CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  FMRP_mutant  ***

elNémo ID: 210502013824117363

Job options:

ID        	=	 210502013824117363
JOBID     	=	 FMRP_mutant
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER FMRP_mutant

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 2QND
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   01-MAY-21 1MOD    1       05:11
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.0
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.90
REMARK   3  QMNV    4.2.0
REMARK   3  QMN4    -0.14
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   2qnd
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2021-04-23
REMARK   3  SMTLE   2qnd.2.A
REMARK   3  SMTLV   2021-04-28
REMARK   3  MTHD    X-RAY DIFFRACTION 1.90 A
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.95
REMARK   3  SIM     0.60
REMARK   3  SID     99.31
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG ASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVK
REMARK   3  ALN A TRG KARSFLEFAEDVIQVPRNLVGKVIGKNGKLNQEIVDKSGVVRVRIEAENEKNVPQEEG
REMARK   3  ALN A TRG MVPFVFVGTKDSIANATVLLDYHLNYLK
REMARK   3  ALN A TPL ASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVK
REMARK   3  ALN A TPL KARSFLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKNVPQEEG
REMARK   3  ALN A TPL MVPFVFVGTKDSIANATVLLDYHLNYLK
REMARK   3  ALN A OFF 0
ATOM      1  N   SER A   2      58.341  85.445  -5.235  1.00  0.56           N  
ATOM      2  CA  SER A   2      59.142  84.569  -4.298  1.00  0.56           C  
ATOM      3  C   SER A   2      58.451  83.227  -4.207  1.00  0.56           C  
ATOM      4  O   SER A   2      57.533  83.065  -3.426  1.00  0.56           O  
ATOM      5  CB  SER A   2      59.282  85.273  -2.888  1.00  0.56           C  
ATOM      6  OG  SER A   2      58.211  86.174  -2.588  1.00  0.56           O  
ATOM      7  N   ARG A   3      58.792  82.233  -5.069  1.00  0.71           N  
ATOM      8  CA  ARG A   3      58.055  80.981  -5.076  1.00  0.71           C  
ATOM      9  C   ARG A   3      58.553  79.986  -4.053  1.00  0.71           C  
ATOM     10  O   ARG A   3      59.739  79.670  -4.012  1.00  0.71           O  
ATOM     11  CB  ARG A   3      58.045  80.314  -6.484  1.00  0.71           C  
ATOM     12  CG  ARG A   3      56.793  79.441  -6.731  1.00  0.71           C  
ATOM     13  CD  ARG A   3      55.525  80.302  -6.667  1.00  0.71           C  
ATOM     14  NE  ARG A   3      54.351  79.512  -7.118  1.00  0.71           N  
ATOM     15  CZ  ARG A   3      53.139  80.067  -7.241  1.00  0.71           C  
ATOM     16  NH1 ARG A   3      52.928  81.332  -6.879  1.00  0.71           N  
ATOM     17  NH2 ARG A   3      52.147  79.340  -7.737  1.00  0.71           N  
ATOM     18  N   PHE A   4      57.637  79.470  -3.213  1.00  0.83           N  
ATOM     19  CA  PHE A   4      57.957  78.470  -2.224  1.00  0.83           C  
ATOM     20  C   PHE A   4      57.143  77.236  -2.477  1.00  0.83           C  
ATOM     21  O   PHE A   4      56.005  77.295  -2.952  1.00  0.83           O  
ATOM     22  CB  PHE A   4      57.704  78.972  -0.787  1.00  0.83           C  
ATOM     23  CG  PHE A   4      58.624  80.136  -0.546  1.00  0.83           C  
ATOM     24  CD1 PHE A   4      58.123  81.441  -0.560  1.00  0.83           C  
ATOM     25  CD2 PHE A   4      60.006  79.947  -0.379  1.00  0.83           C  
ATOM     26  CE1 PHE A   4      58.961  82.534  -0.316  1.00  0.83           C  
ATOM     27  CE2 PHE A   4      60.855  81.038  -0.137  1.00  0.83           C  
ATOM     28  CZ  PHE A   4      60.326  82.334  -0.086  1.00  0.83           C  
ATOM     29  N   HIS A   5      57.768  76.087  -2.195  1.00  0.80           N  
ATOM     30  CA  HIS A   5      57.211  74.773  -2.324  1.00  0.80           C  
ATOM     31  C   HIS A   5      57.405  74.071  -0.996  1.00  0.80           C  
ATOM     32  O   HIS A   5      58.488  74.128  -0.417  1.00  0.80           O  
ATOM     33  CB  HIS A   5      57.932  73.993  -3.444  1.00  0.80           C  
ATOM     34  CG  HIS A   5      57.594  72.545  -3.473  1.00  0.80           C  
ATOM     35  ND1 HIS A   5      58.560  71.637  -3.083  1.00  0.80           N  
ATOM     36  CD2 HIS A   5      56.453  71.906  -3.808  1.00  0.80           C  
ATOM     37  CE1 HIS A   5      57.987  70.468  -3.196  1.00  0.80           C  
ATOM     38  NE2 HIS A   5      56.709  70.565  -3.638  1.00  0.80           N  
ATOM     39  N   GLU A   6      56.351  73.409  -0.486  1.00  0.83           N  
ATOM     40  CA  GLU A   6      56.442  72.489   0.631  1.00  0.83           C  
ATOM     41  C   GLU A   6      55.859  71.170   0.188  1.00  0.83           C  
ATOM     42  O   GLU A   6      54.795  71.147  -0.434  1.00  0.83           O  
ATOM     43  CB  GLU A   6      55.589  72.922   1.851  1.00  0.83           C  
ATOM     44  CG  GLU A   6      56.028  74.243   2.506  1.00  0.83           C  
ATOM     45  CD  GLU A   6      57.010  74.050   3.643  1.00  0.83           C  
ATOM     46  OE1 GLU A   6      57.017  72.974   4.298  1.00  0.83           O  
ATOM     47  OE2 GLU A   6      57.728  75.031   3.944  1.00  0.83           O  
ATOM     48  N   GLN A   7      56.505  70.034   0.518  1.00  0.84           N  
ATOM     49  CA  GLN A   7      55.925  68.732   0.259  1.00  0.84           C  
ATOM     50  C   GLN A   7      55.937  67.855   1.493  1.00  0.84           C  
ATOM     51  O   GLN A   7      56.837  67.944   2.337  1.00  0.84           O  
ATOM     52  CB  GLN A   7      56.550  68.004  -0.962  1.00  0.84           C  
ATOM     53  CG  GLN A   7      57.947  67.347  -0.758  1.00  0.84           C  
ATOM     54  CD  GLN A   7      57.955  65.893  -1.245  1.00  0.84           C  
ATOM     55  OE1 GLN A   7      57.313  65.031  -0.667  1.00  0.84           O  
ATOM     56  NE2 GLN A   7      58.712  65.591  -2.327  1.00  0.84           N  
ATOM     57  N   PHE A   8      54.901  67.011   1.644  1.00  0.88           N  
ATOM     58  CA  PHE A   8      54.804  66.069   2.738  1.00  0.88           C  
ATOM     59  C   PHE A   8      53.882  64.921   2.373  1.00  0.88           C  
ATOM     60  O   PHE A   8      52.893  65.083   1.654  1.00  0.88           O  
ATOM     61  CB  PHE A   8      54.353  66.715   4.091  1.00  0.88           C  
ATOM     62  CG  PHE A   8      53.093  67.539   3.945  1.00  0.88           C  
ATOM     63  CD1 PHE A   8      51.839  67.012   4.297  1.00  0.88           C  
ATOM     64  CD2 PHE A   8      53.153  68.845   3.428  1.00  0.88           C  
ATOM     65  CE1 PHE A   8      50.672  67.768   4.125  1.00  0.88           C  
ATOM     66  CE2 PHE A   8      51.988  69.585   3.212  1.00  0.88           C  
ATOM     67  CZ  PHE A   8      50.746  69.053   3.572  1.00  0.88           C  
ATOM     68  N   ILE A   9      54.186  63.724   2.902  1.00  0.89           N  
ATOM     69  CA  ILE A   9      53.380  62.529   2.764  1.00  0.89           C  
ATOM     70  C   ILE A   9      52.389  62.501   3.902  1.00  0.89           C  
ATOM     71  O   ILE A   9      52.746  62.699   5.066  1.00  0.89           O  
ATOM     72  CB  ILE A   9      54.228  61.251   2.805  1.00  0.89           C  
ATOM     73  CG1 ILE A   9      55.317  61.340   1.703  1.00  0.89           C  
ATOM     74  CG2 ILE A   9      53.321  60.000   2.639  1.00  0.89           C  
ATOM     75  CD1 ILE A   9      56.066  60.031   1.405  1.00  0.89           C  
ATOM     76  N   VAL A  10      51.115  62.218   3.600  1.00  0.89           N  
ATOM     77  CA  VAL A  10      50.124  61.900   4.603  1.00  0.89           C  
ATOM     78  C   VAL A  10      49.880  60.428   4.391  1.00  0.89           C  
ATOM     79  O   VAL A  10      49.692  59.973   3.268  1.00  0.89           O  
ATOM     80  CB  VAL A  10      48.854  62.738   4.455  1.00  0.89           C  
ATOM     81  CG1 VAL A  10      47.684  62.193   5.306  1.00  0.89           C  
ATOM     82  CG2 VAL A  10      49.206  64.179   4.880  1.00  0.89           C  
ATOM     83  N   ARG A  11      49.929  59.607   5.460  1.00  0.81           N  
ATOM     84  CA  ARG A  11      49.593  58.193   5.378  1.00  0.81           C  
ATOM     85  C   ARG A  11      48.181  57.968   4.867  1.00  0.81           C  
ATOM     86  O   ARG A  11      47.275  58.745   5.162  1.00  0.81           O  
ATOM     87  CB  ARG A  11      49.676  57.479   6.754  1.00  0.81           C  
ATOM     88  CG  ARG A  11      51.100  57.207   7.273  1.00  0.81           C  
ATOM     89  CD  ARG A  11      51.145  56.700   8.728  1.00  0.81           C  
ATOM     90  NE  ARG A  11      50.375  55.418   8.808  1.00  0.81           N  
ATOM     91  CZ  ARG A  11      50.427  54.561   9.833  1.00  0.81           C  
ATOM     92  NH1 ARG A  11      51.127  54.840  10.921  1.00  0.81           N  
ATOM     93  NH2 ARG A  11      49.563  53.560   9.880  1.00  0.81           N  
ATOM     94  N   GLU A  12      47.971  56.873   4.107  1.00  0.78           N  
ATOM     95  CA  GLU A  12      46.724  56.519   3.456  1.00  0.78           C  
ATOM     96  C   GLU A  12      45.525  56.521   4.415  1.00  0.78           C  
ATOM     97  O   GLU A  12      44.513  57.175   4.178  1.00  0.78           O  
ATOM     98  CB  GLU A  12      46.937  55.143   2.759  1.00  0.78           C  
ATOM     99  CG  GLU A  12      46.061  54.907   1.502  1.00  0.78           C  
ATOM    100  CD  GLU A  12      44.598  54.634   1.834  1.00  0.78           C  
ATOM    101  OE1 GLU A  12      44.356  53.788   2.732  1.00  0.78           O  
ATOM    102  OE2 GLU A  12      43.725  55.247   1.170  1.00  0.78           O  
ATOM    103  N   ASP A  13      45.704  55.931   5.620  1.00  0.85           N  
ATOM    104  CA  ASP A  13      44.695  55.804   6.640  1.00  0.85           C  
ATOM    105  C   ASP A  13      44.318  57.146   7.303  1.00  0.85           C  
ATOM    106  O   ASP A  13      43.259  57.298   7.914  1.00  0.85           O  
ATOM    107  CB  ASP A  13      45.180  54.690   7.633  1.00  0.85           C  
ATOM    108  CG  ASP A  13      46.443  54.949   8.459  1.00  0.85           C  
ATOM    109  OD1 ASP A  13      47.543  55.217   7.896  1.00  0.85           O  
ATOM    110  OD2 ASP A  13      46.362  54.781   9.699  1.00  0.85           O  
ATOM    111  N   LEU A  14      45.156  58.197   7.146  1.00  0.87           N  
ATOM    112  CA  LEU A  14      44.915  59.514   7.704  1.00  0.87           C  
ATOM    113  C   LEU A  14      44.510  60.504   6.623  1.00  0.87           C  
ATOM    114  O   LEU A  14      44.256  61.677   6.899  1.00  0.87           O  
ATOM    115  CB  LEU A  14      46.181  60.054   8.412  1.00  0.87           C  
ATOM    116  CG  LEU A  14      46.799  59.083   9.443  1.00  0.87           C  
ATOM    117  CD1 LEU A  14      48.037  59.732  10.079  1.00  0.87           C  
ATOM    118  CD2 LEU A  14      45.804  58.634  10.533  1.00  0.87           C  
ATOM    119  N   MET A  15      44.400  60.070   5.349  1.00  0.83           N  
ATOM    120  CA  MET A  15      44.061  60.944   4.241  1.00  0.83           C  
ATOM    121  C   MET A  15      42.675  61.570   4.343  1.00  0.83           C  
ATOM    122  O   MET A  15      42.464  62.736   4.018  1.00  0.83           O  
ATOM    123  CB  MET A  15      44.228  60.203   2.895  1.00  0.83           C  
ATOM    124  CG  MET A  15      44.213  61.142   1.666  1.00  0.83           C  
ATOM    125  SD  MET A  15      45.419  62.498   1.720  1.00  0.83           S  
ATOM    126  CE  MET A  15      46.841  61.390   1.674  1.00  0.83           C  
