736  1.00  0.73           C  
ATOM  11443  CG  LEU A1431     135.558 146.857  76.905  1.00  0.73           C  
ATOM  11444  CD1 LEU A1431     135.271 146.010  78.148  1.00  0.73           C  
ATOM  11445  CD2 LEU A1431     136.988 146.598  76.428  1.00  0.73           C  
ATOM  11446  N   ASN A1432     131.642 146.344  74.118  1.00  0.72           N  
ATOM  11447  CA  ASN A1432     130.755 146.754  73.041  1.00  0.72           C  
ATOM  11448  C   ASN A1432     129.577 147.587  73.560  1.00  0.72           C  
ATOM  11449  O   ASN A1432     129.240 148.628  73.002  1.00  0.72           O  
ATOM  11450  CB  ASN A1432     130.289 145.479  72.287  1.00  0.72           C  
ATOM  11451  CG  ASN A1432     129.297 145.769  71.171  1.00  0.72           C  
ATOM  11452  OD1 ASN A1432     129.647 146.185  70.071  1.00  0.72           O  
ATOM  11453  ND2 ASN A1432     127.992 145.542  71.462  1.00  0.72           N  
ATOM  11454  N   GLU A1433     128.963 147.153  74.678  1.00  0.64           N  
ATOM  11455  CA  GLU A1433     127.796 147.790  75.268  1.00  0.64           C  
ATOM  11456  C   GLU A1433     128.109 149.086  76.019  1.00  0.64           C  
ATOM  11457  O   GLU A1433     127.226 149.895  76.293  1.00  0.64           O  
ATOM  11458  CB  GLU A1433     127.097 146.797  76.242  1.00  0.64           C  
ATOM  11459  CG  GLU A1433     126.724 145.444  75.580  1.00  0.64           C  
ATOM  11460  CD  GLU A1433     126.184 144.364  76.517  1.00  0.64           C  
ATOM  11461  OE1 GLU A1433     126.247 144.524  77.764  1.00  0.64           O  
ATOM  11462  OE2 GLU A1433     125.739 143.326  75.958  1.00  0.64           O  
ATOM  11463  N   ARG A1434     129.390 149.335  76.369  1.00  0.57           N  
ATOM  11464  CA  ARG A1434     129.776 150.462  77.203  1.00  0.57           C  
ATOM  11465  C   ARG A1434     130.767 151.376  76.502  1.00  0.57           C  
ATOM  11466  O   ARG A1434     131.956 151.081  76.405  1.00  0.57           O  
ATOM  11467  CB  ARG A1434     130.448 149.959  78.508  1.00  0.57           C  
ATOM  11468  CG  ARG A1434     129.494 149.192  79.446  1.00  0.57           C  
ATOM  11469  CD  ARG A1434     130.206 148.526  80.633  1.00  0.57           C  
ATOM  11470  NE  ARG A1434     129.174 147.901  81.530  1.00  0.57           N  
ATOM  11471  CZ  ARG A1434     128.564 146.729  81.314  1.00  0.57           C  
ATOM  11472  NH1 ARG A1434     128.808 145.971  80.250  1.00  0.57           N  
ATOM  11473  NH2 ARG A1434     127.668 146.304  82.200  1.00  0.57           N  
ATOM  11474  N   SER A1435     130.323 152.558  76.028  1.00  0.71           N  
ATOM  11475  CA  SER A1435     131.201 153.478  75.309  1.00  0.71           C  
ATOM  11476  C   SER A1435     132.236 154.175  76.170  1.00  0.71           C  
ATOM  11477  O   SER A1435     133.420 154.158  75.854  1.00  0.71           O  
ATOM  11478  CB  SER A1435     130.403 154.562  74.544  1.00  0.71           C  
ATOM  11479  OG  SER A1435     129.607 153.948  73.531  1.00  0.71           O  
ATOM  11480  N   LEU A1436     131.839 154.770  77.315  1.00  0.64           N  
ATOM  11481  CA  LEU A1436     132.727 155.541  78.178  1.00  0.64           C  
ATOM  11482  C   LEU A1436     133.870 154.712  78.750  1.00  0.64           C  
ATOM  11483  O   LEU A1436     135.017 155.147  78.804  1.00  0.64           O  
ATOM  11484  CB  LEU A1436     131.963 156.222  79.341  1.00  0.64           C  
ATOM  11485  CG  LEU A1436     130.949 157.312  78.926  1.00  0.64           C  
ATOM  11486  CD1 LEU A1436     129.573 156.769  78.513  1.00  0.64           C  
ATOM  11487  CD2 LEU A1436     130.764 158.315  80.072  1.00  0.64           C  
ATOM  11488  N   PHE A1437     133.581 153.453  79.129  1.00  0.77           N  
ATOM  11489  CA  PHE A1437     134.565 152.518  79.643  1.00  0.77           C  
ATOM  11490  C   PHE A1437     135.707 152.241  78.655  1.00  0.77           C  
ATOM  11491  O   PHE A1437     136.882 152.291  79.007  1.00  0.77           O  
