CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  Príon  ***

elNémo ID: 21042001182230234

Job options:

ID        	=	 21042001182230234
JOBID     	=	 Príon
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 3
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER Príon

HEADER    MEMBRANE PROTEIN                        01-MAY-09   3HAK              
TITLE     HUMAN PRION PROTEIN VARIANT V129                                      
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: MAJOR PRION PROTEIN;                                       
COMPND   3 CHAIN: A;                                                            
COMPND   4 FRAGMENT: UNP RESIDUES 125-227;                                      
COMPND   5 SYNONYM: PRP, PRP27-30, PRP33-35C, ASCR;                             
COMPND   6 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: PRNP, PRIP, PRP;                                               
SOURCE   6 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
SOURCE   7 EXPRESSION_SYSTEM_TAXID: 562                                         
KEYWDS    PRION PROTEIN, CELL MEMBRANE, DISEASE MUTATION, DISULFIDE BOND,       
KEYWDS   2 GLYCOPROTEIN, GOLGI APPARATUS, GPI-ANCHOR, LIPOPROTEIN, MEMBRANE,    
KEYWDS   3 POLYMORPHISM, PRION, MEMBRANE PROTEIN                                
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    S.LEE,L.ANTONY,R.HARTMANN,K.J.KNAUS,K.SUREWICZ,W.K.SUREWICZ,V.C.YEE   
REVDAT   3   01-NOV-17 3HAK    1       REMARK                                   
REVDAT   2   02-MAR-10 3HAK    1       TITLE                                    
REVDAT   1   12-JAN-10 3HAK    0                                                
JRNL        AUTH   S.LEE,L.ANTONY,R.HARTMANN,K.J.KNAUS,K.SUREWICZ,W.K.SUREWICZ, 
JRNL        AUTH 2 V.C.YEE                                                      
JRNL        TITL   CONFORMATIONAL DIVERSITY IN PRION PROTEIN VARIANTS           
JRNL        TITL 2 INFLUENCES INTERMOLECULAR BETA-SHEET FORMATION.              
JRNL        REF    EMBO J.                       V.  29   251 2010              
JRNL        REFN                   ISSN 0261-4189                               
JRNL        PMID   19927125                                                     
JRNL        DOI    10.1038/EMBOJ.2009.333                                       
REMARK   2                                                                      
REMARK   2 RESOLUTION.    1.80 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : REFMAC 5.5.0066                                      
REMARK   3   AUTHORS     : MURSHUDOV,VAGIN,DODSON                               
REMARK   3                                                                      
REMARK   3    REFINEMENT TARGET : MAXIMUM LIKELIHOOD                            
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 1.80                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 16.13                          
REMARK   3   DATA CUTOFF            (SIGMA(F)) : 0.000                          
REMARK   3   COMPLETENESS FOR RANGE        (%) : 99.3                           
REMARK   3   NUMBER OF REFLECTIONS             : 8833                           
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   CROSS-VALIDATION METHOD          : THROUGHOUT                      
REMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          
REMARK   3   R VALUE     (WORKING + TEST SET) : 0.187                           
REMARK   3   R VALUE            (WORKING SET) : 0.185                           
REMARK   3   FREE R VALUE                     : 0.241                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 4.800                           
REMARK   3   FREE R VALUE TEST SET COUNT      : 421                             
REMARK   3                                                                      
REMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  
REMARK   3   TOTAL NUMBER OF BINS USED           : 20                           
REMARK   3   BIN RESOLUTION RANGE HIGH       (A) : 1.80                         
REMARK   3   BIN RESOLUTION RANGE LOW        (A) : 1.84                         
REMARK   3   REFLECTION IN BIN     (WORKING SET) : 589                          
REMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : 96.86                        
REMARK   3   BIN R VALUE           (WORKING SET) : 0.2720                       
REMARK   3   BIN FREE R VALUE SET COUNT          : 27                           
REMARK   3   BIN FREE R VALUE                    : 0.3240                       
REMARK   3                                                                      
REMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    
REMARK   3   PROTEIN ATOMS            : 866                                     
REMARK   3   NUCLEIC ACID ATOMS       : 0                                       
REMARK   3   HETEROGEN ATOMS          : 0                                       
REMARK   3   SOLVENT ATOMS            : 105                                     
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : NULL                           
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : 20.29                          
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : 0.01000                                              
REMARK   3    B22 (A**2) : -0.01000                                             
REMARK   3    B33 (A**2) : 0.00000                                              
REMARK   3    B12 (A**2) : 0.00000                                              
REMARK   3    B13 (A**2) : 0.00000                                              
REMARK   3    B23 (A**2) : 0.00000                                              
REMARK   3                                                                      
REMARK   3  ESTIMATED OVERALL COORDINATE ERROR.                                 
REMARK   3   ESU BASED ON R VALUE                            (A): 0.161         
REMARK   3   ESU BASED ON FREE R VALUE                       (A): 0.152         
REMARK   3   ESU BASED ON MAXIMUM LIKELIHOOD                 (A): 0.096         
REMARK   3   ESU FOR B VALUES BASED ON MAXIMUM LIKELIHOOD (A**2): 3.031         
REMARK   3                                                                      
REMARK   3 CORRELATION COEFFICIENTS.                                            
REMARK   3   CORRELATION COEFFICIENT FO-FC      : 0.951                         
REMARK   3   CORRELATION COEFFICIENT FO-FC FREE : 0.921                         
REMARK   3                                                                      
REMARK   3  RMS DEVIATIONS FROM IDEAL VALUES        COUNT    RMS    WEIGHT      
REMARK   3   BOND LENGTHS REFINED ATOMS        (A):   924 ; 0.012 ; 0.021       
REMARK   3   BOND LENGTHS OTHERS               (A):  NULL ;  NULL ;  NULL       
REMARK   3   BOND ANGLES REFINED ATOMS   (DEGREES):  1258 ; 1.348 ; 1.917       
REMARK   3   BOND ANGLES OTHERS          (DEGREES):  NULL ;  NULL ;  NULL       
REMARK   3   TORSION ANGLES, PERIOD 1    (DEGREES):   112 ; 4.492 ; 5.000       
REMARK   3   TORSION ANGLES, PERIOD 2    (DEGREES):    58 ;35.385 ;23.966       
REMARK   3   TORSION ANGLES, PERIOD 3    (DEGREES):   159 ;13.495 ;15.000       
REMARK   3   TORSION ANGLES, PERIOD 4    (DEGREES):     8 ;22.317 ;15.000       
REMARK   3   CHIRAL-CENTER RESTRAINTS       (A**3):   127 ; 0.096 ; 0.200       
REMARK   3   GENERAL PLANES REFINED ATOMS      (A):   747 ; 0.006 ; 0.020       
REMARK   3   GENERAL PLANES OTHERS             (A):  NULL ;  NULL ;  NULL       
REMARK   3   NON-BONDED CONTACTS REFINED ATOMS (A):  NULL ;  NULL ;  NULL       
REMARK   3   NON-BONDED CONTACTS OTHERS        (A):  NULL ;  NULL ;  NULL       
REMARK   3   NON-BONDED TORSION REFINED ATOMS  (A):  NULL ;  NULL ;  NULL       
REMARK   3   NON-BONDED TORSION OTHERS         (A):  NULL ;  NULL ;  NULL       
REMARK   3   H-BOND (X...Y) REFINED ATOMS      (A):  NULL ;  NULL ;  NULL       
REMARK   3   H-BOND (X...Y) OTHERS             (A):  NULL ;  NULL ;  NULL       
REMARK   3   POTENTIAL METAL-ION REFINED ATOMS (A):  NULL ;  NULL ;  NULL       
REMARK   3   POTENTIAL METAL-ION OTHERS        (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY VDW REFINED ATOMS        (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY VDW OTHERS               (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY H-BOND REFINED ATOMS     (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY H-BOND OTHERS            (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY METAL-ION REFINED ATOMS  (A):  NULL ;  NULL ;  NULL       
REMARK   3   SYMMETRY METAL-ION OTHERS         (A):  NULL ;  NULL ;  NULL       
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.     COUNT   RMS    WEIGHT      
REMARK   3   MAIN-CHAIN BOND REFINED ATOMS  (A**2):   528 ; 0.873 ; 1.500       
REMARK   3   MAIN-CHAIN BOND OTHER ATOMS    (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   MAIN-CHAIN ANGLE REFINED ATOMS (A**2):   867 ; 1.637 ; 2.000       
REMARK   3   MAIN-CHAIN ANGLE OTHER ATOMS   (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   SIDE-CHAIN BOND REFINED ATOMS  (A**2):   396 ; 2.434 ; 3.000       
REMARK   3   SIDE-CHAIN BOND OTHER ATOMS    (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   SIDE-CHAIN ANGLE REFINED ATOMS (A**2):   386 ; 3.967 ; 4.500       
REMARK   3   SIDE-CHAIN ANGLE OTHER ATOMS   (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   LONG RANGE B REFINED ATOMS     (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   LONG RANGE B OTHER ATOMS       (A**2):  NULL ;  NULL ;  NULL       
REMARK   3                                                                      
REMARK   3 ANISOTROPIC THERMAL FACTOR RESTRAINTS.    COUNT   RMS   WEIGHT       
REMARK   3   RIGID-BOND RESTRAINTS          (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   SPHERICITY; FREE ATOMS         (A**2):  NULL ;  NULL ;  NULL       
REMARK   3   SPHERICITY; BONDED ATOMS       (A**2):  NULL ;  NULL ;  NULL       
REMARK   3                                                                      
REMARK   3  NCS RESTRAINTS STATISTICS                                           
REMARK   3   NUMBER OF DIFFERENT NCS GROUPS : NULL                              
REMARK   3                                                                      
REMARK   3  TLS DETAILS                                                         
REMARK   3   NUMBER OF TLS GROUPS  : NULL                                       
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELLING.                                             
REMARK   3   METHOD USED : MASK                                                 
REMARK   3   PARAMETERS FOR MASK CALCULATION                                    
REMARK   3   VDW PROBE RADIUS   : 1.40                                          
REMARK   3   ION PROBE RADIUS   : 0.80                                          
REMARK   3   SHRINKAGE RADIUS   : 0.80                                          
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: HYDROGENS HAVE BEEN ADDED IN THE RIDING   
REMARK   3  POSITIONS U VALUES: REFINED INDIVIDUALLY                            
REMARK   4                                                                      
REMARK   4 3HAK COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 07-MAY-09.                  