ATOM    127  N   GLY A  16      41.685  60.809   4.861  1.00  0.83           N  
ATOM    128  CA  GLY A  16      40.332  61.311   5.103  1.00  0.83           C  
ATOM    129  C   GLY A  16      40.259  62.449   6.104  1.00  0.83           C  
ATOM    130  O   GLY A  16      39.487  63.388   5.932  1.00  0.83           O  
ATOM    131  N   LEU A  17      41.115  62.415   7.151  1.00  0.86           N  
ATOM    132  CA  LEU A  17      41.335  63.509   8.087  1.00  0.86           C  
ATOM    133  C   LEU A  17      41.999  64.715   7.439  1.00  0.86           C  
ATOM    134  O   LEU A  17      41.590  65.851   7.666  1.00  0.86           O  
ATOM    135  CB  LEU A  17      42.225  63.058   9.273  1.00  0.86           C  
ATOM    136  CG  LEU A  17      41.571  62.020  10.207  1.00  0.86           C  
ATOM    137  CD1 LEU A  17      42.660  61.344  11.059  1.00  0.86           C  
ATOM    138  CD2 LEU A  17      40.496  62.676  11.097  1.00  0.86           C  
ATOM    139  N   ALA A  18      43.028  64.489   6.586  1.00  0.87           N  
ATOM    140  CA  ALA A  18      43.714  65.534   5.851  1.00  0.87           C  
ATOM    141  C   ALA A  18      42.802  66.306   4.919  1.00  0.87           C  
ATOM    142  O   ALA A  18      42.817  67.526   4.882  1.00  0.87           O  
ATOM    143  CB  ALA A  18      44.875  64.942   5.025  1.00  0.87           C  
ATOM    144  N   ILE A  19      41.938  65.621   4.158  1.00  0.85           N  
ATOM    145  CA  ILE A  19      40.948  66.292   3.339  1.00  0.85           C  
ATOM    146  C   ILE A  19      39.847  66.948   4.172  1.00  0.85           C  
ATOM    147  O   ILE A  19      39.483  68.104   3.941  1.00  0.85           O  
ATOM    148  CB  ILE A  19      40.451  65.319   2.278  1.00  0.85           C  
ATOM    149  CG1 ILE A  19      41.640  64.859   1.379  1.00  0.85           C  
ATOM    150  CG2 ILE A  19      39.306  65.924   1.437  1.00  0.85           C  
ATOM    151  CD1 ILE A  19      42.344  65.986   0.601  1.00  0.85           C  
ATOM    152  N   GLY A  20      39.336  66.257   5.215  1.00  0.88           N  
ATOM    153  CA  GLY A  20      38.195  66.683   6.014  1.00  0.88           C  
ATOM    154  C   GLY A  20      36.889  66.311   5.372  1.00  0.88           C  
ATOM    155  O   GLY A  20      36.822  65.918   4.205  1.00  0.88           O  
ATOM    156  N   THR A  21      35.777  66.426   6.124  1.00  0.86           N  
ATOM    157  CA  THR A  21      34.445  66.091   5.633  1.00  0.86           C  
ATOM    158  C   THR A  21      34.017  67.050   4.530  1.00  0.86           C  
ATOM    159  O   THR A  21      34.088  68.267   4.673  1.00  0.86           O  
ATOM    160  CB  THR A  21      33.368  65.939   6.720  1.00  0.86           C  
ATOM    161  OG1 THR A  21      33.029  67.151   7.368  1.00  0.86           O  
ATOM    162  CG2 THR A  21      33.884  65.036   7.849  1.00  0.86           C  
ATOM    163  N   HIS A  22      33.690  66.500   3.337  1.00  0.80           N  
ATOM    164  CA  HIS A  22      33.477  67.250   2.098  1.00  0.80           C  
ATOM    165  C   HIS A  22      34.612  68.197   1.712  1.00  0.80           C  
ATOM    166  O   HIS A  22      34.397  69.209   1.057  1.00  0.80           O  
ATOM    167  CB  HIS A  22      32.119  67.989   2.078  1.00  0.80           C  
ATOM    168  CG  HIS A  22      30.987  67.047   2.326  1.00  0.80           C  
ATOM    169  ND1 HIS A  22      29.791  67.572   2.765  1.00  0.80           N  
ATOM    170  CD2 HIS A  22      30.880  65.700   2.175  1.00  0.80           C  
ATOM    171  CE1 HIS A  22      28.983  66.546   2.877  1.00  0.80           C  
ATOM    172  NE2 HIS A  22      29.588  65.381   2.534  1.00  0.80           N  
ATOM    173  N   GLY A  23      35.872  67.879   2.093  1.00  0.86           N  
ATOM    174  CA  GLY A  23      36.997  68.760   1.819  1.00  0.86           C  
ATOM    175  C   GLY A  23      37.119  69.991   2.689  1.00  0.86           C  
ATOM    176  O   GLY A  23      37.829  70.921   2.318  1.00  0.86           O  
ATOM    177  N   ALA A  24      36.471  70.060   3.874  1.00  0.85           N  
ATOM    178  CA  ALA A  24      36.509  71.237   4.734  1.00  0.85           C  
ATOM    179  C   ALA A  24      37.913  71.688   5.174  1.00  0.85           C  
ATOM    180  O   ALA A  24      38.254  72.875   5.165  1.00  0.85           O  
ATOM    181  CB  ALA A  24      35.660  70.972   6.002  1.00  0.85           C  
ATOM    182  N   ASN A  25      38.772  70.717   5.549  1.00  0.81           N  
ATOM    183  CA  ASN A  25      40.135  70.934   5.974  1.00  0.81           C  
ATOM    184  C   ASN A  25      41.053  71.366   4.816  1.00  0.81           C  
ATOM    185  O   ASN A  25      41.811  72.331   4.919  1.00  0.81           O  
ATOM    186  CB  ASN A  25      40.648  69.645   6.660  1.00  0.81           C  
ATOM    187  CG  ASN A  25      41.909  69.993   7.424  1.00  0.81           C  
ATOM    188  OD1 ASN A  25      41.945  70.988   8.160  1.00  0.81           O  
ATOM    189  ND2 ASN A  25      42.978  69.214   7.205  1.00  0.81           N  
ATOM    190  N   ILE A  26      40.978  70.704   3.639  1.00  0.85           N  
ATOM    191  CA  ILE A  26      41.734  71.138   2.463  1.00  0.85           C  
ATOM    192  C   ILE A  26      41.305  72.485   1.937  1.00  0.85           C  
ATOM    193  O   ILE A  26      42.114  73.283   1.464  1.00  0.85           O  
ATOM    194  CB  ILE A  26      41.785  70.119   1.328  1.00  0.85           C  
ATOM    195  CG1 ILE A  26      42.955  70.439   0.364  1.00  0.85           C  
ATOM    196  CG2 ILE A  26      40.424  70.006   0.592  1.00  0.85           C  
ATOM    197  CD1 ILE A  26      43.339  69.222  -0.477  1.00  0.85           C  
ATOM    198  N   GLN A  27      40.000  72.793   2.024  1.00  0.80           N  
ATOM    199  CA  GLN A  27      39.465  74.068   1.641  1.00  0.80           C  
ATOM    200  C   GLN A  27      40.019  75.196   2.495  1.00  0.80           C  
ATOM    201  O   GLN A  27      40.418  76.221   1.963  1.00  0.80           O  
ATOM    202  CB  GLN A  27      37.929  74.042   1.763  1.00  0.80           C  
ATOM    203  CG  GLN A  27      37.237  75.344   1.300  1.00  0.80           C  
ATOM    204  CD  GLN A  27      35.798  75.354   1.803  1.00  0.80           C  
ATOM    205  OE1 GLN A  27      35.124  74.345   1.888  1.00  0.80           O  
ATOM    206  NE2 GLN A  27      35.292  76.556   2.168  1.00  0.80           N  
ATOM    207  N   GLN A  28      40.089  75.045   3.843  1.00  0.81           N  
ATOM    208  CA  GLN A  28      40.685  76.047   4.719  1.00  0.81           C  
ATOM    209  C   GLN A  28      42.176  76.268   4.529  1.00  0.81           C  
ATOM    210  O   GLN A  28      42.626  77.409   4.579  1.00  0.81           O  
ATOM    211  CB  GLN A  28      40.313  75.890   6.213  1.00  0.81           C  
ATOM    212  CG  GLN A  28      41.140  74.836   6.980  1.00  0.81           C  
ATOM    213  CD  GLN A  28      40.680  74.760   8.430  1.00  0.81           C  
ATOM    214  OE1 GLN A  28      40.167  75.734   8.980  1.00  0.81           O  
ATOM    215  NE2 GLN A  28      40.875  73.586   9.071  1.00  0.81           N  
ATOM    216  N   ALA A  29      42.953  75.197   4.253  1.00  0.89           N  
ATOM    217  CA  ALA A  29      44.338  75.266   3.836  1.00  0.89           C  
ATOM    218  C   ALA A  29      44.542  76.025   2.519  1.00  0.89           C  
ATOM    219  O   ALA A  29      45.467  76.817   2.377  1.00  0.89           O  
ATOM    220  CB  ALA A  29      44.858  73.820   3.692  1.00  0.89           C  
ATOM    221  N   ARG A  30      43.648  75.812   1.530  1.00  0.81           N  
ATOM    222  CA  ARG A  30      43.608  76.523   0.259  1.00  0.81           C  
ATOM    223  C   ARG A  30      43.199  77.990   0.315  1.00  0.81           C  
ATOM    224  O   ARG A  30      43.601  78.759  -0.548  1.00  0.81           O  
ATOM    225  CB  ARG A  30      42.630  75.815  -0.710  1.00  0.81           C  
ATOM    226  CG  ARG A  30      43.279  74.639  -1.455  1.00  0.81           C  
ATOM    227  CD  ARG A  30      42.260  73.752  -2.159  1.00  0.81           C  
ATOM    228  NE  ARG A  30      43.056  72.774  -2.985  1.00  0.81           N  
ATOM    229  CZ  ARG A  30      42.605  71.591  -3.419  1.00  0.81           C  
ATOM    230  NH1 ARG A  30      41.405  71.156  -3.052  1.00  0.81           N  
ATOM    231  NH2 ARG A  30      43.361  70.836  -4.214  1.00  0.81           N  
ATOM    232  N   LYS A  31      42.389  78.434   1.303  1.00  0.84           N  
ATOM    233  CA  LYS A  31      41.995  79.837   1.405  1.00  0.84           C  
ATOM    234  C   LYS A  31      42.905  80.575   2.377  1.00  0.84           C  
ATOM    235  O   LYS A  31      42.604  81.685   2.811  1.00  0.84           O  
ATOM    236  CB  LYS A  31      40.497  80.063   1.788  1.00  0.84           C  
ATOM    237  CG  LYS A  31      40.027  79.315   3.049  1.00  0.84           C  
ATOM    238  CD  LYS A  31      38.657  79.783   3.570  1.00  0.84           C  
ATOM    239  CE  LYS A  31      38.205  79.142   4.897  1.00  0.84           C  
ATOM    240  NZ  LYS A  31      37.695  77.761   4.704  1.00  0.84           N  
ATOM    241  N   VAL A  32      44.074  79.999   2.744  1.00  0.88           N  
ATOM    242  CA  VAL A  32      45.155  80.772   3.344  1.00  0.88           C  
ATOM    243  C   VAL A  32      45.660  81.861   2.378  1.00  0.88           C  
ATOM    244  O   VAL A  32      46.107  81.512   1.285  1.00  0.88           O  
ATOM    245  CB  VAL A  32      46.337  79.905   3.783  1.00  0.88           C  
ATOM    246  CG1 VAL A  32      47.539  80.764   4.255  1.00  0.88           C  
ATOM    247  CG2 VAL A  32      45.867  78.965   4.911  1.00  0.88           C  
ATOM    248  N   PRO A  33      45.634  83.167   2.683  1.00  0.91           N  
ATOM    249  CA  PRO A  33      46.239  84.203   1.846  1.00  0.91           C  
ATOM    250  C   PRO A  33      47.710  83.925   1.524  1.00  0.91           C  
ATOM    251  O   PRO A  33      48.462  83.655   2.458  1.00  0.91           O  
ATOM    252  CB  PRO A  33      46.053  85.516   2.650  1.00  0.91           C  
ATOM    253  CG  PRO A  33      44.947  85.202   3.669  1.00  0.91           C  
ATOM    254  CD  PRO A  33      45.150  83.712   3.945  1.00  0.91           C  
ATOM    255  N   GLY A  34      48.124  83.950   0.236  1.00  0.87           N  
ATOM    256  CA  GLY A  34      49.499  83.696  -0.206  1.00  0.87           C  
ATOM    257  C   GLY A  34      49.727  82.275  -0.670  1.00  0.87           C  
ATOM    258  O   GLY A  34      50.783  81.938  -1.208  1.00  0.87           O  
ATOM    259  N   VAL A  35      48.732  81.380  -0.507  1.00  0.85           N  
ATOM    260  CA  VAL A  35      48.790  80.017  -1.015  1.00  0.85           C  
ATOM    261  C   VAL A  35      48.126  79.966  -2.372  1.00  0.85           C  
ATOM    262  O   VAL A  35      46.957  80.297  -2.548  1.00  0.85           O  
ATOM    263  CB  VAL A  35      48.148  79.011  -0.075  1.00  0.85           C  
ATOM    264  CG1 VAL A  35      48.201  77.571  -0.642  1.00  0.85           C  
ATOM    265  CG2 VAL A  35      48.922  79.083   1.252  1.00  0.85           C  
ATOM    266  N   THR A  36      48.887  79.562  -3.399  1.00  0.82           N  
ATOM    267  CA  THR A  36      48.418  79.572  -4.777  1.00  0.82           C  
ATOM    268  C   THR A  36      47.801  78.253  -5.150  1.00  0.82           C  
ATOM    269  O   THR A  36      46.778  78.196  -5.821  1.00  0.82           O  