ATOM  11492  CB  PHE A1437     133.826 151.209  80.034  1.00  0.77           C  
ATOM  11493  CG  PHE A1437     134.695 150.292  80.848  1.00  0.77           C  
ATOM  11494  CD1 PHE A1437     134.889 150.525  82.220  1.00  0.77           C  
ATOM  11495  CD2 PHE A1437     135.343 149.206  80.240  1.00  0.77           C  
ATOM  11496  CE1 PHE A1437     135.735 149.696  82.968  1.00  0.77           C  
ATOM  11497  CE2 PHE A1437     136.196 148.380  80.983  1.00  0.77           C  
ATOM  11498  CZ  PHE A1437     136.392 148.625  82.347  1.00  0.77           C  
ATOM  11499  N   ARG A1438     135.392 152.011  77.360  1.00  0.67           N  
ATOM  11500  CA  ARG A1438     136.416 151.766  76.356  1.00  0.67           C  
ATOM  11501  C   ARG A1438     137.040 153.028  75.770  1.00  0.67           C  
ATOM  11502  O   ARG A1438     138.070 152.986  75.094  1.00  0.67           O  
ATOM  11503  CB  ARG A1438     135.911 150.850  75.217  1.00  0.67           C  
ATOM  11504  CG  ARG A1438     134.736 151.420  74.407  1.00  0.67           C  
ATOM  11505  CD  ARG A1438     134.291 150.499  73.270  1.00  0.67           C  
ATOM  11506  NE  ARG A1438     132.941 150.958  72.820  1.00  0.67           N  
ATOM  11507  CZ  ARG A1438     132.707 151.785  71.793  1.00  0.67           C  
ATOM  11508  NH1 ARG A1438     133.695 152.393  71.140  1.00  0.67           N  
ATOM  11509  NH2 ARG A1438     131.454 152.007  71.411  1.00  0.67           N  
ATOM  11510  N   GLN A1439     136.459 154.211  76.034  1.00  0.72           N  
ATOM  11511  CA  GLN A1439     137.080 155.489  75.725  1.00  0.72           C  
ATOM  11512  C   GLN A1439     138.256 155.797  76.645  1.00  0.72           C  
ATOM  11513  O   GLN A1439     139.187 156.502  76.267  1.00  0.72           O  
ATOM  11514  CB  GLN A1439     136.044 156.637  75.785  1.00  0.72           C  
ATOM  11515  CG  GLN A1439     135.056 156.646  74.593  1.00  0.72           C  
ATOM  11516  CD  GLN A1439     135.742 157.031  73.282  1.00  0.72           C  
ATOM  11517  OE1 GLN A1439     136.872 157.508  73.238  1.00  0.72           O  
ATOM  11518  NE2 GLN A1439     135.034 156.802  72.151  1.00  0.72           N  
ATOM  11519  N   ALA A1440     138.278 155.212  77.857  1.00  0.85           N  
ATOM  11520  CA  ALA A1440     139.350 155.421  78.808  1.00  0.85           C  
ATOM  11521  C   ALA A1440     140.479 154.399  78.696  1.00  0.85           C  
ATOM  11522  O   ALA A1440     141.508 154.508  79.358  1.00  0.85           O  
ATOM  11523  CB  ALA A1440     138.747 155.366  80.222  1.00  0.85           C  
ATOM  11524  N   ILE A1441     140.336 153.383  77.824  1.00  0.80           N  
ATOM  11525  CA  ILE A1441     141.384 152.405  77.561  1.00  0.80           C  
ATOM  11526  C   ILE A1441     142.594 153.001  76.839  1.00  0.80           C  
ATOM  11527  O   ILE A1441     142.472 153.701  75.828  1.00  0.80           O  
ATOM  11528  CB  ILE A1441     140.845 151.166  76.840  1.00  0.80           C  
ATOM  11529  CG1 ILE A1441     139.762 150.504  77.718  1.00  0.80           C  
ATOM  11530  CG2 ILE A1441     141.964 150.146  76.536  1.00  0.80           C  
ATOM  11531  CD1 ILE A1441     139.111 149.272  77.088  1.00  0.80           C  
ATOM  11532  N   SER A1442     143.813 152.682  77.340  1.00  0.81           N  
ATOM  11533  CA  SER A1442     145.094 153.030  76.728  1.00  0.81           C  
ATOM  11534  C   SER A1442     145.192 152.543  75.284  1.00  0.81           C  
ATOM  11535  O   SER A1442     144.764 151.422  75.007  1.00  0.81           O  
ATOM  11536  CB  SER A1442     146.300 152.444  77.531  1.00  0.81           C  
ATOM  11537  OG  SER A1442     147.556 152.612  76.861  1.00  0.81           O  
ATOM  11538  N   PRO A1443     145.736 153.283  74.315  1.00  0.82           N  
ATOM  11539  CA  PRO A1443     145.889 152.801  72.945  1.00  0.82           C  
ATOM  11540  C   PRO A1443     146.714 151.531  72.826  1.00  0.82           C  
ATOM  11541  O   PRO A1443     146.455 150.736  71.924  1.00  0.82           O  
