CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  swiss_gro  ***

elNémo ID: 20020907351435987

Job options:

ID        	=	 20020907351435987
JOBID     	=	 swiss_gro
USERID    	=	 ashgang72
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 on
DORMSD    	=	 on

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER swiss_gro

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 swiss_gro_apo
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   09-FEB-20 1MOD    1       07:20
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   2.0.0
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  QMN4    -3.95
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN    
REMARK   3  MMCIF    
REMARK   3  PDBV    2020-01-31
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2020-02-05
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   BLAST
REMARK   3  SIM     0.58
REMARK   3  SID     100.00
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG MSKLIEYDETARRAMEVGMDKLADTVRVTLGPRGRHVVLAKAFGGPTVTNDGVTVARE
REMARK   3  ALN A TRG IELEDPFEDLGAQLVKSVATKTNDVAGDGTTTATILAQALIKGGLRLVAAGVNPIALG
REMARK   3  ALN A TRG VGIGKAADAVSEALLASATPVSGKTGIAQVATVSSRDEQIGDLVGEAMSKVGHDGVVS
REMARK   3  ALN A TRG VEESSTLGTELEFTEGIGFDKGFLSAYFVTDFDNQQAVLEDALILLHQDKISSLPDLL
REMARK   3  ALN A TRG PLLEKVAGTGKPLLIVAEDVEGEALATLVVNAIRKTLKAVAVKGPYFGDRRKAFLEDL
REMARK   3  ALN A TRG AVVTGGQVVNPDAGMVLREVGLEVLGSARRVVVSKDDTVIVDGGGTAEAVANRAKHLR
REMARK   3  ALN A TRG AEIDKSDSDWDREKLGERLAKLAGGVAVIKVGAATETALKERKESVEDAVAAAKAAVE
REMARK   3  ALN A TRG EGIVPGGGASLIHQARKALTELRASLTGDEVLGVDVFSEALAAPLFWIAANAGLDGSV
REMARK   3  ALN A TRG VVNKVSELPAGHGLNVNTLSYGDLAADGVIDPVKVTRSAVLNASSVARMVLTTETVVV
REMARK   3  ALN A TRG DKPAKAEDHDHHHGHAH
REMARK   3  ALN A TPL MSKLIEYDETARRAMEVGMDKLADTVRVTLGPRGRHVVLAKAFGGPTVTNDGVTVARE
REMARK   3  ALN A TPL IELEDPFEDLGAQLVKSVATKTNDVAGDGTTTATILAQALIKGGLRLVAAGVNPIALG
REMARK   3  ALN A TPL VGIGKAADAVSEALLASATPVSGKTGIAQVATVSSRDEQIGDLVGEAMSKVGHDGVVS
REMARK   3  ALN A TPL VEESSTLGTELEFTEGIGFDKGFLSAYFVTDFDNQQAVLEDALILLHQDKISSLPDLL
REMARK   3  ALN A TPL PLLEKVAGTGKPLLIVAEDVEGEALATLVVNAIRKTLKAVAVKGPYFGDRRKAFLEDL
REMARK   3  ALN A TPL AVVTGGQVVNPDAGMVLREVGLEVLGSARRVVVSKDDTVIVDGGGTAEAVANRAKHLR
REMARK   3  ALN A TPL AEIDKSDSDWDREKLGERLAKLAGGVAVIKVGAATETALKERKESVEDAVAAAKAAVE
REMARK   3  ALN A TPL EGIVPGGGASLIHQARKALTELRASLTGDEVLGVDVFSEALAAPLFWIAANAGLDGSV
REMARK   3  ALN A TPL VVNKVSELPAGHGLNVNTLSYGDLAADGVIDPVKVTRSAVLNASSVARMVLTTETVVV
REMARK   3  ALN A TPL DKPAKAE----------
REMARK   3  ALN A OFF 0
ATOM      1  N   MET A   1      59.408 -82.982  -1.701  1.00  0.13           N  
ATOM      2  CA  MET A   1      60.211 -83.041  -2.972  1.00  0.13           C  
ATOM      3  C   MET A   1      60.900 -81.701  -3.146  1.00  0.13           C  
ATOM      4  O   MET A   1      61.052 -80.997  -2.158  1.00  0.13           O  
ATOM      5  CB  MET A   1      59.275 -83.366  -4.175  1.00  0.13           C  
ATOM      6  CG  MET A   1      58.646 -84.775  -4.170  1.00  0.13           C  
ATOM      7  SD  MET A   1      57.578 -85.052  -5.617  1.00  0.13           S  
ATOM      8  CE  MET A   1      57.354 -86.834  -5.345  1.00  0.13           C  
ATOM      9  N   SER A   2      61.305 -81.301  -4.376  1.00  0.48           N  
ATOM     10  CA  SER A   2      61.676 -79.910  -4.669  1.00  0.48           C  
ATOM     11  C   SER A   2      60.482 -78.971  -4.518  1.00  0.48           C  
ATOM     12  O   SER A   2      60.560 -77.891  -3.944  1.00  0.48           O  
ATOM     13  CB  SER A   2      62.275 -79.766  -6.097  1.00  0.48           C  
ATOM     14  OG  SER A   2      62.793 -78.456  -6.316  1.00  0.48           O  
ATOM     15  N   LYS A   3      59.297 -79.418  -4.992  1.00  0.35           N  
ATOM     16  CA  LYS A   3      58.037 -78.737  -4.762  1.00  0.35           C  
ATOM     17  C   LYS A   3      57.681 -78.580  -3.285  1.00  0.35           C  
ATOM     18  O   LYS A   3      57.605 -79.565  -2.545  1.00  0.35           O  
ATOM     19  CB  LYS A   3      56.856 -79.517  -5.405  1.00  0.35           C  
ATOM     20  CG  LYS A   3      56.968 -79.730  -6.923  1.00  0.35           C  
ATOM     21  CD  LYS A   3      55.826 -80.599  -7.495  1.00  0.35           C  
ATOM     22  CE  LYS A   3      55.906 -82.077  -7.088  1.00  0.35           C  
ATOM     23  NZ  LYS A   3      54.814 -82.862  -7.710  1.00  0.35           N  
ATOM     24  N   LEU A   4      57.393 -77.331  -2.872  1.00  0.49           N  
ATOM     25  CA  LEU A   4      56.753 -77.013  -1.615  1.00  0.49           C  
ATOM     26  C   LEU A   4      55.250 -77.051  -1.825  1.00  0.49           C  
ATOM     27  O   LEU A   4      54.751 -76.669  -2.882  1.00  0.49           O  
ATOM     28  CB  LEU A   4      57.138 -75.598  -1.112  1.00  0.49           C  
ATOM     29  CG  LEU A   4      58.648 -75.362  -0.909  1.00  0.49           C  
ATOM     30  CD1 LEU A   4      58.900 -73.905  -0.490  1.00  0.49           C  
ATOM     31  CD2 LEU A   4      59.259 -76.321   0.124  1.00  0.49           C  
ATOM     32  N   ILE A   5      54.485 -77.528  -0.830  1.00  0.50           N  
ATOM     33  CA  ILE A   5      53.037 -77.573  -0.912  1.00  0.50           C  
ATOM     34  C   ILE A   5      52.524 -76.904   0.339  1.00  0.50           C  
ATOM     35  O   ILE A   5      52.896 -77.281   1.446  1.00  0.50           O  
ATOM     36  CB  ILE A   5      52.467 -78.990  -1.018  1.00  0.50           C  
ATOM     37  CG1 ILE A   5      53.044 -79.721  -2.257  1.00  0.50           C  
ATOM     38  CG2 ILE A   5      50.920 -78.927  -1.081  1.00  0.50           C  
ATOM     39  CD1 ILE A   5      52.647 -81.200  -2.340  1.00  0.50           C  
ATOM     40  N   GLU A   6      51.664 -75.886   0.172  1.00  0.64           N  
ATOM     41  CA  GLU A   6      50.995 -75.212   1.261  1.00  0.64           C  
ATOM     42  C   GLU A   6      49.526 -75.552   1.185  1.00  0.64           C  
ATOM     43  O   GLU A   6      48.993 -75.857   0.118  1.00  0.64           O  
ATOM     44  CB  GLU A   6      51.161 -73.674   1.179  1.00  0.64           C  
ATOM     45  CG  GLU A   6      52.499 -73.164   1.765  1.00  0.64           C  
ATOM     46  CD  GLU A   6      52.524 -73.191   3.292  1.00  0.64           C  
ATOM     47  OE1 GLU A   6      51.622 -73.820   3.907  1.00  0.64           O  
ATOM     48  OE2 GLU A   6      53.419 -72.514   3.862  1.00  0.64           O  
ATOM     49  N   TYR A   7      48.833 -75.506   2.332  1.00  0.59           N  
ATOM     50  CA  TYR A   7      47.449 -75.923   2.442  1.00  0.59           C  
ATOM     51  C   TYR A   7      46.605 -74.771   2.955  1.00  0.59           C  
ATOM     52  O   TYR A   7      47.117 -73.701   3.279  1.00  0.59           O  
ATOM     53  CB  TYR A   7      47.293 -77.167   3.359  1.00  0.59           C  
ATOM     54  CG  TYR A   7      47.811 -78.391   2.651  1.00  0.59           C  
ATOM     55  CD1 TYR A   7      49.128 -78.839   2.848  1.00  0.59           C  
ATOM     56  CD2 TYR A   7      46.979 -79.097   1.764  1.00  0.59           C  
ATOM     57  CE1 TYR A   7      49.603 -79.972   2.173  1.00  0.59           C  
ATOM     58  CE2 TYR A   7      47.453 -80.230   1.087  1.00  0.59           C  
ATOM     59  CZ  TYR A   7      48.766 -80.666   1.294  1.00  0.59           C  
ATOM     60  OH  TYR A   7      49.252 -81.800   0.612  1.00  0.59           O  
ATOM     61  N   ASP A   8      45.269 -74.977   2.959  1.00  0.66           N  
ATOM     62  CA  ASP A   8      44.214 -74.105   3.452  1.00  0.66           C  
ATOM     63  C   ASP A   8      44.502 -72.606   3.643  1.00  0.66           C  
ATOM     64  O   ASP A   8      44.646 -71.864   2.670  1.00  0.66           O  
ATOM     65  CB  ASP A   8      43.456 -74.792   4.616  1.00  0.66           C  
ATOM     66  CG  ASP A   8      44.425 -75.173   5.718  1.00  0.66           C  
ATOM     67  OD1 ASP A   8      44.838 -76.355   5.747  1.00  0.66           O  
ATOM     68  OD2 ASP A   8      44.757 -74.259   6.511  1.00  0.66           O  
ATOM     69  N   GLU A   9      44.518 -72.102   4.891  1.00  0.56           N  
ATOM     70  CA  GLU A   9      44.744 -70.700   5.192  1.00  0.56           C  
ATOM     71  C   GLU A   9      46.132 -70.214   4.809  1.00  0.56           C  
ATOM     72  O   GLU A   9      46.292 -69.130   4.243  1.00  0.56           O  
ATOM     73  CB  GLU A   9      44.445 -70.362   6.668  1.00  0.56           C  
ATOM     74  CG  GLU A   9      44.452 -68.835   6.939  1.00  0.56           C  
ATOM     75  CD  GLU A   9      43.950 -68.446   8.328  1.00  0.56           C  
ATOM     76  OE1 GLU A   9      43.340 -69.303   9.012  1.00  0.56           O  
ATOM     77  OE2 GLU A   9      44.151 -67.256   8.684  1.00  0.56           O  
ATOM     78  N   THR A  10      47.178 -71.027   5.055  1.00  0.70           N  
ATOM     79  CA  THR A  10      48.566 -70.677   4.767  1.00  0.70           C  
ATOM     80  C   THR A  10      48.829 -70.416   3.296  1.00  0.70           C  
ATOM     81  O   THR A  10      49.490 -69.439   2.937  1.00  0.70           O  
ATOM     82  CB  THR A  10      49.568 -71.706   5.254  1.00  0.70           C  
ATOM     83  OG1 THR A  10      49.275 -72.078   6.588  1.00  0.70           O  
ATOM     84  CG2 THR A  10      50.970 -71.092   5.309  1.00  0.70           C  
ATOM     85  N   ALA A  11      48.259 -71.249   2.403  1.00  0.77           N  
ATOM     86  CA  ALA A  11      48.232 -71.013   0.973  1.00  0.77           C  
ATOM     87  C   ALA A  11      47.421 -69.781   0.568  1.00  0.77           C  
ATOM     88  O   ALA A  11      47.860 -68.950  -0.227  1.00  0.77           O  
ATOM     89  CB  ALA A  11      47.637 -72.254   0.277  1.00  0.77           C  
ATOM     90  N   ARG A  12      46.208 -69.614   1.143  1.00  0.62           N  
ATOM     91  CA  ARG A  12      45.320 -68.502   0.841  1.00  0.62           C  
ATOM     92  C   ARG A  12      45.877 -67.129   1.198  1.00  0.62           C  
ATOM     93  O   ARG A  12      45.772 -66.198   0.403  1.00  0.62           O  
ATOM     94  CB  ARG A  12      43.933 -68.697   1.508  1.00  0.62           C  
ATOM     95  CG  ARG A  12      43.060 -69.740   0.777  1.00  0.62           C  
ATOM     96  CD  ARG A  12      41.613 -69.831   1.280  1.00  0.62           C  
ATOM     97  NE  ARG A  12      41.609 -70.401   2.673  1.00  0.62           N  
ATOM     98  CZ  ARG A  12      41.143 -71.613   3.008  1.00  0.62           C  
ATOM     99  NH1 ARG A  12      40.866 -72.532   2.088  1.00  0.62           N  
ATOM    100  NH2 ARG A  12      40.952 -71.918   4.290  1.00  0.62           N  
ATOM    101  N   ARG A  13      46.518 -66.967   2.375  1.00  0.58           N  
ATOM    102  CA  ARG A  13      47.129 -65.703   2.770  1.00  0.58           C  
ATOM    103  C   ARG A  13      48.263 -65.263   1.838  1.00  0.58           C  
ATOM    104  O   ARG A  13      48.386 -64.095   1.489  1.00  0.58           O  
ATOM    105  CB  ARG A  13      47.610 -65.732   4.252  1.00  0.58           C  
ATOM    106  CG  ARG A  13      48.798 -66.679   4.501  1.00  0.58           C  
ATOM    107  CD  ARG A  13      49.334 -66.757   5.928  1.00  0.58           C  
ATOM    108  NE  ARG A  13      50.550 -67.637   5.796  1.00  0.58           N  
ATOM    109  CZ  ARG A  13      51.751 -67.407   6.342  1.00  0.58           C  
ATOM    110  NH1 ARG A  13      51.932 -66.456   7.253  1.00  0.58           N  
ATOM    111  NH2 ARG A  13      52.791 -68.152   5.968  1.00  0.58           N  
ATOM    112  N   ALA A  14      49.121 -66.198   1.370  1.00  0.79           N  
ATOM    113  CA  ALA A  14      50.187 -65.896   0.433  1.00  0.79           C  
ATOM    114  C   ALA A  14      49.646 -65.453  -0.923  1.00  0.79           C  
ATOM    115  O   ALA A  14      50.093 -64.478  -1.525  1.00  0.79           O  
ATOM    116  CB  ALA A  14      51.097 -67.127   0.291  1.00  0.79           C  
ATOM    117  N   MET A  15      48.583 -66.135  -1.390  1.00  0.70           N  
ATOM    118  CA  MET A  15      47.840 -65.768  -2.576  1.00  0.70           C  
ATOM    119  C   MET A  15      47.214 -64.368  -2.493  1.00  0.70           C  
ATOM    120  O   MET A  15      47.265 -63.605  -3.459  1.00  0.70           O  
ATOM    121  CB  MET A  15      46.766 -66.851  -2.838  1.00  0.70           C  
ATOM    122  CG  MET A  15      46.125 -66.793  -4.236  1.00  0.70           C  
ATOM    123  SD  MET A  15      44.857 -68.064  -4.525  1.00  0.70           S  
ATOM    124  CE  MET A  15      43.598 -67.370  -3.417  1.00  0.70           C  
ATOM    125  N   GLU A  16      46.651 -63.977  -1.321  1.00  0.66           N  
ATOM    126  CA  GLU A  16      46.171 -62.622  -1.055  1.00  0.66           C  
ATOM    127  C   GLU A  16      47.252 -61.554  -1.136  1.00  0.66           C  
ATOM    128  O   GLU A  16      47.091 -60.560  -1.840  1.00  0.66           O  
ATOM    129  CB  GLU A  16      45.528 -62.510   0.357  1.00  0.66           C  
ATOM    130  CG  GLU A  16      44.941 -61.104   0.699  1.00  0.66           C  
ATOM    131  CD  GLU A  16      44.352 -60.991   2.110  1.00  0.66           C  
ATOM    132  OE1 GLU A  16      44.677 -61.849   2.966  1.00  0.66           O  
ATOM    133  OE2 GLU A  16      43.537 -60.050   2.333  1.00  0.66           O  
ATOM    134  N   VAL A  17      48.409 -61.749  -0.466  1.00  0.74           N  
ATOM    135  CA  VAL A  17      49.509 -60.784  -0.458  1.00  0.74           C  
ATOM    136  C   VAL A  17      50.100 -60.581  -1.844  1.00  0.74           C  
ATOM    137  O   VAL A  17      50.315 -59.455  -2.301  1.00  0.74           O  
ATOM    138  CB  VAL A  17      50.596 -61.186   0.534  1.00  0.74           C  
ATOM    139  CG1 VAL A  17      51.778 -60.198   0.495  1.00  0.74           C  
ATOM    140  CG2 VAL A  17      50.002 -61.199   1.956  1.00  0.74           C  
ATOM    141  N   GLY A  18      50.303 -61.689  -2.587  1.00  0.80           N  
ATOM    142  CA  GLY A  18      50.613 -61.679  -4.011  1.00  0.80           C  
ATOM    143  C   GLY A  18      49.687 -60.863  -4.867  1.00  0.80           C  
ATOM    144  O   GLY A  18      50.103 -60.011  -5.654  1.00  0.80           O  
ATOM    145  N   MET A  19      48.373 -61.106  -4.711  1.00  0.70           N  
ATOM    146  CA  MET A  19      47.343 -60.354  -5.390  1.00  0.70           C  
ATOM    147  C   MET A  19      47.293 -58.886  -5.006  1.00  0.70           C  
ATOM    148  O   MET A  19      47.194 -58.041  -5.885  1.00  0.70           O  
ATOM    149  CB  MET A  19      45.949 -60.992  -5.208  1.00  0.70           C  
ATOM    150  CG  MET A  19      44.903 -60.370  -6.159  1.00  0.70           C  
ATOM    151  SD  MET A  19      43.275 -61.182  -6.266  1.00  0.70           S  
ATOM    152  CE  MET A  19      43.729 -62.937  -6.091  1.00  0.70           C  
ATOM    153  N   ASP A  20      47.403 -58.520  -3.710  1.00  0.73           N  
ATOM    154  CA  ASP A  20      47.475 -57.128  -3.287  1.00  0.73           C  
ATOM    155  C   ASP A  20      48.721 -56.411  -3.803  1.00  0.73           C  
ATOM    156  O   ASP A  20      48.640 -55.260  -4.213  1.00  0.73           O  
ATOM    157  CB  ASP A  20      47.203 -56.911  -1.753  1.00  0.73           C  
ATOM    158  CG  ASP A  20      45.811 -56.337  -1.490  1.00  0.73           C  
ATOM    159  OD1 ASP A  20      45.060 -56.121  -2.481  1.00  0.73           O  
ATOM    160  OD2 ASP A  20      45.438 -56.063  -0.320  1.00  0.73           O  
ATOM    161  N   LYS A  21      49.903 -57.060  -3.903  1.00  0.73           N  
ATOM    162  CA  LYS A  21      51.027 -56.445  -4.607  1.00  0.73           C  
ATOM    163  C   LYS A  21      50.781 -56.171  -6.094  1.00  0.73           C  
ATOM    164  O   LYS A  21      51.139 -55.109  -6.605  1.00  0.73           O  
ATOM    165  CB  LYS A  21      52.338 -57.253  -4.439  1.00  0.73           C  
ATOM    166  CG  LYS A  21      53.578 -56.476  -4.935  1.00  0.73           C  
ATOM    167  CD  LYS A  21      54.936 -57.133  -4.621  1.00  0.73           C  
ATOM    168  CE  LYS A  21      55.198 -57.470  -3.146  1.00  0.73           C  
ATOM    169  NZ  LYS A  21      55.024 -56.257  -2.316  1.00  0.73           N  
ATOM    170  N   LEU A  22      50.136 -57.111  -6.819  1.00  0.75           N  
ATOM    171  CA  LEU A  22      49.669 -56.916  -8.187  1.00  0.75           C  
ATOM    172  C   LEU A  22      48.612 -55.808  -8.270  1.00  0.75           C  
ATOM    173  O   LEU A  22      48.665 -54.922  -9.121  1.00  0.75           O  
ATOM    174  CB  LEU A  22      49.134 -58.290  -8.697  1.00  0.75           C  
ATOM    175  CG  LEU A  22      48.853 -58.499 -10.210  1.00  0.75           C  
ATOM    176  CD1 LEU A  22      47.633 -57.742 -10.730  1.00  0.75           C  
ATOM    177  CD2 LEU A  22      50.057 -58.198 -11.105  1.00  0.75           C  
ATOM    178  N   ALA A  23      47.635 -55.807  -7.344  1.00  0.76           N  
ATOM    179  CA  ALA A  23      46.579 -54.827  -7.273  1.00  0.76           C  
ATOM    180  C   ALA A  23      46.997 -53.421  -6.882  1.00  0.76           C  
ATOM    181  O   ALA A  23      46.635 -52.483  -7.582  1.00  0.76           O  
ATOM    182  CB  ALA A  23      45.461 -55.324  -6.335  1.00  0.76           C  
ATOM    183  N   ASP A  24      47.788 -53.213  -5.808  1.00  0.75           N  
ATOM    184  CA  ASP A  24      48.155 -51.896  -5.301  1.00  0.75           C  
ATOM    185  C   ASP A  24      48.922 -51.053  -6.299  1.00  0.75           C  
ATOM    186  O   ASP A  24      48.676 -49.858  -6.446  1.00  0.75           O  
ATOM    187  CB  ASP A  24      48.993 -51.998  -3.996  1.00  0.75           C  
ATOM    188  CG  ASP A  24      48.120 -52.071  -2.764  1.00  0.75           C  
ATOM    189  OD1 ASP A  24      46.939 -51.647  -2.858  1.00  0.75           O  
ATOM    190  OD2 ASP A  24      48.620 -52.483  -1.690  1.00  0.75           O  
ATOM    191  N   THR A  25      49.848 -51.672  -7.053  1.00  0.76           N  
ATOM    192  CA  THR A  25      50.568 -50.988  -8.123  1.00  0.76           C  
ATOM    193  C   THR A  25      49.642 -50.502  -9.238  1.00  0.76           C  
ATOM    194  O   THR A  25      49.798 -49.406  -9.765  1.00  0.76           O  
ATOM    195  CB  THR A  25      51.756 -51.801  -8.634  1.00  0.76           C  
ATOM    196  OG1 THR A  25      52.588 -51.044  -9.499  1.00  0.76           O  
ATOM    197  CG2 THR A  25      51.321 -53.071  -9.370  1.00  0.76           C  
ATOM    198  N   VAL A  26      48.595 -51.272  -9.603  1.00  0.73           N  
ATOM    199  CA  VAL A  26      47.572 -50.807 -10.530  1.00  0.73           C  
ATOM    200  C   VAL A  26      46.566 -49.828  -9.901  1.00  0.73           C  
ATOM    201  O   VAL A  26      46.123 -48.884 -10.554  1.00  0.73           O  
ATOM    202  CB  VAL A  26      46.862 -51.962 -11.216  1.00  0.73           C  
ATOM    203  CG1 VAL A  26      45.946 -51.407 -12.323  1.00  0.73           C  
ATOM    204  CG2 VAL A  26      47.894 -52.911 -11.859  1.00  0.73           C  
ATOM    205  N   ARG A  27      46.210 -49.982  -8.597  1.00  0.60           N  
ATOM    206  CA  ARG A  27      45.244 -49.160  -7.858  1.00  0.60           C  
ATOM    207  C   ARG A  27      45.495 -47.659  -7.925  1.00  0.60           C  
ATOM    208  O   ARG A  27      44.573 -46.860  -7.778  1.00  0.60           O  
ATOM    209  CB  ARG A  27      45.106 -49.517  -6.336  1.00  0.60           C  
ATOM    210  CG  ARG A  27      44.318 -50.790  -5.916  1.00  0.60           C  
ATOM    211  CD  ARG A  27      44.223 -50.906  -4.381  1.00  0.60           C  
ATOM    212  NE  ARG A  27      43.826 -52.303  -3.961  1.00  0.60           N  
ATOM    213  CZ  ARG A  27      43.995 -52.742  -2.703  1.00  0.60           C  
ATOM    214  NH1 ARG A  27      44.648 -52.026  -1.806  1.00  0.60           N  
ATOM    215  NH2 ARG A  27      43.645 -53.969  -2.346  1.00  0.60           N  
ATOM    216  N   VAL A  28      46.744 -47.227  -8.150  1.00  0.71           N  
ATOM    217  CA  VAL A  28      47.074 -45.821  -8.228  1.00  0.71           C  
ATOM    218  C   VAL A  28      46.670 -45.131  -9.528  1.00  0.71           C  
ATOM    219  O   VAL A  28      46.609 -43.906  -9.558  1.00  0.71           O  
ATOM    220  CB  VAL A  28      48.555 -45.569  -7.957  1.00  0.71           C  
ATOM    221  CG1 VAL A  28      48.941 -46.232  -6.620  1.00  0.71           C  
ATOM    222  CG2 VAL A  28      49.432 -46.100  -9.104  1.00  0.71           C  
ATOM    223  N   THR A  29      46.354 -45.847 -10.638  1.00  0.61           N  
ATOM    224  CA  THR A  29      46.176 -45.185 -11.944  1.00  0.61           C  
ATOM    225  C   THR A  29      44.731 -44.829 -12.274  1.00  0.61           C  
ATOM    226  O   THR A  29      44.398 -44.479 -13.401  1.00  0.61           O  
ATOM    227  CB  THR A  29      46.818 -45.886 -13.158  1.00  0.61           C  
ATOM    228  OG1 THR A  29      46.111 -46.998 -13.685  1.00  0.61           O  
ATOM    229  CG2 THR A  29      48.206 -46.433 -12.811  1.00  0.61           C  
ATOM    230  N   LEU A  30      43.808 -44.905 -11.297  1.00  0.59           N  
ATOM    231  CA  LEU A  30      42.380 -44.906 -11.582  1.00  0.59           C  
ATOM    232  C   LEU A  30      41.737 -43.557 -11.857  1.00  0.59           C  
ATOM    233  O   LEU A  30      41.630 -42.676 -11.004  1.00  0.59           O  
ATOM    234  CB  LEU A  30      41.568 -45.607 -10.459  1.00  0.59           C  
ATOM    235  CG  LEU A  30      41.448 -47.136 -10.617  1.00  0.59           C  
ATOM    236  CD1 LEU A  30      40.595 -47.553 -11.826  1.00  0.59           C  
ATOM    237  CD2 LEU A  30      42.812 -47.825 -10.653  1.00  0.59           C  
ATOM    238  N   GLY A  31      41.169 -43.416 -13.074  1.00  0.51           N  
ATOM    239  CA  GLY A  31      40.339 -42.280 -13.443  1.00  0.51           C  
ATOM    240  C   GLY A  31      41.050 -40.944 -13.472  1.00  0.51           C  
ATOM    241  O   GLY A  31      42.275 -40.874 -13.540  1.00  0.51           O  
ATOM    242  N   PRO A  32      40.347 -39.821 -13.466  1.00  0.50           N  
ATOM    243  CA  PRO A  32      40.972 -38.503 -13.557  1.00  0.50           C  
ATOM    244  C   PRO A  32      41.745 -38.110 -12.308  1.00  0.50           C  
ATOM    245  O   PRO A  32      42.353 -37.052 -12.313  1.00  0.50           O  
ATOM    246  CB  PRO A  32      39.797 -37.560 -13.861  1.00  0.50           C  
ATOM    247  CG  PRO A  32      38.565 -38.275 -13.300  1.00  0.50           C  
ATOM    248  CD  PRO A  32      38.885 -39.751 -13.541  1.00  0.50           C  
ATOM    249  N   ARG A  33      41.743 -38.915 -11.228  1.00  0.48           N  
ATOM    250  CA  ARG A  33      42.553 -38.650 -10.049  1.00  0.48           C  
ATOM    251  C   ARG A  33      43.645 -39.692  -9.889  1.00  0.48           C  
ATOM    252  O   ARG A  33      44.259 -39.802  -8.827  1.00  0.48           O  
ATOM    253  CB  ARG A  33      41.671 -38.582  -8.774  1.00  0.48           C  
ATOM    254  CG  ARG A  33      40.672 -37.399  -8.746  1.00  0.48           C  
ATOM    255  CD  ARG A  33      41.239 -36.033  -8.310  1.00  0.48           C  
ATOM    256  NE  ARG A  33      42.190 -35.501  -9.342  1.00  0.48           N  
ATOM    257  CZ  ARG A  33      41.877 -34.754 -10.409  1.00  0.48           C  
ATOM    258  NH1 ARG A  33      40.630 -34.507 -10.784  1.00  0.48           N  
ATOM    259  NH2 ARG A  33      42.853 -34.238 -11.143  1.00  0.48           N  
ATOM    260  N   GLY A  34      43.915 -40.464 -10.963  1.00  0.61           N  
ATOM    261  CA  GLY A  34      45.048 -41.370 -11.068  1.00  0.61           C  
ATOM    262  C   GLY A  34      46.419 -40.741 -10.988  1.00  0.61           C  
ATOM    263  O   GLY A  34      46.593 -39.526 -10.905  1.00  0.61           O  
ATOM    264  N   ARG A  35      47.444 -41.604 -10.994  1.00  0.56           N  
ATOM    265  CA  ARG A  35      48.837 -41.230 -11.018  1.00  0.56           C  
ATOM    266  C   ARG A  35      49.595 -42.277 -11.806  1.00  0.56           C  
ATOM    267  O   ARG A  35      49.293 -43.465 -11.714  1.00  0.56           O  
ATOM    268  CB  ARG A  35      49.448 -41.236  -9.589  1.00  0.56           C  
ATOM    269  CG  ARG A  35      48.848 -40.176  -8.650  1.00  0.56           C  
ATOM    270  CD  ARG A  35      49.335 -40.318  -7.212  1.00  0.56           C  
ATOM    271  NE  ARG A  35      48.726 -39.189  -6.431  1.00  0.56           N  
ATOM    272  CZ  ARG A  35      49.298 -37.990  -6.261  1.00  0.56           C  
ATOM    273  NH1 ARG A  35      50.478 -37.699  -6.799  1.00  0.56           N  
ATOM    274  NH2 ARG A  35      48.673 -37.063  -5.539  1.00  0.56           N  
ATOM    275  N   HIS A  36      50.622 -41.880 -12.579  1.00  0.60           N  
ATOM    276  CA  HIS A  36      51.530 -42.803 -13.240  1.00  0.60           C  
ATOM    277  C   HIS A  36      52.257 -43.811 -12.366  1.00  0.60           C  
ATOM    278  O   HIS A  36      52.634 -43.547 -11.225  1.00  0.60           O  
ATOM    279  CB  HIS A  36      52.660 -42.078 -13.995  1.00  0.60           C  
ATOM    280  CG  HIS A  36      52.163 -41.111 -15.001  1.00  0.60           C  
ATOM    281  ND1 HIS A  36      52.011 -39.781 -14.663  1.00  0.60           N  
ATOM    282  CD2 HIS A  36      51.712 -41.345 -16.255  1.00  0.60           C  
ATOM    283  CE1 HIS A  36      51.447 -39.234 -15.725  1.00  0.60           C  
ATOM    284  NE2 HIS A  36      51.253 -40.136 -16.717  1.00  0.60           N  
ATOM    285  N   VAL A  37      52.548 -44.985 -12.953  1.00  0.73           N  
ATOM    286  CA  VAL A  37      53.505 -45.929 -12.408  1.00  0.73           C  
ATOM    287  C   VAL A  37      54.748 -45.839 -13.276  1.00  0.73           C  
ATOM    288  O   VAL A  37      54.673 -45.638 -14.489  1.00  0.73           O  
ATOM    289  CB  VAL A  37      52.981 -47.360 -12.373  1.00  0.73           C  
ATOM    290  CG1 VAL A  37      53.981 -48.299 -11.668  1.00  0.73           C  
ATOM    291  CG2 VAL A  37      51.654 -47.382 -11.598  1.00  0.73           C  
ATOM    292  N   VAL A  38      55.946 -45.942 -12.669  1.00  0.77           N  
ATOM    293  CA  VAL A  38      57.200 -45.956 -13.400  1.00  0.77           C  
ATOM    294  C   VAL A  38      57.674 -47.389 -13.470  1.00  0.77           C  
ATOM    295  O   VAL A  38      57.956 -48.015 -12.451  1.00  0.77           O  
ATOM    296  CB  VAL A  38      58.285 -45.101 -12.754  1.00  0.77           C  
ATOM    297  CG1 VAL A  38      59.567 -45.127 -13.615  1.00  0.77           C  
ATOM    298  CG2 VAL A  38      57.766 -43.657 -12.610  1.00  0.77           C  
ATOM    299  N   LEU A  39      57.758 -47.942 -14.689  1.00  0.74           N  
ATOM    300  CA  LEU A  39      58.063 -49.336 -14.911  1.00  0.74           C  
ATOM    301  C   LEU A  39      59.511 -49.485 -15.341  1.00  0.74           C  
ATOM    302  O   LEU A  39      59.927 -48.985 -16.390  1.00  0.74           O  
ATOM    303  CB  LEU A  39      57.161 -49.909 -16.026  1.00  0.74           C  
ATOM    304  CG  LEU A  39      55.651 -49.679 -15.844  1.00  0.74           C  
ATOM    305  CD1 LEU A  39      54.894 -50.293 -17.028  1.00  0.74           C  
ATOM    306  CD2 LEU A  39      55.139 -50.274 -14.529  1.00  0.74           C  
ATOM    307  N   ALA A  40      60.337 -50.162 -14.526  1.00  0.71           N  
ATOM    308  CA  ALA A  40      61.756 -50.305 -14.778  1.00  0.71           C  
ATOM    309  C   ALA A  40      62.081 -51.234 -15.946  1.00  0.71           C  
ATOM    310  O   ALA A  40      61.612 -52.365 -16.032  1.00  0.71           O  
ATOM    311  CB  ALA A  40      62.491 -50.766 -13.505  1.00  0.71           C  
ATOM    312  N   LYS A  41      62.913 -50.772 -16.899  1.00  0.57           N  
ATOM    313  CA  LYS A  41      63.297 -51.566 -18.048  1.00  0.57           C  
ATOM    314  C   LYS A  41      64.807 -51.592 -18.130  1.00  0.57           C  
ATOM    315  O   LYS A  41      65.462 -50.578 -17.926  1.00  0.57           O  
ATOM    316  CB  LYS A  41      62.731 -51.000 -19.382  1.00  0.57           C  
ATOM    317  CG  LYS A  41      61.209 -50.761 -19.398  1.00  0.57           C  
ATOM    318  CD  LYS A  41      60.347 -52.008 -19.140  1.00  0.57           C  
ATOM    319  CE  LYS A  41      58.915 -51.616 -18.759  1.00  0.57           C  
ATOM    320  NZ  LYS A  41      58.217 -52.745 -18.116  1.00  0.57           N  
ATOM    321  N   ALA A  42      65.403 -52.761 -18.442  1.00  0.41           N  
ATOM    322  CA  ALA A  42      66.835 -52.867 -18.662  1.00  0.41           C  
ATOM    323  C   ALA A  42      67.160 -52.776 -20.149  1.00  0.41           C  
ATOM    324  O   ALA A  42      68.314 -52.770 -20.567  1.00  0.41           O  
ATOM    325  CB  ALA A  42      67.319 -54.232 -18.131  1.00  0.41           C  
ATOM    326  N   PHE A  43      66.112 -52.687 -20.988  1.00  0.46           N  
ATOM    327  CA  PHE A  43      66.207 -52.733 -22.436  1.00  0.46           C  
ATOM    328  C   PHE A  43      66.414 -51.347 -23.031  1.00  0.46           C  
ATOM    329  O   PHE A  43      66.738 -51.188 -24.204  1.00  0.46           O  
ATOM    330  CB  PHE A  43      64.888 -53.302 -23.050  1.00  0.46           C  
ATOM    331  CG  PHE A  43      64.272 -54.375 -22.188  1.00  0.46           C  
ATOM    332  CD1 PHE A  43      64.961 -55.566 -21.905  1.00  0.46           C  
ATOM    333  CD2 PHE A  43      63.005 -54.170 -21.615  1.00  0.46           C  
ATOM    334  CE1 PHE A  43      64.404 -56.523 -21.046  1.00  0.46           C  
ATOM    335  CE2 PHE A  43      62.445 -55.124 -20.757  1.00  0.46           C  
ATOM    336  CZ  PHE A  43      63.148 -56.299 -20.469  1.00  0.46           C  
ATOM    337  N   GLY A  44      66.205 -50.300 -22.216  1.00  0.49           N  
ATOM    338  CA  GLY A  44      66.274 -48.921 -22.649  1.00  0.49           C  
ATOM    339  C   GLY A  44      65.908 -48.066 -21.477  1.00  0.49           C  
ATOM    340  O   GLY A  44      66.218 -48.401 -20.340  1.00  0.49           O  
ATOM    341  N   GLY A  45      65.217 -46.932 -21.705  1.00  0.59           N  
ATOM    342  CA  GLY A  45      64.678 -46.132 -20.607  1.00  0.59           C  
ATOM    343  C   GLY A  45      63.558 -46.809 -19.832  1.00  0.59           C  
ATOM    344  O   GLY A  45      62.835 -47.625 -20.407  1.00  0.59           O  
ATOM    345  N   PRO A  46      63.321 -46.495 -18.559  1.00  0.68           N  
ATOM    346  CA  PRO A  46      62.101 -46.889 -17.864  1.00  0.68           C  
ATOM    347  C   PRO A  46      60.876 -46.214 -18.459  1.00  0.68           C  
ATOM    348  O   PRO A  46      60.957 -45.082 -18.933  1.00  0.68           O  
ATOM    349  CB  PRO A  46      62.346 -46.444 -16.412  1.00  0.68           C  
ATOM    350  CG  PRO A  46      63.305 -45.258 -16.539  1.00  0.68           C  
ATOM    351  CD  PRO A  46      64.186 -45.658 -17.723  1.00  0.68           C  
ATOM    352  N   THR A  47      59.722 -46.900 -18.466  1.00  0.71           N  
ATOM    353  CA  THR A  47      58.512 -46.371 -19.079  1.00  0.71           C  
ATOM    354  C   THR A  47      57.568 -45.868 -18.022  1.00  0.71           C  
ATOM    355  O   THR A  47      57.223 -46.574 -17.078  1.00  0.71           O  
ATOM    356  CB  THR A  47      57.731 -47.354 -19.949  1.00  0.71           C  
ATOM    357  OG1 THR A  47      57.451 -48.577 -19.277  1.00  0.71           O  
ATOM    358  CG2 THR A  47      58.567 -47.698 -21.186  1.00  0.71           C  
ATOM    359  N   VAL A  48      57.097 -44.625 -18.180  1.00  0.67           N  
ATOM    360  CA  VAL A  48      56.070 -44.041 -17.343  1.00  0.67           C  
ATOM    361  C   VAL A  48      54.744 -44.372 -17.992  1.00  0.67           C  
ATOM    362  O   VAL A  48      54.590 -44.119 -19.185  1.00  0.67           O  
ATOM    363  CB  VAL A  48      56.238 -42.526 -17.269  1.00  0.67           C  
ATOM    364  CG1 VAL A  48      55.157 -41.899 -16.376  1.00  0.67           C  
ATOM    365  CG2 VAL A  48      57.635 -42.195 -16.709  1.00  0.67           C  
ATOM    366  N   THR A  49      53.789 -44.980 -17.256  1.00  0.66           N  
ATOM    367  CA  THR A  49      52.507 -45.367 -17.845  1.00  0.66           C  
ATOM    368  C   THR A  49      51.349 -45.238 -16.873  1.00  0.66           C  
ATOM    369  O   THR A  49      51.483 -45.409 -15.659  1.00  0.66           O  
ATOM    370  CB  THR A  49      52.415 -46.798 -18.391  1.00  0.66           C  
ATOM    371  OG1 THR A  49      52.759 -47.774 -17.419  1.00  0.66           O  
ATOM    372  CG2 THR A  49      53.361 -47.009 -19.580  1.00  0.66           C  
ATOM    373  N   ASN A  50      50.143 -44.952 -17.408  1.00  0.60           N  
ATOM    374  CA  ASN A  50      48.897 -45.103 -16.664  1.00  0.60           C  
ATOM    375  C   ASN A  50      48.145 -46.386 -16.979  1.00  0.60           C  
ATOM    376  O   ASN A  50      47.381 -46.878 -16.147  1.00  0.60           O  
ATOM    377  CB  ASN A  50      47.934 -43.948 -16.979  1.00  0.60           C  
ATOM    378  CG  ASN A  50      48.578 -42.653 -16.531  1.00  0.60           C  
ATOM    379  OD1 ASN A  50      48.922 -41.795 -17.340  1.00  0.60           O  
ATOM    380  ND2 ASN A  50      48.749 -42.504 -15.202  1.00  0.60           N  
ATOM    381  N   ASP A  51      48.377 -46.994 -18.163  1.00  0.57           N  
ATOM    382  CA  ASP A  51      47.754 -48.238 -18.585  1.00  0.57           C  
ATOM    383  C   ASP A  51      48.015 -49.376 -17.594  1.00  0.57           C  
ATOM    384  O   ASP A  51      49.144 -49.836 -17.406  1.00  0.57           O  
ATOM    385  CB  ASP A  51      48.217 -48.588 -20.031  1.00  0.57           C  
ATOM    386  CG  ASP A  51      47.662 -49.891 -20.601  1.00  0.57           C  
ATOM    387  OD1 ASP A  51      46.974 -50.642 -19.862  1.00  0.57           O  
ATOM    388  OD2 ASP A  51      48.004 -50.189 -21.772  1.00  0.57           O  
ATOM    389  N   GLY A  52      46.931 -49.868 -16.957  1.00  0.64           N  
ATOM    390  CA  GLY A  52      46.975 -50.872 -15.907  1.00  0.64           C  
ATOM    391  C   GLY A  52      47.542 -52.192 -16.328  1.00  0.64           C  
ATOM    392  O   GLY A  52      48.129 -52.901 -15.516  1.00  0.64           O  
ATOM    393  N   VAL A  53      47.430 -52.558 -17.622  1.00  0.61           N  
ATOM    394  CA  VAL A  53      48.013 -53.797 -18.101  1.00  0.61           C  
ATOM    395  C   VAL A  53      49.519 -53.743 -18.109  1.00  0.61           C  
ATOM    396  O   VAL A  53      50.198 -54.719 -17.817  1.00  0.61           O  
ATOM    397  CB  VAL A  53      47.521 -54.244 -19.470  1.00  0.61           C  
ATOM    398  CG1 VAL A  53      48.302 -53.588 -20.629  1.00  0.61           C  
ATOM    399  CG2 VAL A  53      47.611 -55.779 -19.496  1.00  0.61           C  
ATOM    400  N   THR A  54      50.098 -52.581 -18.467  1.00  0.67           N  
ATOM    401  CA  THR A  54      51.536 -52.415 -18.610  1.00  0.67           C  
ATOM    402  C   THR A  54      52.220 -52.574 -17.279  1.00  0.67           C  
ATOM    403  O   THR A  54      53.241 -53.251 -17.165  1.00  0.67           O  
ATOM    404  CB  THR A  54      51.946 -51.118 -19.293  1.00  0.67           C  
ATOM    405  OG1 THR A  54      51.583 -49.956 -18.563  1.00  0.67           O  
ATOM    406  CG2 THR A  54      51.279 -51.031 -20.670  1.00  0.67           C  
ATOM    407  N   VAL A  55      51.585 -52.003 -16.238  1.00  0.72           N  
ATOM    408  CA  VAL A  55      51.913 -52.198 -14.845  1.00  0.72           C  
ATOM    409  C   VAL A  55      51.724 -53.641 -14.398  1.00  0.72           C  
ATOM    410  O   VAL A  55      52.619 -54.254 -13.824  1.00  0.72           O  
ATOM    411  CB  VAL A  55      51.048 -51.293 -13.972  1.00  0.72           C  
ATOM    412  CG1 VAL A  55      51.587 -51.334 -12.536  1.00  0.72           C  
ATOM    413  CG2 VAL A  55      51.052 -49.844 -14.497  1.00  0.72           C  
ATOM    414  N   ALA A  56      50.562 -54.259 -14.703  1.00  0.75           N  
ATOM    415  CA  ALA A  56      50.277 -55.631 -14.339  1.00  0.75           C  
ATOM    416  C   ALA A  56      51.208 -56.659 -14.971  1.00  0.75           C  
ATOM    417  O   ALA A  56      51.667 -57.571 -14.290  1.00  0.75           O  
ATOM    418  CB  ALA A  56      48.817 -55.975 -14.689  1.00  0.75           C  
ATOM    419  N   ARG A  57      51.543 -56.521 -16.276  1.00  0.63           N  
ATOM    420  CA  ARG A  57      52.347 -57.462 -17.045  1.00  0.63           C  
ATOM    421  C   ARG A  57      53.732 -57.715 -16.446  1.00  0.63           C  
ATOM    422  O   ARG A  57      54.193 -58.858 -16.430  1.00  0.63           O  
ATOM    423  CB  ARG A  57      52.479 -57.065 -18.554  1.00  0.63           C  
ATOM    424  CG  ARG A  57      51.220 -57.365 -19.415  1.00  0.63           C  
ATOM    425  CD  ARG A  57      51.312 -56.895 -20.887  1.00  0.63           C  
ATOM    426  NE  ARG A  57      49.951 -56.898 -21.563  1.00  0.63           N  
ATOM    427  CZ  ARG A  57      49.374 -57.940 -22.186  1.00  0.63           C  
ATOM    428  NH1 ARG A  57      49.833 -59.174 -22.041  1.00  0.63           N  
ATOM    429  NH2 ARG A  57      48.297 -57.751 -22.953  1.00  0.63           N  
ATOM    430  N   GLU A  58      54.417 -56.673 -15.918  1.00  0.68           N  
ATOM    431  CA  GLU A  58      55.765 -56.827 -15.387  1.00  0.68           C  
ATOM    432  C   GLU A  58      55.850 -57.357 -13.962  1.00  0.68           C  
ATOM    433  O   GLU A  58      56.914 -57.779 -13.520  1.00  0.68           O  
ATOM    434  CB  GLU A  58      56.607 -55.527 -15.497  1.00  0.68           C  
ATOM    435  CG  GLU A  58      56.355 -54.425 -14.439  1.00  0.68           C  
ATOM    436  CD  GLU A  58      57.412 -53.323 -14.501  1.00  0.68           C  
ATOM    437  OE1 GLU A  58      58.190 -53.274 -15.501  1.00  0.68           O  
ATOM    438  OE2 GLU A  58      57.410 -52.461 -13.589  1.00  0.68           O  
ATOM    439  N   ILE A  59      54.745 -57.378 -13.187  1.00  0.74           N  
ATOM    440  CA  ILE A  59      54.788 -57.857 -11.811  1.00  0.74           C  
ATOM    441  C   ILE A  59      55.029 -59.360 -11.713  1.00  0.74           C  
ATOM    442  O   ILE A  59      54.263 -60.173 -12.236  1.00  0.74           O  
ATOM    443  CB  ILE A  59      53.543 -57.452 -11.030  1.00  0.74           C  
ATOM    444  CG1 ILE A  59      53.419 -55.915 -10.917  1.00  0.74           C  
ATOM    445  CG2 ILE A  59      53.490 -58.103  -9.628  1.00  0.74           C  
ATOM    446  CD1 ILE A  59      54.556 -55.221 -10.154  1.00  0.74           C  
ATOM    447  N   GLU A  60      56.120 -59.725 -11.021  1.00  0.72           N  
ATOM    448  CA  GLU A  60      56.605 -61.064 -10.779  1.00  0.72           C  
ATOM    449  C   GLU A  60      57.216 -60.981  -9.388  1.00  0.72           C  
ATOM    450  O   GLU A  60      57.759 -59.937  -9.016  1.00  0.72           O  
ATOM    451  CB  GLU A  60      57.665 -61.424 -11.846  1.00  0.72           C  
ATOM    452  CG  GLU A  60      58.326 -62.818 -11.716  1.00  0.72           C  
ATOM    453  CD  GLU A  60      59.294 -63.096 -12.868  1.00  0.72           C  
ATOM    454  OE1 GLU A  60      59.246 -62.355 -13.886  1.00  0.72           O  
ATOM    455  OE2 GLU A  60      60.099 -64.056 -12.741  1.00  0.72           O  
ATOM    456  N   LEU A  61      57.052 -62.012  -8.537  1.00  0.72           N  
ATOM    457  CA  LEU A  61      57.372 -61.911  -7.120  1.00  0.72           C  
ATOM    458  C   LEU A  61      58.386 -62.947  -6.663  1.00  0.72           C  
ATOM    459  O   LEU A  61      58.455 -64.071  -7.145  1.00  0.72           O  
ATOM    460  CB  LEU A  61      56.123 -61.996  -6.203  1.00  0.72           C  
ATOM    461  CG  LEU A  61      55.184 -60.771  -6.253  1.00  0.72           C  
ATOM    462  CD1 LEU A  61      54.244 -60.771  -7.458  1.00  0.72           C  
ATOM    463  CD2 LEU A  61      54.301 -60.748  -5.008  1.00  0.72           C  
ATOM    464  N   GLU A  62      59.237 -62.558  -5.687  1.00  0.70           N  
ATOM    465  CA  GLU A  62      60.273 -63.408  -5.127  1.00  0.70           C  
ATOM    466  C   GLU A  62      59.769 -64.633  -4.366  1.00  0.70           C  
ATOM    467  O   GLU A  62      60.282 -65.738  -4.542  1.00  0.70           O  
ATOM    468  CB  GLU A  62      61.197 -62.557  -4.231  1.00  0.70           C  
ATOM    469  CG  GLU A  62      62.487 -63.280  -3.773  1.00  0.70           C  
ATOM    470  CD  GLU A  62      63.413 -62.363  -2.977  1.00  0.70           C  
ATOM    471  OE1 GLU A  62      63.058 -61.171  -2.784  1.00  0.70           O  
ATOM    472  OE2 GLU A  62      64.490 -62.860  -2.562  1.00  0.70           O  
ATOM    473  N   ASP A  63      58.722 -64.493  -3.517  1.00  0.76           N  
ATOM    474  CA  ASP A  63      58.047 -65.646  -2.952  1.00  0.76           C  
ATOM    475  C   ASP A  63      57.252 -66.402  -4.039  1.00  0.76           C  
ATOM    476  O   ASP A  63      56.447 -65.779  -4.738  1.00  0.76           O  
ATOM    477  CB  ASP A  63      57.124 -65.272  -1.763  1.00  0.76           C  
ATOM    478  CG  ASP A  63      56.496 -66.540  -1.205  1.00  0.76           C  
ATOM    479  OD1 ASP A  63      55.293 -66.771  -1.487  1.00  0.76           O  
ATOM    480  OD2 ASP A  63      57.246 -67.356  -0.615  1.00  0.76           O  
ATOM    481  N   PRO A  64      57.395 -67.719  -4.209  1.00  0.75           N  
ATOM    482  CA  PRO A  64      56.641 -68.468  -5.203  1.00  0.75           C  
ATOM    483  C   PRO A  64      55.139 -68.470  -4.985  1.00  0.75           C  
ATOM    484  O   PRO A  64      54.399 -68.481  -5.964  1.00  0.75           O  
ATOM    485  CB  PRO A  64      57.220 -69.893  -5.112  1.00  0.75           C  
ATOM    486  CG  PRO A  64      58.649 -69.679  -4.608  1.00  0.75           C  
ATOM    487  CD  PRO A  64      58.485 -68.515  -3.637  1.00  0.75           C  
ATOM    488  N   PHE A  65      54.643 -68.496  -3.733  1.00  0.72           N  
ATOM    489  CA  PHE A  65      53.217 -68.546  -3.459  1.00  0.72           C  
ATOM    490  C   PHE A  65      52.556 -67.197  -3.687  1.00  0.72           C  
ATOM    491  O   PHE A  65      51.469 -67.114  -4.268  1.00  0.72           O  
ATOM    492  CB  PHE A  65      52.928 -69.046  -2.026  1.00  0.72           C  
ATOM    493  CG  PHE A  65      53.379 -70.468  -1.859  1.00  0.72           C  
ATOM    494  CD1 PHE A  65      52.638 -71.517  -2.429  1.00  0.72           C  
ATOM    495  CD2 PHE A  65      54.531 -70.770  -1.116  1.00  0.72           C  
ATOM    496  CE1 PHE A  65      53.037 -72.848  -2.253  1.00  0.72           C  
ATOM    497  CE2 PHE A  65      54.931 -72.100  -0.934  1.00  0.72           C  
ATOM    498  CZ  PHE A  65      54.181 -73.139  -1.501  1.00  0.72           C  
ATOM    499  N   GLU A  66      53.231 -66.097  -3.289  1.00  0.72           N  
ATOM    500  CA  GLU A  66      52.832 -64.750  -3.657  1.00  0.72           C  
ATOM    501  C   GLU A  66      52.836 -64.537  -5.173  1.00  0.72           C  
ATOM    502  O   GLU A  66      51.919 -63.930  -5.731  1.00  0.72           O  
ATOM    503  CB  GLU A  66      53.696 -63.639  -3.006  1.00  0.72           C  
ATOM    504  CG  GLU A  66      53.652 -63.536  -1.460  1.00  0.72           C  
ATOM    505  CD  GLU A  66      54.280 -62.237  -0.935  1.00  0.72           C  
ATOM    506  OE1 GLU A  66      54.616 -61.332  -1.749  1.00  0.72           O  
ATOM    507  OE2 GLU A  66      54.392 -62.116   0.311  1.00  0.72           O  
ATOM    508  N   ASP A  67      53.836 -65.079  -5.904  1.00  0.74           N  
ATOM    509  CA  ASP A  67      53.868 -65.006  -7.354  1.00  0.74           C  
ATOM    510  C   ASP A  67      52.651 -65.650  -8.019  1.00  0.74           C  
ATOM    511  O   ASP A  67      52.023 -65.044  -8.882  1.00  0.74           O  
ATOM    512  CB  ASP A  67      55.182 -65.603  -7.908  1.00  0.74           C  
ATOM    513  CG  ASP A  67      55.312 -65.197  -9.363  1.00  0.74           C  
ATOM    514  OD1 ASP A  67      55.432 -63.967  -9.603  1.00  0.74           O  
ATOM    515  OD2 ASP A  67      55.200 -66.092 -10.236  1.00  0.74           O  
ATOM    516  N   LEU A  68      52.207 -66.849  -7.576  1.00  0.74           N  
ATOM    517  CA  LEU A  68      51.001 -67.472  -8.113  1.00  0.74           C  
ATOM    518  C   LEU A  68      49.755 -66.606  -7.939  1.00  0.74           C  
ATOM    519  O   LEU A  68      48.958 -66.447  -8.864  1.00  0.74           O  
ATOM    520  CB  LEU A  68      50.710 -68.865  -7.494  1.00  0.74           C  
ATOM    521  CG  LEU A  68      51.836 -69.911  -7.639  1.00  0.74           C  
ATOM    522  CD1 LEU A  68      51.379 -71.266  -7.078  1.00  0.74           C  
ATOM    523  CD2 LEU A  68      52.350 -70.069  -9.079  1.00  0.74           C  
ATOM    524  N   GLY A  69      49.600 -65.969  -6.754  1.00  0.73           N  
ATOM    525  CA  GLY A  69      48.604 -64.925  -6.501  1.00  0.73           C  
ATOM    526  C   GLY A  69      48.567 -63.804  -7.511  1.00  0.73           C  
ATOM    527  O   GLY A  69      47.513 -63.450  -8.032  1.00  0.73           O  
ATOM    528  N   ALA A  70      49.732 -63.212  -7.821  1.00  0.74           N  
ATOM    529  CA  ALA A  70      49.858 -62.211  -8.859  1.00  0.74           C  
ATOM    530  C   ALA A  70      49.663 -62.733 -10.281  1.00  0.74           C  
ATOM    531  O   ALA A  70      48.965 -62.124 -11.087  1.00  0.74           O  
ATOM    532  CB  ALA A  70      51.240 -61.553  -8.752  1.00  0.74           C  
ATOM    533  N   GLN A  71      50.256 -63.892 -10.629  1.00  0.70           N  
ATOM    534  CA  GLN A  71      50.220 -64.495 -11.952  1.00  0.70           C  
ATOM    535  C   GLN A  71      48.818 -64.819 -12.449  1.00  0.70           C  
ATOM    536  O   GLN A  71      48.478 -64.522 -13.592  1.00  0.70           O  
ATOM    537  CB  GLN A  71      51.072 -65.791 -11.971  1.00  0.70           C  
ATOM    538  CG  GLN A  71      52.603 -65.555 -12.068  1.00  0.70           C  
ATOM    539  CD  GLN A  71      53.087 -65.191 -13.470  1.00  0.70           C  
ATOM    540  OE1 GLN A  71      53.716 -64.166 -13.731  1.00  0.70           O  
ATOM    541  NE2 GLN A  71      52.762 -66.055 -14.461  1.00  0.70           N  
ATOM    542  N   LEU A  72      47.942 -65.387 -11.597  1.00  0.70           N  
ATOM    543  CA  LEU A  72      46.553 -65.660 -11.948  1.00  0.70           C  
ATOM    544  C   LEU A  72      45.741 -64.395 -12.231  1.00  0.70           C  
ATOM    545  O   LEU A  72      44.830 -64.376 -13.056  1.00  0.70           O  
ATOM    546  CB  LEU A  72      45.846 -66.507 -10.855  1.00  0.70           C  
ATOM    547  CG  LEU A  72      45.999 -68.038 -11.024  1.00  0.70           C  
ATOM    548  CD1 LEU A  72      47.428 -68.553 -10.805  1.00  0.70           C  
ATOM    549  CD2 LEU A  72      45.040 -68.771 -10.073  1.00  0.70           C  
ATOM    550  N   VAL A  73      46.053 -63.284 -11.549  1.00  0.67           N  
ATOM    551  CA  VAL A  73      45.330 -62.029 -11.683  1.00  0.67           C  
ATOM    552  C   VAL A  73      45.936 -61.185 -12.792  1.00  0.67           C  
ATOM    553  O   VAL A  73      45.291 -60.379 -13.454  1.00  0.67           O  
ATOM    554  CB  VAL A  73      45.374 -61.316 -10.351  1.00  0.67           C  
ATOM    555  CG1 VAL A  73      44.563 -60.004 -10.373  1.00  0.67           C  
ATOM    556  CG2 VAL A  73      44.777 -62.276  -9.308  1.00  0.67           C  
ATOM    557  N   LYS A  74      47.205 -61.438 -13.132  1.00  0.65           N  
ATOM    558  CA  LYS A  74      47.813 -60.987 -14.363  1.00  0.65           C  
ATOM    559  C   LYS A  74      47.162 -61.611 -15.591  1.00  0.65           C  
ATOM    560  O   LYS A  74      47.083 -60.978 -16.643  1.00  0.65           O  
ATOM    561  CB  LYS A  74      49.329 -61.250 -14.322  1.00  0.65           C  
ATOM    562  CG  LYS A  74      50.096 -60.785 -15.568  1.00  0.65           C  
ATOM    563  CD  LYS A  74      51.600 -60.617 -15.304  1.00  0.65           C  
ATOM    564  CE  LYS A  74      52.327 -61.854 -14.797  1.00  0.65           C  
ATOM    565  NZ  LYS A  74      53.742 -61.550 -14.479  1.00  0.65           N  
ATOM    566  N   SER A  75      46.631 -62.849 -15.483  1.00  0.68           N  
ATOM    567  CA  SER A  75      45.757 -63.433 -16.496  1.00  0.68           C  
ATOM    568  C   SER A  75      44.470 -62.673 -16.708  1.00  0.68           C  
ATOM    569  O   SER A  75      44.091 -62.451 -17.853  1.00  0.68           O  
ATOM    570  CB  SER A  75      45.342 -64.900 -16.235  1.00  0.68           C  
ATOM    571  OG  SER A  75      46.497 -65.718 -16.079  1.00  0.68           O  
ATOM    572  N   VAL A  76      43.751 -62.213 -15.652  1.00  0.58           N  
ATOM    573  CA  VAL A  76      42.616 -61.322 -15.894  1.00  0.58           C  
ATOM    574  C   VAL A  76      43.048 -59.973 -16.438  1.00  0.58           C  
ATOM    575  O   VAL A  76      42.472 -59.533 -17.417  1.00  0.58           O  
ATOM    576  CB  VAL A  76      41.578 -61.200 -14.779  1.00  0.58           C  
ATOM    577  CG1 VAL A  76      42.054 -60.327 -13.618  1.00  0.58           C  
ATOM    578  CG2 VAL A  76      40.267 -60.587 -15.327  1.00  0.58           C  
ATOM    579  N   ALA A  77      44.120 -59.328 -15.916  1.00  0.63           N  
ATOM    580  CA  ALA A  77      44.601 -58.049 -16.413  1.00  0.63           C  
ATOM    581  C   ALA A  77      45.016 -58.101 -17.891  1.00  0.63           C  
ATOM    582  O   ALA A  77      44.673 -57.231 -18.696  1.00  0.63           O  
ATOM    583  CB  ALA A  77      45.762 -57.542 -15.538  1.00  0.63           C  
ATOM    584  N   THR A  78      45.726 -59.183 -18.284  1.00  0.60           N  
ATOM    585  CA  THR A  78      46.070 -59.525 -19.668  1.00  0.60           C  
ATOM    586  C   THR A  78      44.854 -59.811 -20.505  1.00  0.60           C  
ATOM    587  O   THR A  78      44.647 -59.163 -21.527  1.00  0.60           O  
ATOM    588  CB  THR A  78      46.992 -60.732 -19.784  1.00  0.60           C  
ATOM    589  OG1 THR A  78      48.232 -60.429 -19.160  1.00  0.60           O  
ATOM    590  CG2 THR A  78      47.268 -61.112 -21.248  1.00  0.60           C  
ATOM    591  N   LYS A  79      43.922 -60.675 -20.032  1.00  0.51           N  
ATOM    592  CA  LYS A  79      42.700 -60.980 -20.764  1.00  0.51           C  
ATOM    593  C   LYS A  79      41.801 -59.757 -20.820  1.00  0.51           C  
ATOM    594  O   LYS A  79      40.916 -59.641 -21.667  1.00  0.51           O  
ATOM    595  CB  LYS A  79      41.920 -62.204 -20.193  1.00  0.51           C  
ATOM    596  CG  LYS A  79      40.786 -62.705 -21.114  1.00  0.51           C  
ATOM    597  CD  LYS A  79      40.130 -64.016 -20.646  1.00  0.51           C  
ATOM    598  CE  LYS A  79      39.125 -64.544 -21.678  1.00  0.51           C  
ATOM    599  NZ  LYS A  79      38.562 -65.847 -21.254  1.00  0.51           N  
ATOM    600  N   THR A  80      42.055 -58.749 -19.962  1.00  0.47           N  
ATOM    601  CA  THR A  80      41.462 -57.434 -20.031  1.00  0.47           C  
ATOM    602  C   THR A  80      42.270 -56.393 -20.809  1.00  0.47           C  
ATOM    603  O   THR A  80      41.926 -55.218 -20.828  1.00  0.47           O  
ATOM    604  CB  THR A  80      41.004 -56.810 -18.735  1.00  0.47           C  
ATOM    605  OG1 THR A  80      42.057 -56.684 -17.806  1.00  0.47           O  
ATOM    606  CG2 THR A  80      39.913 -57.704 -18.123  1.00  0.47           C  
ATOM    607  N   ASN A  81      43.312 -56.775 -21.553  1.00  0.47           N  
ATOM    608  CA  ASN A  81      43.952 -55.905 -22.528  1.00  0.47           C  
ATOM    609  C   ASN A  81      43.978 -56.562 -23.906  1.00  0.47           C  
ATOM    610  O   ASN A  81      44.215 -55.884 -24.897  1.00  0.47           O  
ATOM    611  CB  ASN A  81      45.368 -55.590 -22.043  1.00  0.47           C  
ATOM    612  CG  ASN A  81      46.216 -54.791 -23.029  1.00  0.47           C  
ATOM    613  OD1 ASN A  81      47.233 -55.318 -23.492  1.00  0.47           O  
ATOM    614  ND2 ASN A  81      45.869 -53.519 -23.311  1.00  0.47           N  
ATOM    615  N   ASP A  82      43.654 -57.869 -23.992  1.00  0.51           N  
ATOM    616  CA  ASP A  82      43.469 -58.597 -25.243  1.00  0.51           C  
ATOM    617  C   ASP A  82      42.168 -58.125 -25.922  1.00  0.51           C  
ATOM    618  O   ASP A  82      42.140 -57.046 -26.498  1.00  0.51           O  
ATOM    619  CB  ASP A  82      43.542 -60.134 -24.995  1.00  0.51           C  
ATOM    620  CG  ASP A  82      44.817 -60.536 -24.246  1.00  0.51           C  
ATOM    621  OD1 ASP A  82      45.849 -59.814 -24.310  1.00  0.51           O  
ATOM    622  OD2 ASP A  82      44.734 -61.580 -23.549  1.00  0.51           O  
ATOM    623  N   VAL A  83      41.034 -58.855 -25.759  1.00  0.44           N  
ATOM    624  CA  VAL A  83      39.668 -58.622 -26.271  1.00  0.44           C  
ATOM    625  C   VAL A  83      39.127 -57.181 -26.336  1.00  0.44           C  
ATOM    626  O   VAL A  83      38.113 -56.900 -26.942  1.00  0.44           O  
ATOM    627  CB  VAL A  83      38.607 -59.528 -25.599  1.00  0.44           C  
ATOM    628  CG1 VAL A  83      37.541 -59.945 -26.640  1.00  0.44           C  
ATOM    629  CG2 VAL A  83      39.235 -60.805 -25.002  1.00  0.44           C  
ATOM    630  N   ALA A  84      39.747 -56.176 -25.706  1.00  0.48           N  
ATOM    631  CA  ALA A  84      39.371 -54.796 -25.913  1.00  0.48           C  
ATOM    632  C   ALA A  84      40.632 -53.975 -25.938  1.00  0.48           C  
ATOM    633  O   ALA A  84      41.094 -53.524 -26.974  1.00  0.48           O  
ATOM    634  CB  ALA A  84      38.437 -54.249 -24.812  1.00  0.48           C  
ATOM    635  N   GLY A  85      41.225 -53.725 -24.764  1.00  0.52           N  
ATOM    636  CA  GLY A  85      42.456 -52.967 -24.716  1.00  0.52           C  
ATOM    637  C   GLY A  85      42.529 -52.181 -23.452  1.00  0.52           C  
ATOM    638  O   GLY A  85      43.609 -51.877 -22.967  1.00  0.52           O  
ATOM    639  N   ASP A  86      41.362 -51.921 -22.848  1.00  0.46           N  
ATOM    640  CA  ASP A  86      41.237 -51.273 -21.567  1.00  0.46           C  
ATOM    641  C   ASP A  86      39.964 -51.777 -20.911  1.00  0.46           C  
ATOM    642  O   ASP A  86      39.290 -52.678 -21.406  1.00  0.46           O  
ATOM    643  CB  ASP A  86      41.281 -49.727 -21.627  1.00  0.46           C  
ATOM    644  CG  ASP A  86      41.346 -49.097 -20.235  1.00  0.46           C  
ATOM    645  OD1 ASP A  86      42.013 -49.692 -19.347  1.00  0.46           O  
ATOM    646  OD2 ASP A  86      40.457 -48.250 -19.989  1.00  0.46           O  
ATOM    647  N   GLY A  87      39.687 -51.236 -19.716  1.00  0.56           N  
ATOM    648  CA  GLY A  87      39.104 -51.877 -18.590  1.00  0.56           C  
ATOM    649  C   GLY A  87      40.185 -52.534 -17.826  1.00  0.56           C  
ATOM    650  O   GLY A  87      39.877 -53.405 -17.045  1.00  0.56           O  
ATOM    651  N   THR A  88      41.476 -52.208 -18.014  1.00  0.56           N  
ATOM    652  CA  THR A  88      42.532 -53.044 -17.435  1.00  0.56           C  
ATOM    653  C   THR A  88      43.069 -52.458 -16.141  1.00  0.56           C  
ATOM    654  O   THR A  88      43.402 -53.170 -15.193  1.00  0.56           O  
ATOM    655  CB  THR A  88      43.639 -53.370 -18.423  1.00  0.56           C  
ATOM    656  OG1 THR A  88      44.557 -54.310 -17.876  1.00  0.56           O  
ATOM    657  CG2 THR A  88      44.378 -52.103 -18.855  1.00  0.56           C  
ATOM    658  N   THR A  89      43.063 -51.115 -15.998  1.00  0.57           N  
ATOM    659  CA  THR A  89      43.259 -50.499 -14.682  1.00  0.57           C  
ATOM    660  C   THR A  89      42.071 -50.742 -13.770  1.00  0.57           C  
ATOM    661  O   THR A  89      42.195 -51.201 -12.631  1.00  0.57           O  
ATOM    662  CB  THR A  89      43.668 -49.039 -14.731  1.00  0.57           C  
ATOM    663  OG1 THR A  89      43.943 -48.583 -13.422  1.00  0.57           O  
ATOM    664  CG2 THR A  89      42.597 -48.130 -15.346  1.00  0.57           C  
ATOM    665  N   THR A  90      40.855 -50.594 -14.338  1.00  0.54           N  
ATOM    666  CA  THR A  90      39.586 -51.002 -13.764  1.00  0.54           C  
ATOM    667  C   THR A  90      39.658 -52.464 -13.414  1.00  0.54           C  
ATOM    668  O   THR A  90      39.351 -52.867 -12.302  1.00  0.54           O  
ATOM    669  CB  THR A  90      38.443 -50.780 -14.747  1.00  0.54           C  
ATOM    670  OG1 THR A  90      38.589 -49.512 -15.363  1.00  0.54           O  
ATOM    671  CG2 THR A  90      37.090 -50.762 -14.040  1.00  0.54           C  
ATOM    672  N   ALA A  91      40.231 -53.296 -14.309  1.00  0.53           N  
ATOM    673  CA  ALA A  91      40.353 -54.716 -14.099  1.00  0.53           C  
ATOM    674  C   ALA A  91      41.201 -55.137 -12.956  1.00  0.53           C  
ATOM    675  O   ALA A  91      41.122 -56.290 -12.581  1.00  0.53           O  
ATOM    676  CB  ALA A  91      40.922 -55.540 -15.262  1.00  0.53           C  
ATOM    677  N   THR A  92      42.030 -54.275 -12.367  1.00  0.59           N  
ATOM    678  CA  THR A  92      42.913 -54.766 -11.324  1.00  0.59           C  
ATOM    679  C   THR A  92      42.589 -54.161  -9.974  1.00  0.59           C  
ATOM    680  O   THR A  92      42.939 -54.717  -8.938  1.00  0.59           O  
ATOM    681  CB  THR A  92      44.353 -54.553 -11.708  1.00  0.59           C  
ATOM    682  OG1 THR A  92      44.599 -54.940 -13.057  1.00  0.59           O  
ATOM    683  CG2 THR A  92      45.250 -55.469 -10.887  1.00  0.59           C  
ATOM    684  N   ILE A  93      41.796 -53.066  -9.905  1.00  0.58           N  
ATOM    685  CA  ILE A  93      41.168 -52.700  -8.634  1.00  0.58           C  
ATOM    686  C   ILE A  93      39.887 -53.446  -8.471  1.00  0.58           C  
ATOM    687  O   ILE A  93      39.374 -53.586  -7.373  1.00  0.58           O  
ATOM    688  CB  ILE A  93      40.881 -51.221  -8.419  1.00  0.58           C  
ATOM    689  CG1 ILE A  93      39.648 -50.622  -9.134  1.00  0.58           C  
ATOM    690  CG2 ILE A  93      42.154 -50.507  -8.843  1.00  0.58           C  
ATOM    691  CD1 ILE A  93      39.147 -49.346  -8.450  1.00  0.58           C  
ATOM    692  N   LEU A  94      39.345 -53.962  -9.585  1.00  0.42           N  
ATOM    693  CA  LEU A  94      38.113 -54.696  -9.584  1.00  0.42           C  
ATOM    694  C   LEU A  94      38.386 -56.197  -9.815  1.00  0.42           C  
ATOM    695  O   LEU A  94      37.719 -57.052  -9.268  1.00  0.42           O  
ATOM    696  CB  LEU A  94      37.085 -53.929 -10.457  1.00  0.42           C  
ATOM    697  CG  LEU A  94      36.518 -52.666  -9.762  1.00  0.42           C  
ATOM    698  CD1 LEU A  94      36.611 -51.480 -10.714  1.00  0.42           C  
ATOM    699  CD2 LEU A  94      35.056 -52.800  -9.316  1.00  0.42           C  
ATOM    700  N   ALA A  95      39.539 -56.639 -10.369  1.00  0.45           N  
ATOM    701  CA  ALA A  95      40.067 -57.957  -9.998  1.00  0.45           C  
ATOM    702  C   ALA A  95      40.912 -57.772  -8.753  1.00  0.45           C  
ATOM    703  O   ALA A  95      41.721 -58.604  -8.352  1.00  0.45           O  
ATOM    704  CB  ALA A  95      40.799 -58.717 -11.104  1.00  0.45           C  
ATOM    705  N   GLN A  96      40.555 -56.697  -8.032  1.00  0.36           N  
ATOM    706  CA  GLN A  96      40.392 -56.649  -6.623  1.00  0.36           C  
ATOM    707  C   GLN A  96      38.940 -56.206  -6.160  1.00  0.36           C  
ATOM    708  O   GLN A  96      38.958 -55.398  -5.281  1.00  0.36           O  
ATOM    709  CB  GLN A  96      41.599 -55.816  -6.083  1.00  0.36           C  
ATOM    710  CG  GLN A  96      42.109 -56.034  -4.627  1.00  0.36           C  
ATOM    711  CD  GLN A  96      42.427 -57.491  -4.273  1.00  0.36           C  
ATOM    712  OE1 GLN A  96      41.515 -58.306  -4.187  1.00  0.36           O  
ATOM    713  NE2 GLN A  96      43.695 -57.868  -4.016  1.00  0.36           N  
ATOM    714  N   ALA A  97      37.679 -56.707  -6.573  1.00  0.27           N  
ATOM    715  CA  ALA A  97      36.311 -56.862  -5.834  1.00  0.27           C  
ATOM    716  C   ALA A  97      35.356 -58.234  -5.389  1.00  0.27           C  
ATOM    717  O   ALA A  97      34.211 -57.901  -5.079  1.00  0.27           O  
ATOM    718  CB  ALA A  97      35.508 -55.560  -6.072  1.00  0.27           C  
ATOM    719  N   LEU A  98      35.318 -59.706  -5.204  1.00  0.41           N  
ATOM    720  CA  LEU A  98      35.848 -61.235  -5.312  1.00  0.41           C  
ATOM    721  C   LEU A  98      36.907 -62.155  -4.551  1.00  0.41           C  
ATOM    722  O   LEU A  98      36.526 -63.301  -4.269  1.00  0.41           O  
ATOM    723  CB  LEU A  98      35.812 -62.097  -6.673  1.00  0.41           C  
ATOM    724  CG  LEU A  98      34.740 -63.199  -6.916  1.00  0.41           C  
ATOM    725  CD1 LEU A  98      35.263 -64.638  -6.824  1.00  0.41           C  
ATOM    726  CD2 LEU A  98      33.422 -62.962  -6.184  1.00  0.41           C  
ATOM    727  N   ILE A  99      38.207 -61.902  -4.245  1.00  0.44           N  
ATOM    728  CA  ILE A  99      39.071 -62.729  -3.433  1.00  0.44           C  
ATOM    729  C   ILE A  99      39.106 -62.189  -2.007  1.00  0.44           C  
ATOM    730  O   ILE A  99      39.378 -62.957  -1.100  1.00  0.44           O  
ATOM    731  CB  ILE A  99      40.510 -62.887  -3.976  1.00  0.44           C  
ATOM    732  CG1 ILE A  99      41.049 -64.323  -3.836  1.00  0.44           C  
ATOM    733  CG2 ILE A  99      41.544 -61.955  -3.293  1.00  0.44           C  
ATOM    734  CD1 ILE A  99      40.433 -65.315  -4.822  1.00  0.44           C  
ATOM    735  N   LYS A 100      38.721 -60.896  -1.771  1.00  0.38           N  
ATOM    736  CA  LYS A 100      38.862 -60.015  -0.607  1.00  0.38           C  
ATOM    737  C   LYS A 100      37.591 -59.341   0.040  1.00  0.38           C  
ATOM    738  O   LYS A 100      37.799 -58.396   0.779  1.00  0.38           O  
ATOM    739  CB  LYS A 100      40.080 -59.079  -0.826  1.00  0.38           C  
ATOM    740  CG  LYS A 100      40.847 -58.680   0.451  1.00  0.38           C  
ATOM    741  CD  LYS A 100      41.647 -57.374   0.298  1.00  0.38           C  
ATOM    742  CE  LYS A 100      42.501 -56.995   1.510  1.00  0.38           C  
ATOM    743  NZ  LYS A 100      41.607 -56.630   2.630  1.00  0.38           N  
ATOM    744  N   GLY A 101      36.299 -59.843  -0.130  1.00  0.29           N  
ATOM    745  CA  GLY A 101      34.970 -59.996   0.685  1.00  0.29           C  
ATOM    746  C   GLY A 101      34.077 -61.358   1.111  1.00  0.29           C  
ATOM    747  O   GLY A 101      32.872 -61.184   1.141  1.00  0.29           O  
ATOM    748  N   GLY A 102      34.459 -62.695   1.479  1.00  0.38           N  
ATOM    749  CA  GLY A 102      34.464 -64.103   0.846  1.00  0.38           C  
ATOM    750  C   GLY A 102      35.536 -65.241   1.048  1.00  0.38           C  
ATOM    751  O   GLY A 102      35.137 -66.348   1.370  1.00  0.38           O  
ATOM    752  N   LEU A 103      36.895 -65.145   0.919  1.00  0.49           N  
ATOM    753  CA  LEU A 103      37.790 -66.194   1.452  1.00  0.49           C  
ATOM    754  C   LEU A 103      37.684 -66.239   2.988  1.00  0.49           C  
ATOM    755  O   LEU A 103      37.861 -67.258   3.636  1.00  0.49           O  
ATOM    756  CB  LEU A 103      39.323 -66.111   1.127  1.00  0.49           C  
ATOM    757  CG  LEU A 103      39.818 -66.139  -0.336  1.00  0.49           C  
ATOM    758  CD1 LEU A 103      41.359 -66.074  -0.357  1.00  0.49           C  
ATOM    759  CD2 LEU A 103      39.386 -67.391  -1.100  1.00  0.49           C  
ATOM    760  N   ARG A 104      37.324 -65.113   3.623  1.00  0.41           N  
ATOM    761  CA  ARG A 104      36.862 -65.029   5.000  1.00  0.41           C  
ATOM    762  C   ARG A 104      35.514 -65.767   5.177  1.00  0.41           C  
ATOM    763  O   ARG A 104      35.244 -66.330   6.228  1.00  0.41           O  
ATOM    764  CB  ARG A 104      36.746 -63.527   5.354  1.00  0.41           C  
ATOM    765  CG  ARG A 104      37.578 -62.849   6.470  1.00  0.41           C  
ATOM    766  CD  ARG A 104      37.323 -61.313   6.456  1.00  0.41           C  
ATOM    767  NE  ARG A 104      38.592 -60.497   6.427  1.00  0.41           N  
ATOM    768  CZ  ARG A 104      38.652 -59.187   6.731  1.00  0.41           C  
ATOM    769  NH1 ARG A 104      37.579 -58.407   6.847  1.00  0.41           N  
ATOM    770  NH2 ARG A 104      39.841 -58.628   6.945  1.00  0.41           N  
ATOM    771  N   LEU A 105      34.627 -65.826   4.137  1.00  0.46           N  
ATOM    772  CA  LEU A 105      33.475 -66.743   4.110  1.00  0.46           C  
ATOM    773  C   LEU A 105      33.949 -68.205   4.124  1.00  0.46           C  
ATOM    774  O   LEU A 105      33.405 -69.007   4.874  1.00  0.46           O  
ATOM    775  CB  LEU A 105      32.412 -66.556   2.951  1.00  0.46           C  
ATOM    776  CG  LEU A 105      31.250 -65.526   3.118  1.00  0.46           C  
ATOM    777  CD1 LEU A 105      31.491 -64.129   2.527  1.00  0.46           C  
ATOM    778  CD2 LEU A 105      29.962 -66.038   2.446  1.00  0.46           C  
ATOM    779  N   VAL A 106      34.998 -68.596   3.354  1.00  0.62           N  
ATOM    780  CA  VAL A 106      35.595 -69.936   3.462  1.00  0.62           C  
ATOM    781  C   VAL A 106      36.266 -70.201   4.810  1.00  0.62           C  
ATOM    782  O   VAL A 106      36.229 -71.314   5.325  1.00  0.62           O  
ATOM    783  CB  VAL A 106      36.457 -70.418   2.275  1.00  0.62           C  
ATOM    784  CG1 VAL A 106      35.835 -69.942   0.951  1.00  0.62           C  
ATOM    785  CG2 VAL A 106      37.953 -70.049   2.331  1.00  0.62           C  
ATOM    786  N   ALA A 107      36.869 -69.171   5.442  1.00  0.60           N  
ATOM    787  CA  ALA A 107      37.346 -69.199   6.818  1.00  0.60           C  
ATOM    788  C   ALA A 107      36.243 -69.424   7.858  1.00  0.60           C  
ATOM    789  O   ALA A 107      36.427 -70.149   8.830  1.00  0.60           O  
ATOM    790  CB  ALA A 107      38.120 -67.906   7.143  1.00  0.60           C  
ATOM    791  N   ALA A 108      35.048 -68.834   7.646  1.00  0.54           N  
ATOM    792  CA  ALA A 108      33.854 -69.081   8.436  1.00  0.54           C  
ATOM    793  C   ALA A 108      33.227 -70.451   8.158  1.00  0.54           C  
ATOM    794  O   ALA A 108      32.382 -70.935   8.908  1.00  0.54           O  
ATOM    795  CB  ALA A 108      32.815 -67.980   8.142  1.00  0.54           C  
ATOM    796  N   GLY A 109      33.647 -71.117   7.063  1.00  0.64           N  
ATOM    797  CA  GLY A 109      33.276 -72.490   6.744  1.00  0.64           C  
ATOM    798  C   GLY A 109      32.303 -72.623   5.611  1.00  0.64           C  
ATOM    799  O   GLY A 109      31.809 -73.713   5.332  1.00  0.64           O  
ATOM    800  N   VAL A 110      31.995 -71.528   4.894  1.00  0.61           N  
ATOM    801  CA  VAL A 110      31.169 -71.593   3.698  1.00  0.61           C  
ATOM    802  C   VAL A 110      31.910 -72.282   2.556  1.00  0.61           C  
ATOM    803  O   VAL A 110      33.074 -72.004   2.276  1.00  0.61           O  
ATOM    804  CB  VAL A 110      30.638 -70.235   3.253  1.00  0.61           C  
ATOM    805  CG1 VAL A 110      29.547 -70.411   2.176  1.00  0.61           C  
ATOM    806  CG2 VAL A 110      30.046 -69.496   4.471  1.00  0.61           C  
ATOM    807  N   ASN A 111      31.245 -73.230   1.863  1.00  0.61           N  
ATOM    808  CA  ASN A 111      31.829 -74.023   0.796  1.00  0.61           C  
ATOM    809  C   ASN A 111      32.351 -73.155  -0.374  1.00  0.61           C  
ATOM    810  O   ASN A 111      31.561 -72.402  -0.947  1.00  0.61           O  
ATOM    811  CB  ASN A 111      30.754 -75.061   0.351  1.00  0.61           C  
ATOM    812  CG  ASN A 111      31.190 -76.018  -0.756  1.00  0.61           C  
ATOM    813  OD1 ASN A 111      32.261 -75.919  -1.351  1.00  0.61           O  
ATOM    814  ND2 ASN A 111      30.300 -76.982  -1.083  1.00  0.61           N  
ATOM    815  N   PRO A 112      33.621 -73.228  -0.808  1.00  0.60           N  
ATOM    816  CA  PRO A 112      34.143 -72.413  -1.902  1.00  0.60           C  
ATOM    817  C   PRO A 112      33.427 -72.634  -3.217  1.00  0.60           C  
ATOM    818  O   PRO A 112      33.311 -71.695  -4.001  1.00  0.60           O  
ATOM    819  CB  PRO A 112      35.627 -72.810  -2.012  1.00  0.60           C  
ATOM    820  CG  PRO A 112      35.995 -73.336  -0.622  1.00  0.60           C  
ATOM    821  CD  PRO A 112      34.690 -73.940  -0.104  1.00  0.60           C  
ATOM    822  N   ILE A 113      32.954 -73.868  -3.478  1.00  0.57           N  
ATOM    823  CA  ILE A 113      32.188 -74.236  -4.660  1.00  0.57           C  
ATOM    824  C   ILE A 113      30.816 -73.581  -4.655  1.00  0.57           C  
ATOM    825  O   ILE A 113      30.334 -73.077  -5.666  1.00  0.57           O  
ATOM    826  CB  ILE A 113      32.030 -75.751  -4.768  1.00  0.57           C  
ATOM    827  CG1 ILE A 113      33.376 -76.500  -4.584  1.00  0.57           C  
ATOM    828  CG2 ILE A 113      31.369 -76.119  -6.115  1.00  0.57           C  
ATOM    829  CD1 ILE A 113      34.480 -76.122  -5.581  1.00  0.57           C  
ATOM    830  N   ALA A 114      30.166 -73.545  -3.476  1.00  0.63           N  
ATOM    831  CA  ALA A 114      28.903 -72.874  -3.246  1.00  0.63           C  
ATOM    832  C   ALA A 114      29.004 -71.365  -3.415  1.00  0.63           C  
ATOM    833  O   ALA A 114      28.191 -70.724  -4.078  1.00  0.63           O  
ATOM    834  CB  ALA A 114      28.409 -73.213  -1.837  1.00  0.63           C  
ATOM    835  N   LEU A 115      30.087 -70.752  -2.891  1.00  0.59           N  
ATOM    836  CA  LEU A 115      30.390 -69.372  -3.211  1.00  0.59           C  
ATOM    837  C   LEU A 115      30.626 -69.185  -4.703  1.00  0.59           C  
ATOM    838  O   LEU A 115      30.043 -68.303  -5.323  1.00  0.59           O  
ATOM    839  CB  LEU A 115      31.668 -68.885  -2.485  1.00  0.59           C  
ATOM    840  CG  LEU A 115      31.645 -68.943  -0.950  1.00  0.59           C  
ATOM    841  CD1 LEU A 115      32.979 -68.441  -0.381  1.00  0.59           C  
ATOM    842  CD2 LEU A 115      30.481 -68.137  -0.371  1.00  0.59           C  
ATOM    843  N   GLY A 116      31.453 -70.062  -5.315  1.00  0.58           N  
ATOM    844  CA  GLY A 116      31.720 -70.153  -6.748  1.00  0.58           C  
ATOM    845  C   GLY A 116      30.509 -70.144  -7.635  1.00  0.58           C  
ATOM    846  O   GLY A 116      30.424 -69.335  -8.552  1.00  0.58           O  
ATOM    847  N   VAL A 117      29.524 -71.027  -7.382  1.00  0.56           N  
ATOM    848  CA  VAL A 117      28.258 -71.018  -8.099  1.00  0.56           C  
ATOM    849  C   VAL A 117      27.437 -69.775  -7.829  1.00  0.56           C  
ATOM    850  O   VAL A 117      26.872 -69.210  -8.755  1.00  0.56           O  
ATOM    851  CB  VAL A 117      27.437 -72.296  -7.947  1.00  0.56           C  
ATOM    852  CG1 VAL A 117      26.750 -72.392  -6.575  1.00  0.56           C  
ATOM    853  CG2 VAL A 117      26.404 -72.374  -9.091  1.00  0.56           C  
ATOM    854  N   GLY A 118      27.391 -69.252  -6.581  1.00  0.65           N  
ATOM    855  CA  GLY A 118      26.700 -68.000  -6.284  1.00  0.65           C  
ATOM    856  C   GLY A 118      27.219 -66.814  -7.058  1.00  0.65           C  
ATOM    857  O   GLY A 118      26.448 -65.961  -7.476  1.00  0.65           O  
ATOM    858  N   ILE A 119      28.541 -66.759  -7.315  1.00  0.53           N  
ATOM    859  CA  ILE A 119      29.180 -65.733  -8.134  1.00  0.53           C  
ATOM    860  C   ILE A 119      29.095 -66.041  -9.600  1.00  0.53           C  
ATOM    861  O   ILE A 119      28.837 -65.158 -10.402  1.00  0.53           O  
ATOM    862  CB  ILE A 119      30.657 -65.537  -7.854  1.00  0.53           C  
ATOM    863  CG1 ILE A 119      30.894 -65.386  -6.341  1.00  0.53           C  
ATOM    864  CG2 ILE A 119      31.222 -64.342  -8.672  1.00  0.53           C  
ATOM    865  CD1 ILE A 119      32.073 -66.254  -5.919  1.00  0.53           C  
ATOM    866  N   GLY A 120      29.320 -67.301 -10.026  1.00  0.56           N  
ATOM    867  CA  GLY A 120      29.268 -67.652 -11.442  1.00  0.56           C  
ATOM    868  C   GLY A 120      27.884 -67.495 -11.974  1.00  0.56           C  
ATOM    869  O   GLY A 120      27.672 -66.921 -13.038  1.00  0.56           O  
ATOM    870  N   LYS A 121      26.896 -67.885 -11.152  1.00  0.58           N  
ATOM    871  CA  LYS A 121      25.528 -67.525 -11.371  1.00  0.58           C  
ATOM    872  C   LYS A 121      25.303 -66.035 -11.264  1.00  0.58           C  
ATOM    873  O   LYS A 121      24.649 -65.502 -12.145  1.00  0.58           O  
ATOM    874  CB  LYS A 121      24.557 -68.304 -10.457  1.00  0.58           C  
ATOM    875  CG  LYS A 121      23.082 -68.161 -10.872  1.00  0.58           C  
ATOM    876  CD  LYS A 121      22.725 -68.847 -12.210  1.00  0.58           C  
ATOM    877  CE  LYS A 121      21.558 -68.224 -12.993  1.00  0.58           C  
ATOM    878  NZ  LYS A 121      21.895 -66.851 -13.415  1.00  0.58           N  
ATOM    879  N   ALA A 122      25.860 -65.304 -10.264  1.00  0.67           N  
ATOM    880  CA  ALA A 122      25.811 -63.849 -10.202  1.00  0.67           C  
ATOM    881  C   ALA A 122      26.630 -63.096 -11.269  1.00  0.67           C  
ATOM    882  O   ALA A 122      26.643 -61.871 -11.273  1.00  0.67           O  
ATOM    883  CB  ALA A 122      26.190 -63.285  -8.819  1.00  0.67           C  
ATOM    884  N   ALA A 123      27.285 -63.775 -12.231  1.00  0.58           N  
ATOM    885  CA  ALA A 123      28.075 -63.146 -13.270  1.00  0.58           C  
ATOM    886  C   ALA A 123      27.635 -63.573 -14.666  1.00  0.58           C  
ATOM    887  O   ALA A 123      27.831 -62.819 -15.614  1.00  0.58           O  
ATOM    888  CB  ALA A 123      29.576 -63.403 -13.041  1.00  0.58           C  
ATOM    889  N   ASP A 124      26.926 -64.721 -14.843  1.00  0.55           N  
ATOM    890  CA  ASP A 124      25.980 -64.849 -15.947  1.00  0.55           C  
ATOM    891  C   ASP A 124      24.799 -63.935 -15.673  1.00  0.55           C  
ATOM    892  O   ASP A 124      24.274 -63.259 -16.546  1.00  0.55           O  
ATOM    893  CB  ASP A 124      25.598 -66.321 -16.291  1.00  0.55           C  
ATOM    894  CG  ASP A 124      24.533 -66.954 -15.418  1.00  0.55           C  
ATOM    895  OD1 ASP A 124      23.355 -66.515 -15.489  1.00  0.55           O  
ATOM    896  OD2 ASP A 124      24.833 -67.898 -14.657  1.00  0.55           O  
ATOM    897  N   ALA A 125      24.425 -63.808 -14.389  1.00  0.48           N  
ATOM    898  CA  ALA A 125      23.509 -62.814 -13.905  1.00  0.48           C  
ATOM    899  C   ALA A 125      23.992 -61.438 -14.206  1.00  0.48           C  
ATOM    900  O   ALA A 125      23.249 -60.658 -14.749  1.00  0.48           O  
ATOM    901  CB  ALA A 125      23.376 -62.895 -12.399  1.00  0.48           C  
ATOM    902  N   VAL A 126      25.260 -61.068 -13.999  1.00  0.55           N  
ATOM    903  CA  VAL A 126      25.717 -59.845 -14.632  1.00  0.55           C  
ATOM    904  C   VAL A 126      25.960 -60.042 -16.153  1.00  0.55           C  
ATOM    905  O   VAL A 126      27.065 -59.893 -16.674  1.00  0.55           O  
ATOM    906  CB  VAL A 126      26.750 -59.105 -13.791  1.00  0.55           C  
ATOM    907  CG1 VAL A 126      27.032 -57.718 -14.368  1.00  0.55           C  
ATOM    908  CG2 VAL A 126      26.118 -58.848 -12.406  1.00  0.55           C  
ATOM    909  N   SER A 127      24.826 -60.293 -16.885  1.00  0.45           N  
ATOM    910  CA  SER A 127      24.575 -60.174 -18.328  1.00  0.45           C  
ATOM    911  C   SER A 127      23.165 -59.651 -18.817  1.00  0.45           C  
ATOM    912  O   SER A 127      23.014 -59.341 -19.997  1.00  0.45           O  
ATOM    913  CB  SER A 127      25.114 -61.324 -19.188  1.00  0.45           C  
ATOM    914  OG  SER A 127      24.358 -62.517 -19.063  1.00  0.45           O  
ATOM    915  N   GLU A 128      22.177 -59.372 -17.890  1.00  0.32           N  
ATOM    916  CA  GLU A 128      20.805 -58.735 -17.926  1.00  0.32           C  
ATOM    917  C   GLU A 128      20.040 -57.365 -17.124  1.00  0.32           C  
ATOM    918  O   GLU A 128      18.829 -57.385 -17.266  1.00  0.32           O  
ATOM    919  CB  GLU A 128      19.998 -60.002 -17.497  1.00  0.32           C  
ATOM    920  CG  GLU A 128      20.527 -61.455 -17.809  1.00  0.32           C  
ATOM    921  CD  GLU A 128      20.193 -61.970 -19.207  1.00  0.32           C  
ATOM    922  OE1 GLU A 128      19.213 -62.757 -19.303  1.00  0.32           O  
ATOM    923  OE2 GLU A 128      20.821 -61.539 -20.200  1.00  0.32           O  
ATOM    924  N   ALA A 129      20.327 -56.075 -16.394  1.00  0.26           N  
ATOM    925  CA  ALA A 129      21.203 -54.916 -15.683  1.00  0.26           C  
ATOM    926  C   ALA A 129      22.724 -54.203 -15.992  1.00  0.26           C  
ATOM    927  O   ALA A 129      23.429 -53.836 -15.019  1.00  0.26           O  
ATOM    928  CB  ALA A 129      20.840 -54.527 -14.220  1.00  0.26           C  
ATOM    929  N   LEU A 130      23.232 -53.855 -17.276  1.00  0.31           N  
ATOM    930  CA  LEU A 130      24.221 -53.237 -18.203  1.00  0.31           C  
ATOM    931  C   LEU A 130      23.616 -53.214 -19.705  1.00  0.31           C  
ATOM    932  O   LEU A 130      22.960 -52.260 -20.107  1.00  0.31           O  
ATOM    933  CB  LEU A 130      25.597 -53.909 -18.311  1.00  0.31           C  
ATOM    934  CG  LEU A 130      26.796 -53.237 -19.004  1.00  0.31           C  
ATOM    935  CD1 LEU A 130      27.457 -52.235 -18.074  1.00  0.31           C  
ATOM    936  CD2 LEU A 130      27.836 -54.308 -19.400  1.00  0.31           C  
ATOM    937  N   LEU A 131      23.766 -54.320 -20.540  1.00  0.30           N  
ATOM    938  CA  LEU A 131      23.393 -54.627 -21.966  1.00  0.30           C  