ATOM    270  CB  THR A  36      49.540  79.845  -5.757  1.00  0.82           C  
ATOM    271  OG1 THR A  36      50.133  81.087  -5.424  1.00  0.82           O  
ATOM    272  CG2 THR A  36      49.012  80.009  -7.195  1.00  0.82           C  
ATOM    273  N   ALA A  37      48.414  77.127  -4.737  1.00  0.85           N  
ATOM    274  CA  ALA A  37      47.878  75.843  -5.110  1.00  0.85           C  
ATOM    275  C   ALA A  37      48.239  74.831  -4.054  1.00  0.85           C  
ATOM    276  O   ALA A  37      49.291  74.921  -3.415  1.00  0.85           O  
ATOM    277  CB  ALA A  37      48.393  75.359  -6.489  1.00  0.85           C  
ATOM    278  N   ILE A  38      47.347  73.841  -3.866  1.00  0.84           N  
ATOM    279  CA  ILE A  38      47.612  72.633  -3.105  1.00  0.84           C  
ATOM    280  C   ILE A  38      47.289  71.468  -4.014  1.00  0.84           C  
ATOM    281  O   ILE A  38      46.106  71.209  -4.293  1.00  0.84           O  
ATOM    282  CB  ILE A  38      46.800  72.491  -1.809  1.00  0.84           C  
ATOM    283  CG1 ILE A  38      46.939  73.779  -0.953  1.00  0.84           C  
ATOM    284  CG2 ILE A  38      47.276  71.210  -1.069  1.00  0.84           C  
ATOM    285  CD1 ILE A  38      46.394  73.667   0.474  1.00  0.84           C  
ATOM    286  N   ASP A  39      48.335  70.749  -4.453  1.00  0.86           N  
ATOM    287  CA  ASP A  39      48.290  69.576  -5.295  1.00  0.86           C  
ATOM    288  C   ASP A  39      48.413  68.344  -4.431  1.00  0.86           C  
ATOM    289  O   ASP A  39      48.892  68.394  -3.294  1.00  0.86           O  
ATOM    290  CB  ASP A  39      49.462  69.547  -6.312  1.00  0.86           C  
ATOM    291  CG  ASP A  39      49.147  70.382  -7.538  1.00  0.86           C  
ATOM    292  OD1 ASP A  39      48.210  71.218  -7.481  1.00  0.86           O  
ATOM    293  OD2 ASP A  39      49.847  70.160  -8.555  1.00  0.86           O  
ATOM    294  N   LEU A  40      47.981  67.196  -4.971  1.00  0.85           N  
ATOM    295  CA  LEU A  40      48.121  65.904  -4.351  1.00  0.85           C  
ATOM    296  C   LEU A  40      48.617  64.926  -5.404  1.00  0.85           C  
ATOM    297  O   LEU A  40      47.982  64.728  -6.439  1.00  0.85           O  
ATOM    298  CB  LEU A  40      46.761  65.453  -3.755  1.00  0.85           C  
ATOM    299  CG  LEU A  40      46.753  64.075  -3.053  1.00  0.85           C  
ATOM    300  CD1 LEU A  40      47.729  63.970  -1.865  1.00  0.85           C  
ATOM    301  CD2 LEU A  40      45.325  63.754  -2.586  1.00  0.85           C  
ATOM    302  N   ASP A  41      49.777  64.282  -5.166  1.00  0.82           N  
ATOM    303  CA  ASP A  41      50.201  63.100  -5.880  1.00  0.82           C  
ATOM    304  C   ASP A  41      49.441  61.949  -5.205  1.00  0.82           C  
ATOM    305  O   ASP A  41      49.681  61.620  -4.044  1.00  0.82           O  
ATOM    306  CB  ASP A  41      51.763  63.007  -5.800  1.00  0.82           C  
ATOM    307  CG  ASP A  41      52.374  61.792  -6.479  1.00  0.82           C  
ATOM    308  OD1 ASP A  41      51.601  60.936  -6.968  1.00  0.82           O  
ATOM    309  OD2 ASP A  41      53.631  61.701  -6.458  1.00  0.82           O  
ATOM    310  N   GLU A  42      48.448  61.370  -5.916  1.00  0.72           N  
ATOM    311  CA  GLU A  42      47.611  60.265  -5.490  1.00  0.72           C  
ATOM    312  C   GLU A  42      48.391  58.958  -5.345  1.00  0.72           C  
ATOM    313  O   GLU A  42      48.051  58.119  -4.512  1.00  0.72           O  
ATOM    314  CB  GLU A  42      46.450  60.044  -6.500  1.00  0.72           C  
ATOM    315  CG  GLU A  42      45.571  61.290  -6.835  1.00  0.72           C  
ATOM    316  CD  GLU A  42      44.452  61.598  -5.838  1.00  0.72           C  
ATOM    317  OE1 GLU A  42      43.806  60.642  -5.342  1.00  0.72           O  
ATOM    318  OE2 GLU A  42      44.193  62.811  -5.624  1.00  0.72           O  
ATOM    319  N   ASP A  43      49.475  58.748  -6.135  1.00  0.75           N  
ATOM    320  CA  ASP A  43      50.245  57.517  -6.150  1.00  0.75           C  
ATOM    321  C   ASP A  43      51.008  57.330  -4.840  1.00  0.75           C  
ATOM    322  O   ASP A  43      51.171  56.221  -4.331  1.00  0.75           O  
ATOM    323  CB  ASP A  43      51.243  57.494  -7.346  1.00  0.75           C  
ATOM    324  CG  ASP A  43      50.563  57.313  -8.699  1.00  0.75           C  
ATOM    325  OD1 ASP A  43      49.312  57.202  -8.755  1.00  0.75           O  
ATOM    326  OD2 ASP A  43      51.319  57.226  -9.703  1.00  0.75           O  
ATOM    327  N   THR A  44      51.514  58.443  -4.262  1.00  0.78           N  
ATOM    328  CA  THR A  44      52.376  58.420  -3.083  1.00  0.78           C  
ATOM    329  C   THR A  44      51.730  59.033  -1.866  1.00  0.78           C  
ATOM    330  O   THR A  44      52.302  59.012  -0.778  1.00  0.78           O  
ATOM    331  CB  THR A  44      53.719  59.119  -3.338  1.00  0.78           C  
ATOM    332  OG1 THR A  44      53.595  60.481  -3.727  1.00  0.78           O  
ATOM    333  CG2 THR A  44      54.403  58.398  -4.502  1.00  0.78           C  
ATOM    334  N   CYS A  45      50.498  59.563  -2.020  1.00  0.85           N  
ATOM    335  CA  CYS A  45      49.763  60.301  -1.009  1.00  0.85           C  
ATOM    336  C   CYS A  45      50.490  61.563  -0.532  1.00  0.85           C  
ATOM    337  O   CYS A  45      50.498  61.920   0.648  1.00  0.85           O  
ATOM    338  CB  CYS A  45      49.302  59.360   0.133  1.00  0.85           C  
ATOM    339  SG  CYS A  45      47.956  58.261  -0.406  1.00  0.85           S  
ATOM    340  N   THR A  46      51.092  62.300  -1.488  1.00  0.87           N  
ATOM    341  CA  THR A  46      52.007  63.405  -1.194  1.00  0.87           C  
ATOM    342  C   THR A  46      51.397  64.716  -1.590  1.00  0.87           C  
ATOM    343  O   THR A  46      51.121  64.984  -2.760  1.00  0.87           O  
ATOM    344  CB  THR A  46      53.353  63.319  -1.894  1.00  0.87           C  
ATOM    345  OG1 THR A  46      54.075  62.219  -1.398  1.00  0.87           O  
ATOM    346  CG2 THR A  46      54.279  64.499  -1.582  1.00  0.87           C  
ATOM    347  N   PHE A  47      51.193  65.608  -0.608  1.00  0.88           N  
ATOM    348  CA  PHE A  47      50.726  66.951  -0.862  1.00  0.88           C  
ATOM    349  C   PHE A  47      51.877  67.813  -1.326  1.00  0.88           C  
ATOM    350  O   PHE A  47      52.988  67.710  -0.810  1.00  0.88           O  
ATOM    351  CB  PHE A  47      50.133  67.612   0.403  1.00  0.88           C  
ATOM    352  CG  PHE A  47      48.771  67.057   0.675  1.00  0.88           C  
ATOM    353  CD1 PHE A  47      48.561  66.107   1.685  1.00  0.88           C  
ATOM    354  CD2 PHE A  47      47.679  67.494  -0.091  1.00  0.88           C  
ATOM    355  CE1 PHE A  47      47.268  65.645   1.964  1.00  0.88           C  
ATOM    356  CE2 PHE A  47      46.389  67.022   0.173  1.00  0.88           C  
ATOM    357  CZ  PHE A  47      46.181  66.107   1.212  1.00  0.88           C  
ATOM    358  N   HIS A  48      51.617  68.698  -2.302  1.00  0.87           N  
ATOM    359  CA  HIS A  48      52.571  69.677  -2.779  1.00  0.87           C  
ATOM    360  C   HIS A  48      51.917  71.040  -2.676  1.00  0.87           C  
ATOM    361  O   HIS A  48      50.897  71.301  -3.313  1.00  0.87           O  
ATOM    362  CB  HIS A  48      52.974  69.390  -4.243  1.00  0.87           C  
ATOM    363  CG  HIS A  48      53.791  68.144  -4.359  1.00  0.87           C  
ATOM    364  ND1 HIS A  48      55.165  68.252  -4.242  1.00  0.87           N  
ATOM    365  CD2 HIS A  48      53.435  66.848  -4.537  1.00  0.87           C  
ATOM    366  CE1 HIS A  48      55.613  67.023  -4.357  1.00  0.87           C  
ATOM    367  NE2 HIS A  48      54.613  66.128  -4.538  1.00  0.87           N  
ATOM    368  N   ILE A  49      52.466  71.943  -1.842  1.00  0.87           N  
ATOM    369  CA  ILE A  49      51.886  73.254  -1.573  1.00  0.87           C  
ATOM    370  C   ILE A  49      52.755  74.297  -2.227  1.00  0.87           C  
ATOM    371  O   ILE A  49      53.971  74.302  -2.040  1.00  0.87           O  
ATOM    372  CB  ILE A  49      51.755  73.567  -0.076  1.00  0.87           C  
ATOM    373  CG1 ILE A  49      50.964  72.419   0.609  1.00  0.87           C  
ATOM    374  CG2 ILE A  49      51.096  74.963   0.118  1.00  0.87           C  
ATOM    375  CD1 ILE A  49      50.462  72.752   2.018  1.00  0.87           C  
ATOM    376  N   TYR A  50      52.159  75.209  -3.019  1.00  0.86           N  
ATOM    377  CA  TYR A  50      52.890  76.258  -3.703  1.00  0.86           C  
ATOM    378  C   TYR A  50      52.356  77.623  -3.315  1.00  0.86           C  
ATOM    379  O   TYR A  50      51.146  77.852  -3.335  1.00  0.86           O  
ATOM    380  CB  TYR A  50      52.746  76.159  -5.243  1.00  0.86           C  
ATOM    381  CG  TYR A  50      53.184  74.809  -5.742  1.00  0.86           C  
ATOM    382  CD1 TYR A  50      52.234  73.808  -6.014  1.00  0.86           C  
ATOM    383  CD2 TYR A  50      54.544  74.525  -5.948  1.00  0.86           C  
ATOM    384  CE1 TYR A  50      52.631  72.563  -6.521  1.00  0.86           C  
ATOM    385  CE2 TYR A  50      54.943  73.280  -6.461  1.00  0.86           C  
ATOM    386  CZ  TYR A  50      53.986  72.296  -6.736  1.00  0.86           C  
ATOM    387  OH  TYR A  50      54.383  71.020  -7.185  1.00  0.86           O  
ATOM    388  N   GLY A  51      53.220  78.603  -2.993  1.00  0.85           N  
ATOM    389  CA  GLY A  51      52.722  79.950  -2.739  1.00  0.85           C  
ATOM    390  C   GLY A  51      53.799  80.992  -2.730  1.00  0.85           C  
ATOM    391  O   GLY A  51      54.889  80.760  -3.257  1.00  0.85           O  
ATOM    392  N   GLU A  52      53.481  82.184  -2.190  1.00  0.78           N  
ATOM    393  CA  GLU A  52      54.282  83.394  -2.290  1.00  0.78           C  
ATOM    394  C   GLU A  52      55.163  83.700  -1.085  1.00  0.78           C  
ATOM    395  O   GLU A  52      56.153  84.429  -1.195  1.00  0.78           O  
ATOM    396  CB  GLU A  52      53.330  84.601  -2.461  1.00  0.78           C  
ATOM    397  CG  GLU A  52      52.357  84.470  -3.659  1.00  0.78           C  
ATOM    398  CD  GLU A  52      51.408  85.660  -3.742  1.00  0.78           C  
ATOM    399  OE1 GLU A  52      50.412  85.680  -2.976  1.00  0.78           O  
ATOM    400  OE2 GLU A  52      51.664  86.526  -4.617  1.00  0.78           O  
ATOM    401  N   ASP A  53      54.883  83.111   0.088  1.00  0.79           N  
ATOM    402  CA  ASP A  53      55.727  83.297   1.238  1.00  0.79           C  
ATOM    403  C   ASP A  53      55.759  81.998   2.033  1.00  0.79           C  
ATOM    404  O   ASP A  53      54.925  81.104   1.880  1.00  0.79           O  
ATOM    405  CB  ASP A  53      55.382  84.595   2.022  1.00  0.79           C  
ATOM    406  CG  ASP A  53      53.972  84.483   2.547  1.00  0.79           C  
ATOM    407  OD1 ASP A  53      53.029  84.931   1.855  1.00  0.79           O  
ATOM    408  OD2 ASP A  53      53.835  83.864   3.633  1.00  0.79           O  
ATOM    409  N   GLN A  54      56.820  81.838   2.848  1.00  0.78           N  
ATOM    410  CA  GLN A  54      57.033  80.679   3.686  1.00  0.78           C  
ATOM    411  C   GLN A  54      55.949  80.505   4.745  1.00  0.78           C  
ATOM    412  O   GLN A  54      55.447  79.401   4.918  1.00  0.78           O  