ATOM  11542  CB  PRO A1443     146.514 153.990  72.201  1.00  0.82           C  
ATOM  11543  CG  PRO A1443     146.054 155.217  72.992  1.00  0.82           C  
ATOM  11544  CD  PRO A1443     146.045 154.715  74.433  1.00  0.82           C  
ATOM  11545  N   SER A1444     147.691 151.324  73.732  1.00  0.80           N  
ATOM  11546  CA  SER A1444     148.502 150.110  73.794  1.00  0.80           C  
ATOM  11547  C   SER A1444     147.688 148.866  74.139  1.00  0.80           C  
ATOM  11548  O   SER A1444     147.768 147.833  73.477  1.00  0.80           O  
ATOM  11549  CB  SER A1444     149.640 150.271  74.836  1.00  0.80           C  
ATOM  11550  OG  SER A1444     150.631 149.252  74.712  1.00  0.80           O  
ATOM  11551  N   ASP A1445     146.812 148.958  75.159  1.00  0.80           N  
ATOM  11552  CA  ASP A1445     145.917 147.880  75.544  1.00  0.80           C  
ATOM  11553  C   ASP A1445     144.772 147.711  74.541  1.00  0.80           C  
ATOM  11554  O   ASP A1445     144.282 146.611  74.294  1.00  0.80           O  
ATOM  11555  CB  ASP A1445     145.334 148.076  76.972  1.00  0.80           C  
ATOM  11556  CG  ASP A1445     146.382 148.140  78.077  1.00  0.80           C  
ATOM  11557  OD1 ASP A1445     147.594 148.014  77.787  1.00  0.80           O  
ATOM  11558  OD2 ASP A1445     145.948 148.334  79.246  1.00  0.80           O  
ATOM  11559  N   ARG A1446     144.321 148.814  73.908  1.00  0.73           N  
ATOM  11560  CA  ARG A1446     143.215 148.835  72.962  1.00  0.73           C  
ATOM  11561  C   ARG A1446     143.416 147.949  71.739  1.00  0.73           C  
ATOM  11562  O   ARG A1446     142.527 147.184  71.378  1.00  0.73           O  
ATOM  11563  CB  ARG A1446     142.982 150.292  72.490  1.00  0.73           C  
ATOM  11564  CG  ARG A1446     141.749 150.524  71.592  1.00  0.73           C  
ATOM  11565  CD  ARG A1446     141.653 151.953  71.041  1.00  0.73           C  
ATOM  11566  NE  ARG A1446     141.602 152.890  72.214  1.00  0.73           N  
ATOM  11567  CZ  ARG A1446     140.497 153.448  72.721  1.00  0.73           C  
ATOM  11568  NH1 ARG A1446     139.290 153.238  72.209  1.00  0.73           N  
ATOM  11569  NH2 ARG A1446     140.596 154.212  73.805  1.00  0.73           N  
ATOM  11570  N   VAL A1447     144.609 148.002  71.109  1.00  0.68           N  
ATOM  11571  CA  VAL A1447     144.975 147.146  69.979  1.00  0.68           C  
ATOM  11572  C   VAL A1447     145.089 145.670  70.367  1.00  0.68           C  
ATOM  11573  O   VAL A1447     144.816 144.754  69.601  1.00  0.68           O  
ATOM  11574  CB  VAL A1447     146.232 147.662  69.274  1.00  0.68           C  
ATOM  11575  CG1 VAL A1447     147.481 147.571  70.168  1.00  0.68           C  
ATOM  11576  CG2 VAL A1447     146.437 146.930  67.935  1.00  0.68           C  
ATOM  11577  N   LYS A1448     145.479 145.387  71.624  1.00  0.70           N  
ATOM  11578  CA  LYS A1448     145.540 144.036  72.150  1.00  0.70           C  
ATOM  11579  C   LYS A1448     144.167 143.399  72.367  1.00  0.70           C  
ATOM  11580  O   LYS A1448     144.027 142.180  72.305  1.00  0.70           O  
ATOM  11581  CB  LYS A1448     146.325 144.019  73.488  1.00  0.70           C  
ATOM  11582  CG  LYS A1448     147.805 144.424  73.361  1.00  0.70           C  
ATOM  11583  CD  LYS A1448     148.478 144.757  74.709  1.00  0.70           C  
ATOM  11584  CE  LYS A1448     148.384 143.700  75.810  1.00  0.70           C  
ATOM  11585  NZ  LYS A1448     149.137 142.500  75.400  1.00  0.70           N  
ATOM  11586  N   LEU A1449     143.129 144.209  72.655  1.00  0.77           N  
ATOM  11587  CA  LEU A1449     141.762 143.732  72.813  1.00  0.77           C  
ATOM  11588  C   LEU A1449     140.977 143.733  71.509  1.00  0.77           C  
ATOM  11589  O   LEU A1449     140.121 142.876  71.292  1.00  0.77           O  
ATOM  11590  CB  LEU A1449     140.988 144.587  73.848  1.00  0.77           C  
ATOM  11591  CG  LEU A1449     141.110 144.091  75.303  1.00  0.77           C  