ATOM    939  C   LEU A 131      22.369 -53.763 -22.661  1.00  0.30           C  
ATOM    940  O   LEU A 131      22.674 -53.181 -23.693  1.00  0.30           O  
ATOM    941  CB  LEU A 131      22.974 -56.138 -22.231  1.00  0.30           C  
ATOM    942  CG  LEU A 131      22.568 -56.668 -23.654  1.00  0.30           C  
ATOM    943  CD1 LEU A 131      22.410 -58.198 -23.562  1.00  0.30           C  
ATOM    944  CD2 LEU A 131      21.247 -56.157 -24.271  1.00  0.30           C  
ATOM    945  N   ALA A 132      21.122 -53.708 -22.166  1.00  0.28           N  
ATOM    946  CA  ALA A 132      20.029 -53.050 -22.856  1.00  0.28           C  
ATOM    947  C   ALA A 132      19.744 -51.657 -22.327  1.00  0.28           C  
ATOM    948  O   ALA A 132      18.950 -50.956 -22.931  1.00  0.28           O  
ATOM    949  CB  ALA A 132      18.749 -53.931 -22.758  1.00  0.28           C  
ATOM    950  N   SER A 133      20.360 -51.189 -21.215  1.00  0.28           N  
ATOM    951  CA  SER A 133      20.297 -49.764 -20.850  1.00  0.28           C  
ATOM    952  C   SER A 133      21.533 -49.102 -21.426  1.00  0.28           C  
ATOM    953  O   SER A 133      21.659 -47.897 -21.620  1.00  0.28           O  
ATOM    954  CB  SER A 133      20.208 -49.586 -19.316  1.00  0.28           C  
ATOM    955  OG  SER A 133      20.050 -48.230 -18.910  1.00  0.28           O  
ATOM    956  N   ALA A 134      22.464 -49.966 -21.845  1.00  0.38           N  
ATOM    957  CA  ALA A 134      23.259 -49.789 -23.015  1.00  0.38           C  
ATOM    958  C   ALA A 134      22.401 -49.821 -24.298  1.00  0.38           C  
ATOM    959  O   ALA A 134      21.476 -50.604 -24.476  1.00  0.38           O  
ATOM    960  CB  ALA A 134      24.371 -50.846 -22.932  1.00  0.38           C  
ATOM    961  N   THR A 135      22.656 -48.874 -25.208  1.00  0.31           N  
ATOM    962  CA  THR A 135      21.662 -48.312 -26.107  1.00  0.31           C  
ATOM    963  C   THR A 135      22.311 -47.862 -27.421  1.00  0.31           C  
ATOM    964  O   THR A 135      23.418 -47.376 -27.326  1.00  0.31           O  
ATOM    965  CB  THR A 135      21.007 -47.158 -25.371  1.00  0.31           C  
ATOM    966  OG1 THR A 135      20.015 -46.515 -26.149  1.00  0.31           O  
ATOM    967  CG2 THR A 135      21.960 -46.105 -24.796  1.00  0.31           C  
ATOM    968  N   PRO A 136      21.845 -47.985 -28.656  1.00  0.34           N  
ATOM    969  CA  PRO A 136      22.707 -47.927 -29.864  1.00  0.34           C  
ATOM    970  C   PRO A 136      23.590 -46.685 -30.141  1.00  0.34           C  
ATOM    971  O   PRO A 136      23.047 -45.599 -30.301  1.00  0.34           O  
ATOM    972  CB  PRO A 136      21.696 -48.123 -31.004  1.00  0.34           C  
ATOM    973  CG  PRO A 136      20.594 -48.972 -30.364  1.00  0.34           C  
ATOM    974  CD  PRO A 136      20.473 -48.374 -28.967  1.00  0.34           C  
ATOM    975  N   VAL A 137      24.947 -46.787 -30.287  1.00  0.41           N  
ATOM    976  CA  VAL A 137      25.771 -45.609 -30.628  1.00  0.41           C  
ATOM    977  C   VAL A 137      25.581 -45.010 -32.012  1.00  0.41           C  
ATOM    978  O   VAL A 137      25.550 -45.699 -33.032  1.00  0.41           O  
ATOM    979  CB  VAL A 137      27.274 -45.694 -30.264  1.00  0.41           C  
ATOM    980  CG1 VAL A 137      28.292 -45.284 -31.362  1.00  0.41           C  
ATOM    981  CG2 VAL A 137      27.542 -44.796 -29.045  1.00  0.41           C  
ATOM    982  N   SER A 138      25.519 -43.666 -32.050  1.00  0.55           N  
ATOM    983  CA  SER A 138      25.688 -42.823 -33.214  1.00  0.55           C  
ATOM    984  C   SER A 138      26.038 -41.422 -32.711  1.00  0.55           C  
ATOM    985  O   SER A 138      26.147 -41.202 -31.513  1.00  0.55           O  
ATOM    986  CB  SER A 138      24.468 -42.817 -34.174  1.00  0.55           C  
ATOM    987  OG  SER A 138      23.307 -42.241 -33.581  1.00  0.55           O  
ATOM    988  N   GLY A 139      26.283 -40.430 -33.600  1.00  0.60           N  
ATOM    989  CA  GLY A 139      26.458 -39.035 -33.178  1.00  0.60           C  
ATOM    990  C   GLY A 139      27.858 -38.650 -32.751  1.00  0.60           C  
ATOM    991  O   GLY A 139      28.488 -39.264 -31.900  1.00  0.60           O  
ATOM    992  N   LYS A 140      28.406 -37.554 -33.324  1.00  0.59           N  
ATOM    993  CA  LYS A 140      29.771 -37.131 -33.038  1.00  0.59           C  
ATOM    994  C   LYS A 140      30.035 -36.725 -31.592  1.00  0.59           C  
ATOM    995  O   LYS A 140      31.128 -36.941 -31.074  1.00  0.59           O  
ATOM    996  CB  LYS A 140      30.277 -36.001 -33.985  1.00  0.59           C  
ATOM    997  CG  LYS A 140      29.628 -34.610 -33.821  1.00  0.59           C  
ATOM    998  CD  LYS A 140      30.576 -33.478 -34.267  1.00  0.59           C  
ATOM    999  CE  LYS A 140      30.167 -32.092 -33.749  1.00  0.59           C  
ATOM   1000  NZ  LYS A 140      31.258 -31.110 -33.967  1.00  0.59           N  
ATOM   1001  N   THR A 141      29.046 -36.092 -30.914  1.00  0.59           N  
ATOM   1002  CA  THR A 141      29.258 -35.436 -29.621  1.00  0.59           C  
ATOM   1003  C   THR A 141      29.656 -36.412 -28.535  1.00  0.59           C  
ATOM   1004  O   THR A 141      30.630 -36.198 -27.820  1.00  0.59           O  
ATOM   1005  CB  THR A 141      28.099 -34.530 -29.173  1.00  0.59           C  
ATOM   1006  OG1 THR A 141      28.420 -33.787 -28.009  1.00  0.59           O  
ATOM   1007  CG2 THR A 141      26.807 -35.292 -28.869  1.00  0.59           C  
ATOM   1008  N   GLY A 142      28.975 -37.566 -28.417  1.00  0.54           N  
ATOM   1009  CA  GLY A 142      29.362 -38.557 -27.439  1.00  0.54           C  
ATOM   1010  C   GLY A 142      30.427 -39.516 -27.869  1.00  0.54           C  
ATOM   1011  O   GLY A 142      31.122 -40.051 -27.019  1.00  0.54           O  
ATOM   1012  N   ILE A 143      30.677 -39.719 -29.179  1.00  0.55           N  
ATOM   1013  CA  ILE A 143      31.884 -40.425 -29.621  1.00  0.55           C  
ATOM   1014  C   ILE A 143      33.120 -39.645 -29.179  1.00  0.55           C  
ATOM   1015  O   ILE A 143      34.093 -40.199 -28.664  1.00  0.55           O  
ATOM   1016  CB  ILE A 143      31.892 -40.702 -31.124  1.00  0.55           C  
ATOM   1017  CG1 ILE A 143      30.712 -41.634 -31.497  1.00  0.55           C  
ATOM   1018  CG2 ILE A 143      33.236 -41.350 -31.540  1.00  0.55           C  
ATOM   1019  CD1 ILE A 143      30.470 -41.734 -33.009  1.00  0.55           C  
ATOM   1020  N   ALA A 144      33.060 -38.300 -29.276  1.00  0.63           N  
ATOM   1021  CA  ALA A 144      34.008 -37.451 -28.596  1.00  0.63           C  
ATOM   1022  C   ALA A 144      33.963 -37.555 -27.069  1.00  0.63           C  
ATOM   1023  O   ALA A 144      35.012 -37.758 -26.471  1.00  0.63           O  
ATOM   1024  CB  ALA A 144      33.840 -35.993 -29.052  1.00  0.63           C  
ATOM   1025  N   GLN A 145      32.780 -37.518 -26.395  1.00  0.54           N  
ATOM   1026  CA  GLN A 145      32.673 -37.656 -24.934  1.00  0.54           C  
ATOM   1027  C   GLN A 145      33.284 -38.933 -24.394  1.00  0.54           C  
ATOM   1028  O   GLN A 145      33.906 -38.938 -23.338  1.00  0.54           O  
ATOM   1029  CB  GLN A 145      31.222 -37.668 -24.363  1.00  0.54           C  
ATOM   1030  CG  GLN A 145      30.430 -36.343 -24.466  1.00  0.54           C  
ATOM   1031  CD  GLN A 145      28.949 -36.565 -24.117  1.00  0.54           C  
ATOM   1032  OE1 GLN A 145      28.599 -36.829 -22.966  1.00  0.54           O  
ATOM   1033  NE2 GLN A 145      28.065 -36.464 -25.134  1.00  0.54           N  
ATOM   1034  N   VAL A 146      33.126 -40.082 -25.073  1.00  0.57           N  
ATOM   1035  CA  VAL A 146      33.767 -41.290 -24.593  1.00  0.57           C  
ATOM   1036  C   VAL A 146      35.244 -41.260 -24.675  1.00  0.57           C  
ATOM   1037  O   VAL A 146      35.918 -41.648 -23.735  1.00  0.57           O  
ATOM   1038  CB  VAL A 146      33.288 -42.577 -25.176  1.00  0.57           C  
ATOM   1039  CG1 VAL A 146      31.790 -42.509 -24.966  1.00  0.57           C  
ATOM   1040  CG2 VAL A 146      33.671 -42.828 -26.648  1.00  0.57           C  
ATOM   1041  N   ALA A 147      35.793 -40.748 -25.782  1.00  0.67           N  
ATOM   1042  CA  ALA A 147      37.198 -40.553 -25.949  1.00  0.67           C  
ATOM   1043  C   ALA A 147      37.718 -39.538 -24.942  1.00  0.67           C  
ATOM   1044  O   ALA A 147      38.781 -39.730 -24.360  1.00  0.67           O  
ATOM   1045  CB  ALA A 147      37.434 -40.192 -27.413  1.00  0.67           C  
ATOM   1046  N   THR A 148      36.939 -38.476 -24.644  1.00  0.64           N  
ATOM   1047  CA  THR A 148      37.234 -37.578 -23.537  1.00  0.64           C  
ATOM   1048  C   THR A 148      37.144 -38.159 -22.136  1.00  0.64           C  
ATOM   1049  O   THR A 148      37.997 -37.839 -21.324  1.00  0.64           O  
ATOM   1050  CB  THR A 148      36.598 -36.184 -23.537  1.00  0.64           C  
ATOM   1051  OG1 THR A 148      35.218 -36.184 -23.211  1.00  0.64           O  
ATOM   1052  CG2 THR A 148      36.737 -35.496 -24.902  1.00  0.64           C  
ATOM   1053  N   VAL A 149      36.168 -39.012 -21.751  1.00  0.58           N  
ATOM   1054  CA  VAL A 149      36.236 -39.698 -20.451  1.00  0.58           C  
ATOM   1055  C   VAL A 149      37.320 -40.764 -20.394  1.00  0.58           C  
ATOM   1056  O   VAL A 149      38.010 -40.905 -19.390  1.00  0.58           O  
ATOM   1057  CB  VAL A 149      34.924 -40.259 -19.891  1.00  0.58           C  
ATOM   1058  CG1 VAL A 149      33.883 -39.128 -19.819  1.00  0.58           C  
ATOM   1059  CG2 VAL A 149      34.387 -41.459 -20.691  1.00  0.58           C  
ATOM   1060  N   SER A 150      37.504 -41.520 -21.496  1.00  0.66           N  
ATOM   1061  CA  SER A 150      38.489 -42.575 -21.698  1.00  0.66           C  
ATOM   1062  C   SER A 150      39.898 -42.057 -21.612  1.00  0.66           C  
ATOM   1063  O   SER A 150      40.673 -42.512 -20.791  1.00  0.66           O  
ATOM   1064  CB  SER A 150      38.242 -43.195 -23.100  1.00  0.66           C  
ATOM   1065  OG  SER A 150      39.190 -44.160 -23.510  1.00  0.66           O  
ATOM   1066  N   SER A 151      40.237 -40.989 -22.357  1.00  0.62           N  
ATOM   1067  CA  SER A 151      41.557 -40.375 -22.286  1.00  0.62           C  
ATOM   1068  C   SER A 151      41.511 -39.245 -21.327  1.00  0.62           C  
ATOM   1069  O   SER A 151      42.431 -38.455 -21.322  1.00  0.62           O  
ATOM   1070  CB  SER A 151      42.072 -39.748 -23.623  1.00  0.62           C  
ATOM   1071  OG  SER A 151      43.148 -40.498 -24.178  1.00  0.62           O  
ATOM   1072  N   ARG A 152      40.443 -39.085 -20.520  1.00  0.43           N  
ATOM   1073  CA  ARG A 152      40.311 -38.080 -19.478  1.00  0.43           C  
ATOM   1074  C   ARG A 152      40.668 -36.627 -19.940  1.00  0.43           C  
ATOM   1075  O   ARG A 152      41.091 -35.784 -19.153  1.00  0.43           O  
ATOM   1076  CB  ARG A 152      40.961 -38.637 -18.159  1.00  0.43           C  
ATOM   1077  CG  ARG A 152      41.086 -40.193 -18.098  1.00  0.43           C  
ATOM   1078  CD  ARG A 152      41.588 -40.756 -16.755  1.00  0.43           C  
ATOM   1079  NE  ARG A 152      42.821 -41.598 -16.910  1.00  0.43           N  
ATOM   1080  CZ  ARG A 152      44.038 -41.312 -16.440  1.00  0.43           C  
ATOM   1081  NH1 ARG A 152      44.251 -40.387 -15.523  1.00  0.43           N  
ATOM   1082  NH2 ARG A 152      45.091 -42.023 -16.829  1.00  0.43           N  
ATOM   1083  N   ASP A 153      40.509 -36.335 -21.262  1.00  0.48           N  
ATOM   1084  CA  ASP A 153      41.149 -35.249 -21.999  1.00  0.48           C  
ATOM   1085  C   ASP A 153      40.255 -34.755 -23.120  1.00  0.48           C  
ATOM   1086  O   ASP A 153      39.597 -35.529 -23.800  1.00  0.48           O  
ATOM   1087  CB  ASP A 153      42.449 -35.735 -22.720  1.00  0.48           C  
ATOM   1088  CG  ASP A 153      43.144 -34.622 -23.484  1.00  0.48           C  
ATOM   1089  OD1 ASP A 153      43.474 -33.600 -22.834  1.00  0.48           O  
ATOM   1090  OD2 ASP A 153      43.255 -34.722 -24.739  1.00  0.48           O  
ATOM   1091  N   GLU A 154      40.268 -33.443 -23.389  1.00  0.52           N  
ATOM   1092  CA  GLU A 154      39.545 -32.839 -24.486  1.00  0.52           C  
ATOM   1093  C   GLU A 154      40.063 -33.107 -25.915  1.00  0.52           C  
ATOM   1094  O   GLU A 154      39.277 -33.430 -26.806  1.00  0.52           O  
ATOM   1095  CB  GLU A 154      39.423 -31.318 -24.196  1.00  0.52           C  
ATOM   1096  CG  GLU A 154      40.779 -30.568 -24.111  1.00  0.52           C  
ATOM   1097  CD  GLU A 154      40.711 -29.277 -23.293  1.00  0.52           C  
ATOM   1098  OE1 GLU A 154      39.776 -28.466 -23.455  1.00  0.52           O  
ATOM   1099  OE2 GLU A 154      41.632 -29.078 -22.459  1.00  0.52           O  
ATOM   1100  N   GLN A 155      41.385 -33.003 -26.200  1.00  0.58           N  
ATOM   1101  CA  GLN A 155      41.891 -32.878 -27.567  1.00  0.58           C  
ATOM   1102  C   GLN A 155      41.739 -34.111 -28.437  1.00  0.58           C  
ATOM   1103  O   GLN A 155      41.382 -34.034 -29.613  1.00  0.58           O  
ATOM   1104  CB  GLN A 155      43.391 -32.482 -27.635  1.00  0.58           C  
ATOM   1105  CG  GLN A 155      43.744 -31.120 -26.980  1.00  0.58           C  
ATOM   1106  CD  GLN A 155      44.579 -31.168 -25.693  1.00  0.58           C  
ATOM   1107  OE1 GLN A 155      45.178 -30.166 -25.288  1.00  0.58           O  
ATOM   1108  NE2 GLN A 155      44.640 -32.325 -25.010  1.00  0.58           N  
ATOM   1109  N   ILE A 156      42.019 -35.306 -27.887  1.00  0.70           N  
ATOM   1110  CA  ILE A 156      41.986 -36.519 -28.693  1.00  0.70           C  
ATOM   1111  C   ILE A 156      40.566 -36.967 -28.991  1.00  0.70           C  
ATOM   1112  O   ILE A 156      40.322 -37.722 -29.931  1.00  0.70           O  
ATOM   1113  CB  ILE A 156      42.787 -37.669 -28.088  1.00  0.70           C  
ATOM   1114  CG1 ILE A 156      42.138 -38.270 -26.824  1.00  0.70           C  
ATOM   1115  CG2 ILE A 156      44.225 -37.179 -27.807  1.00  0.70           C  
ATOM   1116  CD1 ILE A 156      41.292 -39.516 -27.128  1.00  0.70           C  
ATOM   1117  N   GLY A 157      39.571 -36.485 -28.212  1.00  0.71           N  
ATOM   1118  CA  GLY A 157      38.187 -36.900 -28.382  1.00  0.71           C  
ATOM   1119  C   GLY A 157      37.551 -36.322 -29.600  1.00  0.71           C  
ATOM   1120  O   GLY A 157      36.896 -37.027 -30.365  1.00  0.71           O  
ATOM   1121  N   ASP A 158      37.797 -35.026 -29.853  1.00  0.66           N  
ATOM   1122  CA  ASP A 158      37.394 -34.382 -31.083  1.00  0.66           C  
ATOM   1123  C   ASP A 158      38.126 -34.998 -32.282  1.00  0.66           C  
ATOM   1124  O   ASP A 158      37.531 -35.290 -33.311  1.00  0.66           O  
ATOM   1125  CB  ASP A 158      37.618 -32.852 -30.951  1.00  0.66           C  
ATOM   1126  CG  ASP A 158      36.519 -32.029 -31.619  1.00  0.66           C  
ATOM   1127  OD1 ASP A 158      35.465 -32.592 -32.020  1.00  0.66           O  
ATOM   1128  OD2 ASP A 158      36.716 -30.790 -31.691  1.00  0.66           O  
ATOM   1129  N   LEU A 159      39.435 -35.317 -32.136  1.00  0.70           N  
ATOM   1130  CA  LEU A 159      40.240 -35.973 -33.162  1.00  0.70           C  
ATOM   1131  C   LEU A 159      39.703 -37.333 -33.627  1.00  0.70           C  
ATOM   1132  O   LEU A 159      39.582 -37.589 -34.825  1.00  0.70           O  
ATOM   1133  CB  LEU A 159      41.683 -36.175 -32.624  1.00  0.70           C  
ATOM   1134  CG  LEU A 159      42.738 -36.640 -33.650  1.00  0.70           C  
ATOM   1135  CD1 LEU A 159      43.177 -35.490 -34.562  1.00  0.70           C  
ATOM   1136  CD2 LEU A 159      43.965 -37.223 -32.934  1.00  0.70           C  
ATOM   1137  N   VAL A 160      39.322 -38.247 -32.704  1.00  0.61           N  
ATOM   1138  CA  VAL A 160      38.709 -39.519 -33.087  1.00  0.61           C  
ATOM   1139  C   VAL A 160      37.280 -39.369 -33.592  1.00  0.61           C  
ATOM   1140  O   VAL A 160      36.852 -40.103 -34.484  1.00  0.61           O  
ATOM   1141  CB  VAL A 160      38.797 -40.630 -32.043  1.00  0.61           C  
ATOM   1142  CG1 VAL A 160      40.278 -40.880 -31.694  1.00  0.61           C  
ATOM   1143  CG2 VAL A 160      37.978 -40.309 -30.784  1.00  0.61           C  
ATOM   1144  N   GLY A 161      36.511 -38.381 -33.076  1.00  0.65           N  
ATOM   1145  CA  GLY A 161      35.176 -38.066 -33.581  1.00  0.65           C  
ATOM   1146  C   GLY A 161      35.195 -37.489 -34.979  1.00  0.65           C  
ATOM   1147  O   GLY A 161      34.364 -37.833 -35.819  1.00  0.65           O  
ATOM   1148  N   GLU A 162      36.196 -36.639 -35.285  1.00  0.66           N  
ATOM   1149  CA  GLU A 162      36.553 -36.191 -36.620  1.00  0.66           C  
ATOM   1150  C   GLU A 162      36.953 -37.348 -37.514  1.00  0.66           C  
ATOM   1151  O   GLU A 162      36.442 -37.472 -38.624  1.00  0.66           O  
ATOM   1152  CB  GLU A 162      37.739 -35.191 -36.552  1.00  0.66           C  
ATOM   1153  CG  GLU A 162      37.336 -33.697 -36.565  1.00  0.66           C  
ATOM   1154  CD  GLU A 162      37.279 -33.160 -37.979  1.00  0.66           C  
ATOM   1155  OE1 GLU A 162      38.180 -33.487 -38.803  1.00  0.66           O  
ATOM   1156  OE2 GLU A 162      36.258 -32.540 -38.380  1.00  0.66           O  
ATOM   1157  N   ALA A 163      37.835 -38.255 -37.042  1.00  0.67           N  
ATOM   1158  CA  ALA A 163      38.302 -39.394 -37.809  1.00  0.67           C  
ATOM   1159  C   ALA A 163      37.204 -40.367 -38.207  1.00  0.67           C  
ATOM   1160  O   ALA A 163      37.080 -40.716 -39.377  1.00  0.67           O  
ATOM   1161  CB  ALA A 163      39.393 -40.143 -37.019  1.00  0.67           C  
ATOM   1162  N   MET A 164      36.325 -40.763 -37.262  1.00  0.60           N  
ATOM   1163  CA  MET A 164      35.176 -41.609 -37.546  1.00  0.60           C  
ATOM   1164  C   MET A 164      34.169 -40.946 -38.478  1.00  0.60           C  
ATOM   1165  O   MET A 164      33.603 -41.576 -39.365  1.00  0.60           O  
ATOM   1166  CB  MET A 164      34.506 -42.101 -36.243  1.00  0.60           C  
ATOM   1167  CG  MET A 164      33.521 -43.266 -36.480  1.00  0.60           C  
ATOM   1168  SD  MET A 164      32.909 -44.069 -34.967  1.00  0.60           S  
ATOM   1169  CE  MET A 164      34.436 -44.963 -34.556  1.00  0.60           C  
ATOM   1170  N   SER A 165      33.956 -39.623 -38.330  1.00  0.65           N  
ATOM   1171  CA  SER A 165      33.159 -38.831 -39.263  1.00  0.65           C  
ATOM   1172  C   SER A 165      33.718 -38.810 -40.689  1.00  0.65           C  
ATOM   1173  O   SER A 165      32.977 -38.967 -41.655  1.00  0.65           O  
ATOM   1174  CB  SER A 165      32.983 -37.385 -38.720  1.00  0.65           C  
ATOM   1175  OG  SER A 165      32.105 -36.589 -39.518  1.00  0.65           O  
ATOM   1176  N   LYS A 166      35.050 -38.657 -40.875  1.00  0.58           N  
ATOM   1177  CA  LYS A 166      35.662 -38.757 -42.198  1.00  0.58           C  
ATOM   1178  C   LYS A 166      35.666 -40.160 -42.807  1.00  0.58           C  
ATOM   1179  O   LYS A 166      35.385 -40.319 -43.992  1.00  0.58           O  
ATOM   1180  CB  LYS A 166      37.128 -38.236 -42.243  1.00  0.58           C  
ATOM   1181  CG  LYS A 166      37.362 -36.801 -41.740  1.00  0.58           C  
ATOM   1182  CD  LYS A 166      36.571 -35.702 -42.472  1.00  0.58           C  
ATOM   1183  CE  LYS A 166      36.804 -34.304 -41.882  1.00  0.58           C  
ATOM   1184  NZ  LYS A 166      36.342 -34.315 -40.490  1.00  0.58           N  
ATOM   1185  N   VAL A 167      36.009 -41.217 -42.032  1.00  0.59           N  
ATOM   1186  CA  VAL A 167      36.177 -42.556 -42.597  1.00  0.59           C  
ATOM   1187  C   VAL A 167      34.888 -43.369 -42.648  1.00  0.59           C  
ATOM   1188  O   VAL A 167      34.804 -44.360 -43.372  1.00  0.59           O  
ATOM   1189  CB  VAL A 167      37.265 -43.389 -41.899  1.00  0.59           C  
ATOM   1190  CG1 VAL A 167      38.596 -42.615 -41.821  1.00  0.59           C  
ATOM   1191  CG2 VAL A 167      36.843 -43.860 -40.494  1.00  0.59           C  
ATOM   1192  N   GLY A 168      33.835 -42.957 -41.908  1.00  0.64           N  
ATOM   1193  CA  GLY A 168      32.589 -43.707 -41.768  1.00  0.64           C  
ATOM   1194  C   GLY A 168      32.700 -44.965 -40.934  1.00  0.64           C  
ATOM   1195  O   GLY A 168      33.759 -45.342 -40.445  1.00  0.64           O  
ATOM   1196  N   HIS A 169      31.575 -45.679 -40.740  1.00  0.38           N  
ATOM   1197  CA  HIS A 169      31.505 -46.906 -39.955  1.00  0.38           C  
ATOM   1198  C   HIS A 169      32.390 -48.034 -40.458  1.00  0.38           C  
ATOM   1199  O   HIS A 169      32.951 -48.796 -39.673  1.00  0.38           O  
ATOM   1200  CB  HIS A 169      30.054 -47.432 -39.896  1.00  0.38           C  
ATOM   1201  CG  HIS A 169      29.119 -46.462 -39.238  1.00  0.38           C  
ATOM   1202  ND1 HIS A 169      28.696 -45.331 -39.915  1.00  0.38           N  
ATOM   1203  CD2 HIS A 169      28.600 -46.478 -37.983  1.00  0.38           C  
ATOM   1204  CE1 HIS A 169      27.927 -44.688 -39.061  1.00  0.38           C  
ATOM   1205  NE2 HIS A 169      27.835 -45.337 -37.875  1.00  0.38           N  
ATOM   1206  N   ASP A 170      32.539 -48.138 -41.788  1.00  0.39           N  
ATOM   1207  CA  ASP A 170      33.214 -49.233 -42.448  1.00  0.39           C  
ATOM   1208  C   ASP A 170      34.697 -48.911 -42.663  1.00  0.39           C  
ATOM   1209  O   ASP A 170      35.459 -49.695 -43.229  1.00  0.39           O  
ATOM   1210  CB  ASP A 170      32.551 -49.449 -43.838  1.00  0.39           C  
ATOM   1211  CG  ASP A 170      31.048 -49.703 -43.777  1.00  0.39           C  
ATOM   1212  OD1 ASP A 170      30.487 -49.907 -42.672  1.00  0.39           O  
ATOM   1213  OD2 ASP A 170      30.440 -49.664 -44.877  1.00  0.39           O  
ATOM   1214  N   GLY A 171      35.149 -47.722 -42.211  1.00  0.57           N  
ATOM   1215  CA  GLY A 171      36.500 -47.232 -42.435  1.00  0.57           C  
ATOM   1216  C   GLY A 171      37.467 -47.524 -41.317  1.00  0.57           C  
ATOM   1217  O   GLY A 171      37.120 -47.612 -40.144  1.00  0.57           O  
ATOM   1218  N   VAL A 172      38.762 -47.649 -41.661  1.00  0.48           N  
ATOM   1219  CA  VAL A 172      39.814 -47.960 -40.707  1.00  0.48           C  
ATOM   1220  C   VAL A 172      40.573 -46.717 -40.268  1.00  0.48           C  
ATOM   1221  O   VAL A 172      40.765 -45.770 -41.028  1.00  0.48           O  
ATOM   1222  CB  VAL A 172      40.802 -49.001 -41.233  1.00  0.48           C  
ATOM   1223  CG1 VAL A 172      40.067 -50.347 -41.384  1.00  0.48           C  
ATOM   1224  CG2 VAL A 172      41.423 -48.564 -42.576  1.00  0.48           C  
ATOM   1225  N   VAL A 173      41.033 -46.701 -39.000  1.00  0.48           N  
ATOM   1226  CA  VAL A 173      41.861 -45.642 -38.446  1.00  0.48           C  
ATOM   1227  C   VAL A 173      43.066 -46.303 -37.796  1.00  0.48           C  
ATOM   1228  O   VAL A 173      42.919 -47.212 -36.980  1.00  0.48           O  
ATOM   1229  CB  VAL A 173      41.123 -44.796 -37.403  1.00  0.48           C  
ATOM   1230  CG1 VAL A 173      42.033 -43.681 -36.846  1.00  0.48           C  
ATOM   1231  CG2 VAL A 173      39.869 -44.165 -38.040  1.00  0.48           C  
ATOM   1232  N   SER A 174      44.296 -45.885 -38.153  1.00  0.39           N  
ATOM   1233  CA  SER A 174      45.530 -46.324 -37.519  1.00  0.39           C  
ATOM   1234  C   SER A 174      46.010 -45.285 -36.516  1.00  0.39           C  
ATOM   1235  O   SER A 174      45.502 -44.168 -36.446  1.00  0.39           O  
ATOM   1236  CB  SER A 174      46.667 -46.594 -38.545  1.00  0.39           C  
ATOM   1237  OG  SER A 174      46.892 -45.461 -39.384  1.00  0.39           O  
ATOM   1238  N   VAL A 175      47.000 -45.639 -35.672  1.00  0.41           N  
ATOM   1239  CA  VAL A 175      47.676 -44.667 -34.831  1.00  0.41           C  
ATOM   1240  C   VAL A 175      49.160 -44.956 -34.899  1.00  0.41           C  
ATOM   1241  O   VAL A 175      49.607 -46.094 -34.754  1.00  0.41           O  
ATOM   1242  CB  VAL A 175      47.156 -44.594 -33.393  1.00  0.41           C  
ATOM   1243  CG1 VAL A 175      47.332 -45.929 -32.642  1.00  0.41           C  
ATOM   1244  CG2 VAL A 175      47.835 -43.427 -32.643  1.00  0.41           C  
ATOM   1245  N   GLU A 176      49.950 -43.914 -35.196  1.00  0.42           N  
ATOM   1246  CA  GLU A 176      51.347 -43.998 -35.552  1.00  0.42           C  
ATOM   1247  C   GLU A 176      52.026 -42.848 -34.830  1.00  0.42           C  
ATOM   1248  O   GLU A 176      51.355 -41.991 -34.254  1.00  0.42           O  
ATOM   1249  CB  GLU A 176      51.511 -43.894 -37.094  1.00  0.42           C  
ATOM   1250  CG  GLU A 176      50.934 -45.134 -37.836  1.00  0.42           C  
ATOM   1251  CD  GLU A 176      50.608 -44.901 -39.309  1.00  0.42           C  
ATOM   1252  OE1 GLU A 176      51.435 -44.288 -40.024  1.00  0.42           O  
ATOM   1253  OE2 GLU A 176      49.509 -45.367 -39.725  1.00  0.42           O  
ATOM   1254  N   GLU A 177      53.373 -42.815 -34.782  1.00  0.41           N  
ATOM   1255  CA  GLU A 177      54.100 -41.705 -34.186  1.00  0.41           C  
ATOM   1256  C   GLU A 177      54.086 -40.466 -35.080  1.00  0.41           C  
ATOM   1257  O   GLU A 177      53.692 -40.517 -36.243  1.00  0.41           O  
ATOM   1258  CB  GLU A 177      55.516 -42.129 -33.711  1.00  0.41           C  
ATOM   1259  CG  GLU A 177      56.476 -42.679 -34.801  1.00  0.41           C  
ATOM   1260  CD  GLU A 177      57.356 -41.628 -35.483  1.00  0.41           C  
ATOM   1261  OE1 GLU A 177      57.281 -40.432 -35.109  1.00  0.41           O  
ATOM   1262  OE2 GLU A 177      58.141 -42.047 -36.371  1.00  0.41           O  
ATOM   1263  N   SER A 178      54.432 -39.289 -34.522  1.00  0.45           N  
ATOM   1264  CA  SER A 178      54.407 -38.044 -35.268  1.00  0.45           C  
ATOM   1265  C   SER A 178      55.705 -37.316 -35.044  1.00  0.45           C  
ATOM   1266  O   SER A 178      56.249 -37.283 -33.943  1.00  0.45           O  
ATOM   1267  CB  SER A 178      53.236 -37.094 -34.887  1.00  0.45           C  
ATOM   1268  OG  SER A 178      53.188 -35.954 -35.751  1.00  0.45           O  
ATOM   1269  N   SER A 179      56.218 -36.676 -36.108  1.00  0.44           N  
ATOM   1270  CA  SER A 179      57.482 -35.966 -36.102  1.00  0.44           C  
ATOM   1271  C   SER A 179      57.372 -34.576 -35.504  1.00  0.44           C  
ATOM   1272  O   SER A 179      58.378 -33.913 -35.254  1.00  0.44           O  
ATOM   1273  CB  SER A 179      58.029 -35.833 -37.548  1.00  0.44           C  
ATOM   1274  OG  SER A 179      57.080 -35.194 -38.409  1.00  0.44           O  
ATOM   1275  N   THR A 180      56.137 -34.096 -35.263  1.00  0.42           N  
ATOM   1276  CA  THR A 180      55.866 -32.785 -34.690  1.00  0.42           C  
ATOM   1277  C   THR A 180      55.266 -32.918 -33.303  1.00  0.42           C  
ATOM   1278  O   THR A 180      54.804 -33.973 -32.884  1.00  0.42           O  
ATOM   1279  CB  THR A 180      55.004 -31.900 -35.594  1.00  0.42           C  
ATOM   1280  OG1 THR A 180      54.940 -30.551 -35.141  1.00  0.42           O  
ATOM   1281  CG2 THR A 180      53.567 -32.421 -35.725  1.00  0.42           C  
ATOM   1282  N   LEU A 181      55.301 -31.818 -32.529  1.00  0.43           N  
ATOM   1283  CA  LEU A 181      54.853 -31.719 -31.152  1.00  0.43           C  
ATOM   1284  C   LEU A 181      53.352 -31.947 -30.982  1.00  0.43           C  
ATOM   1285  O   LEU A 181      52.897 -32.501 -29.983  1.00  0.43           O  
ATOM   1286  CB  LEU A 181      55.201 -30.320 -30.563  1.00  0.43           C  
ATOM   1287  CG  LEU A 181      56.701 -30.000 -30.319  1.00  0.43           C  
ATOM   1288  CD1 LEU A 181      57.351 -30.985 -29.335  1.00  0.43           C  
ATOM   1289  CD2 LEU A 181      57.552 -29.870 -31.594  1.00  0.43           C  
ATOM   1290  N   GLY A 182      52.535 -31.471 -31.945  1.00  0.49           N  
ATOM   1291  CA  GLY A 182      51.086 -31.631 -31.894  1.00  0.49           C  
ATOM   1292  C   GLY A 182      50.587 -32.936 -32.459  1.00  0.49           C  
ATOM   1293  O   GLY A 182      51.314 -33.708 -33.074  1.00  0.49           O  
ATOM   1294  N   THR A 183      49.272 -33.189 -32.311  1.00  0.59           N  
ATOM   1295  CA  THR A 183      48.620 -34.327 -32.955  1.00  0.59           C  
ATOM   1296  C   THR A 183      48.037 -33.884 -34.277  1.00  0.59           C  
ATOM   1297  O   THR A 183      47.773 -32.702 -34.490  1.00  0.59           O  
ATOM   1298  CB  THR A 183      47.551 -35.008 -32.102  1.00  0.59           C  
ATOM   1299  OG1 THR A 183      47.242 -36.300 -32.607  1.00  0.59           O  
ATOM   1300  CG2 THR A 183      46.243 -34.203 -32.048  1.00  0.59           C  
ATOM   1301  N   GLU A 184      47.831 -34.827 -35.205  1.00  0.57           N  
ATOM   1302  CA  GLU A 184      47.517 -34.517 -36.577  1.00  0.57           C  
ATOM   1303  C   GLU A 184      46.628 -35.627 -37.099  1.00  0.57           C  
ATOM   1304  O   GLU A 184      46.737 -36.773 -36.665  1.00  0.57           O  
ATOM   1305  CB  GLU A 184      48.841 -34.384 -37.366  1.00  0.57           C  
ATOM   1306  CG  GLU A 184      48.741 -33.764 -38.777  1.00  0.57           C  
ATOM   1307  CD  GLU A 184      50.109 -33.222 -39.193  1.00  0.57           C  
ATOM   1308  OE1 GLU A 184      51.072 -34.029 -39.244  1.00  0.57           O  
ATOM   1309  OE2 GLU A 184      50.204 -31.988 -39.418  1.00  0.57           O  
ATOM   1310  N   LEU A 185      45.679 -35.319 -38.004  1.00  0.54           N  
ATOM   1311  CA  LEU A 185      44.784 -36.316 -38.559  1.00  0.54           C  
ATOM   1312  C   LEU A 185      44.966 -36.341 -40.049  1.00  0.54           C  
ATOM   1313  O   LEU A 185      44.654 -35.375 -40.739  1.00  0.54           O  
ATOM   1314  CB  LEU A 185      43.288 -36.022 -38.272  1.00  0.54           C  
ATOM   1315  CG  LEU A 185      42.278 -37.025 -38.884  1.00  0.54           C  
ATOM   1316  CD1 LEU A 185      42.489 -38.461 -38.378  1.00  0.54           C  
ATOM   1317  CD2 LEU A 185      40.837 -36.575 -38.604  1.00  0.54           C  
ATOM   1318  N   GLU A 186      45.454 -37.474 -40.574  1.00  0.53           N  
ATOM   1319  CA  GLU A 186      45.495 -37.698 -41.997  1.00  0.53           C  
ATOM   1320  C   GLU A 186      44.246 -38.390 -42.498  1.00  0.53           C  
ATOM   1321  O   GLU A 186      43.515 -39.049 -41.757  1.00  0.53           O  
ATOM   1322  CB  GLU A 186      46.766 -38.465 -42.434  1.00  0.53           C  
ATOM   1323  CG  GLU A 186      47.845 -37.496 -42.970  1.00  0.53           C  
ATOM   1324  CD  GLU A 186      47.422 -36.819 -44.278  1.00  0.53           C  
ATOM   1325  OE1 GLU A 186      46.320 -37.140 -44.807  1.00  0.53           O  
ATOM   1326  OE2 GLU A 186      48.211 -35.968 -44.748  1.00  0.53           O  
ATOM   1327  N   PHE A 187      43.971 -38.222 -43.799  1.00  0.40           N  
ATOM   1328  CA  PHE A 187      42.826 -38.834 -44.432  1.00  0.40           C  
ATOM   1329  C   PHE A 187      43.103 -39.022 -45.911  1.00  0.40           C  
ATOM   1330  O   PHE A 187      43.194 -40.151 -46.391  1.00  0.40           O  
ATOM   1331  CB  PHE A 187      41.535 -37.990 -44.180  1.00  0.40           C  
ATOM   1332  CG  PHE A 187      40.304 -38.615 -44.790  1.00  0.40           C  
ATOM   1333  CD1 PHE A 187      39.621 -37.967 -45.833  1.00  0.40           C  
ATOM   1334  CD2 PHE A 187      39.843 -39.868 -44.352  1.00  0.40           C  
ATOM   1335  CE1 PHE A 187      38.506 -38.562 -46.438  1.00  0.40           C  
ATOM   1336  CE2 PHE A 187      38.730 -40.467 -44.959  1.00  0.40           C  
ATOM   1337  CZ  PHE A 187      38.062 -39.814 -46.000  1.00  0.40           C  
ATOM   1338  N   THR A 188      43.232 -37.923 -46.679  1.00  0.38           N  
ATOM   1339  CA  THR A 188      43.539 -38.015 -48.097  1.00  0.38           C  
ATOM   1340  C   THR A 188      43.981 -36.665 -48.621  1.00  0.38           C  
ATOM   1341  O   THR A 188      43.631 -35.626 -48.063  1.00  0.38           O  
ATOM   1342  CB  THR A 188      42.380 -38.551 -48.955  1.00  0.38           C  
ATOM   1343  OG1 THR A 188      42.836 -39.013 -50.218  1.00  0.38           O  
ATOM   1344  CG2 THR A 188      41.278 -37.506 -49.209  1.00  0.38           C  
ATOM   1345  N   GLU A 189      44.702 -36.664 -49.756  1.00  0.30           N  
ATOM   1346  CA  GLU A 189      44.981 -35.494 -50.562  1.00  0.30           C  
ATOM   1347  C   GLU A 189      44.419 -35.789 -51.940  1.00  0.30           C  
ATOM   1348  O   GLU A 189      44.154 -36.934 -52.301  1.00  0.30           O  
ATOM   1349  CB  GLU A 189      46.488 -35.176 -50.738  1.00  0.30           C  
ATOM   1350  CG  GLU A 189      47.201 -34.596 -49.494  1.00  0.30           C  
ATOM   1351  CD  GLU A 189      48.550 -34.001 -49.899  1.00  0.30           C  
ATOM   1352  OE1 GLU A 189      49.399 -34.765 -50.428  1.00  0.30           O  
ATOM   1353  OE2 GLU A 189      48.720 -32.764 -49.732  1.00  0.30           O  
ATOM   1354  N   GLY A 190      44.192 -34.755 -52.766  1.00  0.34           N  
ATOM   1355  CA  GLY A 190      43.660 -34.973 -54.099  1.00  0.34           C  
ATOM   1356  C   GLY A 190      43.188 -33.681 -54.676  1.00  0.34           C  
ATOM   1357  O   GLY A 190      43.166 -32.654 -54.002  1.00  0.34           O  
ATOM   1358  N   ILE A 191      42.797 -33.700 -55.957  1.00  0.27           N  
ATOM   1359  CA  ILE A 191      42.401 -32.514 -56.691  1.00  0.27           C  
ATOM   1360  C   ILE A 191      41.087 -32.780 -57.395  1.00  0.27           C  
ATOM   1361  O   ILE A 191      40.618 -33.912 -57.479  1.00  0.27           O  
ATOM   1362  CB  ILE A 191      43.455 -32.062 -57.701  1.00  0.27           C  
ATOM   1363  CG1 ILE A 191      43.900 -33.219 -58.625  1.00  0.27           C  
ATOM   1364  CG2 ILE A 191      44.643 -31.465 -56.914  1.00  0.27           C  
ATOM   1365  CD1 ILE A 191      44.862 -32.793 -59.740  1.00  0.27           C  
ATOM   1366  N   GLY A 192      40.420 -31.707 -57.869  1.00  0.37           N  
ATOM   1367  CA  GLY A 192      39.181 -31.806 -58.628  1.00  0.37           C  
ATOM   1368  C   GLY A 192      39.410 -31.561 -60.089  1.00  0.37           C  
ATOM   1369  O   GLY A 192      40.435 -31.919 -60.659  1.00  0.37           O  
ATOM   1370  N   PHE A 193      38.438 -30.928 -60.765  1.00  0.75           N  
ATOM   1371  CA  PHE A 193      38.545 -30.707 -62.191  1.00  0.75           C  
ATOM   1372  C   PHE A 193      39.279 -29.414 -62.499  1.00  0.75           C  
ATOM   1373  O   PHE A 193      38.655 -28.381 -62.751  1.00  0.75           O  
ATOM   1374  CB  PHE A 193      37.161 -30.652 -62.888  1.00  0.75           C  
ATOM   1375  CG  PHE A 193      36.296 -31.808 -62.484  1.00  0.75           C  
ATOM   1376  CD1 PHE A 193      36.618 -33.117 -62.874  1.00  0.75           C  
ATOM   1377  CD2 PHE A 193      35.152 -31.588 -61.698  1.00  0.75           C  
ATOM   1378  CE1 PHE A 193      35.805 -34.189 -62.483  1.00  0.75           C  
ATOM   1379  CE2 PHE A 193      34.341 -32.658 -61.302  1.00  0.75           C  
ATOM   1380  CZ  PHE A 193      34.671 -33.960 -61.694  1.00  0.75           C  
ATOM   1381  N   ASP A 194      40.631 -29.483 -62.557  1.00  0.72           N  
ATOM   1382  CA  ASP A 194      41.493 -28.468 -63.144  1.00  0.72           C  
ATOM   1383  C   ASP A 194      41.014 -28.158 -64.556  1.00  0.72           C  
ATOM   1384  O   ASP A 194      41.064 -29.040 -65.419  1.00  0.72           O  
ATOM   1385  CB  ASP A 194      42.977 -28.986 -63.164  1.00  0.72           C  
ATOM   1386  CG  ASP A 194      44.033 -28.106 -63.845  1.00  0.72           C  
ATOM   1387  OD1 ASP A 194      43.907 -27.832 -65.062  1.00  0.72           O  
ATOM   1388  OD2 ASP A 194      45.032 -27.732 -63.195  1.00  0.72           O  
ATOM   1389  N   LYS A 195      40.562 -26.906 -64.781  1.00  0.75           N  
ATOM   1390  CA  LYS A 195      40.327 -26.256 -66.055  1.00  0.75           C  
ATOM   1391  C   LYS A 195      39.270 -25.177 -65.980  1.00  0.75           C  
ATOM   1392  O   LYS A 195      38.086 -25.447 -65.790  1.00  0.75           O  
ATOM   1393  CB  LYS A 195      39.953 -27.112 -67.301  1.00  0.75           C  
ATOM   1394  CG  LYS A 195      40.505 -26.512 -68.599  1.00  0.75           C  
ATOM   1395  CD  LYS A 195      42.045 -26.401 -68.676  1.00  0.75           C  
ATOM   1396  CE  LYS A 195      42.847 -27.718 -68.629  1.00  0.75           C  
ATOM   1397  NZ  LYS A 195      42.973 -28.304 -67.297  1.00  0.75           N  
ATOM   1398  N   GLY A 196      39.666 -23.911 -66.183  1.00  0.78           N  
ATOM   1399  CA  GLY A 196      38.713 -22.836 -66.394  1.00  0.78           C  
ATOM   1400  C   GLY A 196      38.190 -22.681 -67.796  1.00  0.78           C  
ATOM   1401  O   GLY A 196      38.537 -23.411 -68.721  1.00  0.78           O  
ATOM   1402  N   PHE A 197      37.336 -21.662 -67.984  1.00  0.79           N  
ATOM   1403  CA  PHE A 197      36.715 -21.324 -69.254  1.00  0.79           C  
ATOM   1404  C   PHE A 197      37.655 -20.952 -70.407  1.00  0.79           C  
ATOM   1405  O   PHE A 197      38.705 -20.339 -70.234  1.00  0.79           O  
ATOM   1406  CB  PHE A 197      35.604 -20.241 -69.074  1.00  0.79           C  
ATOM   1407  CG  PHE A 197      36.034 -19.044 -68.246  1.00  0.79           C  
ATOM   1408  CD1 PHE A 197      37.022 -18.142 -68.683  1.00  0.79           C  
ATOM   1409  CD2 PHE A 197      35.413 -18.798 -67.009  1.00  0.79           C  
ATOM   1410  CE1 PHE A 197      37.403 -17.051 -67.890  1.00  0.79           C  
ATOM   1411  CE2 PHE A 197      35.778 -17.701 -66.219  1.00  0.79           C  
ATOM   1412  CZ  PHE A 197      36.774 -16.826 -66.662  1.00  0.79           C  
ATOM   1413  N   LEU A 198      37.263 -21.285 -71.657  1.00  0.78           N  
ATOM   1414  CA  LEU A 198      38.012 -20.873 -72.837  1.00  0.78           C  
ATOM   1415  C   LEU A 198      37.519 -19.553 -73.405  1.00  0.78           C  
ATOM   1416  O   LEU A 198      38.135 -18.965 -74.289  1.00  0.78           O  
ATOM   1417  CB  LEU A 198      37.895 -21.936 -73.955  1.00  0.78           C  
ATOM   1418  CG  LEU A 198      38.508 -23.300 -73.598  1.00  0.78           C  
ATOM   1419  CD1 LEU A 198      38.272 -24.293 -74.744  1.00  0.78           C  
ATOM   1420  CD2 LEU A 198      40.006 -23.182 -73.288  1.00  0.78           C  
ATOM   1421  N   SER A 199      36.403 -19.018 -72.878  1.00  0.72           N  
ATOM   1422  CA  SER A 199      35.929 -17.692 -73.240  1.00  0.72           C  
ATOM   1423  C   SER A 199      35.810 -16.857 -71.991  1.00  0.72           C  
ATOM   1424  O   SER A 199      34.940 -17.080 -71.152  1.00  0.72           O  
ATOM   1425  CB  SER A 199      34.555 -17.704 -73.959  1.00  0.72           C  
ATOM   1426  OG  SER A 199      34.176 -16.391 -74.387  1.00  0.72           O  
ATOM   1427  N   ALA A 200      36.672 -15.830 -71.860  1.00  0.72           N  
ATOM   1428  CA  ALA A 200      36.684 -14.921 -70.729  1.00  0.72           C  
ATOM   1429  C   ALA A 200      35.527 -13.934 -70.762  1.00  0.72           C  
ATOM   1430  O   ALA A 200      35.173 -13.308 -69.769  1.00  0.72           O  
ATOM   1431  CB  ALA A 200      38.020 -14.154 -70.723  1.00  0.72           C  
ATOM   1432  N   TYR A 201      34.875 -13.830 -71.929  1.00  0.60           N  
ATOM   1433  CA  TYR A 201      33.770 -12.940 -72.192  1.00  0.60           C  
ATOM   1434  C   TYR A 201      32.440 -13.555 -71.766  1.00  0.60           C  
ATOM   1435  O   TYR A 201      31.399 -12.909 -71.818  1.00  0.60           O  
ATOM   1436  CB  TYR A 201      33.673 -12.718 -73.719  1.00  0.60           C  
ATOM   1437  CG  TYR A 201      34.933 -12.162 -74.321  1.00  0.60           C  
ATOM   1438  CD1 TYR A 201      35.207 -10.788 -74.250  1.00  0.60           C  
ATOM   1439  CD2 TYR A 201      35.823 -13.001 -75.017  1.00  0.60           C  
ATOM   1440  CE1 TYR A 201      36.350 -10.258 -74.866  1.00  0.60           C  
ATOM   1441  CE2 TYR A 201      36.970 -12.474 -75.629  1.00  0.60           C  
ATOM   1442  CZ  TYR A 201      37.229 -11.100 -75.554  1.00  0.60           C  
ATOM   1443  OH  TYR A 201      38.364 -10.552 -76.181  1.00  0.60           O  
ATOM   1444  N   PHE A 202      32.439 -14.836 -71.334  1.00  0.68           N  
ATOM   1445  CA  PHE A 202      31.227 -15.551 -70.975  1.00  0.68           C  
ATOM   1446  C   PHE A 202      30.849 -15.354 -69.503  1.00  0.68           C  
ATOM   1447  O   PHE A 202      29.771 -15.766 -69.071  1.00  0.68           O  
ATOM   1448  CB  PHE A 202      31.426 -17.070 -71.289  1.00  0.68           C  
ATOM   1449  CG  PHE A 202      30.156 -17.861 -71.081  1.00  0.68           C  
ATOM   1450  CD1 PHE A 202      29.099 -17.767 -71.996  1.00  0.68           C  
ATOM   1451  CD2 PHE A 202      29.971 -18.608 -69.907  1.00  0.68           C  
ATOM   1452  CE1 PHE A 202      27.871 -18.390 -71.735  1.00  0.68           C  
ATOM   1453  CE2 PHE A 202      28.734 -19.203 -69.625  1.00  0.68           C  
ATOM   1454  CZ  PHE A 202      27.689 -19.112 -70.549  1.00  0.68           C  
ATOM   1455  N   VAL A 203      31.706 -14.711 -68.679  1.00  0.71           N  
ATOM   1456  CA  VAL A 203      31.433 -14.523 -67.259  1.00  0.71           C  
ATOM   1457  C   VAL A 203      30.091 -13.854 -66.969  1.00  0.71           C  
ATOM   1458  O   VAL A 203      29.771 -12.758 -67.421  1.00  0.71           O  
ATOM   1459  CB  VAL A 203      32.566 -13.862 -66.479  1.00  0.71           C  
ATOM   1460  CG1 VAL A 203      33.797 -14.788 -66.514  1.00  0.71           C  
ATOM   1461  CG2 VAL A 203      32.910 -12.467 -67.034  1.00  0.71           C  
ATOM   1462  N   THR A 204      29.219 -14.567 -66.226  1.00  0.69           N  
ATOM   1463  CA  THR A 204      27.831 -14.140 -66.062  1.00  0.69           C  
ATOM   1464  C   THR A 204      27.667 -13.430 -64.748  1.00  0.69           C  
ATOM   1465  O   THR A 204      26.599 -12.898 -64.452  1.00  0.69           O  
ATOM   1466  CB  THR A 204      26.833 -15.296 -66.126  1.00  0.69           C  
ATOM   1467  OG1 THR A 204      25.513 -14.844 -66.415  1.00  0.69           O  
ATOM   1468  CG2 THR A 204      26.762 -16.105 -64.822  1.00  0.69           C  
ATOM   1469  N   ASP A 205      28.752 -13.412 -63.960  1.00  0.67           N  
ATOM   1470  CA  ASP A 205      28.907 -12.615 -62.785  1.00  0.67           C  
ATOM   1471  C   ASP A 205      30.313 -12.033 -62.860  1.00  0.67           C  
ATOM   1472  O   ASP A 205      31.293 -12.722 -63.152  1.00  0.67           O  
ATOM   1473  CB  ASP A 205      28.690 -13.444 -61.495  1.00  0.67           C  
ATOM   1474  CG  ASP A 205      28.943 -12.568 -60.284  1.00  0.67           C  
ATOM   1475  OD1 ASP A 205      28.675 -11.341 -60.373  1.00  0.67           O  
ATOM   1476  OD2 ASP A 205      29.530 -13.086 -59.308  1.00  0.67           O  
ATOM   1477  N   PHE A 206      30.410 -10.726 -62.581  1.00  0.54           N  
ATOM   1478  CA  PHE A 206      31.647  -9.985 -62.574  1.00  0.54           C  
ATOM   1479  C   PHE A 206      32.139  -9.788 -61.150  1.00  0.54           C  
ATOM   1480  O   PHE A 206      33.288  -9.404 -60.950  1.00  0.54           O  
ATOM   1481  CB  PHE A 206      31.434  -8.578 -63.191  1.00  0.54           C  
ATOM   1482  CG  PHE A 206      31.179  -8.666 -64.670  1.00  0.54           C  
ATOM   1483  CD1 PHE A 206      32.261  -8.739 -65.563  1.00  0.54           C  
ATOM   1484  CD2 PHE A 206      29.872  -8.648 -65.185  1.00  0.54           C  
ATOM   1485  CE1 PHE A 206      32.044  -8.778 -66.947  1.00  0.54           C  
ATOM   1486  CE2 PHE A 206      29.650  -8.696 -66.568  1.00  0.54           C  
ATOM   1487  CZ  PHE A 206      30.737  -8.758 -67.449  1.00  0.54           C  
ATOM   1488  N   ASP A 207      31.309 -10.076 -60.118  1.00  0.61           N  
ATOM   1489  CA  ASP A 207      31.740  -9.999 -58.733  1.00  0.61           C  
ATOM   1490  C   ASP A 207      32.622 -11.199 -58.391  1.00  0.61           C  
ATOM   1491  O   ASP A 207      33.761 -11.082 -57.941  1.00  0.61           O  
ATOM   1492  CB  ASP A 207      30.473  -9.945 -57.840  1.00  0.61           C  
ATOM   1493  CG  ASP A 207      30.829  -9.711 -56.385  1.00  0.61           C  
ATOM   1494  OD1 ASP A 207      31.117  -8.538 -56.036  1.00  0.61           O  
ATOM   1495  OD2 ASP A 207      30.823 -10.707 -55.616  1.00  0.61           O  
ATOM   1496  N   ASN A 208      32.142 -12.416 -58.711  1.00  0.66           N  
ATOM   1497  CA  ASN A 208      32.913 -13.627 -58.524  1.00  0.66           C  
ATOM   1498  C   ASN A 208      33.940 -13.827 -59.637  1.00  0.66           C  
ATOM   1499  O   ASN A 208      34.873 -14.614 -59.479  1.00  0.66           O  
ATOM   1500  CB  ASN A 208      31.965 -14.859 -58.487  1.00  0.66           C  
ATOM   1501  CG  ASN A 208      31.256 -15.058 -57.143  1.00  0.66           C  
ATOM   1502  OD1 ASN A 208      31.021 -16.209 -56.762  1.00  0.66           O  
ATOM   1503  ND2 ASN A 208      30.931 -13.982 -56.397  1.00  0.66           N  
ATOM   1504  N   GLN A 209      33.776 -13.126 -60.786  1.00  0.63           N  
ATOM   1505  CA  GLN A 209      34.553 -13.270 -62.017  1.00  0.63           C  
ATOM   1506  C   GLN A 209      34.505 -14.694 -62.564  1.00  0.63           C  
ATOM   1507  O   GLN A 209      35.507 -15.336 -62.890  1.00  0.63           O  
ATOM   1508  CB  GLN A 209      35.992 -12.697 -61.876  1.00  0.63           C  
ATOM   1509  CG  GLN A 209      36.802 -12.534 -63.193  1.00  0.63           C  
ATOM   1510  CD  GLN A 209      36.205 -11.509 -64.163  1.00  0.63           C  
ATOM   1511  OE1 GLN A 209      35.211 -10.831 -63.922  1.00  0.63           O  
ATOM   1512  NE2 GLN A 209      36.861 -11.374 -65.341  1.00  0.63           N  
ATOM   1513  N   GLN A 210      33.280 -15.233 -62.641  1.00  0.71           N  
ATOM   1514  CA  GLN A 210      33.027 -16.635 -62.871  1.00  0.71           C  
ATOM   1515  C   GLN A 210      31.768 -16.759 -63.694  1.00  0.71           C  
ATOM   1516  O   GLN A 210      31.000 -15.812 -63.870  1.00  0.71           O  
ATOM   1517  CB  GLN A 210      32.862 -17.421 -61.536  1.00  0.71           C  
ATOM   1518  CG  GLN A 210      34.208 -17.626 -60.799  1.00  0.71           C  
ATOM   1519  CD  GLN A 210      34.073 -18.403 -59.492  1.00  0.71           C  
ATOM   1520  OE1 GLN A 210      33.860 -19.615 -59.484  1.00  0.71           O  
ATOM   1521  NE2 GLN A 210      34.236 -17.703 -58.348  1.00  0.71           N  
ATOM   1522  N   ALA A 211      31.510 -17.955 -64.243  1.00  0.77           N  
ATOM   1523  CA  ALA A 211      30.263 -18.201 -64.922  1.00  0.77           C  
ATOM   1524  C   ALA A 211      29.511 -19.295 -64.204  1.00  0.77           C  
ATOM   1525  O   ALA A 211      30.023 -20.382 -63.947  1.00  0.77           O  
ATOM   1526  CB  ALA A 211      30.459 -18.521 -66.410  1.00  0.77           C  
ATOM   1527  N   VAL A 212      28.255 -18.993 -63.843  1.00  0.81           N  
ATOM   1528  CA  VAL A 212      27.381 -19.881 -63.117  1.00  0.81           C  
ATOM   1529  C   VAL A 212      26.236 -20.212 -64.043  1.00  0.81           C  
ATOM   1530  O   VAL A 212      25.583 -19.332 -64.604  1.00  0.81           O  
ATOM   1531  CB  VAL A 212      26.840 -19.249 -61.839  1.00  0.81           C  
ATOM   1532  CG1 VAL A 212      25.932 -20.249 -61.096  1.00  0.81           C  
ATOM   1533  CG2 VAL A 212      28.020 -18.838 -60.936  1.00  0.81           C  
ATOM   1534  N   LEU A 213      25.981 -21.508 -64.254  1.00  0.83           N  
ATOM   1535  CA  LEU A 213      24.931 -21.971 -65.128  1.00  0.83           C  
ATOM   1536  C   LEU A 213      24.056 -22.884 -64.298  1.00  0.83           C  
ATOM   1537  O   LEU A 213      24.505 -23.916 -63.807  1.00  0.83           O  
ATOM   1538  CB  LEU A 213      25.478 -22.729 -66.372  1.00  0.83           C  
ATOM   1539  CG  LEU A 213      26.495 -21.945 -67.240  1.00  0.83           C  
ATOM   1540  CD1 LEU A 213      27.945 -22.104 -66.748  1.00  0.83           C  
ATOM   1541  CD2 LEU A 213      26.428 -22.400 -68.705  1.00  0.83           C  
ATOM   1542  N   GLU A 214      22.780 -22.524 -64.074  1.00  0.80           N  
ATOM   1543  CA  GLU A 214      21.861 -23.388 -63.362  1.00  0.80           C  
ATOM   1544  C   GLU A 214      21.240 -24.398 -64.304  1.00  0.80           C  
ATOM   1545  O   GLU A 214      21.058 -24.105 -65.487  1.00  0.80           O  
ATOM   1546  CB  GLU A 214      20.727 -22.596 -62.670  1.00  0.80           C  
ATOM   1547  CG  GLU A 214      19.855 -21.751 -63.634  1.00  0.80           C  
ATOM   1548  CD  GLU A 214      18.397 -21.716 -63.190  1.00  0.80           C  
ATOM   1549  OE1 GLU A 214      18.144 -21.187 -62.080  1.00  0.80           O  
ATOM   1550  OE2 GLU A 214      17.539 -22.235 -63.964  1.00  0.80           O  
ATOM   1551  N   ASP A 215      20.918 -25.608 -63.784  1.00  0.82           N  
ATOM   1552  CA  ASP A 215      20.039 -26.581 -64.409  1.00  0.82           C  
ATOM   1553  C   ASP A 215      20.454 -26.891 -65.852  1.00  0.82           C  
ATOM   1554  O   ASP A 215      19.708 -26.777 -66.824  1.00  0.82           O  
ATOM   1555  CB  ASP A 215      18.614 -26.022 -64.218  1.00  0.82           C  
ATOM   1556  CG  ASP A 215      17.499 -27.022 -64.424  1.00  0.82           C  
ATOM   1557  OD1 ASP A 215      17.748 -28.248 -64.436  1.00  0.82           O  
ATOM   1558  OD2 ASP A 215      16.351 -26.514 -64.574  1.00  0.82           O  
ATOM   1559  N   ALA A 216      21.750 -27.203 -66.011  1.00  0.88           N  
ATOM   1560  CA  ALA A 216      22.428 -27.063 -67.273  1.00  0.88           C  
ATOM   1561  C   ALA A 216      22.719 -28.413 -67.877  1.00  0.88           C  
ATOM   1562  O   ALA A 216      23.120 -29.366 -67.205  1.00  0.88           O  
ATOM   1563  CB  ALA A 216      23.737 -26.260 -67.113  1.00  0.88           C  
ATOM   1564  N   LEU A 217      22.497 -28.517 -69.197  1.00  0.86           N  
ATOM   1565  CA  LEU A 217      22.800 -29.690 -69.977  1.00  0.86           C  
ATOM   1566  C   LEU A 217      24.301 -29.788 -70.195  1.00  0.86           C  
ATOM   1567  O   LEU A 217      25.006 -28.782 -70.232  1.00  0.86           O  
ATOM   1568  CB  LEU A 217      22.051 -29.710 -71.333  1.00  0.86           C  
ATOM   1569  CG  LEU A 217      20.514 -29.851 -71.220  1.00  0.86           C  
ATOM   1570  CD1 LEU A 217      19.799 -28.541 -70.859  1.00  0.86           C  
ATOM   1571  CD2 LEU A 217      19.932 -30.387 -72.533  1.00  0.86           C  
ATOM   1572  N   ILE A 218      24.855 -31.006 -70.304  1.00  0.88           N  
ATOM   1573  CA  ILE A 218      26.295 -31.195 -70.378  1.00  0.88           C  
ATOM   1574  C   ILE A 218      26.651 -32.062 -71.576  1.00  0.88           C  
ATOM   1575  O   ILE A 218      26.266 -33.228 -71.673  1.00  0.88           O  
ATOM   1576  CB  ILE A 218      26.870 -31.763 -69.075  1.00  0.88           C  
ATOM   1577  CG1 ILE A 218      26.494 -30.843 -67.881  1.00  0.88           C  
ATOM   1578  CG2 ILE A 218      28.404 -31.898 -69.218  1.00  0.88           C  
ATOM   1579  CD1 ILE A 218      26.890 -31.365 -66.499  1.00  0.88           C  
ATOM   1580  N   LEU A 219      27.424 -31.494 -72.524  1.00  0.87           N  
ATOM   1581  CA  LEU A 219      27.962 -32.181 -73.682  1.00  0.87           C  
ATOM   1582  C   LEU A 219      29.378 -32.639 -73.397  1.00  0.87           C  
ATOM   1583  O   LEU A 219      30.220 -31.861 -72.952  1.00  0.87           O  
ATOM   1584  CB  LEU A 219      27.989 -31.249 -74.923  1.00  0.87           C  
ATOM   1585  CG  LEU A 219      28.710 -31.800 -76.177  1.00  0.87           C  
ATOM   1586  CD1 LEU A 219      28.062 -33.086 -76.719  1.00  0.87           C  
ATOM   1587  CD2 LEU A 219      28.783 -30.719 -77.266  1.00  0.87           C  
ATOM   1588  N   LEU A 220      29.665 -33.926 -73.673  1.00  0.86           N  
ATOM   1589  CA  LEU A 220      30.971 -34.518 -73.495  1.00  0.86           C  
ATOM   1590  C   LEU A 220      31.488 -35.010 -74.839  1.00  0.86           C  
ATOM   1591  O   LEU A 220      30.972 -35.987 -75.375  1.00  0.86           O  
ATOM   1592  CB  LEU A 220      30.871 -35.754 -72.568  1.00  0.86           C  
ATOM   1593  CG  LEU A 220      30.103 -35.548 -71.249  1.00  0.86           C  
ATOM   1594  CD1 LEU A 220      30.012 -36.880 -70.512  1.00  0.86           C  
ATOM   1595  CD2 LEU A 220      30.734 -34.502 -70.331  1.00  0.86           C  
ATOM   1596  N   HIS A 221      32.522 -34.365 -75.413  1.00  0.79           N  
ATOM   1597  CA  HIS A 221      33.058 -34.733 -76.721  1.00  0.79           C  
ATOM   1598  C   HIS A 221      34.506 -35.164 -76.573  1.00  0.79           C  
ATOM   1599  O   HIS A 221      35.316 -34.441 -76.002  1.00  0.79           O  
ATOM   1600  CB  HIS A 221      32.967 -33.524 -77.693  1.00  0.79           C  
ATOM   1601  CG  HIS A 221      33.284 -33.795 -79.137  1.00  0.79           C  
ATOM   1602  ND1 HIS A 221      32.631 -34.817 -79.792  1.00  0.79           N  
ATOM   1603  CD2 HIS A 221      34.054 -33.099 -80.012  1.00  0.79           C  
ATOM   1604  CE1 HIS A 221      33.016 -34.727 -81.049  1.00  0.79           C  
ATOM   1605  NE2 HIS A 221      33.876 -33.701 -81.239  1.00  0.79           N  
ATOM   1606  N   GLN A 222      34.890 -36.373 -77.039  1.00  0.70           N  
ATOM   1607  CA  GLN A 222      36.289 -36.797 -76.961  1.00  0.70           C  
ATOM   1608  C   GLN A 222      37.227 -36.019 -77.881  1.00  0.70           C  
ATOM   1609  O   GLN A 222      38.323 -35.650 -77.469  1.00  0.70           O  
ATOM   1610  CB  GLN A 222      36.470 -38.340 -77.061  1.00  0.70           C  
ATOM   1611  CG  GLN A 222      35.993 -39.015 -75.747  1.00  0.70           C  
ATOM   1612  CD  GLN A 222      36.180 -40.535 -75.623  1.00  0.70           C  
ATOM   1613  OE1 GLN A 222      37.254 -41.115 -75.774  1.00  0.70           O  
ATOM   1614  NE2 GLN A 222      35.090 -41.225 -75.203  1.00  0.70           N  
ATOM   1615  N   ASP A 223      36.795 -35.714 -79.117  1.00  0.70           N  
ATOM   1616  CA  ASP A 223      37.542 -34.943 -80.093  1.00  0.70           C  
ATOM   1617  C   ASP A 223      37.523 -33.423 -79.867  1.00  0.70           C  
ATOM   1618  O   ASP A 223      36.904 -32.862 -78.958  1.00  0.70           O  
ATOM   1619  CB  ASP A 223      37.028 -35.258 -81.523  1.00  0.70           C  
ATOM   1620  CG  ASP A 223      37.555 -36.597 -82.009  1.00  0.70           C  
ATOM   1621  OD1 ASP A 223      37.288 -37.621 -81.337  1.00  0.70           O  
ATOM   1622  OD2 ASP A 223      38.192 -36.595 -83.091  1.00  0.70           O  
ATOM   1623  N   LYS A 224      38.277 -32.706 -80.721  1.00  0.71           N  
ATOM   1624  CA  LYS A 224      38.463 -31.270 -80.689  1.00  0.71           C  
ATOM   1625  C   LYS A 224      37.499 -30.507 -81.587  1.00  0.71           C  
ATOM   1626  O   LYS A 224      37.324 -30.819 -82.763  1.00  0.71           O  
ATOM   1627  CB  LYS A 224      39.915 -30.977 -81.119  1.00  0.71           C  
ATOM   1628  CG  LYS A 224      40.348 -29.512 -80.996  1.00  0.71           C  
ATOM   1629  CD  LYS A 224      41.868 -29.370 -80.777  1.00  0.71           C  
ATOM   1630  CE  LYS A 224      42.767 -29.903 -81.892  1.00  0.71           C  
ATOM   1631  NZ  LYS A 224      42.433 -29.212 -83.145  1.00  0.71           N  
ATOM   1632  N   ILE A 225      36.848 -29.450 -81.058  1.00  0.74           N  
ATOM   1633  CA  ILE A 225      35.872 -28.663 -81.799  1.00  0.74           C  
ATOM   1634  C   ILE A 225      36.543 -27.422 -82.371  1.00  0.74           C  
ATOM   1635  O   ILE A 225      37.116 -26.615 -81.648  1.00  0.74           O  
ATOM   1636  CB  ILE A 225      34.684 -28.243 -80.928  1.00  0.74           C  
ATOM   1637  CG1 ILE A 225      33.998 -29.488 -80.313  1.00  0.74           C  
ATOM   1638  CG2 ILE A 225      33.679 -27.405 -81.756  1.00  0.74           C  
ATOM   1639  CD1 ILE A 225      32.919 -29.166 -79.272  1.00  0.74           C  
ATOM   1640  N   SER A 226      36.482 -27.223 -83.701  1.00  0.75           N  
ATOM   1641  CA  SER A 226      36.983 -25.999 -84.335  1.00  0.75           C  
ATOM   1642  C   SER A 226      35.905 -25.346 -85.183  1.00  0.75           C  
ATOM   1643  O   SER A 226      35.929 -24.146 -85.459  1.00  0.75           O  
ATOM   1644  CB  SER A 226      38.216 -26.311 -85.229  1.00  0.75           C  
ATOM   1645  OG  SER A 226      38.863 -25.119 -85.680  1.00  0.75           O  
ATOM   1646  N   SER A 227      34.881 -26.135 -85.560  1.00  0.69           N  
ATOM   1647  CA  SER A 227      33.872 -25.754 -86.530  1.00  0.69           C  
ATOM   1648  C   SER A 227      32.507 -25.719 -85.882  1.00  0.69           C  
ATOM   1649  O   SER A 227      32.101 -26.660 -85.201  1.00  0.69           O  
ATOM   1650  CB  SER A 227      33.758 -26.793 -87.681  1.00  0.69           C  
ATOM   1651  OG  SER A 227      35.025 -27.022 -88.300  1.00  0.69           O  
ATOM   1652  N   LEU A 228      31.746 -24.637 -86.103  1.00  0.70           N  
ATOM   1653  CA  LEU A 228      30.350 -24.497 -85.742  1.00  0.70           C  
ATOM   1654  C   LEU A 228      29.401 -25.499 -86.422  1.00  0.70           C  
ATOM   1655  O   LEU A 228      28.529 -25.989 -85.703  1.00  0.70           O  
ATOM   1656  CB  LEU A 228      29.908 -23.028 -85.973  1.00  0.70           C  
ATOM   1657  CG  LEU A 228      28.450 -22.670 -85.623  1.00  0.70           C  
ATOM   1658  CD1 LEU A 228      28.178 -22.740 -84.114  1.00  0.70           C  
ATOM   1659  CD2 LEU A 228      28.098 -21.280 -86.173  1.00  0.70           C  
ATOM   1660  N   PRO A 229      29.476 -25.886 -87.717  1.00  0.75           N  
ATOM   1661  CA  PRO A 229      28.582 -26.856 -88.360  1.00  0.75           C  
ATOM   1662  C   PRO A 229      28.120 -28.095 -87.606  1.00  0.75           C  
ATOM   1663  O   PRO A 229      26.935 -28.419 -87.689  1.00  0.75           O  
ATOM   1664  CB  PRO A 229      29.305 -27.171 -89.668  1.00  0.75           C  
ATOM   1665  CG  PRO A 229      29.838 -25.798 -90.085  1.00  0.75           C  
ATOM   1666  CD  PRO A 229      30.211 -25.138 -88.750  1.00  0.75           C  
ATOM   1667  N   ASP A 230      29.003 -28.790 -86.864  1.00  0.71           N  
ATOM   1668  CA  ASP A 230      28.662 -29.930 -86.031  1.00  0.71           C  
ATOM   1669  C   ASP A 230      27.660 -29.597 -84.930  1.00  0.71           C  
ATOM   1670  O   ASP A 230      26.763 -30.374 -84.606  1.00  0.71           O  
ATOM   1671  CB  ASP A 230      29.941 -30.470 -85.344  1.00  0.71           C  
ATOM   1672  CG  ASP A 230      30.809 -31.277 -86.291  1.00  0.71           C  
ATOM   1673  OD1 ASP A 230      30.441 -31.424 -87.483  1.00  0.71           O  
ATOM   1674  OD2 ASP A 230      31.841 -31.794 -85.795  1.00  0.71           O  
ATOM   1675  N   LEU A 231      27.811 -28.410 -84.318  1.00  0.70           N  
ATOM   1676  CA  LEU A 231      27.055 -27.967 -83.169  1.00  0.70           C  
ATOM   1677  C   LEU A 231      25.584 -27.690 -83.427  1.00  0.70           C  
ATOM   1678  O   LEU A 231      24.770 -27.884 -82.528  1.00  0.70           O  
ATOM   1679  CB  LEU A 231      27.707 -26.712 -82.534  1.00  0.70           C  
ATOM   1680  CG  LEU A 231      29.155 -26.933 -82.043  1.00  0.70           C  
ATOM   1681  CD1 LEU A 231      29.768 -25.621 -81.538  1.00  0.70           C  
ATOM   1682  CD2 LEU A 231      29.228 -27.987 -80.929  1.00  0.70           C  
ATOM   1683  N   LEU A 232      25.185 -27.226 -84.635  1.00  0.69           N  
ATOM   1684  CA  LEU A 232      23.838 -26.709 -84.888  1.00  0.69           C  
ATOM   1685  C   LEU A 232      22.666 -27.626 -84.518  1.00  0.69           C  
ATOM   1686  O   LEU A 232      21.763 -27.099 -83.867  1.00  0.69           O  
ATOM   1687  CB  LEU A 232      23.604 -26.222 -86.350  1.00  0.69           C  
ATOM   1688  CG  LEU A 232      24.210 -24.855 -86.722  1.00  0.69           C  
ATOM   1689  CD1 LEU A 232      25.730 -24.910 -86.825  1.00  0.69           C  
ATOM   1690  CD2 LEU A 232      23.633 -24.368 -88.060  1.00  0.69           C  
ATOM   1691  N   PRO A 233      22.565 -28.932 -84.807  1.00  0.74           N  
ATOM   1692  CA  PRO A 233      21.394 -29.730 -84.428  1.00  0.74           C  
ATOM   1693  C   PRO A 233      21.193 -29.816 -82.926  1.00  0.74           C  
ATOM   1694  O   PRO A 233      20.064 -29.741 -82.443  1.00  0.74           O  
ATOM   1695  CB  PRO A 233      21.670 -31.112 -85.049  1.00  0.74           C  
ATOM   1696  CG  PRO A 233      22.586 -30.803 -86.237  1.00  0.74           C  
ATOM   1697  CD  PRO A 233      23.461 -29.676 -85.698  1.00  0.74           C  
ATOM   1698  N   LEU A 234      22.298 -29.954 -82.173  1.00  0.76           N  
ATOM   1699  CA  LEU A 234      22.320 -29.922 -80.727  1.00  0.76           C  
ATOM   1700  C   LEU A 234      21.976 -28.534 -80.193  1.00  0.76           C  
ATOM   1701  O   LEU A 234      21.119 -28.367 -79.327  1.00  0.76           O  
ATOM   1702  CB  LEU A 234      23.754 -30.334 -80.304  1.00  0.76           C  
ATOM   1703  CG  LEU A 234      24.020 -30.703 -78.829  1.00  0.76           C  
ATOM   1704  CD1 LEU A 234      25.482 -31.141 -78.717  1.00  0.76           C  
ATOM   1705  CD2 LEU A 234      23.768 -29.594 -77.804  1.00  0.76           C  
ATOM   1706  N   LEU A 235      22.627 -27.491 -80.747  1.00  0.77           N  
ATOM   1707  CA  LEU A 235      22.524 -26.107 -80.323  1.00  0.77           C  
ATOM   1708  C   LEU A 235      21.125 -25.533 -80.474  1.00  0.77           C  
ATOM   1709  O   LEU A 235      20.598 -24.909 -79.555  1.00  0.77           O  
ATOM   1710  CB  LEU A 235      23.529 -25.261 -81.144  1.00  0.77           C  
ATOM   1711  CG  LEU A 235      23.812 -23.844 -80.615  1.00  0.77           C  
ATOM   1712  CD1 LEU A 235      24.685 -23.884 -79.351  1.00  0.77           C  
ATOM   1713  CD2 LEU A 235      24.496 -23.004 -81.705  1.00  0.77           C  
ATOM   1714  N   GLU A 236      20.472 -25.800 -81.623  1.00  0.76           N  
ATOM   1715  CA  GLU A 236      19.094 -25.439 -81.911  1.00  0.76           C  
ATOM   1716  C   GLU A 236      18.116 -26.102 -80.952  1.00  0.76           C  
ATOM   1717  O   GLU A 236      17.206 -25.497 -80.385  1.00  0.76           O  
ATOM   1718  CB  GLU A 236      18.774 -25.897 -83.356  1.00  0.76           C  
ATOM   1719  CG  GLU A 236      17.414 -25.413 -83.911  1.00  0.76           C  
ATOM   1720  CD  GLU A 236      17.391 -23.897 -84.084  1.00  0.76           C  
ATOM   1721  OE1 GLU A 236      18.274 -23.381 -84.816  1.00  0.76           O  
ATOM   1722  OE2 GLU A 236      16.489 -23.253 -83.493  1.00  0.76           O  
ATOM   1723  N   LYS A 237      18.324 -27.406 -80.681  1.00  0.74           N  
ATOM   1724  CA  LYS A 237      17.517 -28.139 -79.733  1.00  0.74           C  
ATOM   1725  C   LYS A 237      17.658 -27.652 -78.289  1.00  0.74           C  
ATOM   1726  O   LYS A 237      16.673 -27.568 -77.560  1.00  0.74           O  
ATOM   1727  CB  LYS A 237      17.778 -29.658 -79.869  1.00  0.74           C  
ATOM   1728  CG  LYS A 237      16.744 -30.547 -79.159  1.00  0.74           C  
ATOM   1729  CD  LYS A 237      15.317 -30.468 -79.734  1.00  0.74           C  
ATOM   1730  CE  LYS A 237      14.303 -31.236 -78.878  1.00  0.74           C  
ATOM   1731  NZ  LYS A 237      12.945 -31.120 -79.455  1.00  0.74           N  
ATOM   1732  N   VAL A 238      18.879 -27.280 -77.845  1.00  0.80           N  
ATOM   1733  CA  VAL A 238      19.109 -26.588 -76.577  1.00  0.80           C  
ATOM   1734  C   VAL A 238      18.450 -25.216 -76.524  1.00  0.80           C  
ATOM   1735  O   VAL A 238      17.816 -24.868 -75.528  1.00  0.80           O  
ATOM   1736  CB  VAL A 238      20.598 -26.467 -76.255  1.00  0.80           C  
ATOM   1737  CG1 VAL A 238      20.858 -25.581 -75.019  1.00  0.80           C  
ATOM   1738  CG2 VAL A 238      21.144 -27.877 -75.973  1.00  0.80           C  
ATOM   1739  N   ALA A 239      18.534 -24.415 -77.607  1.00  0.77           N  
ATOM   1740  CA  ALA A 239      17.895 -23.115 -77.702  1.00  0.77           C  
ATOM   1741  C   ALA A 239      16.376 -23.183 -77.551  1.00  0.77           C  
ATOM   1742  O   ALA A 239      15.779 -22.413 -76.802  1.00  0.77           O  
ATOM   1743  CB  ALA A 239      18.270 -22.459 -79.046  1.00  0.77           C  
ATOM   1744  N   GLY A 240      15.725 -24.174 -78.200  1.00  0.76           N  
ATOM   1745  CA  GLY A 240      14.303 -24.457 -78.007  1.00  0.76           C  
ATOM   1746  C   GLY A 240      13.908 -24.965 -76.635  1.00  0.76           C  
ATOM   1747  O   GLY A 240      12.780 -24.766 -76.197  1.00  0.76           O  
ATOM   1748  N   THR A 241      14.820 -25.652 -75.920  1.00  0.78           N  
ATOM   1749  CA  THR A 241      14.652 -26.029 -74.510  1.00  0.78           C  
ATOM   1750  C   THR A 241      14.746 -24.837 -73.570  1.00  0.78           C  
ATOM   1751  O   THR A 241      14.028 -24.739 -72.577  1.00  0.78           O  
ATOM   1752  CB  THR A 241      15.670 -27.076 -74.057  1.00  0.78           C  
ATOM   1753  OG1 THR A 241      15.527 -28.256 -74.834  1.00  0.78           O  
ATOM   1754  CG2 THR A 241      15.466 -27.513 -72.598  1.00  0.78           C  
ATOM   1755  N   GLY A 242      15.669 -23.890 -73.845  1.00  0.80           N  
ATOM   1756  CA  GLY A 242      15.853 -22.677 -73.048  1.00  0.80           C  
ATOM   1757  C   GLY A 242      16.706 -22.841 -71.813  1.00  0.80           C  
ATOM   1758  O   GLY A 242      16.853 -21.920 -71.014  1.00  0.80           O  
ATOM   1759  N   LYS A 243      17.307 -24.025 -71.620  1.00  0.81           N  
ATOM   1760  CA  LYS A 243      18.199 -24.314 -70.512  1.00  0.81           C  
ATOM   1761  C   LYS A 243      19.659 -24.188 -70.958  1.00  0.81           C  
ATOM   1762  O   LYS A 243      19.954 -24.502 -72.111  1.00  0.81           O  
ATOM   1763  CB  LYS A 243      17.939 -25.728 -69.949  1.00  0.81           C  
ATOM   1764  CG  LYS A 243      16.682 -25.812 -69.062  1.00  0.81           C  
ATOM   1765  CD  LYS A 243      16.948 -25.380 -67.602  1.00  0.81           C  
ATOM   1766  CE  LYS A 243      16.061 -24.260 -67.035  1.00  0.81           C  
ATOM   1767  NZ  LYS A 243      16.308 -24.065 -65.586  1.00  0.81           N  
ATOM   1768  N   PRO A 244      20.606 -23.713 -70.146  1.00  0.85           N  
ATOM   1769  CA  PRO A 244      22.014 -23.603 -70.535  1.00  0.85           C  
ATOM   1770  C   PRO A 244      22.737 -24.899 -70.896  1.00  0.85           C  
ATOM   1771  O   PRO A 244      22.290 -25.984 -70.530  1.00  0.85           O  
ATOM   1772  CB  PRO A 244      22.674 -22.935 -69.316  1.00  0.85           C  
ATOM   1773  CG  PRO A 244      21.543 -22.187 -68.614  1.00  0.85           C  
ATOM   1774  CD  PRO A 244      20.358 -23.122 -68.827  1.00  0.85           C  
ATOM   1775  N   LEU A 245      23.885 -24.790 -71.598  1.00  0.85           N  
ATOM   1776  CA  LEU A 245      24.714 -25.917 -71.999  1.00  0.85           C  
ATOM   1777  C   LEU A 245      26.169 -25.752 -71.557  1.00  0.85           C  
ATOM   1778  O   LEU A 245      26.817 -24.733 -71.783  1.00  0.85           O  
ATOM   1779  CB  LEU A 245      24.662 -26.085 -73.541  1.00  0.85           C  
ATOM   1780  CG  LEU A 245      25.478 -27.245 -74.159  1.00  0.85           C  
ATOM   1781  CD1 LEU A 245      24.969 -28.627 -73.727  1.00  0.85           C  
ATOM   1782  CD2 LEU A 245      25.459 -27.146 -75.691  1.00  0.85           C  
ATOM   1783  N   LEU A 246      26.752 -26.783 -70.927  1.00  0.88           N  
ATOM   1784  CA  LEU A 246      28.185 -26.894 -70.724  1.00  0.88           C  
ATOM   1785  C   LEU A 246      28.765 -27.773 -71.816  1.00  0.88           C  
ATOM   1786  O   LEU A 246      28.313 -28.894 -72.043  1.00  0.88           O  
ATOM   1787  CB  LEU A 246      28.495 -27.498 -69.331  1.00  0.88           C  
ATOM   1788  CG  LEU A 246      29.956 -27.928 -69.054  1.00  0.88           C  
ATOM   1789  CD1 LEU A 246      30.961 -26.772 -69.101  1.00  0.88           C  
ATOM   1790  CD2 LEU A 246      30.049 -28.617 -67.690  1.00  0.88           C  
ATOM   1791  N   ILE A 247      29.794 -27.283 -72.531  1.00  0.86           N  
ATOM   1792  CA  ILE A 247      30.503 -28.053 -73.534  1.00  0.86           C  
ATOM   1793  C   ILE A 247      31.886 -28.346 -73.006  1.00  0.86           C  
ATOM   1794  O   ILE A 247      32.722 -27.454 -72.855  1.00  0.86           O  
ATOM   1795  CB  ILE A 247      30.623 -27.323 -74.874  1.00  0.86           C  
ATOM   1796  CG1 ILE A 247      29.216 -27.007 -75.438  1.00  0.86           C  
ATOM   1797  CG2 ILE A 247      31.471 -28.172 -75.856  1.00  0.86           C  
ATOM   1798  CD1 ILE A 247      29.234 -26.130 -76.696  1.00  0.86           C  
ATOM   1799  N   VAL A 248      32.174 -29.633 -72.742  1.00  0.89           N  
ATOM   1800  CA  VAL A 248      33.513 -30.078 -72.423  1.00  0.89           C  
ATOM   1801  C   VAL A 248      33.966 -31.001 -73.544  1.00  0.89           C  
ATOM   1802  O   VAL A 248      33.298 -31.956 -73.944  1.00  0.89           O  
ATOM   1803  CB  VAL A 248      33.639 -30.656 -71.015  1.00  0.89           C  
ATOM   1804  CG1 VAL A 248      32.654 -31.802 -70.768  1.00  0.89           C  
ATOM   1805  CG2 VAL A 248      35.083 -31.097 -70.733  1.00  0.89           C  
ATOM   1806  N   ALA A 249      35.118 -30.666 -74.143  1.00  0.86           N  
ATOM   1807  CA  ALA A 249      35.589 -31.250 -75.379  1.00  0.86           C  
ATOM   1808  C   ALA A 249      37.083 -31.437 -75.248  1.00  0.86           C  
ATOM   1809  O   ALA A 249      37.646 -31.090 -74.213  1.00  0.86           O  
ATOM   1810  CB  ALA A 249      35.265 -30.321 -76.567  1.00  0.86           C  
ATOM   1811  N   GLU A 250      37.812 -31.969 -76.258  1.00  0.73           N  
ATOM   1812  CA  GLU A 250      39.272 -31.947 -76.176  1.00  0.73           C  
ATOM   1813  C   GLU A 250      39.811 -30.522 -76.070  1.00  0.73           C  
ATOM   1814  O   GLU A 250      40.629 -30.190 -75.207  1.00  0.73           O  
ATOM   1815  CB  GLU A 250      39.969 -32.594 -77.399  1.00  0.73           C  
ATOM   1816  CG  GLU A 250      41.473 -32.777 -77.102  1.00  0.73           C  
ATOM   1817  CD  GLU A 250      42.401 -33.268 -78.206  1.00  0.73           C  
ATOM   1818  OE1 GLU A 250      43.355 -33.990 -77.805  1.00  0.73           O  
ATOM   1819  OE2 GLU A 250      42.249 -32.850 -79.379  1.00  0.73           O  
ATOM   1820  N   ASP A 251      39.253 -29.661 -76.932  1.00  0.77           N  
ATOM   1821  CA  ASP A 251      39.494 -28.253 -76.998  1.00  0.77           C  
ATOM   1822  C   ASP A 251      38.316 -27.674 -77.754  1.00  0.77           C  
ATOM   1823  O   ASP A 251      37.602 -28.398 -78.455  1.00  0.77           O  
ATOM   1824  CB  ASP A 251      40.805 -27.974 -77.771  1.00  0.77           C  
ATOM   1825  CG  ASP A 251      41.776 -27.268 -76.883  1.00  0.77           C  
ATOM   1826  OD1 ASP A 251      41.430 -26.168 -76.376  1.00  0.77           O  
ATOM   1827  OD2 ASP A 251      42.897 -27.779 -76.637  1.00  0.77           O  
ATOM   1828  N   VAL A 252      38.094 -26.354 -77.631  1.00  0.81           N  
ATOM   1829  CA  VAL A 252      37.154 -25.630 -78.470  1.00  0.81           C  
ATOM   1830  C   VAL A 252      37.889 -24.404 -78.972  1.00  0.81           C  
ATOM   1831  O   VAL A 252      38.285 -23.542 -78.191  1.00  0.81           O  
ATOM   1832  CB  VAL A 252      35.858 -25.215 -77.776  1.00  0.81           C  
ATOM   1833  CG1 VAL A 252      34.898 -24.579 -78.805  1.00  0.81           C  
ATOM   1834  CG2 VAL A 252      35.194 -26.445 -77.124  1.00  0.81           C  
ATOM   1835  N   GLU A 253      38.112 -24.314 -80.292  1.00  0.75           N  
ATOM   1836  CA  GLU A 253      38.972 -23.310 -80.886  1.00  0.75           C  
ATOM   1837  C   GLU A 253      38.295 -22.685 -82.102  1.00  0.75           C  
ATOM   1838  O   GLU A 253      37.068 -22.602 -82.169  1.00  0.75           O  
ATOM   1839  CB  GLU A 253      40.338 -23.950 -81.262  1.00  0.75           C  
ATOM   1840  CG  GLU A 253      40.221 -25.119 -82.276  1.00  0.75           C  
ATOM   1841  CD  GLU A 253      41.554 -25.514 -82.892  1.00  0.75           C  
ATOM   1842  OE1 GLU A 253      42.209 -24.637 -83.500  1.00  0.75           O  
ATOM   1843  OE2 GLU A 253      41.896 -26.725 -82.826  1.00  0.75           O  
ATOM   1844  N   GLY A 254      39.101 -22.231 -83.094  1.00  0.75           N  
ATOM   1845  CA  GLY A 254      38.679 -21.688 -84.383  1.00  0.75           C  
ATOM   1846  C   GLY A 254      37.584 -20.653 -84.374  1.00  0.75           C  
ATOM   1847  O   GLY A 254      37.499 -19.794 -83.498  1.00  0.75           O  
ATOM   1848  N   GLU A 255      36.705 -20.697 -85.394  1.00  0.70           N  
ATOM   1849  CA  GLU A 255      35.520 -19.863 -85.431  1.00  0.70           C  
ATOM   1850  C   GLU A 255      34.498 -20.279 -84.389  1.00  0.70           C  
ATOM   1851  O   GLU A 255      33.797 -19.428 -83.855  1.00  0.70           O  
ATOM   1852  CB  GLU A 255      34.906 -19.751 -86.853  1.00  0.70           C  
ATOM   1853  CG  GLU A 255      34.443 -21.070 -87.525  1.00  0.70           C  
ATOM   1854  CD  GLU A 255      33.049 -21.563 -87.137  1.00  0.70           C  
ATOM   1855  OE1 GLU A 255      32.324 -20.892 -86.359  1.00  0.70           O  
ATOM   1856  OE2 GLU A 255      32.697 -22.665 -87.638  1.00  0.70           O  
ATOM   1857  N   ALA A 256      34.448 -21.577 -84.009  1.00  0.73           N  
ATOM   1858  CA  ALA A 256      33.475 -22.111 -83.076  1.00  0.73           C  
ATOM   1859  C   ALA A 256      33.476 -21.442 -81.705  1.00  0.73           C  
ATOM   1860  O   ALA A 256      32.431 -21.118 -81.149  1.00  0.73           O  
ATOM   1861  CB  ALA A 256      33.706 -23.623 -82.905  1.00  0.73           C  
ATOM   1862  N   LEU A 257      34.657 -21.165 -81.118  1.00  0.75           N  
ATOM   1863  CA  LEU A 257      34.741 -20.417 -79.870  1.00  0.75           C  
ATOM   1864  C   LEU A 257      34.219 -18.977 -80.009  1.00  0.75           C  
ATOM   1865  O   LEU A 257      33.452 -18.476 -79.182  1.00  0.75           O  
ATOM   1866  CB  LEU A 257      36.202 -20.477 -79.346  1.00  0.75           C  
ATOM   1867  CG  LEU A 257      36.433 -20.237 -77.831  1.00  0.75           C  
ATOM   1868  CD1 LEU A 257      36.192 -18.792 -77.374  1.00  0.75           C  
ATOM   1869  CD2 LEU A 257      35.641 -21.219 -76.955  1.00  0.75           C  
ATOM   1870  N   ALA A 258      34.584 -18.294 -81.113  1.00  0.74           N  
ATOM   1871  CA  ALA A 258      34.115 -16.965 -81.453  1.00  0.74           C  
ATOM   1872  C   ALA A 258      32.609 -16.884 -81.732  1.00  0.74           C  
ATOM   1873  O   ALA A 258      31.908 -15.979 -81.275  1.00  0.74           O  
ATOM   1874  CB  ALA A 258      34.917 -16.451 -82.666  1.00  0.74           C  
ATOM   1875  N   THR A 259      32.048 -17.854 -82.474  1.00  0.72           N  
ATOM   1876  CA  THR A 259      30.616 -17.966 -82.714  1.00  0.72           C  
ATOM   1877  C   THR A 259      29.828 -18.280 -81.453  1.00  0.72           C  
ATOM   1878  O   THR A 259      28.748 -17.733 -81.225  1.00  0.72           O  
ATOM   1879  CB  THR A 259      30.223 -18.884 -83.864  1.00  0.72           C  
ATOM   1880  OG1 THR A 259      30.780 -20.178 -83.746  1.00  0.72           O  
ATOM   1881  CG2 THR A 259      30.750 -18.297 -85.179  1.00  0.72           C  
ATOM   1882  N   LEU A 260      30.364 -19.122 -80.549  1.00  0.75           N  
ATOM   1883  CA  LEU A 260      29.776 -19.375 -79.240  1.00  0.75           C  
ATOM   1884  C   LEU A 260      29.654 -18.141 -78.347  1.00  0.75           C  
ATOM   1885  O   LEU A 260      28.597 -17.911 -77.756  1.00  0.75           O  
ATOM   1886  CB  LEU A 260      30.540 -20.510 -78.504  1.00  0.75           C  
ATOM   1887  CG  LEU A 260      29.896 -21.911 -78.643  1.00  0.75           C  
ATOM   1888  CD1 LEU A 260      28.621 -22.014 -77.799  1.00  0.75           C  
ATOM   1889  CD2 LEU A 260      29.600 -22.333 -80.091  1.00  0.75           C  
ATOM   1890  N   VAL A 261      30.692 -17.277 -78.250  1.00  0.74           N  
ATOM   1891  CA  VAL A 261      30.577 -16.036 -77.481  1.00  0.74           C  
ATOM   1892  C   VAL A 261      29.548 -15.055 -78.036  1.00  0.74           C  
ATOM   1893  O   VAL A 261      28.756 -14.486 -77.282  1.00  0.74           O  
ATOM   1894  CB  VAL A 261      31.911 -15.345 -77.189  1.00  0.74           C  
ATOM   1895  CG1 VAL A 261      32.616 -14.807 -78.444  1.00  0.74           C  
ATOM   1896  CG2 VAL A 261      31.705 -14.200 -76.181  1.00  0.74           C  
ATOM   1897  N   VAL A 262      29.469 -14.857 -79.373  1.00  0.72           N  
ATOM   1898  CA  VAL A 262      28.453 -13.982 -79.950  1.00  0.72           C  
ATOM   1899  C   VAL A 262      27.038 -14.496 -79.733  1.00  0.72           C  
ATOM   1900  O   VAL A 262      26.109 -13.727 -79.513  1.00  0.72           O  
ATOM   1901  CB  VAL A 262      28.673 -13.555 -81.399  1.00  0.72           C  
ATOM   1902  CG1 VAL A 262      30.054 -12.885 -81.518  1.00  0.72           C  
ATOM   1903  CG2 VAL A 262      28.556 -14.733 -82.376  1.00  0.72           C  
ATOM   1904  N   ASN A 263      26.818 -15.823 -79.747  1.00  0.72           N  
ATOM   1905  CA  ASN A 263      25.542 -16.398 -79.357  1.00  0.72           C  
ATOM   1906  C   ASN A 263      25.188 -16.176 -77.884  1.00  0.72           C  
ATOM   1907  O   ASN A 263      24.052 -15.828 -77.560  1.00  0.72           O  