REMARK 100 THE DEPOSITION ID IS D_1000052898.                                   
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : 28-MAR-06                          
REMARK 200  TEMPERATURE           (KELVIN) : 100                                
REMARK 200  PH                             : 5.2                                
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : APS                                
REMARK 200  BEAMLINE                       : 19-ID                              
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : 0.9791                             
REMARK 200  MONOCHROMATOR                  : NULL                               
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : CCD                                
REMARK 200  DETECTOR MANUFACTURER          : ADSC QUANTUM 315                   
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : DENZO, HKL-2000                    
REMARK 200  DATA SCALING SOFTWARE          : SCALEPACK, HKL-2000                
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 8871                               
REMARK 200  RESOLUTION RANGE HIGH      (A) : 1.800                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 30.000                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : NULL                               
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 99.4                               
REMARK 200  DATA REDUNDANCY                : 4.500                              
REMARK 200  R MERGE                    (I) : 0.04200                            
REMARK 200  R SYM                      (I) : NULL                               
REMARK 200   FOR THE DATA SET  : 30.7550                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 1.80                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 1.86                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : 99.8                               
REMARK 200  DATA REDUNDANCY IN SHELL       : 4.50                               
REMARK 200  R MERGE FOR SHELL          (I) : 0.19800                            
REMARK 200  R SYM FOR SHELL            (I) : NULL                               
REMARK 200   FOR SHELL         : NULL                               
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT        
REMARK 200 SOFTWARE USED: EPMR                                                  
REMARK 200 STARTING MODEL: NULL                                                 
REMARK 200                                                                      
REMARK 200 REMARK: NULL                                                         
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 32.90                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 1.83                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: 0.1M NA/K PHOSPHATE, 20% PEG4K, PH       
REMARK 280  5.2, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 277K                
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21                       
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X+1/2,-Y,Z+1/2                                         
REMARK 290       3555   -X,Y+1/2,-Z+1/2                                         
REMARK 290       4555   X+1/2,-Y+1/2,-Z                                         
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000       16.24200            
REMARK 290   SMTRY2   2  0.000000 -1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000  1.000000       28.44250            
REMARK 290   SMTRY1   3 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   3  0.000000  1.000000  0.000000       24.54550            
REMARK 290   SMTRY3   3  0.000000  0.000000 -1.000000       28.44250            
REMARK 290   SMTRY1   4  1.000000  0.000000  0.000000       16.24200            
REMARK 290   SMTRY2   4  0.000000 -1.000000  0.000000       24.54550            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: MONOMERIC                  
REMARK 350 SOFTWARE USED: PISA                                                  
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A                                     
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    SER A 170     -168.83   -117.54                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 3HAF   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3HEQ   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3HER   RELATED DB: PDB                                   
REMARK 900 RELATED ID: 3HES   RELATED DB: PDB                                   
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 THE COMPLETE SEQUENCE OF THE PROTEIN USED FOR CRYSTALLIZATION WAS:   
REMARK 999 GQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYVLGSAMSRPIIHFGSDYEDRYYRENMHRY 
REMARK 999 PNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAY 
REMARK 999 YQRGSS. HOWEVER ACCORDING TO THE AUTHORS THERE IS A REASONABLE       
REMARK 999 CHANCE THAT THE CRYSTAL CONTAINS A PROTEOLYZED VERSION. ONLY THE     
REMARK 999 RESIDUES OBSERVED IN THE EXPERIMENT WERE INCLUDED IN THE SEQRES      
REMARK 999 RECORDS.                                                             
DBREF  3HAK A  125   227  UNP    P04156   PRIO_HUMAN     125    227             
SEQADV 3HAK VAL A  129  UNP  P04156    MET   129 VARIANT                        
SEQRES   1 A  103  LEU GLY GLY TYR VAL LEU GLY SER ALA MET SER ARG PRO          
SEQRES   2 A  103  ILE ILE HIS PHE GLY SER ASP TYR GLU ASP ARG TYR TYR          
SEQRES   3 A  103  ARG GLU ASN MET HIS ARG TYR PRO ASN GLN VAL TYR TYR          
SEQRES   4 A  103  ARG PRO MET ASP GLU TYR SER ASN GLN ASN ASN PHE VAL          
SEQRES   5 A  103  HIS ASP CYS VAL ASN ILE THR ILE LYS GLN HIS THR VAL          
SEQRES   6 A  103  THR THR THR THR LYS GLY GLU ASN PHE THR GLU THR ASP          
SEQRES   7 A  103  VAL LYS MET MET GLU ARG VAL VAL GLU GLN MET CYS ILE          
SEQRES   8 A  103  THR GLN TYR GLU ARG GLU SER GLN ALA TYR TYR GLN              
FORMUL   2  HOH   *105(H2 O)                                                    
HELIX    1   1 SER A  143  MET A  154  1                                  12    
HELIX    2   2 HIS A  155  TYR A  157  5                                   3    
HELIX    3   3 ARG A  164  SER A  170  5                                   7    
HELIX    4   4 ASN A  171  THR A  193  1                                  23    
HELIX    5   5 THR A  199  GLN A  227  1                                  29    
SHEET    1   A 2 VAL A 129  LEU A 130  0                                        
SHEET    2   A 2 TYR A 162  TYR A 163 -1  O  TYR A 163   N  VAL A 129           
SSBOND   1 CYS A  179    CYS A  214                          1555   1555  2.03  
CRYST1   32.484   49.091   56.885  90.00  90.00  90.00 P 21 21 21    4          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.030784  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.020370  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.017579        0.00000                         
ATOM      1  N   LEU A 125      15.788   1.410   9.184  1.00 22.93           N  
ATOM      2  CA  LEU A 125      15.995   1.022  10.605  1.00 21.77           C  
ATOM      3  C   LEU A 125      16.238   2.279  11.453  1.00 21.07           C  
ATOM      4  O   LEU A 125      15.773   2.397  12.602  1.00 21.50           O  
ATOM      5  CB  LEU A 125      17.203   0.065  10.698  1.00 22.25           C  
ATOM      6  CG  LEU A 125      17.622  -0.285  12.124  1.00 22.44           C  
ATOM      7  CD1 LEU A 125      16.477  -0.982  12.830  1.00 27.22           C  
ATOM      8  CD2 LEU A 125      18.841  -1.170  12.072  1.00 24.94           C  
ATOM      9  N   GLY A 126      16.972   3.231  10.891  1.00 20.15           N  
ATOM     10  CA  GLY A 126      17.352   4.401  11.644  1.00 19.63           C  
ATOM     11  C   GLY A 126      16.443   5.573  11.334  1.00 20.10           C  
ATOM     12  O   GLY A 126      16.758   6.701  11.682  1.00 20.74           O  
ATOM     13  N   GLY A 127      15.319   5.296  10.672  1.00 19.39           N  
ATOM     14  CA  GLY A 127      14.429   6.373  10.189  1.00 18.80           C  
ATOM     15  C   GLY A 127      13.486   6.908  11.256  1.00 18.41           C  
ATOM     16  O   GLY A 127      13.422   6.388  12.360  1.00 19.53           O  
ATOM     17  N   TYR A 128      12.756   7.963  10.923  1.00 17.84           N  
ATOM     18  CA  TYR A 128      11.722   8.499  11.817  1.00 16.76           C  
ATOM     19  C   TYR A 128      10.334   7.988  11.442  1.00 15.48           C  