ATOM    413  CB  GLN A  54      58.428  80.744   4.367  1.00  0.78           C  
ATOM    414  CG  GLN A  54      59.632  80.495   3.421  1.00  0.78           C  
ATOM    415  CD  GLN A  54      59.795  78.999   3.128  1.00  0.78           C  
ATOM    416  OE1 GLN A  54      59.053  78.147   3.588  1.00  0.78           O  
ATOM    417  NE2 GLN A  54      60.864  78.655   2.368  1.00  0.78           N  
ATOM    418  N   ASP A  55      55.517  81.583   5.439  1.00  0.83           N  
ATOM    419  CA  ASP A  55      54.459  81.549   6.431  1.00  0.83           C  
ATOM    420  C   ASP A  55      53.141  81.055   5.851  1.00  0.83           C  
ATOM    421  O   ASP A  55      52.491  80.179   6.424  1.00  0.83           O  
ATOM    422  CB  ASP A  55      54.231  82.982   6.986  1.00  0.83           C  
ATOM    423  CG  ASP A  55      55.205  83.352   8.091  1.00  0.83           C  
ATOM    424  OD1 ASP A  55      56.101  82.530   8.414  1.00  0.83           O  
ATOM    425  OD2 ASP A  55      55.038  84.470   8.641  1.00  0.83           O  
ATOM    426  N   ALA A  56      52.721  81.548   4.669  1.00  0.89           N  
ATOM    427  CA  ALA A  56      51.500  81.102   4.035  1.00  0.89           C  
ATOM    428  C   ALA A  56      51.448  79.607   3.694  1.00  0.89           C  
ATOM    429  O   ALA A  56      50.498  78.900   4.039  1.00  0.89           O  
ATOM    430  CB  ALA A  56      51.326  81.908   2.736  1.00  0.89           C  
ATOM    431  N   VAL A  57      52.501  79.063   3.046  1.00  0.86           N  
ATOM    432  CA  VAL A  57      52.593  77.650   2.698  1.00  0.86           C  
ATOM    433  C   VAL A  57      52.750  76.746   3.913  1.00  0.86           C  
ATOM    434  O   VAL A  57      52.151  75.671   3.981  1.00  0.86           O  
ATOM    435  CB  VAL A  57      53.639  77.349   1.619  1.00  0.86           C  
ATOM    436  CG1 VAL A  57      53.349  78.229   0.385  1.00  0.86           C  
ATOM    437  CG2 VAL A  57      55.091  77.575   2.094  1.00  0.86           C  
ATOM    438  N   LYS A  58      53.518  77.181   4.937  1.00  0.82           N  
ATOM    439  CA  LYS A  58      53.625  76.518   6.225  1.00  0.82           C  
ATOM    440  C   LYS A  58      52.310  76.508   7.000  1.00  0.82           C  
ATOM    441  O   LYS A  58      51.934  75.498   7.587  1.00  0.82           O  
ATOM    442  CB  LYS A  58      54.787  77.092   7.072  1.00  0.82           C  
ATOM    443  CG  LYS A  58      56.157  76.734   6.466  1.00  0.82           C  
ATOM    444  CD  LYS A  58      57.307  76.841   7.479  1.00  0.82           C  
ATOM    445  CE  LYS A  58      58.666  77.155   6.839  1.00  0.82           C  
ATOM    446  NZ  LYS A  58      59.022  76.168   5.806  1.00  0.82           N  
ATOM    447  N   LYS A  59      51.534  77.610   6.982  1.00  0.85           N  
ATOM    448  CA  LYS A  59      50.194  77.648   7.535  1.00  0.85           C  
ATOM    449  C   LYS A  59      49.194  76.738   6.818  1.00  0.85           C  
ATOM    450  O   LYS A  59      48.349  76.112   7.438  1.00  0.85           O  
ATOM    451  CB  LYS A  59      49.638  79.090   7.537  1.00  0.85           C  
ATOM    452  CG  LYS A  59      48.400  79.239   8.438  1.00  0.85           C  
ATOM    453  CD  LYS A  59      47.557  80.465   8.073  1.00  0.85           C  
ATOM    454  CE  LYS A  59      46.207  80.476   8.799  1.00  0.85           C  
ATOM    455  NZ  LYS A  59      45.185  81.154   7.972  1.00  0.85           N  
ATOM    456  N   ALA A  60      49.233  76.623   5.476  1.00  0.91           N  
ATOM    457  CA  ALA A  60      48.438  75.627   4.778  1.00  0.91           C  
ATOM    458  C   ALA A  60      48.829  74.187   5.093  1.00  0.91           C  
ATOM    459  O   ALA A  60      47.988  73.300   5.217  1.00  0.91           O  
ATOM    460  CB  ALA A  60      48.555  75.834   3.268  1.00  0.91           C  
ATOM    461  N   ARG A  61      50.146  73.938   5.236  1.00  0.83           N  
ATOM    462  CA  ARG A  61      50.716  72.674   5.655  1.00  0.83           C  
ATOM    463  C   ARG A  61      50.264  72.231   7.039  1.00  0.83           C  
ATOM    464  O   ARG A  61      49.935  71.062   7.226  1.00  0.83           O  
ATOM    465  CB  ARG A  61      52.255  72.779   5.616  1.00  0.83           C  
ATOM    466  CG  ARG A  61      53.009  71.518   6.058  1.00  0.83           C  
ATOM    467  CD  ARG A  61      54.499  71.671   5.787  1.00  0.83           C  
ATOM    468  NE  ARG A  61      55.117  70.413   6.244  1.00  0.83           N  
ATOM    469  CZ  ARG A  61      56.162  69.826   5.674  1.00  0.83           C  
ATOM    470  NH1 ARG A  61      56.777  70.373   4.638  1.00  0.83           N  
ATOM    471  NH2 ARG A  61      56.616  68.689   6.198  1.00  0.83           N  
ATOM    472  N   SER A  62      50.178  73.159   8.024  1.00  0.87           N  
ATOM    473  CA  SER A  62      49.781  72.891   9.411  1.00  0.87           C  
ATOM    474  C   SER A  62      48.406  72.239   9.531  1.00  0.87           C  
ATOM    475  O   SER A  62      48.196  71.319  10.319  1.00  0.87           O  
ATOM    476  CB  SER A  62      49.843  74.157  10.329  1.00  0.87           C  
ATOM    477  OG  SER A  62      48.769  75.081  10.136  1.00  0.87           O  
ATOM    478  N   PHE A  63      47.450  72.672   8.675  1.00  0.88           N  
ATOM    479  CA  PHE A  63      46.135  72.076   8.517  1.00  0.88           C  
ATOM    480  C   PHE A  63      46.177  70.625   8.056  1.00  0.88           C  
ATOM    481  O   PHE A  63      45.406  69.793   8.520  1.00  0.88           O  
ATOM    482  CB  PHE A  63      45.273  72.884   7.504  1.00  0.88           C  
ATOM    483  CG  PHE A  63      44.890  74.219   8.085  1.00  0.88           C  
ATOM    484  CD1 PHE A  63      45.286  75.425   7.488  1.00  0.88           C  
ATOM    485  CD2 PHE A  63      44.091  74.273   9.237  1.00  0.88           C  
ATOM    486  CE1 PHE A  63      44.878  76.658   8.014  1.00  0.88           C  
ATOM    487  CE2 PHE A  63      43.688  75.501   9.778  1.00  0.88           C  
ATOM    488  CZ  PHE A  63      44.071  76.697   9.159  1.00  0.88           C  
ATOM    489  N   LEU A  64      47.071  70.273   7.111  1.00  0.88           N  
ATOM    490  CA  LEU A  64      46.973  69.024   6.383  1.00  0.88           C  
ATOM    491  C   LEU A  64      47.974  67.974   6.821  1.00  0.88           C  
ATOM    492  O   LEU A  64      47.831  66.802   6.473  1.00  0.88           O  
ATOM    493  CB  LEU A  64      47.269  69.309   4.894  1.00  0.88           C  
ATOM    494  CG  LEU A  64      46.238  70.233   4.224  1.00  0.88           C  
ATOM    495  CD1 LEU A  64      46.769  70.793   2.901  1.00  0.88           C  
ATOM    496  CD2 LEU A  64      44.916  69.498   3.996  1.00  0.88           C  
ATOM    497  N   GLU A  65      49.018  68.342   7.591  1.00  0.83           N  
ATOM    498  CA  GLU A  65      50.095  67.434   7.951  1.00  0.83           C  
ATOM    499  C   GLU A  65      49.738  66.485   9.095  1.00  0.83           C  
ATOM    500  O   GLU A  65      50.268  66.562  10.205  1.00  0.83           O  
ATOM    501  CB  GLU A  65      51.442  68.175   8.183  1.00  0.83           C  
ATOM    502  CG  GLU A  65      52.660  67.202   8.111  1.00  0.83           C  
ATOM    503  CD  GLU A  65      54.045  67.825   8.194  1.00  0.83           C  
ATOM    504  OE1 GLU A  65      54.165  69.066   8.233  1.00  0.83           O  
ATOM    505  OE2 GLU A  65      55.045  67.050   8.207  1.00  0.83           O  
ATOM    506  N   PHE A  66      48.794  65.552   8.854  1.00  0.88           N  
ATOM    507  CA  PHE A  66      48.421  64.503   9.788  1.00  0.88           C  
ATOM    508  C   PHE A  66      49.470  63.402   9.891  1.00  0.88           C  
ATOM    509  O   PHE A  66      50.069  62.976   8.905  1.00  0.88           O  
ATOM    510  CB  PHE A  66      47.038  63.866   9.471  1.00  0.88           C  
ATOM    511  CG  PHE A  66      45.921  64.799   9.864  1.00  0.88           C  
ATOM    512  CD1 PHE A  66      45.554  65.869   9.035  1.00  0.88           C  
ATOM    513  CD2 PHE A  66      45.212  64.604  11.064  1.00  0.88           C  
ATOM    514  CE1 PHE A  66      44.502  66.719   9.388  1.00  0.88           C  
ATOM    515  CE2 PHE A  66      44.159  65.460  11.423  1.00  0.88           C  
ATOM    516  CZ  PHE A  66      43.798  66.513  10.576  1.00  0.88           C  
ATOM    517  N   ALA A  67      49.700  62.884  11.111  1.00  0.88           N  
ATOM    518  CA  ALA A  67      50.621  61.797  11.328  1.00  0.88           C  
ATOM    519  C   ALA A  67      50.256  61.040  12.592  1.00  0.88           C  
ATOM    520  O   ALA A  67      49.383  61.446  13.354  1.00  0.88           O  
ATOM    521  CB  ALA A  67      52.062  62.332  11.481  1.00  0.88           C  
ATOM    522  N   GLU A  68      50.958  59.912  12.819  1.00  0.81           N  
ATOM    523  CA  GLU A  68      51.017  59.232  14.091  1.00  0.81           C  
ATOM    524  C   GLU A  68      52.338  59.594  14.725  1.00  0.81           C  
ATOM    525  O   GLU A  68      53.319  59.794  14.002  1.00  0.81           O  
ATOM    526  CB  GLU A  68      51.014  57.688  13.966  1.00  0.81           C  
ATOM    527  CG  GLU A  68      49.721  57.098  13.365  1.00  0.81           C  
ATOM    528  CD  GLU A  68      49.694  55.587  13.515  1.00  0.81           C  
ATOM    529  OE1 GLU A  68      50.760  54.967  13.729  1.00  0.81           O  
ATOM    530  OE2 GLU A  68      48.611  54.991  13.325  1.00  0.81           O  
ATOM    531  N   ASP A  69      52.379  59.663  16.067  1.00  0.86           N  
ATOM    532  CA  ASP A  69      53.601  59.755  16.832  1.00  0.86           C  
ATOM    533  C   ASP A  69      53.458  58.949  18.133  1.00  0.86           C  
ATOM    534  O   ASP A  69      52.473  59.070  18.866  1.00  0.86           O  
ATOM    535  CB  ASP A  69      53.930  61.252  17.062  1.00  0.86           C  
ATOM    536  CG  ASP A  69      55.348  61.459  17.548  1.00  0.86           C  
ATOM    537  OD1 ASP A  69      56.210  60.625  17.174  1.00  0.86           O  
ATOM    538  OD2 ASP A  69      55.581  62.465  18.264  1.00  0.86           O  
ATOM    539  N   VAL A  70      54.433  58.061  18.428  1.00  0.89           N  
ATOM    540  CA  VAL A  70      54.466  57.207  19.612  1.00  0.89           C  
ATOM    541  C   VAL A  70      55.298  57.836  20.710  1.00  0.89           C  
ATOM    542  O   VAL A  70      56.487  58.098  20.551  1.00  0.89           O  
ATOM    543  CB  VAL A  70      55.071  55.819  19.363  1.00  0.89           C  
ATOM    544  CG1 VAL A  70      55.000  54.964  20.655  1.00  0.89           C  
ATOM    545  CG2 VAL A  70      54.315  55.110  18.219  1.00  0.89           C  
ATOM    546  N   ILE A  71      54.711  58.034  21.901  1.00  0.90           N  
ATOM    547  CA  ILE A  71      55.437  58.531  23.052  1.00  0.90           C  
ATOM    548  C   ILE A  71      55.457  57.393  24.050  1.00  0.90           C  
ATOM    549  O   ILE A  71      54.441  56.752  24.306  1.00  0.90           O  
ATOM    550  CB  ILE A  71      54.820  59.804  23.639  1.00  0.90           C  
ATOM    551  CG1 ILE A  71      55.128  61.070  22.783  1.00  0.90           C  
ATOM    552  CG2 ILE A  71      55.366  60.074  25.062  1.00  0.90           C  
ATOM    553  CD1 ILE A  71      54.423  61.208  21.424  1.00  0.90           C  
ATOM    554  N   GLN A  72      56.635  57.078  24.619  1.00  0.88           N  
ATOM    555  CA  GLN A  72      56.793  56.025  25.596  1.00  0.88           C  