ATOM   1908  CB  ASN A 263      25.501 -17.897 -79.726  1.00  0.72           C  
ATOM   1909  CG  ASN A 263      25.470 -18.010 -81.247  1.00  0.72           C  
ATOM   1910  OD1 ASN A 263      24.885 -17.177 -81.950  1.00  0.72           O  
ATOM   1911  ND2 ASN A 263      26.111 -19.071 -81.785  1.00  0.72           N  
ATOM   1912  N   ALA A 264      26.161 -16.323 -76.964  1.00  0.74           N  
ATOM   1913  CA  ALA A 264      25.968 -16.048 -75.554  1.00  0.74           C  
ATOM   1914  C   ALA A 264      25.636 -14.596 -75.213  1.00  0.74           C  
ATOM   1915  O   ALA A 264      24.711 -14.330 -74.446  1.00  0.74           O  
ATOM   1916  CB  ALA A 264      27.230 -16.477 -74.787  1.00  0.74           C  
ATOM   1917  N   ILE A 265      26.359 -13.617 -75.801  1.00  0.66           N  
ATOM   1918  CA  ILE A 265      26.146 -12.191 -75.552  1.00  0.66           C  
ATOM   1919  C   ILE A 265      24.798 -11.680 -76.066  1.00  0.66           C  
ATOM   1920  O   ILE A 265      24.177 -10.798 -75.479  1.00  0.66           O  
ATOM   1921  CB  ILE A 265      27.327 -11.344 -76.043  1.00  0.66           C  
ATOM   1922  CG1 ILE A 265      27.415  -9.957 -75.364  1.00  0.66           C  
ATOM   1923  CG2 ILE A 265      27.308 -11.186 -77.575  1.00  0.66           C  
ATOM   1924  CD1 ILE A 265      27.849 -10.015 -73.894  1.00  0.66           C  
ATOM   1925  N   ARG A 266      24.275 -12.265 -77.167  1.00  0.52           N  
ATOM   1926  CA  ARG A 266      22.956 -11.944 -77.693  1.00  0.52           C  
ATOM   1927  C   ARG A 266      21.816 -12.562 -76.890  1.00  0.52           C  
ATOM   1928  O   ARG A 266      20.664 -12.176 -77.066  1.00  0.52           O  
ATOM   1929  CB  ARG A 266      22.789 -12.512 -79.126  1.00  0.52           C  
ATOM   1930  CG  ARG A 266      23.696 -11.897 -80.207  1.00  0.52           C  
ATOM   1931  CD  ARG A 266      23.735 -12.808 -81.439  1.00  0.52           C  
ATOM   1932  NE  ARG A 266      24.792 -12.301 -82.370  1.00  0.52           N  
ATOM   1933  CZ  ARG A 266      25.343 -13.044 -83.339  1.00  0.52           C  
ATOM   1934  NH1 ARG A 266      25.052 -14.334 -83.493  1.00  0.52           N  
ATOM   1935  NH2 ARG A 266      26.218 -12.483 -84.172  1.00  0.52           N  
ATOM   1936  N   LYS A 267      22.116 -13.569 -76.038  1.00  0.64           N  
ATOM   1937  CA  LYS A 267      21.153 -14.297 -75.225  1.00  0.64           C  
ATOM   1938  C   LYS A 267      20.249 -15.229 -76.044  1.00  0.64           C  
ATOM   1939  O   LYS A 267      19.131 -15.561 -75.660  1.00  0.64           O  
ATOM   1940  CB  LYS A 267      20.370 -13.344 -74.275  1.00  0.64           C  
ATOM   1941  CG  LYS A 267      19.675 -14.007 -73.073  1.00  0.64           C  
ATOM   1942  CD  LYS A 267      18.848 -12.990 -72.269  1.00  0.64           C  
ATOM   1943  CE  LYS A 267      17.914 -13.653 -71.255  1.00  0.64           C  
ATOM   1944  NZ  LYS A 267      17.116 -12.623 -70.553  1.00  0.64           N  
ATOM   1945  N   THR A 268      20.740 -15.731 -77.199  1.00  0.69           N  
ATOM   1946  CA  THR A 268      20.063 -16.793 -77.958  1.00  0.69           C  
ATOM   1947  C   THR A 268      20.209 -18.139 -77.252  1.00  0.69           C  
ATOM   1948  O   THR A 268      19.281 -18.940 -77.184  1.00  0.69           O  
ATOM   1949  CB  THR A 268      20.420 -16.820 -79.456  1.00  0.69           C  
ATOM   1950  OG1 THR A 268      19.974 -17.996 -80.117  1.00  0.69           O  
ATOM   1951  CG2 THR A 268      21.927 -16.700 -79.699  1.00  0.69           C  
ATOM   1952  N   LEU A 269      21.369 -18.380 -76.615  1.00  0.71           N  
ATOM   1953  CA  LEU A 269      21.526 -19.483 -75.694  1.00  0.71           C  
ATOM   1954  C   LEU A 269      22.601 -19.106 -74.694  1.00  0.71           C  
ATOM   1955  O   LEU A 269      23.297 -18.107 -74.854  1.00  0.71           O  
ATOM   1956  CB  LEU A 269      21.765 -20.888 -76.349  1.00  0.71           C  
ATOM   1957  CG  LEU A 269      22.932 -21.116 -77.353  1.00  0.71           C  
ATOM   1958  CD1 LEU A 269      22.638 -20.564 -78.755  1.00  0.71           C  
ATOM   1959  CD2 LEU A 269      24.315 -20.658 -76.869  1.00  0.71           C  
ATOM   1960  N   LYS A 270      22.770 -19.890 -73.614  1.00  0.70           N  
ATOM   1961  CA  LYS A 270      23.898 -19.740 -72.713  1.00  0.70           C  
ATOM   1962  C   LYS A 270      24.729 -20.997 -72.842  1.00  0.70           C  
ATOM   1963  O   LYS A 270      24.289 -22.079 -72.461  1.00  0.70           O  
ATOM   1964  CB  LYS A 270      23.466 -19.597 -71.225  1.00  0.70           C  
ATOM   1965  CG  LYS A 270      23.107 -18.169 -70.766  1.00  0.70           C  
ATOM   1966  CD  LYS A 270      24.316 -17.210 -70.791  1.00  0.70           C  
ATOM   1967  CE  LYS A 270      24.268 -16.020 -69.817  1.00  0.70           C  
ATOM   1968  NZ  LYS A 270      24.437 -16.483 -68.420  1.00  0.70           N  
ATOM   1969  N   ALA A 271      25.957 -20.887 -73.380  1.00  0.78           N  
ATOM   1970  CA  ALA A 271      26.811 -22.038 -73.543  1.00  0.78           C  
ATOM   1971  C   ALA A 271      28.256 -21.697 -73.244  1.00  0.78           C  
ATOM   1972  O   ALA A 271      28.785 -20.679 -73.685  1.00  0.78           O  
ATOM   1973  CB  ALA A 271      26.678 -22.638 -74.953  1.00  0.78           C  
ATOM   1974  N   VAL A 272      28.915 -22.564 -72.457  1.00  0.84           N  
ATOM   1975  CA  VAL A 272      30.267 -22.374 -71.963  1.00  0.84           C  
ATOM   1976  C   VAL A 272      31.150 -23.487 -72.489  1.00  0.84           C  
ATOM   1977  O   VAL A 272      30.734 -24.639 -72.592  1.00  0.84           O  
ATOM   1978  CB  VAL A 272      30.299 -22.312 -70.436  1.00  0.84           C  
ATOM   1979  CG1 VAL A 272      29.630 -23.541 -69.802  1.00  0.84           C  
ATOM   1980  CG2 VAL A 272      31.725 -22.120 -69.883  1.00  0.84           C  
ATOM   1981  N   ALA A 273      32.401 -23.158 -72.868  1.00  0.86           N  
ATOM   1982  CA  ALA A 273      33.336 -24.097 -73.446  1.00  0.86           C  
ATOM   1983  C   ALA A 273      34.568 -24.250 -72.566  1.00  0.86           C  
ATOM   1984  O   ALA A 273      35.141 -23.266 -72.090  1.00  0.86           O  
ATOM   1985  CB  ALA A 273      33.759 -23.608 -74.843  1.00  0.86           C  
ATOM   1986  N   VAL A 274      34.991 -25.509 -72.335  1.00  0.81           N  
ATOM   1987  CA  VAL A 274      36.111 -25.843 -71.474  1.00  0.81           C  
ATOM   1988  C   VAL A 274      36.856 -27.055 -72.037  1.00  0.81           C  
ATOM   1989  O   VAL A 274      36.264 -27.980 -72.595  1.00  0.81           O  
ATOM   1990  CB  VAL A 274      35.642 -26.057 -70.030  1.00  0.81           C  
ATOM   1991  CG1 VAL A 274      34.633 -27.212 -69.906  1.00  0.81           C  
ATOM   1992  CG2 VAL A 274      36.824 -26.287 -69.078  1.00  0.81           C  
ATOM   1993  N   LYS A 275      38.210 -27.074 -71.955  1.00  0.75           N  
ATOM   1994  CA  LYS A 275      38.997 -28.265 -72.265  1.00  0.75           C  
ATOM   1995  C   LYS A 275      38.749 -29.381 -71.253  1.00  0.75           C  
ATOM   1996  O   LYS A 275      38.745 -29.154 -70.045  1.00  0.75           O  
ATOM   1997  CB  LYS A 275      40.532 -28.012 -72.242  1.00  0.75           C  
ATOM   1998  CG  LYS A 275      41.089 -27.018 -73.271  1.00  0.75           C  
ATOM   1999  CD  LYS A 275      42.424 -26.413 -72.782  1.00  0.75           C  
ATOM   2000  CE  LYS A 275      43.077 -25.346 -73.677  1.00  0.75           C  
ATOM   2001  NZ  LYS A 275      43.612 -25.933 -74.907  1.00  0.75           N  
ATOM   2002  N   GLY A 276      38.575 -30.634 -71.712  1.00  0.80           N  
ATOM   2003  CA  GLY A 276      38.517 -31.803 -70.843  1.00  0.80           C  
ATOM   2004  C   GLY A 276      39.736 -31.990 -69.958  1.00  0.80           C  
ATOM   2005  O   GLY A 276      40.846 -31.700 -70.410  1.00  0.80           O  
ATOM   2006  N   PRO A 277      39.611 -32.483 -68.728  1.00  0.73           N  
ATOM   2007  CA  PRO A 277      40.747 -32.649 -67.829  1.00  0.73           C  
ATOM   2008  C   PRO A 277      41.676 -33.773 -68.275  1.00  0.73           C  
ATOM   2009  O   PRO A 277      41.227 -34.734 -68.895  1.00  0.73           O  
ATOM   2010  CB  PRO A 277      40.091 -32.918 -66.459  1.00  0.73           C  
ATOM   2011  CG  PRO A 277      38.720 -33.512 -66.794  1.00  0.73           C  
ATOM   2012  CD  PRO A 277      38.333 -32.761 -68.064  1.00  0.73           C  
ATOM   2013  N   TYR A 278      42.984 -33.653 -67.960  1.00  0.68           N  
ATOM   2014  CA  TYR A 278      44.054 -34.558 -68.367  1.00  0.68           C  
ATOM   2015  C   TYR A 278      44.320 -34.611 -69.885  1.00  0.68           C  
ATOM   2016  O   TYR A 278      43.906 -33.734 -70.634  1.00  0.68           O  
ATOM   2017  CB  TYR A 278      43.920 -35.964 -67.702  1.00  0.68           C  
ATOM   2018  CG  TYR A 278      43.903 -35.841 -66.194  1.00  0.68           C  
ATOM   2019  CD1 TYR A 278      45.091 -35.886 -65.438  1.00  0.68           C  
ATOM   2020  CD2 TYR A 278      42.686 -35.650 -65.519  1.00  0.68           C  
ATOM   2021  CE1 TYR A 278      45.055 -35.754 -64.036  1.00  0.68           C  
ATOM   2022  CE2 TYR A 278      42.662 -35.452 -64.134  1.00  0.68           C  
ATOM   2023  CZ  TYR A 278      43.834 -35.539 -63.383  1.00  0.68           C  
ATOM   2024  OH  TYR A 278      43.734 -35.359 -61.986  1.00  0.68           O  
ATOM   2025  N   PHE A 279      45.111 -35.603 -70.369  1.00  0.54           N  
ATOM   2026  CA  PHE A 279      45.667 -35.602 -71.726  1.00  0.54           C  
ATOM   2027  C   PHE A 279      45.142 -36.724 -72.628  1.00  0.54           C  
ATOM   2028  O   PHE A 279      44.164 -36.543 -73.347  1.00  0.54           O  
ATOM   2029  CB  PHE A 279      47.222 -35.666 -71.662  1.00  0.54           C  
ATOM   2030  CG  PHE A 279      47.782 -34.280 -71.512  1.00  0.54           C  
ATOM   2031  CD1 PHE A 279      47.996 -33.507 -72.665  1.00  0.54           C  
ATOM   2032  CD2 PHE A 279      48.109 -33.736 -70.257  1.00  0.54           C  
ATOM   2033  CE1 PHE A 279      48.536 -32.219 -72.574  1.00  0.54           C  
ATOM   2034  CE2 PHE A 279      48.648 -32.445 -70.162  1.00  0.54           C  
ATOM   2035  CZ  PHE A 279      48.863 -31.688 -71.321  1.00  0.54           C  
ATOM   2036  N   GLY A 280      45.801 -37.909 -72.642  1.00  0.67           N  
ATOM   2037  CA  GLY A 280      45.432 -39.044 -73.501  1.00  0.67           C  
ATOM   2038  C   GLY A 280      44.407 -39.944 -72.863  1.00  0.67           C  
ATOM   2039  O   GLY A 280      43.304 -39.523 -72.530  1.00  0.67           O  
ATOM   2040  N   ASP A 281      44.750 -41.224 -72.630  1.00  0.72           N  
ATOM   2041  CA  ASP A 281      43.889 -42.232 -72.030  1.00  0.72           C  
ATOM   2042  C   ASP A 281      43.306 -41.853 -70.674  1.00  0.72           C  
ATOM   2043  O   ASP A 281      42.163 -42.161 -70.339  1.00  0.72           O  
ATOM   2044  CB  ASP A 281      44.632 -43.575 -71.957  1.00  0.72           C  
ATOM   2045  CG  ASP A 281      44.960 -43.923 -73.392  1.00  0.72           C  
ATOM   2046  OD1 ASP A 281      45.985 -43.381 -73.882  1.00  0.72           O  
ATOM   2047  OD2 ASP A 281      44.123 -44.621 -74.015  1.00  0.72           O  
ATOM   2048  N   ARG A 282      44.074 -41.079 -69.884  1.00  0.68           N  
ATOM   2049  CA  ARG A 282      43.598 -40.443 -68.671  1.00  0.68           C  
ATOM   2050  C   ARG A 282      42.398 -39.514 -68.893  1.00  0.68           C  
ATOM   2051  O   ARG A 282      41.464 -39.519 -68.099  1.00  0.68           O  
ATOM   2052  CB  ARG A 282      44.752 -39.651 -67.989  1.00  0.68           C  
ATOM   2053  CG  ARG A 282      45.862 -40.556 -67.409  1.00  0.68           C  
ATOM   2054  CD  ARG A 282      46.955 -39.822 -66.610  1.00  0.68           C  
ATOM   2055  NE  ARG A 282      47.923 -39.205 -67.588  1.00  0.68           N  
ATOM   2056  CZ  ARG A 282      49.198 -39.588 -67.773  1.00  0.68           C  
ATOM   2057  NH1 ARG A 282      49.757 -40.575 -67.082  1.00  0.68           N  
ATOM   2058  NH2 ARG A 282      49.943 -38.956 -68.680  1.00  0.68           N  
ATOM   2059  N   ARG A 283      42.376 -38.717 -69.985  1.00  0.70           N  
ATOM   2060  CA  ARG A 283      41.266 -37.837 -70.325  1.00  0.70           C  
ATOM   2061  C   ARG A 283      40.006 -38.564 -70.747  1.00  0.70           C  
ATOM   2062  O   ARG A 283      38.916 -38.250 -70.278  1.00  0.70           O  
ATOM   2063  CB  ARG A 283      41.679 -36.862 -71.450  1.00  0.70           C  
ATOM   2064  CG  ARG A 283      40.578 -35.899 -71.940  1.00  0.70           C  
ATOM   2065  CD  ARG A 283      41.076 -34.487 -72.272  1.00  0.70           C  
ATOM   2066  NE  ARG A 283      42.162 -34.576 -73.295  1.00  0.70           N  
ATOM   2067  CZ  ARG A 283      42.664 -33.505 -73.924  1.00  0.70           C  
ATOM   2068  NH1 ARG A 283      42.209 -32.282 -73.660  1.00  0.70           N  
ATOM   2069  NH2 ARG A 283      43.579 -33.681 -74.874  1.00  0.70           N  
ATOM   2070  N   LYS A 284      40.108 -39.590 -71.619  1.00  0.75           N  
ATOM   2071  CA  LYS A 284      38.951 -40.390 -72.000  1.00  0.75           C  
ATOM   2072  C   LYS A 284      38.355 -41.170 -70.836  1.00  0.75           C  
ATOM   2073  O   LYS A 284      37.139 -41.294 -70.732  1.00  0.75           O  
ATOM   2074  CB  LYS A 284      39.167 -41.241 -73.285  1.00  0.75           C  
ATOM   2075  CG  LYS A 284      40.409 -42.144 -73.350  1.00  0.75           C  
ATOM   2076  CD  LYS A 284      40.291 -43.537 -72.699  1.00  0.75           C  
ATOM   2077  CE  LYS A 284      39.931 -44.675 -73.663  1.00  0.75           C  
ATOM   2078  NZ  LYS A 284      38.611 -44.438 -74.291  1.00  0.75           N  
ATOM   2079  N   ALA A 285      39.186 -41.670 -69.897  1.00  0.82           N  
ATOM   2080  CA  ALA A 285      38.698 -42.208 -68.642  1.00  0.82           C  
ATOM   2081  C   ALA A 285      38.000 -41.177 -67.745  1.00  0.82           C  
ATOM   2082  O   ALA A 285      36.894 -41.412 -67.271  1.00  0.82           O  
ATOM   2083  CB  ALA A 285      39.878 -42.852 -67.888  1.00  0.82           C  
ATOM   2084  N   PHE A 286      38.595 -39.980 -67.544  1.00  0.77           N  
ATOM   2085  CA  PHE A 286      38.007 -38.905 -66.750  1.00  0.77           C  
ATOM   2086  C   PHE A 286      36.700 -38.355 -67.324  1.00  0.77           C  
ATOM   2087  O   PHE A 286      35.754 -38.045 -66.603  1.00  0.77           O  
ATOM   2088  CB  PHE A 286      39.025 -37.741 -66.575  1.00  0.77           C  
ATOM   2089  CG  PHE A 286      39.325 -37.501 -65.122  1.00  0.77           C  
ATOM   2090  CD1 PHE A 286      38.474 -36.702 -64.341  1.00  0.77           C  
ATOM   2091  CD2 PHE A 286      40.468 -38.063 -64.529  1.00  0.77           C  
ATOM   2092  CE1 PHE A 286      38.769 -36.458 -62.993  1.00  0.77           C  
ATOM   2093  CE2 PHE A 286      40.767 -37.813 -63.182  1.00  0.77           C  
ATOM   2094  CZ  PHE A 286      39.915 -37.014 -62.413  1.00  0.77           C  
ATOM   2095  N   LEU A 287      36.611 -38.217 -68.660  1.00  0.80           N  
ATOM   2096  CA  LEU A 287      35.405 -37.808 -69.358  1.00  0.80           C  
ATOM   2097  C   LEU A 287      34.258 -38.815 -69.218  1.00  0.80           C  
ATOM   2098  O   LEU A 287      33.100 -38.439 -69.038  1.00  0.80           O  
ATOM   2099  CB  LEU A 287      35.737 -37.511 -70.842  1.00  0.80           C  
ATOM   2100  CG  LEU A 287      34.708 -36.637 -71.589  1.00  0.80           C  
ATOM   2101  CD1 LEU A 287      34.611 -35.217 -71.014  1.00  0.80           C  
ATOM   2102  CD2 LEU A 287      35.066 -36.537 -73.076  1.00  0.80           C  
ATOM   2103  N   GLU A 288      34.570 -40.129 -69.239  1.00  0.81           N  
ATOM   2104  CA  GLU A 288      33.639 -41.204 -68.920  1.00  0.81           C  
ATOM   2105  C   GLU A 288      33.116 -41.137 -67.485  1.00  0.81           C  
ATOM   2106  O   GLU A 288      31.928 -41.291 -67.199  1.00  0.81           O  
ATOM   2107  CB  GLU A 288      34.340 -42.567 -69.142  1.00  0.81           C  
ATOM   2108  CG  GLU A 288      33.359 -43.746 -69.327  1.00  0.81           C  
ATOM   2109  CD  GLU A 288      32.712 -43.683 -70.709  1.00  0.81           C  
ATOM   2110  OE1 GLU A 288      33.461 -43.883 -71.704  1.00  0.81           O  
ATOM   2111  OE2 GLU A 288      31.484 -43.427 -70.782  1.00  0.81           O  
ATOM   2112  N   ASP A 289      34.013 -40.836 -66.527  1.00  0.79           N  
ATOM   2113  CA  ASP A 289      33.682 -40.606 -65.133  1.00  0.79           C  
ATOM   2114  C   ASP A 289      32.755 -39.397 -64.936  1.00  0.79           C  
ATOM   2115  O   ASP A 289      31.847 -39.417 -64.106  1.00  0.79           O  
ATOM   2116  CB  ASP A 289      34.968 -40.488 -64.274  1.00  0.79           C  
ATOM   2117  CG  ASP A 289      35.783 -41.767 -64.266  1.00  0.79           C  
ATOM   2118  OD1 ASP A 289      35.400 -42.796 -64.879  1.00  0.79           O  
ATOM   2119  OD2 ASP A 289      36.850 -41.766 -63.606  1.00  0.79           O  
ATOM   2120  N   LEU A 290      32.906 -38.317 -65.736  1.00  0.81           N  
ATOM   2121  CA  LEU A 290      31.905 -37.258 -65.807  1.00  0.81           C  
ATOM   2122  C   LEU A 290      30.541 -37.727 -66.312  1.00  0.81           C  
ATOM   2123  O   LEU A 290      29.512 -37.319 -65.776  1.00  0.81           O  
ATOM   2124  CB  LEU A 290      32.345 -36.057 -66.690  1.00  0.81           C  
ATOM   2125  CG  LEU A 290      33.495 -35.198 -66.127  1.00  0.81           C  
ATOM   2126  CD1 LEU A 290      33.818 -34.042 -67.086  1.00  0.81           C  
ATOM   2127  CD2 LEU A 290      33.157 -34.620 -64.747  1.00  0.81           C  
ATOM   2128  N   ALA A 291      30.485 -38.601 -67.339  1.00  0.87           N  
ATOM   2129  CA  ALA A 291      29.244 -39.084 -67.927  1.00  0.87           C  
ATOM   2130  C   ALA A 291      28.333 -39.817 -66.962  1.00  0.87           C  
ATOM   2131  O   ALA A 291      27.138 -39.544 -66.882  1.00  0.87           O  
ATOM   2132  CB  ALA A 291      29.553 -40.014 -69.116  1.00  0.87           C  
ATOM   2133  N   VAL A 292      28.888 -40.727 -66.143  1.00  0.81           N  
ATOM   2134  CA  VAL A 292      28.115 -41.453 -65.149  1.00  0.81           C  
ATOM   2135  C   VAL A 292      27.497 -40.556 -64.072  1.00  0.81           C  
ATOM   2136  O   VAL A 292      26.355 -40.745 -63.660  1.00  0.81           O  
ATOM   2137  CB  VAL A 292      28.907 -42.624 -64.576  1.00  0.81           C  
ATOM   2138  CG1 VAL A 292      30.069 -42.173 -63.675  1.00  0.81           C  
ATOM   2139  CG2 VAL A 292      27.955 -43.573 -63.836  1.00  0.81           C  
ATOM   2140  N   VAL A 293      28.229 -39.514 -63.622  1.00  0.81           N  
ATOM   2141  CA  VAL A 293      27.746 -38.500 -62.693  1.00  0.81           C  
ATOM   2142  C   VAL A 293      26.653 -37.617 -63.278  1.00  0.81           C  
ATOM   2143  O   VAL A 293      25.711 -37.230 -62.590  1.00  0.81           O  
ATOM   2144  CB  VAL A 293      28.891 -37.633 -62.170  1.00  0.81           C  
ATOM   2145  CG1 VAL A 293      28.384 -36.554 -61.187  1.00  0.81           C  
ATOM   2146  CG2 VAL A 293      29.906 -38.540 -61.450  1.00  0.81           C  
ATOM   2147  N   THR A 294      26.740 -37.245 -64.568  1.00  0.84           N  
ATOM   2148  CA  THR A 294      25.787 -36.310 -65.164  1.00  0.84           C  
ATOM   2149  C   THR A 294      24.619 -36.999 -65.838  1.00  0.84           C  
ATOM   2150  O   THR A 294      23.609 -36.365 -66.129  1.00  0.84           O  
ATOM   2151  CB  THR A 294      26.443 -35.369 -66.169  1.00  0.84           C  
ATOM   2152  OG1 THR A 294      27.011 -36.061 -67.274  1.00  0.84           O  
ATOM   2153  CG2 THR A 294      27.581 -34.607 -65.474  1.00  0.84           C  
ATOM   2154  N   GLY A 295      24.704 -38.324 -66.071  1.00  0.84           N  
ATOM   2155  CA  GLY A 295      23.659 -39.126 -66.702  1.00  0.84           C  
ATOM   2156  C   GLY A 295      23.697 -39.141 -68.207  1.00  0.84           C  
ATOM   2157  O   GLY A 295      22.839 -39.743 -68.844  1.00  0.84           O  
ATOM   2158  N   GLY A 296      24.697 -38.477 -68.814  1.00  0.87           N  
ATOM   2159  CA  GLY A 296      24.896 -38.460 -70.259  1.00  0.87           C  
ATOM   2160  C   GLY A 296      25.672 -39.636 -70.791  1.00  0.87           C  
ATOM   2161  O   GLY A 296      26.030 -40.568 -70.078  1.00  0.87           O  
ATOM   2162  N   GLN A 297      26.007 -39.587 -72.090  1.00  0.81           N  
ATOM   2163  CA  GLN A 297      26.945 -40.512 -72.698  1.00  0.81           C  
ATOM   2164  C   GLN A 297      28.083 -39.703 -73.284  1.00  0.81           C  
ATOM   2165  O   GLN A 297      27.932 -38.530 -73.626  1.00  0.81           O  
ATOM   2166  CB  GLN A 297      26.306 -41.390 -73.811  1.00  0.81           C  
ATOM   2167  CG  GLN A 297      25.823 -40.576 -75.032  1.00  0.81           C  
ATOM   2168  CD  GLN A 297      25.139 -41.403 -76.118  1.00  0.81           C  
ATOM   2169  OE1 GLN A 297      25.604 -41.477 -77.255  1.00  0.81           O  
ATOM   2170  NE2 GLN A 297      23.978 -42.012 -75.791  1.00  0.81           N  
ATOM   2171  N   VAL A 298      29.278 -40.301 -73.418  1.00  0.86           N  
ATOM   2172  CA  VAL A 298      30.384 -39.617 -74.059  1.00  0.86           C  
ATOM   2173  C   VAL A 298      30.326 -39.812 -75.564  1.00  0.86           C  
ATOM   2174  O   VAL A 298      30.398 -40.937 -76.059  1.00  0.86           O  
ATOM   2175  CB  VAL A 298      31.740 -40.096 -73.569  1.00  0.86           C  
ATOM   2176  CG1 VAL A 298      32.811 -39.114 -74.065  1.00  0.86           C  
ATOM   2177  CG2 VAL A 298      31.775 -40.148 -72.036  1.00  0.86           C  
ATOM   2178  N   VAL A 299      30.221 -38.727 -76.361  1.00  0.81           N  
ATOM   2179  CA  VAL A 299      30.264 -38.875 -77.808  1.00  0.81           C  
ATOM   2180  C   VAL A 299      31.709 -38.971 -78.277  1.00  0.81           C  
ATOM   2181  O   VAL A 299      32.579 -38.158 -77.959  1.00  0.81           O  
ATOM   2182  CB  VAL A 299      29.433 -37.877 -78.608  1.00  0.81           C  
ATOM   2183  CG1 VAL A 299      27.954 -38.081 -78.231  1.00  0.81           C  
ATOM   2184  CG2 VAL A 299      29.850 -36.418 -78.368  1.00  0.81           C  
ATOM   2185  N   ASN A 300      32.012 -40.066 -78.996  1.00  0.76           N  
ATOM   2186  CA  ASN A 300      33.362 -40.419 -79.364  1.00  0.76           C  
ATOM   2187  C   ASN A 300      33.421 -40.722 -80.865  1.00  0.76           C  
ATOM   2188  O   ASN A 300      32.902 -41.761 -81.283  1.00  0.76           O  
ATOM   2189  CB  ASN A 300      33.787 -41.659 -78.520  1.00  0.76           C  
ATOM   2190  CG  ASN A 300      35.280 -41.918 -78.667  1.00  0.76           C  
ATOM   2191  OD1 ASN A 300      36.002 -41.012 -79.077  1.00  0.76           O  
ATOM   2192  ND2 ASN A 300      35.743 -43.151 -78.364  1.00  0.76           N  
ATOM   2193  N   PRO A 301      34.048 -39.891 -81.691  1.00  0.74           N  
ATOM   2194  CA  PRO A 301      34.329 -40.182 -83.098  1.00  0.74           C  
ATOM   2195  C   PRO A 301      35.183 -41.413 -83.350  1.00  0.74           C  
ATOM   2196  O   PRO A 301      34.972 -42.074 -84.365  1.00  0.74           O  
ATOM   2197  CB  PRO A 301      34.971 -38.889 -83.609  1.00  0.74           C  
ATOM   2198  CG  PRO A 301      34.241 -37.813 -82.803  1.00  0.74           C  
ATOM   2199  CD  PRO A 301      34.157 -38.454 -81.418  1.00  0.74           C  
ATOM   2200  N   ASP A 302      36.103 -41.773 -82.431  1.00  0.61           N  
ATOM   2201  CA  ASP A 302      36.858 -43.023 -82.412  1.00  0.61           C  
ATOM   2202  C   ASP A 302      35.917 -44.243 -82.378  1.00  0.61           C  
ATOM   2203  O   ASP A 302      36.114 -45.249 -83.055  1.00  0.61           O  
ATOM   2204  CB  ASP A 302      37.841 -42.901 -81.207  1.00  0.61           C  
ATOM   2205  CG  ASP A 302      38.393 -44.194 -80.629  1.00  0.61           C  
ATOM   2206  OD1 ASP A 302      39.227 -44.845 -81.299  1.00  0.61           O  
ATOM   2207  OD2 ASP A 302      37.983 -44.516 -79.475  1.00  0.61           O  
ATOM   2208  N   ALA A 303      34.779 -44.123 -81.666  1.00  0.67           N  
ATOM   2209  CA  ALA A 303      33.759 -45.150 -81.605  1.00  0.67           C  
ATOM   2210  C   ALA A 303      32.702 -44.983 -82.699  1.00  0.67           C  
ATOM   2211  O   ALA A 303      31.633 -45.588 -82.651  1.00  0.67           O  
ATOM   2212  CB  ALA A 303      33.077 -45.101 -80.224  1.00  0.67           C  
ATOM   2213  N   GLY A 304      32.985 -44.162 -83.733  1.00  0.66           N  
ATOM   2214  CA  GLY A 304      32.142 -44.008 -84.913  1.00  0.66           C  
ATOM   2215  C   GLY A 304      31.003 -43.032 -84.800  1.00  0.66           C  
ATOM   2216  O   GLY A 304      30.206 -42.917 -85.723  1.00  0.66           O  
ATOM   2217  N   MET A 305      30.884 -42.288 -83.688  1.00  0.64           N  
ATOM   2218  CA  MET A 305      29.773 -41.372 -83.485  1.00  0.64           C  
ATOM   2219  C   MET A 305      30.145 -39.941 -83.844  1.00  0.64           C  
ATOM   2220  O   MET A 305      31.058 -39.353 -83.265  1.00  0.64           O  
ATOM   2221  CB  MET A 305      29.322 -41.384 -82.006  1.00  0.64           C  
ATOM   2222  CG  MET A 305      28.732 -42.731 -81.553  1.00  0.64           C  
ATOM   2223  SD  MET A 305      28.267 -42.741 -79.795  1.00  0.64           S  
ATOM   2224  CE  MET A 305      29.924 -43.132 -79.166  1.00  0.64           C  
ATOM   2225  N   VAL A 306      29.432 -39.314 -84.801  1.00  0.70           N  
ATOM   2226  CA  VAL A 306      29.673 -37.921 -85.153  1.00  0.70           C  
ATOM   2227  C   VAL A 306      28.903 -36.982 -84.227  1.00  0.70           C  
ATOM   2228  O   VAL A 306      27.819 -37.286 -83.732  1.00  0.70           O  
ATOM   2229  CB  VAL A 306      29.386 -37.643 -86.632  1.00  0.70           C  
ATOM   2230  CG1 VAL A 306      27.878 -37.683 -86.923  1.00  0.70           C  
ATOM   2231  CG2 VAL A 306      30.014 -36.317 -87.109  1.00  0.70           C  
ATOM   2232  N   LEU A 307      29.442 -35.774 -83.961  1.00  0.74           N  
ATOM   2233  CA  LEU A 307      28.818 -34.792 -83.086  1.00  0.74           C  
ATOM   2234  C   LEU A 307      27.500 -34.244 -83.647  1.00  0.74           C  
ATOM   2235  O   LEU A 307      26.595 -33.842 -82.923  1.00  0.74           O  
ATOM   2236  CB  LEU A 307      29.842 -33.662 -82.808  1.00  0.74           C  
ATOM   2237  CG  LEU A 307      29.399 -32.558 -81.824  1.00  0.74           C  
ATOM   2238  CD1 LEU A 307      28.947 -33.121 -80.471  1.00  0.74           C  
ATOM   2239  CD2 LEU A 307      30.550 -31.565 -81.599  1.00  0.74           C  
ATOM   2240  N   ARG A 308      27.333 -34.293 -84.981  1.00  0.71           N  
ATOM   2241  CA  ARG A 308      26.162 -33.802 -85.681  1.00  0.71           C  
ATOM   2242  C   ARG A 308      24.896 -34.661 -85.523  1.00  0.71           C  
ATOM   2243  O   ARG A 308      23.792 -34.218 -85.828  1.00  0.71           O  
ATOM   2244  CB  ARG A 308      26.516 -33.686 -87.186  1.00  0.71           C  
ATOM   2245  CG  ARG A 308      25.583 -32.746 -87.978  1.00  0.71           C  
ATOM   2246  CD  ARG A 308      25.712 -32.851 -89.499  1.00  0.71           C  
ATOM   2247  NE  ARG A 308      25.077 -34.164 -89.881  1.00  0.71           N  
ATOM   2248  CZ  ARG A 308      24.083 -34.327 -90.765  1.00  0.71           C  
ATOM   2249  NH1 ARG A 308      23.636 -33.325 -91.515  1.00  0.71           N  
ATOM   2250  NH2 ARG A 308      23.523 -35.529 -90.901  1.00  0.71           N  
ATOM   2251  N   GLU A 309      25.005 -35.917 -85.038  1.00  0.74           N  
ATOM   2252  CA  GLU A 309      23.861 -36.813 -84.873  1.00  0.74           C  
ATOM   2253  C   GLU A 309      23.287 -36.741 -83.467  1.00  0.74           C  
ATOM   2254  O   GLU A 309      22.327 -37.422 -83.109  1.00  0.74           O  
ATOM   2255  CB  GLU A 309      24.303 -38.263 -85.175  1.00  0.74           C  
ATOM   2256  CG  GLU A 309      24.378 -38.526 -86.697  1.00  0.74           C  
ATOM   2257  CD  GLU A 309      25.178 -39.767 -87.083  1.00  0.74           C  
ATOM   2258  OE1 GLU A 309      25.783 -40.416 -86.194  1.00  0.74           O  
ATOM   2259  OE2 GLU A 309      25.239 -40.008 -88.317  1.00  0.74           O  
ATOM   2260  N   VAL A 310      23.864 -35.875 -82.625  1.00  0.77           N  
ATOM   2261  CA  VAL A 310      23.440 -35.648 -81.263  1.00  0.77           C  
ATOM   2262  C   VAL A 310      22.056 -35.012 -81.097  1.00  0.77           C  
ATOM   2263  O   VAL A 310      21.734 -33.970 -81.664  1.00  0.77           O  
ATOM   2264  CB  VAL A 310      24.512 -34.843 -80.542  1.00  0.77           C  
ATOM   2265  CG1 VAL A 310      24.014 -34.320 -79.189  1.00  0.77           C  
ATOM   2266  CG2 VAL A 310      25.741 -35.755 -80.359  1.00  0.77           C  
ATOM   2267  N   GLY A 311      21.220 -35.627 -80.228  1.00  0.82           N  
ATOM   2268  CA  GLY A 311      20.019 -35.017 -79.667  1.00  0.82           C  
ATOM   2269  C   GLY A 311      20.174 -34.864 -78.175  1.00  0.82           C  
ATOM   2270  O   GLY A 311      21.231 -35.144 -77.615  1.00  0.82           O  
ATOM   2271  N   LEU A 312      19.106 -34.445 -77.462  1.00  0.82           N  
ATOM   2272  CA  LEU A 312      19.152 -34.205 -76.022  1.00  0.82           C  
ATOM   2273  C   LEU A 312      19.494 -35.435 -75.200  1.00  0.82           C  
ATOM   2274  O   LEU A 312      20.223 -35.338 -74.221  1.00  0.82           O  
ATOM   2275  CB  LEU A 312      17.851 -33.571 -75.473  1.00  0.82           C  
ATOM   2276  CG  LEU A 312      17.471 -32.217 -76.108  1.00  0.82           C  
ATOM   2277  CD1 LEU A 312      16.184 -31.675 -75.470  1.00  0.82           C  
ATOM   2278  CD2 LEU A 312      18.586 -31.163 -76.003  1.00  0.82           C  
ATOM   2279  N   GLU A 313      19.028 -36.622 -75.631  1.00  0.80           N  
ATOM   2280  CA  GLU A 313      19.291 -37.931 -75.058  1.00  0.80           C  
ATOM   2281  C   GLU A 313      20.751 -38.268 -74.753  1.00  0.80           C  
ATOM   2282  O   GLU A 313      21.048 -39.101 -73.900  1.00  0.80           O  
ATOM   2283  CB  GLU A 313      18.755 -39.040 -76.007  1.00  0.80           C  
ATOM   2284  CG  GLU A 313      17.396 -38.739 -76.690  1.00  0.80           C  
ATOM   2285  CD  GLU A 313      16.349 -38.178 -75.735  1.00  0.80           C  
ATOM   2286  OE1 GLU A 313      15.891 -38.925 -74.838  1.00  0.80           O  
ATOM   2287  OE2 GLU A 313      16.025 -36.970 -75.915  1.00  0.80           O  
ATOM   2288  N   VAL A 314      21.728 -37.649 -75.458  1.00  0.84           N  
ATOM   2289  CA  VAL A 314      23.135 -37.889 -75.168  1.00  0.84           C  
ATOM   2290  C   VAL A 314      23.657 -37.036 -74.023  1.00  0.84           C  
ATOM   2291  O   VAL A 314      24.712 -37.317 -73.452  1.00  0.84           O  
ATOM   2292  CB  VAL A 314      24.061 -37.689 -76.379  1.00  0.84           C  
ATOM   2293  CG1 VAL A 314      23.375 -38.200 -77.661  1.00  0.84           C  
ATOM   2294  CG2 VAL A 314      24.548 -36.234 -76.540  1.00  0.84           C  
ATOM   2295  N   LEU A 315      22.941 -35.951 -73.676  1.00  0.87           N  
ATOM   2296  CA  LEU A 315      23.452 -34.891 -72.840  1.00  0.87           C  
ATOM   2297  C   LEU A 315      23.179 -35.176 -71.385  1.00  0.87           C  
ATOM   2298  O   LEU A 315      22.080 -35.551 -70.986  1.00  0.87           O  
ATOM   2299  CB  LEU A 315      22.824 -33.514 -73.195  1.00  0.87           C  
ATOM   2300  CG  LEU A 315      23.064 -33.042 -74.645  1.00  0.87           C  
ATOM   2301  CD1 LEU A 315      22.262 -31.768 -74.947  1.00  0.87           C  
ATOM   2302  CD2 LEU A 315      24.549 -32.789 -74.927  1.00  0.87           C  
ATOM   2303  N   GLY A 316      24.200 -34.987 -70.530  1.00  0.88           N  
ATOM   2304  CA  GLY A 316      23.995 -35.070 -69.094  1.00  0.88           C  
ATOM   2305  C   GLY A 316      23.308 -33.851 -68.556  1.00  0.88           C  
ATOM   2306  O   GLY A 316      23.081 -32.877 -69.269  1.00  0.88           O  
ATOM   2307  N   SER A 317      23.012 -33.837 -67.256  1.00  0.86           N  
ATOM   2308  CA  SER A 317      22.466 -32.666 -66.603  1.00  0.86           C  
ATOM   2309  C   SER A 317      23.110 -32.495 -65.251  1.00  0.86           C  
ATOM   2310  O   SER A 317      23.673 -33.426 -64.669  1.00  0.86           O  
ATOM   2311  CB  SER A 317      20.917 -32.702 -66.453  1.00  0.86           C  
ATOM   2312  OG  SER A 317      20.471 -33.805 -65.656  1.00  0.86           O  
ATOM   2313  N   ALA A 318      23.068 -31.264 -64.721  1.00  0.84           N  
ATOM   2314  CA  ALA A 318      23.497 -31.001 -63.374  1.00  0.84           C  
ATOM   2315  C   ALA A 318      22.736 -29.824 -62.826  1.00  0.84           C  
ATOM   2316  O   ALA A 318      22.366 -28.906 -63.556  1.00  0.84           O  
ATOM   2317  CB  ALA A 318      25.006 -30.706 -63.307  1.00  0.84           C  
ATOM   2318  N   ARG A 319      22.493 -29.833 -61.503  1.00  0.75           N  
ATOM   2319  CA  ARG A 319      21.701 -28.840 -60.810  1.00  0.75           C  
ATOM   2320  C   ARG A 319      22.259 -27.433 -60.935  1.00  0.75           C  
ATOM   2321  O   ARG A 319      21.523 -26.487 -61.209  1.00  0.75           O  
ATOM   2322  CB  ARG A 319      21.635 -29.235 -59.320  1.00  0.75           C  
ATOM   2323  CG  ARG A 319      20.597 -28.474 -58.474  1.00  0.75           C  
ATOM   2324  CD  ARG A 319      20.592 -28.920 -57.006  1.00  0.75           C  
ATOM   2325  NE  ARG A 319      21.885 -28.467 -56.386  1.00  0.75           N  
ATOM   2326  CZ  ARG A 319      22.068 -27.302 -55.752  1.00  0.75           C  
ATOM   2327  NH1 ARG A 319      21.101 -26.390 -55.692  1.00  0.75           N  
ATOM   2328  NH2 ARG A 319      23.230 -27.047 -55.156  1.00  0.75           N  
ATOM   2329  N   ARG A 320      23.590 -27.260 -60.777  1.00  0.76           N  
ATOM   2330  CA  ARG A 320      24.270 -26.026 -61.133  1.00  0.76           C  
ATOM   2331  C   ARG A 320      25.701 -26.350 -61.551  1.00  0.76           C  
ATOM   2332  O   ARG A 320      26.301 -27.332 -61.115  1.00  0.76           O  
ATOM   2333  CB  ARG A 320      24.298 -24.935 -60.006  1.00  0.76           C  
ATOM   2334  CG  ARG A 320      22.905 -24.498 -59.495  1.00  0.76           C  
ATOM   2335  CD  ARG A 320      22.870 -23.482 -58.352  1.00  0.76           C  
ATOM   2336  NE  ARG A 320      23.043 -22.101 -58.917  1.00  0.76           N  
ATOM   2337  CZ  ARG A 320      23.777 -21.146 -58.330  1.00  0.76           C  
ATOM   2338  NH1 ARG A 320      24.808 -21.448 -57.549  1.00  0.76           N  
ATOM   2339  NH2 ARG A 320      23.482 -19.865 -58.541  1.00  0.76           N  
ATOM   2340  N   VAL A 321      26.278 -25.513 -62.426  1.00  0.83           N  
ATOM   2341  CA  VAL A 321      27.664 -25.574 -62.856  1.00  0.83           C  
ATOM   2342  C   VAL A 321      28.305 -24.244 -62.507  1.00  0.83           C  
ATOM   2343  O   VAL A 321      27.703 -23.189 -62.709  1.00  0.83           O  
ATOM   2344  CB  VAL A 321      27.788 -25.814 -64.361  1.00  0.83           C  
ATOM   2345  CG1 VAL A 321      29.265 -25.815 -64.810  1.00  0.83           C  
ATOM   2346  CG2 VAL A 321      27.121 -27.158 -64.716  1.00  0.83           C  
ATOM   2347  N   VAL A 322      29.535 -24.260 -61.955  1.00  0.81           N  
ATOM   2348  CA  VAL A 322      30.311 -23.063 -61.658  1.00  0.81           C  
ATOM   2349  C   VAL A 322      31.671 -23.212 -62.319  1.00  0.81           C  
ATOM   2350  O   VAL A 322      32.361 -24.205 -62.106  1.00  0.81           O  
ATOM   2351  CB  VAL A 322      30.512 -22.854 -60.155  1.00  0.81           C  
ATOM   2352  CG1 VAL A 322      31.341 -21.583 -59.883  1.00  0.81           C  
ATOM   2353  CG2 VAL A 322      29.145 -22.746 -59.451  1.00  0.81           C  
ATOM   2354  N   VAL A 323      32.100 -22.247 -63.158  1.00  0.80           N  
ATOM   2355  CA  VAL A 323      33.424 -22.269 -63.775  1.00  0.80           C  
ATOM   2356  C   VAL A 323      34.199 -20.990 -63.490  1.00  0.80           C  
ATOM   2357  O   VAL A 323      33.657 -19.883 -63.538  1.00  0.80           O  
ATOM   2358  CB  VAL A 323      33.412 -22.526 -65.283  1.00  0.80           C  
ATOM   2359  CG1 VAL A 323      32.790 -23.904 -65.563  1.00  0.80           C  
ATOM   2360  CG2 VAL A 323      32.627 -21.451 -66.049  1.00  0.80           C  
ATOM   2361  N   SER A 324      35.507 -21.116 -63.186  1.00  0.76           N  
ATOM   2362  CA  SER A 324      36.417 -19.995 -62.983  1.00  0.76           C  
ATOM   2363  C   SER A 324      37.432 -19.917 -64.111  1.00  0.76           C  
ATOM   2364  O   SER A 324      37.212 -20.430 -65.207  1.00  0.76           O  
ATOM   2365  CB  SER A 324      37.117 -20.030 -61.588  1.00  0.76           C  
ATOM   2366  OG  SER A 324      38.054 -21.101 -61.466  1.00  0.76           O  
ATOM   2367  N   LYS A 325      38.591 -19.260 -63.887  1.00  0.69           N  
ATOM   2368  CA  LYS A 325      39.679 -19.232 -64.852  1.00  0.69           C  
ATOM   2369  C   LYS A 325      40.559 -20.455 -64.654  1.00  0.69           C  
ATOM   2370  O   LYS A 325      41.406 -20.788 -65.481  1.00  0.69           O  
ATOM   2371  CB  LYS A 325      40.576 -17.998 -64.594  1.00  0.69           C  
ATOM   2372  CG  LYS A 325      39.893 -16.651 -64.873  1.00  0.69           C  
ATOM   2373  CD  LYS A 325      40.733 -15.471 -64.358  1.00  0.69           C  
ATOM   2374  CE  LYS A 325      40.687 -15.343 -62.829  1.00  0.69           C  
ATOM   2375  NZ  LYS A 325      41.691 -14.362 -62.366  1.00  0.69           N  
ATOM   2376  N   ASP A 326      40.324 -21.154 -63.534  1.00  0.70           N  
ATOM   2377  CA  ASP A 326      41.253 -22.056 -62.915  1.00  0.70           C  
ATOM   2378  C   ASP A 326      40.618 -23.456 -62.822  1.00  0.70           C  
ATOM   2379  O   ASP A 326      41.208 -24.454 -63.236  1.00  0.70           O  
ATOM   2380  CB  ASP A 326      41.592 -21.458 -61.503  1.00  0.70           C  
ATOM   2381  CG  ASP A 326      41.584 -19.923 -61.487  1.00  0.70           C  
ATOM   2382  OD1 ASP A 326      40.468 -19.342 -61.326  1.00  0.70           O  
ATOM   2383  OD2 ASP A 326      42.654 -19.294 -61.681  1.00  0.70           O  
ATOM   2384  N   ASP A 327      39.342 -23.537 -62.380  1.00  0.75           N  
ATOM   2385  CA  ASP A 327      38.631 -24.772 -62.099  1.00  0.75           C  
ATOM   2386  C   ASP A 327      37.237 -24.792 -62.728  1.00  0.75           C  
ATOM   2387  O   ASP A 327      36.638 -23.771 -63.074  1.00  0.75           O  
ATOM   2388  CB  ASP A 327      38.413 -24.949 -60.571  1.00  0.75           C  
ATOM   2389  CG  ASP A 327      39.699 -25.322 -59.861  1.00  0.75           C  
ATOM   2390  OD1 ASP A 327      40.191 -26.450 -60.117  1.00  0.75           O  
ATOM   2391  OD2 ASP A 327      40.152 -24.517 -59.009  1.00  0.75           O  
ATOM   2392  N   THR A 328      36.672 -26.009 -62.855  1.00  0.79           N  
ATOM   2393  CA  THR A 328      35.292 -26.255 -63.259  1.00  0.79           C  
ATOM   2394  C   THR A 328      34.640 -27.085 -62.179  1.00  0.79           C  
ATOM   2395  O   THR A 328      35.149 -28.134 -61.800  1.00  0.79           O  
ATOM   2396  CB  THR A 328      35.184 -27.006 -64.581  1.00  0.79           C  
ATOM   2397  OG1 THR A 328      35.475 -26.105 -65.635  1.00  0.79           O  
ATOM   2398  CG2 THR A 328      33.762 -27.546 -64.840  1.00  0.79           C  
ATOM   2399  N   VAL A 329      33.483 -26.663 -61.632  1.00  0.79           N  
ATOM   2400  CA  VAL A 329      32.780 -27.419 -60.603  1.00  0.79           C  
ATOM   2401  C   VAL A 329      31.387 -27.778 -61.082  1.00  0.79           C  
ATOM   2402  O   VAL A 329      30.569 -26.926 -61.427  1.00  0.79           O  
ATOM   2403  CB  VAL A 329      32.675 -26.686 -59.264  1.00  0.79           C  
ATOM   2404  CG1 VAL A 329      31.970 -27.558 -58.198  1.00  0.79           C  
ATOM   2405  CG2 VAL A 329      34.094 -26.325 -58.784  1.00  0.79           C  
ATOM   2406  N   ILE A 330      31.078 -29.089 -61.086  1.00  0.80           N  
ATOM   2407  CA  ILE A 330      29.742 -29.615 -61.296  1.00  0.80           C  
ATOM   2408  C   ILE A 330      29.162 -29.876 -59.922  1.00  0.80           C  
ATOM   2409  O   ILE A 330      29.758 -30.614 -59.138  1.00  0.80           O  
ATOM   2410  CB  ILE A 330      29.762 -30.948 -62.055  1.00  0.80           C  
ATOM   2411  CG1 ILE A 330      30.512 -30.845 -63.405  1.00  0.80           C  
ATOM   2412  CG2 ILE A 330      28.328 -31.489 -62.257  1.00  0.80           C  
ATOM   2413  CD1 ILE A 330      29.906 -29.847 -64.395  1.00  0.80           C  
ATOM   2414  N   VAL A 331      27.991 -29.303 -59.577  1.00  0.76           N  
ATOM   2415  CA  VAL A 331      27.333 -29.647 -58.327  1.00  0.76           C  
ATOM   2416  C   VAL A 331      26.020 -30.335 -58.636  1.00  0.76           C  
ATOM   2417  O   VAL A 331      25.147 -29.799 -59.321  1.00  0.76           O  
ATOM   2418  CB  VAL A 331      27.188 -28.483 -57.336  1.00  0.76           C  
ATOM   2419  CG1 VAL A 331      26.375 -27.305 -57.901  1.00  0.76           C  
ATOM   2420  CG2 VAL A 331      26.588 -28.979 -56.003  1.00  0.76           C  
ATOM   2421  N   ASP A 332      25.884 -31.579 -58.120  1.00  0.76           N  
ATOM   2422  CA  ASP A 332      24.651 -32.338 -58.107  1.00  0.76           C  
ATOM   2423  C   ASP A 332      24.151 -32.732 -59.509  1.00  0.76           C  
ATOM   2424  O   ASP A 332      23.196 -32.188 -60.065  1.00  0.76           O  
ATOM   2425  CB  ASP A 332      23.666 -31.593 -57.175  1.00  0.76           C  
ATOM   2426  CG  ASP A 332      22.672 -32.499 -56.485  1.00  0.76           C  
ATOM   2427  OD1 ASP A 332      23.086 -33.602 -56.057  1.00  0.76           O  
ATOM   2428  OD2 ASP A 332      21.528 -32.016 -56.290  1.00  0.76           O  
ATOM   2429  N   GLY A 333      24.897 -33.659 -60.157  1.00  0.80           N  
ATOM   2430  CA  GLY A 333      24.560 -34.254 -61.449  1.00  0.80           C  
ATOM   2431  C   GLY A 333      23.341 -35.146 -61.452  1.00  0.80           C  
ATOM   2432  O   GLY A 333      22.934 -35.683 -60.429  1.00  0.80           O  
ATOM   2433  N   GLY A 334      22.754 -35.383 -62.643  1.00  0.81           N  
ATOM   2434  CA  GLY A 334      21.556 -36.211 -62.803  1.00  0.81           C  
ATOM   2435  C   GLY A 334      21.761 -37.710 -62.797  1.00  0.81           C  
ATOM   2436  O   GLY A 334      20.807 -38.466 -62.961  1.00  0.81           O  
ATOM   2437  N   GLY A 335      23.016 -38.183 -62.668  1.00  0.80           N  
ATOM   2438  CA  GLY A 335      23.407 -39.591 -62.677  1.00  0.80           C  
ATOM   2439  C   GLY A 335      22.664 -40.525 -61.750  1.00  0.80           C  
ATOM   2440  O   GLY A 335      22.563 -40.310 -60.546  1.00  0.80           O  
ATOM   2441  N   THR A 336      22.155 -41.650 -62.293  1.00  0.72           N  
ATOM   2442  CA  THR A 336      21.489 -42.685 -61.500  1.00  0.72           C  
ATOM   2443  C   THR A 336      22.406 -43.358 -60.481  1.00  0.72           C  
ATOM   2444  O   THR A 336      23.564 -43.681 -60.753  1.00  0.72           O  
ATOM   2445  CB  THR A 336      20.729 -43.713 -62.341  1.00  0.72           C  
ATOM   2446  OG1 THR A 336      19.962 -44.597 -61.532  1.00  0.72           O  
ATOM   2447  CG2 THR A 336      21.670 -44.568 -63.198  1.00  0.72           C  
ATOM   2448  N   ALA A 337      21.886 -43.585 -59.256  1.00  0.71           N  
ATOM   2449  CA  ALA A 337      22.653 -43.944 -58.078  1.00  0.71           C  
ATOM   2450  C   ALA A 337      23.441 -45.243 -58.201  1.00  0.71           C  
ATOM   2451  O   ALA A 337      24.617 -45.317 -57.840  1.00  0.71           O  
ATOM   2452  CB  ALA A 337      21.692 -44.025 -56.874  1.00  0.71           C  
ATOM   2453  N   GLU A 338      22.813 -46.288 -58.777  1.00  0.68           N  
ATOM   2454  CA  GLU A 338      23.445 -47.563 -59.048  1.00  0.68           C  
ATOM   2455  C   GLU A 338      24.617 -47.459 -60.002  1.00  0.68           C  
ATOM   2456  O   GLU A 338      25.657 -48.072 -59.791  1.00  0.68           O  
ATOM   2457  CB  GLU A 338      22.442 -48.553 -59.670  1.00  0.68           C  
ATOM   2458  CG  GLU A 338      21.259 -48.923 -58.750  1.00  0.68           C  
ATOM   2459  CD  GLU A 338      20.336 -49.943 -59.415  1.00  0.68           C  
ATOM   2460  OE1 GLU A 338      20.614 -50.330 -60.579  1.00  0.68           O  
ATOM   2461  OE2 GLU A 338      19.342 -50.328 -58.751  1.00  0.68           O  
ATOM   2462  N   ALA A 339      24.497 -46.653 -61.075  1.00  0.70           N  
ATOM   2463  CA  ALA A 339      25.547 -46.469 -62.055  1.00  0.70           C  
ATOM   2464  C   ALA A 339      26.792 -45.802 -61.489  1.00  0.70           C  
ATOM   2465  O   ALA A 339      27.914 -46.234 -61.755  1.00  0.70           O  
ATOM   2466  CB  ALA A 339      25.015 -45.671 -63.258  1.00  0.70           C  
ATOM   2467  N   VAL A 340      26.624 -44.756 -60.649  1.00  0.74           N  
ATOM   2468  CA  VAL A 340      27.727 -44.088 -59.966  1.00  0.74           C  
ATOM   2469  C   VAL A 340      28.467 -45.044 -59.035  1.00  0.74           C  
ATOM   2470  O   VAL A 340      29.696 -45.126 -59.044  1.00  0.74           O  
ATOM   2471  CB  VAL A 340      27.250 -42.859 -59.190  1.00  0.74           C  
ATOM   2472  CG1 VAL A 340      28.440 -42.130 -58.528  1.00  0.74           C  
ATOM   2473  CG2 VAL A 340      26.533 -41.888 -60.150  1.00  0.74           C  
ATOM   2474  N   ALA A 341      27.721 -45.854 -58.254  1.00  0.73           N  
ATOM   2475  CA  ALA A 341      28.274 -46.919 -57.441  1.00  0.73           C  
ATOM   2476  C   ALA A 341      28.948 -48.033 -58.248  1.00  0.73           C  
ATOM   2477  O   ALA A 341      30.022 -48.510 -57.890  1.00  0.73           O  
ATOM   2478  CB  ALA A 341      27.167 -47.501 -56.543  1.00  0.73           C  
ATOM   2479  N   ASN A 342      28.349 -48.459 -59.382  1.00  0.73           N  
ATOM   2480  CA  ASN A 342      28.895 -49.457 -60.289  1.00  0.73           C  
ATOM   2481  C   ASN A 342      30.226 -49.019 -60.903  1.00  0.73           C  
ATOM   2482  O   ASN A 342      31.216 -49.751 -60.902  1.00  0.73           O  
ATOM   2483  CB  ASN A 342      27.854 -49.803 -61.389  1.00  0.73           C  
ATOM   2484  CG  ASN A 342      28.138 -51.162 -62.023  1.00  0.73           C  
ATOM   2485  OD1 ASN A 342      29.204 -51.432 -62.574  1.00  0.73           O  
ATOM   2486  ND2 ASN A 342      27.153 -52.085 -61.934  1.00  0.73           N  
ATOM   2487  N   ARG A 343      30.313 -47.761 -61.381  1.00  0.73           N  
ATOM   2488  CA  ARG A 343      31.565 -47.211 -61.864  1.00  0.73           C  
ATOM   2489  C   ARG A 343      32.603 -47.099 -60.749  1.00  0.73           C  
ATOM   2490  O   ARG A 343      33.761 -47.477 -60.922  1.00  0.73           O  
ATOM   2491  CB  ARG A 343      31.348 -45.852 -62.575  1.00  0.73           C  
ATOM   2492  CG  ARG A 343      32.299 -45.586 -63.768  1.00  0.73           C  
ATOM   2493  CD  ARG A 343      33.796 -45.553 -63.439  1.00  0.73           C  
ATOM   2494  NE  ARG A 343      34.507 -45.221 -64.706  1.00  0.73           N  
ATOM   2495  CZ  ARG A 343      35.342 -46.012 -65.388  1.00  0.73           C  
ATOM   2496  NH1 ARG A 343      35.716 -47.204 -64.942  1.00  0.73           N  
ATOM   2497  NH2 ARG A 343      35.862 -45.536 -66.514  1.00  0.73           N  
ATOM   2498  N   ALA A 344      32.197 -46.637 -59.549  1.00  0.75           N  
ATOM   2499  CA  ALA A 344      33.055 -46.576 -58.385  1.00  0.75           C  
ATOM   2500  C   ALA A 344      33.592 -47.931 -57.923  1.00  0.75           C  
ATOM   2501  O   ALA A 344      34.776 -48.056 -57.629  1.00  0.75           O  
ATOM   2502  CB  ALA A 344      32.322 -45.869 -57.231  1.00  0.75           C  
ATOM   2503  N   LYS A 345      32.777 -49.013 -57.892  1.00  0.72           N  
ATOM   2504  CA  LYS A 345      33.281 -50.356 -57.618  1.00  0.72           C  
ATOM   2505  C   LYS A 345      34.224 -50.885 -58.679  1.00  0.72           C  
ATOM   2506  O   LYS A 345      35.132 -51.654 -58.374  1.00  0.72           O  
ATOM   2507  CB  LYS A 345      32.207 -51.421 -57.235  1.00  0.72           C  
ATOM   2508  CG  LYS A 345      31.097 -51.780 -58.249  1.00  0.72           C  
ATOM   2509  CD  LYS A 345      31.453 -52.593 -59.517  1.00  0.72           C  
ATOM   2510  CE  LYS A 345      32.089 -53.967 -59.295  1.00  0.72           C  
ATOM   2511  NZ  LYS A 345      32.567 -54.502 -60.594  1.00  0.72           N  
ATOM   2512  N   HIS A 346      34.039 -50.503 -59.960  1.00  0.75           N  
ATOM   2513  CA  HIS A 346      34.971 -50.862 -61.011  1.00  0.75           C  
ATOM   2514  C   HIS A 346      36.289 -50.133 -60.876  1.00  0.75           C  
ATOM   2515  O   HIS A 346      37.347 -50.734 -60.968  1.00  0.75           O  
ATOM   2516  CB  HIS A 346      34.398 -50.633 -62.420  1.00  0.75           C  
ATOM   2517  CG  HIS A 346      35.208 -51.373 -63.433  1.00  0.75           C  
ATOM   2518  ND1 HIS A 346      35.072 -52.748 -63.513  1.00  0.75           N  
ATOM   2519  CD2 HIS A 346      36.198 -50.941 -64.256  1.00  0.75           C  
ATOM   2520  CE1 HIS A 346      35.980 -53.121 -64.398  1.00  0.75           C  
ATOM   2521  NE2 HIS A 346      36.689 -52.068 -64.875  1.00  0.75           N  
ATOM   2522  N   LEU A 347      36.250 -48.824 -60.585  1.00  0.74           N  
ATOM   2523  CA  LEU A 347      37.407 -47.994 -60.308  1.00  0.74           C  
ATOM   2524  C   LEU A 347      38.161 -48.391 -59.043  1.00  0.74           C  
ATOM   2525  O   LEU A 347      39.389 -48.405 -58.975  1.00  0.74           O  
ATOM   2526  CB  LEU A 347      36.926 -46.542 -60.212  1.00  0.74           C  
ATOM   2527  CG  LEU A 347      38.023 -45.508 -59.948  1.00  0.74           C  
ATOM   2528  CD1 LEU A 347      39.125 -45.528 -61.011  1.00  0.74           C  
ATOM   2529  CD2 LEU A 347      37.372 -44.134 -59.896  1.00  0.74           C  
ATOM   2530  N   ARG A 348      37.428 -48.804 -57.997  1.00  0.71           N  
ATOM   2531  CA  ARG A 348      37.993 -49.407 -56.806  1.00  0.71           C  
ATOM   2532  C   ARG A 348      38.662 -50.751 -57.102  1.00  0.71           C  
ATOM   2533  O   ARG A 348      39.557 -51.194 -56.388  1.00  0.71           O  
ATOM   2534  CB  ARG A 348      36.886 -49.591 -55.741  1.00  0.71           C  
ATOM   2535  CG  ARG A 348      37.422 -49.845 -54.319  1.00  0.71           C  
ATOM   2536  CD  ARG A 348      36.339 -50.222 -53.299  1.00  0.71           C  
ATOM   2537  NE  ARG A 348      35.801 -51.577 -53.672  1.00  0.71           N  
ATOM   2538  CZ  ARG A 348      36.436 -52.737 -53.450  1.00  0.71           C  
ATOM   2539  NH1 ARG A 348      37.597 -52.795 -52.809  1.00  0.71           N  
ATOM   2540  NH2 ARG A 348      35.899 -53.873 -53.889  1.00  0.71           N  
ATOM   2541  N   ALA A 349      38.264 -51.411 -58.207  1.00  0.76           N  
ATOM   2542  CA  ALA A 349      38.923 -52.592 -58.708  1.00  0.76           C  
ATOM   2543  C   ALA A 349      39.972 -52.280 -59.779  1.00  0.76           C  
ATOM   2544  O   ALA A 349      40.760 -53.145 -60.154  1.00  0.76           O  
ATOM   2545  CB  ALA A 349      37.857 -53.557 -59.265  1.00  0.76           C  
ATOM   2546  N   GLU A 350      40.063 -51.030 -60.277  1.00  0.73           N  
ATOM   2547  CA  GLU A 350      41.208 -50.529 -61.018  1.00  0.73           C  
ATOM   2548  C   GLU A 350      42.407 -50.396 -60.059  1.00  0.73           C  
ATOM   2549  O   GLU A 350      43.528 -50.771 -60.396  1.00  0.73           O  
ATOM   2550  CB  GLU A 350      40.885 -49.209 -61.811  1.00  0.73           C  
ATOM   2551  CG  GLU A 350      39.859 -49.353 -62.991  1.00  0.73           C  
ATOM   2552  CD  GLU A 350      39.386 -48.048 -63.659  1.00  0.73           C  
ATOM   2553  OE1 GLU A 350      40.226 -47.147 -63.910  1.00  0.73           O  
ATOM   2554  OE2 GLU A 350      38.166 -47.916 -63.968  1.00  0.73           O  
ATOM   2555  N   ILE A 351      42.199 -49.909 -58.804  1.00  0.74           N  
ATOM   2556  CA  ILE A 351      43.258 -49.845 -57.788  1.00  0.74           C  
ATOM   2557  C   ILE A 351      43.799 -51.173 -57.264  1.00  0.74           C  
ATOM   2558  O   ILE A 351      44.997 -51.257 -56.998  1.00  0.74           O  
ATOM   2559  CB  ILE A 351      43.040 -48.882 -56.611  1.00  0.74           C  
ATOM   2560  CG1 ILE A 351      41.846 -49.230 -55.701  1.00  0.74           C  
ATOM   2561  CG2 ILE A 351      42.924 -47.458 -57.177  1.00  0.74           C  
ATOM   2562  CD1 ILE A 351      41.773 -48.367 -54.433  1.00  0.74           C  
ATOM   2563  N   ASP A 352      42.990 -52.254 -57.100  1.00  0.73           N  
ATOM   2564  CA  ASP A 352      43.491 -53.505 -56.524  1.00  0.73           C  
ATOM   2565  C   ASP A 352      44.513 -54.242 -57.400  1.00  0.73           C  
ATOM   2566  O   ASP A 352      45.323 -55.034 -56.924  1.00  0.73           O  
ATOM   2567  CB  ASP A 352      42.349 -54.436 -55.994  1.00  0.73           C  
ATOM   2568  CG  ASP A 352      41.427 -55.065 -57.024  1.00  0.73           C  
ATOM   2569  OD1 ASP A 352      41.936 -55.721 -57.966  1.00  0.73           O  
ATOM   2570  OD2 ASP A 352      40.184 -54.951 -56.887  1.00  0.73           O  
ATOM   2571  N   LYS A 353      44.539 -53.920 -58.705  1.00  0.71           N  
ATOM   2572  CA  LYS A 353      45.460 -54.485 -59.672  1.00  0.71           C  
ATOM   2573  C   LYS A 353      46.630 -53.558 -59.940  1.00  0.71           C  
ATOM   2574  O   LYS A 353      47.398 -53.767 -60.877  1.00  0.71           O  
ATOM   2575  CB  LYS A 353      44.721 -54.707 -61.014  1.00  0.71           C  
ATOM   2576  CG  LYS A 353      43.619 -55.764 -60.891  1.00  0.71           C  
ATOM   2577  CD  LYS A 353      42.468 -55.554 -61.883  1.00  0.71           C  
ATOM   2578  CE  LYS A 353      41.190 -56.307 -61.488  1.00  0.71           C  
ATOM   2579  NZ  LYS A 353      40.680 -55.818 -60.197  1.00  0.71           N  
ATOM   2580  N   SER A 354      46.799 -52.481 -59.152  1.00  0.73           N  
ATOM   2581  CA  SER A 354      47.794 -51.474 -59.481  1.00  0.73           C  
ATOM   2582  C   SER A 354      49.199 -51.822 -59.028  1.00  0.73           C  
ATOM   2583  O   SER A 354      49.535 -51.728 -57.850  1.00  0.73           O  
ATOM   2584  CB  SER A 354      47.447 -50.086 -58.906  1.00  0.73           C  
ATOM   2585  OG  SER A 354      48.228 -49.068 -59.533  1.00  0.73           O  
ATOM   2586  N   ASP A 355      50.057 -52.178 -60.002  1.00  0.64           N  
ATOM   2587  CA  ASP A 355      51.470 -52.471 -59.867  1.00  0.64           C  
ATOM   2588  C   ASP A 355      52.288 -51.276 -59.347  1.00  0.64           C  
ATOM   2589  O   ASP A 355      53.125 -51.375 -58.452  1.00  0.64           O  
ATOM   2590  CB  ASP A 355      51.909 -52.896 -61.296  1.00  0.64           C  
ATOM   2591  CG  ASP A 355      53.231 -53.641 -61.335  1.00  0.64           C  
ATOM   2592  OD1 ASP A 355      53.527 -54.383 -60.368  1.00  0.64           O  
ATOM   2593  OD2 ASP A 355      53.931 -53.498 -62.371  1.00  0.64           O  
ATOM   2594  N   SER A 356      52.010 -50.069 -59.882  1.00  0.62           N  
ATOM   2595  CA  SER A 356      52.738 -48.853 -59.543  1.00  0.62           C  
ATOM   2596  C   SER A 356      51.894 -47.921 -58.690  1.00  0.62           C  
ATOM   2597  O   SER A 356      50.665 -47.889 -58.780  1.00  0.62           O  
ATOM   2598  CB  SER A 356      53.190 -48.094 -60.819  1.00  0.62           C  
ATOM   2599  OG  SER A 356      53.983 -46.938 -60.526  1.00  0.62           O  
ATOM   2600  N   ASP A 357      52.546 -47.122 -57.815  1.00  0.61           N  
ATOM   2601  CA  ASP A 357      51.888 -46.149 -56.965  1.00  0.61           C  
ATOM   2602  C   ASP A 357      51.281 -44.973 -57.743  1.00  0.61           C  
ATOM   2603  O   ASP A 357      50.153 -44.563 -57.494  1.00  0.61           O  
ATOM   2604  CB  ASP A 357      52.831 -45.696 -55.815  1.00  0.61           C  
ATOM   2605  CG  ASP A 357      52.020 -45.276 -54.606  1.00  0.61           C  
ATOM   2606  OD1 ASP A 357      50.770 -45.201 -54.715  1.00  0.61           O  
ATOM   2607  OD2 ASP A 357      52.591 -45.076 -53.508  1.00  0.61           O  
ATOM   2608  N   TRP A 358      51.964 -44.452 -58.787  1.00  0.47           N  
ATOM   2609  CA  TRP A 358      51.419 -43.409 -59.662  1.00  0.47           C  
ATOM   2610  C   TRP A 358      50.125 -43.847 -60.338  1.00  0.47           C  
ATOM   2611  O   TRP A 358      49.157 -43.108 -60.527  1.00  0.47           O  
ATOM   2612  CB  TRP A 358      52.409 -43.065 -60.801  1.00  0.47           C  
ATOM   2613  CG  TRP A 358      53.694 -42.379 -60.390  1.00  0.47           C  
ATOM   2614  CD1 TRP A 358      54.088 -41.874 -59.181  1.00  0.47           C  
ATOM   2615  CD2 TRP A 358      54.717 -42.027 -61.335  1.00  0.47           C  
ATOM   2616  NE1 TRP A 358      55.323 -41.269 -59.301  1.00  0.47           N  
ATOM   2617  CE2 TRP A 358      55.716 -41.334 -60.620  1.00  0.47           C  
ATOM   2618  CE3 TRP A 358      54.821 -42.232 -62.709  1.00  0.47           C  
ATOM   2619  CZ2 TRP A 358      56.837 -40.834 -61.269  1.00  0.47           C  
ATOM   2620  CZ3 TRP A 358      55.948 -41.716 -63.366  1.00  0.47           C  
ATOM   2621  CH2 TRP A 358      56.943 -41.026 -62.657  1.00  0.47           C  
ATOM   2622  N   ASP A 359      50.073 -45.132 -60.713  1.00  0.70           N  
ATOM   2623  CA  ASP A 359      48.875 -45.742 -61.207  1.00  0.70           C  
ATOM   2624  C   ASP A 359      47.752 -45.842 -60.183  1.00  0.70           C  
ATOM   2625  O   ASP A 359      46.611 -45.588 -60.559  1.00  0.70           O  
ATOM   2626  CB  ASP A 359      49.197 -47.058 -61.938  1.00  0.70           C  
ATOM   2627  CG  ASP A 359      49.879 -46.646 -63.222  1.00  0.70           C  
ATOM   2628  OD1 ASP A 359      49.148 -46.029 -64.052  1.00  0.70           O  
ATOM   2629  OD2 ASP A 359      51.100 -46.871 -63.360  1.00  0.70           O  
ATOM   2630  N   ARG A 360      48.041 -46.139 -58.895  1.00  0.68           N  
ATOM   2631  CA  ARG A 360      47.095 -46.085 -57.783  1.00  0.68           C  
ATOM   2632  C   ARG A 360      46.581 -44.670 -57.518  1.00  0.68           C  
ATOM   2633  O   ARG A 360      45.380 -44.442 -57.366  1.00  0.68           O  
ATOM   2634  CB  ARG A 360      47.765 -46.630 -56.482  1.00  0.68           C  
ATOM   2635  CG  ARG A 360      46.886 -46.604 -55.207  1.00  0.68           C  
ATOM   2636  CD  ARG A 360      47.578 -47.106 -53.924  1.00  0.68           C  
ATOM   2637  NE  ARG A 360      48.616 -46.102 -53.514  1.00  0.68           N  
ATOM   2638  CZ  ARG A 360      49.032 -45.835 -52.269  1.00  0.68           C  
ATOM   2639  NH1 ARG A 360      48.434 -46.325 -51.193  1.00  0.68           N  
ATOM   2640  NH2 ARG A 360      50.106 -45.065 -52.117  1.00  0.68           N  
ATOM   2641  N   GLU A 361      47.502 -43.689 -57.497  1.00  0.64           N  
ATOM   2642  CA  GLU A 361      47.308 -42.279 -57.203  1.00  0.64           C  
ATOM   2643  C   GLU A 361      46.237 -41.604 -58.049  1.00  0.64           C  
ATOM   2644  O   GLU A 361      45.239 -41.106 -57.529  1.00  0.64           O  
ATOM   2645  CB  GLU A 361      48.689 -41.630 -57.445  1.00  0.64           C  
ATOM   2646  CG  GLU A 361      48.831 -40.103 -57.271  1.00  0.64           C  
ATOM   2647  CD  GLU A 361      50.259 -39.697 -57.643  1.00  0.64           C  
ATOM   2648  OE1 GLU A 361      50.668 -39.994 -58.797  1.00  0.64           O  
ATOM   2649  OE2 GLU A 361      50.957 -39.116 -56.775  1.00  0.64           O  
ATOM   2650  N   LYS A 362      46.347 -41.686 -59.393  1.00  0.71           N  
ATOM   2651  CA  LYS A 362      45.385 -41.119 -60.331  1.00  0.71           C  
ATOM   2652  C   LYS A 362      43.977 -41.708 -60.217  1.00  0.71           C  
ATOM   2653  O   LYS A 362      42.963 -41.071 -60.487  1.00  0.71           O  
ATOM   2654  CB  LYS A 362      45.899 -41.271 -61.792  1.00  0.71           C  
ATOM   2655  CG  LYS A 362      45.974 -42.725 -62.300  1.00  0.71           C  
ATOM   2656  CD  LYS A 362      46.485 -42.866 -63.742  1.00  0.71           C  
ATOM   2657  CE  LYS A 362      46.127 -44.210 -64.403  1.00  0.71           C  
ATOM   2658  NZ  LYS A 362      46.659 -45.357 -63.645  1.00  0.71           N  
ATOM   2659  N   LEU A 363      43.870 -42.992 -59.833  1.00  0.73           N  
ATOM   2660  CA  LEU A 363      42.604 -43.667 -59.643  1.00  0.73           C  
ATOM   2661  C   LEU A 363      41.956 -43.278 -58.323  1.00  0.73           C  
ATOM   2662  O   LEU A 363      40.736 -43.175 -58.215  1.00  0.73           O  
ATOM   2663  CB  LEU A 363      42.824 -45.187 -59.708  1.00  0.73           C  
ATOM   2664  CG  LEU A 363      43.508 -45.691 -60.994  1.00  0.73           C  
ATOM   2665  CD1 LEU A 363      43.857 -47.176 -60.852  1.00  0.73           C  
ATOM   2666  CD2 LEU A 363      42.679 -45.451 -62.255  1.00  0.73           C  
ATOM   2667  N   GLY A 364      42.782 -42.992 -57.293  1.00  0.71           N  
ATOM   2668  CA  GLY A 364      42.336 -42.414 -56.031  1.00  0.71           C  
ATOM   2669  C   GLY A 364      41.790 -41.014 -56.162  1.00  0.71           C  
ATOM   2670  O   GLY A 364      40.838 -40.660 -55.474  1.00  0.71           O  
ATOM   2671  N   GLU A 365      42.338 -40.197 -57.091  1.00  0.68           N  
ATOM   2672  CA  GLU A 365      41.755 -38.912 -57.467  1.00  0.68           C  
ATOM   2673  C   GLU A 365      40.367 -39.057 -58.075  1.00  0.68           C  
ATOM   2674  O   GLU A 365      39.431 -38.354 -57.710  1.00  0.68           O  
ATOM   2675  CB  GLU A 365      42.606 -38.161 -58.526  1.00  0.68           C  
ATOM   2676  CG  GLU A 365      44.069 -37.867 -58.130  1.00  0.68           C  
ATOM   2677  CD  GLU A 365      44.785 -37.045 -59.202  1.00  0.68           C  
ATOM   2678  OE1 GLU A 365      44.634 -37.344 -60.420  1.00  0.68           O  
ATOM   2679  OE2 GLU A 365      45.489 -36.087 -58.804  1.00  0.68           O  
ATOM   2680  N   ARG A 366      40.206 -40.021 -59.005  1.00  0.72           N  
ATOM   2681  CA  ARG A 366      38.955 -40.314 -59.684  1.00  0.72           C  
ATOM   2682  C   ARG A 366      37.834 -40.808 -58.767  1.00  0.72           C  
ATOM   2683  O   ARG A 366      36.671 -40.474 -58.972  1.00  0.72           O  
ATOM   2684  CB  ARG A 366      39.192 -41.336 -60.829  1.00  0.72           C  
ATOM   2685  CG  ARG A 366      40.000 -40.786 -62.018  1.00  0.72           C  
ATOM   2686  CD  ARG A 366      40.534 -41.845 -62.993  1.00  0.72           C  
ATOM   2687  NE  ARG A 366      39.361 -42.477 -63.665  1.00  0.72           N  
ATOM   2688  CZ  ARG A 366      39.269 -43.739 -64.095  1.00  0.72           C  
ATOM   2689  NH1 ARG A 366      40.316 -44.546 -64.160  1.00  0.72           N  
ATOM   2690  NH2 ARG A 366      38.072 -44.207 -64.425  1.00  0.72           N  
ATOM   2691  N   LEU A 367      38.132 -41.645 -57.741  1.00  0.74           N  
ATOM   2692  CA  LEU A 367      37.091 -42.138 -56.842  1.00  0.74           C  
ATOM   2693  C   LEU A 367      36.697 -41.120 -55.786  1.00  0.74           C  
ATOM   2694  O   LEU A 367      35.590 -41.143 -55.243  1.00  0.74           O  
ATOM   2695  CB  LEU A 367      37.471 -43.510 -56.206  1.00  0.74           C  
ATOM   2696  CG  LEU A 367      38.467 -43.515 -55.021  1.00  0.74           C  
ATOM   2697  CD1 LEU A 367      37.771 -43.370 -53.654  1.00  0.74           C  
ATOM   2698  CD2 LEU A 367      39.281 -44.818 -55.017  1.00  0.74           C  
ATOM   2699  N   ALA A 368      37.612 -40.185 -55.473  1.00  0.68           N  
ATOM   2700  CA  ALA A 368      37.372 -39.084 -54.578  1.00  0.68           C  
ATOM   2701  C   ALA A 368      36.388 -38.060 -55.131  1.00  0.68           C  
ATOM   2702  O   ALA A 368      36.213 -37.876 -56.332  1.00  0.68           O  
ATOM   2703  CB  ALA A 368      38.704 -38.414 -54.193  1.00  0.68           C  
ATOM   2704  N   LYS A 369      35.690 -37.347 -54.233  1.00  0.33           N  
ATOM   2705  CA  LYS A 369      34.792 -36.287 -54.626  1.00  0.33           C  
ATOM   2706  C   LYS A 369      35.345 -34.999 -54.071  1.00  0.33           C  
ATOM   2707  O   LYS A 369      35.766 -34.935 -52.918  1.00  0.33           O  
ATOM   2708  CB  LYS A 369      33.357 -36.520 -54.098  1.00  0.33           C  
ATOM   2709  CG  LYS A 369      32.700 -37.762 -54.723  1.00  0.33           C  
ATOM   2710  CD  LYS A 369      31.262 -37.981 -54.231  1.00  0.33           C  
ATOM   2711  CE  LYS A 369      30.606 -39.213 -54.862  1.00  0.33           C  
ATOM   2712  NZ  LYS A 369      29.230 -39.376 -54.342  1.00  0.33           N  
ATOM   2713  N   LEU A 370      35.386 -33.938 -54.903  1.00  0.19           N  
ATOM   2714  CA  LEU A 370      35.831 -32.622 -54.490  1.00  0.19           C  
ATOM   2715  C   LEU A 370      34.969 -32.046 -53.370  1.00  0.19           C  
ATOM   2716  O   LEU A 370      33.743 -32.137 -53.389  1.00  0.19           O  
ATOM   2717  CB  LEU A 370      35.858 -31.662 -55.707  1.00  0.19           C  
ATOM   2718  CG  LEU A 370      36.480 -30.270 -55.457  1.00  0.19           C  
ATOM   2719  CD1 LEU A 370      37.970 -30.354 -55.091  1.00  0.19           C  
ATOM   2720  CD2 LEU A 370      36.282 -29.370 -56.687  1.00  0.19           C  
ATOM   2721  N   ALA A 371      35.609 -31.447 -52.354  1.00  0.17           N  
ATOM   2722  CA  ALA A 371      34.931 -31.026 -51.160  1.00  0.17           C  
ATOM   2723  C   ALA A 371      35.739 -29.909 -50.539  1.00  0.17           C  
ATOM   2724  O   ALA A 371      36.909 -29.715 -50.868  1.00  0.17           O  
ATOM   2725  CB  ALA A 371      34.812 -32.203 -50.165  1.00  0.17           C  
ATOM   2726  N   GLY A 372      35.119 -29.133 -49.632  1.00  0.17           N  
ATOM   2727  CA  GLY A 372      35.798 -28.099 -48.870  1.00  0.17           C  
ATOM   2728  C   GLY A 372      35.754 -28.459 -47.417  1.00  0.17           C  
ATOM   2729  O   GLY A 372      34.819 -29.102 -46.950  1.00  0.17           O  
ATOM   2730  N   GLY A 373      36.762 -28.035 -46.642  1.00  0.21           N  
ATOM   2731  CA  GLY A 373      36.803 -28.371 -45.233  1.00  0.21           C  
ATOM   2732  C   GLY A 373      38.020 -27.781 -44.599  1.00  0.21           C  
ATOM   2733  O   GLY A 373      39.103 -27.793 -45.174  1.00  0.21           O  
ATOM   2734  N   VAL A 374      37.863 -27.234 -43.385  1.00  0.18           N  
ATOM   2735  CA  VAL A 374      38.955 -26.699 -42.597  1.00  0.18           C  
ATOM   2736  C   VAL A 374      38.842 -27.371 -41.248  1.00  0.18           C  
ATOM   2737  O   VAL A 374      37.769 -27.389 -40.650  1.00  0.18           O  
ATOM   2738  CB  VAL A 374      38.883 -25.181 -42.427  1.00  0.18           C  
ATOM   2739  CG1 VAL A 374      40.065 -24.667 -41.578  1.00  0.18           C  
ATOM   2740  CG2 VAL A 374      38.908 -24.507 -43.814  1.00  0.18           C  
ATOM   2741  N   ALA A 375      39.937 -27.967 -40.748  1.00  0.24           N  
ATOM   2742  CA  ALA A 375      39.941 -28.659 -39.482  1.00  0.24           C  
ATOM   2743  C   ALA A 375      41.289 -28.416 -38.838  1.00  0.24           C  
ATOM   2744  O   ALA A 375      42.318 -28.443 -39.510  1.00  0.24           O  
ATOM   2745  CB  ALA A 375      39.717 -30.172 -39.684  1.00  0.24           C  
ATOM   2746  N   VAL A 376      41.315 -28.138 -37.522  1.00  0.23           N  
ATOM   2747  CA  VAL A 376      42.541 -27.867 -36.795  1.00  0.23           C  
ATOM   2748  C   VAL A 376      42.388 -28.439 -35.403  1.00  0.23           C  
ATOM   2749  O   VAL A 376      41.341 -28.318 -34.776  1.00  0.23           O  
ATOM   2750  CB  VAL A 376      42.916 -26.378 -36.673  1.00  0.23           C  
ATOM   2751  CG1 VAL A 376      43.349 -25.824 -38.044  1.00  0.23           C  
ATOM   2752  CG2 VAL A 376      41.758 -25.530 -36.103  1.00  0.23           C  
ATOM   2753  N   ILE A 377      43.445 -29.081 -34.874  1.00  0.29           N  
ATOM   2754  CA  ILE A 377      43.490 -29.527 -33.493  1.00  0.29           C  
ATOM   2755  C   ILE A 377      44.728 -28.876 -32.913  1.00  0.29           C  
ATOM   2756  O   ILE A 377      45.786 -28.859 -33.536  1.00  0.29           O  
ATOM   2757  CB  ILE A 377      43.545 -31.051 -33.348  1.00  0.29           C  
ATOM   2758  CG1 ILE A 377      42.280 -31.731 -33.938  1.00  0.29           C  
ATOM   2759  CG2 ILE A 377      43.744 -31.468 -31.870  1.00  0.29           C  
ATOM   2760  CD1 ILE A 377      40.968 -31.433 -33.198  1.00  0.29           C  
ATOM   2761  N   LYS A 378      44.626 -28.281 -31.711  1.00  0.25           N  
ATOM   2762  CA  LYS A 378      45.752 -27.665 -31.041  1.00  0.25           C  
ATOM   2763  C   LYS A 378      45.984 -28.438 -29.763  1.00  0.25           C  
ATOM   2764  O   LYS A 378      45.047 -28.695 -29.017  1.00  0.25           O  
ATOM   2765  CB  LYS A 378      45.478 -26.182 -30.681  1.00  0.25           C  
ATOM   2766  CG  LYS A 378      45.316 -25.262 -31.903  1.00  0.25           C  
ATOM   2767  CD  LYS A 378      45.086 -23.799 -31.485  1.00  0.25           C  
ATOM   2768  CE  LYS A 378      44.948 -22.840 -32.672  1.00  0.25           C  
ATOM   2769  NZ  LYS A 378      44.731 -21.457 -32.187  1.00  0.25           N  
ATOM   2770  N   VAL A 379      47.237 -28.851 -29.497  1.00  0.25           N  
ATOM   2771  CA  VAL A 379      47.589 -29.637 -28.327  1.00  0.25           C  
ATOM   2772  C   VAL A 379      48.670 -28.892 -27.583  1.00  0.25           C  
ATOM   2773  O   VAL A 379      49.666 -28.472 -28.166  1.00  0.25           O  
ATOM   2774  CB  VAL A 379      48.104 -31.030 -28.695  1.00  0.25           C  
ATOM   2775  CG1 VAL A 379      48.552 -31.819 -27.447  1.00  0.25           C  
ATOM   2776  CG2 VAL A 379      46.986 -31.805 -29.414  1.00  0.25           C  
ATOM   2777  N   GLY A 380      48.500 -28.695 -26.265  1.00  0.48           N  
ATOM   2778  CA  GLY A 380      49.526 -28.059 -25.461  1.00  0.48           C  
ATOM   2779  C   GLY A 380      49.021 -27.845 -24.073  1.00  0.48           C  
ATOM   2780  O   GLY A 380      47.830 -27.963 -23.807  1.00  0.48           O  
ATOM   2781  N   ALA A 381      49.920 -27.523 -23.133  1.00  0.54           N  
ATOM   2782  CA  ALA A 381      49.547 -27.260 -21.766  1.00  0.54           C  
ATOM   2783  C   ALA A 381      50.327 -26.063 -21.265  1.00  0.54           C  
ATOM   2784  O   ALA A 381      51.535 -25.968 -21.455  1.00  0.54           O  
ATOM   2785  CB  ALA A 381      49.859 -28.473 -20.877  1.00  0.54           C  
ATOM   2786  N   ALA A 382      49.634 -25.101 -20.629  1.00  0.52           N  
ATOM   2787  CA  ALA A 382      50.228 -23.875 -20.136  1.00  0.52           C  
ATOM   2788  C   ALA A 382      51.167 -24.032 -18.938  1.00  0.52           C  
ATOM   2789  O   ALA A 382      52.107 -23.263 -18.761  1.00  0.52           O  
ATOM   2790  CB  ALA A 382      49.090 -22.899 -19.781  1.00  0.52           C  
ATOM   2791  N   THR A 383      50.911 -25.016 -18.054  1.00  0.54           N  
ATOM   2792  CA  THR A 383      51.637 -25.173 -16.796  1.00  0.54           C  
ATOM   2793  C   THR A 383      51.959 -26.630 -16.568  1.00  0.54           C  
ATOM   2794  O   THR A 383      51.372 -27.509 -17.195  1.00  0.54           O  
ATOM   2795  CB  THR A 383      50.875 -24.673 -15.561  1.00  0.54           C  
ATOM   2796  OG1 THR A 383      49.642 -25.358 -15.358  1.00  0.54           O  
ATOM   2797  CG2 THR A 383      50.532 -23.189 -15.726  1.00  0.54           C  
ATOM   2798  N   GLU A 384      52.896 -26.944 -15.641  1.00  0.53           N  
ATOM   2799  CA  GLU A 384      53.235 -28.320 -15.305  1.00  0.53           C  
ATOM   2800  C   GLU A 384      52.084 -29.126 -14.721  1.00  0.53           C  
ATOM   2801  O   GLU A 384      51.901 -30.278 -15.088  1.00  0.53           O  
ATOM   2802  CB  GLU A 384      54.509 -28.446 -14.427  1.00  0.53           C  
ATOM   2803  CG  GLU A 384      54.399 -27.990 -12.947  1.00  0.53           C  
ATOM   2804  CD  GLU A 384      54.408 -29.170 -11.983  1.00  0.53           C  
ATOM   2805  OE1 GLU A 384      53.349 -29.836 -11.833  1.00  0.53           O  
ATOM   2806  OE2 GLU A 384      55.468 -29.518 -11.397  1.00  0.53           O  
ATOM   2807  N   THR A 385      51.235 -28.537 -13.850  1.00  0.59           N  
ATOM   2808  CA  THR A 385      50.040 -29.203 -13.325  1.00  0.59           C  
ATOM   2809  C   THR A 385      49.013 -29.493 -14.415  1.00  0.59           C  
ATOM   2810  O   THR A 385      48.453 -30.583 -14.498  1.00  0.59           O  
ATOM   2811  CB  THR A 385      49.429 -28.495 -12.112  1.00  0.59           C  
ATOM   2812  OG1 THR A 385      48.439 -29.296 -11.485  1.00  0.59           O  
ATOM   2813  CG2 THR A 385      48.776 -27.149 -12.459  1.00  0.59           C  
ATOM   2814  N   ALA A 386      48.797 -28.544 -15.356  1.00  0.57           N  
ATOM   2815  CA  ALA A 386      47.977 -28.767 -16.528  1.00  0.57           C  
ATOM   2816  C   ALA A 386      48.544 -29.823 -17.471  1.00  0.57           C  
ATOM   2817  O   ALA A 386      47.797 -30.627 -18.023  1.00  0.57           O  
ATOM   2818  CB  ALA A 386      47.764 -27.443 -17.287  1.00  0.57           C  
ATOM   2819  N   LEU A 387      49.880 -29.850 -17.678  1.00  0.50           N  
ATOM   2820  CA  LEU A 387      50.564 -30.905 -18.408  1.00  0.50           C  
ATOM   2821  C   LEU A 387      50.500 -32.245 -17.714  1.00  0.50           C  
ATOM   2822  O   LEU A 387      50.286 -33.264 -18.362  1.00  0.50           O  
ATOM   2823  CB  LEU A 387      52.050 -30.580 -18.700  1.00  0.50           C  
ATOM   2824  CG  LEU A 387      52.756 -31.604 -19.627  1.00  0.50           C  
ATOM   2825  CD1 LEU A 387      52.138 -31.654 -21.035  1.00  0.50           C  
ATOM   2826  CD2 LEU A 387      54.260 -31.316 -19.720  1.00  0.50           C  
ATOM   2827  N   LYS A 388      50.658 -32.302 -16.375  1.00  0.49           N  
ATOM   2828  CA  LYS A 388      50.450 -33.524 -15.629  1.00  0.49           C  
ATOM   2829  C   LYS A 388      49.043 -34.026 -15.808  1.00  0.49           C  
ATOM   2830  O   LYS A 388      48.905 -35.119 -16.328  1.00  0.49           O  
ATOM   2831  CB  LYS A 388      50.785 -33.382 -14.125  1.00  0.49           C  
ATOM   2832  CG  LYS A 388      52.298 -33.379 -13.866  1.00  0.49           C  
ATOM   2833  CD  LYS A 388      52.649 -33.076 -12.400  1.00  0.49           C  
ATOM   2834  CE  LYS A 388      54.164 -32.974 -12.172  1.00  0.49           C  
ATOM   2835  NZ  LYS A 388      54.469 -32.095 -11.027  1.00  0.49           N  
ATOM   2836  N   GLU A 389      47.994 -33.211 -15.554  1.00  0.46           N  
ATOM   2837  CA  GLU A 389      46.604 -33.615 -15.734  1.00  0.46           C  
ATOM   2838  C   GLU A 389      46.299 -34.055 -17.162  1.00  0.46           C  
ATOM   2839  O   GLU A 389      45.711 -35.111 -17.372  1.00  0.46           O  
ATOM   2840  CB  GLU A 389      45.646 -32.462 -15.321  1.00  0.46           C  
ATOM   2841  CG  GLU A 389      44.132 -32.829 -15.269  1.00  0.46           C  
ATOM   2842  CD  GLU A 389      43.707 -33.557 -13.996  1.00  0.46           C  
ATOM   2843  OE1 GLU A 389      44.570 -34.128 -13.283  1.00  0.46           O  
ATOM   2844  OE2 GLU A 389      42.487 -33.511 -13.657  1.00  0.46           O  
ATOM   2845  N   ARG A 390      46.760 -33.307 -18.197  1.00  0.43           N  
ATOM   2846  CA  ARG A 390      46.420 -33.649 -19.570  1.00  0.43           C  
ATOM   2847  C   ARG A 390      47.406 -34.542 -20.313  1.00  0.43           C  
ATOM   2848  O   ARG A 390      47.170 -34.911 -21.459  1.00  0.43           O  
ATOM   2849  CB  ARG A 390      46.010 -32.437 -20.437  1.00  0.43           C  
ATOM   2850  CG  ARG A 390      47.129 -31.628 -21.126  1.00  0.43           C  
ATOM   2851  CD  ARG A 390      46.588 -30.541 -22.064  1.00  0.43           C  
ATOM   2852  NE  ARG A 390      45.737 -29.642 -21.224  1.00  0.43           N  
ATOM   2853  CZ  ARG A 390      44.543 -29.206 -21.624  1.00  0.43           C  
ATOM   2854  NH1 ARG A 390      44.163 -29.153 -22.891  1.00  0.43           N  
ATOM   2855  NH2 ARG A 390      43.626 -28.838 -20.725  1.00  0.43           N  
ATOM   2856  N   LYS A 391      48.530 -34.962 -19.701  1.00  0.47           N  
ATOM   2857  CA  LYS A 391      49.284 -36.086 -20.232  1.00  0.47           C  
ATOM   2858  C   LYS A 391      48.957 -37.369 -19.481  1.00  0.47           C  
ATOM   2859  O   LYS A 391      48.860 -38.428 -20.094  1.00  0.47           O  
ATOM   2860  CB  LYS A 391      50.816 -35.865 -20.222  1.00  0.47           C  
ATOM   2861  CG  LYS A 391      51.493 -36.925 -21.111  1.00  0.47           C  
ATOM   2862  CD  LYS A 391      53.002 -37.132 -20.928  1.00  0.47           C  
ATOM   2863  CE  LYS A 391      53.417 -38.477 -21.551  1.00  0.47           C  
ATOM   2864  NZ  LYS A 391      54.791 -38.871 -21.172  1.00  0.47           N  
ATOM   2865  N   GLU A 392      48.697 -37.293 -18.153  1.00  0.40           N  
ATOM   2866  CA  GLU A 392      48.214 -38.385 -17.304  1.00  0.40           C  
ATOM   2867  C   GLU A 392      46.938 -38.939 -17.869  1.00  0.40           C  
ATOM   2868  O   GLU A 392      46.721 -40.138 -17.989  1.00  0.40           O  
ATOM   2869  CB  GLU A 392      47.951 -37.788 -15.892  1.00  0.40           C  
ATOM   2870  CG  GLU A 392      46.999 -38.460 -14.875  1.00  0.40           C  
ATOM   2871  CD  GLU A 392      47.416 -39.841 -14.415  1.00  0.40           C  
ATOM   2872  OE1 GLU A 392      48.591 -40.020 -14.012  1.00  0.40           O  
ATOM   2873  OE2 GLU A 392      46.550 -40.755 -14.426  1.00  0.40           O  
ATOM   2874  N   SER A 393      46.069 -38.035 -18.316  1.00  0.47           N  
ATOM   2875  CA  SER A 393      44.864 -38.402 -19.000  1.00  0.47           C  
ATOM   2876  C   SER A 393      45.024 -39.126 -20.353  1.00  0.47           C  