ATOM  11592  CD1 LEU A1449     142.497 144.307  75.913  1.00  0.77           C  
ATOM  11593  CD2 LEU A1449     140.044 144.760  76.175  1.00  0.77           C  
ATOM  11594  N   PHE A1450     141.258 144.688  70.609  1.00  0.58           N  
ATOM  11595  CA  PHE A1450     140.645 144.759  69.298  1.00  0.58           C  
ATOM  11596  C   PHE A1450     141.766 144.824  68.256  1.00  0.58           C  
ATOM  11597  O   PHE A1450     142.326 145.904  68.043  1.00  0.58           O  
ATOM  11598  CB  PHE A1450     139.736 146.015  69.198  1.00  0.58           C  
ATOM  11599  CG  PHE A1450     138.503 145.859  70.054  1.00  0.58           C  
ATOM  11600  CD1 PHE A1450     137.434 145.070  69.597  1.00  0.58           C  
ATOM  11601  CD2 PHE A1450     138.391 146.488  71.308  1.00  0.58           C  
ATOM  11602  CE1 PHE A1450     136.274 144.916  70.368  1.00  0.58           C  
ATOM  11603  CE2 PHE A1450     137.233 146.336  72.085  1.00  0.58           C  
ATOM  11604  CZ  PHE A1450     136.172 145.554  71.611  1.00  0.58           C  
ATOM  11605  N   PRO A1451     142.115 143.698  67.627  1.00  0.50           N  
ATOM  11606  CA  PRO A1451     143.114 143.665  66.561  1.00  0.50           C  
ATOM  11607  C   PRO A1451     142.625 144.229  65.237  1.00  0.50           C  
ATOM  11608  O   PRO A1451     141.397 144.481  65.085  1.00  0.50           O  
ATOM  11609  CB  PRO A1451     143.428 142.165  66.390  1.00  0.50           C  
ATOM  11610  CG  PRO A1451     143.032 141.519  67.715  1.00  0.50           C  
ATOM  11611  CD  PRO A1451     141.833 142.354  68.145  1.00  0.50           C  
ATOM  11612  OXT PRO A1451     143.477 144.359  64.312  1.00  0.50           O  
TER   11613      PRO A1451                                                      
HETATM11614 MG    MG _   1     156.150 154.332  96.187  1.00 61.46          MG  
HETATM11615  PG  ATP _   3     157.277 151.348  94.852  1.00 55.76           P  
HETATM11616  O1G ATP _   3     156.873 151.454  93.434  1.00 55.41           O  
HETATM11617  O2G ATP _   3     157.168 149.921  95.375  1.00 61.10           O  
HETATM11618  O3G ATP _   3     156.464 152.268  95.761  1.00 50.46           O  
HETATM11619  PB  ATP _   3     159.511 153.186  95.013  1.00 52.32           P  
HETATM11620  O1B ATP _   3     159.972 153.530  93.658  1.00 60.70           O  
HETATM11621  O2B ATP _   3     158.551 154.171  95.658  1.00 58.63           O  
HETATM11622  O3B ATP _   3     158.796 151.766  95.048  1.00 55.95           O  
HETATM11623  PA  ATP _   3     160.785 152.586  97.572  1.00 59.42           P  
HETATM11624  O1A ATP _   3     161.401 153.882  97.938  1.00 45.13           O  
HETATM11625  O2A ATP _   3     159.689 153.372  98.358  1.00 61.20           O  
HETATM11626  O3A ATP _   3     160.726 152.974  96.024  1.00 51.56           O  
HETATM11627  O5' ATP _   3     162.245 152.360  98.243  1.00 56.90           O  
HETATM11628  C5' ATP _   3     163.433 152.255  97.435  1.00 54.61           C  
HETATM11629  C4' ATP _   3     164.415 151.302  98.076  1.00 54.78           C  
HETATM11630  O4' ATP _   3     164.689 151.701  99.438  1.00 51.94           O  
HETATM11631  C3' ATP _   3     163.975 149.842  98.150  1.00 52.73           C  
HETATM11632  O3' ATP _   3     165.070 148.950  97.986  1.00 61.97           O  
HETATM11633  C2' ATP _   3     163.373 149.742  99.552  1.00 52.36           C  
HETATM11634  O2' ATP _   3     163.480 148.425 100.074  1.00 57.97           O  
HETATM11635  C1' ATP _   3     164.274 150.692 100.339  1.00 51.19           C  
HETATM11636  N9  ATP _   3     163.613 151.339 101.467  1.00 57.60           N  
HETATM11637  C8  ATP _   3     162.411 151.994 101.453  1.00 55.68           C  
HETATM11638  N7  ATP _   3     162.063 152.492 102.617  1.00 56.47           N  
HETATM11639  C5  ATP _   3     163.110 152.142 103.450  1.00 59.30           C  
HETATM11640  C6  ATP _   3     163.359 152.380 104.818  1.00 57.19           C  
HETATM11641  N6  ATP _   3     162.525 153.050 105.620  1.00 54.88           N  