ATOM    556  C   GLN A  72      56.583  56.566  26.992  1.00  0.88           C  
ATOM    557  O   GLN A  72      57.254  57.500  27.429  1.00  0.88           O  
ATOM    558  CB  GLN A  72      58.199  55.400  25.468  1.00  0.88           C  
ATOM    559  CG  GLN A  72      58.399  54.717  24.098  1.00  0.88           C  
ATOM    560  CD  GLN A  72      57.478  53.504  23.947  1.00  0.88           C  
ATOM    561  OE1 GLN A  72      57.043  52.871  24.904  1.00  0.88           O  
ATOM    562  NE2 GLN A  72      57.127  53.173  22.683  1.00  0.88           N  
ATOM    563  N   VAL A  73      55.614  56.004  27.730  1.00  0.92           N  
ATOM    564  CA  VAL A  73      55.260  56.469  29.055  1.00  0.92           C  
ATOM    565  C   VAL A  73      55.665  55.383  30.034  1.00  0.92           C  
ATOM    566  O   VAL A  73      55.241  54.243  29.846  1.00  0.92           O  
ATOM    567  CB  VAL A  73      53.773  56.755  29.163  1.00  0.92           C  
ATOM    568  CG1 VAL A  73      53.365  57.105  30.614  1.00  0.92           C  
ATOM    569  CG2 VAL A  73      53.503  57.956  28.234  1.00  0.92           C  
ATOM    570  N   PRO A  74      56.469  55.622  31.069  1.00  0.89           N  
ATOM    571  CA  PRO A  74      56.736  54.662  32.134  1.00  0.89           C  
ATOM    572  C   PRO A  74      55.461  54.081  32.747  1.00  0.89           C  
ATOM    573  O   PRO A  74      54.571  54.846  33.123  1.00  0.89           O  
ATOM    574  CB  PRO A  74      57.596  55.454  33.142  1.00  0.89           C  
ATOM    575  CG  PRO A  74      58.279  56.533  32.293  1.00  0.89           C  
ATOM    576  CD  PRO A  74      57.213  56.861  31.249  1.00  0.89           C  
ATOM    577  N   ARG A  75      55.341  52.738  32.859  1.00  0.81           N  
ATOM    578  CA  ARG A  75      54.123  52.018  33.216  1.00  0.81           C  
ATOM    579  C   ARG A  75      53.483  52.440  34.538  1.00  0.81           C  
ATOM    580  O   ARG A  75      52.259  52.502  34.662  1.00  0.81           O  
ATOM    581  CB  ARG A  75      54.348  50.480  33.198  1.00  0.81           C  
ATOM    582  CG  ARG A  75      53.070  49.689  33.590  1.00  0.81           C  
ATOM    583  CD  ARG A  75      53.007  48.194  33.244  1.00  0.81           C  
ATOM    584  NE  ARG A  75      53.299  48.062  31.761  1.00  0.81           N  
ATOM    585  CZ  ARG A  75      54.296  47.353  31.206  1.00  0.81           C  
ATOM    586  NH1 ARG A  75      55.163  46.692  31.962  1.00  0.81           N  
ATOM    587  NH2 ARG A  75      54.438  47.297  29.881  1.00  0.81           N  
ATOM    588  N   ASN A  76      54.322  52.812  35.530  1.00  0.79           N  
ATOM    589  CA  ASN A  76      53.982  53.357  36.835  1.00  0.79           C  
ATOM    590  C   ASN A  76      53.080  54.587  36.730  1.00  0.79           C  
ATOM    591  O   ASN A  76      52.213  54.818  37.570  1.00  0.79           O  
ATOM    592  CB  ASN A  76      55.272  53.715  37.665  1.00  0.79           C  
ATOM    593  CG  ASN A  76      56.335  54.495  36.881  1.00  0.79           C  
ATOM    594  OD1 ASN A  76      56.810  54.050  35.846  1.00  0.79           O  
ATOM    595  ND2 ASN A  76      56.755  55.683  37.381  1.00  0.79           N  
ATOM    596  N   LEU A  77      53.265  55.413  35.679  1.00  0.79           N  
ATOM    597  CA  LEU A  77      52.521  56.639  35.528  1.00  0.79           C  
ATOM    598  C   LEU A  77      51.384  56.518  34.547  1.00  0.79           C  
ATOM    599  O   LEU A  77      50.683  57.500  34.334  1.00  0.79           O  
ATOM    600  CB  LEU A  77      53.418  57.793  35.032  1.00  0.79           C  
ATOM    601  CG  LEU A  77      54.623  58.058  35.948  1.00  0.79           C  
ATOM    602  CD1 LEU A  77      55.520  59.138  35.331  1.00  0.79           C  
ATOM    603  CD2 LEU A  77      54.217  58.432  37.386  1.00  0.79           C  
ATOM    604  N   VAL A  78      51.115  55.342  33.934  1.00  0.81           N  
ATOM    605  CA  VAL A  78      50.009  55.223  32.985  1.00  0.81           C  
ATOM    606  C   VAL A  78      48.664  55.464  33.630  1.00  0.81           C  
ATOM    607  O   VAL A  78      47.898  56.303  33.182  1.00  0.81           O  
ATOM    608  CB  VAL A  78      49.994  53.877  32.284  1.00  0.81           C  
ATOM    609  CG1 VAL A  78      48.750  53.677  31.379  1.00  0.81           C  
ATOM    610  CG2 VAL A  78      51.259  53.839  31.418  1.00  0.81           C  
ATOM    611  N   GLY A  79      48.380  54.806  34.776  1.00  0.84           N  
ATOM    612  CA  GLY A  79      47.159  55.066  35.536  1.00  0.84           C  
ATOM    613  C   GLY A  79      47.066  56.474  36.090  1.00  0.84           C  
ATOM    614  O   GLY A  79      45.989  57.036  36.237  1.00  0.84           O  
ATOM    615  N   LYS A  80      48.228  57.090  36.392  1.00  0.75           N  
ATOM    616  CA  LYS A  80      48.328  58.479  36.807  1.00  0.75           C  
ATOM    617  C   LYS A  80      48.032  59.494  35.702  1.00  0.75           C  
ATOM    618  O   LYS A  80      47.294  60.448  35.930  1.00  0.75           O  
ATOM    619  CB  LYS A  80      49.750  58.796  37.349  1.00  0.75           C  
ATOM    620  CG  LYS A  80      50.257  57.892  38.488  1.00  0.75           C  
ATOM    621  CD  LYS A  80      49.382  57.967  39.754  1.00  0.75           C  
ATOM    622  CE  LYS A  80      49.911  57.147  40.936  1.00  0.75           C  
ATOM    623  NZ  LYS A  80      51.103  57.810  41.510  1.00  0.75           N  
ATOM    624  N   VAL A  81      48.597  59.320  34.480  1.00  0.83           N  
ATOM    625  CA  VAL A  81      48.431  60.234  33.350  1.00  0.83           C  
ATOM    626  C   VAL A  81      47.128  60.019  32.617  1.00  0.83           C  
ATOM    627  O   VAL A  81      46.572  60.927  32.004  1.00  0.83           O  
ATOM    628  CB  VAL A  81      49.599  60.168  32.365  1.00  0.83           C  
ATOM    629  CG1 VAL A  81      49.570  58.880  31.513  1.00  0.83           C  
ATOM    630  CG2 VAL A  81      49.618  61.437  31.480  1.00  0.83           C  
ATOM    631  N   ILE A  82      46.532  58.812  32.737  1.00  0.85           N  
ATOM    632  CA  ILE A  82      45.147  58.564  32.380  1.00  0.85           C  
ATOM    633  C   ILE A  82      44.282  59.476  33.242  1.00  0.85           C  
ATOM    634  O   ILE A  82      43.360  60.134  32.763  1.00  0.85           O  
ATOM    635  CB  ILE A  82      44.823  57.063  32.501  1.00  0.85           C  
ATOM    636  CG1 ILE A  82      45.446  56.309  31.294  1.00  0.85           C  
ATOM    637  CG2 ILE A  82      43.307  56.777  32.579  1.00  0.85           C  
ATOM    638  CD1 ILE A  82      45.314  54.780  31.383  1.00  0.85           C  
ATOM    639  N   GLY A  83      44.658  59.627  34.532  1.00  0.89           N  
ATOM    640  CA  GLY A  83      43.970  60.460  35.495  1.00  0.89           C  
ATOM    641  C   GLY A  83      42.805  59.716  36.044  1.00  0.89           C  
ATOM    642  O   GLY A  83      42.608  58.541  35.748  1.00  0.89           O  
ATOM    643  N   LYS A  84      41.967  60.361  36.875  1.00  0.81           N  
ATOM    644  CA  LYS A  84      40.740  59.721  37.315  1.00  0.81           C  
ATOM    645  C   LYS A  84      39.786  59.352  36.175  1.00  0.81           C  
ATOM    646  O   LYS A  84      39.047  60.177  35.649  1.00  0.81           O  
ATOM    647  CB  LYS A  84      39.991  60.583  38.363  1.00  0.81           C  
ATOM    648  CG  LYS A  84      38.667  59.980  38.882  1.00  0.81           C  
ATOM    649  CD  LYS A  84      38.815  58.561  39.461  1.00  0.81           C  
ATOM    650  CE  LYS A  84      37.641  58.154  40.357  1.00  0.81           C  
ATOM    651  NZ  LYS A  84      37.986  56.925  41.106  1.00  0.81           N  
ATOM    652  N   ASN A  85      39.821  58.059  35.792  1.00  0.76           N  
ATOM    653  CA  ASN A  85      39.046  57.415  34.754  1.00  0.76           C  
ATOM    654  C   ASN A  85      39.141  58.102  33.395  1.00  0.76           C  
ATOM    655  O   ASN A  85      38.140  58.390  32.749  1.00  0.76           O  
ATOM    656  CB  ASN A  85      37.583  57.167  35.194  1.00  0.76           C  
ATOM    657  CG  ASN A  85      37.564  56.322  36.463  1.00  0.76           C  
ATOM    658  OD1 ASN A  85      38.539  55.757  36.950  1.00  0.76           O  
ATOM    659  ND2 ASN A  85      36.359  56.221  37.067  1.00  0.76           N  
ATOM    660  N   GLY A  86      40.378  58.383  32.929  1.00  0.86           N  
ATOM    661  CA  GLY A  86      40.635  58.939  31.605  1.00  0.86           C  
ATOM    662  C   GLY A  86      40.525  60.422  31.507  1.00  0.86           C  
ATOM    663  O   GLY A  86      40.809  60.970  30.448  1.00  0.86           O  
ATOM    664  N   LYS A  87      40.183  61.114  32.614  1.00  0.85           N  
ATOM    665  CA  LYS A  87      39.980  62.551  32.668  1.00  0.85           C  
ATOM    666  C   LYS A  87      41.147  63.353  32.130  1.00  0.85           C  
ATOM    667  O   LYS A  87      41.002  64.195  31.256  1.00  0.85           O  
ATOM    668  CB  LYS A  87      39.767  62.968  34.155  1.00  0.85           C  
ATOM    669  CG  LYS A  87      39.692  64.488  34.416  1.00  0.85           C  
ATOM    670  CD  LYS A  87      39.540  64.835  35.909  1.00  0.85           C  
ATOM    671  CE  LYS A  87      39.413  66.344  36.195  1.00  0.85           C  
ATOM    672  NZ  LYS A  87      40.605  67.094  35.747  1.00  0.85           N  
ATOM    673  N   LEU A  88      42.354  63.067  32.634  1.00  0.89           N  
ATOM    674  CA  LEU A  88      43.529  63.840  32.353  1.00  0.89           C  
ATOM    675  C   LEU A  88      44.054  63.672  30.949  1.00  0.89           C  
ATOM    676  O   LEU A  88      44.363  64.631  30.248  1.00  0.89           O  
ATOM    677  CB  LEU A  88      44.591  63.383  33.355  1.00  0.89           C  
ATOM    678  CG  LEU A  88      45.867  64.213  33.294  1.00  0.89           C  
ATOM    679  CD1 LEU A  88      45.547  65.702  33.453  1.00  0.89           C  
ATOM    680  CD2 LEU A  88      46.815  63.764  34.402  1.00  0.89           C  
ATOM    681  N   ASN A  89      44.123  62.418  30.474  1.00  0.88           N  
ATOM    682  CA  ASN A  89      44.480  62.143  29.109  1.00  0.88           C  
ATOM    683  C   ASN A  89      43.432  62.690  28.131  1.00  0.88           C  
ATOM    684  O   ASN A  89      43.794  63.291  27.130  1.00  0.88           O  
ATOM    685  CB  ASN A  89      44.752  60.633  28.968  1.00  0.88           C  
ATOM    686  CG  ASN A  89      45.388  60.346  27.624  1.00  0.88           C  
ATOM    687  OD1 ASN A  89      46.244  61.063  27.115  1.00  0.88           O  
ATOM    688  ND2 ASN A  89      44.971  59.213  27.024  1.00  0.88           N  
ATOM    689  N   GLN A  90      42.113  62.568  28.432  1.00  0.86           N  
ATOM    690  CA  GLN A  90      41.049  63.171  27.640  1.00  0.86           C  
ATOM    691  C   GLN A  90      41.211  64.690  27.530  1.00  0.86           C  
ATOM    692  O   GLN A  90      41.237  65.231  26.430  1.00  0.86           O  
ATOM    693  CB  GLN A  90      39.655  62.821  28.247  1.00  0.86           C  
ATOM    694  CG  GLN A  90      38.437  63.328  27.434  1.00  0.86           C  
ATOM    695  CD  GLN A  90      38.483  62.766  26.014  1.00  0.86           C  
ATOM    696  OE1 GLN A  90      38.368  61.552  25.819  1.00  0.86           O  
ATOM    697  NE2 GLN A  90      38.677  63.634  25.002  1.00  0.86           N  
ATOM    698  N   GLU A  91      41.469  65.394  28.663  1.00  0.86           N  