ATOM   2877  O   SER A 393      44.474 -40.213 -20.538  1.00  0.47           O  
ATOM   2878  CB  SER A 393      44.050 -37.105 -19.165  1.00  0.47           C  
ATOM   2879  OG  SER A 393      44.624 -36.210 -20.107  1.00  0.47           O  
ATOM   2880  N   VAL A 394      45.814 -38.568 -21.314  1.00  0.46           N  
ATOM   2881  CA  VAL A 394      45.883 -38.965 -22.734  1.00  0.46           C  
ATOM   2882  C   VAL A 394      46.261 -40.424 -22.953  1.00  0.46           C  
ATOM   2883  O   VAL A 394      45.853 -41.062 -23.925  1.00  0.46           O  
ATOM   2884  CB  VAL A 394      46.757 -38.031 -23.597  1.00  0.46           C  
ATOM   2885  CG1 VAL A 394      47.095 -38.605 -24.998  1.00  0.46           C  
ATOM   2886  CG2 VAL A 394      45.988 -36.713 -23.801  1.00  0.46           C  
ATOM   2887  N   GLU A 395      47.030 -41.012 -22.030  1.00  0.35           N  
ATOM   2888  CA  GLU A 395      47.398 -42.410 -22.043  1.00  0.35           C  
ATOM   2889  C   GLU A 395      46.210 -43.382 -21.991  1.00  0.35           C  
ATOM   2890  O   GLU A 395      46.249 -44.455 -22.596  1.00  0.35           O  
ATOM   2891  CB  GLU A 395      48.441 -42.666 -20.931  1.00  0.35           C  
ATOM   2892  CG  GLU A 395      49.697 -41.764 -21.112  1.00  0.35           C  
ATOM   2893  CD  GLU A 395      50.899 -42.157 -20.257  1.00  0.35           C  
ATOM   2894  OE1 GLU A 395      50.839 -43.221 -19.588  1.00  0.35           O  
ATOM   2895  OE2 GLU A 395      51.917 -41.405 -20.322  1.00  0.35           O  
ATOM   2896  N   ASP A 396      45.092 -43.039 -21.319  1.00  0.41           N  
ATOM   2897  CA  ASP A 396      43.997 -43.984 -21.172  1.00  0.41           C  
ATOM   2898  C   ASP A 396      43.032 -44.165 -22.355  1.00  0.41           C  
ATOM   2899  O   ASP A 396      42.404 -45.212 -22.418  1.00  0.41           O  
ATOM   2900  CB  ASP A 396      43.155 -43.736 -19.909  1.00  0.41           C  
ATOM   2901  CG  ASP A 396      43.854 -44.090 -18.626  1.00  0.41           C  
ATOM   2902  OD1 ASP A 396      45.104 -44.145 -18.562  1.00  0.41           O  
ATOM   2903  OD2 ASP A 396      43.119 -44.137 -17.604  1.00  0.41           O  
ATOM   2904  N   ALA A 397      42.886 -43.275 -23.373  1.00  0.53           N  
ATOM   2905  CA  ALA A 397      42.144 -43.667 -24.578  1.00  0.53           C  
ATOM   2906  C   ALA A 397      43.102 -44.145 -25.618  1.00  0.53           C  
ATOM   2907  O   ALA A 397      42.704 -44.728 -26.620  1.00  0.53           O  
ATOM   2908  CB  ALA A 397      41.280 -42.596 -25.271  1.00  0.53           C  
ATOM   2909  N   VAL A 398      44.418 -44.036 -25.371  1.00  0.38           N  
ATOM   2910  CA  VAL A 398      45.344 -44.926 -26.047  1.00  0.38           C  
ATOM   2911  C   VAL A 398      45.037 -46.361 -25.621  1.00  0.38           C  
ATOM   2912  O   VAL A 398      44.966 -47.248 -26.463  1.00  0.38           O  
ATOM   2913  CB  VAL A 398      46.808 -44.531 -25.890  1.00  0.38           C  
ATOM   2914  CG1 VAL A 398      47.750 -45.514 -26.621  1.00  0.38           C  
ATOM   2915  CG2 VAL A 398      46.977 -43.108 -26.460  1.00  0.38           C  
ATOM   2916  N   ALA A 399      44.735 -46.611 -24.330  1.00  0.43           N  
ATOM   2917  CA  ALA A 399      44.134 -47.857 -23.896  1.00  0.43           C  
ATOM   2918  C   ALA A 399      42.663 -48.089 -24.343  1.00  0.43           C  
ATOM   2919  O   ALA A 399      42.339 -49.099 -24.965  1.00  0.43           O  
ATOM   2920  CB  ALA A 399      44.300 -47.929 -22.361  1.00  0.43           C  
ATOM   2921  N   ALA A 400      41.704 -47.166 -24.104  1.00  0.56           N  
ATOM   2922  CA  ALA A 400      40.287 -47.464 -24.280  1.00  0.56           C  
ATOM   2923  C   ALA A 400      39.663 -47.019 -25.600  1.00  0.56           C  
ATOM   2924  O   ALA A 400      38.500 -47.321 -25.861  1.00  0.56           O  
ATOM   2925  CB  ALA A 400      39.422 -47.014 -23.077  1.00  0.56           C  
ATOM   2926  N   ALA A 401      40.407 -46.373 -26.525  1.00  0.48           N  
ATOM   2927  CA  ALA A 401      40.001 -46.356 -27.924  1.00  0.48           C  
ATOM   2928  C   ALA A 401      40.419 -47.647 -28.624  1.00  0.48           C  
ATOM   2929  O   ALA A 401      39.780 -48.070 -29.583  1.00  0.48           O  
ATOM   2930  CB  ALA A 401      40.539 -45.129 -28.689  1.00  0.48           C  
ATOM   2931  N   LYS A 402      41.443 -48.371 -28.097  1.00  0.41           N  
ATOM   2932  CA  LYS A 402      41.657 -49.779 -28.424  1.00  0.41           C  
ATOM   2933  C   LYS A 402      40.484 -50.610 -27.906  1.00  0.41           C  
ATOM   2934  O   LYS A 402      39.974 -51.487 -28.592  1.00  0.41           O  
ATOM   2935  CB  LYS A 402      43.000 -50.358 -27.887  1.00  0.41           C  
ATOM   2936  CG  LYS A 402      44.277 -49.686 -28.430  1.00  0.41           C  
ATOM   2937  CD  LYS A 402      45.520 -50.124 -27.621  1.00  0.41           C  
ATOM   2938  CE  LYS A 402      46.807 -49.325 -27.875  1.00  0.41           C  
ATOM   2939  NZ  LYS A 402      47.261 -49.511 -29.266  1.00  0.41           N  
ATOM   2940  N   ALA A 403      39.965 -50.289 -26.699  1.00  0.50           N  
ATOM   2941  CA  ALA A 403      38.856 -50.996 -26.083  1.00  0.50           C  
ATOM   2942  C   ALA A 403      37.544 -51.070 -26.849  1.00  0.50           C  
ATOM   2943  O   ALA A 403      36.761 -51.997 -26.659  1.00  0.50           O  
ATOM   2944  CB  ALA A 403      38.578 -50.523 -24.649  1.00  0.50           C  
ATOM   2945  N   ALA A 404      37.265 -50.117 -27.746  1.00  0.49           N  
ATOM   2946  CA  ALA A 404      36.100 -50.201 -28.603  1.00  0.49           C  
ATOM   2947  C   ALA A 404      36.251 -51.192 -29.765  1.00  0.49           C  
ATOM   2948  O   ALA A 404      35.266 -51.571 -30.394  1.00  0.49           O  
ATOM   2949  CB  ALA A 404      35.782 -48.797 -29.161  1.00  0.49           C  
ATOM   2950  N   VAL A 405      37.491 -51.621 -30.088  1.00  0.39           N  
ATOM   2951  CA  VAL A 405      37.802 -52.378 -31.296  1.00  0.39           C  
ATOM   2952  C   VAL A 405      37.378 -53.844 -31.299  1.00  0.39           C  
ATOM   2953  O   VAL A 405      36.742 -54.288 -32.251  1.00  0.39           O  
ATOM   2954  CB  VAL A 405      39.297 -52.275 -31.613  1.00  0.39           C  
ATOM   2955  CG1 VAL A 405      39.707 -53.099 -32.853  1.00  0.39           C  
ATOM   2956  CG2 VAL A 405      39.628 -50.790 -31.856  1.00  0.39           C  
ATOM   2957  N   GLU A 406      37.710 -54.645 -30.258  1.00  0.33           N  
ATOM   2958  CA  GLU A 406      37.567 -56.106 -30.357  1.00  0.33           C  
ATOM   2959  C   GLU A 406      36.415 -56.746 -29.576  1.00  0.33           C  
ATOM   2960  O   GLU A 406      35.858 -57.746 -30.021  1.00  0.33           O  
ATOM   2961  CB  GLU A 406      38.955 -56.759 -30.072  1.00  0.33           C  
ATOM   2962  CG  GLU A 406      39.081 -58.309 -30.203  1.00  0.33           C  
ATOM   2963  CD  GLU A 406      40.502 -58.868 -30.042  1.00  0.33           C  
ATOM   2964  OE1 GLU A 406      41.429 -58.327 -30.694  1.00  0.33           O  
ATOM   2965  OE2 GLU A 406      40.654 -59.874 -29.296  1.00  0.33           O  
ATOM   2966  N   GLU A 407      35.919 -56.161 -28.457  1.00  0.39           N  
ATOM   2967  CA  GLU A 407      34.712 -56.679 -27.807  1.00  0.39           C  
ATOM   2968  C   GLU A 407      33.509 -55.950 -28.375  1.00  0.39           C  
ATOM   2969  O   GLU A 407      32.356 -56.275 -28.097  1.00  0.39           O  
ATOM   2970  CB  GLU A 407      34.606 -56.404 -26.261  1.00  0.39           C  
ATOM   2971  CG  GLU A 407      35.677 -57.020 -25.320  1.00  0.39           C  
ATOM   2972  CD  GLU A 407      35.260 -57.727 -24.035  1.00  0.39           C  
ATOM   2973  OE1 GLU A 407      34.089 -57.679 -23.607  1.00  0.39           O  
ATOM   2974  OE2 GLU A 407      36.180 -58.308 -23.388  1.00  0.39           O  
ATOM   2975  N   GLY A 408      33.745 -54.885 -29.167  1.00  0.45           N  
ATOM   2976  CA  GLY A 408      32.738 -53.858 -29.361  1.00  0.45           C  
ATOM   2977  C   GLY A 408      32.486 -53.063 -28.098  1.00  0.45           C  
ATOM   2978  O   GLY A 408      33.411 -52.657 -27.397  1.00  0.45           O  
ATOM   2979  N   ILE A 409      31.214 -52.764 -27.776  1.00  0.55           N  
ATOM   2980  CA  ILE A 409      30.943 -51.680 -26.847  1.00  0.55           C  
ATOM   2981  C   ILE A 409      29.661 -51.855 -26.029  1.00  0.55           C  
ATOM   2982  O   ILE A 409      28.694 -52.442 -26.508  1.00  0.55           O  
ATOM   2983  CB  ILE A 409      30.929 -50.393 -27.661  1.00  0.55           C  
ATOM   2984  CG1 ILE A 409      31.357 -49.190 -26.825  1.00  0.55           C  
ATOM   2985  CG2 ILE A 409      29.593 -50.174 -28.410  1.00  0.55           C  
ATOM   2986  CD1 ILE A 409      32.879 -49.036 -26.748  1.00  0.55           C  
ATOM   2987  N   VAL A 410      29.599 -51.337 -24.769  1.00  0.67           N  
ATOM   2988  CA  VAL A 410      28.324 -51.148 -24.077  1.00  0.67           C  
ATOM   2989  C   VAL A 410      28.093 -49.645 -23.854  1.00  0.67           C  
ATOM   2990  O   VAL A 410      28.966 -48.899 -23.421  1.00  0.67           O  
ATOM   2991  CB  VAL A 410      28.071 -51.899 -22.776  1.00  0.67           C  
ATOM   2992  CG1 VAL A 410      27.923 -53.404 -23.067  1.00  0.67           C  
ATOM   2993  CG2 VAL A 410      29.138 -51.587 -21.732  1.00  0.67           C  
ATOM   2994  N   PRO A 411      26.949 -49.126 -24.221  1.00  0.58           N  
ATOM   2995  CA  PRO A 411      26.653 -47.709 -23.992  1.00  0.58           C  
ATOM   2996  C   PRO A 411      26.327 -47.261 -22.582  1.00  0.58           C  
ATOM   2997  O   PRO A 411      25.611 -47.964 -21.890  1.00  0.58           O  
ATOM   2998  CB  PRO A 411      25.531 -47.421 -24.951  1.00  0.58           C  
ATOM   2999  CG  PRO A 411      25.806 -48.374 -26.118  1.00  0.58           C  
ATOM   3000  CD  PRO A 411      26.371 -49.603 -25.470  1.00  0.58           C  
ATOM   3001  N   GLY A 412      26.842 -46.094 -22.147  1.00  0.66           N  
ATOM   3002  CA  GLY A 412      27.411 -45.956 -20.810  1.00  0.66           C  
ATOM   3003  C   GLY A 412      27.037 -44.775 -19.959  1.00  0.66           C  
ATOM   3004  O   GLY A 412      25.897 -44.334 -19.891  1.00  0.66           O  
ATOM   3005  N   GLY A 413      28.034 -44.263 -19.206  1.00  0.58           N  
ATOM   3006  CA  GLY A 413      27.886 -43.215 -18.196  1.00  0.58           C  
ATOM   3007  C   GLY A 413      27.535 -43.786 -16.851  1.00  0.58           C  
ATOM   3008  O   GLY A 413      27.138 -43.074 -15.935  1.00  0.58           O  
ATOM   3009  N   GLY A 414      27.596 -45.127 -16.733  1.00  0.65           N  
ATOM   3010  CA  GLY A 414      27.052 -45.888 -15.613  1.00  0.65           C  
ATOM   3011  C   GLY A 414      25.559 -46.039 -15.694  1.00  0.65           C  
ATOM   3012  O   GLY A 414      24.951 -46.737 -14.890  1.00  0.65           O  
ATOM   3013  N   ALA A 415      24.929 -45.435 -16.724  1.00  0.57           N  
ATOM   3014  CA  ALA A 415      23.538 -45.631 -17.052  1.00  0.57           C  
ATOM   3015  C   ALA A 415      23.324 -46.989 -17.660  1.00  0.57           C  
ATOM   3016  O   ALA A 415      22.264 -47.595 -17.505  1.00  0.57           O  
ATOM   3017  CB  ALA A 415      23.083 -44.595 -18.086  1.00  0.57           C  
ATOM   3018  N   SER A 416      24.399 -47.516 -18.299  1.00  0.52           N  
ATOM   3019  CA  SER A 416      24.552 -48.887 -18.735  1.00  0.52           C  
ATOM   3020  C   SER A 416      24.115 -49.807 -17.655  1.00  0.52           C  
ATOM   3021  O   SER A 416      23.170 -50.553 -17.879  1.00  0.52           O  
ATOM   3022  CB  SER A 416      26.021 -49.278 -19.085  1.00  0.52           C  
ATOM   3023  OG  SER A 416      26.983 -48.787 -18.144  1.00  0.52           O  
ATOM   3024  N   LEU A 417      24.701 -49.713 -16.441  1.00  0.52           N  
ATOM   3025  CA  LEU A 417      24.454 -50.635 -15.343  1.00  0.52           C  
ATOM   3026  C   LEU A 417      23.054 -50.611 -14.723  1.00  0.52           C  
ATOM   3027  O   LEU A 417      22.901 -50.799 -13.518  1.00  0.52           O  
ATOM   3028  CB  LEU A 417      25.564 -50.578 -14.255  1.00  0.52           C  
ATOM   3029  CG  LEU A 417      26.886 -51.231 -14.710  1.00  0.52           C  
ATOM   3030  CD1 LEU A 417      28.054 -50.901 -13.785  1.00  0.52           C  
ATOM   3031  CD2 LEU A 417      26.794 -52.762 -14.750  1.00  0.52           C  
ATOM   3032  N   ILE A 418      21.990 -50.431 -15.548  1.00  0.52           N  
ATOM   3033  CA  ILE A 418      20.637 -50.919 -15.325  1.00  0.52           C  
ATOM   3034  C   ILE A 418      20.076 -51.988 -16.390  1.00  0.52           C  
ATOM   3035  O   ILE A 418      19.061 -52.577 -16.036  1.00  0.52           O  
ATOM   3036  CB  ILE A 418      19.669 -49.782 -14.844  1.00  0.52           C  
ATOM   3037  CG1 ILE A 418      20.118 -49.201 -13.464  1.00  0.52           C  
ATOM   3038  CG2 ILE A 418      18.201 -50.228 -14.625  1.00  0.52           C  
ATOM   3039  CD1 ILE A 418      20.737 -47.801 -13.461  1.00  0.52           C  
ATOM   3040  N   HIS A 419      20.730 -52.496 -17.564  1.00  0.44           N  
ATOM   3041  CA  HIS A 419      20.330 -53.827 -18.301  1.00  0.44           C  
ATOM   3042  C   HIS A 419      21.272 -55.203 -18.818  1.00  0.44           C  
ATOM   3043  O   HIS A 419      20.953 -55.507 -19.965  1.00  0.44           O  
ATOM   3044  CB  HIS A 419      19.116 -53.647 -19.315  1.00  0.44           C  
ATOM   3045  CG  HIS A 419      17.964 -52.647 -19.111  1.00  0.44           C  
ATOM   3046  ND1 HIS A 419      17.145 -52.698 -17.997  1.00  0.44           N  
ATOM   3047  CD2 HIS A 419      17.538 -51.629 -19.915  1.00  0.44           C  
ATOM   3048  CE1 HIS A 419      16.299 -51.682 -18.127  1.00  0.44           C  
ATOM   3049  NE2 HIS A 419      16.494 -51.016 -19.275  1.00  0.44           N  
ATOM   3050  N   GLN A 420      22.315 -56.166 -18.243  1.00  0.39           N  
ATOM   3051  CA  GLN A 420      23.149 -56.778 -16.935  1.00  0.39           C  
ATOM   3052  C   GLN A 420      22.546 -57.468 -15.502  1.00  0.39           C  
ATOM   3053  O   GLN A 420      22.047 -58.567 -15.466  1.00  0.39           O  
ATOM   3054  CB  GLN A 420      24.702 -56.558 -16.702  1.00  0.39           C  
ATOM   3055  CG  GLN A 420      25.874 -56.970 -17.689  1.00  0.39           C  
ATOM   3056  CD  GLN A 420      25.611 -57.150 -19.186  1.00  0.39           C  
ATOM   3057  OE1 GLN A 420      24.555 -56.807 -19.695  1.00  0.39           O  
ATOM   3058  NE2 GLN A 420      26.585 -57.699 -19.943  1.00  0.39           N  
ATOM   3059  N   ALA A 421      22.453 -56.947 -14.236  1.00  0.44           N  
ATOM   3060  CA  ALA A 421      21.493 -57.444 -13.166  1.00  0.44           C  
ATOM   3061  C   ALA A 421      19.870 -57.510 -13.156  1.00  0.44           C  
ATOM   3062  O   ALA A 421      19.289 -57.876 -12.141  1.00  0.44           O  
ATOM   3063  CB  ALA A 421      21.818 -56.726 -11.825  1.00  0.44           C  
ATOM   3064  N   ARG A 422      19.027 -57.182 -14.178  1.00  0.30           N  
ATOM   3065  CA  ARG A 422      17.540 -57.190 -14.141  1.00  0.30           C  
ATOM   3066  C   ARG A 422      16.870 -58.496 -14.647  1.00  0.30           C  
ATOM   3067  O   ARG A 422      16.025 -59.077 -13.969  1.00  0.30           O  
ATOM   3068  CB  ARG A 422      16.883 -55.956 -14.899  1.00  0.30           C  
ATOM   3069  CG  ARG A 422      16.521 -54.726 -14.016  1.00  0.30           C  
ATOM   3070  CD  ARG A 422      16.078 -53.435 -14.763  1.00  0.30           C  
ATOM   3071  NE  ARG A 422      14.594 -53.417 -15.085  1.00  0.30           N  
ATOM   3072  CZ  ARG A 422      14.031 -53.640 -16.283  1.00  0.30           C  
ATOM   3073  NH1 ARG A 422      14.719 -54.057 -17.334  1.00  0.30           N  
ATOM   3074  NH2 ARG A 422      12.740 -53.346 -16.458  1.00  0.30           N  
ATOM   3075  N   LYS A 423      17.178 -58.974 -15.874  1.00  0.27           N  
ATOM   3076  CA  LYS A 423      16.329 -59.867 -16.669  1.00  0.27           C  
ATOM   3077  C   LYS A 423      16.379 -61.364 -16.295  1.00  0.27           C  
ATOM   3078  O   LYS A 423      15.346 -61.916 -15.936  1.00  0.27           O  
ATOM   3079  CB  LYS A 423      16.424 -59.465 -18.188  1.00  0.27           C  
ATOM   3080  CG  LYS A 423      16.718 -60.509 -19.278  1.00  0.27           C  
ATOM   3081  CD  LYS A 423      17.419 -59.845 -20.492  1.00  0.27           C  
ATOM   3082  CE  LYS A 423      18.130 -60.820 -21.447  1.00  0.27           C  
ATOM   3083  NZ  LYS A 423      17.748 -60.671 -22.863  1.00  0.27           N  
ATOM   3084  N   ALA A 424      17.542 -62.059 -16.225  1.00  0.32           N  
ATOM   3085  CA  ALA A 424      17.605 -63.439 -15.725  1.00  0.32           C  
ATOM   3086  C   ALA A 424      17.920 -63.502 -14.226  1.00  0.32           C  
ATOM   3087  O   ALA A 424      18.522 -64.458 -13.736  1.00  0.32           O  
ATOM   3088  CB  ALA A 424      18.648 -64.295 -16.484  1.00  0.32           C  
ATOM   3089  N   LEU A 425      17.550 -62.451 -13.458  1.00  0.54           N  
ATOM   3090  CA  LEU A 425      18.025 -62.255 -12.091  1.00  0.54           C  
ATOM   3091  C   LEU A 425      16.950 -62.074 -11.086  1.00  0.54           C  
ATOM   3092  O   LEU A 425      17.063 -62.502  -9.943  1.00  0.54           O  
ATOM   3093  CB  LEU A 425      18.836 -60.982 -11.919  1.00  0.54           C  
ATOM   3094  CG  LEU A 425      20.231 -61.152 -12.477  1.00  0.54           C  
ATOM   3095  CD1 LEU A 425      20.214 -60.801 -13.965  1.00  0.54           C  
ATOM   3096  CD2 LEU A 425      21.206 -60.383 -11.565  1.00  0.54           C  
ATOM   3097  N   THR A 426      15.840 -61.473 -11.505  1.00  0.52           N  
ATOM   3098  CA  THR A 426      14.616 -61.429 -10.734  1.00  0.52           C  
ATOM   3099  C   THR A 426      14.142 -62.858 -10.513  1.00  0.52           C  
ATOM   3100  O   THR A 426      13.790 -63.257  -9.403  1.00  0.52           O  
ATOM   3101  CB  THR A 426      13.607 -60.556 -11.459  1.00  0.52           C  
ATOM   3102  OG1 THR A 426      13.578 -60.881 -12.843  1.00  0.52           O  
ATOM   3103  CG2 THR A 426      14.081 -59.094 -11.355  1.00  0.52           C  
ATOM   3104  N   GLU A 427      14.293 -63.676 -11.572  1.00  0.50           N  
ATOM   3105  CA  GLU A 427      14.273 -65.127 -11.578  1.00  0.50           C  
ATOM   3106  C   GLU A 427      15.330 -65.839 -10.713  1.00  0.50           C  
ATOM   3107  O   GLU A 427      15.003 -66.703  -9.904  1.00  0.50           O  
ATOM   3108  CB  GLU A 427      14.498 -65.552 -13.054  1.00  0.50           C  
ATOM   3109  CG  GLU A 427      14.385 -67.072 -13.329  1.00  0.50           C  
ATOM   3110  CD  GLU A 427      12.998 -67.637 -13.021  1.00  0.50           C  
ATOM   3111  OE1 GLU A 427      12.023 -66.847 -12.957  1.00  0.50           O  
ATOM   3112  OE2 GLU A 427      12.920 -68.881 -12.858  1.00  0.50           O  
ATOM   3113  N   LEU A 428      16.629 -65.470 -10.831  1.00  0.63           N  
ATOM   3114  CA  LEU A 428      17.803 -66.164 -10.288  1.00  0.63           C  
ATOM   3115  C   LEU A 428      17.779 -66.582  -8.839  1.00  0.63           C  
ATOM   3116  O   LEU A 428      17.761 -65.759  -7.931  1.00  0.63           O  
ATOM   3117  CB  LEU A 428      19.041 -65.259 -10.433  1.00  0.63           C  
ATOM   3118  CG  LEU A 428      20.465 -65.792 -10.167  1.00  0.63           C  
ATOM   3119  CD1 LEU A 428      21.392 -64.649 -10.550  1.00  0.63           C  
ATOM   3120  CD2 LEU A 428      20.831 -66.221  -8.743  1.00  0.63           C  
ATOM   3121  N   ARG A 429      17.907 -67.892  -8.583  1.00  0.44           N  
ATOM   3122  CA  ARG A 429      17.986 -68.403  -7.239  1.00  0.44           C  
ATOM   3123  C   ARG A 429      19.240 -69.243  -7.111  1.00  0.44           C  
ATOM   3124  O   ARG A 429      19.914 -69.569  -8.085  1.00  0.44           O  
ATOM   3125  CB  ARG A 429      16.736 -69.235  -6.872  1.00  0.44           C  
ATOM   3126  CG  ARG A 429      15.384 -68.496  -7.032  1.00  0.44           C  
ATOM   3127  CD  ARG A 429      14.922 -67.542  -5.909  1.00  0.44           C  
ATOM   3128  NE  ARG A 429      15.683 -66.241  -5.893  1.00  0.44           N  
ATOM   3129  CZ  ARG A 429      15.299 -65.133  -6.552  1.00  0.44           C  
ATOM   3130  NH1 ARG A 429      14.418 -65.191  -7.544  1.00  0.44           N  
ATOM   3131  NH2 ARG A 429      15.837 -63.953  -6.238  1.00  0.44           N  
ATOM   3132  N   ALA A 430      19.601 -69.533  -5.858  1.00  0.61           N  
ATOM   3133  CA  ALA A 430      20.831 -70.154  -5.456  1.00  0.61           C  
ATOM   3134  C   ALA A 430      20.821 -71.672  -5.537  1.00  0.61           C  
ATOM   3135  O   ALA A 430      19.810 -72.289  -5.865  1.00  0.61           O  
ATOM   3136  CB  ALA A 430      21.082 -69.725  -4.015  1.00  0.61           C  
ATOM   3137  N   SER A 431      21.978 -72.304  -5.257  1.00  0.44           N  
ATOM   3138  CA  SER A 431      22.112 -73.751  -5.333  1.00  0.44           C  
ATOM   3139  C   SER A 431      21.774 -74.445  -4.036  1.00  0.44           C  
ATOM   3140  O   SER A 431      21.120 -75.484  -4.051  1.00  0.44           O  
ATOM   3141  CB  SER A 431      23.541 -74.197  -5.718  1.00  0.44           C  
ATOM   3142  OG  SER A 431      23.802 -73.889  -7.088  1.00  0.44           O  
ATOM   3143  N   LEU A 432      22.231 -73.918  -2.880  1.00  0.29           N  
ATOM   3144  CA  LEU A 432      21.993 -74.572  -1.602  1.00  0.29           C  
ATOM   3145  C   LEU A 432      20.892 -73.877  -0.812  1.00  0.29           C  
ATOM   3146  O   LEU A 432      19.853 -74.472  -0.526  1.00  0.29           O  
ATOM   3147  CB  LEU A 432      23.273 -74.646  -0.715  1.00  0.29           C  
ATOM   3148  CG  LEU A 432      24.374 -75.665  -1.117  1.00  0.29           C  
ATOM   3149  CD1 LEU A 432      23.864 -77.114  -1.114  1.00  0.29           C  
ATOM   3150  CD2 LEU A 432      25.080 -75.348  -2.444  1.00  0.29           C  
ATOM   3151  N   THR A 433      21.090 -72.602  -0.411  1.00  0.50           N  
ATOM   3152  CA  THR A 433      20.292 -72.017   0.672  1.00  0.50           C  
ATOM   3153  C   THR A 433      19.994 -70.551   0.369  1.00  0.50           C  
ATOM   3154  O   THR A 433      20.444 -69.972  -0.617  1.00  0.50           O  
ATOM   3155  CB  THR A 433      20.942 -72.166   2.063  1.00  0.50           C  
ATOM   3156  OG1 THR A 433      21.531 -73.445   2.234  1.00  0.50           O  
ATOM   3157  CG2 THR A 433      19.935 -72.050   3.223  1.00  0.50           C  
ATOM   3158  N   GLY A 434      19.145 -69.882   1.181  1.00  0.60           N  
ATOM   3159  CA  GLY A 434      18.753 -68.491   0.966  1.00  0.60           C  
ATOM   3160  C   GLY A 434      19.751 -67.441   1.393  1.00  0.60           C  
ATOM   3161  O   GLY A 434      19.586 -66.268   1.081  1.00  0.60           O  
ATOM   3162  N   ASP A 435      20.840 -67.805   2.082  1.00  0.44           N  
ATOM   3163  CA  ASP A 435      21.966 -66.925   2.344  1.00  0.44           C  
ATOM   3164  C   ASP A 435      22.713 -66.584   1.051  1.00  0.44           C  
ATOM   3165  O   ASP A 435      23.033 -65.430   0.767  1.00  0.44           O  
ATOM   3166  CB  ASP A 435      22.879 -67.541   3.444  1.00  0.44           C  
ATOM   3167  CG  ASP A 435      23.227 -69.009   3.228  1.00  0.44           C  
ATOM   3168  OD1 ASP A 435      22.934 -69.545   2.129  1.00  0.44           O  
ATOM   3169  OD2 ASP A 435      23.746 -69.621   4.189  1.00  0.44           O  
ATOM   3170  N   GLU A 436      22.901 -67.599   0.189  1.00  0.58           N  
ATOM   3171  CA  GLU A 436      23.372 -67.477  -1.174  1.00  0.58           C  
ATOM   3172  C   GLU A 436      22.492 -66.575  -2.035  1.00  0.58           C  
ATOM   3173  O   GLU A 436      23.020 -65.768  -2.796  1.00  0.58           O  
ATOM   3174  CB  GLU A 436      23.466 -68.859  -1.859  1.00  0.58           C  
ATOM   3175  CG  GLU A 436      24.522 -69.830  -1.287  1.00  0.58           C  
ATOM   3176  CD  GLU A 436      24.503 -71.212  -1.945  1.00  0.58           C  
ATOM   3177  OE1 GLU A 436      23.703 -71.484  -2.882  1.00  0.58           O  
ATOM   3178  OE2 GLU A 436      25.311 -72.050  -1.483  1.00  0.58           O  
ATOM   3179  N   VAL A 437      21.132 -66.630  -1.937  1.00  0.55           N  
ATOM   3180  CA  VAL A 437      20.289 -65.670  -2.669  1.00  0.55           C  
ATOM   3181  C   VAL A 437      20.504 -64.238  -2.219  1.00  0.55           C  
ATOM   3182  O   VAL A 437      20.691 -63.362  -3.051  1.00  0.55           O  
ATOM   3183  CB  VAL A 437      18.787 -65.968  -2.844  1.00  0.55           C  
ATOM   3184  CG1 VAL A 437      18.588 -67.440  -3.230  1.00  0.55           C  
ATOM   3185  CG2 VAL A 437      17.890 -65.579  -1.655  1.00  0.55           C  
ATOM   3186  N   LEU A 438      20.613 -63.967  -0.899  1.00  0.49           N  
ATOM   3187  CA  LEU A 438      20.955 -62.642  -0.397  1.00  0.49           C  
ATOM   3188  C   LEU A 438      22.325 -62.169  -0.876  1.00  0.49           C  
ATOM   3189  O   LEU A 438      22.525 -60.996  -1.184  1.00  0.49           O  
ATOM   3190  CB  LEU A 438      20.890 -62.573   1.149  1.00  0.49           C  
ATOM   3191  CG  LEU A 438      19.510 -62.913   1.755  1.00  0.49           C  
ATOM   3192  CD1 LEU A 438      19.577 -62.863   3.289  1.00  0.49           C  
ATOM   3193  CD2 LEU A 438      18.384 -62.003   1.238  1.00  0.49           C  
ATOM   3194  N   GLY A 439      23.300 -63.097  -1.003  1.00  0.50           N  
ATOM   3195  CA  GLY A 439      24.582 -62.855  -1.663  1.00  0.50           C  
ATOM   3196  C   GLY A 439      24.502 -62.495  -3.135  1.00  0.50           C  
ATOM   3197  O   GLY A 439      25.337 -61.753  -3.645  1.00  0.50           O  
ATOM   3198  N   VAL A 440      23.486 -62.985  -3.864  1.00  0.54           N  
ATOM   3199  CA  VAL A 440      23.182 -62.530  -5.215  1.00  0.54           C  
ATOM   3200  C   VAL A 440      22.490 -61.181  -5.199  1.00  0.54           C  
ATOM   3201  O   VAL A 440      22.882 -60.262  -5.917  1.00  0.54           O  
ATOM   3202  CB  VAL A 440      22.272 -63.511  -5.948  1.00  0.54           C  
ATOM   3203  CG1 VAL A 440      21.839 -62.968  -7.327  1.00  0.54           C  
ATOM   3204  CG2 VAL A 440      23.004 -64.856  -6.109  1.00  0.54           C  
ATOM   3205  N   ASP A 441      21.449 -61.021  -4.359  1.00  0.57           N  
ATOM   3206  CA  ASP A 441      20.622 -59.834  -4.294  1.00  0.57           C  
ATOM   3207  C   ASP A 441      21.422 -58.591  -3.882  1.00  0.57           C  
ATOM   3208  O   ASP A 441      21.313 -57.544  -4.516  1.00  0.57           O  
ATOM   3209  CB  ASP A 441      19.357 -60.092  -3.429  1.00  0.57           C  
ATOM   3210  CG  ASP A 441      18.475 -61.180  -4.044  1.00  0.57           C  
ATOM   3211  OD1 ASP A 441      18.243 -61.133  -5.281  1.00  0.57           O  
ATOM   3212  OD2 ASP A 441      17.997 -62.068  -3.291  1.00  0.57           O  
ATOM   3213  N   VAL A 442      22.351 -58.705  -2.902  1.00  0.54           N  
ATOM   3214  CA  VAL A 442      23.288 -57.636  -2.549  1.00  0.54           C  
ATOM   3215  C   VAL A 442      24.190 -57.221  -3.714  1.00  0.54           C  
ATOM   3216  O   VAL A 442      24.466 -56.041  -3.935  1.00  0.54           O  
ATOM   3217  CB  VAL A 442      24.117 -57.980  -1.302  1.00  0.54           C  
ATOM   3218  CG1 VAL A 442      25.185 -59.060  -1.566  1.00  0.54           C  
ATOM   3219  CG2 VAL A 442      24.773 -56.712  -0.721  1.00  0.54           C  
ATOM   3220  N   PHE A 443      24.653 -58.188  -4.542  1.00  0.46           N  
ATOM   3221  CA  PHE A 443      25.384 -57.898  -5.759  1.00  0.46           C  
ATOM   3222  C   PHE A 443      24.515 -57.198  -6.793  1.00  0.46           C  
ATOM   3223  O   PHE A 443      24.927 -56.221  -7.407  1.00  0.46           O  
ATOM   3224  CB  PHE A 443      26.022 -59.189  -6.351  1.00  0.46           C  
ATOM   3225  CG  PHE A 443      27.157 -58.831  -7.273  1.00  0.46           C  
ATOM   3226  CD1 PHE A 443      28.224 -58.080  -6.760  1.00  0.46           C  
ATOM   3227  CD2 PHE A 443      27.174 -59.196  -8.632  1.00  0.46           C  
ATOM   3228  CE1 PHE A 443      29.261 -57.659  -7.590  1.00  0.46           C  
ATOM   3229  CE2 PHE A 443      28.244 -58.813  -9.456  1.00  0.46           C  
ATOM   3230  CZ  PHE A 443      29.282 -58.030  -8.937  1.00  0.46           C  
ATOM   3231  N   SER A 444      23.258 -57.654  -6.951  1.00  0.54           N  
ATOM   3232  CA  SER A 444      22.253 -57.093  -7.849  1.00  0.54           C  
ATOM   3233  C   SER A 444      21.956 -55.623  -7.568  1.00  0.54           C  
ATOM   3234  O   SER A 444      21.946 -54.787  -8.472  1.00  0.54           O  
ATOM   3235  CB  SER A 444      20.940 -57.917  -7.760  1.00  0.54           C  
ATOM   3236  OG  SER A 444      20.053 -57.629  -8.839  1.00  0.54           O  
ATOM   3237  N   GLU A 445      21.802 -55.255  -6.278  1.00  0.55           N  
ATOM   3238  CA  GLU A 445      21.714 -53.877  -5.817  1.00  0.55           C  
ATOM   3239  C   GLU A 445      22.960 -53.045  -6.121  1.00  0.55           C  
ATOM   3240  O   GLU A 445      22.879 -51.893  -6.553  1.00  0.55           O  
ATOM   3241  CB  GLU A 445      21.478 -53.851  -4.289  1.00  0.55           C  
ATOM   3242  CG  GLU A 445      20.111 -54.429  -3.852  1.00  0.55           C  
ATOM   3243  CD  GLU A 445      19.978 -54.409  -2.332  1.00  0.55           C  
ATOM   3244  OE1 GLU A 445      19.964 -53.286  -1.766  1.00  0.55           O  
ATOM   3245  OE2 GLU A 445      19.891 -55.508  -1.728  1.00  0.55           O  
ATOM   3246  N   ALA A 446      24.162 -53.629  -5.934  1.00  0.61           N  
ATOM   3247  CA  ALA A 446      25.446 -52.979  -6.121  1.00  0.61           C  
ATOM   3248  C   ALA A 446      25.712 -52.447  -7.530  1.00  0.61           C  
ATOM   3249  O   ALA A 446      26.379 -51.426  -7.692  1.00  0.61           O  
ATOM   3250  CB  ALA A 446      26.585 -53.919  -5.680  1.00  0.61           C  
ATOM   3251  N   LEU A 447      25.168 -53.088  -8.590  1.00  0.55           N  
ATOM   3252  CA  LEU A 447      25.273 -52.606  -9.966  1.00  0.55           C  
ATOM   3253  C   LEU A 447      24.720 -51.205 -10.182  1.00  0.55           C  
ATOM   3254  O   LEU A 447      25.253 -50.436 -10.975  1.00  0.55           O  
ATOM   3255  CB  LEU A 447      24.542 -53.505 -10.989  1.00  0.55           C  
ATOM   3256  CG  LEU A 447      25.271 -54.805 -11.372  1.00  0.55           C  
ATOM   3257  CD1 LEU A 447      25.046 -55.927 -10.358  1.00  0.55           C  
ATOM   3258  CD2 LEU A 447      24.788 -55.235 -12.756  1.00  0.55           C  
ATOM   3259  N   ALA A 448      23.649 -50.814  -9.466  1.00  0.68           N  
ATOM   3260  CA  ALA A 448      23.039 -49.512  -9.638  1.00  0.68           C  
ATOM   3261  C   ALA A 448      23.893 -48.370  -9.076  1.00  0.68           C  
ATOM   3262  O   ALA A 448      23.681 -47.196  -9.384  1.00  0.68           O  
ATOM   3263  CB  ALA A 448      21.652 -49.526  -8.969  1.00  0.68           C  
ATOM   3264  N   ALA A 449      24.917 -48.697  -8.254  1.00  0.72           N  
ATOM   3265  CA  ALA A 449      25.804 -47.747  -7.614  1.00  0.72           C  
ATOM   3266  C   ALA A 449      26.544 -46.777  -8.538  1.00  0.72           C  
ATOM   3267  O   ALA A 449      26.533 -45.593  -8.208  1.00  0.72           O  
ATOM   3268  CB  ALA A 449      26.786 -48.478  -6.678  1.00  0.72           C  
ATOM   3269  N   PRO A 450      27.162 -47.096  -9.674  1.00  0.67           N  
ATOM   3270  CA  PRO A 450      27.683 -46.091 -10.594  1.00  0.67           C  
ATOM   3271  C   PRO A 450      26.676 -45.064 -11.079  1.00  0.67           C  
ATOM   3272  O   PRO A 450      27.023 -43.889 -11.043  1.00  0.67           O  
ATOM   3273  CB  PRO A 450      28.370 -46.882 -11.719  1.00  0.67           C  
ATOM   3274  CG  PRO A 450      27.902 -48.326 -11.520  1.00  0.67           C  
ATOM   3275  CD  PRO A 450      27.638 -48.428 -10.023  1.00  0.67           C  
ATOM   3276  N   LEU A 451      25.433 -45.411 -11.493  1.00  0.71           N  
ATOM   3277  CA  LEU A 451      24.449 -44.375 -11.814  1.00  0.71           C  
ATOM   3278  C   LEU A 451      24.072 -43.557 -10.577  1.00  0.71           C  
ATOM   3279  O   LEU A 451      24.010 -42.331 -10.630  1.00  0.71           O  
ATOM   3280  CB  LEU A 451      23.167 -44.898 -12.521  1.00  0.71           C  
ATOM   3281  CG  LEU A 451      22.515 -43.926 -13.556  1.00  0.71           C  
ATOM   3282  CD1 LEU A 451      21.066 -44.334 -13.844  1.00  0.71           C  
ATOM   3283  CD2 LEU A 451      22.517 -42.430 -13.205  1.00  0.71           C  
ATOM   3284  N   PHE A 452      23.889 -44.200  -9.396  1.00  0.66           N  
ATOM   3285  CA  PHE A 452      23.650 -43.482  -8.147  1.00  0.66           C  
ATOM   3286  C   PHE A 452      24.745 -42.460  -7.831  1.00  0.66           C  
ATOM   3287  O   PHE A 452      24.453 -41.304  -7.532  1.00  0.66           O  
ATOM   3288  CB  PHE A 452      23.571 -44.444  -6.917  1.00  0.66           C  
ATOM   3289  CG  PHE A 452      22.291 -45.233  -6.789  1.00  0.66           C  
ATOM   3290  CD1 PHE A 452      21.049 -44.585  -6.835  1.00  0.66           C  
ATOM   3291  CD2 PHE A 452      22.314 -46.601  -6.462  1.00  0.66           C  
ATOM   3292  CE1 PHE A 452      19.863 -45.281  -6.569  1.00  0.66           C  
ATOM   3293  CE2 PHE A 452      21.132 -47.309  -6.213  1.00  0.66           C  
ATOM   3294  CZ  PHE A 452      19.904 -46.646  -6.264  1.00  0.66           C  
ATOM   3295  N   TRP A 453      26.033 -42.842  -7.943  1.00  0.61           N  
ATOM   3296  CA  TRP A 453      27.152 -41.933  -7.772  1.00  0.61           C  
ATOM   3297  C   TRP A 453      27.280 -40.868  -8.853  1.00  0.61           C  
ATOM   3298  O   TRP A 453      27.484 -39.695  -8.550  1.00  0.61           O  
ATOM   3299  CB  TRP A 453      28.496 -42.697  -7.634  1.00  0.61           C  
ATOM   3300  CG  TRP A 453      28.585 -43.594  -6.407  1.00  0.61           C  
ATOM   3301  CD1 TRP A 453      28.829 -44.939  -6.349  1.00  0.61           C  
ATOM   3302  CD2 TRP A 453      28.409 -43.157  -5.044  1.00  0.61           C  
ATOM   3303  NE1 TRP A 453      28.776 -45.382  -5.044  1.00  0.61           N  
ATOM   3304  CE2 TRP A 453      28.515 -44.305  -4.228  1.00  0.61           C  
ATOM   3305  CE3 TRP A 453      28.172 -41.900  -4.486  1.00  0.61           C  
ATOM   3306  CZ2 TRP A 453      28.367 -44.218  -2.850  1.00  0.61           C  
ATOM   3307  CZ3 TRP A 453      28.019 -41.816  -3.094  1.00  0.61           C  
ATOM   3308  CH2 TRP A 453      28.111 -42.959  -2.287  1.00  0.61           C  
ATOM   3309  N   ILE A 454      27.134 -41.217 -10.148  1.00  0.65           N  
ATOM   3310  CA  ILE A 454      27.192 -40.263 -11.255  1.00  0.65           C  
ATOM   3311  C   ILE A 454      26.075 -39.218 -11.161  1.00  0.65           C  
ATOM   3312  O   ILE A 454      26.308 -38.024 -11.345  1.00  0.65           O  
ATOM   3313  CB  ILE A 454      27.301 -40.970 -12.619  1.00  0.65           C  
ATOM   3314  CG1 ILE A 454      28.782 -41.240 -13.003  1.00  0.65           C  
ATOM   3315  CG2 ILE A 454      26.656 -40.163 -13.767  1.00  0.65           C  
ATOM   3316  CD1 ILE A 454      29.482 -42.365 -12.233  1.00  0.65           C  
ATOM   3317  N   ALA A 455      24.846 -39.629 -10.789  1.00  0.73           N  
ATOM   3318  CA  ALA A 455      23.757 -38.730 -10.457  1.00  0.73           C  
ATOM   3319  C   ALA A 455      23.999 -37.861  -9.223  1.00  0.73           C  
ATOM   3320  O   ALA A 455      23.728 -36.662  -9.231  1.00  0.73           O  
ATOM   3321  CB  ALA A 455      22.485 -39.561 -10.244  1.00  0.73           C  
ATOM   3322  N   ALA A 456      24.563 -38.440  -8.141  1.00  0.69           N  
ATOM   3323  CA  ALA A 456      24.930 -37.725  -6.932  1.00  0.69           C  
ATOM   3324  C   ALA A 456      25.970 -36.633  -7.170  1.00  0.69           C  
ATOM   3325  O   ALA A 456      25.855 -35.527  -6.648  1.00  0.69           O  
ATOM   3326  CB  ALA A 456      25.439 -38.720  -5.870  1.00  0.69           C  
ATOM   3327  N   ASN A 457      26.972 -36.897  -8.037  1.00  0.58           N  
ATOM   3328  CA  ASN A 457      27.943 -35.912  -8.504  1.00  0.58           C  
ATOM   3329  C   ASN A 457      27.311 -34.733  -9.245  1.00  0.58           C  
ATOM   3330  O   ASN A 457      27.835 -33.623  -9.231  1.00  0.58           O  
ATOM   3331  CB  ASN A 457      28.992 -36.551  -9.450  1.00  0.58           C  
ATOM   3332  CG  ASN A 457      29.919 -37.477  -8.674  1.00  0.58           C  
ATOM   3333  OD1 ASN A 457      30.426 -37.142  -7.605  1.00  0.58           O  
ATOM   3334  ND2 ASN A 457      30.202 -38.672  -9.238  1.00  0.58           N  
ATOM   3335  N   ALA A 458      26.151 -34.941  -9.900  1.00  0.71           N  
ATOM   3336  CA  ALA A 458      25.412 -33.888 -10.565  1.00  0.71           C  
ATOM   3337  C   ALA A 458      24.508 -33.113  -9.607  1.00  0.71           C  
ATOM   3338  O   ALA A 458      23.912 -32.104  -9.978  1.00  0.71           O  
ATOM   3339  CB  ALA A 458      24.543 -34.506 -11.682  1.00  0.71           C  
ATOM   3340  N   GLY A 459      24.389 -33.559  -8.336  1.00  0.71           N  
ATOM   3341  CA  GLY A 459      23.566 -32.897  -7.330  1.00  0.71           C  
ATOM   3342  C   GLY A 459      22.110 -33.264  -7.386  1.00  0.71           C  
ATOM   3343  O   GLY A 459      21.270 -32.549  -6.850  1.00  0.71           O  
ATOM   3344  N   LEU A 460      21.771 -34.384  -8.049  1.00  0.68           N  
ATOM   3345  CA  LEU A 460      20.397 -34.789  -8.275  1.00  0.68           C  
ATOM   3346  C   LEU A 460      20.088 -36.109  -7.596  1.00  0.68           C  
ATOM   3347  O   LEU A 460      20.952 -36.969  -7.420  1.00  0.68           O  
ATOM   3348  CB  LEU A 460      20.101 -34.958  -9.787  1.00  0.68           C  
ATOM   3349  CG  LEU A 460      20.270 -33.677 -10.628  1.00  0.68           C  
ATOM   3350  CD1 LEU A 460      20.000 -33.983 -12.107  1.00  0.68           C  
ATOM   3351  CD2 LEU A 460      19.355 -32.535 -10.158  1.00  0.68           C  
ATOM   3352  N   ASP A 461      18.817 -36.301  -7.193  1.00  0.71           N  
ATOM   3353  CA  ASP A 461      18.329 -37.483  -6.516  1.00  0.71           C  
ATOM   3354  C   ASP A 461      18.560 -38.801  -7.253  1.00  0.71           C  
ATOM   3355  O   ASP A 461      17.936 -39.121  -8.271  1.00  0.71           O  
ATOM   3356  CB  ASP A 461      16.823 -37.330  -6.236  1.00  0.71           C  
ATOM   3357  CG  ASP A 461      16.615 -36.044  -5.471  1.00  0.71           C  
ATOM   3358  OD1 ASP A 461      16.785 -36.072  -4.229  1.00  0.71           O  
ATOM   3359  OD2 ASP A 461      16.340 -35.022  -6.151  1.00  0.71           O  
ATOM   3360  N   GLY A 462      19.477 -39.634  -6.713  1.00  0.73           N  
ATOM   3361  CA  GLY A 462      19.853 -40.913  -7.304  1.00  0.73           C  
ATOM   3362  C   GLY A 462      18.734 -41.924  -7.382  1.00  0.73           C  
ATOM   3363  O   GLY A 462      18.637 -42.703  -8.326  1.00  0.73           O  
ATOM   3364  N   SER A 463      17.826 -41.916  -6.393  1.00  0.75           N  
ATOM   3365  CA  SER A 463      16.627 -42.743  -6.365  1.00  0.75           C  
ATOM   3366  C   SER A 463      15.644 -42.390  -7.467  1.00  0.75           C  
ATOM   3367  O   SER A 463      15.082 -43.247  -8.144  1.00  0.75           O  
ATOM   3368  CB  SER A 463      15.913 -42.627  -4.994  1.00  0.75           C  
ATOM   3369  OG  SER A 463      15.734 -41.254  -4.634  1.00  0.75           O  
ATOM   3370  N   VAL A 464      15.435 -41.088  -7.702  1.00  0.74           N  
ATOM   3371  CA  VAL A 464      14.550 -40.576  -8.729  1.00  0.74           C  
ATOM   3372  C   VAL A 464      15.023 -40.930 -10.135  1.00  0.74           C  
ATOM   3373  O   VAL A 464      14.233 -41.359 -10.979  1.00  0.74           O  
ATOM   3374  CB  VAL A 464      14.358 -39.075  -8.540  1.00  0.74           C  
ATOM   3375  CG1 VAL A 464      13.464 -38.462  -9.632  1.00  0.74           C  
ATOM   3376  CG2 VAL A 464      13.719 -38.832  -7.157  1.00  0.74           C  
ATOM   3377  N   VAL A 465      16.335 -40.802 -10.436  1.00  0.73           N  
ATOM   3378  CA  VAL A 465      16.888 -41.274 -11.704  1.00  0.73           C  
ATOM   3379  C   VAL A 465      16.877 -42.789 -11.884  1.00  0.73           C  
ATOM   3380  O   VAL A 465      16.500 -43.260 -12.959  1.00  0.73           O  
ATOM   3381  CB  VAL A 465      18.252 -40.669 -12.039  1.00  0.73           C  
ATOM   3382  CG1 VAL A 465      19.327 -41.110 -11.041  1.00  0.73           C  
ATOM   3383  CG2 VAL A 465      18.704 -41.026 -13.469  1.00  0.73           C  
ATOM   3384  N   VAL A 466      17.238 -43.596 -10.851  1.00  0.72           N  
ATOM   3385  CA  VAL A 466      17.292 -45.053 -10.969  1.00  0.72           C  
ATOM   3386  C   VAL A 466      15.939 -45.672 -11.279  1.00  0.72           C  
ATOM   3387  O   VAL A 466      15.827 -46.578 -12.104  1.00  0.72           O  
ATOM   3388  CB  VAL A 466      17.984 -45.764  -9.803  1.00  0.72           C  
ATOM   3389  CG1 VAL A 466      17.067 -45.985  -8.585  1.00  0.72           C  
ATOM   3390  CG2 VAL A 466      18.537 -47.118 -10.288  1.00  0.72           C  
ATOM   3391  N   ASN A 467      14.854 -45.152 -10.666  1.00  0.69           N  
ATOM   3392  CA  ASN A 467      13.499 -45.587 -10.955  1.00  0.69           C  
ATOM   3393  C   ASN A 467      13.112 -45.315 -12.404  1.00  0.69           C  
ATOM   3394  O   ASN A 467      12.667 -46.209 -13.112  1.00  0.69           O  
ATOM   3395  CB  ASN A 467      12.481 -44.878 -10.022  1.00  0.69           C  
ATOM   3396  CG  ASN A 467      12.701 -45.298  -8.572  1.00  0.69           C  
ATOM   3397  OD1 ASN A 467      13.358 -46.286  -8.251  1.00  0.69           O  
ATOM   3398  ND2 ASN A 467      12.112 -44.520  -7.633  1.00  0.69           N  
ATOM   3399  N   LYS A 468      13.364 -44.091 -12.915  1.00  0.69           N  
ATOM   3400  CA  LYS A 468      13.034 -43.724 -14.285  1.00  0.69           C  
ATOM   3401  C   LYS A 468      13.752 -44.529 -15.362  1.00  0.69           C  
ATOM   3402  O   LYS A 468      13.149 -44.890 -16.366  1.00  0.69           O  
ATOM   3403  CB  LYS A 468      13.236 -42.206 -14.521  1.00  0.69           C  
ATOM   3404  CG  LYS A 468      12.011 -41.383 -14.083  1.00  0.69           C  
ATOM   3405  CD  LYS A 468      12.209 -39.869 -14.263  1.00  0.69           C  
ATOM   3406  CE  LYS A 468      12.928 -39.239 -13.069  1.00  0.69           C  
ATOM   3407  NZ  LYS A 468      13.422 -37.883 -13.390  1.00  0.69           N  
ATOM   3408  N   VAL A 469      15.051 -44.844 -15.201  1.00  0.68           N  
ATOM   3409  CA  VAL A 469      15.740 -45.752 -16.118  1.00  0.68           C  
ATOM   3410  C   VAL A 469      15.288 -47.215 -15.991  1.00  0.68           C  
ATOM   3411  O   VAL A 469      15.204 -47.951 -16.971  1.00  0.68           O  
ATOM   3412  CB  VAL A 469      17.252 -45.578 -16.034  1.00  0.68           C  
ATOM   3413  CG1 VAL A 469      17.793 -46.014 -14.671  1.00  0.68           C  
ATOM   3414  CG2 VAL A 469      17.960 -46.347 -17.160  1.00  0.68           C  
ATOM   3415  N   SER A 470      14.931 -47.678 -14.771  1.00  0.63           N  
ATOM   3416  CA  SER A 470      14.465 -49.042 -14.510  1.00  0.63           C  
ATOM   3417  C   SER A 470      13.147 -49.406 -15.166  1.00  0.63           C  
ATOM   3418  O   SER A 470      12.913 -50.577 -15.480  1.00  0.63           O  
ATOM   3419  CB  SER A 470      14.304 -49.349 -13.002  1.00  0.63           C  
ATOM   3420  OG  SER A 470      15.565 -49.276 -12.342  1.00  0.63           O  
ATOM   3421  N   GLU A 471      12.263 -48.411 -15.376  1.00  0.57           N  
ATOM   3422  CA  GLU A 471      11.011 -48.548 -16.099  1.00  0.57           C  
ATOM   3423  C   GLU A 471      11.179 -48.975 -17.554  1.00  0.57           C  
ATOM   3424  O   GLU A 471      10.477 -49.852 -18.057  1.00  0.57           O  
ATOM   3425  CB  GLU A 471      10.285 -47.175 -16.128  1.00  0.57           C  
ATOM   3426  CG  GLU A 471       9.751 -46.699 -14.757  1.00  0.57           C  
ATOM   3427  CD  GLU A 471       8.639 -47.601 -14.236  1.00  0.57           C  
ATOM   3428  OE1 GLU A 471       7.561 -47.626 -14.881  1.00  0.57           O  
ATOM   3429  OE2 GLU A 471       8.861 -48.260 -13.188  1.00  0.57           O  
ATOM   3430  N   LEU A 472      12.119 -48.346 -18.288  1.00  0.54           N  
ATOM   3431  CA  LEU A 472      12.216 -48.518 -19.726  1.00  0.54           C  
ATOM   3432  C   LEU A 472      12.688 -49.912 -20.180  1.00  0.54           C  
ATOM   3433  O   LEU A 472      13.547 -50.524 -19.537  1.00  0.54           O  
ATOM   3434  CB  LEU A 472      13.036 -47.397 -20.423  1.00  0.54           C  
ATOM   3435  CG  LEU A 472      12.288 -46.052 -20.641  1.00  0.54           C  
ATOM   3436  CD1 LEU A 472      11.015 -46.182 -21.493  1.00  0.54           C  
ATOM   3437  CD2 LEU A 472      12.001 -45.282 -19.347  1.00  0.54           C  
ATOM   3438  N   PRO A 473      12.183 -50.464 -21.288  1.00  0.42           N  
ATOM   3439  CA  PRO A 473      12.762 -51.639 -21.911  1.00  0.42           C  
ATOM   3440  C   PRO A 473      13.622 -51.218 -23.087  1.00  0.42           C  
ATOM   3441  O   PRO A 473      13.279 -50.294 -23.822  1.00  0.42           O  
ATOM   3442  CB  PRO A 473      11.538 -52.452 -22.375  1.00  0.42           C  
ATOM   3443  CG  PRO A 473      10.332 -51.490 -22.344  1.00  0.42           C  
ATOM   3444  CD  PRO A 473      10.893 -50.138 -21.895  1.00  0.42           C  
ATOM   3445  N   ALA A 474      14.772 -51.894 -23.272  1.00  0.43           N  
ATOM   3446  CA  ALA A 474      15.848 -51.424 -24.118  1.00  0.43           C  
ATOM   3447  C   ALA A 474      16.331 -50.010 -23.785  1.00  0.43           C  
ATOM   3448  O   ALA A 474      16.245 -49.563 -22.644  1.00  0.43           O  
ATOM   3449  CB  ALA A 474      15.537 -51.640 -25.618  1.00  0.43           C  
ATOM   3450  N   GLY A 475      16.934 -49.339 -24.782  1.00  0.48           N  
ATOM   3451  CA  GLY A 475      18.015 -48.384 -24.593  1.00  0.48           C  
ATOM   3452  C   GLY A 475      17.975 -47.292 -23.550  1.00  0.48           C  
ATOM   3453  O   GLY A 475      18.893 -47.144 -22.756  1.00  0.48           O  
ATOM   3454  N   HIS A 476      16.938 -46.450 -23.596  1.00  0.50           N  
ATOM   3455  CA  HIS A 476      16.755 -45.234 -22.815  1.00  0.50           C  
ATOM   3456  C   HIS A 476      17.328 -45.125 -21.390  1.00  0.50           C  
ATOM   3457  O   HIS A 476      16.974 -45.890 -20.498  1.00  0.50           O  
ATOM   3458  CB  HIS A 476      15.240 -45.002 -22.733  1.00  0.50           C  
ATOM   3459  CG  HIS A 476      14.793 -43.789 -21.984  1.00  0.50           C  
ATOM   3460  ND1 HIS A 476      14.329 -42.693 -22.679  1.00  0.50           N  
ATOM   3461  CD2 HIS A 476      14.621 -43.613 -20.648  1.00  0.50           C  
ATOM   3462  CE1 HIS A 476      13.876 -41.872 -21.756  1.00  0.50           C  
ATOM   3463  NE2 HIS A 476      14.025 -42.383 -20.508  1.00  0.50           N  
ATOM   3464  N   GLY A 477      18.141 -44.078 -21.122  1.00  0.68           N  
ATOM   3465  CA  GLY A 477      18.647 -43.759 -19.790  1.00  0.68           C  
ATOM   3466  C   GLY A 477      18.805 -42.269 -19.620  1.00  0.68           C  
ATOM   3467  O   GLY A 477      18.004 -41.498 -20.133  1.00  0.68           O  
ATOM   3468  N   LEU A 478      19.832 -41.807 -18.873  1.00  0.68           N  
ATOM   3469  CA  LEU A 478      20.002 -40.406 -18.502  1.00  0.68           C  
ATOM   3470  C   LEU A 478      21.395 -39.898 -18.845  1.00  0.68           C  
ATOM   3471  O   LEU A 478      22.389 -40.437 -18.361  1.00  0.68           O  
ATOM   3472  CB  LEU A 478      19.755 -40.280 -16.969  1.00  0.68           C  
ATOM   3473  CG  LEU A 478      19.742 -38.870 -16.319  1.00  0.68           C  
ATOM   3474  CD1 LEU A 478      21.126 -38.410 -15.835  1.00  0.68           C  
ATOM   3475  CD2 LEU A 478      19.070 -37.786 -17.171  1.00  0.68           C  
ATOM   3476  N   ASN A 479      21.513 -38.821 -19.660  1.00  0.64           N  
ATOM   3477  CA  ASN A 479      22.780 -38.132 -19.861  1.00  0.64           C  
ATOM   3478  C   ASN A 479      22.890 -37.002 -18.835  1.00  0.64           C  
ATOM   3479  O   ASN A 479      22.083 -36.076 -18.781  1.00  0.64           O  
ATOM   3480  CB  ASN A 479      22.954 -37.598 -21.319  1.00  0.64           C  
ATOM   3481  CG  ASN A 479      24.337 -36.977 -21.549  1.00  0.64           C  
ATOM   3482  OD1 ASN A 479      25.206 -36.988 -20.670  1.00  0.64           O  
ATOM   3483  ND2 ASN A 479      24.579 -36.408 -22.746  1.00  0.64           N  
ATOM   3484  N   VAL A 480      23.928 -37.061 -17.980  1.00  0.66           N  
ATOM   3485  CA  VAL A 480      24.241 -36.047 -16.988  1.00  0.66           C  
ATOM   3486  C   VAL A 480      24.654 -34.711 -17.580  1.00  0.66           C  
ATOM   3487  O   VAL A 480      24.355 -33.663 -17.018  1.00  0.66           O  
ATOM   3488  CB  VAL A 480      25.281 -36.516 -15.975  1.00  0.66           C  
ATOM   3489  CG1 VAL A 480      24.642 -37.616 -15.108  1.00  0.66           C  
ATOM   3490  CG2 VAL A 480      26.571 -37.018 -16.660  1.00  0.66           C  
ATOM   3491  N   ASN A 481      25.342 -34.704 -18.738  1.00  0.56           N  
ATOM   3492  CA  ASN A 481      25.830 -33.487 -19.371  1.00  0.56           C  
ATOM   3493  C   ASN A 481      24.722 -32.579 -19.896  1.00  0.56           C  
ATOM   3494  O   ASN A 481      24.827 -31.356 -19.852  1.00  0.56           O  
ATOM   3495  CB  ASN A 481      26.834 -33.822 -20.501  1.00  0.56           C  
ATOM   3496  CG  ASN A 481      28.056 -34.474 -19.868  1.00  0.56           C  
ATOM   3497  OD1 ASN A 481      28.633 -33.949 -18.916  1.00  0.56           O  
ATOM   3498  ND2 ASN A 481      28.487 -35.645 -20.382  1.00  0.56           N  
ATOM   3499  N   THR A 482      23.623 -33.159 -20.409  1.00  0.60           N  
ATOM   3500  CA  THR A 482      22.491 -32.403 -20.935  1.00  0.60           C  
ATOM   3501  C   THR A 482      21.361 -32.287 -19.933  1.00  0.60           C  
ATOM   3502  O   THR A 482      20.427 -31.515 -20.137  1.00  0.60           O  
ATOM   3503  CB  THR A 482      21.874 -33.111 -22.138  1.00  0.60           C  
ATOM   3504  OG1 THR A 482      21.591 -34.472 -21.828  1.00  0.60           O  
ATOM   3505  CG2 THR A 482      22.875 -33.116 -23.301  1.00  0.60           C  
ATOM   3506  N   LEU A 483      21.412 -33.094 -18.851  1.00  0.69           N  
ATOM   3507  CA  LEU A 483      20.352 -33.300 -17.874  1.00  0.69           C  
ATOM   3508  C   LEU A 483      19.078 -33.886 -18.477  1.00  0.69           C  
ATOM   3509  O   LEU A 483      17.980 -33.742 -17.939  1.00  0.69           O  
ATOM   3510  CB  LEU A 483      20.040 -32.033 -17.033  1.00  0.69           C  
ATOM   3511  CG  LEU A 483      21.249 -31.463 -16.264  1.00  0.69           C  
ATOM   3512  CD1 LEU A 483      20.866 -30.143 -15.579  1.00  0.69           C  
ATOM   3513  CD2 LEU A 483      21.795 -32.455 -15.227  1.00  0.69           C  
ATOM   3514  N   SER A 484      19.201 -34.610 -19.606  1.00  0.69           N  
ATOM   3515  CA  SER A 484      18.064 -35.126 -20.346  1.00  0.69           C  
ATOM   3516  C   SER A 484      18.088 -36.632 -20.432  1.00  0.69           C  
ATOM   3517  O   SER A 484      19.128 -37.289 -20.503  1.00  0.69           O  
ATOM   3518  CB  SER A 484      17.886 -34.537 -21.780  1.00  0.69           C  
ATOM   3519  OG  SER A 484      18.982 -34.822 -22.654  1.00  0.69           O  
ATOM   3520  N   TYR A 485      16.885 -37.233 -20.402  1.00  0.68           N  
ATOM   3521  CA  TYR A 485      16.725 -38.646 -20.641  1.00  0.68           C  
ATOM   3522  C   TYR A 485      16.610 -38.919 -22.122  1.00  0.68           C  
ATOM   3523  O   TYR A 485      16.167 -38.083 -22.908  1.00  0.68           O  
ATOM   3524  CB  TYR A 485      15.468 -39.266 -19.979  1.00  0.68           C  
ATOM   3525  CG  TYR A 485      15.539 -39.223 -18.486  1.00  0.68           C  
ATOM   3526  CD1 TYR A 485      15.166 -38.060 -17.798  1.00  0.68           C  
ATOM   3527  CD2 TYR A 485      15.974 -40.342 -17.755  1.00  0.68           C  
ATOM   3528  CE1 TYR A 485      15.277 -37.993 -16.405  1.00  0.68           C  
ATOM   3529  CE2 TYR A 485      16.072 -40.284 -16.358  1.00  0.68           C  
ATOM   3530  CZ  TYR A 485      15.743 -39.099 -15.690  1.00  0.68           C  
ATOM   3531  OH  TYR A 485      15.902 -39.001 -14.298  1.00  0.68           O  
ATOM   3532  N   GLY A 486      16.991 -40.133 -22.527  1.00  0.67           N  
ATOM   3533  CA  GLY A 486      16.878 -40.558 -23.899  1.00  0.67           C  
ATOM   3534  C   GLY A 486      17.872 -41.631 -24.112  1.00  0.67           C  
ATOM   3535  O   GLY A 486      18.420 -42.212 -23.178  1.00  0.67           O  
ATOM   3536  N   ASP A 487      18.164 -41.909 -25.379  1.00  0.62           N  
ATOM   3537  CA  ASP A 487      19.277 -42.727 -25.759  1.00  0.62           C  
ATOM   3538  C   ASP A 487      20.607 -42.041 -25.389  1.00  0.62           C  
ATOM   3539  O   ASP A 487      20.930 -40.965 -25.893  1.00  0.62           O  
ATOM   3540  CB  ASP A 487      19.115 -42.959 -27.278  1.00  0.62           C  
ATOM   3541  CG  ASP A 487      20.021 -44.055 -27.780  1.00  0.62           C  
ATOM   3542  OD1 ASP A 487      21.116 -44.235 -27.188  1.00  0.62           O  
ATOM   3543  OD2 ASP A 487      19.619 -44.771 -28.721  1.00  0.62           O  
ATOM   3544  N   LEU A 488      21.421 -42.679 -24.511  1.00  0.53           N  
ATOM   3545  CA  LEU A 488      22.761 -42.243 -24.122  1.00  0.53           C  
ATOM   3546  C   LEU A 488      23.658 -42.139 -25.329  1.00  0.53           C  
ATOM   3547  O   LEU A 488      24.577 -41.334 -25.385  1.00  0.53           O  
ATOM   3548  CB  LEU A 488      23.497 -43.249 -23.173  1.00  0.53           C  
ATOM   3549  CG  LEU A 488      23.161 -43.209 -21.670  1.00  0.53           C  
ATOM   3550  CD1 LEU A 488      23.746 -41.970 -20.978  1.00  0.53           C  
ATOM   3551  CD2 LEU A 488      21.670 -43.362 -21.382  1.00  0.53           C  
ATOM   3552  N   ALA A 489      23.439 -42.997 -26.317  1.00  0.51           N  
ATOM   3553  CA  ALA A 489      24.376 -43.273 -27.344  1.00  0.51           C  
ATOM   3554  C   ALA A 489      23.952 -42.777 -28.698  1.00  0.51           C  
ATOM   3555  O   ALA A 489      24.768 -42.662 -29.599  1.00  0.51           O  
ATOM   3556  CB  ALA A 489      24.390 -44.763 -27.339  1.00  0.51           C  
ATOM   3557  N   ALA A 490      22.695 -42.361 -28.865  1.00  0.53           N  
ATOM   3558  CA  ALA A 490      22.367 -41.469 -29.955  1.00  0.53           C  
ATOM   3559  C   ALA A 490      22.876 -40.051 -29.669  1.00  0.53           C  
ATOM   3560  O   ALA A 490      23.186 -39.283 -30.576  1.00  0.53           O  
ATOM   3561  CB  ALA A 490      20.860 -41.510 -30.239  1.00  0.53           C  
ATOM   3562  N   ASP A 491      23.039 -39.695 -28.371  1.00  0.49           N  
ATOM   3563  CA  ASP A 491      23.916 -38.621 -27.934  1.00  0.49           C  
ATOM   3564  C   ASP A 491      25.392 -39.027 -28.132  1.00  0.49           C  
ATOM   3565  O   ASP A 491      26.192 -38.331 -28.762  1.00  0.49           O  
ATOM   3566  CB  ASP A 491      23.520 -38.348 -26.456  1.00  0.49           C  
ATOM   3567  CG  ASP A 491      24.212 -37.180 -25.784  1.00  0.49           C  
ATOM   3568  OD1 ASP A 491      25.461 -37.208 -25.646  1.00  0.49           O  
ATOM   3569  OD2 ASP A 491      23.483 -36.274 -25.304  1.00  0.49           O  
ATOM   3570  N   GLY A 492      25.741 -40.251 -27.685  1.00  0.53           N  
ATOM   3571  CA  GLY A 492      26.963 -40.949 -28.066  1.00  0.53           C  
ATOM   3572  C   GLY A 492      27.763 -41.560 -26.941  1.00  0.53           C  
ATOM   3573  O   GLY A 492      28.797 -42.160 -27.197  1.00  0.53           O  
ATOM   3574  N   VAL A 493      27.370 -41.423 -25.662  1.00  0.53           N  
ATOM   3575  CA  VAL A 493      28.153 -41.947 -24.545  1.00  0.53           C  
ATOM   3576  C   VAL A 493      28.112 -43.484 -24.354  1.00  0.53           C  
ATOM   3577  O   VAL A 493      27.076 -44.119 -24.162  1.00  0.53           O  
ATOM   3578  CB  VAL A 493      27.984 -41.126 -23.254  1.00  0.53           C  
ATOM   3579  CG1 VAL A 493      26.569 -40.536 -23.119  1.00  0.53           C  
ATOM   3580  CG2 VAL A 493      28.352 -41.914 -21.980  1.00  0.53           C  
ATOM   3581  N   ILE A 494      29.309 -44.113 -24.400  1.00  0.58           N  
ATOM   3582  CA  ILE A 494      29.660 -45.515 -24.193  1.00  0.58           C  
ATOM   3583  C   ILE A 494      30.737 -45.699 -23.124  1.00  0.58           C  
ATOM   3584  O   ILE A 494      31.638 -44.878 -22.972  1.00  0.58           O  
ATOM   3585  CB  ILE A 494      30.100 -46.314 -25.453  1.00  0.58           C  
ATOM   3586  CG1 ILE A 494      31.285 -45.743 -26.277  1.00  0.58           C  
ATOM   3587  CG2 ILE A 494      28.892 -46.624 -26.357  1.00  0.58           C  
ATOM   3588  CD1 ILE A 494      30.861 -44.816 -27.423  1.00  0.58           C  
ATOM   3589  N   ASP A 495      30.685 -46.823 -22.372  1.00  0.65           N  
ATOM   3590  CA  ASP A 495      31.801 -47.330 -21.595  1.00  0.65           C  
ATOM   3591  C   ASP A 495      32.126 -48.715 -22.190  1.00  0.65           C  
ATOM   3592  O   ASP A 495      31.255 -49.570 -22.153  1.00  0.65           O  
ATOM   3593  CB  ASP A 495      31.574 -47.373 -20.039  1.00  0.65           C  
ATOM   3594  CG  ASP A 495      30.140 -47.278 -19.519  1.00  0.65           C  
ATOM   3595  OD1 ASP A 495      29.320 -48.216 -19.685  1.00  0.65           O  
ATOM   3596  OD2 ASP A 495      29.841 -46.230 -18.883  1.00  0.65           O  
ATOM   3597  N   PRO A 496      33.275 -49.037 -22.805  1.00  0.63           N  
ATOM   3598  CA  PRO A 496      33.535 -50.331 -23.465  1.00  0.63           C  
ATOM   3599  C   PRO A 496      33.096 -51.598 -22.734  1.00  0.63           C  
ATOM   3600  O   PRO A 496      33.119 -51.595 -21.505  1.00  0.63           O  
ATOM   3601  CB  PRO A 496      35.045 -50.299 -23.741  1.00  0.63           C  
ATOM   3602  CG  PRO A 496      35.365 -48.809 -23.920  1.00  0.63           C  
ATOM   3603  CD  PRO A 496      34.388 -48.103 -22.979  1.00  0.63           C  
ATOM   3604  N   VAL A 497      32.727 -52.706 -23.445  1.00  0.54           N  
ATOM   3605  CA  VAL A 497      32.181 -53.933 -22.829  1.00  0.54           C  
ATOM   3606  C   VAL A 497      33.115 -54.463 -21.780  1.00  0.54           C  
ATOM   3607  O   VAL A 497      32.749 -54.894 -20.695  1.00  0.54           O  
ATOM   3608  CB  VAL A 497      31.987 -55.112 -23.789  1.00  0.54           C  
ATOM   3609  CG1 VAL A 497      31.180 -56.235 -23.105  1.00  0.54           C  
ATOM   3610  CG2 VAL A 497      31.280 -54.695 -25.074  1.00  0.54           C  
ATOM   3611  N   LYS A 498      34.405 -54.399 -22.090  1.00  0.44           N  
ATOM   3612  CA  LYS A 498      35.425 -54.705 -21.149  1.00  0.44           C  
ATOM   3613  C   LYS A 498      35.587 -53.776 -19.963  1.00  0.44           C  
ATOM   3614  O   LYS A 498      35.798 -54.263 -18.868  1.00  0.44           O  
ATOM   3615  CB  LYS A 498      36.726 -54.852 -21.887  1.00  0.44           C  
ATOM   3616  CG  LYS A 498      37.786 -55.449 -20.984  1.00  0.44           C  
ATOM   3617  CD  LYS A 498      38.992 -55.847 -21.803  1.00  0.44           C  
ATOM   3618  CE  LYS A 498      38.809 -57.148 -22.572  1.00  0.44           C  
ATOM   3619  NZ  LYS A 498      40.093 -57.609 -23.112  1.00  0.44           N  
ATOM   3620  N   VAL A 499      35.472 -52.437 -20.088  1.00  0.51           N  
ATOM   3621  CA  VAL A 499      35.602 -51.519 -18.949  1.00  0.51           C  
ATOM   3622  C   VAL A 499      34.566 -51.824 -17.887  1.00  0.51           C  
ATOM   3623  O   VAL A 499      34.845 -51.863 -16.690  1.00  0.51           O  
ATOM   3624  CB  VAL A 499      35.521 -50.047 -19.366  1.00  0.51           C  
ATOM   3625  CG1 VAL A 499      35.615 -49.106 -18.145  1.00  0.51           C  
ATOM   3626  CG2 VAL A 499      36.684 -49.710 -20.319  1.00  0.51           C  
ATOM   3627  N   THR A 500      33.348 -52.115 -18.348  1.00  0.70           N  
ATOM   3628  CA  THR A 500      32.227 -52.558 -17.550  1.00  0.70           C  
ATOM   3629  C   THR A 500      32.273 -54.014 -17.116  1.00  0.70           C  
ATOM   3630  O   THR A 500      31.975 -54.302 -15.963  1.00  0.70           O  
ATOM   3631  CB  THR A 500      30.940 -52.265 -18.257  1.00  0.70           C  
ATOM   3632  OG1 THR A 500      30.965 -52.791 -19.569  1.00  0.70           O  
ATOM   3633  CG2 THR A 500      30.808 -50.745 -18.391  1.00  0.70           C  
ATOM   3634  N   ARG A 501      32.707 -54.988 -17.956  1.00  0.47           N  
ATOM   3635  CA  ARG A 501      33.000 -56.365 -17.538  1.00  0.47           C  
ATOM   3636  C   ARG A 501      34.054 -56.381 -16.452  1.00  0.47           C  
ATOM   3637  O   ARG A 501      33.936 -57.071 -15.443  1.00  0.47           O  
ATOM   3638  CB  ARG A 501      33.536 -57.279 -18.669  1.00  0.47           C  
ATOM   3639  CG  ARG A 501      32.463 -57.935 -19.565  1.00  0.47           C  
ATOM   3640  CD  ARG A 501      33.020 -58.739 -20.754  1.00  0.47           C  
ATOM   3641  NE  ARG A 501      33.973 -59.774 -20.212  1.00  0.47           N  
ATOM   3642  CZ  ARG A 501      35.306 -59.667 -20.273  1.00  0.47           C  
ATOM   3643  NH1 ARG A 501      35.902 -58.639 -20.856  1.00  0.47           N  
ATOM   3644  NH2 ARG A 501      36.078 -60.512 -19.598  1.00  0.47           N  
ATOM   3645  N   SER A 502      35.063 -55.518 -16.598  1.00  0.46           N  
ATOM   3646  CA  SER A 502      36.116 -55.312 -15.641  1.00  0.46           C  
ATOM   3647  C   SER A 502      35.684 -54.405 -14.520  1.00  0.46           C  
ATOM   3648  O   SER A 502      36.495 -54.045 -13.674  1.00  0.46           O  
ATOM   3649  CB  SER A 502      37.328 -54.605 -16.258  1.00  0.46           C  
ATOM   3650  OG  SER A 502      37.986 -55.418 -17.220  1.00  0.46           O  
ATOM   3651  N   ALA A 503      34.385 -54.084 -14.425  1.00  0.56           N  
ATOM   3652  CA  ALA A 503      33.789 -53.517 -13.250  1.00  0.56           C  
ATOM   3653  C   ALA A 503      32.751 -54.470 -12.648  1.00  0.56           C  
ATOM   3654  O   ALA A 503      32.179 -54.161 -11.609  1.00  0.56           O  
ATOM   3655  CB  ALA A 503      33.116 -52.184 -13.621  1.00  0.56           C  
ATOM   3656  N   VAL A 504      32.490 -55.673 -13.238  1.00  0.55           N  
ATOM   3657  CA  VAL A 504      31.402 -56.560 -12.784  1.00  0.55           C  
ATOM   3658  C   VAL A 504      31.706 -58.055 -12.709  1.00  0.55           C  
ATOM   3659  O   VAL A 504      31.178 -58.730 -11.834  1.00  0.55           O  
ATOM   3660  CB  VAL A 504      30.115 -56.454 -13.562  1.00  0.55           C  
ATOM   3661  CG1 VAL A 504      29.610 -55.003 -13.539  1.00  0.55           C  
ATOM   3662  CG2 VAL A 504      30.289 -56.975 -14.997  1.00  0.55           C  
ATOM   3663  N   LEU A 505      32.700 -58.594 -13.469  1.00  0.51           N  
ATOM   3664  CA  LEU A 505      33.409 -59.837 -13.124  1.00  0.51           C  
ATOM   3665  C   LEU A 505      34.365 -59.543 -11.973  1.00  0.51           C  
ATOM   3666  O   LEU A 505      35.216 -60.335 -11.597  1.00  0.51           O  
ATOM   3667  CB  LEU A 505      34.381 -60.297 -14.249  1.00  0.51           C  
ATOM   3668  CG  LEU A 505      33.790 -60.850 -15.547  1.00  0.51           C  
ATOM   3669  CD1 LEU A 505      34.956 -61.321 -16.435  1.00  0.51           C  
ATOM   3670  CD2 LEU A 505      32.838 -62.012 -15.257  1.00  0.51           C  
ATOM   3671  N   ASN A 506      34.188 -58.344 -11.422  1.00  0.34           N  
ATOM   3672  CA  ASN A 506      35.208 -57.422 -11.095  1.00  0.34           C  
ATOM   3673  C   ASN A 506      34.699 -56.389 -10.093  1.00  0.34           C  
ATOM   3674  O   ASN A 506      35.419 -55.939  -9.235  1.00  0.34           O  
ATOM   3675  CB  ASN A 506      35.700 -56.809 -12.393  1.00  0.34           C  
ATOM   3676  CG  ASN A 506      36.939 -57.504 -12.958  1.00  0.34           C  
ATOM   3677  OD1 ASN A 506      36.991 -58.622 -13.456  1.00  0.34           O  
ATOM   3678  ND2 ASN A 506      38.021 -56.709 -12.957  1.00  0.34           N  
ATOM   3679  N   ALA A 507      33.387 -56.172  -9.902  1.00  0.35           N  
ATOM   3680  CA  ALA A 507      32.929 -55.873  -8.547  1.00  0.35           C  
ATOM   3681  C   ALA A 507      32.927 -57.182  -7.710  1.00  0.35           C  
ATOM   3682  O   ALA A 507      32.296 -57.259  -6.663  1.00  0.35           O  
ATOM   3683  CB  ALA A 507      31.617 -55.061  -8.555  1.00  0.35           C  
ATOM   3684  N   SER A 508      33.717 -58.166  -8.234  1.00  0.39           N  
ATOM   3685  CA  SER A 508      34.366 -59.412  -7.890  1.00  0.39           C  
ATOM   3686  C   SER A 508      36.025 -59.354  -8.116  1.00  0.39           C  
ATOM   3687  O   SER A 508      36.413 -59.476  -9.256  1.00  0.39           O  
ATOM   3688  CB  SER A 508      33.608 -60.491  -8.750  1.00  0.39           C  
ATOM   3689  OG  SER A 508      32.363 -60.879  -8.151  1.00  0.39           O  
ATOM   3690  N   SER A 509      37.232 -59.306  -7.332  1.00  0.24           N  
ATOM   3691  CA  SER A 509      38.068 -59.376  -5.995  1.00  0.24           C  
ATOM   3692  C   SER A 509      37.953 -58.773  -4.346  1.00  0.24           C  
ATOM   3693  O   SER A 509      37.434 -59.474  -3.490  1.00  0.24           O  
ATOM   3694  CB  SER A 509      39.418 -59.855  -6.483  1.00  0.24           C  
ATOM   3695  OG  SER A 509      40.227 -60.248  -5.410  1.00  0.24           O  
ATOM   3696  N   VAL A 510      38.202 -57.514  -3.751  1.00  0.22           N  
ATOM   3697  CA  VAL A 510      37.655 -56.894  -2.449  1.00  0.22           C  
ATOM   3698  C   VAL A 510      36.246 -57.196  -1.883  1.00  0.22           C  
ATOM   3699  O   VAL A 510      36.004 -56.951  -0.712  1.00  0.22           O  
ATOM   3700  CB  VAL A 510      37.797 -55.354  -2.030  1.00  0.22           C  
ATOM   3701  CG1 VAL A 510      38.584 -55.230  -0.711  1.00  0.22           C  
ATOM   3702  CG2 VAL A 510      38.331 -54.268  -2.966  1.00  0.22           C  
ATOM   3703  N   ALA A 511      35.255 -57.710  -2.596  1.00  0.36           N  
ATOM   3704  CA  ALA A 511      33.947 -58.070  -2.085  1.00  0.36           C  
ATOM   3705  C   ALA A 511      33.655 -59.584  -2.182  1.00  0.36           C  
ATOM   3706  O   ALA A 511      32.511 -59.998  -2.033  1.00  0.36           O  
ATOM   3707  CB  ALA A 511      32.813 -57.128  -2.556  1.00  0.36           C  
ATOM   3708  N   ARG A 512      34.719 -60.463  -2.292  1.00  0.32           N  
ATOM   3709  CA  ARG A 512      34.699 -61.843  -1.762  1.00  0.32           C  
ATOM   3710  C   ARG A 512      36.063 -62.576  -1.098  1.00  0.32           C  
ATOM   3711  O   ARG A 512      36.455 -63.548  -1.723  1.00  0.32           O  
ATOM   3712  CB  ARG A 512      33.841 -62.636  -2.785  1.00  0.32           C  
ATOM   3713  CG  ARG A 512      32.758 -63.569  -2.222  1.00  0.32           C  
ATOM   3714  CD  ARG A 512      32.894 -65.018  -2.678  1.00  0.32           C  
ATOM   3715  NE  ARG A 512      34.334 -65.407  -2.544  1.00  0.32           N  
ATOM   3716  CZ  ARG A 512      34.947 -66.333  -3.290  1.00  0.32           C  
ATOM   3717  NH1 ARG A 512      34.324 -67.367  -3.838  1.00  0.32           N  
ATOM   3718  NH2 ARG A 512      36.243 -66.150  -3.529  1.00  0.32           N  
ATOM   3719  N   MET A 513      36.932 -62.430   0.085  1.00  0.27           N  
ATOM   3720  CA  MET A 513      37.246 -62.098   1.599  1.00  0.27           C  
ATOM   3721  C   MET A 513      36.681 -61.110   2.731  1.00  0.27           C  
ATOM   3722  O   MET A 513      35.867 -61.564   3.516  1.00  0.27           O  
ATOM   3723  CB  MET A 513      38.716 -62.482   1.832  1.00  0.27           C  
ATOM   3724  CG  MET A 513      39.529 -61.931   2.996  1.00  0.27           C  
ATOM   3725  SD  MET A 513      41.156 -62.734   3.109  1.00  0.27           S  
ATOM   3726  CE  MET A 513      41.708 -62.639   1.375  1.00  0.27           C  
ATOM   3727  N   VAL A 514      36.914 -59.775   2.864  1.00  0.28           N  
ATOM   3728  CA  VAL A 514      36.314 -58.855   3.854  1.00  0.28           C  
ATOM   3729  C   VAL A 514      35.008 -59.138   4.640  1.00  0.28           C  
ATOM   3730  O   VAL A 514      35.091 -59.034   5.863  1.00  0.28           O  
ATOM   3731  CB  VAL A 514      36.309 -57.339   3.554  1.00  0.28           C  
ATOM   3732  CG1 VAL A 514      37.729 -56.809   3.259  1.00  0.28           C  
ATOM   3733  CG2 VAL A 514      35.299 -56.934   2.463  1.00  0.28           C  
ATOM   3734  N   LEU A 515      33.824 -59.505   4.060  1.00  0.35           N  
ATOM   3735  CA  LEU A 515      32.502 -59.446   4.713  1.00  0.35           C  
ATOM   3736  C   LEU A 515      32.414 -60.155   6.064  1.00  0.35           C  
ATOM   3737  O   LEU A 515      31.768 -59.709   7.006  1.00  0.35           O  
ATOM   3738  CB  LEU A 515      31.435 -60.032   3.725  1.00  0.35           C  
ATOM   3739  CG  LEU A 515      29.922 -59.979   4.085  1.00  0.35           C  
ATOM   3740  CD1 LEU A 515      29.074 -59.746   2.816  1.00  0.35           C  
ATOM   3741  CD2 LEU A 515      29.443 -61.280   4.754  1.00  0.35           C  
ATOM   3742  N   THR A 516      33.110 -61.289   6.173  1.00  0.32           N  
ATOM   3743  CA  THR A 516      32.986 -62.286   7.225  1.00  0.32           C  
ATOM   3744  C   THR A 516      34.039 -62.193   8.324  1.00  0.32           C  
ATOM   3745  O   THR A 516      34.554 -63.212   8.775  1.00  0.32           O  
ATOM   3746  CB  THR A 516      33.078 -63.692   6.631  1.00  0.32           C  
ATOM   3747  OG1 THR A 516      32.924 -63.651   5.224  1.00  0.32           O  
ATOM   3748  CG2 THR A 516      31.952 -64.561   7.189  1.00  0.32           C  
ATOM   3749  N   THR A 517      34.493 -60.996   8.770  1.00  0.22           N  
ATOM   3750  CA  THR A 517      35.611 -60.974   9.739  1.00  0.22           C  
ATOM   3751  C   THR A 517      35.243 -61.373  11.152  1.00  0.22           C  
ATOM   3752  O   THR A 517      34.562 -60.656  11.876  1.00  0.22           O  
ATOM   3753  CB  THR A 517      36.526 -59.727   9.723  1.00  0.22           C  
ATOM   3754  OG1 THR A 517      37.868 -60.091   9.435  1.00  0.22           O  
ATOM   3755  CG2 THR A 517      36.618 -58.855  10.980  1.00  0.22           C  
ATOM   3756  N   GLU A 518      35.743 -62.549  11.577  1.00  0.26           N  
ATOM   3757  CA  GLU A 518      35.722 -62.988  12.960  1.00  0.26           C  
ATOM   3758  C   GLU A 518      36.947 -62.465  13.714  1.00  0.26           C  
ATOM   3759  O   GLU A 518      37.008 -62.414  14.939  1.00  0.26           O  
ATOM   3760  CB  GLU A 518      35.701 -64.540  12.968  1.00  0.26           C  
ATOM   3761  CG  GLU A 518      34.765 -65.151  14.037  1.00  0.26           C  
ATOM   3762  CD  GLU A 518      33.300 -64.865  13.710  1.00  0.26           C  
ATOM   3763  OE1 GLU A 518      32.866 -65.256  12.595  1.00  0.26           O  
ATOM   3764  OE2 GLU A 518      32.610 -64.266  14.573  1.00  0.26           O  
ATOM   3765  N   THR A 519      37.981 -62.022  12.966  1.00  0.27           N  
ATOM   3766  CA  THR A 519      39.193 -61.443  13.537  1.00  0.27           C  
ATOM   3767  C   THR A 519      39.925 -60.635  12.481  1.00  0.27           C  
ATOM   3768  O   THR A 519      39.628 -60.753  11.293  1.00  0.27           O  
ATOM   3769  CB  THR A 519      40.118 -62.492  14.168  1.00  0.27           C  
ATOM   3770  OG1 THR A 519      41.184 -61.906  14.901  1.00  0.27           O  
ATOM   3771  CG2 THR A 519      40.735 -63.439  13.127  1.00  0.27           C  
ATOM   3772  N   VAL A 520      40.882 -59.779  12.894  1.00  0.27           N  
ATOM   3773  CA  VAL A 520      41.863 -59.086  12.068  1.00  0.27           C  
ATOM   3774  C   VAL A 520      43.087 -58.987  12.964  1.00  0.27           C  
ATOM   3775  O   VAL A 520      42.947 -58.753  14.162  1.00  0.27           O  
ATOM   3776  CB  VAL A 520      41.479 -57.656  11.651  1.00  0.27           C  
ATOM   3777  CG1 VAL A 520      42.552 -57.040  10.726  1.00  0.27           C  
ATOM   3778  CG2 VAL A 520      40.128 -57.646  10.919  1.00  0.27           C  
ATOM   3779  N   VAL A 521      44.315 -59.162  12.433  1.00  0.45           N  
ATOM   3780  CA  VAL A 521      45.537 -59.002  13.207  1.00  0.45           C  
ATOM   3781  C   VAL A 521      46.374 -57.903  12.576  1.00  0.45           C  
ATOM   3782  O   VAL A 521      46.578 -57.871  11.364  1.00  0.45           O  
ATOM   3783  CB  VAL A 521      46.338 -60.296  13.365  1.00  0.45           C  
ATOM   3784  CG1 VAL A 521      45.545 -61.249  14.282  1.00  0.45           C  
ATOM   3785  CG2 VAL A 521      46.627 -60.970  12.007  1.00  0.45           C  
ATOM   3786  N   VAL A 522      46.825 -56.935  13.399  1.00  0.49           N  
ATOM   3787  CA  VAL A 522      47.616 -55.784  12.993  1.00  0.49           C  
ATOM   3788  C   VAL A 522      48.476 -55.465  14.202  1.00  0.49           C  
ATOM   3789  O   VAL A 522      48.044 -55.689  15.335  1.00  0.49           O  
ATOM   3790  CB  VAL A 522      46.782 -54.526  12.670  1.00  0.49           C  
ATOM   3791  CG1 VAL A 522      47.671 -53.409  12.081  1.00  0.49           C  
ATOM   3792  CG2 VAL A 522      45.656 -54.840  11.668  1.00  0.49           C  
ATOM   3793  N   ASP A 523      49.703 -54.941  14.015  1.00  0.29           N  
ATOM   3794  CA  ASP A 523      50.538 -54.390  15.063  1.00  0.29           C  
ATOM   3795  C   ASP A 523      49.875 -53.267  15.863  1.00  0.29           C  
ATOM   3796  O   ASP A 523      49.032 -52.519  15.371  1.00  0.29           O  
ATOM   3797  CB  ASP A 523      51.855 -53.864  14.455  1.00  0.29           C  
ATOM   3798  CG  ASP A 523      52.488 -54.999  13.682  1.00  0.29           C  
ATOM   3799  OD1 ASP A 523      53.241 -55.783  14.310  1.00  0.29           O  
ATOM   3800  OD2 ASP A 523      52.166 -55.115  12.471  1.00  0.29           O  
ATOM   3801  N   LYS A 524      50.223 -53.137  17.159  1.00  0.24           N  
ATOM   3802  CA  LYS A 524      49.633 -52.154  18.050  1.00  0.24           C  
ATOM   3803  C   LYS A 524      50.012 -50.703  17.717  1.00  0.24           C  
ATOM   3804  O   LYS A 524      51.200 -50.379  17.745  1.00  0.24           O  
ATOM   3805  CB  LYS A 524      50.057 -52.467  19.513  1.00  0.24           C  
ATOM   3806  CG  LYS A 524      49.556 -51.492  20.598  1.00  0.24           C  
ATOM   3807  CD  LYS A 524      48.028 -51.468  20.775  1.00  0.24           C  
ATOM   3808  CE  LYS A 524      47.576 -50.328  21.695  1.00  0.24           C  
ATOM   3809  NZ  LYS A 524      46.102 -50.327  21.830  1.00  0.24           N  
ATOM   3810  N   PRO A 525      49.090 -49.767  17.442  1.00  0.24           N  
ATOM   3811  CA  PRO A 525      49.402 -48.343  17.392  1.00  0.24           C  
ATOM   3812  C   PRO A 525      50.018 -47.794  18.668  1.00  0.24           C  
ATOM   3813  O   PRO A 525      49.422 -47.928  19.739  1.00  0.24           O  
ATOM   3814  CB  PRO A 525      48.059 -47.667  17.063  1.00  0.24           C  
ATOM   3815  CG  PRO A 525      47.293 -48.748  16.298  1.00  0.24           C  
ATOM   3816  CD  PRO A 525      47.712 -50.028  17.018  1.00  0.24           C  
ATOM   3817  N   ALA A 526      51.194 -47.148  18.574  1.00  0.20           N  
ATOM   3818  CA  ALA A 526      51.838 -46.513  19.700  1.00  0.20           C  
ATOM   3819  C   ALA A 526      51.243 -45.135  19.960  1.00  0.20           C  
ATOM   3820  O   ALA A 526      51.562 -44.146  19.301  1.00  0.20           O  
ATOM   3821  CB  ALA A 526      53.354 -46.404  19.445  1.00  0.20           C  
ATOM   3822  N   LYS A 527      50.327 -45.047  20.940  1.00  0.18           N  
ATOM   3823  CA  LYS A 527      49.608 -43.830  21.226  1.00  0.18           C  
ATOM   3824  C   LYS A 527      49.360 -43.691  22.709  1.00  0.18           C  
ATOM   3825  O   LYS A 527      49.225 -44.663  23.447  1.00  0.18           O  
ATOM   3826  CB  LYS A 527      48.217 -43.770  20.522  1.00  0.18           C  
ATOM   3827  CG  LYS A 527      48.246 -43.499  19.005  1.00  0.18           C  
ATOM   3828  CD  LYS A 527      48.907 -42.165  18.596  1.00  0.18           C  
ATOM   3829  CE  LYS A 527      48.267 -40.918  19.224  1.00  0.18           C  
ATOM   3830  NZ  LYS A 527      49.045 -39.710  18.867  1.00  0.18           N  
ATOM   3831  N   ALA A 528      49.266 -42.424  23.130  1.00  0.25           N  
ATOM   3832  CA  ALA A 528      48.786 -41.970  24.402  1.00  0.25           C  
ATOM   3833  C   ALA A 528      47.958 -40.751  24.040  1.00  0.25           C  
ATOM   3834  O   ALA A 528      48.000 -40.314  22.880  1.00  0.25           O  
ATOM   3835  CB  ALA A 528      49.945 -41.587  25.345  1.00  0.25           C  
ATOM   3836  N   GLU A 529      47.180 -40.228  24.996  1.00  0.24           N  
ATOM   3837  CA  GLU A 529      46.463 -38.982  24.874  1.00  0.24           C  
ATOM   3838  C   GLU A 529      47.295 -37.835  25.511  1.00  0.24           C  
ATOM   3839  O   GLU A 529      48.243 -38.128  26.293  1.00  0.24           O  
ATOM   3840  CB  GLU A 529      45.042 -39.108  25.491  1.00  0.24           C  
ATOM   3841  CG  GLU A 529      44.985 -39.596  26.965  1.00  0.24           C  
ATOM   3842  CD  GLU A 529      43.573 -39.949  27.442  1.00  0.24           C  
ATOM   3843  OE1 GLU A 529      42.613 -39.885  26.631  1.00  0.24           O  
ATOM   3844  OE2 GLU A 529      43.455 -40.326  28.639  1.00  0.24           O  
ATOM   3845  OXT GLU A 529      47.025 -36.654  25.159  1.00  0.24           O  