HETATM11642  N1  ATP _   3     164.506 151.898 105.341  1.00 53.52           N  
HETATM11643  C2  ATP _   3     165.341 151.223 104.546  1.00 51.99           C  
HETATM11644  N3  ATP _   3     165.215 150.938 103.249  1.00 50.62           N  
HETATM11645  C4  ATP _   3     164.076 151.427 102.758  1.00 56.97           C  
HETATM11646  PG  ATP _   4     137.550 149.334  95.408  1.00 48.53           P  
HETATM11647  O1G ATP _   4     137.757 148.998  93.971  1.00 56.28           O  
HETATM11648  O2G ATP _   4     137.815 150.811  95.698  1.00 46.33           O  
HETATM11649  O3G ATP _   4     138.429 148.489  96.335  1.00 48.69           O  
HETATM11650  PB  ATP _   4     135.191 147.718  95.863  1.00 36.82           P  
HETATM11651  O1B ATP _   4     134.615 147.435  94.535  1.00 44.91           O  
HETATM11652  O2B ATP _   4     136.089 146.636  96.441  1.00 49.63           O  
HETATM11653  O3B ATP _   4     136.051 149.053  95.848  1.00 48.15           O  
HETATM11654  PA  ATP _   4     134.107 148.194  98.543  1.00 48.73           P  
HETATM11655  O1A ATP _   4     133.495 146.855  98.722  1.00 39.82           O  
HETATM11656  O2A ATP _   4     135.247 147.313  99.124  1.00 55.22           O  
HETATM11657  O3A ATP _   4     134.075 148.054  96.953  1.00 42.94           O  
HETATM11658  O5' ATP _   4     132.705 148.310  99.355  1.00 47.77           O  
HETATM11659  C5' ATP _   4     131.448 148.561  98.699  1.00 47.16           C  
HETATM11660  C4' ATP _   4     130.636 149.553  99.501  1.00 49.85           C  
HETATM11661  O4' ATP _   4     130.499 149.106 100.869  1.00 49.97           O  
HETATM11662  C3' ATP _   4     131.202 150.972  99.572  1.00 49.64           C  
HETATM11663  O3' ATP _   4     130.181 151.962  99.524  1.00 56.17           O  
HETATM11664  C2' ATP _   4     131.916 150.989 100.923  1.00 46.24           C  
HETATM11665  O2' ATP _   4     131.922 152.297 101.479  1.00 52.38           O  
HETATM11666  C1' ATP _   4     131.017 150.079 101.756  1.00 37.52           C  
HETATM11667  N9  ATP _   4     131.712 149.386 102.832  1.00 50.68           N  
HETATM11668  C8  ATP _   4     132.914 148.728 102.751  1.00 53.67           C  
HETATM11669  N7  ATP _   4     133.311 148.199 103.880  1.00 55.39           N  
HETATM11670  C5  ATP _   4     132.298 148.529 104.776  1.00 54.22           C  
HETATM11671  C6  ATP _   4     132.117 148.258 106.141  1.00 47.63           C  
HETATM11672  N6  ATP _   4     132.986 147.575 106.892  1.00 46.51           N  
HETATM11673  N1  ATP _   4     130.992 148.725 106.727  1.00 44.61           N  
HETATM11674  C2  ATP _   4     130.120 149.414 105.986  1.00 41.16           C  
HETATM11675  N3  ATP _   4     130.188 149.730 104.692  1.00 45.12           N  
HETATM11676  C4  ATP _   4     131.311 149.257 104.135  1.00 53.81           C  
HETATM11677  C1  CLR _   5     164.587 161.497 180.031  1.00 44.81           C  
HETATM11678  C2  CLR _   5     164.605 160.920 181.446  1.00 41.63           C  
HETATM11679  C3  CLR _   5     163.245 160.373 181.812  1.00 43.72           C  
HETATM11680  C4  CLR _   5     162.833 159.298 180.825  1.00 48.36           C  
HETATM11681  C5  CLR _   5     162.905 159.774 179.392  1.00 45.36           C  
HETATM11682  C6  CLR _   5     161.891 159.575 178.565  1.00 45.35           C  
HETATM11683  C7  CLR _   5     161.853 160.003 177.132  1.00 43.31           C  
HETATM11684  C8  CLR _   5     163.237 160.333 176.585  1.00 44.30           C  
HETATM11685  C9  CLR _   5     164.015 161.177 177.604  1.00 46.02           C  
HETATM11686  C10 CLR _   5     164.204 160.453 178.969  1.00 44.66           C  
HETATM11687  C11 CLR _   5     165.334 161.710 177.025  1.00 43.30           C  
HETATM11688  C12 CLR _   5     165.176 162.395 175.667  1.00 40.90           C  
HETATM11689  C13 CLR _   5     164.484 161.484 174.644  1.00 47.42           C  
HETATM11690  C14 CLR _   5     163.126 161.100 175.266  1.00 43.29           C  
HETATM11691  C15 CLR _   5     162.350 160.478 174.098  1.00 47.75           C  