ATOM    699  CA  GLU A  91      41.760  66.824  28.681  1.00  0.86           C  
ATOM    700  C   GLU A  91      42.984  67.188  27.846  1.00  0.86           C  
ATOM    701  O   GLU A  91      42.990  68.216  27.162  1.00  0.86           O  
ATOM    702  CB  GLU A  91      42.027  67.340  30.124  1.00  0.86           C  
ATOM    703  CG  GLU A  91      40.781  67.364  31.041  1.00  0.86           C  
ATOM    704  CD  GLU A  91      41.093  67.481  32.524  1.00  0.86           C  
ATOM    705  OE1 GLU A  91      42.264  67.504  32.979  1.00  0.86           O  
ATOM    706  OE2 GLU A  91      40.092  67.509  33.288  1.00  0.86           O  
ATOM    707  N   ILE A  92      44.053  66.351  27.864  1.00  0.87           N  
ATOM    708  CA  ILE A  92      45.222  66.496  26.999  1.00  0.87           C  
ATOM    709  C   ILE A  92      44.874  66.446  25.524  1.00  0.87           C  
ATOM    710  O   ILE A  92      45.277  67.345  24.794  1.00  0.87           O  
ATOM    711  CB  ILE A  92      46.342  65.473  27.288  1.00  0.87           C  
ATOM    712  CG1 ILE A  92      47.016  65.839  28.633  1.00  0.87           C  
ATOM    713  CG2 ILE A  92      47.391  65.355  26.132  1.00  0.87           C  
ATOM    714  CD1 ILE A  92      48.024  64.788  29.117  1.00  0.87           C  
ATOM    715  N   VAL A  93      44.095  65.433  25.048  1.00  0.90           N  
ATOM    716  CA  VAL A  93      43.712  65.343  23.637  1.00  0.90           C  
ATOM    717  C   VAL A  93      42.848  66.515  23.200  1.00  0.90           C  
ATOM    718  O   VAL A  93      43.093  67.116  22.155  1.00  0.90           O  
ATOM    719  CB  VAL A  93      43.118  63.989  23.156  1.00  0.90           C  
ATOM    720  CG1 VAL A  93      43.554  62.807  24.036  1.00  0.90           C  
ATOM    721  CG2 VAL A  93      41.584  63.964  22.956  1.00  0.90           C  
ATOM    722  N   ASP A  94      41.859  66.902  24.038  1.00  0.90           N  
ATOM    723  CA  ASP A  94      40.949  67.998  23.783  1.00  0.90           C  
ATOM    724  C   ASP A  94      41.641  69.360  23.729  1.00  0.90           C  
ATOM    725  O   ASP A  94      41.373  70.184  22.858  1.00  0.90           O  
ATOM    726  CB  ASP A  94      39.832  68.011  24.870  1.00  0.90           C  
ATOM    727  CG  ASP A  94      38.877  66.843  24.695  1.00  0.90           C  
ATOM    728  OD1 ASP A  94      38.825  66.255  23.588  1.00  0.90           O  
ATOM    729  OD2 ASP A  94      38.183  66.500  25.687  1.00  0.90           O  
ATOM    730  N   LYS A  95      42.577  69.642  24.663  1.00  0.86           N  
ATOM    731  CA  LYS A  95      43.364  70.863  24.629  1.00  0.86           C  
ATOM    732  C   LYS A  95      44.385  70.930  23.504  1.00  0.86           C  
ATOM    733  O   LYS A  95      44.566  71.980  22.887  1.00  0.86           O  
ATOM    734  CB  LYS A  95      44.089  71.117  25.973  1.00  0.86           C  
ATOM    735  CG  LYS A  95      44.865  72.454  25.990  1.00  0.86           C  
ATOM    736  CD  LYS A  95      44.632  73.274  27.265  1.00  0.86           C  
ATOM    737  CE  LYS A  95      43.445  74.234  27.089  1.00  0.86           C  
ATOM    738  NZ  LYS A  95      43.019  74.768  28.399  1.00  0.86           N  
ATOM    739  N   SER A  96      45.102  69.821  23.219  1.00  0.87           N  
ATOM    740  CA  SER A  96      46.104  69.759  22.163  1.00  0.87           C  
ATOM    741  C   SER A  96      45.537  69.966  20.777  1.00  0.87           C  
ATOM    742  O   SER A  96      46.175  70.589  19.930  1.00  0.87           O  
ATOM    743  CB  SER A  96      46.924  68.437  22.171  1.00  0.87           C  
ATOM    744  OG  SER A  96      46.147  67.275  21.891  1.00  0.87           O  
ATOM    745  N   GLY A  97      44.321  69.420  20.546  1.00  0.92           N  
ATOM    746  CA  GLY A  97      43.639  69.380  19.268  1.00  0.92           C  
ATOM    747  C   GLY A  97      44.000  68.151  18.472  1.00  0.92           C  
ATOM    748  O   GLY A  97      43.747  68.086  17.271  1.00  0.92           O  
ATOM    749  N   VAL A  98      44.646  67.126  19.080  1.00  0.88           N  
ATOM    750  CA  VAL A  98      44.829  65.827  18.413  1.00  0.88           C  
ATOM    751  C   VAL A  98      43.488  65.141  18.142  1.00  0.88           C  
ATOM    752  O   VAL A  98      42.472  65.417  18.771  1.00  0.88           O  
ATOM    753  CB  VAL A  98      45.789  64.809  19.067  1.00  0.88           C  
ATOM    754  CG1 VAL A  98      47.202  65.369  19.327  1.00  0.88           C  
ATOM    755  CG2 VAL A  98      45.176  64.296  20.371  1.00  0.88           C  
ATOM    756  N   VAL A  99      43.430  64.212  17.170  1.00  0.93           N  
ATOM    757  CA  VAL A  99      42.218  63.456  16.904  1.00  0.93           C  
ATOM    758  C   VAL A  99      41.987  62.440  18.001  1.00  0.93           C  
ATOM    759  O   VAL A  99      40.879  62.236  18.484  1.00  0.93           O  
ATOM    760  CB  VAL A  99      42.329  62.739  15.560  1.00  0.93           C  
ATOM    761  CG1 VAL A  99      41.111  61.821  15.298  1.00  0.93           C  
ATOM    762  CG2 VAL A  99      42.441  63.821  14.466  1.00  0.93           C  
ATOM    763  N   ARG A 100      43.064  61.750  18.413  1.00  0.85           N  
ATOM    764  CA  ARG A 100      42.965  60.769  19.455  1.00  0.85           C  
ATOM    765  C   ARG A 100      44.347  60.461  19.950  1.00  0.85           C  
ATOM    766  O   ARG A 100      45.350  60.816  19.321  1.00  0.85           O  
ATOM    767  CB  ARG A 100      42.301  59.441  18.966  1.00  0.85           C  
ATOM    768  CG  ARG A 100      43.106  58.679  17.881  1.00  0.85           C  
ATOM    769  CD  ARG A 100      42.485  57.355  17.420  1.00  0.85           C  
ATOM    770  NE  ARG A 100      41.191  57.689  16.726  1.00  0.85           N  
ATOM    771  CZ  ARG A 100      41.064  58.073  15.446  1.00  0.85           C  
ATOM    772  NH1 ARG A 100      42.105  58.118  14.624  1.00  0.85           N  
ATOM    773  NH2 ARG A 100      39.871  58.450  14.985  1.00  0.85           N  
ATOM    774  N   VAL A 101      44.419  59.727  21.063  1.00  0.90           N  
ATOM    775  CA  VAL A 101      45.584  58.981  21.457  1.00  0.90           C  
ATOM    776  C   VAL A 101      45.120  57.554  21.651  1.00  0.90           C  
ATOM    777  O   VAL A 101      43.969  57.325  22.036  1.00  0.90           O  
ATOM    778  CB  VAL A 101      46.206  59.543  22.726  1.00  0.90           C  
ATOM    779  CG1 VAL A 101      45.226  59.503  23.911  1.00  0.90           C  
ATOM    780  CG2 VAL A 101      47.544  58.854  23.081  1.00  0.90           C  
ATOM    781  N   ARG A 102      45.966  56.550  21.371  1.00  0.83           N  
ATOM    782  CA  ARG A 102      45.711  55.182  21.783  1.00  0.83           C  
ATOM    783  C   ARG A 102      46.802  54.762  22.730  1.00  0.83           C  
ATOM    784  O   ARG A 102      47.987  54.973  22.486  1.00  0.83           O  
ATOM    785  CB  ARG A 102      45.623  54.142  20.632  1.00  0.83           C  
ATOM    786  CG  ARG A 102      45.446  54.720  19.217  1.00  0.83           C  
ATOM    787  CD  ARG A 102      45.464  53.588  18.188  1.00  0.83           C  
ATOM    788  NE  ARG A 102      45.553  54.205  16.827  1.00  0.83           N  
ATOM    789  CZ  ARG A 102      46.704  54.341  16.153  1.00  0.83           C  
ATOM    790  NH1 ARG A 102      47.854  53.822  16.557  1.00  0.83           N  
ATOM    791  NH2 ARG A 102      46.672  54.983  14.989  1.00  0.83           N  
ATOM    792  N   ILE A 103      46.422  54.159  23.857  1.00  0.88           N  
ATOM    793  CA  ILE A 103      47.355  53.670  24.840  1.00  0.88           C  
ATOM    794  C   ILE A 103      47.408  52.182  24.623  1.00  0.88           C  
ATOM    795  O   ILE A 103      46.394  51.496  24.747  1.00  0.88           O  
ATOM    796  CB  ILE A 103      46.835  53.995  26.227  1.00  0.88           C  
ATOM    797  CG1 ILE A 103      46.679  55.524  26.399  1.00  0.88           C  
ATOM    798  CG2 ILE A 103      47.779  53.420  27.307  1.00  0.88           C  
ATOM    799  CD1 ILE A 103      45.742  55.857  27.560  1.00  0.88           C  
ATOM    800  N   GLU A 104      48.577  51.651  24.228  1.00  0.80           N  
ATOM    801  CA  GLU A 104      48.651  50.313  23.692  1.00  0.80           C  
ATOM    802  C   GLU A 104      49.370  49.401  24.665  1.00  0.80           C  
ATOM    803  O   GLU A 104      50.511  49.617  25.068  1.00  0.80           O  
ATOM    804  CB  GLU A 104      49.262  50.329  22.266  1.00  0.80           C  
ATOM    805  CG  GLU A 104      48.420  51.222  21.304  1.00  0.80           C  
ATOM    806  CD  GLU A 104      48.842  51.185  19.837  1.00  0.80           C  
ATOM    807  OE1 GLU A 104      49.958  50.702  19.538  1.00  0.80           O  
ATOM    808  OE2 GLU A 104      48.054  51.698  18.991  1.00  0.80           O  
ATOM    809  N   ALA A 105      48.676  48.340  25.115  1.00  0.79           N  
ATOM    810  CA  ALA A 105      49.248  47.344  25.982  1.00  0.79           C  
ATOM    811  C   ALA A 105      49.484  46.116  25.140  1.00  0.79           C  
ATOM    812  O   ALA A 105      48.570  45.518  24.573  1.00  0.79           O  
ATOM    813  CB  ALA A 105      48.328  47.043  27.185  1.00  0.79           C  
ATOM    814  N   GLU A 106      50.758  45.745  25.002  1.00  0.71           N  
ATOM    815  CA  GLU A 106      51.189  44.675  24.157  1.00  0.71           C  
ATOM    816  C   GLU A 106      51.151  43.380  24.959  1.00  0.71           C  
ATOM    817  O   GLU A 106      51.266  43.379  26.183  1.00  0.71           O  
ATOM    818  CB  GLU A 106      52.614  45.010  23.661  1.00  0.71           C  
ATOM    819  CG  GLU A 106      52.804  46.504  23.277  1.00  0.71           C  
ATOM    820  CD  GLU A 106      54.283  46.764  23.069  1.00  0.71           C  
ATOM    821  OE1 GLU A 106      54.872  46.003  22.265  1.00  0.71           O  
ATOM    822  OE2 GLU A 106      54.820  47.701  23.714  1.00  0.71           O  
ATOM    823  N   ASN A 107      50.955  42.215  24.305  1.00  0.68           N  
ATOM    824  CA  ASN A 107      51.258  40.928  24.927  1.00  0.68           C  
ATOM    825  C   ASN A 107      52.754  40.758  25.153  1.00  0.68           C  
ATOM    826  O   ASN A 107      53.560  41.178  24.330  1.00  0.68           O  
ATOM    827  CB  ASN A 107      50.723  39.723  24.070  1.00  0.68           C  
ATOM    828  CG  ASN A 107      50.627  38.375  24.798  1.00  0.68           C  
ATOM    829  OD1 ASN A 107      51.553  37.559  24.835  1.00  0.68           O  
ATOM    830  ND2 ASN A 107      49.435  38.064  25.357  1.00  0.68           N  
ATOM    831  N   GLU A 108      53.138  40.060  26.240  1.00  0.63           N  
ATOM    832  CA  GLU A 108      54.489  39.800  26.691  1.00  0.63           C  
ATOM    833  C   GLU A 108      55.422  39.246  25.617  1.00  0.63           C  
ATOM    834  O   GLU A 108      56.617  39.518  25.564  1.00  0.63           O  
ATOM    835  CB  GLU A 108      54.331  38.783  27.833  1.00  0.63           C  
ATOM    836  CG  GLU A 108      55.631  38.523  28.616  1.00  0.63           C  
ATOM    837  CD  GLU A 108      55.281  38.046  30.016  1.00  0.63           C  
ATOM    838  OE1 GLU A 108      54.600  36.993  30.114  1.00  0.63           O  
ATOM    839  OE2 GLU A 108      55.653  38.757  30.984  1.00  0.63           O  
ATOM    840  N   LYS A 109      54.834  38.469  24.686  1.00  0.65           N  
ATOM    841  CA  LYS A 109      55.514  37.822  23.591  1.00  0.65           C  