TER    3846      GLU A 529                                                      
END   


A second structure was input as follows:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 swiss_gro_cu3
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   09-FEB-20 1MOD    1       07:22
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   2.0.0
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  QMN4    -5.16
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN    
REMARK   3  MMCIF    
REMARK   3  PDBV    2020-01-31
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2020-02-05
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   BLAST
REMARK   3  SIM     0.58
REMARK   3  SID     100.00
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG MSKLIEYDETARRAMEVGMDKLADTVRVTLGPRGRHVVLAKAFGGPTVTNDGVTVARE
REMARK   3  ALN A TRG IELEDPFEDLGAQLVKSVATKTNDVAGDGTTTATILAQALIKGGLRLVAAGVNPIALG
REMARK   3  ALN A TRG VGIGKAADAVSEALLASATPVSGKTGIAQVATVSSRDEQIGDLVGEAMSKVGHDGVVS
REMARK   3  ALN A TRG VEESSTLGTELEFTEGIGFDKGFLSAYFVTDFDNQQAVLEDALILLHQDKISSLPDLL
REMARK   3  ALN A TRG PLLEKVAGTGKPLLIVAEDVEGEALATLVVNAIRKTLKAVAVKGPYFGDRRKAFLEDL
REMARK   3  ALN A TRG AVVTGGQVVNPDAGMVLREVGLEVLGSARRVVVSKDDTVIVDGGGTAEAVANRAKHLR
REMARK   3  ALN A TRG AEIDKSDSDWDREKLGERLAKLAGGVAVIKVGAATETALKERKESVEDAVAAAKAAVE
REMARK   3  ALN A TRG EGIVPGGGASLIHQARKALTELRASLTGDEVLGVDVFSEALAAPLFWIAANAGLDGSV
REMARK   3  ALN A TRG VVNKVSELPAGHGLNVNTLSYGDLAADGVIDPVKVTRSAVLNASSVARMVLTTETVVV
REMARK   3  ALN A TRG DKPAKAEDHDHHHGHAH
REMARK   3  ALN A TPL MSKLIEYDETARRAMEVGMDKLADTVRVTLGPRGRHVVLAKAFGGPTVTNDGVTVARE
REMARK   3  ALN A TPL IELEDPFEDLGAQLVKSVATKTNDVAGDGTTTATILAQALIKGGLRLVAAGVNPIALG
REMARK   3  ALN A TPL VGIGKAADAVSEALLASATPVSGKTGIAQVATVSSRDEQIGDLVGEAMSKVGHDGVVS
REMARK   3  ALN A TPL VEESSTLGTELEFTEGIGFDKGFLSAYFVTDFDNQQAVLEDALILLHQDKISSLPDLL
REMARK   3  ALN A TPL PLLEKVAGTGKPLLIVAEDVEGEALATLVVNAIRKTLKAVAVKGPYFGDRRKAFLEDL
REMARK   3  ALN A TPL AVVTGGQVVNPDAGMVLREVGLEVLGSARRVVVSKDDTVIVDGGGTAEAVANRAKHLR
REMARK   3  ALN A TPL AEIDKSDSDWDREKLGERLAKLAGGVAVIKVGAATETALKERKESVEDAVAAAKAAVE
REMARK   3  ALN A TPL EGIVPGGGASLIHQARKALTELRASLTGDEVLGVDVFSEALAAPLFWIAANAGLDGSV
REMARK   3  ALN A TPL VVNKVSELPAGHGLNVNTLSYGDLAADGVIDPVKVTRSAVLNASSVARMVLTTETVVV
REMARK   3  ALN A TPL DKPAKAE----------
REMARK   3  ALN A OFF 0
ATOM      1  N   MET A   1      68.934 -65.757   5.083  1.00  0.13           N  
ATOM      2  CA  MET A   1      69.866 -64.934   4.235  1.00  0.13           C  
ATOM      3  C   MET A   1      69.584 -63.472   4.525  1.00  0.13           C  
ATOM      4  O   MET A   1      69.029 -63.189   5.577  1.00  0.13           O  
ATOM      5  CB  MET A   1      69.650 -65.271   2.730  1.00  0.13           C  
ATOM      6  CG  MET A   1      70.062 -66.696   2.301  1.00  0.13           C  
ATOM      7  SD  MET A   1      69.774 -66.984   0.528  1.00  0.13           S  
ATOM      8  CE  MET A   1      70.668 -68.564   0.448  1.00  0.13           C  
ATOM      9  N   SER A   2      69.920 -62.522   3.619  1.00  0.46           N  
ATOM     10  CA  SER A   2      69.390 -61.153   3.679  1.00  0.46           C  
ATOM     11  C   SER A   2      67.878 -61.132   3.465  1.00  0.46           C  
ATOM     12  O   SER A   2      67.124 -60.460   4.159  1.00  0.46           O  
ATOM     13  CB  SER A   2      70.078 -60.225   2.636  1.00  0.46           C  
ATOM     14  OG  SER A   2      69.690 -58.864   2.812  1.00  0.46           O  
ATOM     15  N   LYS A   3      67.391 -61.952   2.508  1.00  0.39           N  
ATOM     16  CA  LYS A   3      65.975 -62.195   2.310  1.00  0.39           C  
ATOM     17  C   LYS A   3      65.273 -62.781   3.534  1.00  0.39           C  
ATOM     18  O   LYS A   3      65.667 -63.835   4.044  1.00  0.39           O  
ATOM     19  CB  LYS A   3      65.738 -63.208   1.155  1.00  0.39           C  
ATOM     20  CG  LYS A   3      66.302 -62.781  -0.210  1.00  0.39           C  
ATOM     21  CD  LYS A   3      66.122 -63.859  -1.301  1.00  0.39           C  
ATOM     22  CE  LYS A   3      67.008 -65.098  -1.104  1.00  0.39           C  
ATOM     23  NZ  LYS A   3      66.823 -66.067  -2.209  1.00  0.39           N  
ATOM     24  N   LEU A   4      64.180 -62.124   3.965  1.00  0.56           N  
ATOM     25  CA  LEU A   4      63.214 -62.662   4.896  1.00  0.56           C  
ATOM     26  C   LEU A   4      62.169 -63.428   4.106  1.00  0.56           C  
ATOM     27  O   LEU A   4      61.809 -63.041   2.995  1.00  0.56           O  
ATOM     28  CB  LEU A   4      62.496 -61.543   5.694  1.00  0.56           C  
ATOM     29  CG  LEU A   4      63.423 -60.616   6.508  1.00  0.56           C  
ATOM     30  CD1 LEU A   4      62.598 -59.507   7.179  1.00  0.56           C  
ATOM     31  CD2 LEU A   4      64.237 -61.380   7.563  1.00  0.56           C  
ATOM     32  N   ILE A   5      61.662 -64.547   4.648  1.00  0.57           N  
ATOM     33  CA  ILE A   5      60.632 -65.335   3.997  1.00  0.57           C  
ATOM     34  C   ILE A   5      59.540 -65.529   5.020  1.00  0.57           C  
ATOM     35  O   ILE A   5      59.797 -65.996   6.126  1.00  0.57           O  
ATOM     36  CB  ILE A   5      61.123 -66.694   3.489  1.00  0.57           C  
ATOM     37  CG1 ILE A   5      62.300 -66.514   2.496  1.00  0.57           C  
ATOM     38  CG2 ILE A   5      59.950 -67.457   2.826  1.00  0.57           C  
ATOM     39  CD1 ILE A   5      62.949 -67.835   2.064  1.00  0.57           C  
ATOM     40  N   GLU A   6      58.300 -65.159   4.659  1.00  0.68           N  
ATOM     41  CA  GLU A   6      57.125 -65.376   5.472  1.00  0.68           C  
ATOM     42  C   GLU A   6      56.263 -66.404   4.779  1.00  0.68           C  
ATOM     43  O   GLU A   6      56.311 -66.563   3.558  1.00  0.68           O  
ATOM     44  CB  GLU A   6      56.306 -64.075   5.666  1.00  0.68           C  
ATOM     45  CG  GLU A   6      56.838 -63.176   6.808  1.00  0.68           C  
ATOM     46  CD  GLU A   6      56.502 -63.717   8.196  1.00  0.68           C  
ATOM     47  OE1 GLU A   6      56.085 -64.901   8.306  1.00  0.68           O  
ATOM     48  OE2 GLU A   6      56.595 -62.914   9.161  1.00  0.68           O  
ATOM     49  N   TYR A   7      55.448 -67.133   5.554  1.00  0.64           N  
ATOM     50  CA  TYR A   7      54.659 -68.244   5.058  1.00  0.64           C  
ATOM     51  C   TYR A   7      53.189 -67.997   5.337  1.00  0.64           C  
ATOM     52  O   TYR A   7      52.817 -67.014   5.975  1.00  0.64           O  
ATOM     53  CB  TYR A   7      55.114 -69.595   5.675  1.00  0.64           C  
ATOM     54  CG  TYR A   7      56.431 -70.010   5.074  1.00  0.64           C  
ATOM     55  CD1 TYR A   7      57.645 -69.709   5.713  1.00  0.64           C  
ATOM     56  CD2 TYR A   7      56.460 -70.697   3.848  1.00  0.64           C  
ATOM     57  CE1 TYR A   7      58.866 -70.089   5.138  1.00  0.64           C  
ATOM     58  CE2 TYR A   7      57.681 -71.078   3.270  1.00  0.64           C  
ATOM     59  CZ  TYR A   7      58.883 -70.773   3.919  1.00  0.64           C  
ATOM     60  OH  TYR A   7      60.113 -71.148   3.343  1.00  0.64           O  
ATOM     61  N   ASP A   8      52.330 -68.880   4.780  1.00  0.67           N  
ATOM     62  CA  ASP A   8      50.883 -68.957   4.915  1.00  0.67           C  
ATOM     63  C   ASP A   8      50.106 -67.720   5.396  1.00  0.67           C  
ATOM     64  O   ASP A   8      49.973 -66.738   4.665  1.00  0.67           O  
ATOM     65  CB  ASP A   8      50.478 -70.298   5.578  1.00  0.67           C  
ATOM     66  CG  ASP A   8      51.169 -70.450   6.919  1.00  0.67           C  
ATOM     67  OD1 ASP A   8      52.218 -71.135   6.959  1.00  0.67           O  
ATOM     68  OD2 ASP A   8      50.641 -69.856   7.889  1.00  0.67           O  
ATOM     69  N   GLU A   9      49.510 -67.757   6.602  1.00  0.67           N  
ATOM     70  CA  GLU A   9      48.731 -66.661   7.149  1.00  0.67           C  
ATOM     71  C   GLU A   9      49.547 -65.409   7.415  1.00  0.67           C  
ATOM     72  O   GLU A   9      49.120 -64.295   7.107  1.00  0.67           O  
ATOM     73  CB  GLU A   9      47.967 -67.070   8.425  1.00  0.67           C  
ATOM     74  CG  GLU A   9      46.976 -65.974   8.896  1.00  0.67           C  
ATOM     75  CD  GLU A   9      46.087 -66.412  10.058  1.00  0.67           C  
ATOM     76  OE1 GLU A   9      45.853 -67.636  10.204  1.00  0.67           O  
ATOM     77  OE2 GLU A   9      45.614 -65.493  10.777  1.00  0.67           O  
ATOM     78  N   THR A  10      50.775 -65.556   7.950  1.00  0.73           N  
ATOM     79  CA  THR A  10      51.654 -64.441   8.288  1.00  0.73           C  
ATOM     80  C   THR A  10      52.030 -63.587   7.091  1.00  0.73           C  
ATOM     81  O   THR A  10      51.994 -62.356   7.156  1.00  0.73           O  
ATOM     82  CB  THR A  10      52.929 -64.861   8.994  1.00  0.73           C  
ATOM     83  OG1 THR A  10      52.636 -65.784  10.028  1.00  0.73           O  
ATOM     84  CG2 THR A  10      53.562 -63.658   9.700  1.00  0.73           C  
ATOM     85  N   ALA A  11      52.335 -64.224   5.943  1.00  0.78           N  
ATOM     86  CA  ALA A  11      52.496 -63.565   4.662  1.00  0.78           C  
ATOM     87  C   ALA A  11      51.212 -62.926   4.134  1.00  0.78           C  
ATOM     88  O   ALA A  11      51.199 -61.775   3.696  1.00  0.78           O  
ATOM     89  CB  ALA A  11      52.995 -64.601   3.633  1.00  0.78           C  
ATOM     90  N   ARG A  12      50.076 -63.656   4.192  1.00  0.67           N  
ATOM     91  CA  ARG A  12      48.789 -63.175   3.710  1.00  0.67           C  
ATOM     92  C   ARG A  12      48.256 -61.955   4.445  1.00  0.67           C  
ATOM     93  O   ARG A  12      47.781 -61.021   3.807  1.00  0.67           O  
ATOM     94  CB  ARG A  12      47.715 -64.292   3.710  1.00  0.67           C  
ATOM     95  CG  ARG A  12      47.927 -65.318   2.577  1.00  0.67           C  
ATOM     96  CD  ARG A  12      46.817 -66.368   2.443  1.00  0.67           C  
ATOM     97  NE  ARG A  12      46.846 -67.275   3.641  1.00  0.67           N  
ATOM     98  CZ  ARG A  12      47.141 -68.582   3.612  1.00  0.67           C  
ATOM     99  NH1 ARG A  12      47.683 -69.150   2.540  1.00  0.67           N  
ATOM    100  NH2 ARG A  12      46.897 -69.333   4.684  1.00  0.67           N  
ATOM    101  N   ARG A  13      48.355 -61.899   5.791  1.00  0.67           N  
ATOM    102  CA  ARG A  13      47.921 -60.740   6.562  1.00  0.67           C  
ATOM    103  C   ARG A  13      48.696 -59.465   6.217  1.00  0.67           C  
ATOM    104  O   ARG A  13      48.122 -58.390   6.092  1.00  0.67           O  
ATOM    105  CB  ARG A  13      47.960 -61.011   8.098  1.00  0.67           C  
ATOM    106  CG  ARG A  13      49.382 -61.166   8.670  1.00  0.67           C  
ATOM    107  CD  ARG A  13      49.508 -61.430  10.169  1.00  0.67           C  
ATOM    108  NE  ARG A  13      50.996 -61.395  10.406  1.00  0.67           N  
ATOM    109  CZ  ARG A  13      51.620 -60.771  11.413  1.00  0.67           C  
ATOM    110  NH1 ARG A  13      50.950 -60.275  12.448  1.00  0.67           N  
ATOM    111  NH2 ARG A  13      52.947 -60.649  11.384  1.00  0.67           N  
ATOM    112  N   ALA A  14      50.031 -59.546   6.016  1.00  0.80           N  
ATOM    113  CA  ALA A  14      50.846 -58.413   5.620  1.00  0.80           C  
ATOM    114  C   ALA A  14      50.508 -57.925   4.217  1.00  0.80           C  
ATOM    115  O   ALA A  14      50.366 -56.733   3.956  1.00  0.80           O  
ATOM    116  CB  ALA A  14      52.331 -58.796   5.725  1.00  0.80           C  
ATOM    117  N   MET A  15      50.289 -58.871   3.284  1.00  0.75           N  
ATOM    118  CA  MET A  15      49.804 -58.589   1.948  1.00  0.75           C  
ATOM    119  C   MET A  15      48.430 -57.914   1.935  1.00  0.75           C  
ATOM    120  O   MET A  15      48.206 -56.962   1.187  1.00  0.75           O  
ATOM    121  CB  MET A  15      49.751 -59.912   1.149  1.00  0.75           C  
ATOM    122  CG  MET A  15      49.473 -59.745  -0.357  1.00  0.75           C  
ATOM    123  SD  MET A  15      49.244 -61.320  -1.237  1.00  0.75           S  
ATOM    124  CE  MET A  15      47.583 -61.672  -0.591  1.00  0.75           C  
ATOM    125  N   GLU A  16      47.489 -58.371   2.793  1.00  0.75           N  
ATOM    126  CA  GLU A  16      46.189 -57.750   2.997  1.00  0.75           C  
ATOM    127  C   GLU A  16      46.275 -56.336   3.556  1.00  0.75           C  
ATOM    128  O   GLU A  16      45.690 -55.425   2.986  1.00  0.75           O  
ATOM    129  CB  GLU A  16      45.286 -58.637   3.891  1.00  0.75           C  
ATOM    130  CG  GLU A  16      43.791 -58.212   3.930  1.00  0.75           C  
ATOM    131  CD  GLU A  16      42.887 -59.267   4.577  1.00  0.75           C  
ATOM    132  OE1 GLU A  16      43.290 -59.833   5.626  1.00  0.75           O  
ATOM    133  OE2 GLU A  16      41.787 -59.530   4.018  1.00  0.75           O  
ATOM    134  N   VAL A  17      47.092 -56.078   4.606  1.00  0.80           N  
ATOM    135  CA  VAL A  17      47.322 -54.730   5.137  1.00  0.80           C  
ATOM    136  C   VAL A  17      47.968 -53.800   4.113  1.00  0.80           C  
ATOM    137  O   VAL A  17      47.579 -52.644   3.947  1.00  0.80           O  
ATOM    138  CB  VAL A  17      48.150 -54.741   6.420  1.00  0.80           C  
ATOM    139  CG1 VAL A  17      48.438 -53.308   6.918  1.00  0.80           C  
ATOM    140  CG2 VAL A  17      47.368 -55.489   7.516  1.00  0.80           C  
ATOM    141  N   GLY A  18      48.959 -54.302   3.348  1.00  0.81           N  
ATOM    142  CA  GLY A  18      49.482 -53.651   2.150  1.00  0.81           C  
ATOM    143  C   GLY A  18      48.452 -53.234   1.133  1.00  0.81           C  
ATOM    144  O   GLY A  18      48.412 -52.090   0.679  1.00  0.81           O  
ATOM    145  N   MET A  19      47.568 -54.178   0.755  1.00  0.75           N  
ATOM    146  CA  MET A  19      46.437 -53.908  -0.108  1.00  0.75           C  
ATOM    147  C   MET A  19      45.423 -52.961   0.501  1.00  0.75           C  
ATOM    148  O   MET A  19      44.942 -52.081  -0.204  1.00  0.75           O  
ATOM    149  CB  MET A  19      45.744 -55.187  -0.632  1.00  0.75           C  
ATOM    150  CG  MET A  19      44.701 -54.864  -1.731  1.00  0.75           C  
ATOM    151  SD  MET A  19      44.111 -56.216  -2.805  1.00  0.75           S  
ATOM    152  CE  MET A  19      45.442 -57.450  -2.695  1.00  0.75           C  
ATOM    153  N   ASP A  20      45.103 -53.060   1.811  1.00  0.76           N  
ATOM    154  CA  ASP A  20      44.315 -52.064   2.515  1.00  0.76           C  
ATOM    155  C   ASP A  20      44.975 -50.694   2.444  1.00  0.76           C  
ATOM    156  O   ASP A  20      44.343 -49.751   2.017  1.00  0.76           O  
ATOM    157  CB  ASP A  20      44.044 -52.427   4.005  1.00  0.76           C  
ATOM    158  CG  ASP A  20      42.807 -53.298   4.203  1.00  0.76           C  
ATOM    159  OD1 ASP A  20      41.806 -53.121   3.452  1.00  0.76           O  
ATOM    160  OD2 ASP A  20      42.828 -54.107   5.162  1.00  0.76           O  
ATOM    161  N   LYS A  21      46.278 -50.498   2.723  1.00  0.73           N  
ATOM    162  CA  LYS A  21      46.856 -49.161   2.600  1.00  0.73           C  
ATOM    163  C   LYS A  21      46.854 -48.565   1.190  1.00  0.73           C  
ATOM    164  O   LYS A  21      46.573 -47.379   1.009  1.00  0.73           O  
ATOM    165  CB  LYS A  21      48.277 -49.073   3.198  1.00  0.73           C  
ATOM    166  CG  LYS A  21      48.752 -47.614   3.368  1.00  0.73           C  
ATOM    167  CD  LYS A  21      50.069 -47.434   4.146  1.00  0.73           C  
ATOM    168  CE  LYS A  21      50.114 -48.062   5.546  1.00  0.73           C  
ATOM    169  NZ  LYS A  21      48.979 -47.563   6.356  1.00  0.73           N  
ATOM    170  N   LEU A  22      47.138 -49.378   0.148  1.00  0.75           N  
ATOM    171  CA  LEU A  22      46.968 -48.967  -1.240  1.00  0.75           C  
ATOM    172  C   LEU A  22      45.512 -48.660  -1.560  1.00  0.75           C  
ATOM    173  O   LEU A  22      45.187 -47.621  -2.129  1.00  0.75           O  
ATOM    174  CB  LEU A  22      47.512 -50.084  -2.174  1.00  0.75           C  
ATOM    175  CG  LEU A  22      47.688 -49.781  -3.689  1.00  0.75           C  
ATOM    176  CD1 LEU A  22      46.380 -49.733  -4.488  1.00  0.75           C  
ATOM    177  CD2 LEU A  22      48.518 -48.525  -3.964  1.00  0.75           C  
ATOM    178  N   ALA A  23      44.581 -49.539  -1.146  1.00  0.74           N  
ATOM    179  CA  ALA A  23      43.167 -49.333  -1.321  1.00  0.74           C  
ATOM    180  C   ALA A  23      42.619 -48.153  -0.548  1.00  0.74           C  
ATOM    181  O   ALA A  23      41.914 -47.364  -1.139  1.00  0.74           O  
ATOM    182  CB  ALA A  23      42.370 -50.614  -0.998  1.00  0.74           C  
ATOM    183  N   ASP A  24      42.943 -47.956   0.738  1.00  0.67           N  
ATOM    184  CA  ASP A  24      42.393 -46.958   1.640  1.00  0.67           C  
ATOM    185  C   ASP A  24      42.639 -45.517   1.206  1.00  0.67           C  
ATOM    186  O   ASP A  24      41.785 -44.646   1.334  1.00  0.67           O  
ATOM    187  CB  ASP A  24      42.889 -47.160   3.092  1.00  0.67           C  
ATOM    188  CG  ASP A  24      42.372 -48.451   3.712  1.00  0.67           C  
ATOM    189  OD1 ASP A  24      41.642 -49.223   3.042  1.00  0.67           O  
ATOM    190  OD2 ASP A  24      42.735 -48.686   4.889  1.00  0.67           O  
ATOM    191  N   THR A  25      43.813 -45.210   0.629  1.00  0.71           N  
ATOM    192  CA  THR A  25      44.056 -43.884   0.047  1.00  0.71           C  
ATOM    193  C   THR A  25      43.334 -43.703  -1.292  1.00  0.71           C  
ATOM    194  O   THR A  25      42.955 -42.607  -1.697  1.00  0.71           O  
ATOM    195  CB  THR A  25      45.545 -43.602  -0.068  1.00  0.71           C  
ATOM    196  OG1 THR A  25      45.813 -42.257  -0.433  1.00  0.71           O  
ATOM    197  CG2 THR A  25      46.206 -44.523  -1.094  1.00  0.71           C  
ATOM    198  N   VAL A  26      43.008 -44.824  -1.962  1.00  0.69           N  
ATOM    199  CA  VAL A  26      42.165 -44.923  -3.145  1.00  0.69           C  
ATOM    200  C   VAL A  26      40.723 -45.222  -2.668  1.00  0.69           C  
ATOM    201  O   VAL A  26      39.842 -45.699  -3.383  1.00  0.69           O  
ATOM    202  CB  VAL A  26      42.763 -45.992  -4.078  1.00  0.69           C  
ATOM    203  CG1 VAL A  26      41.980 -46.139  -5.385  1.00  0.69           C  
ATOM    204  CG2 VAL A  26      44.214 -45.609  -4.450  1.00  0.69           C  
ATOM    205  N   ARG A  27      40.462 -44.921  -1.375  1.00  0.47           N  
ATOM    206  CA  ARG A  27      39.182 -44.994  -0.715  1.00  0.47           C  
ATOM    207  C   ARG A  27      38.896 -43.701   0.071  1.00  0.47           C  
ATOM    208  O   ARG A  27      38.191 -43.737   1.076  1.00  0.47           O  
ATOM    209  CB  ARG A  27      39.010 -46.174   0.263  1.00  0.47           C  
ATOM    210  CG  ARG A  27      38.866 -47.602  -0.298  1.00  0.47           C  
ATOM    211  CD  ARG A  27      38.541 -48.516   0.886  1.00  0.47           C  
ATOM    212  NE  ARG A  27      39.190 -49.839   0.757  1.00  0.47           N  
ATOM    213  CZ  ARG A  27      39.355 -50.559   1.872  1.00  0.47           C  
ATOM    214  NH1 ARG A  27      38.591 -50.379   2.961  1.00  0.47           N  
ATOM    215  NH2 ARG A  27      40.575 -51.142   2.012  1.00  0.47           N  
ATOM    216  N   VAL A  28      39.296 -42.494  -0.401  1.00  0.55           N  
ATOM    217  CA  VAL A  28      38.734 -41.239   0.131  1.00  0.55           C  
ATOM    218  C   VAL A  28      38.097 -40.299  -0.918  1.00  0.55           C  
ATOM    219  O   VAL A  28      37.734 -39.158  -0.622  1.00  0.55           O  
ATOM    220  CB  VAL A  28      39.729 -40.470   0.996  1.00  0.55           C  
ATOM    221  CG1 VAL A  28      40.142 -41.343   2.199  1.00  0.55           C  
ATOM    222  CG2 VAL A  28      40.959 -40.051   0.178  1.00  0.55           C  
ATOM    223  N   THR A  29      37.900 -40.754  -2.173  1.00  0.51           N  
ATOM    224  CA  THR A  29      37.530 -39.962  -3.351  1.00  0.51           C  
ATOM    225  C   THR A  29      36.278 -40.380  -4.205  1.00  0.51           C  
ATOM    226  O   THR A  29      36.143 -39.850  -5.297  1.00  0.51           O  
ATOM    227  CB  THR A  29      38.739 -39.839  -4.297  1.00  0.51           C  
ATOM    228  OG1 THR A  29      39.207 -41.112  -4.712  1.00  0.51           O  
ATOM    229  CG2 THR A  29      39.938 -39.240  -3.543  1.00  0.51           C  
ATOM    230  N   LEU A  30      35.322 -41.284  -3.785  1.00  0.37           N  
ATOM    231  CA  LEU A  30      34.164 -41.890  -4.514  1.00  0.37           C  
ATOM    232  C   LEU A  30      33.102 -40.903  -4.957  1.00  0.37           C  
ATOM    233  O   LEU A  30      32.640 -40.044  -4.207  1.00  0.37           O  
ATOM    234  CB  LEU A  30      33.415 -43.157  -3.852  1.00  0.37           C  
ATOM    235  CG  LEU A  30      33.481 -44.607  -4.463  1.00  0.37           C  
ATOM    236  CD1 LEU A  30      33.633 -44.500  -5.915  1.00  0.37           C  
ATOM    237  CD2 LEU A  30      34.462 -45.753  -4.114  1.00  0.37           C  
ATOM    238  N   GLY A  31      32.637 -41.043  -6.219  1.00  0.46           N  
ATOM    239  CA  GLY A  31      31.818 -40.045  -6.891  1.00  0.46           C  
ATOM    240  C   GLY A  31      32.329 -38.620  -6.734  1.00  0.46           C  
ATOM    241  O   GLY A  31      33.527 -38.372  -6.639  1.00  0.46           O  
ATOM    242  N   PRO A  32      31.434 -37.667  -6.703  1.00  0.50           N  
ATOM    243  CA  PRO A  32      31.767 -36.314  -6.266  1.00  0.50           C  
ATOM    244  C   PRO A  32      31.475 -36.007  -4.791  1.00  0.50           C  
ATOM    245  O   PRO A  32      31.516 -34.836  -4.422  1.00  0.50           O  
ATOM    246  CB  PRO A  32      30.959 -35.420  -7.228  1.00  0.50           C  
ATOM    247  CG  PRO A  32      29.860 -36.286  -7.859  1.00  0.50           C  
ATOM    248  CD  PRO A  32      30.354 -37.712  -7.694  1.00  0.50           C  
ATOM    249  N   ARG A  33      31.195 -36.988  -3.888  1.00  0.43           N  
ATOM    250  CA  ARG A  33      31.328 -36.756  -2.442  1.00  0.43           C  
ATOM    251  C   ARG A  33      32.793 -36.896  -2.129  1.00  0.43           C  
ATOM    252  O   ARG A  33      33.283 -36.437  -1.096  1.00  0.43           O  
ATOM    253  CB  ARG A  33      30.618 -37.799  -1.523  1.00  0.43           C  
ATOM    254  CG  ARG A  33      29.133 -37.583  -1.150  1.00  0.43           C  
ATOM    255  CD  ARG A  33      28.827 -36.435  -0.176  1.00  0.43           C  
ATOM    256  NE  ARG A  33      28.650 -35.169  -0.962  1.00  0.43           N  
ATOM    257  CZ  ARG A  33      27.487 -34.761  -1.494  1.00  0.43           C  
ATOM    258  NH1 ARG A  33      26.356 -35.438  -1.319  1.00  0.43           N  
ATOM    259  NH2 ARG A  33      27.469 -33.661  -2.243  1.00  0.43           N  
ATOM    260  N   GLY A  34      33.494 -37.563  -3.066  1.00  0.59           N  
ATOM    261  CA  GLY A  34      34.911 -37.650  -3.209  1.00  0.59           C  
ATOM    262  C   GLY A  34      35.662 -36.412  -2.915  1.00  0.59           C  
ATOM    263  O   GLY A  34      35.470 -35.352  -3.503  1.00  0.59           O  
ATOM    264  N   ARG A  35      36.593 -36.575  -1.983  1.00  0.55           N  
ATOM    265  CA  ARG A  35      37.465 -35.543  -1.537  1.00  0.55           C  
ATOM    266  C   ARG A  35      38.684 -35.647  -2.422  1.00  0.55           C  
ATOM    267  O   ARG A  35      38.684 -36.363  -3.424  1.00  0.55           O  
ATOM    268  CB  ARG A  35      37.726 -35.774  -0.027  1.00  0.55           C  
ATOM    269  CG  ARG A  35      36.385 -35.831   0.745  1.00  0.55           C  
ATOM    270  CD  ARG A  35      36.498 -36.150   2.236  1.00  0.55           C  
ATOM    271  NE  ARG A  35      35.105 -36.075   2.806  1.00  0.55           N  
ATOM    272  CZ  ARG A  35      34.489 -34.936   3.155  1.00  0.55           C  
ATOM    273  NH1 ARG A  35      35.088 -33.755   3.040  1.00  0.55           N  
ATOM    274  NH2 ARG A  35      33.247 -34.979   3.634  1.00  0.55           N  
ATOM    275  N   HIS A  36      39.751 -34.915  -2.123  1.00  0.64           N  
ATOM    276  CA  HIS A  36      40.930 -34.979  -2.947  1.00  0.64           C  
ATOM    277  C   HIS A  36      42.058 -35.493  -2.108  1.00  0.64           C  
ATOM    278  O   HIS A  36      42.228 -35.096  -0.957  1.00  0.64           O  
ATOM    279  CB  HIS A  36      41.321 -33.603  -3.497  1.00  0.64           C  
ATOM    280  CG  HIS A  36      40.291 -32.987  -4.389  1.00  0.64           C  
ATOM    281  ND1 HIS A  36      39.168 -32.394  -3.846  1.00  0.64           N  
ATOM    282  CD2 HIS A  36      40.276 -32.869  -5.741  1.00  0.64           C  
ATOM    283  CE1 HIS A  36      38.491 -31.927  -4.872  1.00  0.64           C  
ATOM    284  NE2 HIS A  36      39.118 -32.187  -6.046  1.00  0.64           N  
ATOM    285  N   VAL A  37      42.880 -36.393  -2.670  1.00  0.75           N  
ATOM    286  CA  VAL A  37      44.103 -36.788  -2.006  1.00  0.75           C  
ATOM    287  C   VAL A  37      45.148 -35.739  -2.328  1.00  0.75           C  
ATOM    288  O   VAL A  37      45.290 -35.296  -3.469  1.00  0.75           O  
ATOM    289  CB  VAL A  37      44.592 -38.177  -2.385  1.00  0.75           C  
ATOM    290  CG1 VAL A  37      45.818 -38.562  -1.533  1.00  0.75           C  
ATOM    291  CG2 VAL A  37      43.470 -39.192  -2.116  1.00  0.75           C  
ATOM    292  N   VAL A  38      45.878 -35.274  -1.301  1.00  0.78           N  
ATOM    293  CA  VAL A  38      46.953 -34.323  -1.473  1.00  0.78           C  
ATOM    294  C   VAL A  38      48.234 -35.117  -1.572  1.00  0.78           C  
ATOM    295  O   VAL A  38      48.756 -35.625  -0.582  1.00  0.78           O  
ATOM    296  CB  VAL A  38      47.037 -33.325  -0.326  1.00  0.78           C  
ATOM    297  CG1 VAL A  38      48.173 -32.315  -0.588  1.00  0.78           C  
ATOM    298  CG2 VAL A  38      45.685 -32.595  -0.201  1.00  0.78           C  
ATOM    299  N   LEU A  39      48.758 -35.263  -2.797  1.00  0.73           N  
ATOM    300  CA  LEU A  39      49.904 -36.102  -3.057  1.00  0.73           C  
ATOM    301  C   LEU A  39      51.181 -35.300  -2.884  1.00  0.73           C  
ATOM    302  O   LEU A  39      51.428 -34.324  -3.597  1.00  0.73           O  
ATOM    303  CB  LEU A  39      49.843 -36.659  -4.496  1.00  0.73           C  
ATOM    304  CG  LEU A  39      48.538 -37.378  -4.878  1.00  0.73           C  
ATOM    305  CD1 LEU A  39      48.577 -37.786  -6.355  1.00  0.73           C  
ATOM    306  CD2 LEU A  39      48.307 -38.620  -4.013  1.00  0.73           C  
ATOM    307  N   ALA A  40      52.023 -35.672  -1.905  1.00  0.72           N  
ATOM    308  CA  ALA A  40      53.213 -34.925  -1.555  1.00  0.72           C  
ATOM    309  C   ALA A  40      54.333 -35.049  -2.583  1.00  0.72           C  
ATOM    310  O   ALA A  40      54.759 -36.139  -2.957  1.00  0.72           O  
ATOM    311  CB  ALA A  40      53.719 -35.335  -0.159  1.00  0.72           C  
ATOM    312  N   LYS A  41      54.848 -33.910  -3.083  1.00  0.63           N  
ATOM    313  CA  LYS A  41      55.901 -33.902  -4.075  1.00  0.63           C  
ATOM    314  C   LYS A  41      57.055 -33.078  -3.550  1.00  0.63           C  
ATOM    315  O   LYS A  41      56.858 -32.022  -2.961  1.00  0.63           O  
ATOM    316  CB  LYS A  41      55.428 -33.316  -5.435  1.00  0.63           C  
ATOM    317  CG  LYS A  41      54.154 -33.963  -6.014  1.00  0.63           C  
ATOM    318  CD  LYS A  41      54.246 -35.480  -6.263  1.00  0.63           C  
ATOM    319  CE  LYS A  41      52.859 -36.103  -6.454  1.00  0.63           C  
ATOM    320  NZ  LYS A  41      52.907 -37.566  -6.310  1.00  0.63           N  
ATOM    321  N   ALA A  42      58.303 -33.541  -3.760  1.00  0.49           N  
ATOM    322  CA  ALA A  42      59.485 -32.773  -3.411  1.00  0.49           C  
ATOM    323  C   ALA A  42      60.016 -32.027  -4.630  1.00  0.49           C  
ATOM    324  O   ALA A  42      60.985 -31.276  -4.566  1.00  0.49           O  
ATOM    325  CB  ALA A  42      60.572 -33.743  -2.908  1.00  0.49           C  
ATOM    326  N   PHE A  43      59.354 -32.221  -5.786  1.00  0.51           N  
ATOM    327  CA  PHE A  43      59.784 -31.707  -7.075  1.00  0.51           C  
ATOM    328  C   PHE A  43      59.193 -30.330  -7.349  1.00  0.51           C  
ATOM    329  O   PHE A  43      59.569 -29.643  -8.296  1.00  0.51           O  
ATOM    330  CB  PHE A  43      59.305 -32.650  -8.225  1.00  0.51           C  
ATOM    331  CG  PHE A  43      59.327 -34.105  -7.825  1.00  0.51           C  
ATOM    332  CD1 PHE A  43      60.523 -34.740  -7.453  1.00  0.51           C  
ATOM    333  CD2 PHE A  43      58.127 -34.837  -7.779  1.00  0.51           C  
ATOM    334  CE1 PHE A  43      60.518 -36.073  -7.021  1.00  0.51           C  
ATOM    335  CE2 PHE A  43      58.117 -36.169  -7.348  1.00  0.51           C  
ATOM    336  CZ  PHE A  43      59.314 -36.786  -6.965  1.00  0.51           C  
ATOM    337  N   GLY A  44      58.222 -29.908  -6.521  1.00  0.58           N  
ATOM    338  CA  GLY A  44      57.490 -28.674  -6.712  1.00  0.58           C  
ATOM    339  C   GLY A  44      56.400 -28.632  -5.688  1.00  0.58           C  
ATOM    340  O   GLY A  44      56.573 -29.111  -4.572  1.00  0.58           O  
ATOM    341  N   GLY A  45      55.224 -28.071  -6.030  1.00  0.69           N  
ATOM    342  CA  GLY A  45      54.061 -28.136  -5.148  1.00  0.69           C  
ATOM    343  C   GLY A  45      53.478 -29.533  -4.988  1.00  0.69           C  
ATOM    344  O   GLY A  45      53.584 -30.339  -5.914  1.00  0.69           O  
ATOM    345  N   PRO A  46      52.821 -29.878  -3.879  1.00  0.72           N  
ATOM    346  CA  PRO A  46      51.978 -31.066  -3.800  1.00  0.72           C  
ATOM    347  C   PRO A  46      50.779 -30.978  -4.733  1.00  0.72           C  
ATOM    348  O   PRO A  46      50.301 -29.886  -5.036  1.00  0.72           O  
ATOM    349  CB  PRO A  46      51.548 -31.110  -2.325  1.00  0.72           C  
ATOM    350  CG  PRO A  46      51.535 -29.640  -1.900  1.00  0.72           C  
ATOM    351  CD  PRO A  46      52.715 -29.050  -2.675  1.00  0.72           C  
ATOM    352  N   THR A  47      50.278 -32.127  -5.215  1.00  0.75           N  
ATOM    353  CA  THR A  47      49.234 -32.160  -6.233  1.00  0.75           C  
ATOM    354  C   THR A  47      47.941 -32.688  -5.661  1.00  0.75           C  
ATOM    355  O   THR A  47      47.888 -33.764  -5.071  1.00  0.75           O  
ATOM    356  CB  THR A  47      49.564 -33.009  -7.459  1.00  0.75           C  
ATOM    357  OG1 THR A  47      49.982 -34.325  -7.111  1.00  0.75           O  
ATOM    358  CG2 THR A  47      50.716 -32.373  -8.236  1.00  0.75           C  
ATOM    359  N   VAL A  48      46.846 -31.936  -5.851  1.00  0.77           N  
ATOM    360  CA  VAL A  48      45.525 -32.254  -5.344  1.00  0.77           C  
ATOM    361  C   VAL A  48      44.738 -32.981  -6.424  1.00  0.77           C  
ATOM    362  O   VAL A  48      44.455 -32.413  -7.478  1.00  0.77           O  
ATOM    363  CB  VAL A  48      44.821 -30.950  -4.973  1.00  0.77           C  
ATOM    364  CG1 VAL A  48      43.403 -31.203  -4.443  1.00  0.77           C  
ATOM    365  CG2 VAL A  48      45.646 -30.213  -3.898  1.00  0.77           C  
ATOM    366  N   THR A  49      44.377 -34.270  -6.226  1.00  0.74           N  
ATOM    367  CA  THR A  49      43.773 -35.059  -7.305  1.00  0.74           C  
ATOM    368  C   THR A  49      42.564 -35.863  -6.859  1.00  0.74           C  
ATOM    369  O   THR A  49      42.395 -36.209  -5.692  1.00  0.74           O  
ATOM    370  CB  THR A  49      44.740 -36.037  -7.990  1.00  0.74           C  
ATOM    371  OG1 THR A  49      45.270 -36.996  -7.090  1.00  0.74           O  
ATOM    372  CG2 THR A  49      45.939 -35.284  -8.583  1.00  0.74           C  
ATOM    373  N   ASN A  50      41.667 -36.189  -7.823  1.00  0.65           N  
ATOM    374  CA  ASN A  50      40.655 -37.222  -7.638  1.00  0.65           C  
ATOM    375  C   ASN A  50      40.986 -38.453  -8.466  1.00  0.65           C  
ATOM    376  O   ASN A  50      40.410 -39.513  -8.253  1.00  0.65           O  
ATOM    377  CB  ASN A  50      39.249 -36.778  -8.116  1.00  0.65           C  
ATOM    378  CG  ASN A  50      38.832 -35.455  -7.500  1.00  0.65           C  
ATOM    379  OD1 ASN A  50      38.754 -34.454  -8.221  1.00  0.65           O  
ATOM    380  ND2 ASN A  50      38.524 -35.431  -6.186  1.00  0.65           N  
ATOM    381  N   ASP A  51      41.932 -38.344  -9.429  1.00  0.61           N  
ATOM    382  CA  ASP A  51      42.414 -39.459 -10.218  1.00  0.61           C  
ATOM    383  C   ASP A  51      43.200 -40.409  -9.331  1.00  0.61           C  
ATOM    384  O   ASP A  51      44.327 -40.136  -8.915  1.00  0.61           O  
ATOM    385  CB  ASP A  51      43.265 -38.954 -11.419  1.00  0.61           C  
ATOM    386  CG  ASP A  51      43.838 -40.075 -12.285  1.00  0.61           C  
ATOM    387  OD1 ASP A  51      43.603 -41.272 -11.976  1.00  0.61           O  
ATOM    388  OD2 ASP A  51      44.596 -39.729 -13.220  1.00  0.61           O  
ATOM    389  N   GLY A  52      42.620 -41.583  -9.053  1.00  0.65           N  
ATOM    390  CA  GLY A  52      43.248 -42.577  -8.213  1.00  0.65           C  
ATOM    391  C   GLY A  52      44.324 -43.378  -8.882  1.00  0.65           C  
ATOM    392  O   GLY A  52      44.973 -44.158  -8.195  1.00  0.65           O  
ATOM    393  N   VAL A  53      44.617 -43.202 -10.199  1.00  0.65           N  
ATOM    394  CA  VAL A  53      45.888 -43.697 -10.731  1.00  0.65           C  
ATOM    395  C   VAL A  53      47.033 -42.898 -10.158  1.00  0.65           C  
ATOM    396  O   VAL A  53      48.055 -43.440  -9.751  1.00  0.65           O  
ATOM    397  CB  VAL A  53      46.025 -43.796 -12.258  1.00  0.65           C  
ATOM    398  CG1 VAL A  53      46.618 -42.551 -12.956  1.00  0.65           C  
ATOM    399  CG2 VAL A  53      46.872 -45.052 -12.558  1.00  0.65           C  
ATOM    400  N   THR A  54      46.875 -41.562 -10.057  1.00  0.69           N  
ATOM    401  CA  THR A  54      47.882 -40.680  -9.478  1.00  0.69           C  
ATOM    402  C   THR A  54      48.120 -40.977  -8.014  1.00  0.69           C  
ATOM    403  O   THR A  54      49.263 -41.042  -7.565  1.00  0.69           O  
ATOM    404  CB  THR A  54      47.634 -39.187  -9.694  1.00  0.69           C  
ATOM    405  OG1 THR A  54      46.525 -38.670  -8.971  1.00  0.69           O  
ATOM    406  CG2 THR A  54      47.377 -38.912 -11.178  1.00  0.69           C  
ATOM    407  N   VAL A  55      47.026 -41.230  -7.262  1.00  0.75           N  
ATOM    408  CA  VAL A  55      47.070 -41.685  -5.884  1.00  0.75           C  
ATOM    409  C   VAL A  55      47.698 -43.065  -5.735  1.00  0.75           C  
ATOM    410  O   VAL A  55      48.584 -43.276  -4.911  1.00  0.75           O  
ATOM    411  CB  VAL A  55      45.678 -41.714  -5.258  1.00  0.75           C  
ATOM    412  CG1 VAL A  55      45.809 -41.962  -3.748  1.00  0.75           C  
ATOM    413  CG2 VAL A  55      44.934 -40.385  -5.494  1.00  0.75           C  
ATOM    414  N   ALA A  56      47.294 -44.050  -6.567  1.00  0.76           N  
ATOM    415  CA  ALA A  56      47.849 -45.388  -6.535  1.00  0.76           C  
ATOM    416  C   ALA A  56      49.330 -45.433  -6.871  1.00  0.76           C  
ATOM    417  O   ALA A  56      50.096 -46.102  -6.186  1.00  0.76           O  
ATOM    418  CB  ALA A  56      47.078 -46.319  -7.495  1.00  0.76           C  
ATOM    419  N   ARG A  57      49.777 -44.684  -7.907  1.00  0.64           N  
ATOM    420  CA  ARG A  57      51.143 -44.695  -8.406  1.00  0.64           C  
ATOM    421  C   ARG A  57      52.200 -44.339  -7.350  1.00  0.64           C  
ATOM    422  O   ARG A  57      53.262 -44.963  -7.320  1.00  0.64           O  
ATOM    423  CB  ARG A  57      51.315 -43.830  -9.699  1.00  0.64           C  
ATOM    424  CG  ARG A  57      50.740 -44.469 -11.001  1.00  0.64           C  
ATOM    425  CD  ARG A  57      50.809 -43.552 -12.246  1.00  0.64           C  
ATOM    426  NE  ARG A  57      49.876 -44.025 -13.349  1.00  0.64           N  
ATOM    427  CZ  ARG A  57      50.162 -44.895 -14.332  1.00  0.64           C  
ATOM    428  NH1 ARG A  57      51.265 -45.629 -14.300  1.00  0.64           N  
ATOM    429  NH2 ARG A  57      49.319 -45.064 -15.357  1.00  0.64           N  
ATOM    430  N   GLU A  58      51.942 -43.367  -6.441  1.00  0.69           N  
ATOM    431  CA  GLU A  58      52.939 -42.959  -5.456  1.00  0.69           C  
ATOM    432  C   GLU A  58      53.051 -43.823  -4.207  1.00  0.69           C  
ATOM    433  O   GLU A  58      54.026 -43.722  -3.470  1.00  0.69           O  
ATOM    434  CB  GLU A  58      52.782 -41.476  -5.030  1.00  0.69           C  
ATOM    435  CG  GLU A  58      51.686 -41.128  -3.985  1.00  0.69           C  
ATOM    436  CD  GLU A  58      51.812 -39.676  -3.524  1.00  0.69           C  
ATOM    437  OE1 GLU A  58      52.564 -38.910  -4.187  1.00  0.69           O  
ATOM    438  OE2 GLU A  58      51.149 -39.289  -2.534  1.00  0.69           O  
ATOM    439  N   ILE A  59      52.080 -44.712  -3.918  1.00  0.74           N  
ATOM    440  CA  ILE A  59      52.119 -45.514  -2.699  1.00  0.74           C  
ATOM    441  C   ILE A  59      53.215 -46.572  -2.689  1.00  0.74           C  
ATOM    442  O   ILE A  59      53.287 -47.435  -3.565  1.00  0.74           O  
ATOM    443  CB  ILE A  59      50.761 -46.132  -2.392  1.00  0.74           C  
ATOM    444  CG1 ILE A  59      49.709 -45.036  -2.112  1.00  0.74           C  
ATOM    445  CG2 ILE A  59      50.807 -47.141  -1.221  1.00  0.74           C  
ATOM    446  CD1 ILE A  59      49.989 -44.160  -0.879  1.00  0.74           C  
ATOM    447  N   GLU A  60      54.076 -46.498  -1.658  1.00  0.72           N  
ATOM    448  CA  GLU A  60      55.219 -47.341  -1.393  1.00  0.72           C  
ATOM    449  C   GLU A  60      55.283 -47.423   0.126  1.00  0.72           C  
ATOM    450  O   GLU A  60      54.933 -46.458   0.811  1.00  0.72           O  
ATOM    451  CB  GLU A  60      56.484 -46.671  -1.978  1.00  0.72           C  
ATOM    452  CG  GLU A  60      57.821 -47.421  -1.765  1.00  0.72           C  
ATOM    453  CD  GLU A  60      58.988 -46.710  -2.457  1.00  0.72           C  
ATOM    454  OE1 GLU A  60      58.731 -45.805  -3.294  1.00  0.72           O  
ATOM    455  OE2 GLU A  60      60.155 -47.066  -2.148  1.00  0.72           O  
ATOM    456  N   LEU A  61      55.614 -48.594   0.706  1.00  0.73           N  
ATOM    457  CA  LEU A  61      55.461 -48.832   2.135  1.00  0.73           C  
ATOM    458  C   LEU A  61      56.761 -49.232   2.818  1.00  0.73           C  
ATOM    459  O   LEU A  61      57.635 -49.882   2.258  1.00  0.73           O  
ATOM    460  CB  LEU A  61      54.388 -49.903   2.463  1.00  0.73           C  
ATOM    461  CG  LEU A  61      52.926 -49.465   2.230  1.00  0.73           C  
ATOM    462  CD1 LEU A  61      52.494 -49.512   0.765  1.00  0.73           C  
ATOM    463  CD2 LEU A  61      51.991 -50.394   2.997  1.00  0.73           C  
ATOM    464  N   GLU A  62      56.915 -48.818   4.096  1.00  0.71           N  
ATOM    465  CA  GLU A  62      58.086 -49.104   4.907  1.00  0.71           C  
ATOM    466  C   GLU A  62      58.303 -50.580   5.237  1.00  0.71           C  
ATOM    467  O   GLU A  62      59.419 -51.089   5.137  1.00  0.71           O  
ATOM    468  CB  GLU A  62      58.022 -48.263   6.200  1.00  0.71           C  
ATOM    469  CG  GLU A  62      59.325 -48.275   7.035  1.00  0.71           C  
ATOM    470  CD  GLU A  62      59.247 -47.343   8.243  1.00  0.71           C  
ATOM    471  OE1 GLU A  62      58.188 -46.691   8.432  1.00  0.71           O  
ATOM    472  OE2 GLU A  62      60.263 -47.280   8.981  1.00  0.71           O  
ATOM    473  N   ASP A  63      57.238 -51.332   5.609  1.00  0.75           N  
ATOM    474  CA  ASP A  63      57.327 -52.778   5.702  1.00  0.75           C  
ATOM    475  C   ASP A  63      57.462 -53.409   4.298  1.00  0.75           C  
ATOM    476  O   ASP A  63      56.632 -53.121   3.430  1.00  0.75           O  
ATOM    477  CB  ASP A  63      56.130 -53.404   6.464  1.00  0.75           C  
ATOM    478  CG  ASP A  63      56.330 -54.910   6.555  1.00  0.75           C  
ATOM    479  OD1 ASP A  63      55.629 -55.640   5.809  1.00  0.75           O  
ATOM    480  OD2 ASP A  63      57.276 -55.335   7.261  1.00  0.75           O  
ATOM    481  N   PRO A  64      58.433 -54.283   4.021  1.00  0.74           N  
ATOM    482  CA  PRO A  64      58.562 -54.927   2.722  1.00  0.74           C  
ATOM    483  C   PRO A  64      57.392 -55.813   2.337  1.00  0.74           C  
ATOM    484  O   PRO A  64      57.065 -55.882   1.156  1.00  0.74           O  
ATOM    485  CB  PRO A  64      59.863 -55.745   2.842  1.00  0.74           C  
ATOM    486  CG  PRO A  64      60.682 -54.986   3.887  1.00  0.74           C  
ATOM    487  CD  PRO A  64      59.611 -54.508   4.863  1.00  0.74           C  
ATOM    488  N   PHE A  65      56.755 -56.533   3.280  1.00  0.73           N  
ATOM    489  CA  PHE A  65      55.662 -57.438   2.967  1.00  0.73           C  
ATOM    490  C   PHE A  65      54.373 -56.685   2.680  1.00  0.73           C  
ATOM    491  O   PHE A  65      53.647 -57.011   1.736  1.00  0.73           O  
ATOM    492  CB  PHE A  65      55.437 -58.475   4.091  1.00  0.73           C  
ATOM    493  CG  PHE A  65      56.631 -59.375   4.225  1.00  0.73           C  
ATOM    494  CD1 PHE A  65      56.872 -60.379   3.272  1.00  0.73           C  
ATOM    495  CD2 PHE A  65      57.510 -59.240   5.312  1.00  0.73           C  
ATOM    496  CE1 PHE A  65      57.969 -61.241   3.406  1.00  0.73           C  
ATOM    497  CE2 PHE A  65      58.605 -60.103   5.452  1.00  0.73           C  
ATOM    498  CZ  PHE A  65      58.832 -61.105   4.499  1.00  0.73           C  
ATOM    499  N   GLU A  66      54.089 -55.614   3.453  1.00  0.71           N  
ATOM    500  CA  GLU A  66      53.031 -54.669   3.134  1.00  0.71           C  
ATOM    501  C   GLU A  66      53.256 -53.979   1.786  1.00  0.71           C  
ATOM    502  O   GLU A  66      52.325 -53.809   0.997  1.00  0.71           O  
ATOM    503  CB  GLU A  66      52.804 -53.576   4.211  1.00  0.71           C  
ATOM    504  CG  GLU A  66      52.366 -54.051   5.619  1.00  0.71           C  
ATOM    505  CD  GLU A  66      51.900 -52.895   6.517  1.00  0.71           C  
ATOM    506  OE1 GLU A  66      51.768 -51.737   6.031  1.00  0.71           O  
ATOM    507  OE2 GLU A  66      51.624 -53.171   7.712  1.00  0.71           O  
ATOM    508  N   ASP A  67      54.510 -53.602   1.446  1.00  0.74           N  
ATOM    509  CA  ASP A  67      54.827 -53.029   0.150  1.00  0.74           C  
ATOM    510  C   ASP A  67      54.487 -53.951  -1.022  1.00  0.74           C  
ATOM    511  O   ASP A  67      53.840 -53.528  -1.978  1.00  0.74           O  
ATOM    512  CB  ASP A  67      56.308 -52.584   0.088  1.00  0.74           C  
ATOM    513  CG  ASP A  67      56.493 -51.705  -1.134  1.00  0.74           C  
ATOM    514  OD1 ASP A  67      55.865 -50.614  -1.150  1.00  0.74           O  
ATOM    515  OD2 ASP A  67      57.182 -52.151  -2.083  1.00  0.74           O  
ATOM    516  N   LEU A  68      54.812 -55.263  -0.953  1.00  0.73           N  
ATOM    517  CA  LEU A  68      54.438 -56.207  -2.001  1.00  0.73           C  
ATOM    518  C   LEU A  68      52.929 -56.279  -2.223  1.00  0.73           C  
ATOM    519  O   LEU A  68      52.453 -56.269  -3.359  1.00  0.73           O  
ATOM    520  CB  LEU A  68      54.957 -57.644  -1.738  1.00  0.73           C  
ATOM    521  CG  LEU A  68      56.485 -57.786  -1.576  1.00  0.73           C  
ATOM    522  CD1 LEU A  68      56.869 -59.265  -1.424  1.00  0.73           C  
ATOM    523  CD2 LEU A  68      57.288 -57.135  -2.714  1.00  0.73           C  
ATOM    524  N   GLY A  69      52.140 -56.286  -1.124  1.00  0.74           N  
ATOM    525  CA  GLY A  69      50.687 -56.107  -1.149  1.00  0.74           C  
ATOM    526  C   GLY A  69      50.191 -54.915  -1.934  1.00  0.74           C  
ATOM    527  O   GLY A  69      49.294 -55.030  -2.763  1.00  0.74           O  
ATOM    528  N   ALA A  70      50.766 -53.726  -1.692  1.00  0.77           N  
ATOM    529  CA  ALA A  70      50.466 -52.527  -2.447  1.00  0.77           C  
ATOM    530  C   ALA A  70      50.961 -52.529  -3.894  1.00  0.77           C  
ATOM    531  O   ALA A  70      50.240 -52.157  -4.821  1.00  0.77           O  
ATOM    532  CB  ALA A  70      51.074 -51.324  -1.712  1.00  0.77           C  
ATOM    533  N   GLN A  71      52.210 -52.974  -4.130  1.00  0.70           N  
ATOM    534  CA  GLN A  71      52.878 -52.992  -5.421  1.00  0.70           C  
ATOM    535  C   GLN A  71      52.158 -53.817  -6.476  1.00  0.70           C  
ATOM    536  O   GLN A  71      52.011 -53.382  -7.615  1.00  0.70           O  
ATOM    537  CB  GLN A  71      54.326 -53.524  -5.260  1.00  0.70           C  
ATOM    538  CG  GLN A  71      55.336 -52.479  -4.713  1.00  0.70           C  
ATOM    539  CD  GLN A  71      55.795 -51.470  -5.762  1.00  0.70           C  
ATOM    540  OE1 GLN A  71      55.624 -50.255  -5.663  1.00  0.70           O  
ATOM    541  NE2 GLN A  71      56.388 -51.983  -6.866  1.00  0.70           N  
ATOM    542  N   LEU A  72      51.649 -55.014  -6.124  1.00  0.71           N  
ATOM    543  CA  LEU A  72      50.862 -55.836  -7.035  1.00  0.71           C  
ATOM    544  C   LEU A  72      49.546 -55.178  -7.461  1.00  0.71           C  
ATOM    545  O   LEU A  72      49.104 -55.289  -8.602  1.00  0.71           O  
ATOM    546  CB  LEU A  72      50.594 -57.241  -6.432  1.00  0.71           C  
ATOM    547  CG  LEU A  72      51.696 -58.288  -6.728  1.00  0.71           C  
ATOM    548  CD1 LEU A  72      53.040 -58.003  -6.041  1.00  0.71           C  
ATOM    549  CD2 LEU A  72      51.215 -59.692  -6.334  1.00  0.71           C  
ATOM    550  N   VAL A  73      48.879 -54.460  -6.544  1.00  0.71           N  
ATOM    551  CA  VAL A  73      47.581 -53.842  -6.782  1.00  0.71           C  
ATOM    552  C   VAL A  73      47.713 -52.514  -7.516  1.00  0.71           C  
ATOM    553  O   VAL A  73      46.845 -52.081  -8.272  1.00  0.71           O  
ATOM    554  CB  VAL A  73      46.874 -53.665  -5.454  1.00  0.71           C  
ATOM    555  CG1 VAL A  73      45.432 -53.157  -5.644  1.00  0.71           C  
ATOM    556  CG2 VAL A  73      46.831 -55.037  -4.764  1.00  0.71           C  
ATOM    557  N   LYS A  74      48.883 -51.866  -7.399  1.00  0.68           N  
ATOM    558  CA  LYS A  74      49.266 -50.717  -8.197  1.00  0.68           C  
ATOM    559  C   LYS A  74      49.297 -51.031  -9.696  1.00  0.68           C  
ATOM    560  O   LYS A  74      48.922 -50.210 -10.537  1.00  0.68           O  
ATOM    561  CB  LYS A  74      50.621 -50.195  -7.667  1.00  0.68           C  
ATOM    562  CG  LYS A  74      51.186 -48.960  -8.381  1.00  0.68           C  
ATOM    563  CD  LYS A  74      52.145 -48.151  -7.487  1.00  0.68           C  
ATOM    564  CE  LYS A  74      53.349 -48.898  -6.925  1.00  0.68           C  
ATOM    565  NZ  LYS A  74      54.147 -48.025  -6.030  1.00  0.68           N  
ATOM    566  N   SER A  75      49.694 -52.267 -10.064  1.00  0.70           N  
ATOM    567  CA  SER A  75      49.607 -52.795 -11.422  1.00  0.70           C  
ATOM    568  C   SER A  75      48.203 -52.870 -11.986  1.00  0.70           C  
ATOM    569  O   SER A  75      47.985 -52.522 -13.145  1.00  0.70           O  
ATOM    570  CB  SER A  75      50.167 -54.233 -11.540  1.00  0.70           C  
ATOM    571  OG  SER A  75      51.515 -54.274 -11.081  1.00  0.70           O  
ATOM    572  N   VAL A  76      47.197 -53.325 -11.202  1.00  0.59           N  
ATOM    573  CA  VAL A  76      45.824 -53.413 -11.698  1.00  0.59           C  
ATOM    574  C   VAL A  76      45.204 -52.046 -11.977  1.00  0.59           C  
ATOM    575  O   VAL A  76      44.575 -51.845 -13.014  1.00  0.59           O  
ATOM    576  CB  VAL A  76      44.917 -54.352 -10.894  1.00  0.59           C  
ATOM    577  CG1 VAL A  76      44.370 -53.741  -9.590  1.00  0.59           C  
ATOM    578  CG2 VAL A  76      43.762 -54.812 -11.803  1.00  0.59           C  
ATOM    579  N   ALA A  77      45.441 -51.048 -11.092  1.00  0.62           N  
ATOM    580  CA  ALA A  77      45.050 -49.665 -11.299  1.00  0.62           C  
ATOM    581  C   ALA A  77      45.717 -49.021 -12.504  1.00  0.62           C  
ATOM    582  O   ALA A  77      45.107 -48.279 -13.275  1.00  0.62           O  
ATOM    583  CB  ALA A  77      45.397 -48.835 -10.047  1.00  0.62           C  
ATOM    584  N   THR A  78      47.018 -49.306 -12.695  1.00  0.66           N  
ATOM    585  CA  THR A  78      47.777 -48.851 -13.854  1.00  0.66           C  
ATOM    586  C   THR A  78      47.228 -49.422 -15.147  1.00  0.66           C  
ATOM    587  O   THR A  78      46.903 -48.684 -16.067  1.00  0.66           O  
ATOM    588  CB  THR A  78      49.257 -49.205 -13.733  1.00  0.66           C  
ATOM    589  OG1 THR A  78      49.832 -48.550 -12.605  1.00  0.66           O  
ATOM    590  CG2 THR A  78      50.054 -48.759 -14.962  1.00  0.66           C  
ATOM    591  N   LYS A  79      47.000 -50.746 -15.227  1.00  0.58           N  
ATOM    592  CA  LYS A  79      46.581 -51.390 -16.461  1.00  0.58           C  
ATOM    593  C   LYS A  79      45.232 -50.938 -17.015  1.00  0.58           C  
ATOM    594  O   LYS A  79      45.056 -50.767 -18.221  1.00  0.58           O  
ATOM    595  CB  LYS A  79      46.593 -52.927 -16.293  1.00  0.58           C  
ATOM    596  CG  LYS A  79      46.434 -53.672 -17.628  1.00  0.58           C  
ATOM    597  CD  LYS A  79      46.675 -55.182 -17.501  1.00  0.58           C  
ATOM    598  CE  LYS A  79      46.647 -55.879 -18.863  1.00  0.58           C  
ATOM    599  NZ  LYS A  79      46.949 -57.319 -18.709  1.00  0.58           N  
ATOM    600  N   THR A  80      44.221 -50.716 -16.155  1.00  0.55           N  
ATOM    601  CA  THR A  80      42.954 -50.130 -16.586  1.00  0.55           C  
ATOM    602  C   THR A  80      43.080 -48.686 -17.050  1.00  0.55           C  
ATOM    603  O   THR A  80      42.433 -48.291 -18.019  1.00  0.55           O  
ATOM    604  CB  THR A  80      41.847 -50.235 -15.557  1.00  0.55           C  
ATOM    605  OG1 THR A  80      42.322 -49.906 -14.266  1.00  0.55           O  
ATOM    606  CG2 THR A  80      41.346 -51.681 -15.466  1.00  0.55           C  
ATOM    607  N   ASN A  81      43.953 -47.869 -16.412  1.00  0.53           N  
ATOM    608  CA  ASN A  81      44.295 -46.525 -16.869  1.00  0.53           C  
ATOM    609  C   ASN A  81      44.912 -46.538 -18.264  1.00  0.53           C  
ATOM    610  O   ASN A  81      44.493 -45.780 -19.135  1.00  0.53           O  
ATOM    611  CB  ASN A  81      45.296 -45.883 -15.860  1.00  0.53           C  
ATOM    612  CG  ASN A  81      45.646 -44.410 -16.077  1.00  0.53           C  
ATOM    613  OD1 ASN A  81      46.827 -44.049 -16.033  1.00  0.53           O  
ATOM    614  ND2 ASN A  81      44.631 -43.534 -16.236  1.00  0.53           N  
ATOM    615  N   ASP A  82      45.873 -47.447 -18.506  1.00  0.61           N  
ATOM    616  CA  ASP A  82      46.538 -47.627 -19.777  1.00  0.61           C  
ATOM    617  C   ASP A  82      45.586 -48.054 -20.910  1.00  0.61           C  
ATOM    618  O   ASP A  82      45.641 -47.525 -22.019  1.00  0.61           O  
ATOM    619  CB  ASP A  82      47.659 -48.692 -19.618  1.00  0.61           C  
ATOM    620  CG  ASP A  82      48.701 -48.383 -18.540  1.00  0.61           C  
ATOM    621  OD1 ASP A  82      48.819 -47.229 -18.044  1.00  0.61           O  
ATOM    622  OD2 ASP A  82      49.411 -49.364 -18.193  1.00  0.61           O  
ATOM    623  N   VAL A  83      44.674 -49.023 -20.661  1.00  0.56           N  
ATOM    624  CA  VAL A  83      43.728 -49.500 -21.672  1.00  0.56           C  
ATOM    625  C   VAL A  83      42.542 -48.576 -21.921  1.00  0.56           C  
ATOM    626  O   VAL A  83      42.190 -48.303 -23.066  1.00  0.56           O  
ATOM    627  CB  VAL A  83      43.196 -50.900 -21.333  1.00  0.56           C  
ATOM    628  CG1 VAL A  83      42.125 -51.379 -22.342  1.00  0.56           C  
ATOM    629  CG2 VAL A  83      44.375 -51.891 -21.348  1.00  0.56           C  
ATOM    630  N   ALA A  84      41.862 -48.090 -20.863  1.00  0.56           N  
ATOM    631  CA  ALA A  84      40.569 -47.453 -21.037  1.00  0.56           C  
ATOM    632  C   ALA A  84      40.580 -45.965 -20.738  1.00  0.56           C  
ATOM    633  O   ALA A  84      39.613 -45.265 -21.022  1.00  0.56           O  
ATOM    634  CB  ALA A  84      39.566 -48.150 -20.091  1.00  0.56           C  
ATOM    635  N   GLY A  85      41.667 -45.436 -20.139  1.00  0.56           N  
ATOM    636  CA  GLY A  85      41.802 -44.025 -19.768  1.00  0.56           C  
ATOM    637  C   GLY A  85      41.034 -43.631 -18.528  1.00  0.56           C  
ATOM    638  O   GLY A  85      41.173 -42.522 -18.026  1.00  0.56           O  
ATOM    639  N   ASP A  86      40.253 -44.572 -17.984  1.00  0.49           N  
ATOM    640  CA  ASP A  86      39.341 -44.406 -16.881  1.00  0.49           C  
ATOM    641  C   ASP A  86      39.112 -45.835 -16.389  1.00  0.49           C  
ATOM    642  O   ASP A  86      39.645 -46.785 -16.963  1.00  0.49           O  
ATOM    643  CB  ASP A  86      38.034 -43.674 -17.323  1.00  0.49           C  
ATOM    644  CG  ASP A  86      37.253 -43.119 -16.141  1.00  0.49           C  
ATOM    645  OD1 ASP A  86      37.688 -43.413 -14.996  1.00  0.49           O  
ATOM    646  OD2 ASP A  86      36.215 -42.435 -16.348  1.00  0.49           O  
ATOM    647  N   GLY A  87      38.384 -46.053 -15.276  1.00  0.55           N  
ATOM    648  CA  GLY A  87      38.266 -47.381 -14.672  1.00  0.55           C  
ATOM    649  C   GLY A  87      39.493 -47.738 -13.883  1.00  0.55           C  
ATOM    650  O   GLY A  87      39.799 -48.900 -13.621  1.00  0.55           O  
ATOM    651  N   THR A  88      40.298 -46.723 -13.534  1.00  0.52           N  
ATOM    652  CA  THR A  88      41.591 -46.935 -12.904  1.00  0.52           C  
ATOM    653  C   THR A  88      41.531 -47.261 -11.425  1.00  0.52           C  
ATOM    654  O   THR A  88      42.043 -48.286 -10.986  1.00  0.52           O  
ATOM    655  CB  THR A  88      42.586 -45.837 -13.228  1.00  0.52           C  
ATOM    656  OG1 THR A  88      43.825 -46.060 -12.575  1.00  0.52           O  
ATOM    657  CG2 THR A  88      42.094 -44.438 -12.842  1.00  0.52           C  
ATOM    658  N   THR A  89      40.846 -46.458 -10.595  1.00  0.54           N  
ATOM    659  CA  THR A  89      40.852 -46.659  -9.143  1.00  0.54           C  
ATOM    660  C   THR A  89      39.949 -47.832  -8.766  1.00  0.54           C  
ATOM    661  O   THR A  89      40.077 -48.501  -7.743  1.00  0.54           O  
ATOM    662  CB  THR A  89      40.569 -45.347  -8.384  1.00  0.54           C  
ATOM    663  OG1 THR A  89      39.398 -45.335  -7.587  1.00  0.54           O  
ATOM    664  CG2 THR A  89      40.432 -44.167  -9.359  1.00  0.54           C  
ATOM    665  N   THR A  90      39.057 -48.163  -9.701  1.00  0.51           N  
ATOM    666  CA  THR A  90      38.122 -49.257  -9.734  1.00  0.51           C  
ATOM    667  C   THR A  90      38.725 -50.594  -9.468  1.00  0.51           C  
ATOM    668  O   THR A  90      38.249 -51.366  -8.639  1.00  0.51           O  
ATOM    669  CB  THR A  90      37.616 -49.340 -11.152  1.00  0.51           C  
ATOM    670  OG1 THR A  90      36.892 -48.181 -11.527  1.00  0.51           O  
ATOM    671  CG2 THR A  90      36.814 -50.599 -11.452  1.00  0.51           C  
ATOM    672  N   ALA A  91      39.805 -50.935 -10.183  1.00  0.60           N  
ATOM    673  CA  ALA A  91      40.274 -52.295 -10.182  1.00  0.60           C  
ATOM    674  C   ALA A  91      41.027 -52.603  -8.899  1.00  0.60           C  
ATOM    675  O   ALA A  91      41.060 -53.741  -8.441  1.00  0.60           O  
ATOM    676  CB  ALA A  91      41.076 -52.541 -11.463  1.00  0.60           C  
ATOM    677  N   THR A  92      41.527 -51.547  -8.223  1.00  0.64           N  
ATOM    678  CA  THR A  92      41.981 -51.579  -6.837  1.00  0.64           C  
ATOM    679  C   THR A  92      40.884 -51.975  -5.873  1.00  0.64           C  
ATOM    680  O   THR A  92      41.066 -52.853  -5.033  1.00  0.64           O  
ATOM    681  CB  THR A  92      42.456 -50.210  -6.360  1.00  0.64           C  
ATOM    682  OG1 THR A  92      43.513 -49.746  -7.177  1.00  0.64           O  
ATOM    683  CG2 THR A  92      42.984 -50.243  -4.923  1.00  0.64           C  
ATOM    684  N   ILE A  93      39.686 -51.355  -5.968  1.00  0.54           N  
ATOM    685  CA  ILE A  93      38.576 -51.678  -5.081  1.00  0.54           C  
ATOM    686  C   ILE A  93      37.937 -53.033  -5.372  1.00  0.54           C  
ATOM    687  O   ILE A  93      37.539 -53.731  -4.441  1.00  0.54           O  
ATOM    688  CB  ILE A  93      37.552 -50.562  -4.868  1.00  0.54           C  
ATOM    689  CG1 ILE A  93      36.780 -50.145  -6.131  1.00  0.54           C  
ATOM    690  CG2 ILE A  93      38.281 -49.340  -4.268  1.00  0.54           C  
ATOM    691  CD1 ILE A  93      35.433 -49.486  -5.803  1.00  0.54           C  
ATOM    692  N   LEU A  94      37.869 -53.488  -6.650  1.00  0.54           N  
ATOM    693  CA  LEU A  94      37.530 -54.880  -6.946  1.00  0.54           C  
ATOM    694  C   LEU A  94      38.558 -55.857  -6.412  1.00  0.54           C  
ATOM    695  O   LEU A  94      38.193 -56.852  -5.797  1.00  0.54           O  
ATOM    696  CB  LEU A  94      37.402 -55.233  -8.450  1.00  0.54           C  
ATOM    697  CG  LEU A  94      36.068 -54.864  -9.110  1.00  0.54           C  
ATOM    698  CD1 LEU A  94      36.062 -53.420  -9.586  1.00  0.54           C  
ATOM    699  CD2 LEU A  94      35.829 -55.792 -10.304  1.00  0.54           C  
ATOM    700  N   ALA A  95      39.869 -55.593  -6.608  1.00  0.69           N  
ATOM    701  CA  ALA A  95      40.939 -56.437  -6.113  1.00  0.69           C  
ATOM    702  C   ALA A  95      40.919 -56.555  -4.600  1.00  0.69           C  
ATOM    703  O   ALA A  95      41.054 -57.643  -4.055  1.00  0.69           O  
ATOM    704  CB  ALA A  95      42.305 -55.905  -6.588  1.00  0.69           C  
ATOM    705  N   GLN A  96      40.671 -55.437  -3.894  1.00  0.57           N  
ATOM    706  CA  GLN A  96      40.421 -55.411  -2.466  1.00  0.57           C  
ATOM    707  C   GLN A  96      39.194 -56.216  -2.039  1.00  0.57           C  
ATOM    708  O   GLN A  96      39.274 -57.048  -1.142  1.00  0.57           O  
ATOM    709  CB  GLN A  96      40.291 -53.927  -2.040  1.00  0.57           C  
ATOM    710  CG  GLN A  96      39.780 -53.644  -0.608  1.00  0.57           C  
ATOM    711  CD  GLN A  96      40.538 -54.369   0.510  1.00  0.57           C  
ATOM    712  OE1 GLN A  96      39.914 -55.148   1.233  1.00  0.57           O  
ATOM    713  NE2 GLN A  96      41.837 -54.073   0.692  1.00  0.57           N  
ATOM    714  N   ALA A  97      38.028 -56.061  -2.699  1.00  0.58           N  
ATOM    715  CA  ALA A  97      36.852 -56.853  -2.373  1.00  0.58           C  
ATOM    716  C   ALA A  97      37.045 -58.350  -2.603  1.00  0.58           C  
ATOM    717  O   ALA A  97      36.724 -59.182  -1.755  1.00  0.58           O  
ATOM    718  CB  ALA A  97      35.662 -56.354  -3.213  1.00  0.58           C  
ATOM    719  N   LEU A  98      37.641 -58.694  -3.755  1.00  0.61           N  
ATOM    720  CA  LEU A  98      37.989 -60.035  -4.164  1.00  0.61           C  
ATOM    721  C   LEU A  98      39.032 -60.686  -3.269  1.00  0.61           C  
ATOM    722  O   LEU A  98      38.876 -61.831  -2.852  1.00  0.61           O  
ATOM    723  CB  LEU A  98      38.471 -59.939  -5.634  1.00  0.61           C  
ATOM    724  CG  LEU A  98      38.712 -61.246  -6.411  1.00  0.61           C  
ATOM    725  CD1 LEU A  98      40.055 -61.913  -6.074  1.00  0.61           C  
ATOM    726  CD2 LEU A  98      37.531 -62.215  -6.273  1.00  0.61           C  
ATOM    727  N   ILE A  99      40.123 -59.972  -2.898  1.00  0.67           N  
ATOM    728  CA  ILE A  99      41.126 -60.498  -1.979  1.00  0.67           C  
ATOM    729  C   ILE A  99      40.547 -60.727  -0.597  1.00  0.67           C  
ATOM    730  O   ILE A  99      40.757 -61.770   0.008  1.00  0.67           O  
ATOM    731  CB  ILE A  99      42.433 -59.682  -1.938  1.00  0.67           C  
ATOM    732  CG1 ILE A  99      43.678 -60.562  -1.686  1.00  0.67           C  
ATOM    733  CG2 ILE A  99      42.403 -58.549  -0.884  1.00  0.67           C  
ATOM    734  CD1 ILE A  99      44.019 -61.537  -2.818  1.00  0.67           C  
ATOM    735  N   LYS A 100      39.734 -59.790  -0.081  1.00  0.62           N  
ATOM    736  CA  LYS A 100      39.185 -59.863   1.253  1.00  0.62           C  
ATOM    737  C   LYS A 100      38.125 -60.953   1.407  1.00  0.62           C  
ATOM    738  O   LYS A 100      37.926 -61.528   2.481  1.00  0.62           O  
ATOM    739  CB  LYS A 100      38.627 -58.471   1.592  1.00  0.62           C  
ATOM    740  CG  LYS A 100      38.307 -58.281   3.072  1.00  0.62           C  
ATOM    741  CD  LYS A 100      37.944 -56.817   3.361  1.00  0.62           C  
ATOM    742  CE  LYS A 100      37.648 -56.529   4.825  1.00  0.62           C  
ATOM    743  NZ  LYS A 100      36.581 -57.457   5.244  1.00  0.62           N  
ATOM    744  N   GLY A 101      37.428 -61.300   0.302  1.00  0.63           N  
ATOM    745  CA  GLY A 101      36.670 -62.545   0.213  1.00  0.63           C  
ATOM    746  C   GLY A 101      37.564 -63.757   0.095  1.00  0.63           C  
ATOM    747  O   GLY A 101      37.492 -64.681   0.901  1.00  0.63           O  
ATOM    748  N   GLY A 102      38.473 -63.764  -0.898  1.00  0.69           N  
ATOM    749  CA  GLY A 102      39.443 -64.823  -1.173  1.00  0.69           C  
ATOM    750  C   GLY A 102      40.277 -65.299  -0.011  1.00  0.69           C  
ATOM    751  O   GLY A 102      40.376 -66.495   0.247  1.00  0.69           O  
ATOM    752  N   LEU A 103      40.906 -64.376   0.739  1.00  0.72           N  
ATOM    753  CA  LEU A 103      41.717 -64.678   1.906  1.00  0.72           C  
ATOM    754  C   LEU A 103      40.913 -65.309   3.032  1.00  0.72           C  
ATOM    755  O   LEU A 103      41.371 -66.230   3.706  1.00  0.72           O  
ATOM    756  CB  LEU A 103      42.508 -63.455   2.426  1.00  0.72           C  
ATOM    757  CG  LEU A 103      43.481 -62.840   1.397  1.00  0.72           C  
ATOM    758  CD1 LEU A 103      44.154 -61.599   1.991  1.00  0.72           C  
ATOM    759  CD2 LEU A 103      44.551 -63.795   0.853  1.00  0.72           C  
ATOM    760  N   ARG A 104      39.655 -64.870   3.226  1.00  0.60           N  
ATOM    761  CA  ARG A 104      38.725 -65.524   4.125  1.00  0.60           C  
ATOM    762  C   ARG A 104      38.391 -66.958   3.704  1.00  0.60           C  
ATOM    763  O   ARG A 104      38.354 -67.870   4.527  1.00  0.60           O  
ATOM    764  CB  ARG A 104      37.433 -64.678   4.251  1.00  0.60           C  
ATOM    765  CG  ARG A 104      36.428 -65.214   5.291  1.00  0.60           C  
ATOM    766  CD  ARG A 104      35.145 -64.387   5.414  1.00  0.60           C  
ATOM    767  NE  ARG A 104      35.531 -63.096   6.069  1.00  0.60           N  
ATOM    768  CZ  ARG A 104      34.658 -62.260   6.646  1.00  0.60           C  
ATOM    769  NH1 ARG A 104      33.348 -62.390   6.462  1.00  0.60           N  
ATOM    770  NH2 ARG A 104      35.106 -61.289   7.440  1.00  0.60           N  
ATOM    771  N   LEU A 105      38.167 -67.209   2.399  1.00  0.62           N  
ATOM    772  CA  LEU A 105      37.959 -68.552   1.876  1.00  0.62           C  
ATOM    773  C   LEU A 105      39.189 -69.468   1.978  1.00  0.62           C  
ATOM    774  O   LEU A 105      39.054 -70.639   2.330  1.00  0.62           O  
ATOM    775  CB  LEU A 105      37.362 -68.548   0.443  1.00  0.62           C  
ATOM    776  CG  LEU A 105      35.824 -68.357   0.383  1.00  0.62           C  
ATOM    777  CD1 LEU A 105      35.358 -66.928   0.687  1.00  0.62           C  
ATOM    778  CD2 LEU A 105      35.278 -68.762  -0.994  1.00  0.62           C  
ATOM    779  N   VAL A 106      40.431 -68.988   1.721  1.00  0.69           N  
ATOM    780  CA  VAL A 106      41.634 -69.797   1.972  1.00  0.69           C  
ATOM    781  C   VAL A 106      41.861 -70.092   3.452  1.00  0.69           C  
ATOM    782  O   VAL A 106      42.328 -71.167   3.818  1.00  0.69           O  
ATOM    783  CB  VAL A 106      42.943 -69.313   1.334  1.00  0.69           C  
ATOM    784  CG1 VAL A 106      42.714 -69.006  -0.152  1.00  0.69           C  
ATOM    785  CG2 VAL A 106      43.550 -68.094   2.046  1.00  0.69           C  
ATOM    786  N   ALA A 107      41.503 -69.151   4.357  1.00  0.73           N  
ATOM    787  CA  ALA A 107      41.500 -69.349   5.797  1.00  0.73           C  
ATOM    788  C   ALA A 107      40.510 -70.420   6.257  1.00  0.73           C  
ATOM    789  O   ALA A 107      40.740 -71.132   7.230  1.00  0.73           O  
ATOM    790  CB  ALA A 107      41.211 -68.013   6.506  1.00  0.73           C  
ATOM    791  N   ALA A 108      39.395 -70.588   5.520  1.00  0.70           N  
ATOM    792  CA  ALA A 108      38.430 -71.650   5.722  1.00  0.70           C  
ATOM    793  C   ALA A 108      38.914 -73.012   5.217  1.00  0.70           C  
ATOM    794  O   ALA A 108      38.283 -74.039   5.463  1.00  0.70           O  
ATOM    795  CB  ALA A 108      37.108 -71.274   5.022  1.00  0.70           C  
ATOM    796  N   GLY A 109      40.054 -73.054   4.495  1.00  0.67           N  
ATOM    797  CA  GLY A 109      40.683 -74.286   4.034  1.00  0.67           C  
ATOM    798  C   GLY A 109      40.410 -74.613   2.596  1.00  0.67           C  
ATOM    799  O   GLY A 109      40.830 -75.653   2.096  1.00  0.67           O  
ATOM    800  N   VAL A 110      39.699 -73.736   1.864  1.00  0.64           N  
ATOM    801  CA  VAL A 110      39.492 -73.905   0.435  1.00  0.64           C  
ATOM    802  C   VAL A 110      40.797 -73.752  -0.347  1.00  0.64           C  
ATOM    803  O   VAL A 110      41.603 -72.859  -0.091  1.00  0.64           O  
ATOM    804  CB  VAL A 110      38.416 -72.978  -0.128  1.00  0.64           C  
ATOM    805  CG1 VAL A 110      38.047 -73.388  -1.570  1.00  0.64           C  
ATOM    806  CG2 VAL A 110      37.158 -73.048   0.762  1.00  0.64           C  
ATOM    807  N   ASN A 111      41.045 -74.636  -1.340  1.00  0.62           N  
ATOM    808  CA  ASN A 111      42.212 -74.584  -2.206  1.00  0.62           C  
ATOM    809  C   ASN A 111      42.300 -73.245  -2.972  1.00  0.62           C  
ATOM    810  O   ASN A 111      41.361 -72.936  -3.709  1.00  0.62           O  
ATOM    811  CB  ASN A 111      42.156 -75.806  -3.177  1.00  0.62           C  
ATOM    812  CG  ASN A 111      43.360 -75.937  -4.111  1.00  0.62           C  
ATOM    813  OD1 ASN A 111      44.231 -75.075  -4.208  1.00  0.62           O  
ATOM    814  ND2 ASN A 111      43.401 -77.053  -4.872  1.00  0.62           N  
ATOM    815  N   PRO A 112      43.374 -72.442  -2.891  1.00  0.68           N  
ATOM    816  CA  PRO A 112      43.491 -71.176  -3.610  1.00  0.68           C  
ATOM    817  C   PRO A 112      43.422 -71.328  -5.115  1.00  0.68           C  
ATOM    818  O   PRO A 112      42.943 -70.424  -5.793  1.00  0.68           O  
ATOM    819  CB  PRO A 112      44.851 -70.603  -3.172  1.00  0.68           C  
ATOM    820  CG  PRO A 112      45.125 -71.251  -1.813  1.00  0.68           C  
ATOM    821  CD  PRO A 112      44.465 -72.623  -1.930  1.00  0.68           C  
ATOM    822  N   ILE A 113      43.901 -72.460  -5.665  1.00  0.61           N  
ATOM    823  CA  ILE A 113      43.814 -72.773  -7.083  1.00  0.61           C  
ATOM    824  C   ILE A 113      42.369 -72.991  -7.512  1.00  0.61           C  
ATOM    825  O   ILE A 113      41.926 -72.517  -8.553  1.00  0.61           O  
ATOM    826  CB  ILE A 113      44.667 -73.985  -7.449  1.00  0.61           C  
ATOM    827  CG1 ILE A 113      46.109 -73.883  -6.882  1.00  0.61           C  
ATOM    828  CG2 ILE A 113      44.687 -74.170  -8.984  1.00  0.61           C  
ATOM    829  CD1 ILE A 113      46.906 -72.651  -7.336  1.00  0.61           C  
ATOM    830  N   ALA A 114      41.566 -73.684  -6.676  1.00  0.67           N  
ATOM    831  CA  ALA A 114      40.135 -73.838  -6.872  1.00  0.67           C  
ATOM    832  C   ALA A 114      39.377 -72.523  -6.730  1.00  0.67           C  
ATOM    833  O   ALA A 114      38.439 -72.241  -7.468  1.00  0.67           O  
ATOM    834  CB  ALA A 114      39.557 -74.896  -5.915  1.00  0.67           C  
ATOM    835  N   LEU A 115      39.787 -71.640  -5.799  1.00  0.59           N  
ATOM    836  CA  LEU A 115      39.282 -70.278  -5.787  1.00  0.59           C  
ATOM    837  C   LEU A 115      39.644 -69.514  -7.047  1.00  0.59           C  
ATOM    838  O   LEU A 115      38.786 -68.883  -7.643  1.00  0.59           O  
ATOM    839  CB  LEU A 115      39.755 -69.477  -4.557  1.00  0.59           C  
ATOM    840  CG  LEU A 115      39.302 -70.068  -3.212  1.00  0.59           C  
ATOM    841  CD1 LEU A 115      39.850 -69.208  -2.072  1.00  0.59           C  
ATOM    842  CD2 LEU A 115      37.775 -70.173  -3.106  1.00  0.59           C  
ATOM    843  N   GLY A 116      40.893 -69.608  -7.551  1.00  0.61           N  
ATOM    844  CA  GLY A 116      41.276 -69.023  -8.837  1.00  0.61           C  
ATOM    845  C   GLY A 116      40.543 -69.578 -10.037  1.00  0.61           C  
ATOM    846  O   GLY A 116      40.238 -68.843 -10.975  1.00  0.61           O  
ATOM    847  N   VAL A 117      40.182 -70.879 -10.015  1.00  0.59           N  
ATOM    848  CA  VAL A 117      39.339 -71.502 -11.028  1.00  0.59           C  
ATOM    849  C   VAL A 117      37.896 -71.031 -10.933  1.00  0.59           C  
ATOM    850  O   VAL A 117      37.174 -71.000 -11.922  1.00  0.59           O  
ATOM    851  CB  VAL A 117      39.471 -73.033 -11.068  1.00  0.59           C  
ATOM    852  CG1 VAL A 117      38.290 -73.800 -10.433  1.00  0.59           C  
ATOM    853  CG2 VAL A 117      39.619 -73.474 -12.536  1.00  0.59           C  
ATOM    854  N   GLY A 118      37.439 -70.577  -9.747  1.00  0.59           N  
ATOM    855  CA  GLY A 118      36.213 -69.799  -9.631  1.00  0.59           C  
ATOM    856  C   GLY A 118      36.390 -68.374 -10.103  1.00  0.59           C  
ATOM    857  O   GLY A 118      35.634 -67.876 -10.924  1.00  0.59           O  
ATOM    858  N   ILE A 119      37.428 -67.659  -9.651  1.00  0.55           N  
ATOM    859  CA  ILE A 119      37.650 -66.244  -9.938  1.00  0.55           C  
ATOM    860  C   ILE A 119      37.840 -65.966 -11.416  1.00  0.55           C  
ATOM    861  O   ILE A 119      37.253 -65.040 -11.971  1.00  0.55           O  
ATOM    862  CB  ILE A 119      38.751 -65.651  -9.074  1.00  0.55           C  
ATOM    863  CG1 ILE A 119      38.343 -65.760  -7.582  1.00  0.55           C  
ATOM    864  CG2 ILE A 119      38.986 -64.169  -9.454  1.00  0.55           C  
ATOM    865  CD1 ILE A 119      39.522 -65.630  -6.612  1.00  0.55           C  
ATOM    866  N   GLY A 120      38.578 -66.825 -12.144  1.00  0.55           N  
ATOM    867  CA  GLY A 120      38.654 -66.705 -13.595  1.00  0.55           C  
ATOM    868  C   GLY A 120      37.418 -67.190 -14.310  1.00  0.55           C  
ATOM    869  O   GLY A 120      37.267 -66.958 -15.498  1.00  0.55           O  
ATOM    870  N   LYS A 121      36.475 -67.835 -13.602  1.00  0.41           N  
ATOM    871  CA  LYS A 121      35.218 -68.330 -14.131  1.00  0.41           C  
ATOM    872  C   LYS A 121      34.106 -67.338 -13.777  1.00  0.41           C  
ATOM    873  O   LYS A 121      32.981 -67.456 -14.262  1.00  0.41           O  
ATOM    874  CB  LYS A 121      34.979 -69.747 -13.540  1.00  0.41           C  
ATOM    875  CG  LYS A 121      33.662 -70.500 -13.797  1.00  0.41           C  
ATOM    876  CD  LYS A 121      33.523 -71.169 -15.170  1.00  0.41           C  
ATOM    877  CE  LYS A 121      32.169 -70.899 -15.838  1.00  0.41           C  
ATOM    878  NZ  LYS A 121      31.991 -69.456 -16.048  1.00  0.41           N  
ATOM    879  N   ALA A 122      34.426 -66.276 -12.993  1.00  0.53           N  
ATOM    880  CA  ALA A 122      33.635 -65.062 -12.826  1.00  0.53           C  
ATOM    881  C   ALA A 122      34.189 -63.912 -13.618  1.00  0.53           C  
ATOM    882  O   ALA A 122      33.455 -63.077 -14.127  1.00  0.53           O  
ATOM    883  CB  ALA A 122      33.685 -64.528 -11.399  1.00  0.53           C  
ATOM    884  N   ALA A 123      35.513 -63.877 -13.815  1.00  0.49           N  
ATOM    885  CA  ALA A 123      36.116 -63.040 -14.810  1.00  0.49           C  
ATOM    886  C   ALA A 123      35.848 -63.638 -16.172  1.00  0.49           C  
ATOM    887  O   ALA A 123      35.919 -62.920 -17.159  1.00  0.49           O  
ATOM    888  CB  ALA A 123      37.616 -62.885 -14.528  1.00  0.49           C  
ATOM    889  N   ASP A 124      35.438 -64.936 -16.236  1.00  0.36           N  
ATOM    890  CA  ASP A 124      34.566 -65.424 -17.285  1.00  0.36           C  
ATOM    891  C   ASP A 124      33.084 -65.146 -17.084  1.00  0.36           C  
ATOM    892  O   ASP A 124      32.500 -64.547 -17.952  1.00  0.36           O  
ATOM    893  CB  ASP A 124      34.911 -66.820 -17.883  1.00  0.36           C  
ATOM    894  CG  ASP A 124      33.891 -67.929 -17.763  1.00  0.36           C  
ATOM    895  OD1 ASP A 124      32.716 -67.789 -18.169  1.00  0.36           O  
ATOM    896  OD2 ASP A 124      34.259 -69.009 -17.262  1.00  0.36           O  
ATOM    897  N   ALA A 125      32.329 -65.482 -16.025  1.00  0.34           N  
ATOM    898  CA  ALA A 125      30.887 -65.301 -16.202  1.00  0.34           C  
ATOM    899  C   ALA A 125      30.380 -63.847 -16.134  1.00  0.34           C  
ATOM    900  O   ALA A 125      29.328 -63.532 -16.670  1.00  0.34           O  
ATOM    901  CB  ALA A 125      30.071 -66.260 -15.326  1.00  0.34           C  
ATOM    902  N   VAL A 126      31.176 -62.892 -15.610  1.00  0.33           N  
ATOM    903  CA  VAL A 126      31.009 -61.440 -15.766  1.00  0.33           C  
ATOM    904  C   VAL A 126      31.924 -60.978 -16.889  1.00  0.33           C  
ATOM    905  O   VAL A 126      32.469 -59.877 -16.998  1.00  0.33           O  
ATOM    906  CB  VAL A 126      31.196 -60.698 -14.466  1.00  0.33           C  
ATOM    907  CG1 VAL A 126      30.787 -59.216 -14.592  1.00  0.33           C  
ATOM    908  CG2 VAL A 126      30.291 -61.397 -13.444  1.00  0.33           C  
ATOM    909  N   SER A 127      32.034 -61.925 -17.795  1.00  0.24           N  
ATOM    910  CA  SER A 127      32.338 -61.867 -19.189  1.00  0.24           C  
ATOM    911  C   SER A 127      31.436 -62.837 -19.943  1.00  0.24           C  
ATOM    912  O   SER A 127      31.649 -62.992 -21.150  1.00  0.24           O  
ATOM    913  CB  SER A 127      33.831 -61.713 -19.502  1.00  0.24           C  
ATOM    914  OG  SER A 127      34.575 -62.914 -19.352  1.00  0.24           O  
ATOM    915  N   GLU A 128      30.304 -63.331 -19.381  1.00  0.27           N  
ATOM    916  CA  GLU A 128      29.156 -63.840 -20.134  1.00  0.27           C  
ATOM    917  C   GLU A 128      27.705 -63.391 -19.532  1.00  0.27           C  
ATOM    918  O   GLU A 128      26.889 -64.262 -19.139  1.00  0.27           O  
ATOM    919  CB  GLU A 128      29.376 -65.340 -20.300  1.00  0.27           C  
ATOM    920  CG  GLU A 128      29.465 -65.972 -21.745  1.00  0.27           C  
ATOM    921  CD  GLU A 128      29.984 -65.378 -23.094  1.00  0.27           C  
ATOM    922  OE1 GLU A 128      29.229 -65.581 -24.070  1.00  0.27           O  
ATOM    923  OE2 GLU A 128      31.129 -64.885 -23.233  1.00  0.27           O  
ATOM    924  N   ALA A 129      27.377 -62.064 -19.445  1.00  0.27           N  
ATOM    925  CA  ALA A 129      26.112 -61.228 -19.379  1.00  0.27           C  
ATOM    926  C   ALA A 129      26.124 -59.671 -18.960  1.00  0.27           C  
ATOM    927  O   ALA A 129      25.355 -59.326 -18.051  1.00  0.27           O  
ATOM    928  CB  ALA A 129      24.982 -61.865 -18.521  1.00  0.27           C  
ATOM    929  N   LEU A 130      26.878 -58.662 -19.503  1.00  0.25           N  
ATOM    930  CA  LEU A 130      26.685 -57.143 -19.423  1.00  0.25           C  
ATOM    931  C   LEU A 130      26.830 -56.452 -20.750  1.00  0.25           C  
ATOM    932  O   LEU A 130      26.017 -55.606 -21.118  1.00  0.25           O  
ATOM    933  CB  LEU A 130      27.739 -56.244 -18.643  1.00  0.25           C  
ATOM    934  CG  LEU A 130      27.975 -54.693 -18.878  1.00  0.25           C  
ATOM    935  CD1 LEU A 130      27.378 -53.811 -17.794  1.00  0.25           C  
ATOM    936  CD2 LEU A 130      29.471 -54.297 -18.955  1.00  0.25           C  
ATOM    937  N   LEU A 131      27.925 -56.684 -21.536  1.00  0.24           N  
ATOM    938  CA  LEU A 131      27.774 -56.749 -23.037  1.00  0.24           C  
ATOM    939  C   LEU A 131      27.207 -58.417 -23.076  1.00  0.24           C  
ATOM    940  O   LEU A 131      27.602 -58.999 -22.182  1.00  0.24           O  