ATOM     20  O   TYR A 128      10.087   7.668  10.274  1.00 15.59           O  
ATOM     21  CB  TYR A 128      11.714  10.011  11.749  1.00 16.48           C  
ATOM     22  CG  TYR A 128      12.888  10.644  12.441  1.00 17.74           C  
ATOM     23  CD1 TYR A 128      14.142  10.689  11.825  1.00 19.28           C  
ATOM     24  CD2 TYR A 128      12.758  11.188  13.715  1.00 17.64           C  
ATOM     25  CE1 TYR A 128      15.231  11.262  12.453  1.00 20.84           C  
ATOM     26  CE2 TYR A 128      13.869  11.796  14.363  1.00 17.49           C  
ATOM     27  CZ  TYR A 128      15.093  11.813  13.720  1.00 18.54           C  
ATOM     28  OH  TYR A 128      16.192  12.403  14.321  1.00 17.37           O  
ATOM     29  N   VAL A 129       9.444   7.903  12.428  1.00 14.05           N  
ATOM     30  CA  VAL A 129       8.052   7.564  12.199  1.00 13.96           C  
ATOM     31  C   VAL A 129       7.209   8.539  13.004  1.00 13.13           C  
ATOM     32  O   VAL A 129       7.725   9.251  13.860  1.00 13.15           O  
ATOM     33  CB  VAL A 129       7.687   6.111  12.609  1.00 13.53           C  
ATOM     34  CG1 VAL A 129       8.393   5.089  11.661  1.00 17.06           C  
ATOM     35  CG2 VAL A 129       8.022   5.840  14.090  1.00 14.84           C  
ATOM     36  N   LEU A 130       5.915   8.586  12.710  1.00 12.86           N  
ATOM     37  CA  LEU A 130       5.002   9.424  13.506  1.00 12.59           C  
ATOM     38  C   LEU A 130       4.389   8.662  14.664  1.00 12.91           C  
ATOM     39  O   LEU A 130       3.982   7.508  14.505  1.00 13.12           O  
ATOM     40  CB  LEU A 130       3.878   9.994  12.641  1.00 13.23           C  
ATOM     41  CG  LEU A 130       4.145  11.269  11.836  1.00 15.21           C  
ATOM     42  CD1 LEU A 130       2.927  11.610  10.977  1.00 17.17           C  
ATOM     43  CD2 LEU A 130       4.518  12.450  12.752  1.00 12.53           C  
ATOM     44  N   GLY A 131       4.304   9.301  15.832  1.00 12.87           N  
ATOM     45  CA  GLY A 131       3.550   8.708  16.938  1.00 14.43           C  
ATOM     46  C   GLY A 131       2.063   9.028  16.873  1.00 15.64           C  
ATOM     47  O   GLY A 131       1.590   9.683  15.942  1.00 16.88           O  
ATOM     48  N   SER A 132       1.301   8.567  17.849  1.00 17.05           N  
ATOM     49  CA  SER A 132      -0.116   8.823  17.797  1.00 17.96           C  
ATOM     50  C   SER A 132      -0.443  10.294  17.995  1.00 18.85           C  
ATOM     51  O   SER A 132       0.290  11.038  18.672  1.00 17.60           O  
ATOM     52  CB  SER A 132      -0.887   7.955  18.800  1.00 19.08           C  
ATOM     53  OG  SER A 132      -0.456   8.221  20.105  1.00 20.59           O  
ATOM     54  N   ALA A 133      -1.541  10.713  17.378  1.00 19.91           N  
ATOM     55  CA  ALA A 133      -2.015  12.077  17.518  1.00 21.92           C  
ATOM     56  C   ALA A 133      -2.422  12.301  18.955  1.00 22.44           C  
ATOM     57  O   ALA A 133      -3.056  11.436  19.574  1.00 23.94           O  
ATOM     58  CB  ALA A 133      -3.184  12.341  16.588  1.00 22.28           C  
ATOM     59  N   MET A 134      -2.082  13.476  19.471  1.00 22.05           N  
ATOM     60  CA  MET A 134      -2.337  13.821  20.851  1.00 22.91           C  
ATOM     61  C   MET A 134      -3.359  14.944  20.966  1.00 23.35           C  
ATOM     62  O   MET A 134      -3.417  15.819  20.112  1.00 22.55           O  
ATOM     63  CB  MET A 134      -1.040  14.261  21.492  1.00 22.28           C  
ATOM     64  CG  MET A 134      -0.038  13.126  21.580  1.00 22.87           C  
ATOM     65  SD  MET A 134       1.496  13.681  22.299  1.00 23.89           S  
ATOM     66  CE  MET A 134       2.495  12.203  22.075  1.00 20.54           C  
ATOM     67  N   SER A 135      -4.170  14.923  22.014  1.00 24.00           N  
ATOM     68  CA  SER A 135      -4.976  16.101  22.294  1.00 25.70           C  
ATOM     69  C   SER A 135      -4.056  17.193  22.843  1.00 26.05           C  
ATOM     70  O   SER A 135      -2.956  16.910  23.344  1.00 25.11           O  
ATOM     71  CB  SER A 135      -6.101  15.798  23.285  1.00 26.44           C  
ATOM     72  OG  SER A 135      -5.554  15.488  24.558  1.00 29.98           O  
ATOM     73  N   ARG A 136      -4.521  18.436  22.747  1.00 26.18           N  
ATOM     74  CA AARG A 136      -3.750  19.615  23.162  0.50 25.90           C  
ATOM     75  CA BARG A 136      -3.733  19.590  23.171  0.50 25.89           C  
ATOM     76  C   ARG A 136      -3.330  19.530  24.629  1.00 24.55           C  
ATOM     77  O   ARG A 136      -4.181  19.512  25.543  1.00 26.32           O  
ATOM     78  CB AARG A 136      -4.533  20.918  22.869  0.50 26.23           C  
ATOM     79  CB BARG A 136      -4.455  20.900  22.842  0.50 26.23           C  
ATOM     80  CG AARG A 136      -4.771  21.226  21.355  0.50 27.67           C  
ATOM     81  CG BARG A 136      -4.424  21.203  21.349  0.50 27.57           C  
ATOM     82  CD AARG A 136      -3.557  21.902  20.637  0.50 27.31           C  
ATOM     83  CD BARG A 136      -3.092  20.759  20.715  0.50 26.59           C  
ATOM     84  NE AARG A 136      -3.699  21.902  19.171  0.50 25.57           N  
ATOM     85  NE BARG A 136      -2.058  21.789  20.786  0.50 25.85           N  
ATOM     86  CZ AARG A 136      -2.692  21.763  18.299  0.50 23.36           C  
ATOM     87  CZ BARG A 136      -0.864  21.683  20.216  0.50 25.14           C  
ATOM     88  NH1AARG A 136      -2.936  21.759  16.999  0.50 20.98           N  
ATOM     89  NH1BARG A 136       0.019  22.665  20.328  0.50 24.73           N  
ATOM     90  NH2AARG A 136      -1.446  21.617  18.716  0.50 23.61           N  
ATOM     91  NH2BARG A 136      -0.560  20.588  19.527  0.50 25.45           N  
ATOM     92  N   PRO A 137      -2.022  19.449  24.877  1.00 23.00           N  
ATOM     93  CA  PRO A 137      -1.692  19.408  26.272  1.00 20.74           C  
ATOM     94  C   PRO A 137      -1.733  20.804  26.850  1.00 18.45           C  
ATOM     95  O   PRO A 137      -1.682  21.792  26.125  1.00 16.96           O  
ATOM     96  CB  PRO A 137      -0.249  18.898  26.280  1.00 21.78           C  
ATOM     97  CG  PRO A 137       0.295  19.285  24.990  1.00 21.94           C  
ATOM     98  CD  PRO A 137      -0.849  19.228  24.024  1.00 22.90           C  
ATOM     99  N   ILE A 138      -1.844  20.862  28.164  1.00 16.72           N  
ATOM    100  CA  ILE A 138      -1.772  22.092  28.890  1.00 15.63           C  
ATOM    101  C   ILE A 138      -0.316  22.463  28.939  1.00 15.29           C  
ATOM    102  O   ILE A 138       0.511  21.673  29.404  1.00 15.44           O  
ATOM    103  CB  ILE A 138      -2.295  21.881  30.327  1.00 15.38           C  
ATOM    104  CG1 ILE A 138      -3.763  21.468  30.285  1.00 16.57           C  
ATOM    105  CG2 ILE A 138      -2.074  23.135  31.158  1.00 16.28           C  
ATOM    106  CD1 ILE A 138      -4.312  21.058  31.662  1.00 17.29           C  
ATOM    107  N   ILE A 139       0.009  23.650  28.450  1.00 16.15           N  
ATOM    108  CA  ILE A 139       1.393  24.122  28.425  1.00 16.99           C  
ATOM    109  C   ILE A 139       1.390  25.539  29.037  1.00 16.85           C  
ATOM    110  O   ILE A 139       0.672  26.416  28.552  1.00 17.00           O  
ATOM    111  CB  ILE A 139       1.978  24.202  26.981  1.00 18.10           C  
ATOM    112  CG1 ILE A 139       2.003  22.850  26.262  1.00 18.64           C  
ATOM    113  CG2 ILE A 139       3.420  24.776  27.003  1.00 17.84           C  
ATOM    114  CD1 ILE A 139       3.065  21.876  26.802  1.00 19.62           C  
ATOM    115  N   HIS A 140       2.146  25.741  30.118  1.00 15.49           N  
ATOM    116  CA  HIS A 140       2.234  27.037  30.784  1.00 15.81           C  
ATOM    117  C   HIS A 140       3.500  27.826  30.383  1.00 16.22           C  
ATOM    118  O   HIS A 140       4.578  27.260  30.326  1.00 15.95           O  
ATOM    119  CB  HIS A 140       2.213  26.865  32.317  1.00 15.96           C  
ATOM    120  CG  HIS A 140       0.890  26.423  32.869  1.00 16.17           C  
ATOM    121  ND1 HIS A 140      -0.087  27.317  33.253  1.00 17.86           N  
ATOM    122  CD2 HIS A 140       0.386  25.185  33.105  1.00 17.03           C  
ATOM    123  CE1 HIS A 140      -1.134  26.647  33.714  1.00 17.37           C  
ATOM    124  NE2 HIS A 140      -0.876  25.355  33.625  1.00 19.84           N  
ATOM    125  N   PHE A 141       3.355  29.126  30.132  1.00 17.35           N  
ATOM    126  CA  PHE A 141       4.509  29.986  29.831  1.00 18.14           C  