ATOM    842  C   LYS A 109      55.891  38.728  22.418  1.00  0.65           C  
ATOM    843  O   LYS A 109      56.613  38.292  21.525  1.00  0.65           O  
ATOM    844  CB  LYS A 109      54.621  36.689  23.028  1.00  0.65           C  
ATOM    845  CG  LYS A 109      54.205  35.669  24.101  1.00  0.65           C  
ATOM    846  CD  LYS A 109      53.590  34.395  23.490  1.00  0.65           C  
ATOM    847  CE  LYS A 109      52.221  34.578  22.822  1.00  0.65           C  
ATOM    848  NZ  LYS A 109      51.219  34.864  23.868  1.00  0.65           N  
ATOM    849  N   ASN A 110      55.379  39.977  22.338  1.00  0.65           N  
ATOM    850  CA  ASN A 110      55.616  40.850  21.196  1.00  0.65           C  
ATOM    851  C   ASN A 110      57.099  41.245  21.067  1.00  0.65           C  
ATOM    852  O   ASN A 110      57.757  41.601  22.037  1.00  0.65           O  
ATOM    853  CB  ASN A 110      54.658  42.078  21.217  1.00  0.65           C  
ATOM    854  CG  ASN A 110      53.212  41.612  21.034  1.00  0.65           C  
ATOM    855  OD1 ASN A 110      52.864  40.443  20.882  1.00  0.65           O  
ATOM    856  ND2 ASN A 110      52.290  42.602  20.998  1.00  0.65           N  
ATOM    857  N   VAL A 111      57.690  41.132  19.852  1.00  0.65           N  
ATOM    858  CA  VAL A 111      59.116  41.407  19.636  1.00  0.65           C  
ATOM    859  C   VAL A 111      59.587  42.846  19.891  1.00  0.65           C  
ATOM    860  O   VAL A 111      60.581  42.991  20.606  1.00  0.65           O  
ATOM    861  CB  VAL A 111      59.553  40.942  18.230  1.00  0.65           C  
ATOM    862  CG1 VAL A 111      60.809  41.660  17.662  1.00  0.65           C  
ATOM    863  CG2 VAL A 111      59.811  39.425  18.249  1.00  0.65           C  
ATOM    864  N   PRO A 112      58.996  43.937  19.391  1.00  0.69           N  
ATOM    865  CA  PRO A 112      59.591  45.248  19.578  1.00  0.69           C  
ATOM    866  C   PRO A 112      58.883  45.956  20.704  1.00  0.69           C  
ATOM    867  O   PRO A 112      57.729  46.329  20.537  1.00  0.69           O  
ATOM    868  CB  PRO A 112      59.354  45.967  18.235  1.00  0.69           C  
ATOM    869  CG  PRO A 112      58.091  45.321  17.641  1.00  0.69           C  
ATOM    870  CD  PRO A 112      58.028  43.934  18.291  1.00  0.69           C  
ATOM    871  N   GLN A 113      59.559  46.207  21.834  1.00  0.70           N  
ATOM    872  CA  GLN A 113      58.917  46.851  22.951  1.00  0.70           C  
ATOM    873  C   GLN A 113      60.003  47.450  23.811  1.00  0.70           C  
ATOM    874  O   GLN A 113      61.143  46.980  23.811  1.00  0.70           O  
ATOM    875  CB  GLN A 113      58.030  45.854  23.757  1.00  0.70           C  
ATOM    876  CG  GLN A 113      58.752  44.566  24.240  1.00  0.70           C  
ATOM    877  CD  GLN A 113      57.770  43.539  24.822  1.00  0.70           C  
ATOM    878  OE1 GLN A 113      56.605  43.782  25.095  1.00  0.70           O  
ATOM    879  NE2 GLN A 113      58.289  42.302  25.026  1.00  0.70           N  
ATOM    880  N   GLU A 114      59.690  48.526  24.552  1.00  0.75           N  
ATOM    881  CA  GLU A 114      60.631  49.169  25.442  1.00  0.75           C  
ATOM    882  C   GLU A 114      60.322  48.770  26.882  1.00  0.75           C  
ATOM    883  O   GLU A 114      59.189  48.861  27.361  1.00  0.75           O  
ATOM    884  CB  GLU A 114      60.630  50.704  25.253  1.00  0.75           C  
ATOM    885  CG  GLU A 114      61.054  51.125  23.821  1.00  0.75           C  
ATOM    886  CD  GLU A 114      61.329  52.619  23.711  1.00  0.75           C  
ATOM    887  OE1 GLU A 114      61.940  53.182  24.653  1.00  0.75           O  
ATOM    888  OE2 GLU A 114      60.927  53.205  22.672  1.00  0.75           O  
ATOM    889  N   GLU A 115      61.337  48.268  27.619  1.00  0.72           N  
ATOM    890  CA  GLU A 115      61.246  47.877  29.016  1.00  0.72           C  
ATOM    891  C   GLU A 115      60.715  48.948  29.956  1.00  0.72           C  
ATOM    892  O   GLU A 115      61.212  50.064  30.044  1.00  0.72           O  
ATOM    893  CB  GLU A 115      62.621  47.439  29.560  1.00  0.72           C  
ATOM    894  CG  GLU A 115      62.971  45.956  29.291  1.00  0.72           C  
ATOM    895  CD  GLU A 115      64.325  45.592  29.897  1.00  0.72           C  
ATOM    896  OE1 GLU A 115      65.014  46.503  30.421  1.00  0.72           O  
ATOM    897  OE2 GLU A 115      64.660  44.383  29.844  1.00  0.72           O  
ATOM    898  N   GLY A 116      59.657  48.604  30.718  1.00  0.83           N  
ATOM    899  CA  GLY A 116      59.051  49.515  31.679  1.00  0.83           C  
ATOM    900  C   GLY A 116      58.113  50.525  31.074  1.00  0.83           C  
ATOM    901  O   GLY A 116      57.509  51.307  31.801  1.00  0.83           O  
ATOM    902  N   MET A 117      57.936  50.518  29.740  1.00  0.84           N  
ATOM    903  CA  MET A 117      57.256  51.568  29.025  1.00  0.84           C  
ATOM    904  C   MET A 117      55.932  51.076  28.465  1.00  0.84           C  
ATOM    905  O   MET A 117      55.664  49.878  28.326  1.00  0.84           O  
ATOM    906  CB  MET A 117      58.164  52.126  27.894  1.00  0.84           C  
ATOM    907  CG  MET A 117      59.558  52.611  28.353  1.00  0.84           C  
ATOM    908  SD  MET A 117      59.480  54.102  29.378  1.00  0.84           S  
ATOM    909  CE  MET A 117      60.996  53.751  30.311  1.00  0.84           C  
ATOM    910  N   VAL A 118      55.024  52.026  28.206  1.00  0.91           N  
ATOM    911  CA  VAL A 118      53.749  51.824  27.559  1.00  0.91           C  
ATOM    912  C   VAL A 118      53.670  52.821  26.406  1.00  0.91           C  
ATOM    913  O   VAL A 118      53.845  54.017  26.659  1.00  0.91           O  
ATOM    914  CB  VAL A 118      52.614  52.065  28.547  1.00  0.91           C  
ATOM    915  CG1 VAL A 118      51.234  52.036  27.850  1.00  0.91           C  
ATOM    916  CG2 VAL A 118      52.713  50.953  29.619  1.00  0.91           C  
ATOM    917  N   PRO A 119      53.432  52.442  25.151  1.00  0.92           N  
ATOM    918  CA  PRO A 119      53.281  53.396  24.061  1.00  0.92           C  
ATOM    919  C   PRO A 119      51.966  54.165  24.142  1.00  0.92           C  
ATOM    920  O   PRO A 119      50.907  53.576  24.364  1.00  0.92           O  
ATOM    921  CB  PRO A 119      53.364  52.550  22.767  1.00  0.92           C  
ATOM    922  CG  PRO A 119      53.272  51.074  23.192  1.00  0.92           C  
ATOM    923  CD  PRO A 119      53.588  51.067  24.688  1.00  0.92           C  
ATOM    924  N   PHE A 120      52.013  55.493  23.931  1.00  0.92           N  
ATOM    925  CA  PHE A 120      50.870  56.360  23.758  1.00  0.92           C  
ATOM    926  C   PHE A 120      50.993  56.843  22.332  1.00  0.92           C  
ATOM    927  O   PHE A 120      51.912  57.592  22.006  1.00  0.92           O  
ATOM    928  CB  PHE A 120      50.926  57.612  24.693  1.00  0.92           C  
ATOM    929  CG  PHE A 120      50.460  57.336  26.102  1.00  0.92           C  
ATOM    930  CD1 PHE A 120      50.852  56.202  26.840  1.00  0.92           C  
ATOM    931  CD2 PHE A 120      49.633  58.283  26.731  1.00  0.92           C  
ATOM    932  CE1 PHE A 120      50.389  55.993  28.141  1.00  0.92           C  
ATOM    933  CE2 PHE A 120      49.187  58.093  28.044  1.00  0.92           C  
ATOM    934  CZ  PHE A 120      49.555  56.937  28.745  1.00  0.92           C  
ATOM    935  N   VAL A 121      50.092  56.406  21.435  1.00  0.91           N  
ATOM    936  CA  VAL A 121      50.154  56.732  20.022  1.00  0.91           C  
ATOM    937  C   VAL A 121      49.214  57.883  19.731  1.00  0.91           C  
ATOM    938  O   VAL A 121      47.996  57.712  19.669  1.00  0.91           O  
ATOM    939  CB  VAL A 121      49.807  55.554  19.115  1.00  0.91           C  
ATOM    940  CG1 VAL A 121      50.214  55.944  17.674  1.00  0.91           C  
ATOM    941  CG2 VAL A 121      50.558  54.293  19.595  1.00  0.91           C  
ATOM    942  N   PHE A 122      49.748  59.104  19.545  1.00  0.90           N  
ATOM    943  CA  PHE A 122      48.963  60.286  19.241  1.00  0.90           C  
ATOM    944  C   PHE A 122      48.736  60.369  17.755  1.00  0.90           C  
ATOM    945  O   PHE A 122      49.622  60.072  16.962  1.00  0.90           O  
ATOM    946  CB  PHE A 122      49.668  61.587  19.682  1.00  0.90           C  
ATOM    947  CG  PHE A 122      49.567  61.704  21.168  1.00  0.90           C  
ATOM    948  CD1 PHE A 122      50.597  61.204  21.964  1.00  0.90           C  
ATOM    949  CD2 PHE A 122      48.446  62.280  21.785  1.00  0.90           C  
ATOM    950  CE1 PHE A 122      50.587  61.393  23.348  1.00  0.90           C  
ATOM    951  CE2 PHE A 122      48.396  62.424  23.179  1.00  0.90           C  
ATOM    952  CZ  PHE A 122      49.483  62.005  23.957  1.00  0.90           C  
ATOM    953  N   VAL A 123      47.516  60.752  17.343  1.00  0.92           N  
ATOM    954  CA  VAL A 123      47.139  60.812  15.947  1.00  0.92           C  
ATOM    955  C   VAL A 123      46.538  62.172  15.711  1.00  0.92           C  
ATOM    956  O   VAL A 123      45.592  62.567  16.395  1.00  0.92           O  
ATOM    957  CB  VAL A 123      46.095  59.741  15.633  1.00  0.92           C  
ATOM    958  CG1 VAL A 123      45.629  59.802  14.159  1.00  0.92           C  
ATOM    959  CG2 VAL A 123      46.717  58.365  15.941  1.00  0.92           C  
ATOM    960  N   GLY A 124      47.052  62.959  14.756  1.00  0.93           N  
ATOM    961  CA  GLY A 124      46.545  64.302  14.546  1.00  0.93           C  
ATOM    962  C   GLY A 124      47.483  65.026  13.647  1.00  0.93           C  
ATOM    963  O   GLY A 124      48.398  64.412  13.101  1.00  0.93           O  
ATOM    964  N   THR A 125      47.305  66.352  13.474  1.00  0.91           N  
ATOM    965  CA  THR A 125      48.288  67.232  12.836  1.00  0.91           C  
ATOM    966  C   THR A 125      49.631  67.190  13.562  1.00  0.91           C  
ATOM    967  O   THR A 125      49.697  66.884  14.753  1.00  0.91           O  
ATOM    968  CB  THR A 125      47.830  68.692  12.630  1.00  0.91           C  
ATOM    969  OG1 THR A 125      47.713  69.422  13.836  1.00  0.91           O  
ATOM    970  CG2 THR A 125      46.439  68.726  11.978  1.00  0.91           C  
ATOM    971  N   LYS A 126      50.769  67.464  12.898  1.00  0.84           N  
ATOM    972  CA  LYS A 126      52.043  67.547  13.604  1.00  0.84           C  
ATOM    973  C   LYS A 126      52.086  68.601  14.713  1.00  0.84           C  
ATOM    974  O   LYS A 126      52.608  68.334  15.800  1.00  0.84           O  
ATOM    975  CB  LYS A 126      53.212  67.822  12.630  1.00  0.84           C  
ATOM    976  CG  LYS A 126      53.538  66.657  11.681  1.00  0.84           C  
ATOM    977  CD  LYS A 126      54.132  65.435  12.411  1.00  0.84           C  
ATOM    978  CE  LYS A 126      55.494  64.976  11.875  1.00  0.84           C  
ATOM    979  NZ  LYS A 126      55.359  64.541  10.467  1.00  0.84           N  
ATOM    980  N   ASP A 127      51.493  69.790  14.488  1.00  0.84           N  
ATOM    981  CA  ASP A 127      51.340  70.861  15.459  1.00  0.84           C  
ATOM    982  C   ASP A 127      50.496  70.447  16.671  1.00  0.84           C  
ATOM    983  O   ASP A 127      50.851  70.685  17.821  1.00  0.84           O  
ATOM    984  CB  ASP A 127      50.711  72.088  14.745  1.00  0.84           C  