ATOM    941  CB  LEU A 131      28.213 -55.379 -23.999  1.00  0.24           C  
ATOM    942  CG  LEU A 131      29.043 -54.805 -25.319  1.00  0.24           C  
ATOM    943  CD1 LEU A 131      29.241 -55.478 -26.711  1.00  0.24           C  
ATOM    944  CD2 LEU A 131      28.586 -53.387 -25.858  1.00  0.24           C  
ATOM    945  N   ALA A 132      26.301 -59.317 -23.914  1.00  0.23           N  
ATOM    946  CA  ALA A 132      24.908 -59.587 -24.689  1.00  0.23           C  
ATOM    947  C   ALA A 132      23.674 -58.854 -25.591  1.00  0.23           C  
ATOM    948  O   ALA A 132      23.173 -59.625 -26.402  1.00  0.23           O  
ATOM    949  CB  ALA A 132      23.893 -60.534 -23.934  1.00  0.23           C  
ATOM    950  N   SER A 133      23.042 -57.545 -25.702  1.00  0.21           N  
ATOM    951  CA  SER A 133      22.340 -56.490 -24.786  1.00  0.21           C  
ATOM    952  C   SER A 133      22.907 -55.032 -24.532  1.00  0.21           C  
ATOM    953  O   SER A 133      22.545 -54.360 -23.568  1.00  0.21           O  
ATOM    954  CB  SER A 133      20.798 -56.179 -24.769  1.00  0.21           C  
ATOM    955  OG  SER A 133      20.387 -55.655 -23.485  1.00  0.21           O  
ATOM    956  N   ALA A 134      23.820 -54.397 -25.267  1.00  0.25           N  
ATOM    957  CA  ALA A 134      24.483 -53.176 -24.841  1.00  0.25           C  
ATOM    958  C   ALA A 134      24.933 -52.490 -26.074  1.00  0.25           C  
ATOM    959  O   ALA A 134      25.126 -53.122 -27.111  1.00  0.25           O  
ATOM    960  CB  ALA A 134      25.610 -53.264 -23.791  1.00  0.25           C  
ATOM    961  N   THR A 135      24.989 -51.168 -26.071  1.00  0.30           N  
ATOM    962  CA  THR A 135      24.746 -50.527 -27.345  1.00  0.30           C  
ATOM    963  C   THR A 135      26.030 -50.203 -28.091  1.00  0.30           C  
ATOM    964  O   THR A 135      27.042 -49.905 -27.459  1.00  0.30           O  
ATOM    965  CB  THR A 135      23.792 -49.361 -27.209  1.00  0.30           C  
ATOM    966  OG1 THR A 135      23.277 -48.985 -28.466  1.00  0.30           O  
ATOM    967  CG2 THR A 135      24.458 -48.201 -26.470  1.00  0.30           C  
ATOM    968  N   PRO A 136      26.074 -50.255 -29.426  1.00  0.24           N  
ATOM    969  CA  PRO A 136      26.744 -49.229 -30.215  1.00  0.24           C  
ATOM    970  C   PRO A 136      26.157 -47.884 -29.876  1.00  0.24           C  
ATOM    971  O   PRO A 136      24.967 -47.682 -30.051  1.00  0.24           O  
ATOM    972  CB  PRO A 136      26.414 -49.587 -31.679  1.00  0.24           C  
ATOM    973  CG  PRO A 136      25.785 -50.983 -31.612  1.00  0.24           C  
ATOM    974  CD  PRO A 136      25.117 -50.983 -30.248  1.00  0.24           C  
ATOM    975  N   VAL A 137      26.925 -46.930 -29.401  1.00  0.26           N  
ATOM    976  CA  VAL A 137      26.395 -45.718 -28.843  1.00  0.26           C  
ATOM    977  C   VAL A 137      26.615 -44.726 -30.075  1.00  0.26           C  
ATOM    978  O   VAL A 137      27.444 -45.016 -30.928  1.00  0.26           O  
ATOM    979  CB  VAL A 137      27.119 -45.625 -27.437  1.00  0.26           C  
ATOM    980  CG1 VAL A 137      26.316 -45.147 -26.206  1.00  0.26           C  
ATOM    981  CG2 VAL A 137      27.777 -46.935 -26.933  1.00  0.26           C  
ATOM    982  N   SER A 138      25.879 -43.591 -30.334  1.00  0.32           N  
ATOM    983  CA  SER A 138      26.281 -42.575 -31.383  1.00  0.32           C  
ATOM    984  C   SER A 138      26.036 -41.046 -31.139  1.00  0.32           C  
ATOM    985  O   SER A 138      26.674 -40.453 -30.300  1.00  0.32           O  
ATOM    986  CB  SER A 138      26.063 -42.963 -32.851  1.00  0.32           C  
ATOM    987  OG  SER A 138      24.681 -42.902 -33.242  1.00  0.32           O  
ATOM    988  N   GLY A 139      25.121 -40.307 -31.802  1.00  0.29           N  
ATOM    989  CA  GLY A 139      24.707 -38.891 -31.539  1.00  0.29           C  
ATOM    990  C   GLY A 139      24.492 -38.273 -30.121  1.00  0.29           C  
ATOM    991  O   GLY A 139      24.427 -38.962 -29.113  1.00  0.29           O  
ATOM    992  N   LYS A 140      24.348 -36.919 -30.008  1.00  0.35           N  
ATOM    993  CA  LYS A 140      24.748 -36.067 -28.863  1.00  0.35           C  
ATOM    994  C   LYS A 140      24.273 -36.196 -27.391  1.00  0.35           C  
ATOM    995  O   LYS A 140      25.041 -35.871 -26.491  1.00  0.35           O  
ATOM    996  CB  LYS A 140      24.766 -34.553 -29.227  1.00  0.35           C  
ATOM    997  CG  LYS A 140      23.448 -33.759 -29.116  1.00  0.35           C  
ATOM    998  CD  LYS A 140      23.725 -32.238 -29.087  1.00  0.35           C  
ATOM    999  CE  LYS A 140      22.502 -31.386 -28.721  1.00  0.35           C  
ATOM   1000  NZ  LYS A 140      22.895 -29.974 -28.481  1.00  0.35           N  
ATOM   1001  N   THR A 141      23.031 -36.589 -27.039  1.00  0.40           N  
ATOM   1002  CA  THR A 141      22.548 -36.422 -25.643  1.00  0.40           C  
ATOM   1003  C   THR A 141      23.271 -37.195 -24.518  1.00  0.40           C  
ATOM   1004  O   THR A 141      23.586 -36.643 -23.464  1.00  0.40           O  
ATOM   1005  CB  THR A 141      21.028 -36.594 -25.524  1.00  0.40           C  
ATOM   1006  OG1 THR A 141      20.546 -36.357 -24.207  1.00  0.40           O  
ATOM   1007  CG2 THR A 141      20.576 -37.998 -25.947  1.00  0.40           C  
ATOM   1008  N   GLY A 142      23.603 -38.492 -24.700  1.00  0.50           N  
ATOM   1009  CA  GLY A 142      24.202 -39.313 -23.636  1.00  0.50           C  
ATOM   1010  C   GLY A 142      25.676 -39.102 -23.443  1.00  0.50           C  
ATOM   1011  O   GLY A 142      26.308 -39.673 -22.563  1.00  0.50           O  
ATOM   1012  N   ILE A 143      26.278 -38.268 -24.285  1.00  0.44           N  
ATOM   1013  CA  ILE A 143      27.692 -37.947 -24.260  1.00  0.44           C  
ATOM   1014  C   ILE A 143      28.081 -37.017 -23.189  1.00  0.44           C  
ATOM   1015  O   ILE A 143      29.075 -37.213 -22.491  1.00  0.44           O  
ATOM   1016  CB  ILE A 143      28.033 -37.358 -25.571  1.00  0.44           C  
ATOM   1017  CG1 ILE A 143      27.934 -38.558 -26.485  1.00  0.44           C  
ATOM   1018  CG2 ILE A 143      29.430 -36.710 -25.616  1.00  0.44           C  
ATOM   1019  CD1 ILE A 143      26.970 -38.285 -27.618  1.00  0.44           C  
ATOM   1020  N   ALA A 144      27.231 -36.005 -22.972  1.00  0.50           N  
ATOM   1021  CA  ALA A 144      27.332 -35.177 -21.811  1.00  0.50           C  
ATOM   1022  C   ALA A 144      27.217 -36.046 -20.569  1.00  0.50           C  
ATOM   1023  O   ALA A 144      28.028 -35.941 -19.668  1.00  0.50           O  
ATOM   1024  CB  ALA A 144      26.259 -34.079 -21.886  1.00  0.50           C  
ATOM   1025  N   GLN A 145      26.298 -37.028 -20.557  1.00  0.52           N  
ATOM   1026  CA  GLN A 145      26.181 -37.992 -19.478  1.00  0.52           C  
ATOM   1027  C   GLN A 145      27.413 -38.887 -19.241  1.00  0.52           C  
ATOM   1028  O   GLN A 145      27.851 -39.012 -18.101  1.00  0.52           O  
ATOM   1029  CB  GLN A 145      24.900 -38.840 -19.676  1.00  0.52           C  
ATOM   1030  CG  GLN A 145      23.628 -37.984 -19.918  1.00  0.52           C  
ATOM   1031  CD  GLN A 145      22.439 -38.855 -20.330  1.00  0.52           C  
ATOM   1032  OE1 GLN A 145      22.284 -39.997 -19.906  1.00  0.52           O  
ATOM   1033  NE2 GLN A 145      21.577 -38.313 -21.224  1.00  0.52           N  
ATOM   1034  N   VAL A 146      28.059 -39.499 -20.272  1.00  0.48           N  
ATOM   1035  CA  VAL A 146      29.317 -40.239 -20.063  1.00  0.48           C  
ATOM   1036  C   VAL A 146      30.476 -39.346 -19.635  1.00  0.48           C  
ATOM   1037  O   VAL A 146      31.299 -39.704 -18.794  1.00  0.48           O  
ATOM   1038  CB  VAL A 146      29.773 -41.188 -21.185  1.00  0.48           C  
ATOM   1039  CG1 VAL A 146      28.619 -42.129 -21.573  1.00  0.48           C  
ATOM   1040  CG2 VAL A 146      30.342 -40.477 -22.429  1.00  0.48           C  
ATOM   1041  N   ALA A 147      30.573 -38.134 -20.197  1.00  0.53           N  
ATOM   1042  CA  ALA A 147      31.566 -37.167 -19.808  1.00  0.53           C  
ATOM   1043  C   ALA A 147      31.386 -36.576 -18.411  1.00  0.53           C  
ATOM   1044  O   ALA A 147      32.347 -36.476 -17.647  1.00  0.53           O  
ATOM   1045  CB  ALA A 147      31.537 -36.052 -20.846  1.00  0.53           C  
ATOM   1046  N   THR A 148      30.146 -36.189 -18.021  1.00  0.52           N  
ATOM   1047  CA  THR A 148      29.848 -35.616 -16.707  1.00  0.52           C  
ATOM   1048  C   THR A 148      30.159 -36.575 -15.589  1.00  0.52           C  
ATOM   1049  O   THR A 148      30.767 -36.176 -14.605  1.00  0.52           O  
ATOM   1050  CB  THR A 148      28.432 -35.069 -16.445  1.00  0.52           C  
ATOM   1051  OG1 THR A 148      27.403 -36.031 -16.632  1.00  0.52           O  
ATOM   1052  CG2 THR A 148      28.094 -33.877 -17.350  1.00  0.52           C  
ATOM   1053  N   VAL A 149      29.820 -37.877 -15.731  1.00  0.50           N  
ATOM   1054  CA  VAL A 149      30.204 -38.887 -14.751  1.00  0.50           C  
ATOM   1055  C   VAL A 149      31.716 -39.045 -14.614  1.00  0.50           C  
ATOM   1056  O   VAL A 149      32.221 -39.220 -13.508  1.00  0.50           O  
ATOM   1057  CB  VAL A 149      29.546 -40.260 -14.947  1.00  0.50           C  
ATOM   1058  CG1 VAL A 149      28.015 -40.097 -14.933  1.00  0.50           C  
ATOM   1059  CG2 VAL A 149      29.976 -40.960 -16.246  1.00  0.50           C  
ATOM   1060  N   SER A 150      32.480 -38.974 -15.732  1.00  0.51           N  
ATOM   1061  CA  SER A 150      33.935 -39.155 -15.714  1.00  0.51           C  
ATOM   1062  C   SER A 150      34.699 -38.054 -14.983  1.00  0.51           C  
ATOM   1063  O   SER A 150      35.507 -38.328 -14.099  1.00  0.51           O  
ATOM   1064  CB  SER A 150      34.516 -39.322 -17.151  1.00  0.51           C  
ATOM   1065  OG  SER A 150      35.871 -39.804 -17.164  1.00  0.51           O  
ATOM   1066  N   SER A 151      34.424 -36.758 -15.259  1.00  0.54           N  
ATOM   1067  CA  SER A 151      35.198 -35.694 -14.606  1.00  0.54           C  
ATOM   1068  C   SER A 151      34.453 -35.035 -13.471  1.00  0.54           C  
ATOM   1069  O   SER A 151      35.010 -34.182 -12.781  1.00  0.54           O  
ATOM   1070  CB  SER A 151      35.562 -34.511 -15.531  1.00  0.54           C  
ATOM   1071  OG  SER A 151      36.280 -34.940 -16.685  1.00  0.54           O  
ATOM   1072  N   ARG A 152      33.178 -35.419 -13.257  1.00  0.47           N  
ATOM   1073  CA  ARG A 152      32.271 -34.906 -12.240  1.00  0.47           C  
ATOM   1074  C   ARG A 152      31.845 -33.444 -12.441  1.00  0.47           C  
ATOM   1075  O   ARG A 152      31.730 -32.699 -11.467  1.00  0.47           O  
ATOM   1076  CB  ARG A 152      32.855 -35.021 -10.808  1.00  0.47           C  
ATOM   1077  CG  ARG A 152      33.585 -36.323 -10.416  1.00  0.47           C  
ATOM   1078  CD  ARG A 152      34.373 -36.223  -9.093  1.00  0.47           C  
ATOM   1079  NE  ARG A 152      35.497 -35.222  -9.235  1.00  0.47           N  
ATOM   1080  CZ  ARG A 152      35.441 -33.919  -8.914  1.00  0.47           C  
ATOM   1081  NH1 ARG A 152      34.323 -33.332  -8.500  1.00  0.47           N  
ATOM   1082  NH2 ARG A 152      36.529 -33.168  -9.050  1.00  0.47           N  
ATOM   1083  N   ASP A 153      31.608 -32.995 -13.691  1.00  0.63           N  
ATOM   1084  CA  ASP A 153      31.318 -31.599 -13.979  1.00  0.63           C  
ATOM   1085  C   ASP A 153      30.414 -31.493 -15.206  1.00  0.63           C  
ATOM   1086  O   ASP A 153      30.583 -32.237 -16.170  1.00  0.63           O  
ATOM   1087  CB  ASP A 153      32.649 -30.830 -14.222  1.00  0.63           C  
ATOM   1088  CG  ASP A 153      32.364 -29.373 -14.521  1.00  0.63           C  
ATOM   1089  OD1 ASP A 153      31.721 -28.736 -13.653  1.00  0.63           O  
ATOM   1090  OD2 ASP A 153      32.673 -28.904 -15.647  1.00  0.63           O  
ATOM   1091  N   GLU A 154      29.439 -30.553 -15.215  1.00  0.57           N  
ATOM   1092  CA  GLU A 154      28.574 -30.330 -16.363  1.00  0.57           C  
ATOM   1093  C   GLU A 154      29.190 -29.533 -17.500  1.00  0.57           C  
ATOM   1094  O   GLU A 154      28.973 -29.868 -18.665  1.00  0.57           O  
ATOM   1095  CB  GLU A 154      27.169 -29.807 -15.991  1.00  0.57           C  
ATOM   1096  CG  GLU A 154      27.055 -28.336 -15.538  1.00  0.57           C  
ATOM   1097  CD  GLU A 154      25.588 -28.007 -15.270  1.00  0.57           C  
ATOM   1098  OE1 GLU A 154      24.789 -28.091 -16.237  1.00  0.57           O  
ATOM   1099  OE2 GLU A 154      25.254 -27.701 -14.098  1.00  0.57           O  
ATOM   1100  N   GLN A 155      30.020 -28.496 -17.224  1.00  0.61           N  
ATOM   1101  CA  GLN A 155      30.618 -27.676 -18.273  1.00  0.61           C  
ATOM   1102  C   GLN A 155      31.547 -28.475 -19.157  1.00  0.61           C  
ATOM   1103  O   GLN A 155      31.489 -28.369 -20.377  1.00  0.61           O  
ATOM   1104  CB  GLN A 155      31.440 -26.453 -17.784  1.00  0.61           C  
ATOM   1105  CG  GLN A 155      30.622 -25.314 -17.128  1.00  0.61           C  
ATOM   1106  CD  GLN A 155      30.289 -25.492 -15.643  1.00  0.61           C  
ATOM   1107  OE1 GLN A 155      29.393 -24.815 -15.137  1.00  0.61           O  
ATOM   1108  NE2 GLN A 155      31.032 -26.353 -14.921  1.00  0.61           N  
ATOM   1109  N   ILE A 156      32.399 -29.344 -18.571  1.00  0.56           N  
ATOM   1110  CA  ILE A 156      33.221 -30.253 -19.359  1.00  0.56           C  
ATOM   1111  C   ILE A 156      32.394 -31.252 -20.140  1.00  0.56           C  
ATOM   1112  O   ILE A 156      32.806 -31.693 -21.206  1.00  0.56           O  
ATOM   1113  CB  ILE A 156      34.312 -31.000 -18.596  1.00  0.56           C  
ATOM   1114  CG1 ILE A 156      33.778 -32.078 -17.629  1.00  0.56           C  
ATOM   1115  CG2 ILE A 156      35.193 -29.971 -17.857  1.00  0.56           C  
ATOM   1116  CD1 ILE A 156      33.670 -33.490 -18.231  1.00  0.56           C  
ATOM   1117  N   GLY A 157      31.210 -31.655 -19.625  1.00  0.61           N  
ATOM   1118  CA  GLY A 157      30.377 -32.666 -20.255  1.00  0.61           C  
ATOM   1119  C   GLY A 157      29.668 -32.166 -21.466  1.00  0.61           C  
ATOM   1120  O   GLY A 157      29.691 -32.821 -22.506  1.00  0.61           O  
ATOM   1121  N   ASP A 158      29.070 -30.959 -21.388  1.00  0.54           N  
ATOM   1122  CA  ASP A 158      28.559 -30.287 -22.568  1.00  0.54           C  
ATOM   1123  C   ASP A 158      29.719 -29.958 -23.501  1.00  0.54           C  
ATOM   1124  O   ASP A 158      29.674 -30.304 -24.674  1.00  0.54           O  
ATOM   1125  CB  ASP A 158      27.689 -29.049 -22.201  1.00  0.54           C  
ATOM   1126  CG  ASP A 158      26.545 -28.808 -23.188  1.00  0.54           C  
ATOM   1127  OD1 ASP A 158      26.243 -29.701 -24.023  1.00  0.54           O  
ATOM   1128  OD2 ASP A 158      25.921 -27.723 -23.076  1.00  0.54           O  
ATOM   1129  N   LEU A 159      30.862 -29.434 -22.970  1.00  0.47           N  
ATOM   1130  CA  LEU A 159      32.053 -29.157 -23.761  1.00  0.47           C  
ATOM   1131  C   LEU A 159      32.579 -30.362 -24.518  1.00  0.47           C  
ATOM   1132  O   LEU A 159      32.753 -30.276 -25.731  1.00  0.47           O  
ATOM   1133  CB  LEU A 159      33.232 -28.599 -22.918  1.00  0.47           C  
ATOM   1134  CG  LEU A 159      34.463 -28.129 -23.730  1.00  0.47           C  
ATOM   1135  CD1 LEU A 159      34.165 -26.831 -24.492  1.00  0.47           C  
ATOM   1136  CD2 LEU A 159      35.686 -27.937 -22.823  1.00  0.47           C  
ATOM   1137  N   VAL A 160      32.799 -31.547 -23.910  1.00  0.40           N  
ATOM   1138  CA  VAL A 160      33.298 -32.695 -24.659  1.00  0.40           C  
ATOM   1139  C   VAL A 160      32.251 -33.329 -25.561  1.00  0.40           C  
ATOM   1140  O   VAL A 160      32.617 -34.078 -26.462  1.00  0.40           O  
ATOM   1141  CB  VAL A 160      34.205 -33.716 -23.989  1.00  0.40           C  
ATOM   1142  CG1 VAL A 160      35.433 -32.990 -23.406  1.00  0.40           C  
ATOM   1143  CG2 VAL A 160      33.460 -34.539 -22.948  1.00  0.40           C  
ATOM   1144  N   GLY A 161      30.949 -32.985 -25.406  1.00  0.41           N  
ATOM   1145  CA  GLY A 161      29.934 -33.209 -26.437  1.00  0.41           C  
ATOM   1146  C   GLY A 161      29.809 -32.148 -27.517  1.00  0.41           C  
ATOM   1147  O   GLY A 161      29.078 -32.339 -28.484  1.00  0.41           O  
ATOM   1148  N   GLU A 162      30.499 -30.996 -27.389  1.00  0.39           N  
ATOM   1149  CA  GLU A 162      30.086 -29.761 -28.048  1.00  0.39           C  
ATOM   1150  C   GLU A 162      30.667 -29.499 -29.420  1.00  0.39           C  
ATOM   1151  O   GLU A 162      30.182 -28.626 -30.137  1.00  0.39           O  
ATOM   1152  CB  GLU A 162      30.529 -28.546 -27.207  1.00  0.39           C  
ATOM   1153  CG  GLU A 162      29.578 -27.322 -27.257  1.00  0.39           C  
ATOM   1154  CD  GLU A 162      30.316 -26.023 -26.906  1.00  0.39           C  
ATOM   1155  OE1 GLU A 162      31.519 -26.107 -26.514  1.00  0.39           O  
ATOM   1156  OE2 GLU A 162      29.689 -24.946 -27.058  1.00  0.39           O  
ATOM   1157  N   ALA A 163      31.678 -30.278 -29.851  1.00  0.25           N  
ATOM   1158  CA  ALA A 163      32.442 -30.020 -31.077  1.00  0.25           C  
ATOM   1159  C   ALA A 163      32.376 -31.068 -32.135  1.00  0.25           C  
ATOM   1160  O   ALA A 163      31.978 -30.798 -33.277  1.00  0.25           O  
ATOM   1161  CB  ALA A 163      33.908 -29.740 -30.800  1.00  0.25           C  
ATOM   1162  N   MET A 164      32.717 -32.305 -31.819  1.00  0.22           N  
ATOM   1163  CA  MET A 164      32.385 -33.480 -32.652  1.00  0.22           C  
ATOM   1164  C   MET A 164      32.239 -33.469 -34.178  1.00  0.22           C  
ATOM   1165  O   MET A 164      33.190 -33.636 -34.938  1.00  0.22           O  
ATOM   1166  CB  MET A 164      31.267 -34.270 -31.919  1.00  0.22           C  
ATOM   1167  CG  MET A 164      31.704 -35.364 -30.887  1.00  0.22           C  
ATOM   1168  SD  MET A 164      31.657 -34.916 -29.165  1.00  0.22           S  
ATOM   1169  CE  MET A 164      32.321 -36.579 -28.769  1.00  0.22           C  
ATOM   1170  N   SER A 165      30.995 -33.348 -34.661  1.00  0.24           N  
ATOM   1171  CA  SER A 165      30.642 -33.479 -36.066  1.00  0.24           C  
ATOM   1172  C   SER A 165      30.996 -32.292 -36.957  1.00  0.24           C  
ATOM   1173  O   SER A 165      30.415 -32.106 -38.016  1.00  0.24           O  
ATOM   1174  CB  SER A 165      29.219 -34.009 -36.332  1.00  0.24           C  
ATOM   1175  OG  SER A 165      28.145 -33.455 -35.472  1.00  0.24           O  
ATOM   1176  N   LYS A 166      32.039 -31.517 -36.580  1.00  0.22           N  
ATOM   1177  CA  LYS A 166      32.883 -30.798 -37.521  1.00  0.22           C  
ATOM   1178  C   LYS A 166      33.842 -31.701 -38.314  1.00  0.22           C  
ATOM   1179  O   LYS A 166      33.953 -31.525 -39.521  1.00  0.22           O  
ATOM   1180  CB  LYS A 166      33.693 -29.664 -36.816  1.00  0.22           C  
ATOM   1181  CG  LYS A 166      32.838 -28.504 -36.268  1.00  0.22           C  
ATOM   1182  CD  LYS A 166      32.059 -27.771 -37.379  1.00  0.22           C  
ATOM   1183  CE  LYS A 166      31.469 -26.410 -36.984  1.00  0.22           C  
ATOM   1184  NZ  LYS A 166      30.165 -26.572 -36.311  1.00  0.22           N  
ATOM   1185  N   VAL A 167      34.562 -32.684 -37.707  1.00  0.22           N  
ATOM   1186  CA  VAL A 167      35.648 -33.378 -38.428  1.00  0.22           C  
ATOM   1187  C   VAL A 167      35.193 -34.405 -39.458  1.00  0.22           C  
ATOM   1188  O   VAL A 167      35.354 -34.239 -40.660  1.00  0.22           O  
ATOM   1189  CB  VAL A 167      36.726 -34.035 -37.525  1.00  0.22           C  
ATOM   1190  CG1 VAL A 167      37.905 -33.049 -37.345  1.00  0.22           C  
ATOM   1191  CG2 VAL A 167      36.164 -34.559 -36.183  1.00  0.22           C  
ATOM   1192  N   GLY A 168      34.665 -35.539 -38.983  1.00  0.23           N  
ATOM   1193  CA  GLY A 168      34.737 -36.804 -39.710  1.00  0.23           C  
ATOM   1194  C   GLY A 168      35.208 -37.748 -38.662  1.00  0.23           C  
ATOM   1195  O   GLY A 168      35.770 -37.290 -37.674  1.00  0.23           O  
ATOM   1196  N   HIS A 169      34.937 -39.053 -38.766  1.00  0.22           N  
ATOM   1197  CA  HIS A 169      35.087 -39.964 -37.635  1.00  0.22           C  
ATOM   1198  C   HIS A 169      36.539 -40.015 -37.099  1.00  0.22           C  
ATOM   1199  O   HIS A 169      36.812 -39.981 -35.903  1.00  0.22           O  
ATOM   1200  CB  HIS A 169      34.529 -41.348 -38.061  1.00  0.22           C  
ATOM   1201  CG  HIS A 169      33.014 -41.477 -38.249  1.00  0.22           C  
ATOM   1202  ND1 HIS A 169      32.110 -40.466 -38.627  1.00  0.22           N  
ATOM   1203  CD2 HIS A 169      32.321 -42.596 -37.908  1.00  0.22           C  
ATOM   1204  CE1 HIS A 169      30.917 -41.015 -38.457  1.00  0.22           C  
ATOM   1205  NE2 HIS A 169      30.987 -42.293 -38.037  1.00  0.22           N  
ATOM   1206  N   ASP A 170      37.520 -39.989 -38.008  1.00  0.31           N  
ATOM   1207  CA  ASP A 170      38.955 -40.043 -37.804  1.00  0.31           C  
ATOM   1208  C   ASP A 170      39.662 -38.924 -36.987  1.00  0.31           C  
ATOM   1209  O   ASP A 170      40.682 -39.164 -36.330  1.00  0.31           O  
ATOM   1210  CB  ASP A 170      39.592 -40.096 -39.226  1.00  0.31           C  
ATOM   1211  CG  ASP A 170      38.964 -41.190 -40.090  1.00  0.31           C  
ATOM   1212  OD1 ASP A 170      39.657 -42.192 -40.374  1.00  0.31           O  
ATOM   1213  OD2 ASP A 170      37.778 -40.999 -40.472  1.00  0.31           O  
ATOM   1214  N   GLY A 171      39.214 -37.648 -37.078  1.00  0.26           N  
ATOM   1215  CA  GLY A 171      40.030 -36.456 -36.742  1.00  0.26           C  
ATOM   1216  C   GLY A 171      40.493 -36.224 -35.308  1.00  0.26           C  
ATOM   1217  O   GLY A 171      39.656 -36.203 -34.427  1.00  0.26           O  
ATOM   1218  N   VAL A 172      41.817 -35.978 -35.087  1.00  0.23           N  
ATOM   1219  CA  VAL A 172      42.670 -35.822 -33.878  1.00  0.23           C  
ATOM   1220  C   VAL A 172      42.270 -35.091 -32.560  1.00  0.23           C  
ATOM   1221  O   VAL A 172      41.335 -34.303 -32.520  1.00  0.23           O  
ATOM   1222  CB  VAL A 172      44.052 -35.347 -34.309  1.00  0.23           C  
ATOM   1223  CG1 VAL A 172      44.589 -36.303 -35.395  1.00  0.23           C  
ATOM   1224  CG2 VAL A 172      43.983 -33.899 -34.830  1.00  0.23           C  
ATOM   1225  N   VAL A 173      42.993 -35.392 -31.423  1.00  0.22           N  
ATOM   1226  CA  VAL A 173      42.845 -34.789 -30.078  1.00  0.22           C  
ATOM   1227  C   VAL A 173      44.103 -34.868 -29.229  1.00  0.22           C  
ATOM   1228  O   VAL A 173      44.900 -35.800 -29.359  1.00  0.22           O  
ATOM   1229  CB  VAL A 173      41.695 -35.373 -29.238  1.00  0.22           C  
ATOM   1230  CG1 VAL A 173      41.874 -35.581 -27.713  1.00  0.22           C  
ATOM   1231  CG2 VAL A 173      40.577 -34.357 -29.319  1.00  0.22           C  
ATOM   1232  N   SER A 174      44.248 -33.897 -28.301  1.00  0.21           N  
ATOM   1233  CA  SER A 174      45.057 -33.925 -27.099  1.00  0.21           C  
ATOM   1234  C   SER A 174      44.333 -33.046 -26.080  1.00  0.21           C  
ATOM   1235  O   SER A 174      43.136 -32.796 -26.196  1.00  0.21           O  
ATOM   1236  CB  SER A 174      46.505 -33.421 -27.345  1.00  0.21           C  
ATOM   1237  OG  SER A 174      46.501 -32.072 -27.823  1.00  0.21           O  
ATOM   1238  N   VAL A 175      45.011 -32.528 -25.048  1.00  0.35           N  
ATOM   1239  CA  VAL A 175      44.432 -31.502 -24.203  1.00  0.35           C  
ATOM   1240  C   VAL A 175      45.590 -30.628 -23.795  1.00  0.35           C  
ATOM   1241  O   VAL A 175      46.711 -31.109 -23.618  1.00  0.35           O  
ATOM   1242  CB  VAL A 175      43.592 -32.027 -23.031  1.00  0.35           C  
ATOM   1243  CG1 VAL A 175      44.389 -32.997 -22.138  1.00  0.35           C  
ATOM   1244  CG2 VAL A 175      42.995 -30.862 -22.211  1.00  0.35           C  
ATOM   1245  N   GLU A 176      45.349 -29.309 -23.740  1.00  0.33           N  
ATOM   1246  CA  GLU A 176      46.357 -28.280 -23.664  1.00  0.33           C  
ATOM   1247  C   GLU A 176      45.920 -27.329 -22.565  1.00  0.33           C  
ATOM   1248  O   GLU A 176      44.726 -27.184 -22.301  1.00  0.33           O  
ATOM   1249  CB  GLU A 176      46.388 -27.482 -25.000  1.00  0.33           C  
ATOM   1250  CG  GLU A 176      46.615 -28.336 -26.279  1.00  0.33           C  
ATOM   1251  CD  GLU A 176      46.097 -27.653 -27.546  1.00  0.33           C  
ATOM   1252  OE1 GLU A 176      44.860 -27.401 -27.627  1.00  0.33           O  
ATOM   1253  OE2 GLU A 176      46.910 -27.432 -28.478  1.00  0.33           O  
ATOM   1254  N   GLU A 177      46.859 -26.646 -21.887  1.00  0.32           N  
ATOM   1255  CA  GLU A 177      46.561 -25.669 -20.857  1.00  0.32           C  
ATOM   1256  C   GLU A 177      46.102 -24.322 -21.406  1.00  0.32           C  
ATOM   1257  O   GLU A 177      45.467 -23.531 -20.711  1.00  0.32           O  
ATOM   1258  CB  GLU A 177      47.786 -25.474 -19.919  1.00  0.32           C  
ATOM   1259  CG  GLU A 177      49.069 -24.850 -20.546  1.00  0.32           C  
ATOM   1260  CD  GLU A 177      49.900 -25.763 -21.454  1.00  0.32           C  
ATOM   1261  OE1 GLU A 177      50.950 -25.268 -21.931  1.00  0.32           O  
ATOM   1262  OE2 GLU A 177      49.502 -26.933 -21.687  1.00  0.32           O  
ATOM   1263  N   SER A 178      46.384 -24.039 -22.690  1.00  0.30           N  
ATOM   1264  CA  SER A 178      45.879 -22.867 -23.384  1.00  0.30           C  
ATOM   1265  C   SER A 178      45.771 -23.218 -24.850  1.00  0.30           C  
ATOM   1266  O   SER A 178      46.599 -23.964 -25.363  1.00  0.30           O  
ATOM   1267  CB  SER A 178      46.818 -21.642 -23.228  1.00  0.30           C  
ATOM   1268  OG  SER A 178      46.252 -20.457 -23.797  1.00  0.30           O  
ATOM   1269  N   SER A 179      44.750 -22.710 -25.569  1.00  0.27           N  
ATOM   1270  CA  SER A 179      44.538 -23.083 -26.959  1.00  0.27           C  
ATOM   1271  C   SER A 179      43.665 -22.059 -27.667  1.00  0.27           C  
ATOM   1272  O   SER A 179      43.148 -21.135 -27.043  1.00  0.27           O  
ATOM   1273  CB  SER A 179      44.003 -24.530 -27.131  1.00  0.27           C  
ATOM   1274  OG  SER A 179      42.622 -24.702 -26.805  1.00  0.27           O  
ATOM   1275  N   THR A 180      43.527 -22.137 -29.011  1.00  0.26           N  
ATOM   1276  CA  THR A 180      42.839 -21.099 -29.783  1.00  0.26           C  
ATOM   1277  C   THR A 180      42.420 -21.640 -31.140  1.00  0.26           C  
ATOM   1278  O   THR A 180      42.799 -22.744 -31.520  1.00  0.26           O  
ATOM   1279  CB  THR A 180      43.665 -19.818 -29.950  1.00  0.26           C  
ATOM   1280  OG1 THR A 180      42.888 -18.740 -30.457  1.00  0.26           O  
ATOM   1281  CG2 THR A 180      44.866 -20.027 -30.887  1.00  0.26           C  
ATOM   1282  N   LEU A 181      41.621 -20.888 -31.921  1.00  0.33           N  
ATOM   1283  CA  LEU A 181      41.149 -21.328 -33.219  1.00  0.33           C  
ATOM   1284  C   LEU A 181      40.971 -20.175 -34.184  1.00  0.33           C  
ATOM   1285  O   LEU A 181      40.978 -19.003 -33.815  1.00  0.33           O  
ATOM   1286  CB  LEU A 181      39.806 -22.111 -33.160  1.00  0.33           C  
ATOM   1287  CG  LEU A 181      38.511 -21.297 -32.903  1.00  0.33           C  
ATOM   1288  CD1 LEU A 181      37.295 -22.048 -33.470  1.00  0.33           C  
ATOM   1289  CD2 LEU A 181      38.315 -20.946 -31.420  1.00  0.33           C  
ATOM   1290  N   GLY A 182      40.765 -20.508 -35.471  1.00  0.24           N  
ATOM   1291  CA  GLY A 182      40.193 -19.600 -36.445  1.00  0.24           C  
ATOM   1292  C   GLY A 182      39.398 -20.441 -37.397  1.00  0.24           C  
ATOM   1293  O   GLY A 182      39.787 -21.566 -37.701  1.00  0.24           O  
ATOM   1294  N   THR A 183      38.260 -19.933 -37.895  1.00  0.22           N  
ATOM   1295  CA  THR A 183      37.501 -20.580 -38.956  1.00  0.22           C  
ATOM   1296  C   THR A 183      37.866 -19.964 -40.288  1.00  0.22           C  
ATOM   1297  O   THR A 183      38.222 -18.792 -40.382  1.00  0.22           O  
ATOM   1298  CB  THR A 183      35.984 -20.497 -38.790  1.00  0.22           C  
ATOM   1299  OG1 THR A 183      35.572 -19.187 -38.420  1.00  0.22           O  
ATOM   1300  CG2 THR A 183      35.551 -21.438 -37.657  1.00  0.22           C  
ATOM   1301  N   GLU A 184      37.780 -20.760 -41.368  1.00  0.20           N  
ATOM   1302  CA  GLU A 184      38.012 -20.306 -42.722  1.00  0.20           C  
ATOM   1303  C   GLU A 184      36.717 -20.516 -43.492  1.00  0.20           C  
ATOM   1304  O   GLU A 184      35.853 -21.284 -43.068  1.00  0.20           O  
ATOM   1305  CB  GLU A 184      39.216 -21.049 -43.349  1.00  0.20           C  
ATOM   1306  CG  GLU A 184      39.712 -20.460 -44.693  1.00  0.20           C  
ATOM   1307  CD  GLU A 184      41.065 -21.021 -45.137  1.00  0.20           C  
ATOM   1308  OE1 GLU A 184      41.529 -20.570 -46.216  1.00  0.20           O  
ATOM   1309  OE2 GLU A 184      41.640 -21.871 -44.414  1.00  0.20           O  
ATOM   1310  N   LEU A 185      36.505 -19.785 -44.605  1.00  0.21           N  
ATOM   1311  CA  LEU A 185      35.234 -19.769 -45.305  1.00  0.21           C  
ATOM   1312  C   LEU A 185      35.345 -20.437 -46.664  1.00  0.21           C  
ATOM   1313  O   LEU A 185      35.994 -19.934 -47.579  1.00  0.21           O  
ATOM   1314  CB  LEU A 185      34.731 -18.320 -45.528  1.00  0.21           C  
ATOM   1315  CG  LEU A 185      34.385 -17.536 -44.245  1.00  0.21           C  
ATOM   1316  CD1 LEU A 185      34.037 -16.082 -44.601  1.00  0.21           C  
ATOM   1317  CD2 LEU A 185      33.224 -18.176 -43.469  1.00  0.21           C  
ATOM   1318  N   GLU A 186      34.677 -21.593 -46.829  1.00  0.26           N  
ATOM   1319  CA  GLU A 186      34.601 -22.301 -48.089  1.00  0.26           C  
ATOM   1320  C   GLU A 186      33.454 -21.790 -48.954  1.00  0.26           C  
ATOM   1321  O   GLU A 186      32.387 -21.430 -48.462  1.00  0.26           O  
ATOM   1322  CB  GLU A 186      34.409 -23.815 -47.858  1.00  0.26           C  
ATOM   1323  CG  GLU A 186      35.545 -24.469 -47.035  1.00  0.26           C  
ATOM   1324  CD  GLU A 186      35.355 -25.978 -46.879  1.00  0.26           C  
ATOM   1325  OE1 GLU A 186      34.385 -26.526 -47.464  1.00  0.26           O  
ATOM   1326  OE2 GLU A 186      36.192 -26.587 -46.168  1.00  0.26           O  
ATOM   1327  N   PHE A 187      33.655 -21.743 -50.288  1.00  0.21           N  
ATOM   1328  CA  PHE A 187      32.654 -21.263 -51.225  1.00  0.21           C  
ATOM   1329  C   PHE A 187      32.525 -22.246 -52.378  1.00  0.21           C  
ATOM   1330  O   PHE A 187      33.490 -22.530 -53.083  1.00  0.21           O  
ATOM   1331  CB  PHE A 187      33.030 -19.876 -51.814  1.00  0.21           C  
ATOM   1332  CG  PHE A 187      32.975 -18.806 -50.758  1.00  0.21           C  
ATOM   1333  CD1 PHE A 187      31.772 -18.128 -50.497  1.00  0.21           C  
ATOM   1334  CD2 PHE A 187      34.122 -18.457 -50.024  1.00  0.21           C  
ATOM   1335  CE1 PHE A 187      31.715 -17.121 -49.524  1.00  0.21           C  
ATOM   1336  CE2 PHE A 187      34.069 -17.453 -49.050  1.00  0.21           C  
ATOM   1337  CZ  PHE A 187      32.865 -16.784 -48.799  1.00  0.21           C  
ATOM   1338  N   THR A 188      31.319 -22.802 -52.600  1.00  0.46           N  
ATOM   1339  CA  THR A 188      31.048 -23.779 -53.652  1.00  0.46           C  
ATOM   1340  C   THR A 188      30.132 -23.218 -54.725  1.00  0.46           C  
ATOM   1341  O   THR A 188      28.936 -23.487 -54.761  1.00  0.46           O  
ATOM   1342  CB  THR A 188      30.461 -25.089 -53.130  1.00  0.46           C  
ATOM   1343  OG1 THR A 188      29.434 -24.867 -52.170  1.00  0.46           O  
ATOM   1344  CG2 THR A 188      31.569 -25.870 -52.409  1.00  0.46           C  
ATOM   1345  N   GLU A 189      30.678 -22.411 -55.660  1.00  0.53           N  
ATOM   1346  CA  GLU A 189      29.927 -21.827 -56.767  1.00  0.53           C  
ATOM   1347  C   GLU A 189      29.307 -22.831 -57.739  1.00  0.53           C  
ATOM   1348  O   GLU A 189      28.186 -22.664 -58.217  1.00  0.53           O  
ATOM   1349  CB  GLU A 189      30.838 -20.902 -57.607  1.00  0.53           C  
ATOM   1350  CG  GLU A 189      31.460 -19.724 -56.823  1.00  0.53           C  
ATOM   1351  CD  GLU A 189      32.308 -18.825 -57.725  1.00  0.53           C  
ATOM   1352  OE1 GLU A 189      32.373 -19.087 -58.954  1.00  0.53           O  
ATOM   1353  OE2 GLU A 189      32.896 -17.864 -57.169  1.00  0.53           O  
ATOM   1354  N   GLY A 190      30.043 -23.904 -58.078  1.00  0.57           N  
ATOM   1355  CA  GLY A 190      29.560 -24.919 -58.996  1.00  0.57           C  
ATOM   1356  C   GLY A 190      30.478 -26.103 -58.982  1.00  0.57           C  
ATOM   1357  O   GLY A 190      31.254 -26.300 -58.048  1.00  0.57           O  
ATOM   1358  N   ILE A 191      30.434 -26.938 -60.036  1.00  0.80           N  
ATOM   1359  CA  ILE A 191      31.218 -28.160 -60.071  1.00  0.80           C  
ATOM   1360  C   ILE A 191      32.644 -27.921 -60.554  1.00  0.80           C  
ATOM   1361  O   ILE A 191      32.908 -27.425 -61.649  1.00  0.80           O  
ATOM   1362  CB  ILE A 191      30.559 -29.303 -60.849  1.00  0.80           C  
ATOM   1363  CG1 ILE A 191      30.255 -28.954 -62.317  1.00  0.80           C  
ATOM   1364  CG2 ILE A 191      29.273 -29.710 -60.112  1.00  0.80           C  
ATOM   1365  CD1 ILE A 191      29.739 -30.146 -63.129  1.00  0.80           C  
ATOM   1366  N   GLY A 192      33.629 -28.293 -59.715  1.00  0.80           N  
ATOM   1367  CA  GLY A 192      35.037 -28.298 -60.085  1.00  0.80           C  
ATOM   1368  C   GLY A 192      35.616 -29.653 -59.832  1.00  0.80           C  
ATOM   1369  O   GLY A 192      35.275 -30.312 -58.850  1.00  0.80           O  
ATOM   1370  N   PHE A 193      36.520 -30.123 -60.699  1.00  0.84           N  
ATOM   1371  CA  PHE A 193      37.177 -31.390 -60.485  1.00  0.84           C  
ATOM   1372  C   PHE A 193      38.629 -31.360 -60.882  1.00  0.84           C  
ATOM   1373  O   PHE A 193      39.088 -30.601 -61.732  1.00  0.84           O  
ATOM   1374  CB  PHE A 193      36.438 -32.616 -61.105  1.00  0.84           C  
ATOM   1375  CG  PHE A 193      36.400 -32.619 -62.612  1.00  0.84           C  
ATOM   1376  CD1 PHE A 193      35.312 -32.057 -63.299  1.00  0.84           C  
ATOM   1377  CD2 PHE A 193      37.433 -33.223 -63.353  1.00  0.84           C  
ATOM   1378  CE1 PHE A 193      35.245 -32.113 -64.697  1.00  0.84           C  
ATOM   1379  CE2 PHE A 193      37.374 -33.277 -64.751  1.00  0.84           C  
ATOM   1380  CZ  PHE A 193      36.274 -32.729 -65.422  1.00  0.84           C  
ATOM   1381  N   ASP A 194      39.348 -32.241 -60.194  1.00  0.79           N  
ATOM   1382  CA  ASP A 194      40.752 -32.335 -59.940  1.00  0.79           C  
ATOM   1383  C   ASP A 194      41.519 -32.851 -61.161  1.00  0.79           C  
ATOM   1384  O   ASP A 194      42.158 -33.910 -61.143  1.00  0.79           O  
ATOM   1385  CB  ASP A 194      40.888 -33.295 -58.702  1.00  0.79           C  
ATOM   1386  CG  ASP A 194      39.716 -33.209 -57.704  1.00  0.79           C  
ATOM   1387  OD1 ASP A 194      39.947 -32.771 -56.559  1.00  0.79           O  
ATOM   1388  OD2 ASP A 194      38.564 -33.580 -58.095  1.00  0.79           O  
ATOM   1389  N   LYS A 195      41.444 -32.140 -62.300  1.00  0.77           N  
ATOM   1390  CA  LYS A 195      42.116 -32.547 -63.513  1.00  0.77           C  
ATOM   1391  C   LYS A 195      42.180 -31.455 -64.564  1.00  0.77           C  
ATOM   1392  O   LYS A 195      41.166 -31.038 -65.117  1.00  0.77           O  
ATOM   1393  CB  LYS A 195      41.422 -33.763 -64.178  1.00  0.77           C  
ATOM   1394  CG  LYS A 195      42.321 -34.485 -65.191  1.00  0.77           C  
ATOM   1395  CD  LYS A 195      43.512 -35.257 -64.591  1.00  0.77           C  
ATOM   1396  CE  LYS A 195      43.116 -36.490 -63.766  1.00  0.77           C  
ATOM   1397  NZ  LYS A 195      42.947 -36.160 -62.335  1.00  0.77           N  
ATOM   1398  N   GLY A 196      43.392 -30.973 -64.886  1.00  0.83           N  
ATOM   1399  CA  GLY A 196      43.606 -30.053 -65.993  1.00  0.83           C  
ATOM   1400  C   GLY A 196      43.682 -30.655 -67.370  1.00  0.83           C  
ATOM   1401  O   GLY A 196      43.545 -31.858 -67.582  1.00  0.83           O  
ATOM   1402  N   PHE A 197      43.936 -29.785 -68.362  1.00  0.80           N  
ATOM   1403  CA  PHE A 197      44.028 -30.126 -69.771  1.00  0.80           C  
ATOM   1404  C   PHE A 197      45.113 -31.129 -70.179  1.00  0.80           C  
ATOM   1405  O   PHE A 197      46.209 -31.180 -69.628  1.00  0.80           O  
ATOM   1406  CB  PHE A 197      44.094 -28.846 -70.664  1.00  0.80           C  
ATOM   1407  CG  PHE A 197      45.110 -27.817 -70.202  1.00  0.80           C  
ATOM   1408  CD1 PHE A 197      46.495 -28.062 -70.227  1.00  0.80           C  
ATOM   1409  CD2 PHE A 197      44.668 -26.560 -69.757  1.00  0.80           C  
ATOM   1410  CE1 PHE A 197      47.406 -27.092 -69.787  1.00  0.80           C  
ATOM   1411  CE2 PHE A 197      45.572 -25.581 -69.329  1.00  0.80           C  
ATOM   1412  CZ  PHE A 197      46.944 -25.848 -69.345  1.00  0.80           C  
ATOM   1413  N   LEU A 198      44.837 -31.943 -71.222  1.00  0.79           N  
ATOM   1414  CA  LEU A 198      45.835 -32.845 -71.784  1.00  0.79           C  
ATOM   1415  C   LEU A 198      46.594 -32.220 -72.942  1.00  0.79           C  
ATOM   1416  O   LEU A 198      47.573 -32.771 -73.436  1.00  0.79           O  
ATOM   1417  CB  LEU A 198      45.166 -34.139 -72.306  1.00  0.79           C  
ATOM   1418  CG  LEU A 198      44.482 -34.980 -71.215  1.00  0.79           C  
ATOM   1419  CD1 LEU A 198      43.795 -36.196 -71.851  1.00  0.79           C  
ATOM   1420  CD2 LEU A 198      45.480 -35.424 -70.138  1.00  0.79           C  
ATOM   1421  N   SER A 199      46.192 -31.016 -73.384  1.00  0.74           N  
ATOM   1422  CA  SER A 199      46.942 -30.260 -74.373  1.00  0.74           C  
ATOM   1423  C   SER A 199      47.262 -28.901 -73.802  1.00  0.74           C  
ATOM   1424  O   SER A 199      46.384 -28.061 -73.619  1.00  0.74           O  
ATOM   1425  CB  SER A 199      46.182 -30.067 -75.712  1.00  0.74           C  
ATOM   1426  OG  SER A 199      46.993 -29.395 -76.683  1.00  0.74           O  
ATOM   1427  N   ALA A 200      48.558 -28.636 -73.544  1.00  0.73           N  
ATOM   1428  CA  ALA A 200      49.038 -27.374 -73.011  1.00  0.73           C  
ATOM   1429  C   ALA A 200      49.037 -26.264 -74.050  1.00  0.73           C  
ATOM   1430  O   ALA A 200      49.115 -25.079 -73.742  1.00  0.73           O  
ATOM   1431  CB  ALA A 200      50.464 -27.576 -72.464  1.00  0.73           C  
ATOM   1432  N   TYR A 201      48.887 -26.650 -75.326  1.00  0.62           N  
ATOM   1433  CA  TYR A 201      48.889 -25.766 -76.466  1.00  0.62           C  
ATOM   1434  C   TYR A 201      47.496 -25.206 -76.738  1.00  0.62           C  
ATOM   1435  O   TYR A 201      47.311 -24.373 -77.620  1.00  0.62           O  
ATOM   1436  CB  TYR A 201      49.269 -26.586 -77.722  1.00  0.62           C  
ATOM   1437  CG  TYR A 201      50.600 -27.274 -77.603  1.00  0.62           C  
ATOM   1438  CD1 TYR A 201      51.789 -26.567 -77.841  1.00  0.62           C  
ATOM   1439  CD2 TYR A 201      50.671 -28.650 -77.312  1.00  0.62           C  
ATOM   1440  CE1 TYR A 201      53.028 -27.222 -77.792  1.00  0.62           C  
ATOM   1441  CE2 TYR A 201      51.909 -29.305 -77.258  1.00  0.62           C  
ATOM   1442  CZ  TYR A 201      53.087 -28.589 -77.501  1.00  0.62           C  
ATOM   1443  OH  TYR A 201      54.336 -29.237 -77.470  1.00  0.62           O  
ATOM   1444  N   PHE A 202      46.470 -25.654 -75.980  1.00  0.67           N  
ATOM   1445  CA  PHE A 202      45.093 -25.248 -76.196  1.00  0.67           C  
ATOM   1446  C   PHE A 202      44.729 -23.993 -75.396  1.00  0.67           C  
ATOM   1447  O   PHE A 202      43.646 -23.430 -75.563  1.00  0.67           O  
ATOM   1448  CB  PHE A 202      44.152 -26.433 -75.804  1.00  0.67           C  
ATOM   1449  CG  PHE A 202      42.707 -26.143 -76.136  1.00  0.67           C  
ATOM   1450  CD1 PHE A 202      42.261 -26.172 -77.464  1.00  0.67           C  
ATOM   1451  CD2 PHE A 202      41.820 -25.718 -75.133  1.00  0.67           C  
ATOM   1452  CE1 PHE A 202      40.959 -25.769 -77.790  1.00  0.67           C  
ATOM   1453  CE2 PHE A 202      40.531 -25.275 -75.459  1.00  0.67           C  
ATOM   1454  CZ  PHE A 202      40.091 -25.324 -76.785  1.00  0.67           C  
ATOM   1455  N   VAL A 203      45.620 -23.495 -74.509  1.00  0.72           N  
ATOM   1456  CA  VAL A 203      45.334 -22.320 -73.692  1.00  0.72           C  
ATOM   1457  C   VAL A 203      44.915 -21.096 -74.502  1.00  0.72           C  
ATOM   1458  O   VAL A 203      45.598 -20.616 -75.402  1.00  0.72           O  
ATOM   1459  CB  VAL A 203      46.420 -21.977 -72.677  1.00  0.72           C  
ATOM   1460  CG1 VAL A 203      46.532 -23.132 -71.664  1.00  0.72           C  
ATOM   1461  CG2 VAL A 203      47.777 -21.702 -73.352  1.00  0.72           C  
ATOM   1462  N   THR A 204      43.696 -20.588 -74.225  1.00  0.72           N  
ATOM   1463  CA  THR A 204      43.088 -19.559 -75.069  1.00  0.72           C  
ATOM   1464  C   THR A 204      43.263 -18.211 -74.433  1.00  0.72           C  
ATOM   1465  O   THR A 204      42.902 -17.190 -75.016  1.00  0.72           O  
ATOM   1466  CB  THR A 204      41.602 -19.798 -75.331  1.00  0.72           C  
ATOM   1467  OG1 THR A 204      41.140 -19.086 -76.476  1.00  0.72           O  
ATOM   1468  CG2 THR A 204      40.709 -19.389 -74.150  1.00  0.72           C  
ATOM   1469  N   ASP A 205      43.847 -18.212 -73.226  1.00  0.68           N  
ATOM   1470  CA  ASP A 205      44.342 -17.056 -72.550  1.00  0.68           C  
ATOM   1471  C   ASP A 205      45.695 -17.458 -71.978  1.00  0.68           C  
ATOM   1472  O   ASP A 205      45.873 -18.542 -71.416  1.00  0.68           O  
ATOM   1473  CB  ASP A 205      43.368 -16.561 -71.452  1.00  0.68           C  
ATOM   1474  CG  ASP A 205      43.985 -15.374 -70.735  1.00  0.68           C  
ATOM   1475  OD1 ASP A 205      44.706 -14.591 -71.407  1.00  0.68           O  
ATOM   1476  OD2 ASP A 205      43.864 -15.330 -69.491  1.00  0.68           O  
ATOM   1477  N   PHE A 206      46.670 -16.552 -72.128  1.00  0.56           N  
ATOM   1478  CA  PHE A 206      48.021 -16.717 -71.648  1.00  0.56           C  
ATOM   1479  C   PHE A 206      48.231 -15.896 -70.386  1.00  0.56           C  
ATOM   1480  O   PHE A 206      49.233 -16.078 -69.701  1.00  0.56           O  
ATOM   1481  CB  PHE A 206      49.036 -16.215 -72.709  1.00  0.56           C  
ATOM   1482  CG  PHE A 206      49.059 -17.119 -73.911  1.00  0.56           C  
ATOM   1483  CD1 PHE A 206      49.853 -18.278 -73.901  1.00  0.56           C  
ATOM   1484  CD2 PHE A 206      48.321 -16.810 -75.066  1.00  0.56           C  
ATOM   1485  CE1 PHE A 206      49.923 -19.106 -75.029  1.00  0.56           C  
ATOM   1486  CE2 PHE A 206      48.381 -17.640 -76.194  1.00  0.56           C  
ATOM   1487  CZ  PHE A 206      49.186 -18.786 -76.176  1.00  0.56           C  
ATOM   1488  N   ASP A 207      47.286 -14.999 -70.016  1.00  0.63           N  
ATOM   1489  CA  ASP A 207      47.368 -14.256 -68.771  1.00  0.63           C  
ATOM   1490  C   ASP A 207      46.989 -15.159 -67.598  1.00  0.63           C  
ATOM   1491  O   ASP A 207      47.733 -15.351 -66.638  1.00  0.63           O  
ATOM   1492  CB  ASP A 207      46.428 -13.029 -68.886  1.00  0.63           C  
ATOM   1493  CG  ASP A 207      46.549 -12.113 -67.683  1.00  0.63           C  
ATOM   1494  OD1 ASP A 207      47.532 -11.330 -67.640  1.00  0.63           O  
ATOM   1495  OD2 ASP A 207      45.659 -12.196 -66.796  1.00  0.63           O  
ATOM   1496  N   ASN A 208      45.834 -15.844 -67.703  1.00  0.70           N  
ATOM   1497  CA  ASN A 208      45.403 -16.793 -66.698  1.00  0.70           C  
ATOM   1498  C   ASN A 208      46.105 -18.140 -66.851  1.00  0.70           C  
ATOM   1499  O   ASN A 208      46.087 -18.952 -65.926  1.00  0.70           O  
ATOM   1500  CB  ASN A 208      43.867 -17.019 -66.796  1.00  0.70           C  
ATOM   1501  CG  ASN A 208      43.025 -15.899 -66.177  1.00  0.70           C  
ATOM   1502  OD1 ASN A 208      41.970 -16.198 -65.610  1.00  0.70           O  
ATOM   1503  ND2 ASN A 208      43.463 -14.627 -66.246  1.00  0.70           N  
ATOM   1504  N   GLN A 209      46.723 -18.401 -68.029  1.00  0.67           N  
ATOM   1505  CA  GLN A 209      47.341 -19.662 -68.434  1.00  0.67           C  
ATOM   1506  C   GLN A 209      46.354 -20.825 -68.391  1.00  0.67           C  
ATOM   1507  O   GLN A 209      46.578 -21.894 -67.818  1.00  0.67           O  
ATOM   1508  CB  GLN A 209      48.673 -19.932 -67.679  1.00  0.67           C  
ATOM   1509  CG  GLN A 209      49.552 -21.094 -68.222  1.00  0.67           C  
ATOM   1510  CD  GLN A 209      50.088 -20.858 -69.639  1.00  0.67           C  
ATOM   1511  OE1 GLN A 209      49.914 -19.823 -70.275  1.00  0.67           O  
ATOM   1512  NE2 GLN A 209      50.802 -21.880 -70.169  1.00  0.67           N  
ATOM   1513  N   GLN A 210      45.180 -20.595 -68.997  1.00  0.71           N  
ATOM   1514  CA  GLN A 210      44.014 -21.430 -68.842  1.00  0.71           C  
ATOM   1515  C   GLN A 210      43.258 -21.435 -70.149  1.00  0.71           C  
ATOM   1516  O   GLN A 210      43.500 -20.635 -71.054  1.00  0.71           O  
ATOM   1517  CB  GLN A 210      43.086 -20.921 -67.697  1.00  0.71           C  
ATOM   1518  CG  GLN A 210      43.659 -21.223 -66.292  1.00  0.71           C  
ATOM   1519  CD  GLN A 210      42.766 -20.736 -65.153  1.00  0.71           C  
ATOM   1520  OE1 GLN A 210      41.714 -21.308 -64.873  1.00  0.71           O  
ATOM   1521  NE2 GLN A 210      43.204 -19.670 -64.447  1.00  0.71           N  
ATOM   1522  N   ALA A 211      42.299 -22.360 -70.299  1.00  0.80           N  
ATOM   1523  CA  ALA A 211      41.427 -22.341 -71.446  1.00  0.80           C  
ATOM   1524  C   ALA A 211      40.002 -22.144 -70.984  1.00  0.80           C  
ATOM   1525  O   ALA A 211      39.487 -22.853 -70.123  1.00  0.80           O  
ATOM   1526  CB  ALA A 211      41.581 -23.588 -72.327  1.00  0.80           C  
ATOM   1527  N   VAL A 212      39.345 -21.126 -71.559  1.00  0.84           N  
ATOM   1528  CA  VAL A 212      37.993 -20.744 -71.235  1.00  0.84           C  
ATOM   1529  C   VAL A 212      37.170 -20.985 -72.478  1.00  0.84           C  
ATOM   1530  O   VAL A 212      37.504 -20.528 -73.571  1.00  0.84           O  
ATOM   1531  CB  VAL A 212      37.885 -19.279 -70.826  1.00  0.84           C  
ATOM   1532  CG1 VAL A 212      36.424 -18.931 -70.479  1.00  0.84           C  
ATOM   1533  CG2 VAL A 212      38.793 -19.022 -69.607  1.00  0.84           C  
ATOM   1534  N   LEU A 213      36.078 -21.747 -72.346  1.00  0.86           N  
ATOM   1535  CA  LEU A 213      35.212 -22.074 -73.451  1.00  0.86           C  
ATOM   1536  C   LEU A 213      33.819 -21.637 -73.051  1.00  0.86           C  
ATOM   1537  O   LEU A 213      33.256 -22.131 -72.079  1.00  0.86           O  
ATOM   1538  CB  LEU A 213      35.225 -23.592 -73.795  1.00  0.86           C  
ATOM   1539  CG  LEU A 213      36.621 -24.201 -74.089  1.00  0.86           C  
ATOM   1540  CD1 LEU A 213      37.344 -24.681 -72.818  1.00  0.86           C  
ATOM   1541  CD2 LEU A 213      36.504 -25.388 -75.057  1.00  0.86           C  
ATOM   1542  N   GLU A 214      33.225 -20.662 -73.761  1.00  0.81           N  
ATOM   1543  CA  GLU A 214      31.860 -20.253 -73.505  1.00  0.81           C  
ATOM   1544  C   GLU A 214      30.887 -21.165 -74.220  1.00  0.81           C  
ATOM   1545  O   GLU A 214      31.214 -21.701 -75.281  1.00  0.81           O  
ATOM   1546  CB  GLU A 214      31.588 -18.796 -73.956  1.00  0.81           C  
ATOM   1547  CG  GLU A 214      31.835 -18.535 -75.468  1.00  0.81           C  
ATOM   1548  CD  GLU A 214      30.793 -17.582 -76.063  1.00  0.81           C  
ATOM   1549  OE1 GLU A 214      30.769 -16.405 -75.628  1.00  0.81           O  
ATOM   1550  OE2 GLU A 214      30.020 -18.044 -76.948  1.00  0.81           O  
ATOM   1551  N   ASP A 215      29.680 -21.356 -73.635  1.00  0.84           N  
ATOM   1552  CA  ASP A 215      28.504 -21.894 -74.298  1.00  0.84           C  
ATOM   1553  C   ASP A 215      28.795 -23.223 -75.003  1.00  0.84           C  
ATOM   1554  O   ASP A 215      28.587 -23.428 -76.199  1.00  0.84           O  
ATOM   1555  CB  ASP A 215      27.982 -20.753 -75.192  1.00  0.84           C  
ATOM   1556  CG  ASP A 215      26.555 -20.918 -75.663  1.00  0.84           C  
ATOM   1557  OD1 ASP A 215      25.804 -21.752 -75.108  1.00  0.84           O  
ATOM   1558  OD2 ASP A 215      26.218 -20.167 -76.622  1.00  0.84           O  
ATOM   1559  N   ALA A 216      29.407 -24.143 -74.242  1.00  0.90           N  
ATOM   1560  CA  ALA A 216      30.188 -25.211 -74.809  1.00  0.90           C  
ATOM   1561  C   ALA A 216      29.491 -26.534 -74.628  1.00  0.90           C  
ATOM   1562  O   ALA A 216      28.931 -26.848 -73.575  1.00  0.90           O  
ATOM   1563  CB  ALA A 216      31.594 -25.266 -74.176  1.00  0.90           C  
ATOM   1564  N   LEU A 217      29.506 -27.348 -75.696  1.00  0.88           N  
ATOM   1565  CA  LEU A 217      28.971 -28.686 -75.699  1.00  0.88           C  
ATOM   1566  C   LEU A 217      29.905 -29.614 -74.939  1.00  0.88           C  
ATOM   1567  O   LEU A 217      31.114 -29.404 -74.896  1.00  0.88           O  
ATOM   1568  CB  LEU A 217      28.715 -29.221 -77.130  1.00  0.88           C  
ATOM   1569  CG  LEU A 217      27.597 -28.483 -77.904  1.00  0.88           C  
ATOM   1570  CD1 LEU A 217      28.045 -27.143 -78.506  1.00  0.88           C  
ATOM   1571  CD2 LEU A 217      27.050 -29.373 -79.025  1.00  0.88           C  
ATOM   1572  N   ILE A 218      29.374 -30.655 -74.277  1.00  0.88           N  
ATOM   1573  CA  ILE A 218      30.177 -31.509 -73.416  1.00  0.88           C  
ATOM   1574  C   ILE A 218      29.974 -32.969 -73.790  1.00  0.88           C  
ATOM   1575  O   ILE A 218      28.879 -33.521 -73.691  1.00  0.88           O  
ATOM   1576  CB  ILE A 218      29.894 -31.258 -71.929  1.00  0.88           C  
ATOM   1577  CG1 ILE A 218      30.129 -29.759 -71.588  1.00  0.88           C  
ATOM   1578  CG2 ILE A 218      30.804 -32.176 -71.080  1.00  0.88           C  
ATOM   1579  CD1 ILE A 218      29.764 -29.340 -70.162  1.00  0.88           C  
ATOM   1580  N   LEU A 219      31.063 -33.638 -74.224  1.00  0.86           N  
ATOM   1581  CA  LEU A 219      31.107 -35.055 -74.525  1.00  0.86           C  
ATOM   1582  C   LEU A 219      31.629 -35.820 -73.325  1.00  0.86           C  
ATOM   1583  O   LEU A 219      32.667 -35.483 -72.757  1.00  0.86           O  
ATOM   1584  CB  LEU A 219      32.039 -35.343 -75.732  1.00  0.86           C  
ATOM   1585  CG  LEU A 219      32.322 -36.835 -76.037  1.00  0.86           C  
ATOM   1586  CD1 LEU A 219      31.048 -37.624 -76.383  1.00  0.86           C  
ATOM   1587  CD2 LEU A 219      33.368 -36.960 -77.155  1.00  0.86           C  
ATOM   1588  N   LEU A 220      30.909 -36.888 -72.931  1.00  0.86           N  
ATOM   1589  CA  LEU A 220      31.274 -37.747 -71.828  1.00  0.86           C  
ATOM   1590  C   LEU A 220      31.477 -39.165 -72.341  1.00  0.86           C  
ATOM   1591  O   LEU A 220      30.512 -39.826 -72.718  1.00  0.86           O  
ATOM   1592  CB  LEU A 220      30.119 -37.796 -70.798  1.00  0.86           C  
ATOM   1593  CG  LEU A 220      29.551 -36.434 -70.358  1.00  0.86           C  
ATOM   1594  CD1 LEU A 220      28.362 -36.667 -69.433  1.00  0.86           C  
ATOM   1595  CD2 LEU A 220      30.575 -35.545 -69.653  1.00  0.86           C  
ATOM   1596  N   HIS A 221      32.722 -39.677 -72.359  1.00  0.81           N  
ATOM   1597  CA  HIS A 221      33.026 -41.008 -72.878  1.00  0.81           C  
ATOM   1598  C   HIS A 221      33.617 -41.861 -71.771  1.00  0.81           C  
ATOM   1599  O   HIS A 221      34.573 -41.458 -71.116  1.00  0.81           O  
ATOM   1600  CB  HIS A 221      34.035 -40.899 -74.054  1.00  0.81           C  
ATOM   1601  CG  HIS A 221      34.297 -42.157 -74.832  1.00  0.81           C  
ATOM   1602  ND1 HIS A 221      33.234 -42.867 -75.350  1.00  0.81           N  
ATOM   1603  CD2 HIS A 221      35.469 -42.696 -75.256  1.00  0.81           C  
ATOM   1604  CE1 HIS A 221      33.777 -43.823 -76.076  1.00  0.81           C  
ATOM   1605  NE2 HIS A 221      35.128 -43.764 -76.057  1.00  0.81           N  
ATOM   1606  N   GLN A 222      33.054 -43.054 -71.478  1.00  0.73           N  
ATOM   1607  CA  GLN A 222      33.631 -43.926 -70.453  1.00  0.73           C  
ATOM   1608  C   GLN A 222      34.979 -44.531 -70.839  1.00  0.73           C  
ATOM   1609  O   GLN A 222      35.889 -44.578 -70.017  1.00  0.73           O  
ATOM   1610  CB  GLN A 222      32.620 -44.971 -69.898  1.00  0.73           C  
ATOM   1611  CG  GLN A 222      31.567 -44.267 -69.001  1.00  0.73           C  
ATOM   1612  CD  GLN A 222      30.531 -45.155 -68.295  1.00  0.73           C  
ATOM   1613  OE1 GLN A 222      30.816 -46.112 -67.575  1.00  0.73           O  
ATOM   1614  NE2 GLN A 222      29.241 -44.750 -68.407  1.00  0.73           N  
ATOM   1615  N   ASP A 223      35.146 -44.955 -72.105  1.00  0.74           N  
ATOM   1616  CA  ASP A 223      36.374 -45.507 -72.644  1.00  0.74           C  
ATOM   1617  C   ASP A 223      37.452 -44.471 -73.002  1.00  0.74           C  
ATOM   1618  O   ASP A 223      37.307 -43.250 -72.890  1.00  0.74           O  
ATOM   1619  CB  ASP A 223      36.060 -46.376 -73.890  1.00  0.74           C  
ATOM   1620  CG  ASP A 223      35.496 -47.727 -73.486  1.00  0.74           C  
ATOM   1621  OD1 ASP A 223      34.437 -47.754 -72.816  1.00  0.74           O  
ATOM   1622  OD2 ASP A 223      36.112 -48.742 -73.895  1.00  0.74           O  
ATOM   1623  N   LYS A 224      38.622 -44.983 -73.424  1.00  0.73           N  
ATOM   1624  CA  LYS A 224      39.806 -44.225 -73.770  1.00  0.73           C  
ATOM   1625  C   LYS A 224      39.916 -43.905 -75.255  1.00  0.73           C  
ATOM   1626  O   LYS A 224      39.778 -44.771 -76.116  1.00  0.73           O  
ATOM   1627  CB  LYS A 224      41.036 -45.045 -73.323  1.00  0.73           C  
ATOM   1628  CG  LYS A 224      42.383 -44.332 -73.472  1.00  0.73           C  
ATOM   1629  CD  LYS A 224      43.427 -44.840 -72.456  1.00  0.73           C  
ATOM   1630  CE  LYS A 224      43.806 -46.318 -72.553  1.00  0.73           C  
ATOM   1631  NZ  LYS A 224      44.330 -46.589 -73.899  1.00  0.73           N  
ATOM   1632  N   ILE A 225      40.190 -42.631 -75.607  1.00  0.75           N  
ATOM   1633  CA  ILE A 225      40.276 -42.188 -76.992  1.00  0.75           C  
ATOM   1634  C   ILE A 225      41.732 -42.166 -77.435  1.00  0.75           C  
ATOM   1635  O   ILE A 225      42.569 -41.492 -76.844  1.00  0.75           O  
ATOM   1636  CB  ILE A 225      39.664 -40.798 -77.194  1.00  0.75           C  
ATOM   1637  CG1 ILE A 225      38.188 -40.784 -76.724  1.00  0.75           C  
ATOM   1638  CG2 ILE A 225      39.780 -40.368 -78.677  1.00  0.75           C  
ATOM   1639  CD1 ILE A 225      37.545 -39.392 -76.705  1.00  0.75           C  
ATOM   1640  N   SER A 226      42.082 -42.901 -78.509  1.00  0.77           N  
ATOM   1641  CA  SER A 226      43.427 -42.844 -79.092  1.00  0.77           C  
ATOM   1642  C   SER A 226      43.366 -42.499 -80.570  1.00  0.77           C  
ATOM   1643  O   SER A 226      44.322 -41.999 -81.163  1.00  0.77           O  
ATOM   1644  CB  SER A 226      44.157 -44.204 -78.911  1.00  0.77           C  
ATOM   1645  OG  SER A 226      45.542 -44.122 -79.261  1.00  0.77           O  
ATOM   1646  N   SER A 227      42.186 -42.705 -81.185  1.00  0.68           N  
ATOM   1647  CA  SER A 227      41.990 -42.634 -82.620  1.00  0.68           C  
ATOM   1648  C   SER A 227      41.019 -41.525 -82.959  1.00  0.68           C  
ATOM   1649  O   SER A 227      39.940 -41.426 -82.378  1.00  0.68           O  
ATOM   1650  CB  SER A 227      41.348 -43.936 -83.178  1.00  0.68           C  
ATOM   1651  OG  SER A 227      42.100 -45.090 -82.803  1.00  0.68           O  
ATOM   1652  N   LEU A 228      41.368 -40.673 -83.935  1.00  0.69           N  
ATOM   1653  CA  LEU A 228      40.506 -39.681 -84.545  1.00  0.69           C  
ATOM   1654  C   LEU A 228      39.274 -40.248 -85.269  1.00  0.69           C  
ATOM   1655  O   LEU A 228      38.218 -39.639 -85.094  1.00  0.69           O  
ATOM   1656  CB  LEU A 228      41.353 -38.767 -85.469  1.00  0.69           C  
ATOM   1657  CG  LEU A 228      40.616 -37.622 -86.191  1.00  0.69           C  
ATOM   1658  CD1 LEU A 228      40.121 -36.544 -85.217  1.00  0.69           C  
ATOM   1659  CD2 LEU A 228      41.524 -37.007 -87.266  1.00  0.69           C  
ATOM   1660  N   PRO A 229      39.267 -41.358 -86.044  1.00  0.76           N  
ATOM   1661  CA  PRO A 229      38.085 -41.907 -86.720  1.00  0.76           C  
ATOM   1662  C   PRO A 229      36.728 -41.905 -86.028  1.00  0.76           C  
ATOM   1663  O   PRO A 229      35.741 -41.572 -86.683  1.00  0.76           O  
ATOM   1664  CB  PRO A 229      38.552 -43.298 -87.145  1.00  0.76           C  
ATOM   1665  CG  PRO A 229      39.992 -43.038 -87.592  1.00  0.76           C  
ATOM   1666  CD  PRO A 229      40.483 -41.960 -86.616  1.00  0.76           C  
ATOM   1667  N   ASP A 230      36.644 -42.251 -84.729  1.00  0.72           N  
ATOM   1668  CA  ASP A 230      35.424 -42.197 -83.940  1.00  0.72           C  
ATOM   1669  C   ASP A 230      34.833 -40.795 -83.835  1.00  0.72           C  
ATOM   1670  O   ASP A 230      33.620 -40.594 -83.869  1.00  0.72           O  
ATOM   1671  CB  ASP A 230      35.718 -42.686 -82.500  1.00  0.72           C  
ATOM   1672  CG  ASP A 230      35.823 -44.197 -82.411  1.00  0.72           C  
ATOM   1673  OD1 ASP A 230      35.679 -44.884 -83.452  1.00  0.72           O  
ATOM   1674  OD2 ASP A 230      36.006 -44.675 -81.263  1.00  0.72           O  
ATOM   1675  N   LEU A 231      35.704 -39.782 -83.692  1.00  0.68           N  
ATOM   1676  CA  LEU A 231      35.341 -38.406 -83.439  1.00  0.68           C  
ATOM   1677  C   LEU A 231      34.647 -37.697 -84.589  1.00  0.68           C  
ATOM   1678  O   LEU A 231      33.824 -36.820 -84.346  1.00  0.68           O  
ATOM   1679  CB  LEU A 231      36.581 -37.583 -83.005  1.00  0.68           C  
ATOM   1680  CG  LEU A 231      37.260 -38.096 -81.716  1.00  0.68           C  
ATOM   1681  CD1 LEU A 231      38.543 -37.310 -81.424  1.00  0.68           C  
ATOM   1682  CD2 LEU A 231      36.324 -38.008 -80.502  1.00  0.68           C  
ATOM   1683  N   LEU A 232      34.945 -38.031 -85.867  1.00  0.66           N  
ATOM   1684  CA  LEU A 232      34.508 -37.244 -87.023  1.00  0.66           C  
ATOM   1685  C   LEU A 232      33.006 -36.958 -87.135  1.00  0.66           C  
ATOM   1686  O   LEU A 232      32.704 -35.787 -87.369  1.00  0.66           O  
ATOM   1687  CB  LEU A 232      34.978 -37.811 -88.395  1.00  0.66           C  
ATOM   1688  CG  LEU A 232      36.450 -37.553 -88.770  1.00  0.66           C  
ATOM   1689  CD1 LEU A 232      37.416 -38.382 -87.931  1.00  0.66           C  
ATOM   1690  CD2 LEU A 232      36.679 -37.864 -90.257  1.00  0.66           C  
ATOM   1691  N   PRO A 233      32.018 -37.849 -86.967  1.00  0.74           N  
ATOM   1692  CA  PRO A 233      30.605 -37.487 -87.112  1.00  0.74           C  
ATOM   1693  C   PRO A 233      30.148 -36.455 -86.097  1.00  0.74           C  
ATOM   1694  O   PRO A 233      29.391 -35.545 -86.431  1.00  0.74           O  
ATOM   1695  CB  PRO A 233      29.860 -38.824 -86.944  1.00  0.74           C  
ATOM   1696  CG  PRO A 233      30.888 -39.875 -87.373  1.00  0.74           C  
ATOM   1697  CD  PRO A 233      32.195 -39.299 -86.837  1.00  0.74           C  
ATOM   1698  N   LEU A 234      30.627 -36.580 -84.847  1.00  0.75           N  
ATOM   1699  CA  LEU A 234      30.414 -35.625 -83.782  1.00  0.75           C  
ATOM   1700  C   LEU A 234      31.130 -34.307 -84.061  1.00  0.75           C  
ATOM   1701  O   LEU A 234      30.550 -33.225 -83.986  1.00  0.75           O  
ATOM   1702  CB  LEU A 234      30.961 -36.286 -82.491  1.00  0.75           C  
ATOM   1703  CG  LEU A 234      30.599 -35.666 -81.126  1.00  0.75           C  
ATOM   1704  CD1 LEU A 234      31.191 -36.564 -80.038  1.00  0.75           C  
ATOM   1705  CD2 LEU A 234      31.092 -34.235 -80.889  1.00  0.75           C  
ATOM   1706  N   LEU A 235      32.422 -34.384 -84.439  1.00  0.76           N  
ATOM   1707  CA  LEU A 235      33.309 -33.256 -84.657  1.00  0.76           C  
ATOM   1708  C   LEU A 235      32.860 -32.345 -85.788  1.00  0.76           C  
ATOM   1709  O   LEU A 235      32.821 -31.125 -85.636  1.00  0.76           O  
ATOM   1710  CB  LEU A 235      34.731 -33.795 -84.949  1.00  0.76           C  
ATOM   1711  CG  LEU A 235      35.874 -32.767 -84.864  1.00  0.76           C  
ATOM   1712  CD1 LEU A 235      36.173 -32.384 -83.406  1.00  0.76           C  
ATOM   1713  CD2 LEU A 235      37.137 -33.330 -85.533  1.00  0.76           C  
ATOM   1714  N   GLU A 236      32.445 -32.937 -86.926  1.00  0.76           N  
ATOM   1715  CA  GLU A 236      31.876 -32.249 -88.073  1.00  0.76           C  
ATOM   1716  C   GLU A 236      30.581 -31.530 -87.724  1.00  0.76           C  
ATOM   1717  O   GLU A 236      30.343 -30.366 -88.048  1.00  0.76           O  
ATOM   1718  CB  GLU A 236      31.590 -33.307 -89.169  1.00  0.76           C  
ATOM   1719  CG  GLU A 236      31.175 -32.731 -90.542  1.00  0.76           C  
ATOM   1720  CD  GLU A 236      32.318 -31.957 -91.192  1.00  0.76           C  
ATOM   1721  OE1 GLU A 236      33.403 -32.567 -91.378  1.00  0.76           O  
ATOM   1722  OE2 GLU A 236      32.109 -30.761 -91.513  1.00  0.76           O  
ATOM   1723  N   LYS A 237      29.698 -32.209 -86.966  1.00  0.76           N  
ATOM   1724  CA  LYS A 237      28.462 -31.620 -86.501  1.00  0.76           C  
ATOM   1725  C   LYS A 237      28.657 -30.460 -85.522  1.00  0.76           C  
ATOM   1726  O   LYS A 237      27.956 -29.454 -85.600  1.00  0.76           O  
ATOM   1727  CB  LYS A 237      27.527 -32.714 -85.935  1.00  0.76           C  
ATOM   1728  CG  LYS A 237      26.073 -32.261 -85.721  1.00  0.76           C  
ATOM   1729  CD  LYS A 237      25.314 -31.895 -87.010  1.00  0.76           C  
ATOM   1730  CE  LYS A 237      23.936 -31.289 -86.719  1.00  0.76           C  
ATOM   1731  NZ  LYS A 237      23.255 -30.928 -87.983  1.00  0.76           N  
ATOM   1732  N   VAL A 238      29.639 -30.548 -84.598  1.00  0.80           N  
ATOM   1733  CA  VAL A 238      30.074 -29.430 -83.760  1.00  0.80           C  
ATOM   1734  C   VAL A 238      30.661 -28.280 -84.569  1.00  0.80           C  
ATOM   1735  O   VAL A 238      30.332 -27.119 -84.328  1.00  0.80           O  
ATOM   1736  CB  VAL A 238      31.065 -29.877 -82.686  1.00  0.80           C  
ATOM   1737  CG1 VAL A 238      31.683 -28.684 -81.929  1.00  0.80           C  
ATOM   1738  CG2 VAL A 238      30.311 -30.763 -81.678  1.00  0.80           C  
ATOM   1739  N   ALA A 239      31.506 -28.565 -85.582  1.00  0.78           N  
ATOM   1740  CA  ALA A 239      32.077 -27.562 -86.464  1.00  0.78           C  
ATOM   1741  C   ALA A 239      31.020 -26.766 -87.227  1.00  0.78           C  
ATOM   1742  O   ALA A 239      31.071 -25.539 -87.287  1.00  0.78           O  
ATOM   1743  CB  ALA A 239      33.051 -28.240 -87.447  1.00  0.78           C  
ATOM   1744  N   GLY A 240      29.983 -27.450 -87.759  1.00  0.77           N  
ATOM   1745  CA  GLY A 240      28.822 -26.799 -88.366  1.00  0.77           C  
ATOM   1746  C   GLY A 240      27.941 -26.004 -87.423  1.00  0.77           C  
ATOM   1747  O   GLY A 240      27.283 -25.055 -87.836  1.00  0.77           O  
ATOM   1748  N   THR A 241      27.890 -26.374 -86.129  1.00  0.80           N  
ATOM   1749  CA  THR A 241      27.249 -25.588 -85.067  1.00  0.80           C  
ATOM   1750  C   THR A 241      28.030 -24.329 -84.722  1.00  0.80           C  
ATOM   1751  O   THR A 241      27.463 -23.272 -84.451  1.00  0.80           O  
ATOM   1752  CB  THR A 241      27.045 -26.391 -83.782  1.00  0.80           C  
ATOM   1753  OG1 THR A 241      26.215 -27.514 -84.040  1.00  0.80           O  
ATOM   1754  CG2 THR A 241      26.329 -25.589 -82.684  1.00  0.80           C  
ATOM   1755  N   GLY A 242      29.378 -24.410 -84.698  1.00  0.81           N  
ATOM   1756  CA  GLY A 242      30.256 -23.275 -84.414  1.00  0.81           C  
ATOM   1757  C   GLY A 242      30.467 -22.972 -82.950  1.00  0.81           C  
ATOM   1758  O   GLY A 242      31.103 -21.986 -82.589  1.00  0.81           O  
ATOM   1759  N   LYS A 243      29.945 -23.824 -82.052  1.00  0.82           N  
ATOM   1760  CA  LYS A 243      30.103 -23.689 -80.615  1.00  0.82           C  
ATOM   1761  C   LYS A 243      31.210 -24.623 -80.114  1.00  0.82           C  
ATOM   1762  O   LYS A 243      31.370 -25.706 -80.677  1.00  0.82           O  
ATOM   1763  CB  LYS A 243      28.776 -23.993 -79.883  1.00  0.82           C  
ATOM   1764  CG  LYS A 243      27.762 -22.834 -79.949  1.00  0.82           C  
ATOM   1765  CD  LYS A 243      28.003 -21.766 -78.857  1.00  0.82           C  
ATOM   1766  CE  LYS A 243      28.161 -20.311 -79.332  1.00  0.82           C  
ATOM   1767  NZ  LYS A 243      28.204 -19.372 -78.191  1.00  0.82           N  
ATOM   1768  N   PRO A 244      32.029 -24.275 -79.117  1.00  0.85           N  
ATOM   1769  CA  PRO A 244      33.090 -25.147 -78.606  1.00  0.85           C  
ATOM   1770  C   PRO A 244      32.659 -26.486 -78.010  1.00  0.85           C  
ATOM   1771  O   PRO A 244      31.499 -26.658 -77.639  1.00  0.85           O  
ATOM   1772  CB  PRO A 244      33.789 -24.282 -77.543  1.00  0.85           C  
ATOM   1773  CG  PRO A 244      33.486 -22.841 -77.946  1.00  0.85           C  
ATOM   1774  CD  PRO A 244      32.067 -22.949 -78.492  1.00  0.85           C  
ATOM   1775  N   LEU A 245      33.605 -27.441 -77.886  1.00  0.83           N  
ATOM   1776  CA  LEU A 245      33.373 -28.758 -77.315  1.00  0.83           C  
ATOM   1777  C   LEU A 245      34.354 -29.080 -76.187  1.00  0.83           C  
ATOM   1778  O   LEU A 245      35.569 -28.948 -76.310  1.00  0.83           O  
ATOM   1779  CB  LEU A 245      33.495 -29.837 -78.424  1.00  0.83           C  
ATOM   1780  CG  LEU A 245      33.271 -31.311 -78.011  1.00  0.83           C  
ATOM   1781  CD1 LEU A 245      31.836 -31.582 -77.537  1.00  0.83           C  
ATOM   1782  CD2 LEU A 245      33.611 -32.245 -79.180  1.00  0.83           C  
ATOM   1783  N   LEU A 246      33.851 -29.554 -75.037  1.00  0.86           N  
ATOM   1784  CA  LEU A 246      34.658 -30.183 -74.009  1.00  0.86           C  
ATOM   1785  C   LEU A 246      34.573 -31.689 -74.174  1.00  0.86           C  
ATOM   1786  O   LEU A 246      33.489 -32.265 -74.236  1.00  0.86           O  
ATOM   1787  CB  LEU A 246      34.159 -29.773 -72.601  1.00  0.86           C  
ATOM   1788  CG  LEU A 246      34.733 -30.552 -71.393  1.00  0.86           C  
ATOM   1789  CD1 LEU A 246      36.249 -30.399 -71.222  1.00  0.86           C  
ATOM   1790  CD2 LEU A 246      34.038 -30.104 -70.104  1.00  0.86           C  
ATOM   1791  N   ILE A 247      35.727 -32.374 -74.251  1.00  0.84           N  
ATOM   1792  CA  ILE A 247      35.793 -33.820 -74.305  1.00  0.84           C  
ATOM   1793  C   ILE A 247      36.369 -34.311 -72.997  1.00  0.84           C  
ATOM   1794  O   ILE A 247      37.543 -34.099 -72.690  1.00  0.84           O  
ATOM   1795  CB  ILE A 247      36.656 -34.333 -75.461  1.00  0.84           C  
ATOM   1796  CG1 ILE A 247      36.085 -33.840 -76.814  1.00  0.84           C  
ATOM   1797  CG2 ILE A 247      36.754 -35.879 -75.393  1.00  0.84           C  
ATOM   1798  CD1 ILE A 247      36.972 -34.172 -78.021  1.00  0.84           C  
ATOM   1799  N   VAL A 248      35.550 -35.018 -72.199  1.00  0.88           N  
ATOM   1800  CA  VAL A 248      36.025 -35.717 -71.024  1.00  0.88           C  
ATOM   1801  C   VAL A 248      35.822 -37.205 -71.266  1.00  0.88           C  
ATOM   1802  O   VAL A 248      34.749 -37.692 -71.629  1.00  0.88           O  
ATOM   1803  CB  VAL A 248      35.435 -35.185 -69.719  1.00  0.88           C  
ATOM   1804  CG1 VAL A 248      33.905 -35.199 -69.727  1.00  0.88           C  
ATOM   1805  CG2 VAL A 248      35.993 -35.955 -68.510  1.00  0.88           C  
ATOM   1806  N   ALA A 249      36.919 -37.967 -71.142  1.00  0.87           N  
ATOM   1807  CA  ALA A 249      37.008 -39.343 -71.574  1.00  0.87           C  
ATOM   1808  C   ALA A 249      37.802 -40.092 -70.529  1.00  0.87           C  
ATOM   1809  O   ALA A 249      38.224 -39.489 -69.545  1.00  0.87           O  
ATOM   1810  CB  ALA A 249      37.703 -39.428 -72.949  1.00  0.87           C  
ATOM   1811  N   GLU A 250      38.066 -41.413 -70.663  1.00  0.76           N  
ATOM   1812  CA  GLU A 250      39.015 -42.047 -69.749  1.00  0.76           C  
ATOM   1813  C   GLU A 250      40.397 -41.405 -69.837  1.00  0.76           C  
ATOM   1814  O   GLU A 250      41.016 -41.033 -68.837  1.00  0.76           O  
ATOM   1815  CB  GLU A 250      39.214 -43.561 -70.016  1.00  0.76           C  
ATOM   1816  CG  GLU A 250      40.006 -44.190 -68.849  1.00  0.76           C  
ATOM   1817  CD  GLU A 250      40.462 -45.640 -68.944  1.00  0.76           C  
ATOM   1818  OE1 GLU A 250      40.525 -46.237 -67.833  1.00  0.76           O  
ATOM   1819  OE2 GLU A 250      40.845 -46.108 -70.043  1.00  0.76           O  
ATOM   1820  N   ASP A 251      40.828 -41.208 -71.091  1.00  0.80           N  
ATOM   1821  CA  ASP A 251      42.042 -40.556 -71.471  1.00  0.80           C  
ATOM   1822  C   ASP A 251      41.857 -40.147 -72.917  1.00  0.80           C  
ATOM   1823  O   ASP A 251      40.988 -40.680 -73.614  1.00  0.80           O  
ATOM   1824  CB  ASP A 251      43.230 -41.540 -71.350  1.00  0.80           C  
ATOM   1825  CG  ASP A 251      44.216 -41.005 -70.367  1.00  0.80           C  
ATOM   1826  OD1 ASP A 251      44.720 -39.870 -70.583  1.00  0.80           O  
ATOM   1827  OD2 ASP A 251      44.512 -41.670 -69.343  1.00  0.80           O  
ATOM   1828  N   VAL A 252      42.674 -39.193 -73.396  1.00  0.83           N  
ATOM   1829  CA  VAL A 252      42.758 -38.866 -74.809  1.00  0.83           C  
ATOM   1830  C   VAL A 252      44.233 -38.845 -75.155  1.00  0.83           C  
ATOM   1831  O   VAL A 252      44.992 -38.028 -74.639  1.00  0.83           O  
ATOM   1832  CB  VAL A 252      42.107 -37.542 -75.204  1.00  0.83           C  
ATOM   1833  CG1 VAL A 252      42.142 -37.384 -76.740  1.00  0.83           C  
ATOM   1834  CG2 VAL A 252      40.648 -37.503 -74.704  1.00  0.83           C  
ATOM   1835  N   GLU A 253      44.676 -39.768 -76.022  1.00  0.75           N  
ATOM   1836  CA  GLU A 253      46.082 -40.003 -76.285  1.00  0.75           C  
ATOM   1837  C   GLU A 253      46.325 -40.111 -77.787  1.00  0.75           C  
ATOM   1838  O   GLU A 253      45.616 -39.500 -78.588  1.00  0.75           O  
ATOM   1839  CB  GLU A 253      46.546 -41.287 -75.538  1.00  0.75           C  
ATOM   1840  CG  GLU A 253      45.769 -42.565 -75.953  1.00  0.75           C  
ATOM   1841  CD  GLU A 253      46.437 -43.857 -75.507  1.00  0.75           C  
ATOM   1842  OE1 GLU A 253      47.613 -44.080 -75.875  1.00  0.75           O  
ATOM   1843  OE2 GLU A 253      45.740 -44.678 -74.853  1.00  0.75           O  
ATOM   1844  N   GLY A 254      47.349 -40.902 -78.192  1.00  0.79           N  
ATOM   1845  CA  GLY A 254      47.707 -41.231 -79.570  1.00  0.79           C  
ATOM   1846  C   GLY A 254      47.781 -40.094 -80.555  1.00  0.79           C  
ATOM   1847  O   GLY A 254      48.222 -38.987 -80.252  1.00  0.79           O  
ATOM   1848  N   GLU A 255      47.358 -40.359 -81.806  1.00  0.71           N  
ATOM   1849  CA  GLU A 255      47.225 -39.325 -82.813  1.00  0.71           C  
ATOM   1850  C   GLU A 255      46.080 -38.377 -82.510  1.00  0.71           C  
ATOM   1851  O   GLU A 255      46.175 -37.193 -82.817  1.00  0.71           O  
ATOM   1852  CB  GLU A 255      47.156 -39.894 -84.255  1.00  0.71           C  
ATOM   1853  CG  GLU A 255      45.991 -40.867 -84.575  1.00  0.71           C  
ATOM   1854  CD  GLU A 255      44.664 -40.213 -84.957  1.00  0.71           C  
ATOM   1855  OE1 GLU A 255      44.566 -38.964 -85.059  1.00  0.71           O  
ATOM   1856  OE2 GLU A 255      43.705 -41.006 -85.155  1.00  0.71           O  
ATOM   1857  N   ALA A 256      45.012 -38.848 -81.826  1.00  0.72           N  
ATOM   1858  CA  ALA A 256      43.822 -38.071 -81.538  1.00  0.72           C  
ATOM   1859  C   ALA A 256      44.077 -36.786 -80.760  1.00  0.72           C  
ATOM   1860  O   ALA A 256      43.541 -35.728 -81.077  1.00  0.72           O  
ATOM   1861  CB  ALA A 256      42.817 -38.944 -80.765  1.00  0.72           C  
ATOM   1862  N   LEU A 257      44.941 -36.813 -79.728  1.00  0.74           N  
ATOM   1863  CA  LEU A 257      45.330 -35.603 -79.016  1.00  0.74           C  
ATOM   1864  C   LEU A 257      46.088 -34.607 -79.909  1.00  0.74           C  
ATOM   1865  O   LEU A 257      45.819 -33.403 -79.922  1.00  0.74           O  
ATOM   1866  CB  LEU A 257      46.138 -36.006 -77.751  1.00  0.74           C  
ATOM   1867  CG  LEU A 257      46.201 -34.985 -76.587  1.00  0.74           C  
ATOM   1868  CD1 LEU A 257      47.050 -33.741 -76.881  1.00  0.74           C  
ATOM   1869  CD2 LEU A 257      44.807 -34.582 -76.083  1.00  0.74           C  
ATOM   1870  N   ALA A 258      47.026 -35.113 -80.736  1.00  0.73           N  
ATOM   1871  CA  ALA A 258      47.770 -34.340 -81.712  1.00  0.73           C  
ATOM   1872  C   ALA A 258      46.908 -33.748 -82.834  1.00  0.73           C  
ATOM   1873  O   ALA A 258      47.047 -32.586 -83.219  1.00  0.73           O  
ATOM   1874  CB  ALA A 258      48.887 -35.224 -82.303  1.00  0.73           C  
ATOM   1875  N   THR A 259      45.960 -34.527 -83.383  1.00  0.70           N  
ATOM   1876  CA  THR A 259      44.994 -34.061 -84.370  1.00  0.70           C  
ATOM   1877  C   THR A 259      44.025 -33.033 -83.808  1.00  0.70           C  
ATOM   1878  O   THR A 259      43.694 -32.047 -84.467  1.00  0.70           O  
ATOM   1879  CB  THR A 259      44.269 -35.162 -85.133  1.00  0.70           C  
ATOM   1880  OG1 THR A 259      43.652 -36.104 -84.278  1.00  0.70           O  
ATOM   1881  CG2 THR A 259      45.284 -35.938 -85.980  1.00  0.70           C  
ATOM   1882  N   LEU A 260      43.582 -33.184 -82.545  1.00  0.74           N  
ATOM   1883  CA  LEU A 260      42.784 -32.185 -81.848  1.00  0.74           C  
ATOM   1884  C   LEU A 260      43.466 -30.827 -81.681  1.00  0.74           C  
ATOM   1885  O   LEU A 260      42.855 -29.793 -81.955  1.00  0.74           O  
ATOM   1886  CB  LEU A 260      42.303 -32.726 -80.473  1.00  0.74           C  
ATOM   1887  CG  LEU A 260      40.869 -33.307 -80.479  1.00  0.74           C  
ATOM   1888  CD1 LEU A 260      39.826 -32.189 -80.572  1.00  0.74           C  
ATOM   1889  CD2 LEU A 260      40.614 -34.355 -81.574  1.00  0.74           C  
ATOM   1890  N   VAL A 261      44.760 -30.769 -81.283  1.00  0.76           N  
ATOM   1891  CA  VAL A 261      45.473 -29.493 -81.197  1.00  0.76           C  
ATOM   1892  C   VAL A 261      45.644 -28.789 -82.540  1.00  0.76           C  
ATOM   1893  O   VAL A 261      45.425 -27.581 -82.645  1.00  0.76           O  
ATOM   1894  CB  VAL A 261      46.790 -29.554 -80.420  1.00  0.76           C  
ATOM   1895  CG1 VAL A 261      47.862 -30.422 -81.095  1.00  0.76           C  
ATOM   1896  CG2 VAL A 261      47.341 -28.135 -80.194  1.00  0.76           C  
ATOM   1897  N   VAL A 262      45.981 -29.513 -83.633  1.00  0.73           N  
ATOM   1898  CA  VAL A 262      46.082 -28.890 -84.949  1.00  0.73           C  
ATOM   1899  C   VAL A 262      44.750 -28.358 -85.457  1.00  0.73           C  
ATOM   1900  O   VAL A 262      44.686 -27.318 -86.102  1.00  0.73           O  
ATOM   1901  CB  VAL A 262      46.800 -29.700 -86.025  1.00  0.73           C  
ATOM   1902  CG1 VAL A 262      48.211 -30.053 -85.521  1.00  0.73           C  
ATOM   1903  CG2 VAL A 262      46.028 -30.970 -86.406  1.00  0.73           C  
ATOM   1904  N   ASN A 263      43.624 -29.028 -85.157  1.00  0.72           N  
ATOM   1905  CA  ASN A 263      42.304 -28.485 -85.433  1.00  0.72           C  
ATOM   1906  C   ASN A 263      41.974 -27.223 -84.633  1.00  0.72           C  
ATOM   1907  O   ASN A 263      41.439 -26.259 -85.180  1.00  0.72           O  
ATOM   1908  CB  ASN A 263      41.228 -29.574 -85.233  1.00  0.72           C  
ATOM   1909  CG  ASN A 263      41.403 -30.621 -86.329  1.00  0.72           C  