ATOM    127  C   PHE A 141       4.759  30.960  30.975  1.00 19.51           C  
ATOM    128  O   PHE A 141       3.997  30.993  31.933  1.00 20.42           O  
ATOM    129  CB  PHE A 141       4.297  30.726  28.503  1.00 17.72           C  
ATOM    130  CG  PHE A 141       4.303  29.819  27.330  1.00 16.80           C  
ATOM    131  CD1 PHE A 141       3.146  29.145  26.962  1.00 19.18           C  
ATOM    132  CD2 PHE A 141       5.484  29.568  26.635  1.00 18.10           C  
ATOM    133  CE1 PHE A 141       3.170  28.246  25.894  1.00 19.64           C  
ATOM    134  CE2 PHE A 141       5.515  28.690  25.557  1.00 18.22           C  
ATOM    135  CZ  PHE A 141       4.349  28.023  25.184  1.00 18.02           C  
ATOM    136  N   GLY A 142       5.800  31.774  30.854  1.00 20.74           N  
ATOM    137  CA  GLY A 142       6.158  32.739  31.911  1.00 23.48           C  
ATOM    138  C   GLY A 142       5.295  33.996  32.023  1.00 24.92           C  
ATOM    139  O   GLY A 142       5.349  34.710  33.028  1.00 26.12           O  
ATOM    140  N   SER A 143       4.479  34.287  31.017  1.00 26.22           N  
ATOM    141  CA  SER A 143       3.714  35.533  31.043  1.00 26.90           C  
ATOM    142  C   SER A 143       2.303  35.384  30.502  1.00 27.50           C  
ATOM    143  O   SER A 143       2.016  34.468  29.718  1.00 27.03           O  
ATOM    144  CB  SER A 143       4.440  36.577  30.211  1.00 27.83           C  
ATOM    145  OG  SER A 143       4.380  36.204  28.840  1.00 28.98           O  
ATOM    146  N   ASP A 144       1.434  36.300  30.929  1.00 27.79           N  
ATOM    147  CA  ASP A 144       0.077  36.419  30.431  1.00 28.95           C  
ATOM    148  C   ASP A 144       0.118  36.589  28.927  1.00 27.72           C  
ATOM    149  O   ASP A 144      -0.630  35.924  28.198  1.00 27.39           O  
ATOM    150  CB  ASP A 144      -0.606  37.658  31.028  1.00 29.47           C  
ATOM    151  CG  ASP A 144      -1.234  37.400  32.383  1.00 34.13           C  
ATOM    152  OD1 ASP A 144      -1.575  36.236  32.691  1.00 38.77           O  
ATOM    153  OD2 ASP A 144      -1.411  38.382  33.144  1.00 38.67           O  
ATOM    154  N   TYR A 145       0.976  37.491  28.449  1.00 26.94           N  
ATOM    155  CA  TYR A 145       1.090  37.706  27.002  1.00 26.28           C  
ATOM    156  C   TYR A 145       1.381  36.404  26.239  1.00 24.55           C  
ATOM    157  O   TYR A 145       0.759  36.119  25.218  1.00 24.61           O  
ATOM    158  CB  TYR A 145       2.159  38.754  26.629  1.00 27.72           C  
ATOM    159  CG  TYR A 145       2.510  38.634  25.150  1.00 30.16           C  
ATOM    160  CD1 TYR A 145       1.689  39.184  24.168  1.00 31.97           C  
ATOM    161  CD2 TYR A 145       3.619  37.907  24.735  1.00 33.43           C  
ATOM    162  CE1 TYR A 145       1.987  39.043  22.811  1.00 33.79           C  
ATOM    163  CE2 TYR A 145       3.921  37.756  23.386  1.00 35.12           C  
ATOM    164  CZ  TYR A 145       3.109  38.329  22.432  1.00 35.51           C  
ATOM    165  OH  TYR A 145       3.429  38.166  21.101  1.00 36.87           O  
ATOM    166  N   GLU A 146       2.317  35.613  26.728  1.00 21.95           N  
ATOM    167  CA  GLU A 146       2.642  34.361  26.062  1.00 20.76           C  
ATOM    168  C   GLU A 146       1.517  33.349  26.120  1.00 19.01           C  
ATOM    169  O   GLU A 146       1.244  32.655  25.139  1.00 18.07           O  
ATOM    170  CB  GLU A 146       3.894  33.744  26.655  1.00 20.72           C  
ATOM    171  CG  GLU A 146       5.141  34.531  26.396  1.00 23.96           C  
ATOM    172  CD  GLU A 146       6.267  33.986  27.223  1.00 28.24           C  
ATOM    173  OE1 GLU A 146       6.271  34.248  28.446  1.00 30.01           O  
ATOM    174  OE2 GLU A 146       7.118  33.275  26.651  1.00 29.29           O  
ATOM    175  N   ASP A 147       0.886  33.217  27.273  1.00 17.65           N  
ATOM    176  CA  ASP A 147      -0.227  32.279  27.385  1.00 16.98           C  
ATOM    177  C   ASP A 147      -1.346  32.620  26.410  1.00 16.52           C  
ATOM    178  O   ASP A 147      -1.938  31.727  25.806  1.00 15.91           O  
ATOM    179  CB  ASP A 147      -0.792  32.268  28.806  1.00 16.04           C  
ATOM    180  CG  ASP A 147       0.134  31.576  29.806  1.00 17.62           C  
ATOM    181  OD1 ASP A 147       0.984  30.750  29.390  1.00 15.49           O  
ATOM    182  OD2 ASP A 147       0.011  31.875  31.021  1.00 18.87           O  
ATOM    183  N   ARG A 148      -1.627  33.914  26.255  1.00 16.64           N  
ATOM    184  CA  ARG A 148      -2.688  34.338  25.365  1.00 17.58           C  
ATOM    185  C   ARG A 148      -2.299  34.086  23.909  1.00 16.62           C  
ATOM    186  O   ARG A 148      -3.111  33.554  23.122  1.00 17.26           O  
ATOM    187  CB  ARG A 148      -3.006  35.828  25.548  1.00 17.73           C  
ATOM    188  CG  ARG A 148      -4.192  36.219  24.692  1.00 21.97           C  
ATOM    189  CD  ARG A 148      -4.525  37.712  24.803  1.00 28.49           C  
ATOM    190  NE  ARG A 148      -5.365  38.117  23.676  1.00 32.72           N  
ATOM    191  CZ  ARG A 148      -5.802  39.352  23.461  1.00 32.46           C  
ATOM    192  NH1 ARG A 148      -5.476  40.328  24.294  1.00 33.72           N  
ATOM    193  NH2 ARG A 148      -6.556  39.603  22.404  1.00 32.69           N  
ATOM    194  N   TYR A 149      -1.079  34.465  23.547  1.00 15.53           N  
ATOM    195  CA  TYR A 149      -0.586  34.175  22.210  1.00 15.74           C  
ATOM    196  C   TYR A 149      -0.660  32.672  21.909  1.00 14.98           C  
ATOM    197  O   TYR A 149      -1.154  32.247  20.840  1.00 14.31           O  
ATOM    198  CB  TYR A 149       0.838  34.707  22.006  1.00 15.89           C  
ATOM    199  CG  TYR A 149       1.313  34.519  20.576  1.00 16.05           C  
ATOM    200  CD1 TYR A 149       1.148  35.536  19.628  1.00 17.58           C  
ATOM    201  CD2 TYR A 149       1.896  33.330  20.162  1.00 13.18           C  
ATOM    202  CE1 TYR A 149       1.556  35.356  18.316  1.00 16.68           C  
ATOM    203  CE2 TYR A 149       2.297  33.149  18.842  1.00 14.66           C  
ATOM    204  CZ  TYR A 149       2.126  34.176  17.934  1.00 15.09           C  
ATOM    205  OH  TYR A 149       2.510  34.040  16.595  1.00 17.64           O  
ATOM    206  N   TYR A 150      -0.184  31.863  22.856  1.00 14.60           N  
ATOM    207  CA  TYR A 150      -0.204  30.424  22.698  1.00 14.20           C  
ATOM    208  C   TYR A 150      -1.615  29.903  22.465  1.00 13.91           C  
ATOM    209  O   TYR A 150      -1.838  29.125  21.547  1.00 13.30           O  
ATOM    210  CB  TYR A 150       0.431  29.696  23.901  1.00 14.00           C  
ATOM    211  CG  TYR A 150       0.485  28.207  23.645  1.00 13.62           C  
ATOM    212  CD1 TYR A 150       1.436  27.669  22.783  1.00 14.02           C  
ATOM    213  CD2 TYR A 150      -0.453  27.343  24.199  1.00 14.06           C  
ATOM    214  CE1 TYR A 150       1.480  26.321  22.499  1.00 15.20           C  
ATOM    215  CE2 TYR A 150      -0.419  25.985  23.915  1.00 15.74           C  
ATOM    216  CZ  TYR A 150       0.550  25.480  23.059  1.00 14.95           C  
ATOM    217  OH  TYR A 150       0.598  24.133  22.754  1.00 16.40           O  
ATOM    218  N   ARG A 151      -2.571  30.321  23.296  1.00 14.52           N  
ATOM    219  CA  ARG A 151      -3.939  29.845  23.166  1.00 16.47           C  
ATOM    220  C   ARG A 151      -4.512  30.170  21.779  1.00 16.18           C  
ATOM    221  O   ARG A 151      -5.243  29.365  21.189  1.00 16.51           O  
ATOM    222  CB  ARG A 151      -4.813  30.477  24.259  1.00 17.02           C  
ATOM    223  CG  ARG A 151      -6.290  30.301  24.074  1.00 22.27           C  
ATOM    224  CD  ARG A 151      -7.075  30.909  25.247  1.00 25.96           C  
ATOM    225  NE  ARG A 151      -6.861  32.339  25.370  1.00 27.45           N  
ATOM    226  CZ  ARG A 151      -6.330  32.921  26.436  1.00 28.73           C  
ATOM    227  NH1 ARG A 151      -5.974  32.183  27.474  1.00 29.07           N  
ATOM    228  NH2 ARG A 151      -6.174  34.241  26.472  1.00 29.62           N  
ATOM    229  N   GLU A 152      -4.160  31.339  21.264  1.00 17.00           N  
ATOM    230  CA  GLU A 152      -4.717  31.808  20.000  1.00 16.70           C  
ATOM    231  C   GLU A 152      -4.016  31.251  18.773  1.00 15.99           C  
ATOM    232  O   GLU A 152      -4.569  31.302  17.675  1.00 15.38           O  
ATOM    233  CB  GLU A 152      -4.677  33.337  19.962  1.00 18.59           C  