ATOM    985  CG  ASP A 127      51.722  72.780  13.844  1.00  0.84           C  
ATOM    986  OD1 ASP A 127      52.921  72.414  13.868  1.00  0.84           O  
ATOM    987  OD2 ASP A 127      51.282  73.702  13.116  1.00  0.84           O  
ATOM    988  N   SER A 128      49.374  69.726  16.440  1.00  0.86           N  
ATOM    989  CA  SER A 128      48.562  69.098  17.480  1.00  0.86           C  
ATOM    990  C   SER A 128      49.348  68.099  18.281  1.00  0.86           C  
ATOM    991  O   SER A 128      49.243  68.040  19.513  1.00  0.86           O  
ATOM    992  CB  SER A 128      47.426  68.259  16.850  1.00  0.86           C  
ATOM    993  OG  SER A 128      46.297  69.049  16.512  1.00  0.86           O  
ATOM    994  N   ILE A 129      50.172  67.263  17.623  1.00  0.88           N  
ATOM    995  CA  ILE A 129      51.043  66.321  18.289  1.00  0.88           C  
ATOM    996  C   ILE A 129      52.040  67.019  19.236  1.00  0.88           C  
ATOM    997  O   ILE A 129      52.078  66.753  20.363  1.00  0.88           O  
ATOM    998  CB  ILE A 129      51.694  65.360  17.314  1.00  0.88           C  
ATOM    999  CG1 ILE A 129      50.589  64.397  16.804  1.00  0.88           C  
ATOM   1000  CG2 ILE A 129      52.886  64.592  17.942  1.00  0.88           C  
ATOM   1001  CD1 ILE A 129      51.013  63.522  15.625  1.00  0.88           C  
ATOM   1002  N   ALA A 130      52.743  68.084  18.686  1.00  0.89           N  
ATOM   1003  CA  ALA A 130      53.663  68.901  19.480  1.00  0.89           C  
ATOM   1004  C   ALA A 130      53.030  69.521  20.724  1.00  0.89           C  
ATOM   1005  O   ALA A 130      53.618  69.490  21.817  1.00  0.89           O  
ATOM   1006  CB  ALA A 130      54.189  70.041  18.570  1.00  0.89           C  
ATOM   1007  N   ASN A 131      51.788  70.035  20.630  1.00  0.85           N  
ATOM   1008  CA  ASN A 131      51.010  70.498  21.773  1.00  0.85           C  
ATOM   1009  C   ASN A 131      50.728  69.405  22.808  1.00  0.85           C  
ATOM   1010  O   ASN A 131      50.839  69.621  24.011  1.00  0.85           O  
ATOM   1011  CB  ASN A 131      49.608  71.020  21.355  1.00  0.85           C  
ATOM   1012  CG  ASN A 131      49.692  72.217  20.421  1.00  0.85           C  
ATOM   1013  OD1 ASN A 131      50.660  72.970  20.406  1.00  0.85           O  
ATOM   1014  ND2 ASN A 131      48.601  72.434  19.647  1.00  0.85           N  
ATOM   1015  N   ALA A 132      50.345  68.193  22.347  1.00  0.90           N  
ATOM   1016  CA  ALA A 132      50.098  67.032  23.180  1.00  0.90           C  
ATOM   1017  C   ALA A 132      51.335  66.536  23.910  1.00  0.90           C  
ATOM   1018  O   ALA A 132      51.242  66.222  25.098  1.00  0.90           O  
ATOM   1019  CB  ALA A 132      49.506  65.873  22.345  1.00  0.90           C  
ATOM   1020  N   THR A 133      52.521  66.468  23.257  1.00  0.85           N  
ATOM   1021  CA  THR A 133      53.778  66.060  23.901  1.00  0.85           C  
ATOM   1022  C   THR A 133      54.203  67.044  24.979  1.00  0.85           C  
ATOM   1023  O   THR A 133      54.481  66.629  26.097  1.00  0.85           O  
ATOM   1024  CB  THR A 133      54.944  65.616  22.975  1.00  0.85           C  
ATOM   1025  OG1 THR A 133      55.959  66.575  22.741  1.00  0.85           O  
ATOM   1026  CG2 THR A 133      54.442  65.305  21.567  1.00  0.85           C  
ATOM   1027  N   VAL A 134      54.114  68.375  24.713  1.00  0.84           N  
ATOM   1028  CA  VAL A 134      54.367  69.438  25.692  1.00  0.84           C  
ATOM   1029  C   VAL A 134      53.476  69.331  26.916  1.00  0.84           C  
ATOM   1030  O   VAL A 134      53.936  69.429  28.052  1.00  0.84           O  
ATOM   1031  CB  VAL A 134      54.156  70.828  25.058  1.00  0.84           C  
ATOM   1032  CG1 VAL A 134      53.811  71.958  26.073  1.00  0.84           C  
ATOM   1033  CG2 VAL A 134      55.436  71.198  24.282  1.00  0.84           C  
ATOM   1034  N   LEU A 135      52.158  69.090  26.722  1.00  0.83           N  
ATOM   1035  CA  LEU A 135      51.250  68.820  27.820  1.00  0.83           C  
ATOM   1036  C   LEU A 135      51.638  67.568  28.577  1.00  0.83           C  
ATOM   1037  O   LEU A 135      51.799  67.593  29.794  1.00  0.83           O  
ATOM   1038  CB  LEU A 135      49.800  68.647  27.298  1.00  0.83           C  
ATOM   1039  CG  LEU A 135      49.090  69.961  26.920  1.00  0.83           C  
ATOM   1040  CD1 LEU A 135      47.754  69.623  26.241  1.00  0.83           C  
ATOM   1041  CD2 LEU A 135      48.851  70.849  28.158  1.00  0.83           C  
ATOM   1042  N   LEU A 136      51.900  66.460  27.859  1.00  0.84           N  
ATOM   1043  CA  LEU A 136      52.238  65.192  28.457  1.00  0.84           C  
ATOM   1044  C   LEU A 136      53.480  65.252  29.348  1.00  0.84           C  
ATOM   1045  O   LEU A 136      53.458  64.765  30.480  1.00  0.84           O  
ATOM   1046  CB  LEU A 136      52.442  64.131  27.354  1.00  0.84           C  
ATOM   1047  CG  LEU A 136      52.180  62.699  27.848  1.00  0.84           C  
ATOM   1048  CD1 LEU A 136      50.676  62.412  27.973  1.00  0.84           C  
ATOM   1049  CD2 LEU A 136      52.845  61.711  26.893  1.00  0.84           C  
ATOM   1050  N   ASP A 137      54.550  65.938  28.873  1.00  0.80           N  
ATOM   1051  CA  ASP A 137      55.788  66.216  29.575  1.00  0.80           C  
ATOM   1052  C   ASP A 137      55.555  66.962  30.882  1.00  0.80           C  
ATOM   1053  O   ASP A 137      56.042  66.561  31.945  1.00  0.80           O  
ATOM   1054  CB  ASP A 137      56.678  67.115  28.660  1.00  0.80           C  
ATOM   1055  CG  ASP A 137      57.560  66.302  27.725  1.00  0.80           C  
ATOM   1056  OD1 ASP A 137      57.752  65.088  27.988  1.00  0.80           O  
ATOM   1057  OD2 ASP A 137      58.102  66.916  26.771  1.00  0.80           O  
ATOM   1058  N   TYR A 138      54.739  68.042  30.848  1.00  0.77           N  
ATOM   1059  CA  TYR A 138      54.384  68.819  32.025  1.00  0.77           C  
ATOM   1060  C   TYR A 138      53.637  68.012  33.063  1.00  0.77           C  
ATOM   1061  O   TYR A 138      53.965  68.059  34.248  1.00  0.77           O  
ATOM   1062  CB  TYR A 138      53.477  70.032  31.676  1.00  0.77           C  
ATOM   1063  CG  TYR A 138      54.168  71.122  30.904  1.00  0.77           C  
ATOM   1064  CD1 TYR A 138      55.543  71.417  31.013  1.00  0.77           C  
ATOM   1065  CD2 TYR A 138      53.367  71.937  30.089  1.00  0.77           C  
ATOM   1066  CE1 TYR A 138      56.094  72.497  30.309  1.00  0.77           C  
ATOM   1067  CE2 TYR A 138      53.915  73.025  29.398  1.00  0.77           C  
ATOM   1068  CZ  TYR A 138      55.283  73.298  29.506  1.00  0.77           C  
ATOM   1069  OH  TYR A 138      55.857  74.382  28.815  1.00  0.77           O  
ATOM   1070  N   HIS A 139      52.634  67.216  32.641  1.00  0.77           N  
ATOM   1071  CA  HIS A 139      51.896  66.343  33.532  1.00  0.77           C  
ATOM   1072  C   HIS A 139      52.737  65.265  34.187  1.00  0.77           C  
ATOM   1073  O   HIS A 139      52.688  65.082  35.395  1.00  0.77           O  
ATOM   1074  CB  HIS A 139      50.704  65.681  32.814  1.00  0.77           C  
ATOM   1075  CG  HIS A 139      49.610  66.665  32.616  1.00  0.77           C  
ATOM   1076  ND1 HIS A 139      49.476  67.392  31.458  1.00  0.77           N  
ATOM   1077  CD2 HIS A 139      48.687  67.055  33.517  1.00  0.77           C  
ATOM   1078  CE1 HIS A 139      48.474  68.209  31.671  1.00  0.77           C  
ATOM   1079  NE2 HIS A 139      47.953  68.054  32.911  1.00  0.77           N  
ATOM   1080  N   LEU A 140      53.591  64.567  33.419  1.00  0.80           N  
ATOM   1081  CA  LEU A 140      54.516  63.553  33.902  1.00  0.80           C  
ATOM   1082  C   LEU A 140      55.520  64.063  34.916  1.00  0.80           C  
ATOM   1083  O   LEU A 140      55.884  63.339  35.832  1.00  0.80           O  
ATOM   1084  CB  LEU A 140      55.282  62.950  32.699  1.00  0.80           C  
ATOM   1085  CG  LEU A 140      54.700  61.649  32.088  1.00  0.80           C  
ATOM   1086  CD1 LEU A 140      53.184  61.436  32.276  1.00  0.80           C  
ATOM   1087  CD2 LEU A 140      55.050  61.603  30.591  1.00  0.80           C  
ATOM   1088  N   ASN A 141      55.980  65.322  34.785  1.00  0.70           N  
ATOM   1089  CA  ASN A 141      56.894  65.959  35.718  1.00  0.70           C  
ATOM   1090  C   ASN A 141      56.365  66.108  37.144  1.00  0.70           C  
ATOM   1091  O   ASN A 141      57.155  66.009  38.075  1.00  0.70           O  
ATOM   1092  CB  ASN A 141      57.384  67.319  35.152  1.00  0.70           C  
ATOM   1093  CG  ASN A 141      58.676  67.109  34.367  1.00  0.70           C  
ATOM   1094  OD1 ASN A 141      59.729  67.598  34.761  1.00  0.70           O  
ATOM   1095  ND2 ASN A 141      58.625  66.357  33.245  1.00  0.70           N  
ATOM   1096  N   TYR A 142      55.047  66.335  37.371  1.00  0.68           N  
ATOM   1097  CA  TYR A 142      54.527  66.413  38.733  1.00  0.68           C  
ATOM   1098  C   TYR A 142      53.767  65.150  39.146  1.00  0.68           C  
ATOM   1099  O   TYR A 142      53.482  64.961  40.322  1.00  0.68           O  
ATOM   1100  CB  TYR A 142      53.635  67.682  38.946  1.00  0.68           C  
ATOM   1101  CG  TYR A 142      52.260  67.573  38.324  1.00  0.68           C  
ATOM   1102  CD1 TYR A 142      51.230  66.920  39.027  1.00  0.68           C  
ATOM   1103  CD2 TYR A 142      51.979  68.106  37.057  1.00  0.68           C  
ATOM   1104  CE1 TYR A 142      49.947  66.813  38.485  1.00  0.68           C  
ATOM   1105  CE2 TYR A 142      50.674  68.049  36.537  1.00  0.68           C  
ATOM   1106  CZ  TYR A 142      49.660  67.405  37.259  1.00  0.68           C  
ATOM   1107  OH  TYR A 142      48.336  67.346  36.788  1.00  0.68           O  
ATOM   1108  N   LEU A 143      53.379  64.270  38.190  1.00  0.65           N  
ATOM   1109  CA  LEU A 143      52.772  62.978  38.489  1.00  0.65           C  
ATOM   1110  C   LEU A 143      53.780  61.897  38.863  1.00  0.65           C  
ATOM   1111  O   LEU A 143      53.395  60.812  39.309  1.00  0.65           O  
ATOM   1112  CB  LEU A 143      51.997  62.439  37.261  1.00  0.65           C  
ATOM   1113  CG  LEU A 143      50.715  63.207  36.896  1.00  0.65           C  
ATOM   1114  CD1 LEU A 143      50.160  62.627  35.589  1.00  0.65           C  
ATOM   1115  CD2 LEU A 143      49.648  63.159  38.003  1.00  0.65           C  
ATOM   1116  N   LYS A 144      55.065  62.196  38.603  1.00  0.68           N  
ATOM   1117  CA  LYS A 144      56.273  61.603  39.128  1.00  0.68           C  
ATOM   1118  C   LYS A 144      56.395  61.578  40.674  1.00  0.68           C  
ATOM   1119  O   LYS A 144      55.723  62.364  41.385  1.00  0.68           O  
ATOM   1120  CB  LYS A 144      57.469  62.391  38.495  1.00  0.68           C  
ATOM   1121  CG  LYS A 144      58.890  61.884  38.784  1.00  0.68           C  
ATOM   1122  CD  LYS A 144      59.185  60.519  38.145  1.00  0.68           C  
ATOM   1123  CE  LYS A 144      60.477  59.922  38.698  1.00  0.68           C  
ATOM   1124  NZ  LYS A 144      60.776  58.647  38.016  1.00  0.68           N  
ATOM   1125  OXT LYS A 144      57.172  60.707  41.160  1.00  0.68           O  
TER    1126      LYS A 144                                                      
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.