ATOM   1910  OD1 ASN A 263      41.801 -30.316 -87.462  1.00  0.72           O  
ATOM   1911  ND2 ASN A 263      41.094 -31.894 -86.000  1.00  0.72           N  
ATOM   1912  N   ALA A 264      42.327 -27.181 -83.335  1.00  0.76           N  
ATOM   1913  CA  ALA A 264      42.157 -26.006 -82.502  1.00  0.76           C  
ATOM   1914  C   ALA A 264      42.959 -24.778 -82.933  1.00  0.76           C  
ATOM   1915  O   ALA A 264      42.422 -23.673 -83.001  1.00  0.76           O  
ATOM   1916  CB  ALA A 264      42.522 -26.367 -81.052  1.00  0.76           C  
ATOM   1917  N   ILE A 265      44.257 -24.945 -83.270  1.00  0.66           N  
ATOM   1918  CA  ILE A 265      45.132 -23.850 -83.691  1.00  0.66           C  
ATOM   1919  C   ILE A 265      44.735 -23.238 -85.036  1.00  0.66           C  
ATOM   1920  O   ILE A 265      44.885 -22.042 -85.269  1.00  0.66           O  
ATOM   1921  CB  ILE A 265      46.612 -24.250 -83.636  1.00  0.66           C  
ATOM   1922  CG1 ILE A 265      47.574 -23.041 -83.549  1.00  0.66           C  
ATOM   1923  CG2 ILE A 265      46.997 -25.151 -84.825  1.00  0.66           C  
ATOM   1924  CD1 ILE A 265      47.538 -22.320 -82.196  1.00  0.66           C  
ATOM   1925  N   ARG A 266      44.158 -24.045 -85.955  1.00  0.58           N  
ATOM   1926  CA  ARG A 266      43.639 -23.565 -87.228  1.00  0.58           C  
ATOM   1927  C   ARG A 266      42.304 -22.840 -87.102  1.00  0.58           C  
ATOM   1928  O   ARG A 266      41.878 -22.174 -88.042  1.00  0.58           O  
ATOM   1929  CB  ARG A 266      43.362 -24.751 -88.185  1.00  0.58           C  
ATOM   1930  CG  ARG A 266      44.596 -25.545 -88.652  1.00  0.58           C  
ATOM   1931  CD  ARG A 266      44.163 -26.902 -89.221  1.00  0.58           C  
ATOM   1932  NE  ARG A 266      45.387 -27.729 -89.456  1.00  0.58           N  
ATOM   1933  CZ  ARG A 266      45.367 -29.063 -89.582  1.00  0.58           C  
ATOM   1934  NH1 ARG A 266      44.255 -29.774 -89.410  1.00  0.58           N  
ATOM   1935  NH2 ARG A 266      46.496 -29.705 -89.880  1.00  0.58           N  
ATOM   1936  N   LYS A 267      41.599 -23.006 -85.960  1.00  0.63           N  
ATOM   1937  CA  LYS A 267      40.293 -22.427 -85.686  1.00  0.63           C  
ATOM   1938  C   LYS A 267      39.164 -23.059 -86.513  1.00  0.63           C  
ATOM   1939  O   LYS A 267      38.132 -22.452 -86.785  1.00  0.63           O  
ATOM   1940  CB  LYS A 267      40.330 -20.872 -85.768  1.00  0.63           C  
ATOM   1941  CG  LYS A 267      39.177 -20.128 -85.073  1.00  0.63           C  
ATOM   1942  CD  LYS A 267      39.254 -18.613 -85.322  1.00  0.63           C  
ATOM   1943  CE  LYS A 267      37.979 -17.876 -84.908  1.00  0.63           C  
ATOM   1944  NZ  LYS A 267      38.103 -16.436 -85.224  1.00  0.63           N  
ATOM   1945  N   THR A 268      39.310 -24.346 -86.900  1.00  0.70           N  
ATOM   1946  CA  THR A 268      38.218 -25.127 -87.501  1.00  0.70           C  
ATOM   1947  C   THR A 268      37.186 -25.512 -86.443  1.00  0.70           C  
ATOM   1948  O   THR A 268      35.980 -25.479 -86.671  1.00  0.70           O  
ATOM   1949  CB  THR A 268      38.694 -26.298 -88.381  1.00  0.70           C  
ATOM   1950  OG1 THR A 268      37.651 -27.196 -88.734  1.00  0.70           O  
ATOM   1951  CG2 THR A 268      39.798 -27.120 -87.711  1.00  0.70           C  
ATOM   1952  N   LEU A 269      37.642 -25.797 -85.210  1.00  0.72           N  
ATOM   1953  CA  LEU A 269      36.760 -25.904 -84.070  1.00  0.72           C  
ATOM   1954  C   LEU A 269      37.558 -25.555 -82.829  1.00  0.72           C  
ATOM   1955  O   LEU A 269      38.778 -25.423 -82.872  1.00  0.72           O  
ATOM   1956  CB  LEU A 269      35.986 -27.261 -83.936  1.00  0.72           C  
ATOM   1957  CG  LEU A 269      36.747 -28.619 -83.914  1.00  0.72           C  
ATOM   1958  CD1 LEU A 269      37.205 -29.076 -85.306  1.00  0.72           C  
ATOM   1959  CD2 LEU A 269      37.901 -28.710 -82.905  1.00  0.72           C  
ATOM   1960  N   LYS A 270      36.893 -25.379 -81.673  1.00  0.71           N  
ATOM   1961  CA  LYS A 270      37.571 -25.253 -80.396  1.00  0.71           C  
ATOM   1962  C   LYS A 270      37.191 -26.468 -79.580  1.00  0.71           C  
ATOM   1963  O   LYS A 270      36.034 -26.627 -79.197  1.00  0.71           O  
ATOM   1964  CB  LYS A 270      37.139 -23.984 -79.607  1.00  0.71           C  
ATOM   1965  CG  LYS A 270      37.890 -22.685 -79.962  1.00  0.71           C  
ATOM   1966  CD  LYS A 270      39.388 -22.742 -79.594  1.00  0.71           C  
ATOM   1967  CE  LYS A 270      40.073 -21.395 -79.302  1.00  0.71           C  
ATOM   1968  NZ  LYS A 270      39.589 -20.832 -78.021  1.00  0.71           N  
ATOM   1969  N   ALA A 271      38.157 -27.357 -79.286  1.00  0.76           N  
ATOM   1970  CA  ALA A 271      37.877 -28.543 -78.515  1.00  0.76           C  
ATOM   1971  C   ALA A 271      39.011 -28.856 -77.559  1.00  0.76           C  
ATOM   1972  O   ALA A 271      40.186 -28.812 -77.915  1.00  0.76           O  
ATOM   1973  CB  ALA A 271      37.589 -29.747 -79.428  1.00  0.76           C  
ATOM   1974  N   VAL A 272      38.652 -29.163 -76.301  1.00  0.83           N  
ATOM   1975  CA  VAL A 272      39.578 -29.387 -75.205  1.00  0.83           C  
ATOM   1976  C   VAL A 272      39.411 -30.804 -74.690  1.00  0.83           C  
ATOM   1977  O   VAL A 272      38.304 -31.335 -74.627  1.00  0.83           O  
ATOM   1978  CB  VAL A 272      39.377 -28.363 -74.088  1.00  0.83           C  
ATOM   1979  CG1 VAL A 272      37.921 -28.332 -73.598  1.00  0.83           C  
ATOM   1980  CG2 VAL A 272      40.348 -28.576 -72.911  1.00  0.83           C  
ATOM   1981  N   ALA A 273      40.528 -31.468 -74.333  1.00  0.86           N  
ATOM   1982  CA  ALA A 273      40.535 -32.841 -73.881  1.00  0.86           C  
ATOM   1983  C   ALA A 273      41.051 -32.943 -72.453  1.00  0.86           C  
ATOM   1984  O   ALA A 273      42.067 -32.340 -72.095  1.00  0.86           O  
ATOM   1985  CB  ALA A 273      41.425 -33.683 -74.812  1.00  0.86           C  
ATOM   1986  N   VAL A 274      40.343 -33.719 -71.608  1.00  0.83           N  
ATOM   1987  CA  VAL A 274      40.661 -33.893 -70.202  1.00  0.83           C  
ATOM   1988  C   VAL A 274      40.346 -35.327 -69.773  1.00  0.83           C  
ATOM   1989  O   VAL A 274      39.376 -35.943 -70.216  1.00  0.83           O  
ATOM   1990  CB  VAL A 274      39.938 -32.851 -69.340  1.00  0.83           C  
ATOM   1991  CG1 VAL A 274      38.408 -32.947 -69.467  1.00  0.83           C  
ATOM   1992  CG2 VAL A 274      40.348 -32.949 -67.863  1.00  0.83           C  
ATOM   1993  N   LYS A 275      41.197 -35.939 -68.915  1.00  0.77           N  
ATOM   1994  CA  LYS A 275      40.890 -37.212 -68.271  1.00  0.77           C  
ATOM   1995  C   LYS A 275      39.711 -37.092 -67.305  1.00  0.77           C  
ATOM   1996  O   LYS A 275      39.625 -36.156 -66.512  1.00  0.77           O  
ATOM   1997  CB  LYS A 275      42.080 -37.752 -67.427  1.00  0.77           C  
ATOM   1998  CG  LYS A 275      43.349 -38.159 -68.192  1.00  0.77           C  
ATOM   1999  CD  LYS A 275      44.580 -38.164 -67.260  1.00  0.77           C  
ATOM   2000  CE  LYS A 275      45.950 -38.438 -67.908  1.00  0.77           C  
ATOM   2001  NZ  LYS A 275      46.081 -39.835 -68.323  1.00  0.77           N  
ATOM   2002  N   GLY A 276      38.779 -38.062 -67.309  1.00  0.83           N  
ATOM   2003  CA  GLY A 276      37.718 -38.158 -66.314  1.00  0.83           C  
ATOM   2004  C   GLY A 276      38.209 -38.246 -64.879  1.00  0.83           C  
ATOM   2005  O   GLY A 276      39.266 -38.834 -64.637  1.00  0.83           O  
ATOM   2006  N   PRO A 277      37.495 -37.714 -63.894  1.00  0.74           N  
ATOM   2007  CA  PRO A 277      37.924 -37.752 -62.502  1.00  0.74           C  
ATOM   2008  C   PRO A 277      37.802 -39.146 -61.892  1.00  0.74           C  
ATOM   2009  O   PRO A 277      36.937 -39.920 -62.292  1.00  0.74           O  
ATOM   2010  CB  PRO A 277      37.009 -36.715 -61.824  1.00  0.74           C  
ATOM   2011  CG  PRO A 277      35.731 -36.717 -62.667  1.00  0.74           C  
ATOM   2012  CD  PRO A 277      36.256 -36.951 -64.080  1.00  0.74           C  
ATOM   2013  N   TYR A 278      38.667 -39.471 -60.904  1.00  0.68           N  
ATOM   2014  CA  TYR A 278      38.788 -40.774 -60.252  1.00  0.68           C  
ATOM   2015  C   TYR A 278      39.194 -41.924 -61.199  1.00  0.68           C  
ATOM   2016  O   TYR A 278      39.742 -41.693 -62.271  1.00  0.68           O  
ATOM   2017  CB  TYR A 278      37.560 -41.116 -59.340  1.00  0.68           C  
ATOM   2018  CG  TYR A 278      37.290 -40.014 -58.332  1.00  0.68           C  
ATOM   2019  CD1 TYR A 278      37.740 -40.064 -56.994  1.00  0.68           C  
ATOM   2020  CD2 TYR A 278      36.570 -38.883 -58.744  1.00  0.68           C  
ATOM   2021  CE1 TYR A 278      37.482 -38.997 -56.109  1.00  0.68           C  
ATOM   2022  CE2 TYR A 278      36.396 -37.788 -57.894  1.00  0.68           C  
ATOM   2023  CZ  TYR A 278      36.800 -37.861 -56.562  1.00  0.68           C  
ATOM   2024  OH  TYR A 278      36.449 -36.804 -55.696  1.00  0.68           O  
ATOM   2025  N   PHE A 279      39.017 -43.205 -60.784  1.00  0.55           N  
ATOM   2026  CA  PHE A 279      39.618 -44.359 -61.465  1.00  0.55           C  
ATOM   2027  C   PHE A 279      38.611 -45.349 -62.062  1.00  0.55           C  
ATOM   2028  O   PHE A 279      38.250 -45.247 -63.230  1.00  0.55           O  
ATOM   2029  CB  PHE A 279      40.572 -45.113 -60.495  1.00  0.55           C  
ATOM   2030  CG  PHE A 279      41.934 -44.478 -60.518  1.00  0.55           C  
ATOM   2031  CD1 PHE A 279      42.850 -44.873 -61.507  1.00  0.55           C  
ATOM   2032  CD2 PHE A 279      42.325 -43.515 -59.573  1.00  0.55           C  
ATOM   2033  CE1 PHE A 279      44.138 -44.327 -61.548  1.00  0.55           C  
ATOM   2034  CE2 PHE A 279      43.614 -42.964 -59.611  1.00  0.55           C  
ATOM   2035  CZ  PHE A 279      44.520 -43.372 -60.598  1.00  0.55           C  
ATOM   2036  N   GLY A 280      38.155 -46.366 -61.289  1.00  0.66           N  
ATOM   2037  CA  GLY A 280      37.241 -47.411 -61.774  1.00  0.66           C  
ATOM   2038  C   GLY A 280      35.792 -47.037 -61.609  1.00  0.66           C  
ATOM   2039  O   GLY A 280      35.322 -46.044 -62.156  1.00  0.66           O  
ATOM   2040  N   ASP A 281      35.032 -47.802 -60.806  1.00  0.73           N  
ATOM   2041  CA  ASP A 281      33.619 -47.595 -60.530  1.00  0.73           C  
ATOM   2042  C   ASP A 281      33.269 -46.213 -59.993  1.00  0.73           C  
ATOM   2043  O   ASP A 281      32.232 -45.628 -60.308  1.00  0.73           O  
ATOM   2044  CB  ASP A 281      33.109 -48.699 -59.590  1.00  0.73           C  
ATOM   2045  CG  ASP A 281      33.338 -49.992 -60.340  1.00  0.73           C  
ATOM   2046  OD1 ASP A 281      34.498 -50.478 -60.283  1.00  0.73           O  
ATOM   2047  OD2 ASP A 281      32.397 -50.412 -61.056  1.00  0.73           O  
ATOM   2048  N   ARG A 282      34.198 -45.615 -59.223  1.00  0.68           N  
ATOM   2049  CA  ARG A 282      34.135 -44.222 -58.826  1.00  0.68           C  
ATOM   2050  C   ARG A 282      34.066 -43.252 -60.011  1.00  0.68           C  
ATOM   2051  O   ARG A 282      33.279 -42.315 -59.981  1.00  0.68           O  
ATOM   2052  CB  ARG A 282      35.350 -43.852 -57.926  1.00  0.68           C  
ATOM   2053  CG  ARG A 282      35.306 -44.507 -56.528  1.00  0.68           C  
ATOM   2054  CD  ARG A 282      36.417 -44.057 -55.560  1.00  0.68           C  
ATOM   2055  NE  ARG A 282      37.677 -44.813 -55.899  1.00  0.68           N  
ATOM   2056  CZ  ARG A 282      38.241 -45.769 -55.142  1.00  0.68           C  
ATOM   2057  NH1 ARG A 282      37.741 -46.140 -53.968  1.00  0.68           N  
ATOM   2058  NH2 ARG A 282      39.351 -46.371 -55.570  1.00  0.68           N  
ATOM   2059  N   ARG A 283      34.853 -43.468 -61.089  1.00  0.70           N  
ATOM   2060  CA  ARG A 283      34.851 -42.637 -62.287  1.00  0.70           C  
ATOM   2061  C   ARG A 283      33.585 -42.739 -63.115  1.00  0.70           C  
ATOM   2062  O   ARG A 283      33.031 -41.730 -63.542  1.00  0.70           O  
ATOM   2063  CB  ARG A 283      36.066 -42.982 -63.177  1.00  0.70           C  
ATOM   2064  CG  ARG A 283      36.173 -42.203 -64.505  1.00  0.70           C  
ATOM   2065  CD  ARG A 283      37.609 -41.854 -64.926  1.00  0.70           C  
ATOM   2066  NE  ARG A 283      38.416 -43.109 -64.998  1.00  0.70           N  
ATOM   2067  CZ  ARG A 283      39.635 -43.178 -65.550  1.00  0.70           C  
ATOM   2068  NH1 ARG A 283      40.214 -42.102 -66.074  1.00  0.70           N  
ATOM   2069  NH2 ARG A 283      40.235 -44.364 -65.635  1.00  0.70           N  
ATOM   2070  N   LYS A 284      33.056 -43.959 -63.347  1.00  0.77           N  
ATOM   2071  CA  LYS A 284      31.792 -44.125 -64.055  1.00  0.77           C  
ATOM   2072  C   LYS A 284      30.601 -43.541 -63.308  1.00  0.77           C  
ATOM   2073  O   LYS A 284      29.710 -42.959 -63.918  1.00  0.77           O  
ATOM   2074  CB  LYS A 284      31.550 -45.567 -64.584  1.00  0.77           C  
ATOM   2075  CG  LYS A 284      31.683 -46.728 -63.585  1.00  0.77           C  
ATOM   2076  CD  LYS A 284      30.440 -47.061 -62.734  1.00  0.77           C  
ATOM   2077  CE  LYS A 284      29.541 -48.169 -63.302  1.00  0.77           C  
ATOM   2078  NZ  LYS A 284      29.002 -47.787 -64.628  1.00  0.77           N  
ATOM   2079  N   ALA A 285      30.575 -43.626 -61.960  1.00  0.82           N  
ATOM   2080  CA  ALA A 285      29.620 -42.886 -61.156  1.00  0.82           C  
ATOM   2081  C   ALA A 285      29.781 -41.367 -61.262  1.00  0.82           C  
ATOM   2082  O   ALA A 285      28.811 -40.642 -61.462  1.00  0.82           O  
ATOM   2083  CB  ALA A 285      29.751 -43.326 -59.685  1.00  0.82           C  
ATOM   2084  N   PHE A 286      31.027 -40.857 -61.189  1.00  0.78           N  
ATOM   2085  CA  PHE A 286      31.339 -39.441 -61.312  1.00  0.78           C  
ATOM   2086  C   PHE A 286      30.986 -38.833 -62.663  1.00  0.78           C  
ATOM   2087  O   PHE A 286      30.481 -37.717 -62.760  1.00  0.78           O  
ATOM   2088  CB  PHE A 286      32.851 -39.207 -61.045  1.00  0.78           C  
ATOM   2089  CG  PHE A 286      33.011 -38.158 -59.995  1.00  0.78           C  
ATOM   2090  CD1 PHE A 286      32.917 -36.803 -60.334  1.00  0.78           C  
ATOM   2091  CD2 PHE A 286      33.193 -38.523 -58.653  1.00  0.78           C  
ATOM   2092  CE1 PHE A 286      33.008 -35.818 -59.346  1.00  0.78           C  
ATOM   2093  CE2 PHE A 286      33.294 -37.540 -57.662  1.00  0.78           C  
ATOM   2094  CZ  PHE A 286      33.193 -36.187 -58.005  1.00  0.78           C  
ATOM   2095  N   LEU A 287      31.251 -39.559 -63.762  1.00  0.83           N  
ATOM   2096  CA  LEU A 287      30.903 -39.151 -65.110  1.00  0.83           C  
ATOM   2097  C   LEU A 287      29.391 -39.049 -65.326  1.00  0.83           C  
ATOM   2098  O   LEU A 287      28.901 -38.131 -65.982  1.00  0.83           O  
ATOM   2099  CB  LEU A 287      31.590 -40.099 -66.125  1.00  0.83           C  
ATOM   2100  CG  LEU A 287      31.742 -39.541 -67.555  1.00  0.83           C  
ATOM   2101  CD1 LEU A 287      32.623 -38.286 -67.614  1.00  0.83           C  
ATOM   2102  CD2 LEU A 287      32.348 -40.601 -68.481  1.00  0.83           C  
ATOM   2103  N   GLU A 288      28.614 -39.968 -64.714  1.00  0.82           N  
ATOM   2104  CA  GLU A 288      27.160 -39.908 -64.635  1.00  0.82           C  
ATOM   2105  C   GLU A 288      26.646 -38.681 -63.878  1.00  0.82           C  
ATOM   2106  O   GLU A 288      25.716 -37.987 -64.293  1.00  0.82           O  
ATOM   2107  CB  GLU A 288      26.639 -41.192 -63.945  1.00  0.82           C  
ATOM   2108  CG  GLU A 288      25.170 -41.524 -64.289  1.00  0.82           C  
ATOM   2109  CD  GLU A 288      25.075 -42.080 -65.709  1.00  0.82           C  
ATOM   2110  OE1 GLU A 288      25.585 -43.214 -65.917  1.00  0.82           O  
ATOM   2111  OE2 GLU A 288      24.514 -41.379 -66.588  1.00  0.82           O  
ATOM   2112  N   ASP A 289      27.298 -38.338 -62.749  1.00  0.80           N  
ATOM   2113  CA  ASP A 289      27.043 -37.125 -61.991  1.00  0.80           C  
ATOM   2114  C   ASP A 289      27.326 -35.850 -62.800  1.00  0.80           C  
ATOM   2115  O   ASP A 289      26.597 -34.863 -62.712  1.00  0.80           O  
ATOM   2116  CB  ASP A 289      27.850 -37.112 -60.667  1.00  0.80           C  
ATOM   2117  CG  ASP A 289      27.426 -38.190 -59.692  1.00  0.80           C  
ATOM   2118  OD1 ASP A 289      26.523 -39.018 -59.974  1.00  0.80           O  
ATOM   2119  OD2 ASP A 289      28.000 -38.210 -58.576  1.00  0.80           O  
ATOM   2120  N   LEU A 290      28.372 -35.837 -63.654  1.00  0.84           N  
ATOM   2121  CA  LEU A 290      28.565 -34.775 -64.634  1.00  0.84           C  
ATOM   2122  C   LEU A 290      27.436 -34.680 -65.665  1.00  0.84           C  
ATOM   2123  O   LEU A 290      27.008 -33.582 -66.017  1.00  0.84           O  
ATOM   2124  CB  LEU A 290      29.916 -34.879 -65.396  1.00  0.84           C  
ATOM   2125  CG  LEU A 290      31.193 -34.774 -64.532  1.00  0.84           C  
ATOM   2126  CD1 LEU A 290      32.445 -34.774 -65.423  1.00  0.84           C  
ATOM   2127  CD2 LEU A 290      31.217 -33.519 -63.651  1.00  0.84           C  
ATOM   2128  N   ALA A 291      26.912 -35.820 -66.165  1.00  0.89           N  
ATOM   2129  CA  ALA A 291      25.857 -35.864 -67.166  1.00  0.89           C  
ATOM   2130  C   ALA A 291      24.558 -35.200 -66.755  1.00  0.89           C  
ATOM   2131  O   ALA A 291      23.986 -34.407 -67.500  1.00  0.89           O  
ATOM   2132  CB  ALA A 291      25.556 -37.327 -67.548  1.00  0.89           C  
ATOM   2133  N   VAL A 292      24.082 -35.454 -65.524  1.00  0.85           N  
ATOM   2134  CA  VAL A 292      22.856 -34.853 -65.023  1.00  0.85           C  
ATOM   2135  C   VAL A 292      22.916 -33.325 -64.915  1.00  0.85           C  
ATOM   2136  O   VAL A 292      21.957 -32.625 -65.231  1.00  0.85           O  
ATOM   2137  CB  VAL A 292      22.383 -35.534 -63.743  1.00  0.85           C  
ATOM   2138  CG1 VAL A 292      23.288 -35.228 -62.536  1.00  0.85           C  
ATOM   2139  CG2 VAL A 292      20.922 -35.149 -63.467  1.00  0.85           C  
ATOM   2140  N   VAL A 293      24.078 -32.766 -64.513  1.00  0.84           N  
ATOM   2141  CA  VAL A 293      24.345 -31.332 -64.487  1.00  0.84           C  
ATOM   2142  C   VAL A 293      24.376 -30.700 -65.868  1.00  0.84           C  
ATOM   2143  O   VAL A 293      23.919 -29.577 -66.067  1.00  0.84           O  
ATOM   2144  CB  VAL A 293      25.655 -31.015 -63.769  1.00  0.84           C  
ATOM   2145  CG1 VAL A 293      25.923 -29.495 -63.712  1.00  0.84           C  
ATOM   2146  CG2 VAL A 293      25.564 -31.558 -62.336  1.00  0.84           C  
ATOM   2147  N   THR A 294      24.938 -31.386 -66.878  1.00  0.86           N  
ATOM   2148  CA  THR A 294      25.125 -30.787 -68.196  1.00  0.86           C  
ATOM   2149  C   THR A 294      23.978 -31.075 -69.142  1.00  0.86           C  
ATOM   2150  O   THR A 294      23.842 -30.419 -70.171  1.00  0.86           O  
ATOM   2151  CB  THR A 294      26.428 -31.229 -68.852  1.00  0.86           C  
ATOM   2152  OG1 THR A 294      26.476 -32.632 -69.073  1.00  0.86           O  
ATOM   2153  CG2 THR A 294      27.600 -30.876 -67.924  1.00  0.86           C  
ATOM   2154  N   GLY A 295      23.096 -32.034 -68.801  1.00  0.88           N  
ATOM   2155  CA  GLY A 295      21.931 -32.411 -69.597  1.00  0.88           C  
ATOM   2156  C   GLY A 295      22.207 -33.427 -70.674  1.00  0.88           C  
ATOM   2157  O   GLY A 295      21.314 -33.787 -71.433  1.00  0.88           O  
ATOM   2158  N   GLY A 296      23.457 -33.917 -70.763  1.00  0.90           N  
ATOM   2159  CA  GLY A 296      23.853 -34.954 -71.710  1.00  0.90           C  
ATOM   2160  C   GLY A 296      23.584 -36.356 -71.234  1.00  0.90           C  
ATOM   2161  O   GLY A 296      23.010 -36.595 -70.176  1.00  0.90           O  
ATOM   2162  N   GLN A 297      24.060 -37.346 -72.005  1.00  0.84           N  
ATOM   2163  CA  GLN A 297      24.084 -38.735 -71.585  1.00  0.84           C  
ATOM   2164  C   GLN A 297      25.523 -39.206 -71.621  1.00  0.84           C  
ATOM   2165  O   GLN A 297      26.355 -38.680 -72.360  1.00  0.84           O  
ATOM   2166  CB  GLN A 297      23.213 -39.658 -72.483  1.00  0.84           C  
ATOM   2167  CG  GLN A 297      23.720 -39.757 -73.940  1.00  0.84           C  
ATOM   2168  CD  GLN A 297      22.849 -40.609 -74.860  1.00  0.84           C  
ATOM   2169  OE1 GLN A 297      23.284 -41.629 -75.392  1.00  0.84           O  
ATOM   2170  NE2 GLN A 297      21.595 -40.167 -75.103  1.00  0.84           N  
ATOM   2171  N   VAL A 298      25.876 -40.218 -70.813  1.00  0.89           N  
ATOM   2172  CA  VAL A 298      27.210 -40.780 -70.864  1.00  0.89           C  
ATOM   2173  C   VAL A 298      27.293 -41.855 -71.933  1.00  0.89           C  
ATOM   2174  O   VAL A 298      26.596 -42.867 -71.869  1.00  0.89           O  
ATOM   2175  CB  VAL A 298      27.641 -41.388 -69.540  1.00  0.89           C  
ATOM   2176  CG1 VAL A 298      29.150 -41.661 -69.604  1.00  0.89           C  
ATOM   2177  CG2 VAL A 298      27.352 -40.425 -68.380  1.00  0.89           C  
ATOM   2178  N   VAL A 299      28.168 -41.699 -72.952  1.00  0.84           N  
ATOM   2179  CA  VAL A 299      28.342 -42.754 -73.937  1.00  0.84           C  
ATOM   2180  C   VAL A 299      29.287 -43.819 -73.401  1.00  0.84           C  
ATOM   2181  O   VAL A 299      30.391 -43.562 -72.917  1.00  0.84           O  
ATOM   2182  CB  VAL A 299      28.683 -42.299 -75.354  1.00  0.84           C  
ATOM   2183  CG1 VAL A 299      27.507 -41.455 -75.880  1.00  0.84           C  
ATOM   2184  CG2 VAL A 299      29.991 -41.500 -75.426  1.00  0.84           C  
ATOM   2185  N   ASN A 300      28.801 -45.072 -73.395  1.00  0.79           N  
ATOM   2186  CA  ASN A 300      29.469 -46.173 -72.746  1.00  0.79           C  
ATOM   2187  C   ASN A 300      29.550 -47.363 -73.709  1.00  0.79           C  
ATOM   2188  O   ASN A 300      28.518 -47.986 -73.973  1.00  0.79           O  
ATOM   2189  CB  ASN A 300      28.667 -46.537 -71.461  1.00  0.79           C  
ATOM   2190  CG  ASN A 300      29.458 -47.510 -70.596  1.00  0.79           C  
ATOM   2191  OD1 ASN A 300      30.676 -47.580 -70.749  1.00  0.79           O  
ATOM   2192  ND2 ASN A 300      28.772 -48.273 -69.721  1.00  0.79           N  
ATOM   2193  N   PRO A 301      30.721 -47.730 -74.224  1.00  0.76           N  
ATOM   2194  CA  PRO A 301      30.935 -48.960 -74.989  1.00  0.76           C  
ATOM   2195  C   PRO A 301      30.621 -50.250 -74.251  1.00  0.76           C  
ATOM   2196  O   PRO A 301      30.183 -51.201 -74.895  1.00  0.76           O  
ATOM   2197  CB  PRO A 301      32.401 -48.859 -75.421  1.00  0.76           C  
ATOM   2198  CG  PRO A 301      32.588 -47.355 -75.626  1.00  0.76           C  
ATOM   2199  CD  PRO A 301      31.810 -46.773 -74.447  1.00  0.76           C  
ATOM   2200  N   ASP A 302      30.783 -50.296 -72.912  1.00  0.68           N  
ATOM   2201  CA  ASP A 302      30.336 -51.367 -72.023  1.00  0.68           C  
ATOM   2202  C   ASP A 302      28.817 -51.592 -72.144  1.00  0.68           C  
ATOM   2203  O   ASP A 302      28.317 -52.713 -72.190  1.00  0.68           O  
ATOM   2204  CB  ASP A 302      30.855 -50.975 -70.602  1.00  0.68           C  
ATOM   2205  CG  ASP A 302      30.098 -51.533 -69.398  1.00  0.68           C  
ATOM   2206  OD1 ASP A 302      30.217 -52.747 -69.122  1.00  0.68           O  
ATOM   2207  OD2 ASP A 302      29.410 -50.708 -68.730  1.00  0.68           O  
ATOM   2208  N   ALA A 303      28.046 -50.503 -72.329  1.00  0.75           N  
ATOM   2209  CA  ALA A 303      26.616 -50.563 -72.549  1.00  0.75           C  
ATOM   2210  C   ALA A 303      26.256 -50.668 -74.036  1.00  0.75           C  
ATOM   2211  O   ALA A 303      25.111 -50.464 -74.431  1.00  0.75           O  
ATOM   2212  CB  ALA A 303      25.959 -49.307 -71.943  1.00  0.75           C  
ATOM   2213  N   GLY A 304      27.234 -51.013 -74.903  1.00  0.73           N  
ATOM   2214  CA  GLY A 304      27.023 -51.283 -76.321  1.00  0.73           C  
ATOM   2215  C   GLY A 304      27.006 -50.091 -77.239  1.00  0.73           C  
ATOM   2216  O   GLY A 304      26.771 -50.242 -78.431  1.00  0.73           O  
ATOM   2217  N   MET A 305      27.265 -48.872 -76.735  1.00  0.68           N  
ATOM   2218  CA  MET A 305      27.194 -47.669 -77.549  1.00  0.68           C  
ATOM   2219  C   MET A 305      28.562 -47.257 -78.074  1.00  0.68           C  
ATOM   2220  O   MET A 305      29.480 -46.970 -77.307  1.00  0.68           O  
ATOM   2221  CB  MET A 305      26.629 -46.487 -76.727  1.00  0.68           C  
ATOM   2222  CG  MET A 305      25.168 -46.687 -76.287  1.00  0.68           C  
ATOM   2223  SD  MET A 305      24.546 -45.316 -75.266  1.00  0.68           S  
ATOM   2224  CE  MET A 305      25.209 -45.940 -73.696  1.00  0.68           C  
ATOM   2225  N   VAL A 306      28.742 -47.189 -79.408  1.00  0.71           N  
ATOM   2226  CA  VAL A 306      29.995 -46.731 -79.994  1.00  0.71           C  
ATOM   2227  C   VAL A 306      30.028 -45.207 -80.095  1.00  0.71           C  
ATOM   2228  O   VAL A 306      29.014 -44.535 -80.273  1.00  0.71           O  
ATOM   2229  CB  VAL A 306      30.285 -47.408 -81.337  1.00  0.71           C  
ATOM   2230  CG1 VAL A 306      29.340 -46.899 -82.435  1.00  0.71           C  
ATOM   2231  CG2 VAL A 306      31.762 -47.261 -81.757  1.00  0.71           C  
ATOM   2232  N   LEU A 307      31.225 -44.593 -79.992  1.00  0.74           N  
ATOM   2233  CA  LEU A 307      31.393 -43.148 -80.047  1.00  0.74           C  
ATOM   2234  C   LEU A 307      31.060 -42.559 -81.422  1.00  0.74           C  
ATOM   2235  O   LEU A 307      30.652 -41.410 -81.563  1.00  0.74           O  
ATOM   2236  CB  LEU A 307      32.842 -42.813 -79.612  1.00  0.74           C  
ATOM   2237  CG  LEU A 307      33.206 -41.315 -79.520  1.00  0.74           C  
ATOM   2238  CD1 LEU A 307      32.253 -40.531 -78.607  1.00  0.74           C  
ATOM   2239  CD2 LEU A 307      34.644 -41.157 -79.006  1.00  0.74           C  
ATOM   2240  N   ARG A 308      31.151 -43.384 -82.480  1.00  0.71           N  
ATOM   2241  CA  ARG A 308      30.891 -42.993 -83.851  1.00  0.71           C  
ATOM   2242  C   ARG A 308      29.408 -42.774 -84.197  1.00  0.71           C  
ATOM   2243  O   ARG A 308      29.080 -42.194 -85.229  1.00  0.71           O  
ATOM   2244  CB  ARG A 308      31.479 -44.085 -84.780  1.00  0.71           C  
ATOM   2245  CG  ARG A 308      31.726 -43.612 -86.227  1.00  0.71           C  
ATOM   2246  CD  ARG A 308      31.996 -44.738 -87.226  1.00  0.71           C  
ATOM   2247  NE  ARG A 308      30.675 -45.437 -87.431  1.00  0.71           N  
ATOM   2248  CZ  ARG A 308      30.062 -45.629 -88.606  1.00  0.71           C  
ATOM   2249  NH1 ARG A 308      30.646 -45.333 -89.762  1.00  0.71           N  
ATOM   2250  NH2 ARG A 308      28.829 -46.136 -88.622  1.00  0.71           N  
ATOM   2251  N   GLU A 309      28.460 -43.226 -83.349  1.00  0.75           N  
ATOM   2252  CA  GLU A 309      27.027 -43.080 -83.599  1.00  0.75           C  
ATOM   2253  C   GLU A 309      26.460 -41.842 -82.923  1.00  0.75           C  
ATOM   2254  O   GLU A 309      25.268 -41.543 -82.983  1.00  0.75           O  
ATOM   2255  CB  GLU A 309      26.291 -44.338 -83.085  1.00  0.75           C  
ATOM   2256  CG  GLU A 309      26.429 -45.516 -84.079  1.00  0.75           C  
ATOM   2257  CD  GLU A 309      26.096 -46.884 -83.491  1.00  0.75           C  
ATOM   2258  OE1 GLU A 309      25.820 -46.983 -82.270  1.00  0.75           O  
ATOM   2259  OE2 GLU A 309      26.204 -47.853 -84.287  1.00  0.75           O  
ATOM   2260  N   VAL A 310      27.329 -41.063 -82.265  1.00  0.75           N  
ATOM   2261  CA  VAL A 310      26.981 -39.831 -81.594  1.00  0.75           C  
ATOM   2262  C   VAL A 310      26.527 -38.686 -82.505  1.00  0.75           C  
ATOM   2263  O   VAL A 310      27.196 -38.297 -83.462  1.00  0.75           O  
ATOM   2264  CB  VAL A 310      28.140 -39.408 -80.703  1.00  0.75           C  
ATOM   2265  CG1 VAL A 310      27.959 -37.977 -80.180  1.00  0.75           C  
ATOM   2266  CG2 VAL A 310      28.224 -40.409 -79.535  1.00  0.75           C  
ATOM   2267  N   GLY A 311      25.373 -38.069 -82.157  1.00  0.83           N  
ATOM   2268  CA  GLY A 311      24.947 -36.767 -82.659  1.00  0.83           C  
ATOM   2269  C   GLY A 311      24.895 -35.774 -81.524  1.00  0.83           C  
ATOM   2270  O   GLY A 311      25.277 -36.079 -80.397  1.00  0.83           O  
ATOM   2271  N   LEU A 312      24.384 -34.549 -81.771  1.00  0.83           N  
ATOM   2272  CA  LEU A 312      24.335 -33.488 -80.766  1.00  0.83           C  
ATOM   2273  C   LEU A 312      23.501 -33.834 -79.545  1.00  0.83           C  
ATOM   2274  O   LEU A 312      23.881 -33.503 -78.427  1.00  0.83           O  
ATOM   2275  CB  LEU A 312      23.865 -32.131 -81.344  1.00  0.83           C  
ATOM   2276  CG  LEU A 312      24.737 -31.579 -82.491  1.00  0.83           C  
ATOM   2277  CD1 LEU A 312      24.197 -30.221 -82.961  1.00  0.83           C  
ATOM   2278  CD2 LEU A 312      26.223 -31.444 -82.115  1.00  0.83           C  
ATOM   2279  N   GLU A 313      22.389 -34.566 -79.735  1.00  0.80           N  
ATOM   2280  CA  GLU A 313      21.488 -35.085 -78.719  1.00  0.80           C  
ATOM   2281  C   GLU A 313      22.123 -35.795 -77.523  1.00  0.80           C  
ATOM   2282  O   GLU A 313      21.540 -35.867 -76.444  1.00  0.80           O  
ATOM   2283  CB  GLU A 313      20.481 -36.082 -79.363  1.00  0.80           C  
ATOM   2284  CG  GLU A 313      19.979 -35.703 -80.783  1.00  0.80           C  
ATOM   2285  CD  GLU A 313      19.612 -34.224 -80.936  1.00  0.80           C  
ATOM   2286  OE1 GLU A 313      18.579 -33.800 -80.369  1.00  0.80           O  
ATOM   2287  OE2 GLU A 313      20.412 -33.530 -81.623  1.00  0.80           O  
ATOM   2288  N   VAL A 314      23.339 -36.370 -77.670  1.00  0.85           N  
ATOM   2289  CA  VAL A 314      24.018 -37.002 -76.545  1.00  0.85           C  
ATOM   2290  C   VAL A 314      24.784 -36.010 -75.684  1.00  0.85           C  
ATOM   2291  O   VAL A 314      25.147 -36.306 -74.545  1.00  0.85           O  
ATOM   2292  CB  VAL A 314      24.976 -38.132 -76.957  1.00  0.85           C  
ATOM   2293  CG1 VAL A 314      24.381 -38.931 -78.132  1.00  0.85           C  
ATOM   2294  CG2 VAL A 314      26.401 -37.637 -77.274  1.00  0.85           C  
ATOM   2295  N   LEU A 315      25.071 -34.810 -76.221  1.00  0.88           N  
ATOM   2296  CA  LEU A 315      26.039 -33.895 -75.663  1.00  0.88           C  
ATOM   2297  C   LEU A 315      25.388 -32.972 -74.664  1.00  0.88           C  
ATOM   2298  O   LEU A 315      24.326 -32.401 -74.895  1.00  0.88           O  
ATOM   2299  CB  LEU A 315      26.719 -33.026 -76.758  1.00  0.88           C  
ATOM   2300  CG  LEU A 315      27.482 -33.820 -77.840  1.00  0.88           C  
ATOM   2301  CD1 LEU A 315      27.965 -32.892 -78.963  1.00  0.88           C  
ATOM   2302  CD2 LEU A 315      28.679 -34.581 -77.258  1.00  0.88           C  
ATOM   2303  N   GLY A 316      26.035 -32.789 -73.499  1.00  0.90           N  
ATOM   2304  CA  GLY A 316      25.579 -31.794 -72.544  1.00  0.90           C  
ATOM   2305  C   GLY A 316      25.945 -30.403 -72.969  1.00  0.90           C  
ATOM   2306  O   GLY A 316      26.651 -30.199 -73.952  1.00  0.90           O  
ATOM   2307  N   SER A 317      25.528 -29.396 -72.198  1.00  0.87           N  
ATOM   2308  CA  SER A 317      25.924 -28.024 -72.441  1.00  0.87           C  
ATOM   2309  C   SER A 317      26.219 -27.339 -71.130  1.00  0.87           C  
ATOM   2310  O   SER A 317      25.795 -27.769 -70.054  1.00  0.87           O  
ATOM   2311  CB  SER A 317      24.871 -27.203 -73.241  1.00  0.87           C  
ATOM   2312  OG  SER A 317      23.621 -27.098 -72.553  1.00  0.87           O  
ATOM   2313  N   ALA A 318      26.997 -26.248 -71.187  1.00  0.86           N  
ATOM   2314  CA  ALA A 318      27.225 -25.418 -70.036  1.00  0.86           C  
ATOM   2315  C   ALA A 318      27.524 -24.008 -70.470  1.00  0.86           C  
ATOM   2316  O   ALA A 318      28.094 -23.774 -71.534  1.00  0.86           O  
ATOM   2317  CB  ALA A 318      28.400 -25.942 -69.197  1.00  0.86           C  
ATOM   2318  N   ARG A 319      27.145 -23.028 -69.629  1.00  0.76           N  
ATOM   2319  CA  ARG A 319      27.279 -21.616 -69.911  1.00  0.76           C  
ATOM   2320  C   ARG A 319      28.717 -21.174 -70.129  1.00  0.76           C  
ATOM   2321  O   ARG A 319      29.012 -20.460 -71.085  1.00  0.76           O  
ATOM   2322  CB  ARG A 319      26.675 -20.827 -68.732  1.00  0.76           C  
ATOM   2323  CG  ARG A 319      26.460 -19.322 -68.982  1.00  0.76           C  
ATOM   2324  CD  ARG A 319      25.846 -18.601 -67.775  1.00  0.76           C  
ATOM   2325  NE  ARG A 319      26.866 -18.602 -66.668  1.00  0.76           N  
ATOM   2326  CZ  ARG A 319      27.752 -17.626 -66.434  1.00  0.76           C  
ATOM   2327  NH1 ARG A 319      27.851 -16.575 -67.245  1.00  0.76           N  
ATOM   2328  NH2 ARG A 319      28.544 -17.687 -65.365  1.00  0.76           N  
ATOM   2329  N   ARG A 320      29.663 -21.618 -69.270  1.00  0.77           N  
ATOM   2330  CA  ARG A 320      31.086 -21.467 -69.530  1.00  0.77           C  
ATOM   2331  C   ARG A 320      31.849 -22.613 -68.872  1.00  0.77           C  
ATOM   2332  O   ARG A 320      31.454 -23.153 -67.838  1.00  0.77           O  
ATOM   2333  CB  ARG A 320      31.706 -20.107 -69.054  1.00  0.77           C  
ATOM   2334  CG  ARG A 320      31.040 -18.847 -69.652  1.00  0.77           C  
ATOM   2335  CD  ARG A 320      31.568 -17.491 -69.181  1.00  0.77           C  
ATOM   2336  NE  ARG A 320      32.803 -17.149 -69.964  1.00  0.77           N  
ATOM   2337  CZ  ARG A 320      33.888 -16.574 -69.427  1.00  0.77           C  
ATOM   2338  NH1 ARG A 320      34.195 -16.737 -68.144  1.00  0.77           N  
ATOM   2339  NH2 ARG A 320      34.687 -15.835 -70.193  1.00  0.77           N  
ATOM   2340  N   VAL A 321      32.981 -23.003 -69.475  1.00  0.87           N  
ATOM   2341  CA  VAL A 321      33.906 -24.005 -68.974  1.00  0.87           C  
ATOM   2342  C   VAL A 321      35.245 -23.320 -68.774  1.00  0.87           C  
ATOM   2343  O   VAL A 321      35.669 -22.525 -69.613  1.00  0.87           O  
ATOM   2344  CB  VAL A 321      34.078 -25.161 -69.961  1.00  0.87           C  
ATOM   2345  CG1 VAL A 321      35.129 -26.177 -69.467  1.00  0.87           C  
ATOM   2346  CG2 VAL A 321      32.713 -25.847 -70.174  1.00  0.87           C  
ATOM   2347  N   VAL A 322      35.934 -23.593 -67.647  1.00  0.86           N  
ATOM   2348  CA  VAL A 322      37.263 -23.067 -67.364  1.00  0.86           C  
ATOM   2349  C   VAL A 322      38.166 -24.232 -66.995  1.00  0.86           C  
ATOM   2350  O   VAL A 322      37.857 -24.998 -66.085  1.00  0.86           O  
ATOM   2351  CB  VAL A 322      37.262 -22.055 -66.214  1.00  0.86           C  
ATOM   2352  CG1 VAL A 322      38.687 -21.532 -65.944  1.00  0.86           C  
ATOM   2353  CG2 VAL A 322      36.331 -20.874 -66.554  1.00  0.86           C  
ATOM   2354  N   VAL A 323      39.302 -24.420 -67.699  1.00  0.84           N  
ATOM   2355  CA  VAL A 323      40.264 -25.472 -67.381  1.00  0.84           C  
ATOM   2356  C   VAL A 323      41.660 -24.911 -67.152  1.00  0.84           C  
ATOM   2357  O   VAL A 323      42.129 -24.027 -67.873  1.00  0.84           O  
ATOM   2358  CB  VAL A 323      40.331 -26.593 -68.420  1.00  0.84           C  
ATOM   2359  CG1 VAL A 323      38.950 -27.254 -68.546  1.00  0.84           C  
ATOM   2360  CG2 VAL A 323      40.762 -26.081 -69.801  1.00  0.84           C  
ATOM   2361  N   SER A 324      42.368 -25.425 -66.127  1.00  0.82           N  
ATOM   2362  CA  SER A 324      43.748 -25.080 -65.812  1.00  0.82           C  
ATOM   2363  C   SER A 324      44.661 -26.266 -66.079  1.00  0.82           C  
ATOM   2364  O   SER A 324      44.313 -27.184 -66.819  1.00  0.82           O  
ATOM   2365  CB  SER A 324      43.914 -24.541 -64.356  1.00  0.82           C  
ATOM   2366  OG  SER A 324      43.684 -25.546 -63.370  1.00  0.82           O  
ATOM   2367  N   LYS A 325      45.880 -26.287 -65.495  1.00  0.71           N  
ATOM   2368  CA  LYS A 325      46.766 -27.440 -65.574  1.00  0.71           C  
ATOM   2369  C   LYS A 325      46.385 -28.452 -64.507  1.00  0.71           C  
ATOM   2370  O   LYS A 325      46.771 -29.619 -64.539  1.00  0.71           O  
ATOM   2371  CB  LYS A 325      48.218 -27.012 -65.261  1.00  0.71           C  
ATOM   2372  CG  LYS A 325      48.833 -26.045 -66.284  1.00  0.71           C  
ATOM   2373  CD  LYS A 325      50.144 -25.436 -65.763  1.00  0.71           C  
ATOM   2374  CE  LYS A 325      49.904 -24.375 -64.678  1.00  0.71           C  
ATOM   2375  NZ  LYS A 325      51.182 -24.007 -64.032  1.00  0.71           N  
ATOM   2376  N   ASP A 326      45.581 -27.983 -63.546  1.00  0.71           N  
ATOM   2377  CA  ASP A 326      45.422 -28.564 -62.248  1.00  0.71           C  
ATOM   2378  C   ASP A 326      43.967 -29.030 -62.099  1.00  0.71           C  
ATOM   2379  O   ASP A 326      43.709 -30.162 -61.689  1.00  0.71           O  
ATOM   2380  CB  ASP A 326      45.820 -27.456 -61.212  1.00  0.71           C  
ATOM   2381  CG  ASP A 326      47.003 -26.598 -61.694  1.00  0.71           C  
ATOM   2382  OD1 ASP A 326      46.751 -25.609 -62.447  1.00  0.71           O  
ATOM   2383  OD2 ASP A 326      48.173 -26.929 -61.377  1.00  0.71           O  
ATOM   2384  N   ASP A 327      43.000 -28.195 -62.555  1.00  0.80           N  
ATOM   2385  CA  ASP A 327      41.570 -28.359 -62.362  1.00  0.80           C  
ATOM   2386  C   ASP A 327      40.752 -28.118 -63.639  1.00  0.80           C  
ATOM   2387  O   ASP A 327      41.187 -27.498 -64.610  1.00  0.80           O  
ATOM   2388  CB  ASP A 327      41.039 -27.331 -61.330  1.00  0.80           C  
ATOM   2389  CG  ASP A 327      41.697 -27.534 -59.981  1.00  0.80           C  
ATOM   2390  OD1 ASP A 327      41.437 -28.600 -59.370  1.00  0.80           O  
ATOM   2391  OD2 ASP A 327      42.425 -26.605 -59.545  1.00  0.80           O  
ATOM   2392  N   THR A 328      39.494 -28.603 -63.633  1.00  0.84           N  
ATOM   2393  CA  THR A 328      38.457 -28.338 -64.627  1.00  0.84           C  
ATOM   2394  C   THR A 328      37.215 -27.870 -63.902  1.00  0.84           C  
ATOM   2395  O   THR A 328      36.720 -28.551 -63.006  1.00  0.84           O  
ATOM   2396  CB  THR A 328      38.065 -29.564 -65.444  1.00  0.84           C  
ATOM   2397  OG1 THR A 328      39.101 -29.855 -66.378  1.00  0.84           O  
ATOM   2398  CG2 THR A 328      36.788 -29.341 -66.277  1.00  0.84           C  
ATOM   2399  N   VAL A 329      36.659 -26.697 -64.264  1.00  0.86           N  
ATOM   2400  CA  VAL A 329      35.458 -26.138 -63.657  1.00  0.86           C  
ATOM   2401  C   VAL A 329      34.381 -25.967 -64.713  1.00  0.86           C  
ATOM   2402  O   VAL A 329      34.623 -25.458 -65.809  1.00  0.86           O  
ATOM   2403  CB  VAL A 329      35.719 -24.786 -62.988  1.00  0.86           C  
ATOM   2404  CG1 VAL A 329      34.438 -24.191 -62.358  1.00  0.86           C  
ATOM   2405  CG2 VAL A 329      36.794 -24.960 -61.898  1.00  0.86           C  
ATOM   2406  N   ILE A 330      33.136 -26.378 -64.394  1.00  0.84           N  
ATOM   2407  CA  ILE A 330      31.977 -26.151 -65.244  1.00  0.84           C  
ATOM   2408  C   ILE A 330      31.067 -25.203 -64.490  1.00  0.84           C  
ATOM   2409  O   ILE A 330      30.612 -25.510 -63.388  1.00  0.84           O  
ATOM   2410  CB  ILE A 330      31.166 -27.418 -65.540  1.00  0.84           C  
ATOM   2411  CG1 ILE A 330      32.033 -28.603 -66.027  1.00  0.84           C  
ATOM   2412  CG2 ILE A 330      30.019 -27.111 -66.526  1.00  0.84           C  
ATOM   2413  CD1 ILE A 330      32.698 -28.382 -67.385  1.00  0.84           C  
ATOM   2414  N   VAL A 331      30.753 -24.022 -65.060  1.00  0.80           N  
ATOM   2415  CA  VAL A 331      29.822 -23.107 -64.423  1.00  0.80           C  
ATOM   2416  C   VAL A 331      28.525 -23.099 -65.208  1.00  0.80           C  
ATOM   2417  O   VAL A 331      28.493 -22.811 -66.406  1.00  0.80           O  
ATOM   2418  CB  VAL A 331      30.389 -21.703 -64.175  1.00  0.80           C  
ATOM   2419  CG1 VAL A 331      30.835 -20.996 -65.467  1.00  0.80           C  
ATOM   2420  CG2 VAL A 331      29.379 -20.843 -63.387  1.00  0.80           C  
ATOM   2421  N   ASP A 332      27.418 -23.445 -64.510  1.00  0.79           N  
ATOM   2422  CA  ASP A 332      26.061 -23.287 -64.992  1.00  0.79           C  
ATOM   2423  C   ASP A 332      25.714 -24.204 -66.181  1.00  0.79           C  
ATOM   2424  O   ASP A 332      25.655 -23.804 -67.345  1.00  0.79           O  
ATOM   2425  CB  ASP A 332      25.812 -21.768 -65.166  1.00  0.79           C  
ATOM   2426  CG  ASP A 332      24.364 -21.356 -65.029  1.00  0.79           C  
ATOM   2427  OD1 ASP A 332      23.646 -21.983 -64.218  1.00  0.79           O  
ATOM   2428  OD2 ASP A 332      24.025 -20.328 -65.669  1.00  0.79           O  
ATOM   2429  N   GLY A 333      25.573 -25.520 -65.893  1.00  0.84           N  
ATOM   2430  CA  GLY A 333      25.177 -26.544 -66.859  1.00  0.84           C  
ATOM   2431  C   GLY A 333      23.734 -26.483 -67.303  1.00  0.84           C  
ATOM   2432  O   GLY A 333      22.878 -25.920 -66.634  1.00  0.84           O  
ATOM   2433  N   GLY A 334      23.412 -27.134 -68.440  1.00  0.83           N  
ATOM   2434  CA  GLY A 334      22.061 -27.151 -69.008  1.00  0.83           C  
ATOM   2435  C   GLY A 334      21.073 -28.113 -68.387  1.00  0.83           C  
ATOM   2436  O   GLY A 334      19.930 -28.200 -68.831  1.00  0.83           O  
ATOM   2437  N   GLY A 335      21.492 -28.904 -67.380  1.00  0.83           N  
ATOM   2438  CA  GLY A 335      20.685 -29.908 -66.691  1.00  0.83           C  
ATOM   2439  C   GLY A 335      19.346 -29.474 -66.141  1.00  0.83           C  
ATOM   2440  O   GLY A 335      19.221 -28.496 -65.410  1.00  0.83           O  
ATOM   2441  N   THR A 336      18.281 -30.245 -66.441  1.00  0.76           N  
ATOM   2442  CA  THR A 336      16.948 -29.999 -65.889  1.00  0.76           C  
ATOM   2443  C   THR A 336      16.875 -30.161 -64.371  1.00  0.76           C  
ATOM   2444  O   THR A 336      17.440 -31.084 -63.783  1.00  0.76           O  
ATOM   2445  CB  THR A 336      15.832 -30.771 -66.595  1.00  0.76           C  
ATOM   2446  OG1 THR A 336      14.544 -30.372 -66.141  1.00  0.76           O  
ATOM   2447  CG2 THR A 336      15.953 -32.284 -66.381  1.00  0.76           C  
ATOM   2448  N   ALA A 337      16.155 -29.238 -63.697  1.00  0.74           N  
ATOM   2449  CA  ALA A 337      16.174 -29.052 -62.257  1.00  0.74           C  
ATOM   2450  C   ALA A 337      15.734 -30.269 -61.452  1.00  0.74           C  
ATOM   2451  O   ALA A 337      16.368 -30.652 -60.468  1.00  0.74           O  
ATOM   2452  CB  ALA A 337      15.281 -27.843 -61.909  1.00  0.74           C  
ATOM   2453  N   GLU A 338      14.655 -30.943 -61.899  1.00  0.71           N  
ATOM   2454  CA  GLU A 338      14.161 -32.166 -61.300  1.00  0.71           C  
ATOM   2455  C   GLU A 338      15.167 -33.300 -61.342  1.00  0.71           C  
ATOM   2456  O   GLU A 338      15.340 -34.025 -60.370  1.00  0.71           O  
ATOM   2457  CB  GLU A 338      12.890 -32.659 -62.017  1.00  0.71           C  
ATOM   2458  CG  GLU A 338      11.690 -31.692 -61.917  1.00  0.71           C  
ATOM   2459  CD  GLU A 338      10.456 -32.262 -62.616  1.00  0.71           C  
ATOM   2460  OE1 GLU A 338      10.554 -33.382 -63.179  1.00  0.71           O  
ATOM   2461  OE2 GLU A 338       9.414 -31.563 -62.588  1.00  0.71           O  
ATOM   2462  N   ALA A 339      15.887 -33.471 -62.468  1.00  0.75           N  
ATOM   2463  CA  ALA A 339      16.880 -34.514 -62.629  1.00  0.75           C  
ATOM   2464  C   ALA A 339      18.075 -34.364 -61.697  1.00  0.75           C  
ATOM   2465  O   ALA A 339      18.520 -35.337 -61.088  1.00  0.75           O  
ATOM   2466  CB  ALA A 339      17.350 -34.577 -64.092  1.00  0.75           C  
ATOM   2467  N   VAL A 340      18.598 -33.128 -61.525  1.00  0.77           N  
ATOM   2468  CA  VAL A 340      19.684 -32.839 -60.592  1.00  0.77           C  
ATOM   2469  C   VAL A 340      19.277 -33.148 -59.156  1.00  0.77           C  
ATOM   2470  O   VAL A 340      19.990 -33.827 -58.418  1.00  0.77           O  
ATOM   2471  CB  VAL A 340      20.162 -31.390 -60.702  1.00  0.77           C  
ATOM   2472  CG1 VAL A 340      21.358 -31.134 -59.758  1.00  0.77           C  
ATOM   2473  CG2 VAL A 340      20.588 -31.095 -62.154  1.00  0.77           C  
ATOM   2474  N   ALA A 341      18.059 -32.727 -58.754  1.00  0.75           N  
ATOM   2475  CA  ALA A 341      17.468 -33.072 -57.478  1.00  0.75           C  
ATOM   2476  C   ALA A 341      17.212 -34.569 -57.295  1.00  0.75           C  
ATOM   2477  O   ALA A 341      17.475 -35.128 -56.232  1.00  0.75           O  
ATOM   2478  CB  ALA A 341      16.161 -32.279 -57.291  1.00  0.75           C  
ATOM   2479  N   ASN A 342      16.717 -35.272 -58.338  1.00  0.74           N  
ATOM   2480  CA  ASN A 342      16.494 -36.710 -58.340  1.00  0.74           C  
ATOM   2481  C   ASN A 342      17.791 -37.500 -58.149  1.00  0.74           C  
ATOM   2482  O   ASN A 342      17.888 -38.398 -57.311  1.00  0.74           O  
ATOM   2483  CB  ASN A 342      15.761 -37.139 -59.641  1.00  0.74           C  
ATOM   2484  CG  ASN A 342      15.024 -38.464 -59.460  1.00  0.74           C  
ATOM   2485  OD1 ASN A 342      15.585 -39.493 -59.078  1.00  0.74           O  
ATOM   2486  ND2 ASN A 342      13.697 -38.455 -59.717  1.00  0.74           N  
ATOM   2487  N   ARG A 343      18.867 -37.129 -58.872  1.00  0.73           N  
ATOM   2488  CA  ARG A 343      20.172 -37.731 -58.670  1.00  0.73           C  
ATOM   2489  C   ARG A 343      20.722 -37.431 -57.278  1.00  0.73           C  
ATOM   2490  O   ARG A 343      21.220 -38.320 -56.590  1.00  0.73           O  
ATOM   2491  CB  ARG A 343      21.172 -37.310 -59.777  1.00  0.73           C  
ATOM   2492  CG  ARG A 343      22.207 -38.395 -60.167  1.00  0.73           C  
ATOM   2493  CD  ARG A 343      23.145 -38.868 -59.047  1.00  0.73           C  
ATOM   2494  NE  ARG A 343      24.093 -39.849 -59.652  1.00  0.73           N  
ATOM   2495  CZ  ARG A 343      24.143 -41.166 -59.419  1.00  0.73           C  
ATOM   2496  NH1 ARG A 343      23.408 -41.747 -58.478  1.00  0.73           N  
ATOM   2497  NH2 ARG A 343      25.030 -41.887 -60.098  1.00  0.73           N  
ATOM   2498  N   ALA A 344      20.584 -36.179 -56.797  1.00  0.77           N  
ATOM   2499  CA  ALA A 344      20.968 -35.790 -55.457  1.00  0.77           C  
ATOM   2500  C   ALA A 344      20.220 -36.531 -54.347  1.00  0.77           C  
ATOM   2501  O   ALA A 344      20.839 -36.984 -53.390  1.00  0.77           O  
ATOM   2502  CB  ALA A 344      20.816 -34.268 -55.285  1.00  0.77           C  
ATOM   2503  N   LYS A 345      18.885 -36.742 -54.443  1.00  0.73           N  
ATOM   2504  CA  LYS A 345      18.164 -37.586 -53.493  1.00  0.73           C  
ATOM   2505  C   LYS A 345      18.569 -39.045 -53.535  1.00  0.73           C  
ATOM   2506  O   LYS A 345      18.536 -39.726 -52.513  1.00  0.73           O  
ATOM   2507  CB  LYS A 345      16.610 -37.432 -53.484  1.00  0.73           C  
ATOM   2508  CG  LYS A 345      15.802 -37.762 -54.759  1.00  0.73           C  
ATOM   2509  CD  LYS A 345      15.660 -39.234 -55.218  1.00  0.73           C  
ATOM   2510  CE  LYS A 345      15.036 -40.210 -54.217  1.00  0.73           C  
ATOM   2511  NZ  LYS A 345      15.174 -41.596 -54.733  1.00  0.73           N  
ATOM   2512  N   HIS A 346      18.953 -39.578 -54.713  1.00  0.76           N  
ATOM   2513  CA  HIS A 346      19.476 -40.927 -54.813  1.00  0.76           C  
ATOM   2514  C   HIS A 346      20.849 -41.056 -54.189  1.00  0.76           C  
ATOM   2515  O   HIS A 346      21.106 -41.979 -53.433  1.00  0.76           O  
ATOM   2516  CB  HIS A 346      19.519 -41.444 -56.262  1.00  0.76           C  
ATOM   2517  CG  HIS A 346      19.665 -42.930 -56.275  1.00  0.76           C  
ATOM   2518  ND1 HIS A 346      18.567 -43.706 -55.944  1.00  0.76           N  
ATOM   2519  CD2 HIS A 346      20.767 -43.704 -56.443  1.00  0.76           C  
ATOM   2520  CE1 HIS A 346      19.029 -44.945 -55.932  1.00  0.76           C  
ATOM   2521  NE2 HIS A 346      20.352 -44.998 -56.223  1.00  0.76           N  
ATOM   2522  N   LEU A 347      21.743 -40.089 -54.443  1.00  0.75           N  
ATOM   2523  CA  LEU A 347      23.066 -39.994 -53.856  1.00  0.75           C  
ATOM   2524  C   LEU A 347      23.052 -39.741 -52.351  1.00  0.75           C  
ATOM   2525  O   LEU A 347      23.831 -40.292 -51.575  1.00  0.75           O  
ATOM   2526  CB  LEU A 347      23.822 -38.896 -54.615  1.00  0.75           C  
ATOM   2527  CG  LEU A 347      25.281 -38.675 -54.202  1.00  0.75           C  
ATOM   2528  CD1 LEU A 347      26.113 -39.959 -54.173  1.00  0.75           C  
ATOM   2529  CD2 LEU A 347      25.899 -37.684 -55.184  1.00  0.75           C  
ATOM   2530  N   ARG A 348      22.084 -38.942 -51.870  1.00  0.70           N  
ATOM   2531  CA  ARG A 348      21.793 -38.796 -50.457  1.00  0.70           C  
ATOM   2532  C   ARG A 348      21.271 -40.095 -49.835  1.00  0.70           C  
ATOM   2533  O   ARG A 348      21.389 -40.323 -48.635  1.00  0.70           O  
ATOM   2534  CB  ARG A 348      20.760 -37.662 -50.250  1.00  0.70           C  
ATOM   2535  CG  ARG A 348      20.673 -37.148 -48.798  1.00  0.70           C  
ATOM   2536  CD  ARG A 348      19.518 -36.170 -48.542  1.00  0.70           C  
ATOM   2537  NE  ARG A 348      18.226 -36.932 -48.674  1.00  0.70           N  
ATOM   2538  CZ  ARG A 348      17.740 -37.773 -47.749  1.00  0.70           C  
ATOM   2539  NH1 ARG A 348      18.338 -37.957 -46.578  1.00  0.70           N  
ATOM   2540  NH2 ARG A 348      16.628 -38.459 -48.005  1.00  0.70           N  
ATOM   2541  N   ALA A 349      20.717 -41.005 -50.660  1.00  0.77           N  
ATOM   2542  CA  ALA A 349      20.331 -42.327 -50.229  1.00  0.77           C  
ATOM   2543  C   ALA A 349      21.419 -43.372 -50.487  1.00  0.77           C  
ATOM   2544  O   ALA A 349      21.337 -44.500 -50.006  1.00  0.77           O  
ATOM   2545  CB  ALA A 349      19.022 -42.729 -50.939  1.00  0.77           C  
ATOM   2546  N   GLU A 350      22.502 -43.031 -51.211  1.00  0.73           N  
ATOM   2547  CA  GLU A 350      23.737 -43.794 -51.248  1.00  0.73           C  
ATOM   2548  C   GLU A 350      24.447 -43.665 -49.888  1.00  0.73           C  
ATOM   2549  O   GLU A 350      24.961 -44.643 -49.347  1.00  0.73           O  
ATOM   2550  CB  GLU A 350      24.641 -43.395 -52.470  1.00  0.73           C  
ATOM   2551  CG  GLU A 350      24.068 -43.755 -53.886  1.00  0.73           C  
ATOM   2552  CD  GLU A 350      24.857 -43.230 -55.104  1.00  0.73           C  
ATOM   2553  OE1 GLU A 350      26.109 -43.348 -55.131  1.00  0.73           O  
ATOM   2554  OE2 GLU A 350      24.227 -42.707 -56.068  1.00  0.73           O  
ATOM   2555  N   ILE A 351      24.452 -42.457 -49.260  1.00  0.72           N  
ATOM   2556  CA  ILE A 351      25.000 -42.267 -47.911  1.00  0.72           C  
ATOM   2557  C   ILE A 351      24.259 -42.936 -46.760  1.00  0.72           C  
ATOM   2558  O   ILE A 351      24.915 -43.371 -45.816  1.00  0.72           O  
ATOM   2559  CB  ILE A 351      25.375 -40.837 -47.498  1.00  0.72           C  
ATOM   2560  CG1 ILE A 351      24.187 -39.861 -47.414  1.00  0.72           C  
ATOM   2561  CG2 ILE A 351      26.462 -40.330 -48.459  1.00  0.72           C  
ATOM   2562  CD1 ILE A 351      24.553 -38.498 -46.812  1.00  0.72           C  
ATOM   2563  N   ASP A 352      22.906 -43.071 -46.757  1.00  0.68           N  
ATOM   2564  CA  ASP A 352      22.222 -43.642 -45.595  1.00  0.68           C  
ATOM   2565  C   ASP A 352      22.472 -45.139 -45.375  1.00  0.68           C  
ATOM   2566  O   ASP A 352      22.292 -45.671 -44.280  1.00  0.68           O  
ATOM   2567  CB  ASP A 352      20.705 -43.272 -45.548  1.00  0.68           C  
ATOM   2568  CG  ASP A 352      19.805 -43.938 -46.592  1.00  0.68           C  
ATOM   2569  OD1 ASP A 352      19.739 -45.189 -46.671  1.00  0.68           O  
ATOM   2570  OD2 ASP A 352      19.145 -43.198 -47.359  1.00  0.68           O  
ATOM   2571  N   LYS A 353      22.972 -45.827 -46.416  1.00  0.70           N  
ATOM   2572  CA  LYS A 353      23.314 -47.237 -46.390  1.00  0.70           C  
ATOM   2573  C   LYS A 353      24.811 -47.447 -46.223  1.00  0.70           C  
ATOM   2574  O   LYS A 353      25.320 -48.551 -46.405  1.00  0.70           O  
ATOM   2575  CB  LYS A 353      22.891 -47.893 -47.730  1.00  0.70           C  
ATOM   2576  CG  LYS A 353      21.370 -47.910 -47.935  1.00  0.70           C  
ATOM   2577  CD  LYS A 353      20.967 -47.860 -49.416  1.00  0.70           C  
ATOM   2578  CE  LYS A 353      19.512 -47.422 -49.624  1.00  0.70           C  
ATOM   2579  NZ  LYS A 353      19.335 -46.033 -49.162  1.00  0.70           N  
ATOM   2580  N   SER A 354      25.583 -46.391 -45.898  1.00  0.72           N  
ATOM   2581  CA  SER A 354      27.035 -46.492 -45.889  1.00  0.72           C  
ATOM   2582  C   SER A 354      27.611 -47.058 -44.605  1.00  0.72           C  
ATOM   2583  O   SER A 354      27.683 -46.384 -43.580  1.00  0.72           O  
ATOM   2584  CB  SER A 354      27.723 -45.135 -46.158  1.00  0.72           C  
ATOM   2585  OG  SER A 354      29.096 -45.313 -46.507  1.00  0.72           O  
ATOM   2586  N   ASP A 355      28.088 -48.315 -44.684  1.00  0.60           N  
ATOM   2587  CA  ASP A 355      28.768 -49.068 -43.648  1.00  0.60           C  
ATOM   2588  C   ASP A 355      30.078 -48.405 -43.180  1.00  0.60           C  
ATOM   2589  O   ASP A 355      30.377 -48.273 -41.995  1.00  0.60           O  
ATOM   2590  CB  ASP A 355      29.007 -50.465 -44.291  1.00  0.60           C  
ATOM   2591  CG  ASP A 355      29.290 -51.567 -43.284  1.00  0.60           C  
ATOM   2592  OD1 ASP A 355      28.788 -51.471 -42.139  1.00  0.60           O  
ATOM   2593  OD2 ASP A 355      29.978 -52.539 -43.688  1.00  0.60           O  
ATOM   2594  N   SER A 356      30.887 -47.902 -44.138  1.00  0.60           N  
ATOM   2595  CA  SER A 356      32.192 -47.307 -43.864  1.00  0.60           C  
ATOM   2596  C   SER A 356      32.178 -45.796 -44.064  1.00  0.60           C  
ATOM   2597  O   SER A 356      31.416 -45.262 -44.873  1.00  0.60           O  
ATOM   2598  CB  SER A 356      33.282 -47.936 -44.776  1.00  0.60           C  
ATOM   2599  OG  SER A 356      34.596 -47.445 -44.489  1.00  0.60           O  
ATOM   2600  N   ASP A 357      33.032 -45.046 -43.320  1.00  0.53           N  
ATOM   2601  CA  ASP A 357      33.186 -43.606 -43.479  1.00  0.53           C  
ATOM   2602  C   ASP A 357      33.817 -43.220 -44.820  1.00  0.53           C  
ATOM   2603  O   ASP A 357      33.354 -42.304 -45.488  1.00  0.53           O  
ATOM   2604  CB  ASP A 357      33.918 -42.948 -42.272  1.00  0.53           C  
ATOM   2605  CG  ASP A 357      33.574 -41.470 -42.156  1.00  0.53           C  
ATOM   2606  OD1 ASP A 357      32.820 -40.940 -43.017  1.00  0.53           O  
ATOM   2607  OD2 ASP A 357      33.952 -40.817 -41.153  1.00  0.53           O  
ATOM   2608  N   TRP A 358      34.829 -43.962 -45.320  1.00  0.57           N  
ATOM   2609  CA  TRP A 358      35.419 -43.710 -46.638  1.00  0.57           C  
ATOM   2610  C   TRP A 358      34.386 -43.794 -47.757  1.00  0.57           C  
ATOM   2611  O   TRP A 358      34.349 -43.031 -48.725  1.00  0.57           O  
ATOM   2612  CB  TRP A 358      36.510 -44.758 -46.965  1.00  0.57           C  
ATOM   2613  CG  TRP A 358      37.752 -44.731 -46.099  1.00  0.57           C  
ATOM   2614  CD1 TRP A 358      38.118 -43.895 -45.079  1.00  0.57           C  
ATOM   2615  CD2 TRP A 358      38.858 -45.623 -46.313  1.00  0.57           C  
ATOM   2616  NE1 TRP A 358      39.370 -44.237 -44.611  1.00  0.57           N  
ATOM   2617  CE2 TRP A 358      39.852 -45.279 -45.373  1.00  0.57           C  
ATOM   2618  CE3 TRP A 358      39.055 -46.650 -47.234  1.00  0.57           C  
ATOM   2619  CZ2 TRP A 358      41.066 -45.954 -45.345  1.00  0.57           C  
ATOM   2620  CZ3 TRP A 358      40.284 -47.326 -47.210  1.00  0.57           C  
ATOM   2621  CH2 TRP A 358      41.278 -46.981 -46.281  1.00  0.57           C  
ATOM   2622  N   ASP A 359      33.456 -44.751 -47.624  1.00  0.71           N  
ATOM   2623  CA  ASP A 359      32.322 -44.845 -48.494  1.00  0.71           C  
ATOM   2624  C   ASP A 359      31.340 -43.688 -48.388  1.00  0.71           C  
ATOM   2625  O   ASP A 359      30.852 -43.248 -49.425  1.00  0.71           O  
ATOM   2626  CB  ASP A 359      31.663 -46.230 -48.369  1.00  0.71           C  
ATOM   2627  CG  ASP A 359      32.600 -47.195 -49.059  1.00  0.71           C  
ATOM   2628  OD1 ASP A 359      32.700 -47.066 -50.312  1.00  0.71           O  
ATOM   2629  OD2 ASP A 359      33.256 -47.997 -48.360  1.00  0.71           O  
ATOM   2630  N   ARG A 360      31.075 -43.146 -47.181  1.00  0.65           N  
ATOM   2631  CA  ARG A 360      30.310 -41.924 -46.962  1.00  0.65           C  
ATOM   2632  C   ARG A 360      30.985 -40.684 -47.547  1.00  0.65           C  
ATOM   2633  O   ARG A 360      30.351 -39.875 -48.225  1.00  0.65           O  
ATOM   2634  CB  ARG A 360      30.090 -41.708 -45.437  1.00  0.65           C  
ATOM   2635  CG  ARG A 360      29.292 -40.441 -45.057  1.00  0.65           C  
ATOM   2636  CD  ARG A 360      29.076 -40.256 -43.549  1.00  0.65           C  
ATOM   2637  NE  ARG A 360      30.385 -39.894 -42.916  1.00  0.65           N  
ATOM   2638  CZ  ARG A 360      30.532 -39.477 -41.655  1.00  0.65           C  
ATOM   2639  NH1 ARG A 360      29.500 -39.377 -40.827  1.00  0.65           N  
ATOM   2640  NH2 ARG A 360      31.748 -39.262 -41.171  1.00  0.65           N  
ATOM   2641  N   GLU A 361      32.304 -40.541 -47.318  1.00  0.67           N  
ATOM   2642  CA  GLU A 361      33.164 -39.436 -47.707  1.00  0.67           C  
ATOM   2643  C   GLU A 361      33.121 -39.113 -49.192  1.00  0.67           C  
ATOM   2644  O   GLU A 361      32.760 -38.006 -49.587  1.00  0.67           O  
ATOM   2645  CB  GLU A 361      34.597 -39.852 -47.300  1.00  0.67           C  
ATOM   2646  CG  GLU A 361      35.758 -38.914 -47.700  1.00  0.67           C  
ATOM   2647  CD  GLU A 361      37.096 -39.585 -47.382  1.00  0.67           C  
ATOM   2648  OE1 GLU A 361      37.296 -40.737 -47.852  1.00  0.67           O  
ATOM   2649  OE2 GLU A 361      37.916 -38.955 -46.668  1.00  0.67           O  
ATOM   2650  N   LYS A 362      33.370 -40.114 -50.062  1.00  0.72           N  
ATOM   2651  CA  LYS A 362      33.333 -39.967 -51.512  1.00  0.72           C  
ATOM   2652  C   LYS A 362      31.962 -39.559 -52.057  1.00  0.72           C  
ATOM   2653  O   LYS A 362      31.818 -38.853 -53.053  1.00  0.72           O  
ATOM   2654  CB  LYS A 362      33.809 -41.279 -52.201  1.00  0.72           C  
ATOM   2655  CG  LYS A 362      32.861 -42.480 -52.018  1.00  0.72           C  
ATOM   2656  CD  LYS A 362      33.336 -43.778 -52.689  1.00  0.72           C  
ATOM   2657  CE  LYS A 362      32.208 -44.795 -52.939  1.00  0.72           C  
ATOM   2658  NZ  LYS A 362      31.550 -45.190 -51.683  1.00  0.72           N  
ATOM   2659  N   LEU A 363      30.877 -40.024 -51.415  1.00  0.74           N  
ATOM   2660  CA  LEU A 363      29.519 -39.666 -51.767  1.00  0.74           C  
ATOM   2661  C   LEU A 363      29.190 -38.250 -51.330  1.00  0.74           C  
ATOM   2662  O   LEU A 363      28.507 -37.509 -52.035  1.00  0.74           O  
ATOM   2663  CB  LEU A 363      28.536 -40.673 -51.148  1.00  0.74           C  
ATOM   2664  CG  LEU A 363      28.807 -42.144 -51.521  1.00  0.74           C  
ATOM   2665  CD1 LEU A 363      27.915 -43.066 -50.686  1.00  0.74           C  
ATOM   2666  CD2 LEU A 363      28.641 -42.436 -53.012  1.00  0.74           C  
ATOM   2667  N   GLY A 364      29.729 -37.824 -50.167  1.00  0.73           N  
ATOM   2668  CA  GLY A 364      29.686 -36.443 -49.703  1.00  0.73           C  
ATOM   2669  C   GLY A 364      30.427 -35.479 -50.593  1.00  0.73           C  
ATOM   2670  O   GLY A 364      29.952 -34.371 -50.826  1.00  0.73           O  
ATOM   2671  N   GLU A 365      31.576 -35.890 -51.173  1.00  0.74           N  
ATOM   2672  CA  GLU A 365      32.253 -35.132 -52.215  1.00  0.74           C  
ATOM   2673  C   GLU A 365      31.393 -34.958 -53.453  1.00  0.74           C  
ATOM   2674  O   GLU A 365      31.211 -33.849 -53.954  1.00  0.74           O  
ATOM   2675  CB  GLU A 365      33.521 -35.857 -52.728  1.00  0.74           C  
ATOM   2676  CG  GLU A 365      34.671 -36.045 -51.719  1.00  0.74           C  
ATOM   2677  CD  GLU A 365      35.825 -36.808 -52.381  1.00  0.74           C  
ATOM   2678  OE1 GLU A 365      35.564 -37.633 -53.301  1.00  0.74           O  
ATOM   2679  OE2 GLU A 365      36.985 -36.529 -52.009  1.00  0.74           O  
ATOM   2680  N   ARG A 366      30.801 -36.064 -53.954  1.00  0.77           N  
ATOM   2681  CA  ARG A 366      29.942 -36.051 -55.124  1.00  0.77           C  
ATOM   2682  C   ARG A 366      28.715 -35.170 -54.938  1.00  0.77           C  
ATOM   2683  O   ARG A 366      28.430 -34.311 -55.771  1.00  0.77           O  
ATOM   2684  CB  ARG A 366      29.470 -37.489 -55.465  1.00  0.77           C  
ATOM   2685  CG  ARG A 366      30.554 -38.408 -56.053  1.00  0.77           C  
ATOM   2686  CD  ARG A 366      30.176 -39.895 -56.085  1.00  0.77           C  
ATOM   2687  NE  ARG A 366      29.033 -40.053 -57.032  1.00  0.77           N  
ATOM   2688  CZ  ARG A 366      28.077 -40.984 -56.961  1.00  0.77           C  
ATOM   2689  NH1 ARG A 366      28.163 -42.025 -56.144  1.00  0.77           N  
ATOM   2690  NH2 ARG A 366      26.990 -40.839 -57.706  1.00  0.77           N  
ATOM   2691  N   LEU A 367      27.985 -35.315 -53.809  1.00  0.76           N  
ATOM   2692  CA  LEU A 367      26.776 -34.546 -53.571  1.00  0.76           C  
ATOM   2693  C   LEU A 367      27.025 -33.070 -53.373  1.00  0.76           C  
ATOM   2694  O   LEU A 367      26.296 -32.265 -53.937  1.00  0.76           O  
ATOM   2695  CB  LEU A 367      25.850 -35.160 -52.484  1.00  0.76           C  
ATOM   2696  CG  LEU A 367      26.224 -34.948 -51.004  1.00  0.76           C  
ATOM   2697  CD1 LEU A 367      25.611 -33.666 -50.422  1.00  0.76           C  
ATOM   2698  CD2 LEU A 367      25.754 -36.143 -50.160  1.00  0.76           C  
ATOM   2699  N   ALA A 368      28.085 -32.682 -52.625  1.00  0.74           N  
ATOM   2700  CA  ALA A 368      28.422 -31.301 -52.321  1.00  0.74           C  
ATOM   2701  C   ALA A 368      28.723 -30.461 -53.551  1.00  0.74           C  
ATOM   2702  O   ALA A 368      28.421 -29.271 -53.621  1.00  0.74           O  
ATOM   2703  CB  ALA A 368      29.637 -31.267 -51.376  1.00  0.74           C  
ATOM   2704  N   LYS A 369      29.356 -31.091 -54.556  1.00  0.75           N  
ATOM   2705  CA  LYS A 369      29.579 -30.520 -55.865  1.00  0.75           C  
ATOM   2706  C   LYS A 369      28.277 -30.324 -56.651  1.00  0.75           C  
ATOM   2707  O   LYS A 369      28.077 -29.282 -57.269  1.00  0.75           O  
ATOM   2708  CB  LYS A 369      30.637 -31.397 -56.600  1.00  0.75           C  
ATOM   2709  CG  LYS A 369      32.022 -31.275 -55.922  1.00  0.75           C  
ATOM   2710  CD  LYS A 369      33.034 -32.420 -56.160  1.00  0.75           C  
ATOM   2711  CE  LYS A 369      33.595 -32.541 -57.578  1.00  0.75           C  
ATOM   2712  NZ  LYS A 369      35.042 -32.907 -57.566  1.00  0.75           N  
ATOM   2713  N   LEU A 370      27.346 -31.303 -56.633  1.00  0.73           N  
ATOM   2714  CA  LEU A 370      26.031 -31.173 -57.252  1.00  0.73           C  
ATOM   2715  C   LEU A 370      25.104 -30.152 -56.583  1.00  0.73           C  
ATOM   2716  O   LEU A 370      24.427 -29.378 -57.260  1.00  0.73           O  
ATOM   2717  CB  LEU A 370      25.297 -32.543 -57.288  1.00  0.73           C  
ATOM   2718  CG  LEU A 370      26.020 -33.656 -58.078  1.00  0.73           C  
ATOM   2719  CD1 LEU A 370      25.302 -35.003 -57.901  1.00  0.73           C  
ATOM   2720  CD2 LEU A 370      26.141 -33.330 -59.569  1.00  0.73           C  
ATOM   2721  N   ALA A 371      25.042 -30.135 -55.237  1.00  0.59           N  
ATOM   2722  CA  ALA A 371      24.232 -29.207 -54.479  1.00  0.59           C  
ATOM   2723  C   ALA A 371      24.725 -29.145 -53.035  1.00  0.59           C  
ATOM   2724  O   ALA A 371      25.395 -30.046 -52.546  1.00  0.59           O  
ATOM   2725  CB  ALA A 371      22.744 -29.626 -54.499  1.00  0.59           C  
ATOM   2726  N   GLY A 372      24.415 -28.060 -52.287  1.00  0.35           N  
ATOM   2727  CA  GLY A 372      24.838 -27.908 -50.889  1.00  0.35           C  
ATOM   2728  C   GLY A 372      24.503 -29.053 -49.946  1.00  0.35           C  
ATOM   2729  O   GLY A 372      23.374 -29.530 -49.880  1.00  0.35           O  
ATOM   2730  N   GLY A 373      25.506 -29.519 -49.171  1.00  0.30           N  
ATOM   2731  CA  GLY A 373      25.380 -30.722 -48.354  1.00  0.30           C  
ATOM   2732  C   GLY A 373      24.506 -30.642 -47.126  1.00  0.30           C  
ATOM   2733  O   GLY A 373      24.676 -29.791 -46.253  1.00  0.30           O  
ATOM   2734  N   VAL A 374      23.587 -31.617 -46.987  1.00  0.20           N  
ATOM   2735  CA  VAL A 374      22.746 -31.762 -45.813  1.00  0.20           C  
ATOM   2736  C   VAL A 374      23.428 -32.673 -44.806  1.00  0.20           C  
ATOM   2737  O   VAL A 374      23.647 -33.859 -45.050  1.00  0.20           O  
ATOM   2738  CB  VAL A 374      21.362 -32.328 -46.131  1.00  0.20           C  
ATOM   2739  CG1 VAL A 374      20.469 -32.278 -44.871  1.00  0.20           C  
ATOM   2740  CG2 VAL A 374      20.717 -31.505 -47.263  1.00  0.20           C  
ATOM   2741  N   ALA A 375      23.769 -32.130 -43.623  1.00  0.17           N  
ATOM   2742  CA  ALA A 375      24.380 -32.875 -42.546  1.00  0.17           C  
ATOM   2743  C   ALA A 375      23.376 -33.057 -41.420  1.00  0.17           C  
ATOM   2744  O   ALA A 375      22.647 -32.127 -41.069  1.00  0.17           O  
ATOM   2745  CB  ALA A 375      25.611 -32.130 -42.005  1.00  0.17           C  
ATOM   2746  N   VAL A 376      23.302 -34.283 -40.864  1.00  0.17           N  
ATOM   2747  CA  VAL A 376      22.279 -34.683 -39.906  1.00  0.17           C  
ATOM   2748  C   VAL A 376      22.459 -34.098 -38.511  1.00  0.17           C  
ATOM   2749  O   VAL A 376      21.541 -33.540 -37.918  1.00  0.17           O  
ATOM   2750  CB  VAL A 376      22.261 -36.208 -39.798  1.00  0.17           C  
ATOM   2751  CG1 VAL A 376      21.055 -36.678 -38.963  1.00  0.17           C  
ATOM   2752  CG2 VAL A 376      22.182 -36.829 -41.208  1.00  0.17           C  
ATOM   2753  N   ILE A 377      23.679 -34.201 -37.954  1.00  0.22           N  
ATOM   2754  CA  ILE A 377      24.011 -33.668 -36.644  1.00  0.22           C  
ATOM   2755  C   ILE A 377      25.277 -32.868 -36.868  1.00  0.22           C  
ATOM   2756  O   ILE A 377      26.304 -33.425 -37.250  1.00  0.22           O  
ATOM   2757  CB  ILE A 377      24.233 -34.770 -35.584  1.00  0.22           C  
ATOM   2758  CG1 ILE A 377      22.928 -35.561 -35.289  1.00  0.22           C  
ATOM   2759  CG2 ILE A 377      24.839 -34.187 -34.283  1.00  0.22           C  
ATOM   2760  CD1 ILE A 377      23.138 -36.796 -34.398  1.00  0.22           C  
ATOM   2761  N   LYS A 378      25.252 -31.538 -36.638  1.00  0.21           N  
ATOM   2762  CA  LYS A 378      26.435 -30.692 -36.665  1.00  0.21           C  
ATOM   2763  C   LYS A 378      26.582 -30.005 -35.332  1.00  0.21           C  
ATOM   2764  O   LYS A 378      25.622 -29.538 -34.728  1.00  0.21           O  
ATOM   2765  CB  LYS A 378      26.451 -29.614 -37.767  1.00  0.21           C  
ATOM   2766  CG  LYS A 378      26.747 -30.229 -39.136  1.00  0.21           C  
ATOM   2767  CD  LYS A 378      26.886 -29.176 -40.244  1.00  0.21           C  
ATOM   2768  CE  LYS A 378      25.592 -28.387 -40.472  1.00  0.21           C  
ATOM   2769  NZ  LYS A 378      25.716 -27.529 -41.670  1.00  0.21           N  
ATOM   2770  N   VAL A 379      27.826 -29.978 -34.845  1.00  0.21           N  
ATOM   2771  CA  VAL A 379      28.212 -29.682 -33.482  1.00  0.21           C  
ATOM   2772  C   VAL A 379      29.475 -28.808 -33.699  1.00  0.21           C  
ATOM   2773  O   VAL A 379      29.902 -28.728 -34.849  1.00  0.21           O  
ATOM   2774  CB  VAL A 379      28.367 -31.068 -32.832  1.00  0.21           C  
ATOM   2775  CG1 VAL A 379      28.876 -31.024 -31.422  1.00  0.21           C  
ATOM   2776  CG2 VAL A 379      27.026 -31.799 -32.663  1.00  0.21           C  
ATOM   2777  N   GLY A 380      30.079 -28.032 -32.745  1.00  0.27           N  
ATOM   2778  CA  GLY A 380      31.093 -26.987 -33.073  1.00  0.27           C  
ATOM   2779  C   GLY A 380      32.337 -26.772 -32.208  1.00  0.27           C  
ATOM   2780  O   GLY A 380      32.292 -26.732 -30.989  1.00  0.27           O  
ATOM   2781  N   ALA A 381      33.528 -26.621 -32.840  1.00  0.38           N  
ATOM   2782  CA  ALA A 381      34.806 -26.716 -32.140  1.00  0.38           C  
ATOM   2783  C   ALA A 381      35.513 -25.430 -31.741  1.00  0.38           C  
ATOM   2784  O   ALA A 381      35.243 -24.344 -32.247  1.00  0.38           O  
ATOM   2785  CB  ALA A 381      35.814 -27.544 -32.973  1.00  0.38           C  
ATOM   2786  N   ALA A 382      36.505 -25.599 -30.832  1.00  0.40           N  
ATOM   2787  CA  ALA A 382      37.657 -24.730 -30.704  1.00  0.40           C  
ATOM   2788  C   ALA A 382      38.790 -25.266 -31.596  1.00  0.40           C  
ATOM   2789  O   ALA A 382      38.709 -25.223 -32.821  1.00  0.40           O  
ATOM   2790  CB  ALA A 382      38.099 -24.595 -29.226  1.00  0.40           C  
ATOM   2791  N   THR A 383      39.885 -25.803 -31.017  1.00  0.33           N  
ATOM   2792  CA  THR A 383      40.992 -26.421 -31.752  1.00  0.33           C  
ATOM   2793  C   THR A 383      40.622 -27.656 -32.556  1.00  0.33           C  
ATOM   2794  O   THR A 383      39.638 -28.337 -32.281  1.00  0.33           O  
ATOM   2795  CB  THR A 383      42.178 -26.828 -30.871  1.00  0.33           C  
ATOM   2796  OG1 THR A 383      41.765 -27.432 -29.656  1.00  0.33           O  
ATOM   2797  CG2 THR A 383      42.974 -25.597 -30.474  1.00  0.33           C  
ATOM   2798  N   GLU A 384      41.465 -28.036 -33.555  1.00  0.27           N  
ATOM   2799  CA  GLU A 384      41.396 -29.369 -34.154  1.00  0.27           C  
ATOM   2800  C   GLU A 384      41.616 -30.456 -33.114  1.00  0.27           C  
ATOM   2801  O   GLU A 384      40.942 -31.479 -33.097  1.00  0.27           O  
ATOM   2802  CB  GLU A 384      42.377 -29.616 -35.335  1.00  0.27           C  
ATOM   2803  CG  GLU A 384      43.879 -29.820 -34.989  1.00  0.27           C  
ATOM   2804  CD  GLU A 384      44.681 -30.404 -36.154  1.00  0.27           C  
ATOM   2805  OE1 GLU A 384      44.103 -30.586 -37.253  1.00  0.27           O  
ATOM   2806  OE2 GLU A 384      45.881 -30.697 -35.920  1.00  0.27           O  
ATOM   2807  N   THR A 385      42.514 -30.183 -32.139  1.00  0.25           N  
ATOM   2808  CA  THR A 385      42.951 -31.108 -31.104  1.00  0.25           C  
ATOM   2809  C   THR A 385      41.979 -31.087 -29.936  1.00  0.25           C  
ATOM   2810  O   THR A 385      42.222 -31.601 -28.847  1.00  0.25           O  
ATOM   2811  CB  THR A 385      44.396 -30.837 -30.679  1.00  0.25           C  
ATOM   2812  OG1 THR A 385      45.058 -32.037 -30.335  1.00  0.25           O  
ATOM   2813  CG2 THR A 385      44.563 -29.849 -29.522  1.00  0.25           C  
ATOM   2814  N   ALA A 386      40.785 -30.529 -30.200  1.00  0.30           N  
ATOM   2815  CA  ALA A 386      39.596 -30.614 -29.401  1.00  0.30           C  
ATOM   2816  C   ALA A 386      38.484 -31.374 -30.133  1.00  0.30           C  
ATOM   2817  O   ALA A 386      37.347 -31.354 -29.663  1.00  0.30           O  
ATOM   2818  CB  ALA A 386      39.112 -29.191 -29.055  1.00  0.30           C  
ATOM   2819  N   LEU A 387      38.779 -32.075 -31.259  1.00  0.26           N  
ATOM   2820  CA  LEU A 387      37.880 -33.026 -31.915  1.00  0.26           C  
ATOM   2821  C   LEU A 387      38.074 -34.433 -31.316  1.00  0.26           C  
ATOM   2822  O   LEU A 387      37.859 -34.552 -30.127  1.00  0.26           O  
ATOM   2823  CB  LEU A 387      37.918 -32.946 -33.481  1.00  0.26           C  
ATOM   2824  CG  LEU A 387      37.004 -31.839 -34.126  1.00  0.26           C  
ATOM   2825  CD1 LEU A 387      35.637 -31.717 -33.445  1.00  0.26           C  
ATOM   2826  CD2 LEU A 387      37.624 -30.453 -34.360  1.00  0.26           C  
ATOM   2827  N   LYS A 388      38.478 -35.524 -32.010  1.00  0.23           N  
ATOM   2828  CA  LYS A 388      38.583 -36.948 -31.594  1.00  0.23           C  
ATOM   2829  C   LYS A 388      38.125 -37.535 -30.255  1.00  0.23           C  
ATOM   2830  O   LYS A 388      37.284 -38.413 -30.249  1.00  0.23           O  
ATOM   2831  CB  LYS A 388      39.983 -37.528 -31.835  1.00  0.23           C  
ATOM   2832  CG  LYS A 388      40.026 -38.925 -32.492  1.00  0.23           C  
ATOM   2833  CD  LYS A 388      41.397 -39.585 -32.256  1.00  0.23           C  
ATOM   2834  CE  LYS A 388      42.224 -39.794 -33.526  1.00  0.23           C  
ATOM   2835  NZ  LYS A 388      43.647 -40.024 -33.159  1.00  0.23           N  
ATOM   2836  N   GLU A 389      38.599 -37.152 -29.048  1.00  0.22           N  
ATOM   2837  CA  GLU A 389      37.925 -37.596 -27.799  1.00  0.22           C  
ATOM   2838  C   GLU A 389      36.487 -37.068 -27.799  1.00  0.22           C  
ATOM   2839  O   GLU A 389      35.473 -37.733 -27.565  1.00  0.22           O  
ATOM   2840  CB  GLU A 389      38.671 -37.077 -26.539  1.00  0.22           C  
ATOM   2841  CG  GLU A 389      38.139 -37.599 -25.176  1.00  0.22           C  
ATOM   2842  CD  GLU A 389      38.404 -39.089 -24.941  1.00  0.22           C  
ATOM   2843  OE1 GLU A 389      39.332 -39.642 -25.579  1.00  0.22           O  
ATOM   2844  OE2 GLU A 389      37.692 -39.654 -24.072  1.00  0.22           O  
ATOM   2845  N   ARG A 390      36.421 -35.838 -28.282  1.00  0.24           N  
ATOM   2846  CA  ARG A 390      35.315 -35.133 -28.827  1.00  0.24           C  
ATOM   2847  C   ARG A 390      35.121 -35.404 -30.343  1.00  0.24           C  
ATOM   2848  O   ARG A 390      34.827 -34.479 -31.094  1.00  0.24           O  
ATOM   2849  CB  ARG A 390      35.474 -33.685 -28.326  1.00  0.24           C  
ATOM   2850  CG  ARG A 390      34.507 -32.667 -28.912  1.00  0.24           C  
ATOM   2851  CD  ARG A 390      34.193 -31.483 -28.008  1.00  0.24           C  
ATOM   2852  NE  ARG A 390      35.400 -30.640 -27.736  1.00  0.24           N  
ATOM   2853  CZ  ARG A 390      35.308 -29.343 -27.387  1.00  0.24           C  
ATOM   2854  NH1 ARG A 390      34.145 -28.698 -27.378  1.00  0.24           N  
ATOM   2855  NH2 ARG A 390      36.378 -28.688 -26.954  1.00  0.24           N  
ATOM   2856  N   LYS A 391      35.252 -36.668 -30.830  1.00  0.23           N  
ATOM   2857  CA  LYS A 391      34.645 -37.294 -32.038  1.00  0.23           C  
ATOM   2858  C   LYS A 391      34.915 -38.785 -32.287  1.00  0.23           C  
ATOM   2859  O   LYS A 391      34.757 -39.297 -33.386  1.00  0.23           O  
ATOM   2860  CB  LYS A 391      34.574 -36.516 -33.388  1.00  0.23           C  
ATOM   2861  CG  LYS A 391      33.208 -36.806 -34.059  1.00  0.23           C  
ATOM   2862  CD  LYS A 391      33.185 -36.784 -35.593  1.00  0.23           C  
ATOM   2863  CE  LYS A 391      31.829 -37.202 -36.171  1.00  0.23           C  
ATOM   2864  NZ  LYS A 391      32.039 -37.850 -37.500  1.00  0.23           N  
ATOM   2865  N   GLU A 392      35.115 -39.522 -31.183  1.00  0.23           N  
ATOM   2866  CA  GLU A 392      34.446 -40.748 -30.825  1.00  0.23           C  
ATOM   2867  C   GLU A 392      33.058 -40.273 -30.369  1.00  0.23           C  
ATOM   2868  O   GLU A 392      32.448 -39.409 -30.997  1.00  0.23           O  
ATOM   2869  CB  GLU A 392      35.261 -41.434 -29.690  1.00  0.23           C  
ATOM   2870  CG  GLU A 392      35.228 -42.983 -29.700  1.00  0.23           C  
ATOM   2871  CD  GLU A 392      36.289 -43.590 -30.625  1.00  0.23           C  
ATOM   2872  OE1 GLU A 392      35.935 -44.490 -31.429  1.00  0.23           O  
ATOM   2873  OE2 GLU A 392      37.479 -43.190 -30.507  1.00  0.23           O  
ATOM   2874  N   SER A 393      32.517 -40.729 -29.239  1.00  0.25           N  
ATOM   2875  CA  SER A 393      31.471 -40.057 -28.467  1.00  0.25           C  
ATOM   2876  C   SER A 393      30.159 -39.439 -29.046  1.00  0.25           C  
ATOM   2877  O   SER A 393      29.105 -39.874 -28.670  1.00  0.25           O  
ATOM   2878  CB  SER A 393      31.796 -39.848 -26.938  1.00  0.25           C  