ATOM    234  CG  GLU A 152      -5.660  33.941  20.948  1.00 20.56           C  
ATOM    235  CD  GLU A 152      -5.540  35.445  21.064  1.00 24.25           C  
ATOM    236  OE1 GLU A 152      -4.624  36.043  20.456  1.00 24.60           O  
ATOM    237  OE2 GLU A 152      -6.372  36.037  21.781  1.00 28.08           O  
ATOM    238  N   ASN A 153      -2.807  30.705  18.962  1.00 14.77           N  
ATOM    239  CA  ASN A 153      -2.020  30.195  17.848  1.00 14.80           C  
ATOM    240  C   ASN A 153      -1.787  28.683  17.851  1.00 14.38           C  
ATOM    241  O   ASN A 153      -1.358  28.139  16.860  1.00 13.87           O  
ATOM    242  CB  ASN A 153      -0.662  30.890  17.749  1.00 13.76           C  
ATOM    243  CG  ASN A 153      -0.767  32.342  17.267  1.00 16.33           C  
ATOM    244  OD1 ASN A 153      -0.529  32.637  16.090  1.00 15.13           O  
ATOM    245  ND2 ASN A 153      -1.107  33.239  18.176  1.00 13.62           N  
ATOM    246  N   MET A 154      -2.111  28.014  18.951  1.00 15.23           N  
ATOM    247  CA  MET A 154      -1.728  26.611  19.095  1.00 15.80           C  
ATOM    248  C   MET A 154      -2.335  25.720  18.012  1.00 15.39           C  
ATOM    249  O   MET A 154      -1.768  24.675  17.663  1.00 15.08           O  
ATOM    250  CB  MET A 154      -2.030  26.099  20.505  1.00 16.49           C  
ATOM    251  CG  MET A 154      -3.523  25.908  20.772  1.00 18.87           C  
ATOM    252  SD  MET A 154      -3.801  25.455  22.494  1.00 23.88           S  
ATOM    253  CE  MET A 154      -5.597  25.492  22.478  1.00 19.54           C  
ATOM    254  N   HIS A 155      -3.444  26.157  17.432  1.00 15.33           N  
ATOM    255  CA  HIS A 155      -4.051  25.418  16.340  1.00 14.32           C  
ATOM    256  C   HIS A 155      -3.101  25.270  15.164  1.00 14.13           C  
ATOM    257  O   HIS A 155      -3.257  24.364  14.333  1.00 15.13           O  
ATOM    258  CB  HIS A 155      -5.359  26.078  15.896  1.00 13.96           C  
ATOM    259  CG  HIS A 155      -5.166  27.389  15.212  1.00 13.27           C  
ATOM    260  ND1 HIS A 155      -5.203  27.526  13.841  1.00 15.04           N  
ATOM    261  CD2 HIS A 155      -4.896  28.617  15.707  1.00 13.87           C  
ATOM    262  CE1 HIS A 155      -4.994  28.792  13.523  1.00 14.38           C  
ATOM    263  NE2 HIS A 155      -4.817  29.477  14.635  1.00 15.69           N  
ATOM    264  N   ARG A 156      -2.106  26.148  15.074  1.00 14.12           N  
ATOM    265  CA  ARG A 156      -1.182  26.087  13.964  1.00 13.67           C  
ATOM    266  C   ARG A 156       0.014  25.159  14.211  1.00 13.91           C  
ATOM    267  O   ARG A 156       0.832  24.983  13.313  1.00 14.22           O  
ATOM    268  CB  ARG A 156      -0.648  27.478  13.650  1.00 13.79           C  
ATOM    269  CG  ARG A 156      -1.750  28.528  13.421  1.00 14.26           C  
ATOM    270  CD  ARG A 156      -1.170  29.977  13.466  1.00 17.68           C  
ATOM    271  NE  ARG A 156      -0.003  30.102  12.615  1.00 20.16           N  
ATOM    272  CZ  ARG A 156       1.062  30.833  12.892  1.00 15.68           C  
ATOM    273  NH1 ARG A 156       1.131  31.566  14.006  1.00 18.37           N  
ATOM    274  NH2 ARG A 156       2.071  30.834  12.034  1.00 19.96           N  
ATOM    275  N   TYR A 157       0.114  24.589  15.420  1.00 13.19           N  
ATOM    276  CA  TYR A 157       1.282  23.788  15.826  1.00 13.00           C  
ATOM    277  C   TYR A 157       0.987  22.281  15.707  1.00 13.07           C  
ATOM    278  O   TYR A 157      -0.174  21.888  15.568  1.00 14.08           O  
ATOM    279  CB  TYR A 157       1.722  24.166  17.261  1.00 12.78           C  
ATOM    280  CG  TYR A 157       2.002  25.662  17.461  1.00 13.29           C  
ATOM    281  CD1 TYR A 157       2.356  26.477  16.385  1.00 14.93           C  
ATOM    282  CD2 TYR A 157       1.905  26.240  18.717  1.00 12.93           C  
ATOM    283  CE1 TYR A 157       2.626  27.857  16.572  1.00 13.36           C  
ATOM    284  CE2 TYR A 157       2.165  27.603  18.919  1.00 14.95           C  
ATOM    285  CZ  TYR A 157       2.519  28.393  17.831  1.00 14.83           C  
ATOM    286  OH  TYR A 157       2.758  29.728  18.026  1.00 14.00           O  
ATOM    287  N   PRO A 158       2.031  21.429  15.741  1.00 12.77           N  
ATOM    288  CA  PRO A 158       1.828  19.991  15.553  1.00 14.01           C  
ATOM    289  C   PRO A 158       1.008  19.319  16.673  1.00 14.06           C  
ATOM    290  O   PRO A 158       1.025  19.812  17.788  1.00 14.93           O  
ATOM    291  CB  PRO A 158       3.268  19.406  15.604  1.00 12.65           C  
ATOM    292  CG  PRO A 158       4.196  20.534  15.500  1.00 13.87           C  
ATOM    293  CD  PRO A 158       3.451  21.808  15.852  1.00 13.01           C  
ATOM    294  N   ASN A 159       0.291  18.222  16.385  1.00 15.16           N  
ATOM    295  CA  ASN A 159      -0.309  17.440  17.472  1.00 16.45           C  
ATOM    296  C   ASN A 159       0.058  15.976  17.393  1.00 15.52           C  
ATOM    297  O   ASN A 159      -0.544  15.115  18.041  1.00 15.63           O  
ATOM    298  CB  ASN A 159      -1.823  17.614  17.596  1.00 18.66           C  
ATOM    299  CG  ASN A 159      -2.557  16.900  16.538  1.00 22.01           C  
ATOM    300  OD1 ASN A 159      -2.081  16.780  15.412  1.00 23.56           O  
ATOM    301  ND2 ASN A 159      -3.728  16.363  16.894  1.00 28.16           N  
ATOM    302  N   GLN A 160       1.093  15.723  16.617  1.00 14.64           N  
ATOM    303  CA  GLN A 160       1.645  14.394  16.403  1.00 14.24           C  
ATOM    304  C   GLN A 160       3.134  14.599  16.200  1.00 13.67           C  
ATOM    305  O   GLN A 160       3.519  15.520  15.474  1.00 13.78           O  
ATOM    306  CB  GLN A 160       1.045  13.856  15.128  1.00 15.49           C  
ATOM    307  CG  GLN A 160       1.165  12.416  14.907  1.00 17.49           C  
ATOM    308  CD  GLN A 160       0.177  11.937  13.850  1.00 19.67           C  
ATOM    309  OE1 GLN A 160      -0.336  12.733  13.022  1.00 18.54           O  
ATOM    310  NE2 GLN A 160      -0.115  10.647  13.884  1.00 16.76           N  
ATOM    311  N   VAL A 161       3.979  13.753  16.793  1.00 12.87           N  
ATOM    312  CA  VAL A 161       5.433  13.999  16.717  1.00 11.62           C  
ATOM    313  C   VAL A 161       6.181  12.893  15.954  1.00 12.10           C  
ATOM    314  O   VAL A 161       5.776  11.730  15.974  1.00 11.70           O  
ATOM    315  CB  VAL A 161       6.089  14.223  18.105  1.00 11.10           C  
ATOM    316  CG1 VAL A 161       5.416  15.407  18.835  1.00 12.51           C  
ATOM    317  CG2 VAL A 161       6.033  12.962  18.981  1.00 12.83           C  
ATOM    318  N   TYR A 162       7.281  13.281  15.313  1.00 12.04           N  
ATOM    319  CA  TYR A 162       8.142  12.331  14.608  1.00 11.98           C  
ATOM    320  C   TYR A 162       9.184  11.930  15.623  1.00 12.22           C  
ATOM    321  O   TYR A 162       9.708  12.791  16.326  1.00 13.04           O  
ATOM    322  CB  TYR A 162       8.892  13.047  13.490  1.00 11.80           C  
ATOM    323  CG  TYR A 162       8.114  13.232  12.243  1.00 14.14           C  
ATOM    324  CD1 TYR A 162       7.514  14.442  11.954  1.00 14.53           C  
ATOM    325  CD2 TYR A 162       7.983  12.186  11.336  1.00 16.33           C  
ATOM    326  CE1 TYR A 162       6.795  14.606  10.780  1.00 16.84           C  
ATOM    327  CE2 TYR A 162       7.260  12.343  10.167  1.00 16.89           C  
ATOM    328  CZ  TYR A 162       6.674  13.537   9.896  1.00 18.28           C  
ATOM    329  OH  TYR A 162       5.951  13.670   8.720  1.00 22.56           O  
ATOM    330  N   TYR A 163       9.514  10.639  15.691  1.00 12.52           N  
ATOM    331  CA  TYR A 163      10.559  10.178  16.583  1.00 12.52           C  
ATOM    332  C   TYR A 163      11.281   9.024  15.915  1.00 12.14           C  
ATOM    333  O   TYR A 163      10.810   8.430  14.924  1.00 13.08           O  
ATOM    334  CB  TYR A 163      10.025   9.786  17.980  1.00 12.66           C  
ATOM    335  CG  TYR A 163       9.180   8.537  17.922  1.00 12.39           C  
ATOM    336  CD1 TYR A 163       9.731   7.286  18.196  1.00 12.80           C  
ATOM    337  CD2 TYR A 163       7.858   8.599  17.478  1.00 12.70           C  
ATOM    338  CE1 TYR A 163       8.973   6.130  18.088  1.00 16.17           C  
ATOM    339  CE2 TYR A 163       7.077   7.455  17.377  1.00 15.06           C  
ATOM    340  CZ  TYR A 163       7.654   6.210  17.679  1.00 15.44           C  