HETATM11692  C16 CLR _   5     162.848 161.233 172.856  1.00 48.89           C  
HETATM11693  C17 CLR _   5     164.004 162.138 173.326  1.00 41.44           C  
HETATM11694  C18 CLR _   5     165.348 160.243 174.364  1.00 49.82           C  
HETATM11695  C19 CLR _   5     165.306 159.379 178.893  1.00 45.24           C  
HETATM11696  C20 CLR _   5     165.020 162.396 172.197  1.00 45.11           C  
HETATM11697  C21 CLR _   5     166.045 163.477 172.528  1.00 45.95           C  
HETATM11698  C22 CLR _   5     164.287 162.726 170.886  1.00 38.91           C  
HETATM11699  C23 CLR _   5     163.671 164.114 170.814  1.00 42.95           C  
HETATM11700  C24 CLR _   5     162.616 164.230 169.722  1.00 45.30           C  
HETATM11701  C25 CLR _   5     163.012 163.717 168.347  1.00 42.59           C  
HETATM11702  C26 CLR _   5     161.836 163.757 167.389  1.00 45.45           C  
HETATM11703  C27 CLR _   5     164.190 164.481 167.772  1.00 49.79           C  
HETATM11704  O1  CLR _   5     163.266 159.833 183.134  1.00 45.61           O  
HETATM11705  C1  D12 _   6     171.979 162.152 144.782  1.00 69.26           C  
HETATM11706  C2  D12 _   6     170.832 163.159 144.734  1.00 70.75           C  
HETATM11707  C3  D12 _   6     170.704 163.963 146.026  1.00 70.53           C  
HETATM11708  C4  D12 _   6     170.092 163.150 147.164  1.00 71.03           C  
HETATM11709  C5  D12 _   6     168.565 163.182 147.155  1.00 70.19           C  
HETATM11710  C6  D12 _   6     167.963 162.347 148.284  1.00 73.25           C  
HETATM11711  C7  D12 _   6     166.434 162.339 148.273  1.00 70.58           C  
HETATM11712  C8  D12 _   6     165.838 163.623 148.846  1.00 67.70           C  
HETATM11713  C9  D12 _   6     164.450 163.405 149.444  1.00 65.92           C  
HETATM11714  C10 D12 _   6     163.882 164.677 150.070  1.00 66.49           C  
HETATM11715  C11 D12 _   6     162.555 164.431 150.786  1.00 68.16           C  
HETATM11716  C12 D12 _   6     162.027 165.684 151.482  1.00 64.33           C  
HETATM11717  C1  VX8 _   7     166.673 167.366 146.892  1.00 59.63           C  
HETATM11718  C10 VX8 _   7     165.893 164.036 144.803  1.00 60.39           C  
HETATM11719  C11 VX8 _   7     162.580 166.669 145.735  1.00 64.87           C  
HETATM11720  C12 VX8 _   7     160.159 167.382 145.125  1.00 61.30           C  
HETATM11721  C13 VX8 _   7     158.774 166.895 144.642  1.00 60.67           C  
HETATM11722  C14 VX8 _   7     158.856 165.369 144.374  1.00 65.58           C  
HETATM11723  C15 VX8 _   7     158.380 164.454 145.307  1.00 59.19           C  
HETATM11724  C16 VX8 _   7     158.468 163.072 145.055  1.00 57.96           C  
HETATM11725  C17 VX8 _   7     159.032 162.625 143.882  1.00 60.39           C  
HETATM11726  C18 VX8 _   7     159.519 163.549 142.938  1.00 57.50           C  
HETATM11727  C19 VX8 _   7     159.430 164.912 143.190  1.00 60.54           C  
HETATM11728  C2  VX8 _   7     165.205 167.119 146.482  1.00 63.58           C  
HETATM11729  C20 VX8 _   7     158.271 160.806 145.024  1.00 60.02           C  
HETATM11730  C21 VX8 _   7     158.317 167.741 143.449  1.00 56.75           C  
HETATM11731  C22 VX8 _   7     157.743 168.013 144.836  1.00 53.85           C  
HETATM11732  C23 VX8 _   7     162.857 167.566 146.760  1.00 62.99           C  
HETATM11733  C24 VX8 _   7     164.179 167.797 147.137  1.00 63.55           C  
HETATM11734  C3  VX8 _   7     164.840 166.235 145.463  1.00 62.01           C  
HETATM11735  C4  VX8 _   7     165.884 165.420 144.666  1.00 59.37           C  
HETATM11736  C5  VX8 _   7     166.781 166.034 143.798  1.00 59.70           C  
HETATM11737  C6  VX8 _   7     167.698 165.262 143.091  1.00 66.18           C  
HETATM11738  C7  VX8 _   7     168.702 165.925 142.143  1.00 67.36           C  
HETATM11739  C8  VX8 _   7     167.709 163.882 143.237  1.00 62.79           C  
HETATM11740  C9  VX8 _   7     166.806 163.268 144.093  1.00 60.22           C  