ATOM   2879  OG  SER A 393      31.864 -38.519 -26.411  1.00  0.25           O  
ATOM   2880  N   VAL A 394      30.079 -38.551 -30.079  1.00  0.28           N  
ATOM   2881  CA  VAL A 394      28.838 -38.419 -30.910  1.00  0.28           C  
ATOM   2882  C   VAL A 394      28.856 -39.564 -31.945  1.00  0.28           C  
ATOM   2883  O   VAL A 394      28.063 -39.681 -32.886  1.00  0.28           O  
ATOM   2884  CB  VAL A 394      28.657 -37.032 -31.557  1.00  0.28           C  
ATOM   2885  CG1 VAL A 394      27.456 -36.774 -32.482  1.00  0.28           C  
ATOM   2886  CG2 VAL A 394      28.498 -36.034 -30.400  1.00  0.28           C  
ATOM   2887  N   GLU A 395      29.758 -40.515 -31.676  1.00  0.22           N  
ATOM   2888  CA  GLU A 395      29.842 -41.902 -32.055  1.00  0.22           C  
ATOM   2889  C   GLU A 395      29.738 -42.790 -30.797  1.00  0.22           C  
ATOM   2890  O   GLU A 395      30.106 -43.958 -30.849  1.00  0.22           O  
ATOM   2891  CB  GLU A 395      31.105 -42.118 -32.916  1.00  0.22           C  
ATOM   2892  CG  GLU A 395      31.119 -41.024 -34.019  1.00  0.22           C  
ATOM   2893  CD  GLU A 395      32.183 -41.084 -35.098  1.00  0.22           C  
ATOM   2894  OE1 GLU A 395      32.849 -42.127 -35.272  1.00  0.22           O  
ATOM   2895  OE2 GLU A 395      32.232 -40.059 -35.840  1.00  0.22           O  
ATOM   2896  N   ASP A 396      29.128 -42.246 -29.694  1.00  0.31           N  
ATOM   2897  CA  ASP A 396      28.698 -42.866 -28.430  1.00  0.31           C  
ATOM   2898  C   ASP A 396      27.379 -42.363 -27.644  1.00  0.31           C  
ATOM   2899  O   ASP A 396      27.359 -42.449 -26.418  1.00  0.31           O  
ATOM   2900  CB  ASP A 396      29.777 -43.019 -27.323  1.00  0.31           C  
ATOM   2901  CG  ASP A 396      30.963 -43.850 -27.784  1.00  0.31           C  
ATOM   2902  OD1 ASP A 396      30.783 -45.097 -27.830  1.00  0.31           O  
ATOM   2903  OD2 ASP A 396      32.039 -43.244 -28.013  1.00  0.31           O  
ATOM   2904  N   ALA A 397      26.231 -41.871 -28.194  1.00  0.42           N  
ATOM   2905  CA  ALA A 397      24.840 -41.940 -27.678  1.00  0.42           C  
ATOM   2906  C   ALA A 397      23.507 -41.913 -28.547  1.00  0.42           C  
ATOM   2907  O   ALA A 397      22.470 -42.309 -28.028  1.00  0.42           O  
ATOM   2908  CB  ALA A 397      24.649 -40.924 -26.545  1.00  0.42           C  
ATOM   2909  N   VAL A 398      23.392 -41.556 -29.863  1.00  0.36           N  
ATOM   2910  CA  VAL A 398      22.181 -41.803 -30.709  1.00  0.36           C  
ATOM   2911  C   VAL A 398      21.917 -43.263 -30.904  1.00  0.36           C  
ATOM   2912  O   VAL A 398      20.784 -43.714 -30.818  1.00  0.36           O  
ATOM   2913  CB  VAL A 398      22.048 -41.138 -32.119  1.00  0.36           C  
ATOM   2914  CG1 VAL A 398      21.412 -41.992 -33.260  1.00  0.36           C  
ATOM   2915  CG2 VAL A 398      21.230 -39.849 -31.961  1.00  0.36           C  
ATOM   2916  N   ALA A 399      22.941 -44.087 -31.165  1.00  0.42           N  
ATOM   2917  CA  ALA A 399      22.718 -45.499 -31.301  1.00  0.42           C  
ATOM   2918  C   ALA A 399      22.364 -46.141 -29.948  1.00  0.42           C  
ATOM   2919  O   ALA A 399      21.650 -47.134 -29.890  1.00  0.42           O  
ATOM   2920  CB  ALA A 399      23.865 -46.121 -32.120  1.00  0.42           C  
ATOM   2921  N   ALA A 400      22.696 -45.483 -28.807  1.00  0.44           N  
ATOM   2922  CA  ALA A 400      22.089 -45.782 -27.520  1.00  0.44           C  
ATOM   2923  C   ALA A 400      20.592 -45.550 -27.509  1.00  0.44           C  
ATOM   2924  O   ALA A 400      19.848 -46.401 -27.049  1.00  0.44           O  
ATOM   2925  CB  ALA A 400      22.717 -44.969 -26.371  1.00  0.44           C  
ATOM   2926  N   ALA A 401      20.105 -44.428 -28.076  1.00  0.50           N  
ATOM   2927  CA  ALA A 401      18.692 -44.210 -28.319  1.00  0.50           C  
ATOM   2928  C   ALA A 401      18.073 -45.221 -29.294  1.00  0.50           C  
ATOM   2929  O   ALA A 401      17.021 -45.778 -29.006  1.00  0.50           O  
ATOM   2930  CB  ALA A 401      18.441 -42.762 -28.793  1.00  0.50           C  
ATOM   2931  N   LYS A 402      18.735 -45.550 -30.433  1.00  0.47           N  
ATOM   2932  CA  LYS A 402      18.265 -46.552 -31.394  1.00  0.47           C  
ATOM   2933  C   LYS A 402      18.073 -47.921 -30.767  1.00  0.47           C  
ATOM   2934  O   LYS A 402      17.066 -48.591 -30.975  1.00  0.47           O  
ATOM   2935  CB  LYS A 402      19.277 -46.811 -32.555  1.00  0.47           C  
ATOM   2936  CG  LYS A 402      19.503 -45.671 -33.563  1.00  0.47           C  
ATOM   2937  CD  LYS A 402      20.565 -46.085 -34.607  1.00  0.47           C  
ATOM   2938  CE  LYS A 402      20.823 -45.089 -35.742  1.00  0.47           C  
ATOM   2939  NZ  LYS A 402      19.644 -45.028 -36.632  1.00  0.47           N  
ATOM   2940  N   ALA A 403      19.054 -48.361 -29.972  1.00  0.54           N  
ATOM   2941  CA  ALA A 403      19.047 -49.682 -29.417  1.00  0.54           C  
ATOM   2942  C   ALA A 403      18.351 -49.748 -28.049  1.00  0.54           C  
ATOM   2943  O   ALA A 403      17.858 -50.790 -27.627  1.00  0.54           O  
ATOM   2944  CB  ALA A 403      20.499 -50.171 -29.447  1.00  0.54           C  
ATOM   2945  N   ALA A 404      18.187 -48.608 -27.344  1.00  0.55           N  
ATOM   2946  CA  ALA A 404      17.229 -48.472 -26.258  1.00  0.55           C  
ATOM   2947  C   ALA A 404      15.790 -48.568 -26.745  1.00  0.55           C  
ATOM   2948  O   ALA A 404      14.951 -49.200 -26.114  1.00  0.55           O  
ATOM   2949  CB  ALA A 404      17.418 -47.144 -25.498  1.00  0.55           C  
ATOM   2950  N   VAL A 405      15.479 -47.971 -27.912  1.00  0.54           N  
ATOM   2951  CA  VAL A 405      14.218 -48.154 -28.621  1.00  0.54           C  
ATOM   2952  C   VAL A 405      14.000 -49.613 -29.037  1.00  0.54           C  
ATOM   2953  O   VAL A 405      12.897 -50.142 -28.921  1.00  0.54           O  
ATOM   2954  CB  VAL A 405      14.143 -47.179 -29.801  1.00  0.54           C  
ATOM   2955  CG1 VAL A 405      13.025 -47.528 -30.802  1.00  0.54           C  
ATOM   2956  CG2 VAL A 405      13.915 -45.754 -29.254  1.00  0.54           C  
ATOM   2957  N   GLU A 406      15.063 -50.308 -29.498  1.00  0.54           N  
ATOM   2958  CA  GLU A 406      15.057 -51.731 -29.811  1.00  0.54           C  
ATOM   2959  C   GLU A 406      14.777 -52.665 -28.630  1.00  0.54           C  
ATOM   2960  O   GLU A 406      13.965 -53.580 -28.754  1.00  0.54           O  
ATOM   2961  CB  GLU A 406      16.435 -52.093 -30.417  1.00  0.54           C  
ATOM   2962  CG  GLU A 406      16.585 -53.504 -31.033  1.00  0.54           C  
ATOM   2963  CD  GLU A 406      18.035 -53.816 -31.340  1.00  0.54           C  
ATOM   2964  OE1 GLU A 406      18.926 -52.936 -31.173  1.00  0.54           O  
ATOM   2965  OE2 GLU A 406      18.340 -54.993 -31.672  1.00  0.54           O  
ATOM   2966  N   GLU A 407      15.424 -52.463 -27.455  1.00  0.53           N  
ATOM   2967  CA  GLU A 407      15.295 -53.421 -26.356  1.00  0.53           C  
ATOM   2968  C   GLU A 407      14.850 -52.897 -24.979  1.00  0.53           C  
ATOM   2969  O   GLU A 407      14.418 -53.687 -24.142  1.00  0.53           O  
ATOM   2970  CB  GLU A 407      16.631 -54.158 -26.136  1.00  0.53           C  
ATOM   2971  CG  GLU A 407      16.979 -55.291 -27.135  1.00  0.53           C  
ATOM   2972  CD  GLU A 407      17.877 -56.367 -26.500  1.00  0.53           C  
ATOM   2973  OE1 GLU A 407      17.549 -56.856 -25.381  1.00  0.53           O  
ATOM   2974  OE2 GLU A 407      18.913 -56.762 -27.101  1.00  0.53           O  
ATOM   2975  N   GLY A 408      14.893 -51.582 -24.667  1.00  0.66           N  
ATOM   2976  CA  GLY A 408      14.382 -51.056 -23.388  1.00  0.66           C  
ATOM   2977  C   GLY A 408      15.392 -50.355 -22.491  1.00  0.66           C  
ATOM   2978  O   GLY A 408      16.431 -49.875 -22.940  1.00  0.66           O  
ATOM   2979  N   ILE A 409      15.117 -50.259 -21.160  1.00  0.61           N  
ATOM   2980  CA  ILE A 409      15.919 -49.469 -20.212  1.00  0.61           C  
ATOM   2981  C   ILE A 409      15.965 -50.092 -18.807  1.00  0.61           C  
ATOM   2982  O   ILE A 409      15.018 -50.767 -18.408  1.00  0.61           O  
ATOM   2983  CB  ILE A 409      15.477 -48.001 -20.159  1.00  0.61           C  
ATOM   2984  CG1 ILE A 409      16.662 -47.046 -19.905  1.00  0.61           C  
ATOM   2985  CG2 ILE A 409      14.327 -47.764 -19.155  1.00  0.61           C  
ATOM   2986  CD1 ILE A 409      17.175 -46.415 -21.204  1.00  0.61           C  
ATOM   2987  N   VAL A 410      17.070 -49.923 -18.027  1.00  0.65           N  
ATOM   2988  CA  VAL A 410      17.213 -50.477 -16.675  1.00  0.65           C  
ATOM   2989  C   VAL A 410      17.850 -49.456 -15.719  1.00  0.65           C  
ATOM   2990  O   VAL A 410      18.380 -48.439 -16.169  1.00  0.65           O  
ATOM   2991  CB  VAL A 410      18.009 -51.791 -16.606  1.00  0.65           C  
ATOM   2992  CG1 VAL A 410      17.056 -52.987 -16.779  1.00  0.65           C  
ATOM   2993  CG2 VAL A 410      19.139 -51.828 -17.640  1.00  0.65           C  
ATOM   2994  N   PRO A 411      17.786 -49.647 -14.387  1.00  0.74           N  
ATOM   2995  CA  PRO A 411      18.526 -48.851 -13.403  1.00  0.74           C  
ATOM   2996  C   PRO A 411      20.026 -48.808 -13.610  1.00  0.74           C  
ATOM   2997  O   PRO A 411      20.667 -49.858 -13.573  1.00  0.74           O  
ATOM   2998  CB  PRO A 411      18.186 -49.511 -12.058  1.00  0.74           C  
ATOM   2999  CG  PRO A 411      16.792 -50.091 -12.292  1.00  0.74           C  
ATOM   3000  CD  PRO A 411      16.876 -50.588 -13.729  1.00  0.74           C  
ATOM   3001  N   GLY A 412      20.596 -47.600 -13.789  1.00  0.74           N  
ATOM   3002  CA  GLY A 412      21.976 -47.440 -14.197  1.00  0.74           C  
ATOM   3003  C   GLY A 412      23.072 -47.663 -13.203  1.00  0.74           C  
ATOM   3004  O   GLY A 412      22.896 -47.995 -12.035  1.00  0.74           O  
ATOM   3005  N   GLY A 413      24.309 -47.458 -13.676  1.00  0.66           N  
ATOM   3006  CA  GLY A 413      25.481 -47.428 -12.821  1.00  0.66           C  
ATOM   3007  C   GLY A 413      25.952 -48.791 -12.422  1.00  0.66           C  
ATOM   3008  O   GLY A 413      26.663 -48.951 -11.437  1.00  0.66           O  
ATOM   3009  N   GLY A 414      25.515 -49.835 -13.147  1.00  0.66           N  
ATOM   3010  CA  GLY A 414      25.835 -51.213 -12.799  1.00  0.66           C  
ATOM   3011  C   GLY A 414      24.989 -51.773 -11.688  1.00  0.66           C  
ATOM   3012  O   GLY A 414      25.198 -52.906 -11.257  1.00  0.66           O  
ATOM   3013  N   ALA A 415      23.989 -51.003 -11.205  1.00  0.79           N  
ATOM   3014  CA  ALA A 415      23.047 -51.425 -10.187  1.00  0.79           C  
ATOM   3015  C   ALA A 415      22.228 -52.621 -10.639  1.00  0.79           C  
ATOM   3016  O   ALA A 415      22.080 -53.600  -9.912  1.00  0.79           O  
ATOM   3017  CB  ALA A 415      22.110 -50.255  -9.829  1.00  0.79           C  
ATOM   3018  N   SER A 416      21.778 -52.599 -11.912  1.00  0.69           N  
ATOM   3019  CA  SER A 416      21.014 -53.652 -12.569  1.00  0.69           C  
ATOM   3020  C   SER A 416      21.576 -55.054 -12.375  1.00  0.69           C  
ATOM   3021  O   SER A 416      20.873 -55.986 -11.993  1.00  0.69           O  
ATOM   3022  CB  SER A 416      20.934 -53.371 -14.100  1.00  0.69           C  
ATOM   3023  OG  SER A 416      22.232 -53.321 -14.707  1.00  0.69           O  
ATOM   3024  N   LEU A 417      22.888 -55.210 -12.597  1.00  0.68           N  
ATOM   3025  CA  LEU A 417      23.660 -56.416 -12.421  1.00  0.68           C  
ATOM   3026  C   LEU A 417      23.759 -56.893 -10.983  1.00  0.68           C  
ATOM   3027  O   LEU A 417      23.631 -58.083 -10.709  1.00  0.68           O  
ATOM   3028  CB  LEU A 417      25.041 -56.197 -13.061  1.00  0.68           C  
ATOM   3029  CG  LEU A 417      24.937 -56.080 -14.595  1.00  0.68           C  
ATOM   3030  CD1 LEU A 417      26.219 -55.500 -15.159  1.00  0.68           C  
ATOM   3031  CD2 LEU A 417      24.659 -57.412 -15.305  1.00  0.68           C  
ATOM   3032  N   ILE A 418      23.922 -55.986 -10.002  1.00  0.71           N  
ATOM   3033  CA  ILE A 418      23.855 -56.329  -8.583  1.00  0.71           C  
ATOM   3034  C   ILE A 418      22.486 -56.855  -8.197  1.00  0.71           C  
ATOM   3035  O   ILE A 418      22.343 -57.855  -7.494  1.00  0.71           O  
ATOM   3036  CB  ILE A 418      24.234 -55.151  -7.695  1.00  0.71           C  
ATOM   3037  CG1 ILE A 418      25.692 -54.782  -8.019  1.00  0.71           C  
ATOM   3038  CG2 ILE A 418      24.082 -55.534  -6.201  1.00  0.71           C  
ATOM   3039  CD1 ILE A 418      26.223 -53.565  -7.268  1.00  0.71           C  
ATOM   3040  N   HIS A 419      21.415 -56.225  -8.702  1.00  0.67           N  
ATOM   3041  CA  HIS A 419      20.075 -56.750  -8.553  1.00  0.67           C  
ATOM   3042  C   HIS A 419      19.846 -58.106  -9.216  1.00  0.67           C  
ATOM   3043  O   HIS A 419      19.148 -58.934  -8.638  1.00  0.67           O  
ATOM   3044  CB  HIS A 419      19.008 -55.707  -8.920  1.00  0.67           C  
ATOM   3045  CG  HIS A 419      19.013 -54.602  -7.903  1.00  0.67           C  
ATOM   3046  ND1 HIS A 419      19.558 -53.381  -8.224  1.00  0.67           N  
ATOM   3047  CD2 HIS A 419      18.621 -54.613  -6.599  1.00  0.67           C  
ATOM   3048  CE1 HIS A 419      19.484 -52.663  -7.118  1.00  0.67           C  
ATOM   3049  NE2 HIS A 419      18.929 -53.366  -6.099  1.00  0.67           N  
ATOM   3050  N   GLN A 420      20.452 -58.411 -10.391  1.00  0.56           N  
ATOM   3051  CA  GLN A 420      20.491 -59.776 -10.924  1.00  0.56           C  
ATOM   3052  C   GLN A 420      21.245 -60.761 -10.032  1.00  0.56           C  
ATOM   3053  O   GLN A 420      20.780 -61.870  -9.772  1.00  0.56           O  
ATOM   3054  CB  GLN A 420      21.141 -59.894 -12.333  1.00  0.56           C  
ATOM   3055  CG  GLN A 420      20.550 -59.009 -13.456  1.00  0.56           C  
ATOM   3056  CD  GLN A 420      19.047 -59.182 -13.692  1.00  0.56           C  
ATOM   3057  OE1 GLN A 420      18.349 -60.061 -13.185  1.00  0.56           O  
ATOM   3058  NE2 GLN A 420      18.510 -58.275 -14.543  1.00  0.56           N  
ATOM   3059  N   ALA A 421      22.419 -60.355  -9.503  1.00  0.63           N  
ATOM   3060  CA  ALA A 421      23.281 -61.142  -8.637  1.00  0.63           C  
ATOM   3061  C   ALA A 421      22.583 -61.612  -7.371  1.00  0.63           C  
ATOM   3062  O   ALA A 421      22.745 -62.746  -6.923  1.00  0.63           O  
ATOM   3063  CB  ALA A 421      24.516 -60.303  -8.265  1.00  0.63           C  
ATOM   3064  N   ARG A 422      21.719 -60.746  -6.812  1.00  0.54           N  
ATOM   3065  CA  ARG A 422      20.922 -61.040  -5.641  1.00  0.54           C  
ATOM   3066  C   ARG A 422      19.563 -61.664  -5.971  1.00  0.54           C  
ATOM   3067  O   ARG A 422      18.733 -61.819  -5.078  1.00  0.54           O  
ATOM   3068  CB  ARG A 422      20.564 -59.730  -4.896  1.00  0.54           C  
ATOM   3069  CG  ARG A 422      21.724 -58.866  -4.372  1.00  0.54           C  
ATOM   3070  CD  ARG A 422      21.276 -57.461  -3.918  1.00  0.54           C  
ATOM   3071  NE  ARG A 422      20.665 -57.515  -2.540  1.00  0.54           N  
ATOM   3072  CZ  ARG A 422      19.376 -57.702  -2.217  1.00  0.54           C  
ATOM   3073  NH1 ARG A 422      18.472 -58.130  -3.088  1.00  0.54           N  
ATOM   3074  NH2 ARG A 422      19.006 -57.447  -0.961  1.00  0.54           N  
ATOM   3075  N   LYS A 423      19.272 -61.999  -7.246  1.00  0.51           N  
ATOM   3076  CA  LYS A 423      17.949 -62.451  -7.652  1.00  0.51           C  
ATOM   3077  C   LYS A 423      17.827 -63.966  -7.636  1.00  0.51           C  
ATOM   3078  O   LYS A 423      17.472 -64.567  -6.630  1.00  0.51           O  
ATOM   3079  CB  LYS A 423      17.588 -61.872  -9.046  1.00  0.51           C  
ATOM   3080  CG  LYS A 423      16.131 -62.083  -9.487  1.00  0.51           C  
ATOM   3081  CD  LYS A 423      15.879 -61.446 -10.865  1.00  0.51           C  
ATOM   3082  CE  LYS A 423      14.465 -61.648 -11.414  1.00  0.51           C  
ATOM   3083  NZ  LYS A 423      13.481 -61.005 -10.516  1.00  0.51           N  
ATOM   3084  N   ALA A 424      18.103 -64.638  -8.771  1.00  0.48           N  
ATOM   3085  CA  ALA A 424      18.056 -66.084  -8.851  1.00  0.48           C  
ATOM   3086  C   ALA A 424      19.462 -66.653  -8.856  1.00  0.48           C  
ATOM   3087  O   ALA A 424      19.669 -67.858  -8.756  1.00  0.48           O  
ATOM   3088  CB  ALA A 424      17.332 -66.490 -10.151  1.00  0.48           C  
ATOM   3089  N   LEU A 425      20.479 -65.775  -8.938  1.00  0.51           N  
ATOM   3090  CA  LEU A 425      21.871 -66.147  -9.084  1.00  0.51           C  
ATOM   3091  C   LEU A 425      22.492 -66.522  -7.746  1.00  0.51           C  
ATOM   3092  O   LEU A 425      23.527 -67.176  -7.684  1.00  0.51           O  
ATOM   3093  CB  LEU A 425      22.655 -64.976  -9.728  1.00  0.51           C  
ATOM   3094  CG  LEU A 425      22.512 -64.831 -11.265  1.00  0.51           C  
ATOM   3095  CD1 LEU A 425      21.073 -64.684 -11.790  1.00  0.51           C  
ATOM   3096  CD2 LEU A 425      23.331 -63.621 -11.733  1.00  0.51           C  
ATOM   3097  N   THR A 426      21.841 -66.151  -6.627  1.00  0.47           N  
ATOM   3098  CA  THR A 426      22.137 -66.664  -5.296  1.00  0.47           C  
ATOM   3099  C   THR A 426      21.756 -68.126  -5.146  1.00  0.47           C  
ATOM   3100  O   THR A 426      22.541 -68.940  -4.661  1.00  0.47           O  
ATOM   3101  CB  THR A 426      21.374 -65.889  -4.225  1.00  0.47           C  
ATOM   3102  OG1 THR A 426      20.020 -65.699  -4.622  1.00  0.47           O  
ATOM   3103  CG2 THR A 426      21.985 -64.491  -4.090  1.00  0.47           C  
ATOM   3104  N   GLU A 427      20.530 -68.478  -5.581  1.00  0.49           N  
ATOM   3105  CA  GLU A 427      19.967 -69.815  -5.560  1.00  0.49           C  
ATOM   3106  C   GLU A 427      20.598 -70.770  -6.558  1.00  0.49           C  
ATOM   3107  O   GLU A 427      20.864 -71.926  -6.238  1.00  0.49           O  
ATOM   3108  CB  GLU A 427      18.434 -69.756  -5.775  1.00  0.49           C  
ATOM   3109  CG  GLU A 427      17.704 -71.118  -5.606  1.00  0.49           C  
ATOM   3110  CD  GLU A 427      17.819 -71.732  -4.207  1.00  0.49           C  
ATOM   3111  OE1 GLU A 427      18.309 -71.048  -3.273  1.00  0.49           O  
ATOM   3112  OE2 GLU A 427      17.403 -72.912  -4.077  1.00  0.49           O  
ATOM   3113  N   LEU A 428      20.876 -70.301  -7.795  1.00  0.47           N  
ATOM   3114  CA  LEU A 428      21.527 -71.032  -8.879  1.00  0.47           C  
ATOM   3115  C   LEU A 428      22.691 -71.930  -8.452  1.00  0.47           C  
ATOM   3116  O   LEU A 428      23.715 -71.468  -7.960  1.00  0.47           O  
ATOM   3117  CB  LEU A 428      21.988 -70.027  -9.972  1.00  0.47           C  
ATOM   3118  CG  LEU A 428      22.040 -70.520 -11.439  1.00  0.47           C  
ATOM   3119  CD1 LEU A 428      22.239 -69.310 -12.368  1.00  0.47           C  
ATOM   3120  CD2 LEU A 428      23.128 -71.557 -11.749  1.00  0.47           C  
ATOM   3121  N   ARG A 429      22.558 -73.253  -8.649  1.00  0.32           N  
ATOM   3122  CA  ARG A 429      23.590 -74.214  -8.325  1.00  0.32           C  
ATOM   3123  C   ARG A 429      23.893 -74.999  -9.581  1.00  0.32           C  
ATOM   3124  O   ARG A 429      23.197 -74.920 -10.589  1.00  0.32           O  
ATOM   3125  CB  ARG A 429      23.177 -75.220  -7.213  1.00  0.32           C  
ATOM   3126  CG  ARG A 429      22.939 -74.627  -5.806  1.00  0.32           C  
ATOM   3127  CD  ARG A 429      24.173 -74.266  -4.947  1.00  0.32           C  
ATOM   3128  NE  ARG A 429      24.774 -72.936  -5.324  1.00  0.32           N  
ATOM   3129  CZ  ARG A 429      24.264 -71.763  -4.927  1.00  0.32           C  
ATOM   3130  NH1 ARG A 429      23.028 -71.633  -4.468  1.00  0.32           N  
ATOM   3131  NH2 ARG A 429      24.997 -70.658  -4.994  1.00  0.32           N  
ATOM   3132  N   ALA A 430      24.993 -75.755  -9.530  1.00  0.46           N  
ATOM   3133  CA  ALA A 430      25.531 -76.539 -10.607  1.00  0.46           C  
ATOM   3134  C   ALA A 430      24.793 -77.820 -10.954  1.00  0.46           C  
ATOM   3135  O   ALA A 430      23.892 -78.272 -10.249  1.00  0.46           O  
ATOM   3136  CB  ALA A 430      26.949 -76.917 -10.196  1.00  0.46           C  
ATOM   3137  N   SER A 431      25.202 -78.431 -12.082  1.00  0.37           N  
ATOM   3138  CA  SER A 431      24.642 -79.675 -12.577  1.00  0.37           C  
ATOM   3139  C   SER A 431      25.403 -80.881 -12.071  1.00  0.37           C  
ATOM   3140  O   SER A 431      24.805 -81.903 -11.743  1.00  0.37           O  
ATOM   3141  CB  SER A 431      24.691 -79.737 -14.124  1.00  0.37           C  
ATOM   3142  OG  SER A 431      23.804 -78.778 -14.699  1.00  0.37           O  
ATOM   3143  N   LEU A 432      26.748 -80.802 -12.019  1.00  0.23           N  
ATOM   3144  CA  LEU A 432      27.596 -81.924 -11.659  1.00  0.23           C  
ATOM   3145  C   LEU A 432      28.172 -81.763 -10.258  1.00  0.23           C  
ATOM   3146  O   LEU A 432      27.842 -82.524  -9.348  1.00  0.23           O  
ATOM   3147  CB  LEU A 432      28.775 -82.107 -12.666  1.00  0.23           C  
ATOM   3148  CG  LEU A 432      28.451 -82.755 -14.039  1.00  0.23           C  
ATOM   3149  CD1 LEU A 432      27.810 -84.145 -13.904  1.00  0.23           C  
ATOM   3150  CD2 LEU A 432      27.614 -81.861 -14.963  1.00  0.23           C  
ATOM   3151  N   THR A 433      29.085 -80.790 -10.048  1.00  0.37           N  
ATOM   3152  CA  THR A 433      30.012 -80.846  -8.912  1.00  0.37           C  
ATOM   3153  C   THR A 433      30.215 -79.450  -8.332  1.00  0.37           C  
ATOM   3154  O   THR A 433      29.709 -78.445  -8.827  1.00  0.37           O  
ATOM   3155  CB  THR A 433      31.368 -81.495  -9.262  1.00  0.37           C  
ATOM   3156  OG1 THR A 433      31.198 -82.650 -10.069  1.00  0.37           O  
ATOM   3157  CG2 THR A 433      32.144 -82.002  -8.033  1.00  0.37           C  
ATOM   3158  N   GLY A 434      30.924 -79.321  -7.189  1.00  0.56           N  
ATOM   3159  CA  GLY A 434      31.123 -78.045  -6.509  1.00  0.56           C  
ATOM   3160  C   GLY A 434      32.156 -77.119  -7.108  1.00  0.56           C  
ATOM   3161  O   GLY A 434      32.231 -75.955  -6.737  1.00  0.56           O  
ATOM   3162  N   ASP A 435      32.959 -77.570  -8.081  1.00  0.55           N  
ATOM   3163  CA  ASP A 435      33.808 -76.718  -8.898  1.00  0.55           C  
ATOM   3164  C   ASP A 435      32.969 -75.822  -9.813  1.00  0.55           C  
ATOM   3165  O   ASP A 435      33.158 -74.606  -9.894  1.00  0.55           O  
ATOM   3166  CB  ASP A 435      34.844 -77.593  -9.665  1.00  0.55           C  
ATOM   3167  CG  ASP A 435      34.255 -78.854 -10.288  1.00  0.55           C  
ATOM   3168  OD1 ASP A 435      33.011 -78.915 -10.465  1.00  0.55           O  
ATOM   3169  OD2 ASP A 435      35.041 -79.797 -10.533  1.00  0.55           O  
ATOM   3170  N   GLU A 436      31.932 -76.410 -10.437  1.00  0.47           N  
ATOM   3171  CA  GLU A 436      30.867 -75.707 -11.117  1.00  0.47           C  
ATOM   3172  C   GLU A 436      30.100 -74.762 -10.188  1.00  0.47           C  
ATOM   3173  O   GLU A 436      29.821 -73.634 -10.587  1.00  0.47           O  
ATOM   3174  CB  GLU A 436      29.843 -76.666 -11.770  1.00  0.47           C  
ATOM   3175  CG  GLU A 436      30.302 -77.508 -12.983  1.00  0.47           C  
ATOM   3176  CD  GLU A 436      29.123 -78.259 -13.613  1.00  0.47           C  
ATOM   3177  OE1 GLU A 436      28.159 -78.615 -12.879  1.00  0.47           O  
ATOM   3178  OE2 GLU A 436      29.157 -78.472 -14.849  1.00  0.47           O  
ATOM   3179  N   VAL A 437      29.756 -75.143  -8.920  1.00  0.50           N  
ATOM   3180  CA  VAL A 437      29.124 -74.182  -7.995  1.00  0.50           C  
ATOM   3181  C   VAL A 437      30.019 -73.017  -7.660  1.00  0.50           C  
ATOM   3182  O   VAL A 437      29.563 -71.883  -7.717  1.00  0.50           O  
ATOM   3183  CB  VAL A 437      28.427 -74.659  -6.706  1.00  0.50           C  
ATOM   3184  CG1 VAL A 437      27.610 -75.930  -6.959  1.00  0.50           C  
ATOM   3185  CG2 VAL A 437      29.342 -74.804  -5.472  1.00  0.50           C  
ATOM   3186  N   LEU A 438      31.338 -73.232  -7.416  1.00  0.53           N  
ATOM   3187  CA  LEU A 438      32.278 -72.139  -7.213  1.00  0.53           C  
ATOM   3188  C   LEU A 438      32.276 -71.201  -8.400  1.00  0.53           C  
ATOM   3189  O   LEU A 438      32.267 -69.993  -8.220  1.00  0.53           O  
ATOM   3190  CB  LEU A 438      33.738 -72.610  -6.969  1.00  0.53           C  
ATOM   3191  CG  LEU A 438      34.001 -73.304  -5.615  1.00  0.53           C  
ATOM   3192  CD1 LEU A 438      35.475 -73.732  -5.525  1.00  0.53           C  
ATOM   3193  CD2 LEU A 438      33.632 -72.412  -4.420  1.00  0.53           C  
ATOM   3194  N   GLY A 439      32.181 -71.751  -9.629  1.00  0.54           N  
ATOM   3195  CA  GLY A 439      31.983 -71.016 -10.872  1.00  0.54           C  
ATOM   3196  C   GLY A 439      30.701 -70.218 -11.031  1.00  0.54           C  
ATOM   3197  O   GLY A 439      30.651 -69.292 -11.839  1.00  0.54           O  
ATOM   3198  N   VAL A 440      29.631 -70.557 -10.291  1.00  0.52           N  
ATOM   3199  CA  VAL A 440      28.395 -69.783 -10.217  1.00  0.52           C  
ATOM   3200  C   VAL A 440      28.438 -68.775  -9.081  1.00  0.52           C  
ATOM   3201  O   VAL A 440      28.075 -67.611  -9.240  1.00  0.52           O  
ATOM   3202  CB  VAL A 440      27.170 -70.664 -10.000  1.00  0.52           C  
ATOM   3203  CG1 VAL A 440      25.896 -69.799  -9.888  1.00  0.52           C  
ATOM   3204  CG2 VAL A 440      27.026 -71.646 -11.178  1.00  0.52           C  
ATOM   3205  N   ASP A 441      28.900 -69.182  -7.890  1.00  0.55           N  
ATOM   3206  CA  ASP A 441      28.912 -68.367  -6.690  1.00  0.55           C  
ATOM   3207  C   ASP A 441      29.770 -67.113  -6.890  1.00  0.55           C  
ATOM   3208  O   ASP A 441      29.375 -65.984  -6.596  1.00  0.55           O  
ATOM   3209  CB  ASP A 441      29.444 -69.230  -5.510  1.00  0.55           C  
ATOM   3210  CG  ASP A 441      28.569 -70.442  -5.199  1.00  0.55           C  
ATOM   3211  OD1 ASP A 441      27.460 -70.585  -5.779  1.00  0.55           O  
ATOM   3212  OD2 ASP A 441      28.996 -71.258  -4.346  1.00  0.55           O  
ATOM   3213  N   VAL A 442      30.936 -67.307  -7.527  1.00  0.48           N  
ATOM   3214  CA  VAL A 442      31.854 -66.278  -7.977  1.00  0.48           C  
ATOM   3215  C   VAL A 442      31.292 -65.340  -9.045  1.00  0.48           C  
ATOM   3216  O   VAL A 442      31.624 -64.156  -9.100  1.00  0.48           O  
ATOM   3217  CB  VAL A 442      33.132 -66.947  -8.440  1.00  0.48           C  
ATOM   3218  CG1 VAL A 442      32.909 -67.708  -9.768  1.00  0.48           C  
ATOM   3219  CG2 VAL A 442      34.314 -65.960  -8.442  1.00  0.48           C  
ATOM   3220  N   PHE A 443      30.386 -65.815  -9.941  1.00  0.43           N  
ATOM   3221  CA  PHE A 443      29.708 -64.983 -10.934  1.00  0.43           C  
ATOM   3222  C   PHE A 443      28.949 -63.884 -10.207  1.00  0.43           C  
ATOM   3223  O   PHE A 443      29.118 -62.704 -10.497  1.00  0.43           O  
ATOM   3224  CB  PHE A 443      28.773 -65.877 -11.821  1.00  0.43           C  
ATOM   3225  CG  PHE A 443      27.808 -65.202 -12.769  1.00  0.43           C  
ATOM   3226  CD1 PHE A 443      28.207 -64.184 -13.638  1.00  0.43           C  
ATOM   3227  CD2 PHE A 443      26.477 -65.650 -12.839  1.00  0.43           C  
ATOM   3228  CE1 PHE A 443      27.299 -63.599 -14.533  1.00  0.43           C  
ATOM   3229  CE2 PHE A 443      25.594 -65.141 -13.800  1.00  0.43           C  
ATOM   3230  CZ  PHE A 443      25.998 -64.095 -14.636  1.00  0.43           C  
ATOM   3231  N   SER A 444      28.221 -64.254  -9.135  1.00  0.61           N  
ATOM   3232  CA  SER A 444      27.529 -63.319  -8.256  1.00  0.61           C  
ATOM   3233  C   SER A 444      28.448 -62.295  -7.586  1.00  0.61           C  
ATOM   3234  O   SER A 444      28.125 -61.108  -7.551  1.00  0.61           O  
ATOM   3235  CB  SER A 444      26.670 -64.061  -7.199  1.00  0.61           C  
ATOM   3236  OG  SER A 444      25.730 -63.177  -6.585  1.00  0.61           O  
ATOM   3237  N   GLU A 445      29.660 -62.699  -7.121  1.00  0.58           N  
ATOM   3238  CA  GLU A 445      30.672 -61.772  -6.614  1.00  0.58           C  
ATOM   3239  C   GLU A 445      31.077 -60.718  -7.635  1.00  0.58           C  
ATOM   3240  O   GLU A 445      31.153 -59.524  -7.349  1.00  0.58           O  
ATOM   3241  CB  GLU A 445      32.005 -62.484  -6.245  1.00  0.58           C  
ATOM   3242  CG  GLU A 445      31.934 -63.547  -5.128  1.00  0.58           C  
ATOM   3243  CD  GLU A 445      33.320 -64.151  -4.898  1.00  0.58           C  
ATOM   3244  OE1 GLU A 445      34.247 -63.376  -4.549  1.00  0.58           O  
ATOM   3245  OE2 GLU A 445      33.465 -65.386  -5.084  1.00  0.58           O  
ATOM   3246  N   ALA A 446      31.327 -61.132  -8.888  1.00  0.52           N  
ATOM   3247  CA  ALA A 446      31.802 -60.223  -9.900  1.00  0.52           C  
ATOM   3248  C   ALA A 446      30.718 -59.379 -10.568  1.00  0.52           C  
ATOM   3249  O   ALA A 446      31.046 -58.370 -11.181  1.00  0.52           O  
ATOM   3250  CB  ALA A 446      32.628 -60.989 -10.943  1.00  0.52           C  
ATOM   3251  N   LEU A 447      29.396 -59.678 -10.454  1.00  0.52           N  
ATOM   3252  CA  LEU A 447      28.357 -58.800 -11.020  1.00  0.52           C  
ATOM   3253  C   LEU A 447      28.254 -57.501 -10.235  1.00  0.52           C  
ATOM   3254  O   LEU A 447      27.709 -56.505 -10.707  1.00  0.52           O  
ATOM   3255  CB  LEU A 447      26.926 -59.401 -11.053  1.00  0.52           C  
ATOM   3256  CG  LEU A 447      26.562 -60.274 -12.271  1.00  0.52           C  
ATOM   3257  CD1 LEU A 447      26.707 -61.753 -11.963  1.00  0.52           C  
ATOM   3258  CD2 LEU A 447      25.117 -60.053 -12.732  1.00  0.52           C  
ATOM   3259  N   ALA A 448      28.857 -57.473  -9.033  1.00  0.72           N  
ATOM   3260  CA  ALA A 448      29.131 -56.270  -8.286  1.00  0.72           C  
ATOM   3261  C   ALA A 448      30.004 -55.277  -9.043  1.00  0.72           C  
ATOM   3262  O   ALA A 448      29.875 -54.064  -8.870  1.00  0.72           O  
ATOM   3263  CB  ALA A 448      29.761 -56.637  -6.933  1.00  0.72           C  
ATOM   3264  N   ALA A 449      30.894 -55.786  -9.929  1.00  0.60           N  
ATOM   3265  CA  ALA A 449      31.880 -55.035 -10.671  1.00  0.60           C  
ATOM   3266  C   ALA A 449      31.399 -53.723 -11.268  1.00  0.60           C  
ATOM   3267  O   ALA A 449      31.989 -52.731 -10.866  1.00  0.60           O  
ATOM   3268  CB  ALA A 449      32.562 -55.908 -11.747  1.00  0.60           C  
ATOM   3269  N   PRO A 450      30.406 -53.512 -12.122  1.00  0.54           N  
ATOM   3270  CA  PRO A 450      30.271 -52.202 -12.743  1.00  0.54           C  
ATOM   3271  C   PRO A 450      29.732 -51.125 -11.822  1.00  0.54           C  
ATOM   3272  O   PRO A 450      29.891 -49.962 -12.180  1.00  0.54           O  
ATOM   3273  CB  PRO A 450      29.422 -52.424 -13.995  1.00  0.54           C  
ATOM   3274  CG  PRO A 450      28.762 -53.781 -13.769  1.00  0.54           C  
ATOM   3275  CD  PRO A 450      29.762 -54.549 -12.914  1.00  0.54           C  
ATOM   3276  N   LEU A 451      29.161 -51.439 -10.633  1.00  0.68           N  
ATOM   3277  CA  LEU A 451      29.010 -50.410  -9.607  1.00  0.68           C  
ATOM   3278  C   LEU A 451      30.353 -50.003  -9.024  1.00  0.68           C  
ATOM   3279  O   LEU A 451      30.662 -48.820  -8.927  1.00  0.68           O  
ATOM   3280  CB  LEU A 451      28.056 -50.798  -8.454  1.00  0.68           C  
ATOM   3281  CG  LEU A 451      27.864 -49.692  -7.380  1.00  0.68           C  
ATOM   3282  CD1 LEU A 451      27.282 -48.391  -7.956  1.00  0.68           C  
ATOM   3283  CD2 LEU A 451      26.974 -50.185  -6.236  1.00  0.68           C  
ATOM   3284  N   PHE A 452      31.233 -50.980  -8.702  1.00  0.55           N  
ATOM   3285  CA  PHE A 452      32.608 -50.713  -8.305  1.00  0.55           C  
ATOM   3286  C   PHE A 452      33.358 -49.935  -9.411  1.00  0.55           C  
ATOM   3287  O   PHE A 452      34.113 -49.008  -9.125  1.00  0.55           O  
ATOM   3288  CB  PHE A 452      33.403 -52.020  -7.961  1.00  0.55           C  
ATOM   3289  CG  PHE A 452      33.152 -52.660  -6.608  1.00  0.55           C  
ATOM   3290  CD1 PHE A 452      31.980 -53.372  -6.306  1.00  0.55           C  
ATOM   3291  CD2 PHE A 452      34.192 -52.692  -5.662  1.00  0.55           C  
ATOM   3292  CE1 PHE A 452      31.866 -54.087  -5.105  1.00  0.55           C  
ATOM   3293  CE2 PHE A 452      34.061 -53.343  -4.435  1.00  0.55           C  
ATOM   3294  CZ  PHE A 452      32.895 -54.055  -4.158  1.00  0.55           C  
ATOM   3295  N   TRP A 453      33.143 -50.260 -10.711  1.00  0.40           N  
ATOM   3296  CA  TRP A 453      33.678 -49.499 -11.835  1.00  0.40           C  
ATOM   3297  C   TRP A 453      33.127 -48.102 -11.977  1.00  0.40           C  
ATOM   3298  O   TRP A 453      33.909 -47.164 -11.934  1.00  0.40           O  
ATOM   3299  CB  TRP A 453      33.566 -50.194 -13.236  1.00  0.40           C  
ATOM   3300  CG  TRP A 453      34.414 -51.447 -13.504  1.00  0.40           C  
ATOM   3301  CD1 TRP A 453      34.472 -52.628 -12.818  1.00  0.40           C  
ATOM   3302  CD2 TRP A 453      35.479 -51.517 -14.481  1.00  0.40           C  
ATOM   3303  NE1 TRP A 453      35.465 -53.439 -13.312  1.00  0.40           N  
ATOM   3304  CE2 TRP A 453      36.110 -52.772 -14.317  1.00  0.40           C  
ATOM   3305  CE3 TRP A 453      35.962 -50.595 -15.409  1.00  0.40           C  
ATOM   3306  CZ2 TRP A 453      37.213 -53.129 -15.075  1.00  0.40           C  
ATOM   3307  CZ3 TRP A 453      37.089 -50.952 -16.168  1.00  0.40           C  
ATOM   3308  CH2 TRP A 453      37.703 -52.203 -16.006  1.00  0.40           C  
ATOM   3309  N   ILE A 454      31.794 -47.888 -12.089  1.00  0.48           N  
ATOM   3310  CA  ILE A 454      31.292 -46.525 -12.316  1.00  0.48           C  
ATOM   3311  C   ILE A 454      31.613 -45.603 -11.155  1.00  0.48           C  
ATOM   3312  O   ILE A 454      32.011 -44.449 -11.332  1.00  0.48           O  
ATOM   3313  CB  ILE A 454      29.812 -46.423 -12.720  1.00  0.48           C  
ATOM   3314  CG1 ILE A 454      29.547 -45.061 -13.419  1.00  0.48           C  
ATOM   3315  CG2 ILE A 454      28.869 -46.652 -11.522  1.00  0.48           C  
ATOM   3316  CD1 ILE A 454      28.151 -44.907 -14.042  1.00  0.48           C  
ATOM   3317  N   ALA A 455      31.519 -46.109  -9.917  1.00  0.53           N  
ATOM   3318  CA  ALA A 455      31.840 -45.372  -8.745  1.00  0.53           C  
ATOM   3319  C   ALA A 455      33.329 -45.023  -8.742  1.00  0.53           C  
ATOM   3320  O   ALA A 455      33.709 -43.859  -8.623  1.00  0.53           O  
ATOM   3321  CB  ALA A 455      31.399 -46.255  -7.554  1.00  0.53           C  
ATOM   3322  N   ALA A 456      34.225 -46.022  -8.876  1.00  0.46           N  
ATOM   3323  CA  ALA A 456      35.633 -45.860  -8.533  1.00  0.46           C  
ATOM   3324  C   ALA A 456      36.513 -45.565  -9.723  1.00  0.46           C  
ATOM   3325  O   ALA A 456      37.724 -45.824  -9.752  1.00  0.46           O  
ATOM   3326  CB  ALA A 456      36.139 -46.974  -7.622  1.00  0.46           C  
ATOM   3327  N   ASN A 457      35.961 -44.823 -10.670  1.00  0.36           N  
ATOM   3328  CA  ASN A 457      36.703 -43.870 -11.481  1.00  0.36           C  
ATOM   3329  C   ASN A 457      37.195 -42.738 -10.551  1.00  0.36           C  
ATOM   3330  O   ASN A 457      38.220 -42.099 -10.755  1.00  0.36           O  
ATOM   3331  CB  ASN A 457      35.767 -43.358 -12.603  1.00  0.36           C  
ATOM   3332  CG  ASN A 457      35.380 -44.510 -13.540  1.00  0.36           C  
ATOM   3333  OD1 ASN A 457      35.802 -45.661 -13.416  1.00  0.36           O  
ATOM   3334  ND2 ASN A 457      34.554 -44.195 -14.558  1.00  0.36           N  
ATOM   3335  N   ALA A 458      36.459 -42.572  -9.430  1.00  0.36           N  
ATOM   3336  CA  ALA A 458      36.721 -41.695  -8.312  1.00  0.36           C  
ATOM   3337  C   ALA A 458      37.467 -42.377  -7.113  1.00  0.36           C  
ATOM   3338  O   ALA A 458      38.691 -42.336  -7.096  1.00  0.36           O  
ATOM   3339  CB  ALA A 458      35.343 -41.090  -8.010  1.00  0.36           C  
ATOM   3340  N   GLY A 459      36.802 -43.002  -6.080  1.00  0.40           N  
ATOM   3341  CA  GLY A 459      37.420 -43.838  -4.997  1.00  0.40           C  
ATOM   3342  C   GLY A 459      37.274 -43.579  -3.452  1.00  0.40           C  
ATOM   3343  O   GLY A 459      38.289 -43.256  -2.876  1.00  0.40           O  
ATOM   3344  N   LEU A 460      36.107 -43.703  -2.699  1.00  0.36           N  
ATOM   3345  CA  LEU A 460      35.827 -43.560  -1.222  1.00  0.36           C  
ATOM   3346  C   LEU A 460      35.148 -44.857  -0.766  1.00  0.36           C  
ATOM   3347  O   LEU A 460      34.014 -45.085  -1.167  1.00  0.36           O  
ATOM   3348  CB  LEU A 460      34.778 -42.551  -0.545  1.00  0.36           C  
ATOM   3349  CG  LEU A 460      34.706 -41.013  -0.703  1.00  0.36           C  
ATOM   3350  CD1 LEU A 460      33.272 -40.632  -1.117  1.00  0.36           C  
ATOM   3351  CD2 LEU A 460      34.970 -40.257   0.609  1.00  0.36           C  
ATOM   3352  N   ASP A 461      35.718 -45.706   0.101  1.00  0.43           N  
ATOM   3353  CA  ASP A 461      35.227 -47.049   0.411  1.00  0.43           C  
ATOM   3354  C   ASP A 461      34.267 -47.806  -0.529  1.00  0.43           C  
ATOM   3355  O   ASP A 461      33.042 -47.813  -0.393  1.00  0.43           O  
ATOM   3356  CB  ASP A 461      34.871 -47.218   1.907  1.00  0.43           C  
ATOM   3357  CG  ASP A 461      36.143 -47.300   2.734  1.00  0.43           C  
ATOM   3358  OD1 ASP A 461      36.525 -48.449   3.103  1.00  0.43           O  
ATOM   3359  OD2 ASP A 461      36.801 -46.251   2.882  1.00  0.43           O  
ATOM   3360  N   GLY A 462      34.852 -48.516  -1.525  1.00  0.49           N  
ATOM   3361  CA  GLY A 462      34.117 -49.295  -2.520  1.00  0.49           C  
ATOM   3362  C   GLY A 462      33.305 -50.452  -1.991  1.00  0.49           C  
ATOM   3363  O   GLY A 462      32.244 -50.792  -2.505  1.00  0.49           O  
ATOM   3364  N   SER A 463      33.779 -51.074  -0.903  1.00  0.53           N  
ATOM   3365  CA  SER A 463      33.052 -52.071  -0.136  1.00  0.53           C  
ATOM   3366  C   SER A 463      31.828 -51.484   0.551  1.00  0.53           C  
ATOM   3367  O   SER A 463      30.735 -52.042   0.537  1.00  0.53           O  
ATOM   3368  CB  SER A 463      33.995 -52.686   0.932  1.00  0.53           C  
ATOM   3369  OG  SER A 463      34.724 -51.651   1.601  1.00  0.53           O  
ATOM   3370  N   VAL A 464      31.976 -50.292   1.146  1.00  0.61           N  
ATOM   3371  CA  VAL A 464      30.920 -49.558   1.818  1.00  0.61           C  
ATOM   3372  C   VAL A 464      29.794 -49.127   0.876  1.00  0.61           C  
ATOM   3373  O   VAL A 464      28.616 -49.238   1.225  1.00  0.61           O  
ATOM   3374  CB  VAL A 464      31.533 -48.404   2.606  1.00  0.61           C  
ATOM   3375  CG1 VAL A 464      30.488 -47.459   3.217  1.00  0.61           C  
ATOM   3376  CG2 VAL A 464      32.408 -48.997   3.730  1.00  0.61           C  
ATOM   3377  N   VAL A 465      30.093 -48.656  -0.362  1.00  0.63           N  
ATOM   3378  CA  VAL A 465      29.052 -48.411  -1.367  1.00  0.63           C  
ATOM   3379  C   VAL A 465      28.314 -49.673  -1.818  1.00  0.63           C  
ATOM   3380  O   VAL A 465      27.083 -49.662  -1.898  1.00  0.63           O  
ATOM   3381  CB  VAL A 465      29.493 -47.543  -2.560  1.00  0.63           C  
ATOM   3382  CG1 VAL A 465      30.499 -48.254  -3.479  1.00  0.63           C  
ATOM   3383  CG2 VAL A 465      28.277 -47.083  -3.394  1.00  0.63           C  
ATOM   3384  N   VAL A 466      29.013 -50.809  -2.073  1.00  0.66           N  
ATOM   3385  CA  VAL A 466      28.340 -52.050  -2.454  1.00  0.66           C  
ATOM   3386  C   VAL A 466      27.464 -52.638  -1.357  1.00  0.66           C  
ATOM   3387  O   VAL A 466      26.366 -53.128  -1.618  1.00  0.66           O  
ATOM   3388  CB  VAL A 466      29.219 -53.119  -3.097  1.00  0.66           C  
ATOM   3389  CG1 VAL A 466      29.975 -53.992  -2.076  1.00  0.66           C  
ATOM   3390  CG2 VAL A 466      28.330 -53.998  -4.004  1.00  0.66           C  
ATOM   3391  N   ASN A 467      27.894 -52.568  -0.079  1.00  0.67           N  
ATOM   3392  CA  ASN A 467      27.071 -52.997   1.041  1.00  0.67           C  
ATOM   3393  C   ASN A 467      25.776 -52.194   1.126  1.00  0.67           C  
ATOM   3394  O   ASN A 467      24.690 -52.755   1.205  1.00  0.67           O  
ATOM   3395  CB  ASN A 467      27.830 -52.855   2.385  1.00  0.67           C  
ATOM   3396  CG  ASN A 467      29.026 -53.798   2.435  1.00  0.67           C  
ATOM   3397  OD1 ASN A 467      29.165 -54.761   1.684  1.00  0.67           O  
ATOM   3398  ND2 ASN A 467      29.949 -53.523   3.387  1.00  0.67           N  
ATOM   3399  N   LYS A 468      25.853 -50.852   1.008  1.00  0.71           N  
ATOM   3400  CA  LYS A 468      24.677 -49.997   0.991  1.00  0.71           C  
ATOM   3401  C   LYS A 468      23.718 -50.223  -0.173  1.00  0.71           C  
ATOM   3402  O   LYS A 468      22.508 -50.185   0.021  1.00  0.71           O  
ATOM   3403  CB  LYS A 468      25.067 -48.504   1.093  1.00  0.71           C  
ATOM   3404  CG  LYS A 468      25.321 -48.078   2.549  1.00  0.71           C  
ATOM   3405  CD  LYS A 468      25.765 -46.611   2.666  1.00  0.71           C  
ATOM   3406  CE  LYS A 468      27.264 -46.455   2.419  1.00  0.71           C  
ATOM   3407  NZ  LYS A 468      27.632 -45.040   2.201  1.00  0.71           N  
ATOM   3408  N   VAL A 469      24.189 -50.477  -1.416  1.00  0.77           N  
ATOM   3409  CA  VAL A 469      23.268 -50.877  -2.484  1.00  0.77           C  
ATOM   3410  C   VAL A 469      22.641 -52.249  -2.248  1.00  0.77           C  
ATOM   3411  O   VAL A 469      21.484 -52.492  -2.575  1.00  0.77           O  
ATOM   3412  CB  VAL A 469      23.847 -50.770  -3.897  1.00  0.77           C  
ATOM   3413  CG1 VAL A 469      24.781 -51.939  -4.246  1.00  0.77           C  
ATOM   3414  CG2 VAL A 469      22.700 -50.719  -4.924  1.00  0.77           C  
ATOM   3415  N   SER A 470      23.394 -53.193  -1.643  1.00  0.72           N  
ATOM   3416  CA  SER A 470      22.973 -54.579  -1.487  1.00  0.72           C  
ATOM   3417  C   SER A 470      21.908 -54.779  -0.433  1.00  0.72           C  
ATOM   3418  O   SER A 470      21.194 -55.784  -0.456  1.00  0.72           O  
ATOM   3419  CB  SER A 470      24.149 -55.522  -1.143  1.00  0.72           C  
ATOM   3420  OG  SER A 470      25.102 -55.520  -2.205  1.00  0.72           O  
ATOM   3421  N   GLU A 471      21.743 -53.815   0.484  1.00  0.66           N  
ATOM   3422  CA  GLU A 471      20.582 -53.693   1.342  1.00  0.66           C  
ATOM   3423  C   GLU A 471      19.287 -53.391   0.575  1.00  0.66           C  
ATOM   3424  O   GLU A 471      18.237 -53.985   0.823  1.00  0.66           O  
ATOM   3425  CB  GLU A 471      20.832 -52.565   2.376  1.00  0.66           C  
ATOM   3426  CG  GLU A 471      22.001 -52.852   3.352  1.00  0.66           C  
ATOM   3427  CD  GLU A 471      21.737 -54.075   4.224  1.00  0.66           C  
ATOM   3428  OE1 GLU A 471      20.771 -54.020   5.027  1.00  0.66           O  
ATOM   3429  OE2 GLU A 471      22.502 -55.065   4.095  1.00  0.66           O  
ATOM   3430  N   LEU A 472      19.319 -52.464  -0.409  1.00  0.71           N  
ATOM   3431  CA  LEU A 472      18.106 -51.921  -1.003  1.00  0.71           C  
ATOM   3432  C   LEU A 472      17.585 -52.697  -2.231  1.00  0.71           C  
ATOM   3433  O   LEU A 472      18.361 -53.124  -3.091  1.00  0.71           O  
ATOM   3434  CB  LEU A 472      18.230 -50.426  -1.403  1.00  0.71           C  
ATOM   3435  CG  LEU A 472      18.170 -49.370  -0.266  1.00  0.71           C  
ATOM   3436  CD1 LEU A 472      16.974 -49.545   0.681  1.00  0.71           C  
ATOM   3437  CD2 LEU A 472      19.477 -49.248   0.524  1.00  0.71           C  
ATOM   3438  N   PRO A 473      16.271 -52.899  -2.392  1.00  0.63           N  
ATOM   3439  CA  PRO A 473      15.710 -53.494  -3.604  1.00  0.63           C  
ATOM   3440  C   PRO A 473      15.621 -52.555  -4.805  1.00  0.63           C  
ATOM   3441  O   PRO A 473      15.924 -51.368  -4.710  1.00  0.63           O  
ATOM   3442  CB  PRO A 473      14.268 -53.882  -3.188  1.00  0.63           C  
ATOM   3443  CG  PRO A 473      14.273 -53.893  -1.660  1.00  0.63           C  
ATOM   3444  CD  PRO A 473      15.271 -52.796  -1.325  1.00  0.63           C  
ATOM   3445  N   ALA A 474      15.091 -53.100  -5.922  1.00  0.70           N  
ATOM   3446  CA  ALA A 474      14.640 -52.389  -7.107  1.00  0.70           C  
ATOM   3447  C   ALA A 474      15.610 -51.405  -7.761  1.00  0.70           C  
ATOM   3448  O   ALA A 474      16.753 -51.735  -8.041  1.00  0.70           O  
ATOM   3449  CB  ALA A 474      13.250 -51.770  -6.837  1.00  0.70           C  
ATOM   3450  N   GLY A 475      15.151 -50.181  -8.102  1.00  0.77           N  
ATOM   3451  CA  GLY A 475      15.937 -49.220  -8.876  1.00  0.77           C  
ATOM   3452  C   GLY A 475      16.969 -48.457  -8.101  1.00  0.77           C  
ATOM   3453  O   GLY A 475      17.693 -47.634  -8.653  1.00  0.77           O  
ATOM   3454  N   HIS A 476      17.037 -48.687  -6.783  1.00  0.74           N  
ATOM   3455  CA  HIS A 476      17.922 -47.994  -5.875  1.00  0.74           C  
ATOM   3456  C   HIS A 476      19.419 -48.218  -6.079  1.00  0.74           C  
ATOM   3457  O   HIS A 476      19.895 -49.331  -6.296  1.00  0.74           O  
ATOM   3458  CB  HIS A 476      17.572 -48.369  -4.427  1.00  0.74           C  
ATOM   3459  CG  HIS A 476      18.292 -47.537  -3.420  1.00  0.74           C  
ATOM   3460  ND1 HIS A 476      17.746 -46.337  -3.017  1.00  0.74           N  
ATOM   3461  CD2 HIS A 476      19.493 -47.737  -2.823  1.00  0.74           C  
ATOM   3462  CE1 HIS A 476      18.618 -45.832  -2.172  1.00  0.74           C  
ATOM   3463  NE2 HIS A 476      19.695 -46.642  -2.018  1.00  0.74           N  
ATOM   3464  N   GLY A 477      20.217 -47.145  -5.938  1.00  0.80           N  
ATOM   3465  CA  GLY A 477      21.664 -47.258  -5.890  1.00  0.80           C  
ATOM   3466  C   GLY A 477      22.305 -45.940  -5.581  1.00  0.80           C  
ATOM   3467  O   GLY A 477      21.841 -45.204  -4.718  1.00  0.80           O  
ATOM   3468  N   LEU A 478      23.415 -45.611  -6.265  1.00  0.71           N  
ATOM   3469  CA  LEU A 478      24.219 -44.440  -5.971  1.00  0.71           C  
ATOM   3470  C   LEU A 478      24.451 -43.665  -7.254  1.00  0.71           C  
ATOM   3471  O   LEU A 478      25.013 -44.191  -8.213  1.00  0.71           O  
ATOM   3472  CB  LEU A 478      25.567 -44.912  -5.349  1.00  0.71           C  
ATOM   3473  CG  LEU A 478      26.571 -43.848  -4.832  1.00  0.71           C  
ATOM   3474  CD1 LEU A 478      27.516 -43.317  -5.922  1.00  0.71           C  
ATOM   3475  CD2 LEU A 478      25.905 -42.700  -4.059  1.00  0.71           C  
ATOM   3476  N   ASN A 479      24.029 -42.382  -7.319  1.00  0.65           N  
ATOM   3477  CA  ASN A 479      24.339 -41.545  -8.463  1.00  0.65           C  
ATOM   3478  C   ASN A 479      25.733 -40.939  -8.308  1.00  0.65           C  
ATOM   3479  O   ASN A 479      26.092 -40.359  -7.286  1.00  0.65           O  
ATOM   3480  CB  ASN A 479      23.278 -40.430  -8.684  1.00  0.65           C  
ATOM   3481  CG  ASN A 479      23.528 -39.638  -9.972  1.00  0.65           C  
ATOM   3482  OD1 ASN A 479      24.386 -39.955 -10.799  1.00  0.65           O  
ATOM   3483  ND2 ASN A 479      22.796 -38.529 -10.148  1.00  0.65           N  
ATOM   3484  N   VAL A 480      26.538 -41.033  -9.378  1.00  0.58           N  
ATOM   3485  CA  VAL A 480      27.892 -40.534  -9.456  1.00  0.58           C  
ATOM   3486  C   VAL A 480      27.952 -39.109 -10.001  1.00  0.58           C  
ATOM   3487  O   VAL A 480      29.025 -38.612 -10.325  1.00  0.58           O  
ATOM   3488  CB  VAL A 480      28.776 -41.464 -10.279  1.00  0.58           C  
ATOM   3489  CG1 VAL A 480      28.859 -42.828  -9.569  1.00  0.58           C  
ATOM   3490  CG2 VAL A 480      28.218 -41.639 -11.703  1.00  0.58           C  
ATOM   3491  N   ASN A 481      26.807 -38.393 -10.066  1.00  0.50           N  
ATOM   3492  CA  ASN A 481      26.796 -36.938 -10.176  1.00  0.50           C  
ATOM   3493  C   ASN A 481      26.185 -36.250  -8.945  1.00  0.50           C  
ATOM   3494  O   ASN A 481      26.784 -35.333  -8.392  1.00  0.50           O  
ATOM   3495  CB  ASN A 481      26.013 -36.472 -11.432  1.00  0.50           C  
ATOM   3496  CG  ASN A 481      26.874 -36.615 -12.683  1.00  0.50           C  
ATOM   3497  OD1 ASN A 481      27.913 -35.967 -12.810  1.00  0.50           O  
ATOM   3498  ND2 ASN A 481      26.426 -37.424 -13.666  1.00  0.50           N  
ATOM   3499  N   THR A 482      24.982 -36.643  -8.465  1.00  0.51           N  
ATOM   3500  CA  THR A 482      24.319 -35.949  -7.344  1.00  0.51           C  
ATOM   3501  C   THR A 482      24.756 -36.397  -5.960  1.00  0.51           C  
ATOM   3502  O   THR A 482      24.894 -35.578  -5.049  1.00  0.51           O  
ATOM   3503  CB  THR A 482      22.795 -36.057  -7.370  1.00  0.51           C  
ATOM   3504  OG1 THR A 482      22.375 -37.416  -7.394  1.00  0.51           O  
ATOM   3505  CG2 THR A 482      22.273 -35.376  -8.639  1.00  0.51           C  
ATOM   3506  N   LEU A 483      24.938 -37.725  -5.788  1.00  0.56           N  
ATOM   3507  CA  LEU A 483      25.429 -38.422  -4.607  1.00  0.56           C  
ATOM   3508  C   LEU A 483      24.409 -38.664  -3.536  1.00  0.56           C  
ATOM   3509  O   LEU A 483      24.739 -39.010  -2.399  1.00  0.56           O  
ATOM   3510  CB  LEU A 483      26.619 -37.766  -3.922  1.00  0.56           C  
ATOM   3511  CG  LEU A 483      27.784 -37.586  -4.871  1.00  0.56           C  
ATOM   3512  CD1 LEU A 483      28.313 -36.164  -4.651  1.00  0.56           C  
ATOM   3513  CD2 LEU A 483      28.744 -38.775  -4.683  1.00  0.56           C  
ATOM   3514  N   SER A 484      23.126 -38.539  -3.866  1.00  0.62           N  
ATOM   3515  CA  SER A 484      22.100 -39.098  -3.028  1.00  0.62           C  
ATOM   3516  C   SER A 484      21.954 -40.553  -3.411  1.00  0.62           C  
ATOM   3517  O   SER A 484      22.069 -40.953  -4.569  1.00  0.62           O  
ATOM   3518  CB  SER A 484      20.752 -38.338  -3.115  1.00  0.62           C  
ATOM   3519  OG  SER A 484      20.447 -37.981  -4.463  1.00  0.62           O  
ATOM   3520  N   TYR A 485      21.739 -41.413  -2.403  1.00  0.68           N  
ATOM   3521  CA  TYR A 485      21.342 -42.776  -2.649  1.00  0.68           C  
ATOM   3522  C   TYR A 485      19.862 -42.767  -2.991  1.00  0.68           C  
ATOM   3523  O   TYR A 485      19.041 -42.262  -2.227  1.00  0.68           O  
ATOM   3524  CB  TYR A 485      21.573 -43.677  -1.412  1.00  0.68           C  
ATOM   3525  CG  TYR A 485      23.017 -44.049  -1.238  1.00  0.68           C  
ATOM   3526  CD1 TYR A 485      23.867 -43.262  -0.446  1.00  0.68           C  
ATOM   3527  CD2 TYR A 485      23.524 -45.225  -1.819  1.00  0.68           C  
ATOM   3528  CE1 TYR A 485      25.198 -43.644  -0.232  1.00  0.68           C  
ATOM   3529  CE2 TYR A 485      24.854 -45.614  -1.604  1.00  0.68           C  
ATOM   3530  CZ  TYR A 485      25.688 -44.819  -0.809  1.00  0.68           C  
ATOM   3531  OH  TYR A 485      27.026 -45.196  -0.590  1.00  0.68           O  
ATOM   3532  N   GLY A 486      19.485 -43.287  -4.166  1.00  0.79           N  
ATOM   3533  CA  GLY A 486      18.116 -43.159  -4.628  1.00  0.79           C  
ATOM   3534  C   GLY A 486      17.901 -43.987  -5.849  1.00  0.79           C  
ATOM   3535  O   GLY A 486      18.801 -44.694  -6.296  1.00  0.79           O  
ATOM   3536  N   ASP A 487      16.689 -43.907  -6.429  1.00  0.73           N  
ATOM   3537  CA  ASP A 487      16.359 -44.544  -7.685  1.00  0.73           C  
ATOM   3538  C   ASP A 487      17.134 -43.936  -8.856  1.00  0.73           C  
ATOM   3539  O   ASP A 487      17.061 -42.741  -9.144  1.00  0.73           O  
ATOM   3540  CB  ASP A 487      14.825 -44.495  -7.919  1.00  0.73           C  
ATOM   3541  CG  ASP A 487      14.390 -45.167  -9.217  1.00  0.73           C  
ATOM   3542  OD1 ASP A 487      15.146 -46.028  -9.742  1.00  0.73           O  
ATOM   3543  OD2 ASP A 487      13.328 -44.764  -9.738  1.00  0.73           O  
ATOM   3544  N   LEU A 488      17.871 -44.797  -9.572  1.00  0.69           N  
ATOM   3545  CA  LEU A 488      18.595 -44.487 -10.782  1.00  0.69           C  
ATOM   3546  C   LEU A 488      17.649 -44.067 -11.906  1.00  0.69           C  
ATOM   3547  O   LEU A 488      17.941 -43.151 -12.676  1.00  0.69           O  
ATOM   3548  CB  LEU A 488      19.385 -45.738 -11.241  1.00  0.69           C  
ATOM   3549  CG  LEU A 488      20.715 -46.071 -10.517  1.00  0.69           C  
ATOM   3550  CD1 LEU A 488      21.846 -45.092 -10.838  1.00  0.69           C  
ATOM   3551  CD2 LEU A 488      20.627 -46.223  -9.005  1.00  0.69           C  
ATOM   3552  N   ALA A 489      16.475 -44.732 -12.017  1.00  0.74           N  
ATOM   3553  CA  ALA A 489      15.481 -44.436 -13.030  1.00  0.74           C  
ATOM   3554  C   ALA A 489      14.849 -43.059 -12.864  1.00  0.74           C  
ATOM   3555  O   ALA A 489      14.723 -42.303 -13.825  1.00  0.74           O  
ATOM   3556  CB  ALA A 489      14.396 -45.530 -13.021  1.00  0.74           C  
ATOM   3557  N   ALA A 490      14.477 -42.695 -11.621  1.00  0.71           N  
ATOM   3558  CA  ALA A 490      14.002 -41.373 -11.264  1.00  0.71           C  
ATOM   3559  C   ALA A 490      15.020 -40.247 -11.437  1.00  0.71           C  
ATOM   3560  O   ALA A 490      14.676 -39.162 -11.901  1.00  0.71           O  
ATOM   3561  CB  ALA A 490      13.516 -41.392  -9.803  1.00  0.71           C  
ATOM   3562  N   ASP A 491      16.295 -40.476 -11.052  1.00  0.67           N  
ATOM   3563  CA  ASP A 491      17.387 -39.530 -11.220  1.00  0.67           C  
ATOM   3564  C   ASP A 491      17.693 -39.244 -12.701  1.00  0.67           C  
ATOM   3565  O   ASP A 491      17.831 -38.096 -13.126  1.00  0.67           O  
ATOM   3566  CB  ASP A 491      18.603 -40.104 -10.433  1.00  0.67           C  
ATOM   3567  CG  ASP A 491      19.781 -39.153 -10.354  1.00  0.67           C  
ATOM   3568  OD1 ASP A 491      20.393 -38.907 -11.423  1.00  0.67           O  
ATOM   3569  OD2 ASP A 491      20.154 -38.702  -9.234  1.00  0.67           O  
ATOM   3570  N   GLY A 492      17.739 -40.301 -13.541  1.00  0.66           N  
ATOM   3571  CA  GLY A 492      18.010 -40.172 -14.969  1.00  0.66           C  
ATOM   3572  C   GLY A 492      19.369 -40.672 -15.357  1.00  0.66           C  
ATOM   3573  O   GLY A 492      19.786 -40.552 -16.504  1.00  0.66           O  
ATOM   3574  N   VAL A 493      20.091 -41.310 -14.424  1.00  0.59           N  
ATOM   3575  CA  VAL A 493      21.267 -42.103 -14.731  1.00  0.59           C  
ATOM   3576  C   VAL A 493      20.818 -43.531 -15.020  1.00  0.59           C  
ATOM   3577  O   VAL A 493      20.657 -44.393 -14.156  1.00  0.59           O  
ATOM   3578  CB  VAL A 493      22.350 -41.997 -13.657  1.00  0.59           C  
ATOM   3579  CG1 VAL A 493      21.717 -42.061 -12.255  1.00  0.59           C  
ATOM   3580  CG2 VAL A 493      23.475 -43.039 -13.858  1.00  0.59           C  
ATOM   3581  N   ILE A 494      20.573 -43.809 -16.308  1.00  0.61           N  
ATOM   3582  CA  ILE A 494      20.084 -45.086 -16.779  1.00  0.61           C  
ATOM   3583  C   ILE A 494      21.030 -45.634 -17.814  1.00  0.61           C  
ATOM   3584  O   ILE A 494      21.421 -44.959 -18.765  1.00  0.61           O  
ATOM   3585  CB  ILE A 494      18.650 -45.071 -17.326  1.00  0.61           C  
ATOM   3586  CG1 ILE A 494      18.384 -44.199 -18.590  1.00  0.61           C  
ATOM   3587  CG2 ILE A 494      17.689 -44.731 -16.169  1.00  0.61           C  
ATOM   3588  CD1 ILE A 494      18.564 -42.684 -18.462  1.00  0.61           C  
ATOM   3589  N   ASP A 495      21.419 -46.911 -17.669  1.00  0.55           N  
ATOM   3590  CA  ASP A 495      21.989 -47.638 -18.769  1.00  0.55           C  
ATOM   3591  C   ASP A 495      20.820 -48.391 -19.429  1.00  0.55           C  
ATOM   3592  O   ASP A 495      19.990 -48.984 -18.741  1.00  0.55           O  
ATOM   3593  CB  ASP A 495      23.231 -48.498 -18.399  1.00  0.55           C  
ATOM   3594  CG  ASP A 495      23.350 -48.905 -16.951  1.00  0.55           C  
ATOM   3595  OD1 ASP A 495      22.560 -49.785 -16.530  1.00  0.55           O  
ATOM   3596  OD2 ASP A 495      24.250 -48.368 -16.250  1.00  0.55           O  
ATOM   3597  N   PRO A 496      20.622 -48.341 -20.743  1.00  0.52           N  
ATOM   3598  CA  PRO A 496      19.585 -49.114 -21.408  1.00  0.52           C  
ATOM   3599  C   PRO A 496      19.535 -50.640 -21.165  1.00  0.52           C  
ATOM   3600  O   PRO A 496      20.465 -51.250 -20.637  1.00  0.52           O  
ATOM   3601  CB  PRO A 496      19.749 -48.707 -22.886  1.00  0.52           C  
ATOM   3602  CG  PRO A 496      20.286 -47.278 -22.868  1.00  0.52           C  
ATOM   3603  CD  PRO A 496      21.104 -47.232 -21.581  1.00  0.52           C  
ATOM   3604  N   VAL A 497      18.471 -51.295 -21.680  1.00  0.55           N  
ATOM   3605  CA  VAL A 497      18.464 -52.713 -22.059  1.00  0.55           C  
ATOM   3606  C   VAL A 497      18.900 -52.741 -23.504  1.00  0.55           C  
ATOM   3607  O   VAL A 497      18.753 -53.679 -24.257  1.00  0.55           O  
ATOM   3608  CB  VAL A 497      17.175 -53.497 -21.777  1.00  0.55           C  
ATOM   3609  CG1 VAL A 497      17.352 -55.020 -21.975  1.00  0.55           C  
ATOM   3610  CG2 VAL A 497      16.761 -53.316 -20.313  1.00  0.55           C  
ATOM   3611  N   LYS A 498      19.647 -51.721 -23.902  1.00  0.36           N  
ATOM   3612  CA  LYS A 498      20.890 -51.982 -24.566  1.00  0.36           C  
ATOM   3613  C   LYS A 498      22.008 -51.161 -23.884  1.00  0.36           C  
ATOM   3614  O   LYS A 498      22.614 -50.321 -24.542  1.00  0.36           O  
ATOM   3615  CB  LYS A 498      20.811 -51.823 -26.113  1.00  0.36           C  
ATOM   3616  CG  LYS A 498      20.963 -53.157 -26.889  1.00  0.36           C  
ATOM   3617  CD  LYS A 498      20.977 -53.202 -28.430  1.00  0.36           C  
ATOM   3618  CE  LYS A 498      20.768 -54.643 -28.941  1.00  0.36           C  
ATOM   3619  NZ  LYS A 498      20.647 -54.735 -30.400  1.00  0.36           N  
ATOM   3620  N   VAL A 499      22.360 -51.360 -22.594  1.00  0.36           N  
ATOM   3621  CA  VAL A 499      23.707 -51.067 -22.084  1.00  0.36           C  
ATOM   3622  C   VAL A 499      24.112 -52.066 -21.017  1.00  0.36           C  
ATOM   3623  O   VAL A 499      25.288 -52.401 -20.880  1.00  0.36           O  
ATOM   3624  CB  VAL A 499      24.018 -49.615 -21.666  1.00  0.36           C  
ATOM   3625  CG1 VAL A 499      25.318 -49.503 -20.829  1.00  0.36           C  
ATOM   3626  CG2 VAL A 499      24.259 -48.689 -22.881  1.00  0.36           C  
ATOM   3627  N   THR A 500      23.166 -52.672 -20.285  1.00  0.42           N  
ATOM   3628  CA  THR A 500      23.531 -53.753 -19.365  1.00  0.42           C  
ATOM   3629  C   THR A 500      23.167 -55.148 -19.851  1.00  0.42           C  
ATOM   3630  O   THR A 500      22.978 -56.057 -19.034  1.00  0.42           O  
ATOM   3631  CB  THR A 500      23.315 -53.469 -17.873  1.00  0.42           C  
ATOM   3632  OG1 THR A 500      21.981 -53.134 -17.550  1.00  0.42           O  
ATOM   3633  CG2 THR A 500      24.130 -52.229 -17.465  1.00  0.42           C  
ATOM   3634  N   ARG A 501      23.178 -55.415 -21.197  1.00  0.39           N  
ATOM   3635  CA  ARG A 501      23.472 -56.737 -21.722  1.00  0.39           C  
ATOM   3636  C   ARG A 501      24.523 -57.213 -22.866  1.00  0.39           C  
ATOM   3637  O   ARG A 501      24.694 -58.247 -22.384  1.00  0.39           O  
ATOM   3638  CB  ARG A 501      22.387 -57.915 -21.433  1.00  0.39           C  
ATOM   3639  CG  ARG A 501      20.859 -57.653 -21.226  1.00  0.39           C  
ATOM   3640  CD  ARG A 501      19.744 -58.270 -22.137  1.00  0.39           C  
ATOM   3641  NE  ARG A 501      20.280 -59.405 -22.942  1.00  0.39           N  
ATOM   3642  CZ  ARG A 501      19.889 -59.681 -24.201  1.00  0.39           C  
ATOM   3643  NH1 ARG A 501      18.834 -59.125 -24.834  1.00  0.39           N  
ATOM   3644  NH2 ARG A 501      20.690 -60.523 -24.889  1.00  0.39           N  
ATOM   3645  N   SER A 502      25.196 -56.581 -24.148  1.00  0.29           N  
ATOM   3646  CA  SER A 502      26.138 -56.962 -25.507  1.00  0.29           C  
ATOM   3647  C   SER A 502      27.515 -57.891 -25.892  1.00  0.29           C  
ATOM   3648  O   SER A 502      27.334 -58.691 -26.777  1.00  0.29           O  
ATOM   3649  CB  SER A 502      25.879 -55.980 -26.727  1.00  0.29           C  
ATOM   3650  OG  SER A 502      26.265 -56.429 -28.046  1.00  0.29           O  
ATOM   3651  N   ALA A 503      28.870 -58.175 -25.418  1.00  0.20           N  
ATOM   3652  CA  ALA A 503      30.197 -57.857 -24.654  1.00  0.20           C  
ATOM   3653  C   ALA A 503      30.709 -58.540 -23.435  1.00  0.20           C  
ATOM   3654  O   ALA A 503      31.583 -59.397 -23.600  1.00  0.20           O  
ATOM   3655  CB  ALA A 503      31.250 -56.692 -24.628  1.00  0.20           C  
ATOM   3656  N   VAL A 504      30.309 -58.215 -22.208  1.00  0.22           N  
ATOM   3657  CA  VAL A 504      30.599 -59.151 -21.097  1.00  0.22           C  
ATOM   3658  C   VAL A 504      29.842 -60.443 -21.384  1.00  0.22           C  
ATOM   3659  O   VAL A 504      29.452 -61.079 -20.381  1.00  0.22           O  
ATOM   3660  CB  VAL A 504      30.723 -58.665 -19.586  1.00  0.22           C  
ATOM   3661  CG1 VAL A 504      31.421 -57.321 -19.363  1.00  0.22           C  
ATOM   3662  CG2 VAL A 504      29.727 -59.012 -18.424  1.00  0.22           C  
ATOM   3663  N   LEU A 505      29.335 -60.724 -22.604  1.00  0.23           N  
ATOM   3664  CA  LEU A 505      29.145 -61.931 -23.412  1.00  0.23           C  
ATOM   3665  C   LEU A 505      29.903 -61.830 -24.645  1.00  0.23           C  
ATOM   3666  O   LEU A 505      29.289 -61.154 -25.557  1.00  0.23           O  
ATOM   3667  CB  LEU A 505      27.828 -62.497 -23.896  1.00  0.23           C  
ATOM   3668  CG  LEU A 505      26.503 -62.930 -23.319  1.00  0.23           C  
ATOM   3669  CD1 LEU A 505      25.554 -63.260 -24.496  1.00  0.23           C  
ATOM   3670  CD2 LEU A 505      26.401 -64.243 -22.605  1.00  0.23           C  
ATOM   3671  N   ASN A 506      31.021 -62.436 -24.897  1.00  0.23           N  
ATOM   3672  CA  ASN A 506      31.994 -62.242 -25.921  1.00  0.23           C  
ATOM   3673  C   ASN A 506      33.298 -62.368 -25.212  1.00  0.23           C  
ATOM   3674  O   ASN A 506      34.243 -62.995 -25.736  1.00  0.23           O  
ATOM   3675  CB  ASN A 506      31.940 -60.805 -26.487  1.00  0.23           C  
ATOM   3676  CG  ASN A 506      32.809 -60.676 -27.704  1.00  0.23           C  
ATOM   3677  OD1 ASN A 506      33.131 -61.594 -28.457  1.00  0.23           O  
ATOM   3678  ND2 ASN A 506      33.165 -59.394 -27.905  1.00  0.23           N  
ATOM   3679  N   ALA A 507      33.437 -61.847 -23.986  1.00  0.24           N  
ATOM   3680  CA  ALA A 507      34.735 -61.765 -23.358  1.00  0.24           C  
ATOM   3681  C   ALA A 507      34.956 -62.951 -22.449  1.00  0.24           C  
ATOM   3682  O   ALA A 507      36.048 -63.073 -21.919  1.00  0.24           O  
ATOM   3683  CB  ALA A 507      35.015 -60.392 -22.686  1.00  0.24           C  
ATOM   3684  N   SER A 508      33.986 -63.887 -22.324  1.00  0.22           N  
ATOM   3685  CA  SER A 508      34.172 -65.222 -21.757  1.00  0.22           C  
ATOM   3686  C   SER A 508      34.426 -66.210 -22.860  1.00  0.22           C  
ATOM   3687  O   SER A 508      35.127 -67.197 -22.651  1.00  0.22           O  
ATOM   3688  CB  SER A 508      32.997 -65.680 -20.898  1.00  0.22           C  
ATOM   3689  OG  SER A 508      32.886 -67.119 -20.631  1.00  0.22           O  
ATOM   3690  N   SER A 509      34.002 -65.917 -24.103  1.00  0.40           N  
ATOM   3691  CA  SER A 509      34.549 -66.596 -25.275  1.00  0.40           C  
ATOM   3692  C   SER A 509      36.072 -66.407 -25.346  1.00  0.40           C  
ATOM   3693  O   SER A 509      36.824 -67.317 -25.681  1.00  0.40           O  
ATOM   3694  CB  SER A 509      33.771 -66.238 -26.578  1.00  0.40           C  
ATOM   3695  OG  SER A 509      34.329 -65.146 -27.314  1.00  0.40           O  
ATOM   3696  N   VAL A 510      36.546 -65.226 -24.888  1.00  0.38           N  
ATOM   3697  CA  VAL A 510      37.918 -65.006 -24.456  1.00  0.38           C  
ATOM   3698  C   VAL A 510      38.252 -65.651 -23.089  1.00  0.38           C  
ATOM   3699  O   VAL A 510      38.985 -66.630 -23.012  1.00  0.38           O  
ATOM   3700  CB  VAL A 510      38.243 -63.508 -24.421  1.00  0.38           C  
ATOM   3701  CG1 VAL A 510      39.739 -63.272 -24.122  1.00  0.38           C  
ATOM   3702  CG2 VAL A 510      37.861 -62.857 -25.767  1.00  0.38           C  
ATOM   3703  N   ALA A 511      37.748 -65.127 -21.947  1.00  0.37           N  
ATOM   3704  CA  ALA A 511      38.204 -65.417 -20.594  1.00  0.37           C  
ATOM   3705  C   ALA A 511      38.042 -66.838 -20.069  1.00  0.37           C  
ATOM   3706  O   ALA A 511      38.886 -67.332 -19.326  1.00  0.37           O  
ATOM   3707  CB  ALA A 511      37.589 -64.437 -19.579  1.00  0.37           C  
ATOM   3708  N   ARG A 512      36.971 -67.564 -20.435  1.00  0.39           N  
ATOM   3709  CA  ARG A 512      36.789 -68.959 -20.056  1.00  0.39           C  
ATOM   3710  C   ARG A 512      37.863 -69.822 -20.678  1.00  0.39           C  
ATOM   3711  O   ARG A 512      38.441 -70.726 -20.078  1.00  0.39           O  
ATOM   3712  CB  ARG A 512      35.410 -69.422 -20.565  1.00  0.39           C  
ATOM   3713  CG  ARG A 512      34.863 -70.738 -19.994  1.00  0.39           C  
ATOM   3714  CD  ARG A 512      33.373 -70.904 -20.320  1.00  0.39           C  
ATOM   3715  NE  ARG A 512      33.287 -71.246 -21.779  1.00  0.39           N  
ATOM   3716  CZ  ARG A 512      32.163 -71.196 -22.507  1.00  0.39           C  
ATOM   3717  NH1 ARG A 512      31.053 -70.628 -22.047  1.00  0.39           N  
ATOM   3718  NH2 ARG A 512      32.155 -71.726 -23.730  1.00  0.39           N  
ATOM   3719  N   MET A 513      38.180 -69.488 -21.939  1.00  0.42           N  
ATOM   3720  CA  MET A 513      39.301 -70.014 -22.675  1.00  0.42           C  
ATOM   3721  C   MET A 513      40.646 -69.614 -22.060  1.00  0.42           C  
ATOM   3722  O   MET A 513      41.503 -70.472 -21.869  1.00  0.42           O  
ATOM   3723  CB  MET A 513      39.146 -69.596 -24.155  1.00  0.42           C  
ATOM   3724  CG  MET A 513      39.875 -70.507 -25.156  1.00  0.42           C  
ATOM   3725  SD  MET A 513      39.546 -70.102 -26.903  1.00  0.42           S  
ATOM   3726  CE  MET A 513      37.763 -70.468 -26.936  1.00  0.42           C  
ATOM   3727  N   VAL A 514      40.850 -68.333 -21.644  1.00  0.39           N  
ATOM   3728  CA  VAL A 514      42.070 -67.927 -20.932  1.00  0.39           C  
ATOM   3729  C   VAL A 514      42.268 -68.600 -19.575  1.00  0.39           C  
ATOM   3730  O   VAL A 514      43.389 -68.972 -19.243  1.00  0.39           O  
ATOM   3731  CB  VAL A 514      42.432 -66.433 -20.861  1.00  0.39           C  
ATOM   3732  CG1 VAL A 514      42.058 -65.719 -22.170  1.00  0.39           C  
ATOM   3733  CG2 VAL A 514      41.871 -65.705 -19.623  1.00  0.39           C  
ATOM   3734  N   LEU A 515      41.197 -68.840 -18.778  1.00  0.39           N  
ATOM   3735  CA  LEU A 515      41.237 -69.648 -17.558  1.00  0.39           C  
ATOM   3736  C   LEU A 515      41.704 -71.073 -17.813  1.00  0.39           C  
ATOM   3737  O   LEU A 515      42.439 -71.662 -17.026  1.00  0.39           O  
ATOM   3738  CB  LEU A 515      39.848 -69.683 -16.857  1.00  0.39           C  
ATOM   3739  CG  LEU A 515      39.678 -70.731 -15.723  1.00  0.39           C  
ATOM   3740  CD1 LEU A 515      38.769 -70.201 -14.622  1.00  0.39           C  
ATOM   3741  CD2 LEU A 515      39.083 -72.064 -16.214  1.00  0.39           C  
ATOM   3742  N   THR A 516      41.309 -71.650 -18.964  1.00  0.42           N  
ATOM   3743  CA  THR A 516      41.534 -73.059 -19.297  1.00  0.42           C  
ATOM   3744  C   THR A 516      42.947 -73.242 -19.864  1.00  0.42           C  
ATOM   3745  O   THR A 516      43.405 -74.333 -20.200  1.00  0.42           O  
ATOM   3746  CB  THR A 516      40.478 -73.545 -20.305  1.00  0.42           C  
ATOM   3747  OG1 THR A 516      39.159 -73.319 -19.810  1.00  0.42           O  
ATOM   3748  CG2 THR A 516      40.534 -75.057 -20.556  1.00  0.42           C  
ATOM   3749  N   THR A 517      43.723 -72.144 -19.924  1.00  0.42           N  
ATOM   3750  CA  THR A 517      45.108 -72.100 -20.379  1.00  0.42           C  
ATOM   3751  C   THR A 517      46.101 -72.725 -19.416  1.00  0.42           C  
ATOM   3752  O   THR A 517      46.769 -72.047 -18.639  1.00  0.42           O  
ATOM   3753  CB  THR A 517      45.611 -70.694 -20.665  1.00  0.42           C  
ATOM   3754  OG1 THR A 517      44.702 -69.997 -21.496  1.00  0.42           O  
ATOM   3755  CG2 THR A 517      46.923 -70.712 -21.442  1.00  0.42           C  
ATOM   3756  N   GLU A 518      46.260 -74.058 -19.495  1.00  0.28           N  
ATOM   3757  CA  GLU A 518      47.334 -74.811 -18.862  1.00  0.28           C  
ATOM   3758  C   GLU A 518      48.723 -74.416 -19.381  1.00  0.28           C  
ATOM   3759  O   GLU A 518      49.713 -74.365 -18.656  1.00  0.28           O  
ATOM   3760  CB  GLU A 518      47.100 -76.325 -19.107  1.00  0.28           C  
ATOM   3761  CG  GLU A 518      48.046 -77.269 -18.316  1.00  0.28           C  
ATOM   3762  CD  GLU A 518      47.731 -77.363 -16.820  1.00  0.28           C  
ATOM   3763  OE1 GLU A 518      46.724 -76.765 -16.366  1.00  0.28           O  
ATOM   3764  OE2 GLU A 518      48.503 -78.079 -16.130  1.00  0.28           O  
ATOM   3765  N   THR A 519      48.838 -74.117 -20.693  1.00  0.52           N  
ATOM   3766  CA  THR A 519      50.127 -73.850 -21.321  1.00  0.52           C  
ATOM   3767  C   THR A 519      49.985 -72.829 -22.433  1.00  0.52           C  
ATOM   3768  O   THR A 519      48.920 -72.678 -23.029  1.00  0.52           O  
ATOM   3769  CB  THR A 519      50.799 -75.122 -21.840  1.00  0.52           C  
ATOM   3770  OG1 THR A 519      52.134 -74.887 -22.266  1.00  0.52           O  
ATOM   3771  CG2 THR A 519      50.027 -75.740 -23.018  1.00  0.52           C  
ATOM   3772  N   VAL A 520      51.067 -72.075 -22.717  1.00  0.35           N  
ATOM   3773  CA  VAL A 520      51.096 -70.985 -23.680  1.00  0.35           C  
ATOM   3774  C   VAL A 520      52.334 -71.166 -24.538  1.00  0.35           C  
ATOM   3775  O   VAL A 520      53.415 -71.446 -24.025  1.00  0.35           O  
ATOM   3776  CB  VAL A 520      51.175 -69.599 -23.028  1.00  0.35           C  
ATOM   3777  CG1 VAL A 520      51.094 -68.484 -24.090  1.00  0.35           C  
ATOM   3778  CG2 VAL A 520      50.008 -69.410 -22.048  1.00  0.35           C  
ATOM   3779  N   VAL A 521      52.219 -71.004 -25.872  1.00  0.52           N  
ATOM   3780  CA  VAL A 521      53.355 -71.047 -26.778  1.00  0.52           C  
ATOM   3781  C   VAL A 521      53.468 -69.708 -27.489  1.00  0.52           C  
ATOM   3782  O   VAL A 521      52.485 -69.162 -27.986  1.00  0.52           O  
ATOM   3783  CB  VAL A 521      53.293 -72.201 -27.781  1.00  0.52           C  
ATOM   3784  CG1 VAL A 521      53.507 -73.522 -27.016  1.00  0.52           C  
ATOM   3785  CG2 VAL A 521      51.954 -72.232 -28.547  1.00  0.52           C  
ATOM   3786  N   VAL A 522      54.683 -69.122 -27.498  1.00  0.49           N  
ATOM   3787  CA  VAL A 522      54.984 -67.828 -28.094  1.00  0.49           C  
ATOM   3788  C   VAL A 522      56.426 -67.943 -28.552  1.00  0.49           C  
ATOM   3789  O   VAL A 522      57.211 -68.657 -27.925  1.00  0.49           O  
ATOM   3790  CB  VAL A 522      54.904 -66.642 -27.109  1.00  0.49           C  
ATOM   3791  CG1 VAL A 522      55.062 -65.293 -27.841  1.00  0.49           C  
ATOM   3792  CG2 VAL A 522      53.565 -66.635 -26.352  1.00  0.49           C  
ATOM   3793  N   ASP A 523      56.820 -67.258 -29.642  1.00  0.31           N  
ATOM   3794  CA  ASP A 523      58.195 -67.086 -30.066  1.00  0.31           C  
ATOM   3795  C   ASP A 523      59.104 -66.469 -29.001  1.00  0.31           C  
ATOM   3796  O   ASP A 523      58.685 -65.688 -28.149  1.00  0.31           O  
ATOM   3797  CB  ASP A 523      58.239 -66.207 -31.334  1.00  0.31           C  
ATOM   3798  CG  ASP A 523      57.327 -66.835 -32.368  1.00  0.31           C  
ATOM   3799  OD1 ASP A 523      57.831 -67.663 -33.164  1.00  0.31           O  
ATOM   3800  OD2 ASP A 523      56.109 -66.520 -32.315  1.00  0.31           O  
ATOM   3801  N   LYS A 524      60.400 -66.838 -29.002  1.00  0.24           N  
ATOM   3802  CA  LYS A 524      61.363 -66.387 -28.014  1.00  0.24           C  
ATOM   3803  C   LYS A 524      61.702 -64.892 -28.112  1.00  0.24           C  
ATOM   3804  O   LYS A 524      62.195 -64.463 -29.156  1.00  0.24           O  
ATOM   3805  CB  LYS A 524      62.670 -67.216 -28.153  1.00  0.24           C  
ATOM   3806  CG  LYS A 524      63.829 -66.839 -27.208  1.00  0.24           C  
ATOM   3807  CD  LYS A 524      63.535 -67.071 -25.716  1.00  0.24           C  
ATOM   3808  CE  LYS A 524      64.626 -66.476 -24.819  1.00  0.24           C  
ATOM   3809  NZ  LYS A 524      64.304 -66.705 -23.393  1.00  0.24           N  
ATOM   3810  N   PRO A 525      61.518 -64.048 -27.086  1.00  0.26           N  
ATOM   3811  CA  PRO A 525      62.078 -62.701 -27.065  1.00  0.26           C  
ATOM   3812  C   PRO A 525      63.588 -62.649 -27.223  1.00  0.26           C  
ATOM   3813  O   PRO A 525      64.304 -63.272 -26.436  1.00  0.26           O  
ATOM   3814  CB  PRO A 525      61.624 -62.120 -25.716  1.00  0.26           C  
ATOM   3815  CG  PRO A 525      60.327 -62.874 -25.419  1.00  0.26           C  
ATOM   3816  CD  PRO A 525      60.629 -64.277 -25.944  1.00  0.26           C  
ATOM   3817  N   ALA A 526      64.095 -61.886 -28.208  1.00  0.24           N  
ATOM   3818  CA  ALA A 526      65.513 -61.699 -28.411  1.00  0.24           C  
ATOM   3819  C   ALA A 526      66.055 -60.632 -27.468  1.00  0.24           C  
ATOM   3820  O   ALA A 526      65.919 -59.429 -27.690  1.00  0.24           O  
ATOM   3821  CB  ALA A 526      65.785 -61.309 -29.876  1.00  0.24           C  
ATOM   3822  N   LYS A 527      66.677 -61.064 -26.357  1.00  0.18           N  
ATOM   3823  CA  LYS A 527      67.144 -60.166 -25.329  1.00  0.18           C  
ATOM   3824  C   LYS A 527      68.427 -60.678 -24.718  1.00  0.18           C  
ATOM   3825  O   LYS A 527      68.688 -61.876 -24.643  1.00  0.18           O  
ATOM   3826  CB  LYS A 527      66.119 -59.996 -24.166  1.00  0.18           C  
ATOM   3827  CG  LYS A 527      64.891 -59.118 -24.479  1.00  0.18           C  
ATOM   3828  CD  LYS A 527      65.221 -57.662 -24.878  1.00  0.18           C  
ATOM   3829  CE  LYS A 527      66.031 -56.883 -23.832  1.00  0.18           C  
ATOM   3830  NZ  LYS A 527      66.395 -55.547 -24.357  1.00  0.18           N  
ATOM   3831  N   ALA A 528      69.225 -59.716 -24.239  1.00  0.24           N  
ATOM   3832  CA  ALA A 528      70.363 -59.884 -23.384  1.00  0.24           C  
ATOM   3833  C   ALA A 528      70.226 -58.730 -22.407  1.00  0.24           C  
ATOM   3834  O   ALA A 528      69.369 -57.858 -22.617  1.00  0.24           O  
ATOM   3835  CB  ALA A 528      71.685 -59.783 -24.172  1.00  0.24           C  
ATOM   3836  N   GLU A 529      71.020 -58.739 -21.330  1.00  0.23           N  
ATOM   3837  CA  GLU A 529      71.144 -57.650 -20.391  1.00  0.23           C  
ATOM   3838  C   GLU A 529      72.366 -56.768 -20.768  1.00  0.23           C  
ATOM   3839  O   GLU A 529      73.241 -57.235 -21.550  1.00  0.23           O  
ATOM   3840  CB  GLU A 529      71.220 -58.193 -18.937  1.00  0.23           C  
ATOM   3841  CG  GLU A 529      72.326 -59.250 -18.662  1.00  0.23           C  
ATOM   3842  CD  GLU A 529      72.196 -59.941 -17.301  1.00  0.23           C  
ATOM   3843  OE1 GLU A 529      71.217 -59.665 -16.559  1.00  0.23           O  
ATOM   3844  OE2 GLU A 529      73.078 -60.792 -17.009  1.00  0.23           O  
ATOM   3845  OXT GLU A 529      72.391 -55.587 -20.322  1.00  0.23           O  
TER    3846      GLU A 529                                                      
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.