ATOM    341  OH  TYR A 163       6.884   5.080  17.565  1.00 17.71           O  
ATOM    342  N   ARG A 164      12.432   8.714  16.477  1.00 13.54           N  
ATOM    343  CA  ARG A 164      13.355   7.756  15.894  1.00 13.29           C  
ATOM    344  C   ARG A 164      13.445   6.538  16.815  1.00 14.22           C  
ATOM    345  O   ARG A 164      14.009   6.627  17.915  1.00 13.87           O  
ATOM    346  CB  ARG A 164      14.708   8.455  15.801  1.00 14.44           C  
ATOM    347  CG  ARG A 164      15.696   7.705  14.988  1.00 14.14           C  
ATOM    348  CD  ARG A 164      16.959   8.533  14.748  1.00 16.15           C  
ATOM    349  NE  ARG A 164      17.921   7.646  14.086  1.00 14.94           N  
ATOM    350  CZ  ARG A 164      18.958   7.058  14.698  1.00 18.14           C  
ATOM    351  NH1 ARG A 164      19.230   7.261  15.988  1.00 16.40           N  
ATOM    352  NH2 ARG A 164      19.738   6.271  14.001  1.00 17.15           N  
ATOM    353  N   PRO A 165      12.820   5.413  16.413  1.00 14.70           N  
ATOM    354  CA  PRO A 165      12.889   4.209  17.249  1.00 15.11           C  
ATOM    355  C   PRO A 165      14.313   3.830  17.660  1.00 15.26           C  
ATOM    356  O   PRO A 165      14.525   3.421  18.796  1.00 14.82           O  
ATOM    357  CB  PRO A 165      12.261   3.146  16.358  1.00 15.49           C  
ATOM    358  CG  PRO A 165      11.165   3.915  15.631  1.00 15.28           C  
ATOM    359  CD  PRO A 165      11.877   5.247  15.292  1.00 14.65           C  
ATOM    360  N   MET A 166      15.301   4.026  16.795  1.00 15.79           N  
ATOM    361  CA  MET A 166      16.680   3.727  17.198  1.00 15.76           C  
ATOM    362  C   MET A 166      17.184   4.619  18.327  1.00 16.02           C  
ATOM    363  O   MET A 166      18.133   4.275  19.010  1.00 15.34           O  
ATOM    364  CB  MET A 166      17.650   3.787  16.003  1.00 16.91           C  
ATOM    365  CG  MET A 166      17.686   2.530  15.154  1.00 18.17           C  
ATOM    366  SD  MET A 166      18.206   1.085  16.129  1.00 22.54           S  
ATOM    367  CE  MET A 166      19.822   1.571  16.670  1.00 19.64           C  
ATOM    368  N   ASP A 167      16.596   5.803  18.499  1.00 14.23           N  
ATOM    369  CA  ASP A 167      16.984   6.638  19.631  1.00 13.66           C  
ATOM    370  C   ASP A 167      16.604   5.986  20.965  1.00 13.42           C  
ATOM    371  O   ASP A 167      17.064   6.417  22.013  1.00 13.72           O  
ATOM    372  CB  ASP A 167      16.334   8.020  19.532  1.00 13.43           C  
ATOM    373  CG  ASP A 167      17.095   8.970  18.600  1.00 14.37           C  
ATOM    374  OD1 ASP A 167      18.205   8.634  18.153  1.00 14.46           O  
ATOM    375  OD2 ASP A 167      16.554  10.063  18.306  1.00 13.73           O  
ATOM    376  N   GLU A 168      15.747   4.967  20.952  1.00 13.72           N  
ATOM    377  CA  GLU A 168      15.463   4.247  22.193  1.00 14.89           C  
ATOM    378  C   GLU A 168      16.687   3.443  22.624  1.00 15.40           C  
ATOM    379  O   GLU A 168      16.756   2.997  23.767  1.00 15.36           O  
ATOM    380  CB  GLU A 168      14.214   3.357  22.059  1.00 14.66           C  
ATOM    381  CG  GLU A 168      13.023   4.200  21.543  1.00 16.26           C  
ATOM    382  CD  GLU A 168      11.721   3.448  21.312  1.00 18.27           C  
ATOM    383  OE1 GLU A 168      11.591   2.261  21.672  1.00 20.05           O  
ATOM    384  OE2 GLU A 168      10.798   4.109  20.792  1.00 17.55           O  
ATOM    385  N   TYR A 169      17.641   3.248  21.717  1.00 16.85           N  
ATOM    386  CA  TYR A 169      18.940   2.668  22.114  1.00 18.44           C  
ATOM    387  C   TYR A 169      19.948   3.743  22.538  1.00 20.10           C  
ATOM    388  O   TYR A 169      21.096   3.428  22.832  1.00 22.20           O  
ATOM    389  CB  TYR A 169      19.521   1.815  20.991  1.00 17.77           C  
ATOM    390  CG  TYR A 169      18.803   0.509  20.798  1.00 18.34           C  
ATOM    391  CD1 TYR A 169      17.536   0.465  20.222  1.00 18.14           C  
ATOM    392  CD2 TYR A 169      19.390  -0.693  21.210  1.00 18.77           C  
ATOM    393  CE1 TYR A 169      16.866  -0.729  20.065  1.00 19.48           C  
ATOM    394  CE2 TYR A 169      18.739  -1.882  21.054  1.00 19.08           C  
ATOM    395  CZ  TYR A 169      17.489  -1.905  20.480  1.00 18.85           C  
ATOM    396  OH  TYR A 169      16.855  -3.101  20.347  1.00 21.71           O  
ATOM    397  N   SER A 170      19.519   4.999  22.584  1.00 21.80           N  
ATOM    398  CA  SER A 170      20.356   6.097  23.088  1.00 22.84           C  
ATOM    399  C   SER A 170      19.702   6.709  24.321  1.00 22.93           C  
ATOM    400  O   SER A 170      18.755   6.145  24.860  1.00 23.78           O  
ATOM    401  CB  SER A 170      20.563   7.156  21.997  1.00 23.49           C  
ATOM    402  OG  SER A 170      19.378   7.903  21.807  1.00 26.15           O  
ATOM    403  N   ASN A 171      20.168   7.851  24.805  1.00 22.17           N  
ATOM    404  CA  ASN A 171      19.571   8.369  26.031  1.00 21.96           C  
ATOM    405  C   ASN A 171      18.304   9.178  25.764  1.00 20.98           C  
ATOM    406  O   ASN A 171      18.037   9.566  24.616  1.00 19.76           O  
ATOM    407  CB  ASN A 171      20.579   9.138  26.901  1.00 22.80           C  
ATOM    408  CG  ASN A 171      20.920  10.477  26.337  1.00 26.30           C  
ATOM    409  OD1 ASN A 171      20.152  11.436  26.491  1.00 29.80           O  
ATOM    410  ND2 ASN A 171      22.077  10.571  25.677  1.00 26.44           N  
ATOM    411  N   GLN A 172      17.527   9.409  26.823  1.00 20.60           N  
ATOM    412  CA  GLN A 172      16.247  10.140  26.734  1.00 20.83           C  
ATOM    413  C   GLN A 172      16.423  11.518  26.150  1.00 19.64           C  
ATOM    414  O   GLN A 172      15.585  11.992  25.391  1.00 18.31           O  
ATOM    415  CB  GLN A 172      15.600  10.287  28.122  1.00 21.40           C  
ATOM    416  CG  GLN A 172      14.151  10.863  28.128  1.00 24.82           C  
ATOM    417  CD  GLN A 172      14.018  12.332  28.568  1.00 32.12           C  
ATOM    418  OE1 GLN A 172      14.951  13.148  28.415  1.00 34.30           O  
ATOM    419  NE2 GLN A 172      12.839  12.677  29.119  1.00 29.23           N  
ATOM    420  N   ASN A 173      17.493  12.192  26.543  1.00 19.21           N  
ATOM    421  CA  ASN A 173      17.687  13.554  26.078  1.00 19.82           C  
ATOM    422  C   ASN A 173      17.837  13.622  24.556  1.00 19.12           C  
ATOM    423  O   ASN A 173      17.294  14.526  23.904  1.00 18.78           O  
ATOM    424  CB  ASN A 173      18.870  14.231  26.785  1.00 19.83           C  
ATOM    425  CG  ASN A 173      18.888  15.732  26.557  1.00 22.87           C  
ATOM    426  OD1 ASN A 173      18.080  16.467  27.132  1.00 27.71           O  
ATOM    427  ND2 ASN A 173      19.789  16.195  25.703  1.00 20.18           N  
ATOM    428  N   ASN A 174      18.563  12.656  24.008  1.00 19.01           N  
ATOM    429  CA AASN A 174      18.742  12.552  22.580  0.50 18.43           C  
ATOM    430  CA BASN A 174      18.758  12.506  22.564  0.50 18.67           C  
ATOM    431  C   ASN A 174      17.453  12.244  21.809  1.00 17.94           C  
ATOM    432  O   ASN A 174      17.161  12.890  20.804  1.00 17.30           O  
ATOM    433  CB AASN A 174      19.787  11.508  22.264  0.50 19.07           C  
ATOM    434  CB BASN A 174      19.736  11.367  22.257  0.50 19.71           C  
ATOM    435  CG AASN A 174      20.245  11.586  20.850  0.50 18.93           C  
ATOM    436  CG BASN A 174      21.174  11.706  22.626  0.50 20.28           C  
ATOM    437  OD1AASN A 174      20.881  12.569  20.435  0.50 20.01           O  
ATOM    438  OD1BASN A 174      21.484  12.844  22.972  0.50 23.95           O  
ATOM    439  ND2AASN A 174      19.925  10.570  20.088  0.50 16.80           N  
ATOM    440  ND2BASN A 174      22.060  10.722  22.533  0.50 23.27           N  
ATOM    441  N   PHE A 175      16.698  11.250  22.273  1.00 16.05           N  
ATOM    442  CA  PHE A 175      15.413  10.916  21.680  1.00 14.39           C  
ATOM    443  C   PHE A 175      14.543  12.180  21.627  1.00 13.12           C  
ATOM    444  O   PHE A 175      13.914  12.479  20.601  1.00 13.08           O  
ATOM    445  CB  PHE A 175      14.749   9.833  22.550  1.00 14.13           C  
ATOM    446  CG  PHE A 175      13.392   9.433  22.115  1.00 12.20           C  
ATOM    447  CD1 PHE A 175      13.183   8.214  21.502  1.00 12.66           C  