HETATM11741  F1  VX8 _   7     157.066 160.276 144.659  1.00 60.83           F  
HETATM11742  F2  VX8 _   7     158.999 159.885 145.720  1.00 60.64           F  
HETATM11743  N1  VX8 _   7     163.576 166.040 145.135  1.00 62.06           N  
HETATM11744  N2  VX8 _   7     161.212 166.377 145.295  1.00 62.56           N  
HETATM11745  O1  VX8 _   7     168.751 167.183 142.048  1.00 67.90           O  
HETATM11746  O2  VX8 _   7     169.485 165.206 141.464  1.00 64.64           O  
HETATM11747  O3  VX8 _   7     160.352 168.532 145.345  1.00 61.48           O  
HETATM11748  O4  VX8 _   7     158.993 161.209 143.883  1.00 59.57           O  
HETATM11749  O5  VX8 _   7     158.064 161.950 145.817  1.00 62.33           O  
HETATM11750  N1  WJX _   8     129.184 160.557 160.346  1.00 65.90           N  
HETATM11751  C4  WJX _   8     126.669 160.146 157.881  1.00 60.09           C  
HETATM11752  C5  WJX _   8     128.680 160.905 159.156  1.00 62.00           C  
HETATM11753  C6  WJX _   8     128.825 162.182 158.588  1.00 59.49           C  
HETATM11754  C7  WJX _   8     129.520 163.138 159.325  1.00 59.81           C  
HETATM11755  C8  WJX _   8     130.048 162.805 160.559  1.00 61.48           C  
HETATM11756  C10 WJX _   8     130.503 159.802 162.721  1.00 63.25           C  
HETATM11757  C1  WJX _   8     126.410 158.851 157.128  1.00 61.02           C  
HETATM11758  C2  WJX _   8     127.207 157.805 157.926  1.00 62.70           C  
HETATM11759  C3  WJX _   8     128.071 158.537 158.964  1.00 65.31           C  
HETATM11760  O1  WJX _   8     128.342 161.653 156.325  1.00 63.11           O  
HETATM11761  C9  WJX _   8     129.856 161.500 161.014  1.00 65.82           C  
HETATM11762  C11 WJX _   8     131.106 159.873 163.941  1.00 61.19           C  
HETATM11763  N2  WJX _   8     130.407 161.072 162.248  1.00 64.92           N  
HETATM11764  N   WJX _   8     127.987 159.944 158.482  1.00 62.23           N  
HETATM11765  C   WJX _   8     126.796 158.913 155.654  1.00 59.13           C  
HETATM11766  O   WJX _   8     131.944 161.841 165.242  1.00 65.55           O  
HETATM11767  C12 WJX _   8     131.365 161.266 164.170  1.00 59.41           C  
HETATM11768  C13 WJX _   8     132.936 162.851 164.963  1.00 65.31           C  
HETATM11769  C14 WJX _   8     133.878 162.966 166.166  1.00 65.40           C  
HETATM11770  C15 WJX _   8     133.031 162.957 167.445  1.00 59.37           C  
HETATM11771  C16 WJX _   8     134.793 161.735 166.180  1.00 59.91           C  
HETATM11772  C17 WJX _   8     134.680 164.255 166.047  1.00 68.04           C  
HETATM11773  C18 WJX _   8     128.291 162.488 157.223  1.00 58.94           C  
HETATM11774  C19 WJX _   8     127.591 163.457 154.462  1.00 65.03           C  
HETATM11775  C20 WJX _   8     128.120 162.615 153.518  1.00 58.48           C  
HETATM11776  C21 WJX _   8     126.195 163.258 154.420  1.00 66.56           C  
HETATM11777  C22 WJX _   8     125.113 163.903 155.221  1.00 61.56           C  
HETATM11778  C23 WJX _   8     127.098 160.966 151.926  1.00 55.45           C  
HETATM11779  C24 WJX _   8     127.508 158.405 160.381  1.00 58.35           C  
HETATM11780  C25 WJX _   8     129.519 158.045 158.967  1.00 63.87           C  
HETATM11781  F   WJX _   8     135.047 164.724 167.237  1.00 67.67           F  
HETATM11782  F1  WJX _   8     133.987 165.222 165.450  1.00 69.88           F  
HETATM11783  F2  WJX _   8     135.794 164.086 165.340  1.00 68.23           F  
HETATM11784  N3  WJX _   8     130.927 161.984 163.117  1.00 61.55           N  
HETATM11785  N4  WJX _   8     128.200 163.842 156.938  1.00 61.43           N  
HETATM11786  N5  WJX _   8     127.075 161.975 152.976  1.00 61.17           N  
HETATM11787  N6  WJX _   8     125.887 162.351 153.512  1.00 66.30           N  
HETATM11788  O2  WJX _   8     129.793 164.372 155.138  1.00 61.77           O  
HETATM11789  O3  WJX _   8     127.752 165.737 155.426  1.00 62.75           O  
HETATM11790  S   WJX _   8     128.400 164.464 155.443  1.00 76.25           S  
CONECT1161511616116171161811622