ATOM    448  CD2 PHE A 175      12.291  10.267  22.347  1.00 12.94           C  
ATOM    449  CE1 PHE A 175      11.924   7.809  21.083  1.00 13.22           C  
ATOM    450  CE2 PHE A 175      11.007   9.861  21.945  1.00 12.19           C  
ATOM    451  CZ  PHE A 175      10.825   8.640  21.303  1.00 14.29           C  
ATOM    452  N   VAL A 176      14.492  12.910  22.735  1.00 12.57           N  
ATOM    453  CA  VAL A 176      13.589  14.069  22.828  1.00 12.76           C  
ATOM    454  C   VAL A 176      14.059  15.170  21.896  1.00 12.73           C  
ATOM    455  O   VAL A 176      13.263  15.785  21.140  1.00 12.66           O  
ATOM    456  CB  VAL A 176      13.475  14.581  24.295  1.00 12.33           C  
ATOM    457  CG1 VAL A 176      12.762  15.908  24.400  1.00 13.31           C  
ATOM    458  CG2 VAL A 176      12.711  13.566  25.131  1.00 13.97           C  
ATOM    459  N   HIS A 177      15.352  15.465  21.953  1.00 13.06           N  
ATOM    460  CA AHIS A 177      15.764  16.571  21.139  0.50 12.88           C  
ATOM    461  CA BHIS A 177      15.963  16.515  21.114  0.50 13.38           C  
ATOM    462  C   HIS A 177      15.735  16.227  19.642  1.00 12.70           C  
ATOM    463  O   HIS A 177      15.363  17.090  18.858  1.00 11.89           O  
ATOM    464  CB AHIS A 177      17.018  17.271  21.692  0.50 13.13           C  
ATOM    465  CB BHIS A 177      17.475  16.614  21.394  0.50 14.20           C  
ATOM    466  CG AHIS A 177      16.730  18.120  22.899  0.50 13.73           C  
ATOM    467  CG BHIS A 177      18.243  17.416  20.377  0.50 16.09           C  
ATOM    468  ND1AHIS A 177      16.599  17.599  24.172  0.50 15.02           N  
ATOM    469  ND1BHIS A 177      18.663  18.710  20.606  0.50 19.42           N  
ATOM    470  CD2AHIS A 177      16.497  19.451  23.014  0.50 15.38           C  
ATOM    471  CD2BHIS A 177      18.674  17.100  19.132  0.50 17.12           C  
ATOM    472  CE1AHIS A 177      16.319  18.574  25.019  0.50 15.12           C  
ATOM    473  CE1BHIS A 177      19.314  19.158  19.548  0.50 18.13           C  
ATOM    474  NE2AHIS A 177      16.253  19.707  24.343  0.50 16.97           N  
ATOM    475  NE2BHIS A 177      19.336  18.198  18.638  0.50 18.65           N  
ATOM    476  N   ASP A 178      15.995  14.983  19.253  1.00 12.61           N  
ATOM    477  CA  ASP A 178      15.783  14.609  17.846  1.00 13.73           C  
ATOM    478  C   ASP A 178      14.312  14.772  17.435  1.00 12.84           C  
ATOM    479  O   ASP A 178      14.004  15.254  16.334  1.00 12.30           O  
ATOM    480  CB  ASP A 178      16.216  13.157  17.567  1.00 13.90           C  
ATOM    481  CG  ASP A 178      17.729  12.973  17.506  1.00 17.16           C  
ATOM    482  OD1 ASP A 178      18.493  13.961  17.453  1.00 19.64           O  
ATOM    483  OD2 ASP A 178      18.165  11.800  17.508  1.00 18.83           O  
ATOM    484  N   CYS A 179      13.405  14.359  18.319  1.00 11.57           N  
ATOM    485  CA  CYS A 179      11.967  14.425  18.062  1.00 11.90           C  
ATOM    486  C   CYS A 179      11.550  15.883  17.934  1.00 12.01           C  
ATOM    487  O   CYS A 179      10.785  16.253  17.028  1.00 11.36           O  
ATOM    488  CB  CYS A 179      11.215  13.687  19.209  1.00 12.60           C  
ATOM    489  SG  CYS A 179       9.422  13.907  19.283  1.00 12.78           S  
ATOM    490  N   VAL A 180      12.081  16.748  18.810  1.00 11.49           N  
ATOM    491  CA  VAL A 180      11.724  18.170  18.723  1.00 12.43           C  
ATOM    492  C   VAL A 180      12.225  18.776  17.416  1.00 12.77           C  
ATOM    493  O   VAL A 180      11.467  19.474  16.709  1.00 12.62           O  
ATOM    494  CB  VAL A 180      12.312  18.939  19.909  1.00 11.82           C  
ATOM    495  CG1 VAL A 180      12.181  20.468  19.696  1.00 12.98           C  
ATOM    496  CG2 VAL A 180      11.636  18.470  21.211  1.00  9.96           C  
ATOM    497  N   ASN A 181      13.496  18.509  17.090  1.00 13.51           N  
ATOM    498  CA AASN A 181      14.088  19.088  15.897  0.50 13.86           C  
ATOM    499  CA BASN A 181      14.130  19.025  15.877  0.50 13.72           C  
ATOM    500  C   ASN A 181      13.383  18.643  14.605  1.00 14.17           C  
ATOM    501  O   ASN A 181      12.994  19.496  13.777  1.00 13.01           O  
ATOM    502  CB AASN A 181      15.608  18.831  15.832  0.50 14.55           C  
ATOM    503  CB BASN A 181      15.572  18.500  15.782  0.50 14.11           C  
ATOM    504  CG AASN A 181      16.375  19.448  17.007  0.50 15.59           C  
ATOM    505  CG BASN A 181      16.295  18.979  14.529  0.50 14.93           C  
ATOM    506  OD1AASN A 181      17.517  19.069  17.275  0.50 19.66           O  
ATOM    507  OD1BASN A 181      16.519  20.181  14.349  0.50 16.29           O  
ATOM    508  ND2AASN A 181      15.751  20.368  17.724  0.50 17.21           N  
ATOM    509  ND2BASN A 181      16.675  18.037  13.656  0.50 14.55           N  
ATOM    510  N   ILE A 182      13.169  17.345  14.438  1.00 13.00           N  
ATOM    511  CA  ILE A 182      12.555  16.853  13.215  1.00 13.76           C  
ATOM    512  C   ILE A 182      11.081  17.220  13.128  1.00 13.36           C  
ATOM    513  O   ILE A 182      10.580  17.583  12.062  1.00 12.29           O  
ATOM    514  CB  ILE A 182      12.724  15.330  13.076  1.00 15.83           C  
ATOM    515  CG1 ILE A 182      14.215  14.997  12.977  1.00 17.77           C  
ATOM    516  CG2 ILE A 182      11.932  14.806  11.878  1.00 15.48           C  
ATOM    517  CD1 ILE A 182      14.961  15.688  11.825  1.00 22.30           C  
ATOM    518  N   THR A 183      10.385  17.164  14.255  1.00 12.03           N  
ATOM    519  CA  THR A 183       8.978  17.516  14.248  1.00 11.38           C  
ATOM    520  C   THR A 183       8.795  18.977  13.818  1.00 11.49           C  
ATOM    521  O   THR A 183       7.972  19.285  12.973  1.00 11.00           O  
ATOM    522  CB  THR A 183       8.332  17.252  15.618  1.00 11.08           C  
ATOM    523  OG1 THR A 183       8.375  15.845  15.896  1.00  9.35           O  
ATOM    524  CG2 THR A 183       6.893  17.700  15.624  1.00 10.14           C  
ATOM    525  N   ILE A 184       9.573  19.881  14.388  1.00 10.39           N  
ATOM    526  CA  ILE A 184       9.356  21.296  14.081  1.00 11.19           C  
ATOM    527  C   ILE A 184       9.826  21.623  12.663  1.00 11.20           C  
ATOM    528  O   ILE A 184       9.169  22.361  11.932  1.00 10.71           O  
ATOM    529  CB  ILE A 184      10.038  22.196  15.137  1.00 11.64           C  
ATOM    530  CG1 ILE A 184       9.250  22.092  16.453  1.00 10.32           C  
ATOM    531  CG2 ILE A 184      10.107  23.670  14.618  1.00 12.61           C  
ATOM    532  CD1 ILE A 184       9.863  22.911  17.629  1.00 11.18           C  
ATOM    533  N   LYS A 185      10.933  21.030  12.234  1.00 11.28           N  
ATOM    534  CA  LYS A 185      11.412  21.242  10.851  1.00 12.47           C  
ATOM    535  C   LYS A 185      10.423  20.668   9.805  1.00 12.51           C  
ATOM    536  O   LYS A 185      10.073  21.359   8.834  1.00 12.91           O  
ATOM    537  CB  LYS A 185      12.829  20.673  10.675  1.00 13.04           C  
ATOM    538  CG  LYS A 185      13.880  21.558  11.384  1.00 14.34           C  
ATOM    539  CD  LYS A 185      15.295  20.989  11.379  1.00 17.30           C  
ATOM    540  CE  LYS A 185      16.257  22.070  11.895  1.00 21.35           C  
ATOM    541  NZ  LYS A 185      17.628  21.486  12.044  1.00 22.68           N  
ATOM    542  N   GLN A 186       9.911  19.449  10.020  1.00 12.00           N  
ATOM    543  CA  GLN A 186       8.945  18.900   9.057  1.00 12.42           C  
ATOM    544  C   GLN A 186       7.685  19.747   9.054  1.00 11.47           C  
ATOM    545  O   GLN A 186       7.095  19.975   8.011  1.00 12.16           O  
ATOM    546  CB  GLN A 186       8.551  17.479   9.411  1.00 12.98           C  
ATOM    547  CG  GLN A 186       9.680  16.514   9.230  1.00 16.86           C  
ATOM    548  CD  GLN A 186       9.981  16.265   7.794  1.00 23.63           C  
ATOM    549  OE1 GLN A 186      10.532  17.125   7.081  1.00 27.44           O  
ATOM    550  NE2 GLN A 186       9.631  15.074   7.341  1.00 28.60           N  
ATOM    551  N   HIS A 187       7.258  20.201  10.228  1.00 11.23           N  
ATOM    552  CA  HIS A 187       6.016  20.981  10.280  1.00 11.36           C  
ATOM    553  C   HIS A 187       6.208  22.324   9.597  1.00 12.27           C  
ATOM    554  O   HIS A 187       5.268  22.876   8.991  1.00 13.84           O  