CONECT1161611615
CONECT1161711615
CONECT1161811615
CONECT1161911620116211162211626
CONECT1162011619
CONECT1162111619
CONECT116221161511619
CONECT1162311624116251162611627
CONECT1162411623
CONECT1162511623
CONECT116261161911623
CONECT116271162311628
CONECT116281162711629
CONECT11629116281163011631
CONECT116301162911635
CONECT11631116291163211633
CONECT1163211631
CONECT11633116311163411635
CONECT1163411633
CONECT11635116301163311636
CONECT11636116351163711645
CONECT116371163611638
CONECT116381163711639
CONECT11639116381164011645
CONECT11640116391164111642
CONECT1164111640
CONECT116421164011643
CONECT116431164211644
CONECT116441164311645
CONECT11645116361163911644
CONECT1164611647116481164911653
CONECT1164711646
CONECT1164811646
CONECT1164911646
CONECT1165011651116521165311657
CONECT1165111650
CONECT1165211650
CONECT116531164611650
CONECT1165411655116561165711658
CONECT1165511654
CONECT1165611654
CONECT116571165011654
CONECT116581165411659
CONECT116591165811660
CONECT11660116591166111662
CONECT116611166011666
CONECT11662116601166311664
CONECT1166311662
CONECT11664116621166511666
CONECT1166511664
CONECT11666116611166411667
CONECT11667116661166811676
CONECT116681166711669
CONECT116691166811670
CONECT11670116691167111676
CONECT11671116701167211673
CONECT1167211671
CONECT116731167111674
CONECT116741167311675
CONECT116751167411676
CONECT11676116671167011675
CONECT116771167811686
CONECT116781167711679
CONECT11679116781168011704
CONECT116801167911681
CONECT11681116801168211686
CONECT116821168111683
CONECT116831168211684
CONECT11684116831168511690
CONECT11685116841168611687
CONECT1168611677116811168511695
CONECT116871168511688
CONECT116881168711689
CONECT1168911688116901169311694
CONECT11690116841168911691
CONECT116911169011692
CONECT116921169111693
CONECT11693116891169211696
CONECT1169411689
CONECT1169511686
CONECT11696116931169711698
CONECT1169711696
CONECT116981169611699
CONECT116991169811700
CONECT117001169911701
CONECT11701117001170211703
CONECT1170211701
CONECT1170311701
CONECT1170411679
CONECT1170511706
CONECT117061170511707
CONECT117071170611708
CONECT117081170711709
CONECT117091170811710
CONECT117101170911711
CONECT117111171011712
CONECT117121171111713
CONECT117131171211714
CONECT117141171311715
CONECT117151171411716
CONECT1171611715
CONECT1171711728
CONECT117181173511740
CONECT11719117321174311744
CONECT11720117211174411747
CONECT1172111720117221173011731
CONECT11722117211172311727
CONECT117231172211724
CONECT11724117231172511749
CONECT11725117241172611748
CONECT117261172511727
CONECT117271172211726
CONECT11728117171173311734
CONECT1172911741117421174811749
CONECT117301172111731
CONECT117311172111730
CONECT117321171911733
CONECT117331172811732
CONECT11734117281173511743
CONECT11735117181173411736
CONECT117361173511737
CONECT11737117361173811739
CONECT11738117371174511746
CONECT117391173711740
CONECT117401171811739
CONECT1174111729
CONECT1174211729
CONECT117431171911734
CONECT117441171911720
CONECT1174511738
CONECT1174611738
CONECT1174711720
CONECT117481172511729
CONECT117491172411729
CONECT117501175211761
CONECT117511175711764
CONECT11752117501175311764
CONECT11753117521175411773
CONECT117541175311755
CONECT117551175411761
CONECT117561176211763
CONECT11757117511175811765
CONECT117581175711759
CONECT1175911758117641177911780
CONECT1176011773
CONECT11761117501175511763
CONECT117621175611767
CONECT11763117561176111784
CONECT11764117511175211759
CONECT1176511757
CONECT117661176711768
CONECT11767117621176611784
CONECT117681176611769
CONECT1176911768117701177111772
CONECT1177011769
CONECT1177111769
CONECT1177211769117811178211783
CONECT11773117531176011785
CONECT11774117751177611790
CONECT117751177411786
CONECT11776117741177711787
CONECT1177711776
CONECT1177811786
CONECT1177911759
CONECT1178011759
CONECT1178111772
CONECT1178211772
CONECT1178311772
CONECT117841176311767
CONECT117851177311790
CONECT11786117751177811787
CONECT117871177611786
CONECT1178811790
CONECT1178911790
CONECT1179011774117851178811789
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.