ATOM    555  CB  HIS A 187       5.576  21.146  11.731  1.00 10.82           C  
ATOM    556  CG  HIS A 187       4.221  21.733  11.885  1.00 11.10           C  
ATOM    557  ND1 HIS A 187       3.078  21.053  11.520  1.00 12.95           N  
ATOM    558  CD2 HIS A 187       3.823  22.931  12.365  1.00 11.61           C  
ATOM    559  CE1 HIS A 187       2.026  21.819  11.777  1.00 13.29           C  
ATOM    560  NE2 HIS A 187       2.453  22.955  12.291  1.00 14.34           N  
ATOM    561  N   THR A 188       7.424  22.856   9.686  1.00 12.28           N  
ATOM    562  CA  THR A 188       7.752  24.091   8.978  1.00 13.49           C  
ATOM    563  C   THR A 188       7.692  23.873   7.472  1.00 13.76           C  
ATOM    564  O   THR A 188       7.117  24.700   6.729  1.00 14.32           O  
ATOM    565  CB  THR A 188       9.135  24.601   9.398  1.00 13.01           C  
ATOM    566  OG1 THR A 188       9.086  24.899  10.798  1.00 14.45           O  
ATOM    567  CG2 THR A 188       9.512  25.872   8.626  1.00 13.94           C  
ATOM    568  N   VAL A 189       8.301  22.787   7.015  1.00 14.01           N  
ATOM    569  CA  VAL A 189       8.235  22.434   5.590  1.00 16.01           C  
ATOM    570  C   VAL A 189       6.768  22.305   5.122  1.00 17.44           C  
ATOM    571  O   VAL A 189       6.412  22.799   4.069  1.00 16.85           O  
ATOM    572  CB  VAL A 189       9.057  21.181   5.277  1.00 15.27           C  
ATOM    573  CG1 VAL A 189       8.780  20.640   3.817  1.00 17.31           C  
ATOM    574  CG2 VAL A 189      10.545  21.488   5.463  1.00 15.06           C  
ATOM    575  N   THR A 190       5.939  21.595   5.884  1.00 18.98           N  
ATOM    576  CA  THR A 190       4.514  21.477   5.579  1.00 21.51           C  
ATOM    577  C   THR A 190       3.794  22.821   5.593  1.00 21.93           C  
ATOM    578  O   THR A 190       2.918  23.080   4.766  1.00 23.52           O  
ATOM    579  CB  THR A 190       3.824  20.550   6.613  1.00 21.87           C  
ATOM    580  OG1 THR A 190       4.274  19.210   6.402  1.00 24.44           O  
ATOM    581  CG2 THR A 190       2.317  20.637   6.487  1.00 23.98           C  
ATOM    582  N   THR A 191       4.177  23.695   6.508  1.00 22.71           N  
ATOM    583  CA  THR A 191       3.491  24.960   6.684  1.00 24.25           C  
ATOM    584  C   THR A 191       3.846  25.935   5.571  1.00 24.96           C  
ATOM    585  O   THR A 191       2.988  26.654   5.057  1.00 25.29           O  
ATOM    586  CB  THR A 191       3.828  25.574   8.043  1.00 23.65           C  
ATOM    587  OG1 THR A 191       3.221  24.777   9.059  1.00 25.59           O  
ATOM    588  CG2 THR A 191       3.299  27.019   8.143  1.00 24.02           C  
ATOM    589  N   THR A 192       5.121  25.940   5.211  1.00 26.36           N  
ATOM    590  CA  THR A 192       5.620  26.705   4.079  1.00 28.27           C  
ATOM    591  C   THR A 192       4.853  26.385   2.796  1.00 29.25           C  
ATOM    592  O   THR A 192       4.516  27.274   2.009  1.00 29.06           O  
ATOM    593  CB  THR A 192       7.110  26.402   3.877  1.00 28.36           C  
ATOM    594  OG1 THR A 192       7.855  27.082   4.895  1.00 29.65           O  
ATOM    595  CG2 THR A 192       7.559  26.868   2.500  1.00 29.15           C  
ATOM    596  N   THR A 193       4.553  25.115   2.585  1.00 30.26           N  
ATOM    597  CA  THR A 193       3.798  24.749   1.402  1.00 31.71           C  
ATOM    598  C   THR A 193       2.394  25.383   1.346  1.00 32.58           C  
ATOM    599  O   THR A 193       1.817  25.498   0.274  1.00 33.25           O  
ATOM    600  CB  THR A 193       3.757  23.236   1.223  1.00 31.62           C  
ATOM    601  OG1 THR A 193       5.065  22.712   1.490  1.00 32.50           O  
ATOM    602  CG2 THR A 193       3.375  22.907  -0.200  1.00 32.33           C  
ATOM    603  N   LYS A 194       1.863  25.810   2.489  1.00 32.90           N  
ATOM    604  CA  LYS A 194       0.564  26.462   2.540  1.00 33.86           C  
ATOM    605  C   LYS A 194       0.699  27.978   2.472  1.00 33.47           C  
ATOM    606  O   LYS A 194      -0.257  28.692   2.779  1.00 33.70           O  
ATOM    607  CB  LYS A 194      -0.176  26.104   3.830  1.00 34.44           C  
ATOM    608  CG  LYS A 194      -0.458  24.619   4.028  1.00 37.47           C  
ATOM    609  CD  LYS A 194      -0.908  24.394   5.461  1.00 39.77           C  
ATOM    610  CE  LYS A 194      -1.730  25.592   5.928  1.00 42.31           C  
ATOM    611  NZ  LYS A 194      -2.030  25.555   7.389  1.00 45.00           N  
ATOM    612  N   GLY A 195       1.889  28.458   2.098  1.00 32.93           N  
ATOM    613  CA  GLY A 195       2.162  29.892   1.982  1.00 32.23           C  
ATOM    614  C   GLY A 195       2.359  30.608   3.311  1.00 31.82           C  
ATOM    615  O   GLY A 195       2.270  31.844   3.396  1.00 31.85           O  
ATOM    616  N   GLU A 196       2.644  29.845   4.358  1.00 30.75           N  
ATOM    617  CA  GLU A 196       2.737  30.431   5.685  1.00 30.15           C  
ATOM    618  C   GLU A 196       4.124  30.343   6.328  1.00 29.27           C  
ATOM    619  O   GLU A 196       4.994  29.599   5.870  1.00 29.19           O  
ATOM    620  CB  GLU A 196       1.672  29.820   6.567  1.00 30.08           C  
ATOM    621  CG  GLU A 196       0.302  30.179   6.038  1.00 31.49           C  
ATOM    622  CD  GLU A 196      -0.806  29.794   6.976  1.00 33.25           C  
ATOM    623  OE1 GLU A 196      -0.602  28.895   7.822  1.00 33.24           O  
ATOM    624  OE2 GLU A 196      -1.891  30.398   6.863  1.00 35.79           O  
ATOM    625  N   ASN A 197       4.315  31.099   7.402  1.00 28.42           N  
ATOM    626  CA  ASN A 197       5.636  31.323   7.943  1.00 27.92           C  
ATOM    627  C   ASN A 197       5.507  31.257   9.443  1.00 26.21           C  
ATOM    628  O   ASN A 197       4.489  31.675   9.986  1.00 27.38           O  
ATOM    629  CB  ASN A 197       6.110  32.721   7.541  1.00 29.05           C  
ATOM    630  CG  ASN A 197       7.569  32.760   7.145  1.00 33.11           C  
ATOM    631  OD1 ASN A 197       7.999  32.044   6.234  1.00 37.52           O  
ATOM    632  ND2 ASN A 197       8.346  33.611   7.821  1.00 36.86           N  
ATOM    633  N   PHE A 198       6.510  30.724  10.124  1.00 23.18           N  
ATOM    634  CA  PHE A 198       6.486  30.757  11.578  1.00 21.25           C  
ATOM    635  C   PHE A 198       7.492  31.800  12.004  1.00 20.51           C  
ATOM    636  O   PHE A 198       8.598  31.819  11.486  1.00 20.21           O  
ATOM    637  CB  PHE A 198       6.881  29.403  12.184  1.00 20.17           C  
ATOM    638  CG  PHE A 198       5.813  28.339  12.066  1.00 17.50           C  
ATOM    639  CD1 PHE A 198       6.071  27.166  11.376  1.00 17.76           C  
ATOM    640  CD2 PHE A 198       4.593  28.503  12.667  1.00 15.59           C  
ATOM    641  CE1 PHE A 198       5.110  26.178  11.261  1.00 17.44           C  
ATOM    642  CE2 PHE A 198       3.595  27.518  12.559  1.00 17.86           C  
ATOM    643  CZ  PHE A 198       3.858  26.360  11.857  1.00 16.12           C  
ATOM    644  N   THR A 199       7.097  32.642  12.941  1.00 19.86           N  
ATOM    645  CA  THR A 199       7.995  33.631  13.540  1.00 19.81           C  
ATOM    646  C   THR A 199       8.886  33.023  14.632  1.00 19.36           C  
ATOM    647  O   THR A 199       8.691  31.884  15.061  1.00 18.36           O  
ATOM    648  CB  THR A 199       7.201  34.765  14.193  1.00 19.48           C  
ATOM    649  OG1 THR A 199       6.472  34.270  15.332  1.00 18.40           O  
ATOM    650  CG2 THR A 199       6.214  35.406  13.190  1.00 21.22           C  
ATOM    651  N   GLU A 200       9.855  33.798  15.117  1.00 18.77           N  
ATOM    652  CA  GLU A 200      10.666  33.332  16.246  1.00 18.87           C  
ATOM    653  C   GLU A 200       9.776  32.990  17.425  1.00 17.78           C  
ATOM    654  O   GLU A 200      10.050  32.034  18.165  1.00 17.25           O  
ATOM    655  CB  GLU A 200      11.671  34.411  16.666  1.00 19.40           C  
ATOM    656  CG  GLU A 200      12.429  34.942  15.481  1.00 24.10           C  
ATOM    657  CD  GLU A 200      13.426  36.027  15.862  1.00 27.46           C  
ATOM    658  OE1 GLU A 200      13.744  36.158  17.074  1.00 30.45           O  
ATOM    659  OE2 GLU A 200      13.877  36.740  14.943  1.00 28.75           O  
ATOM    660  N   THR A 201       8.711  33.768  17.617  1.00 17.37           N  
ATOM    661  CA  THR A 201       7.810  33.505  18.733  1.00 18.04           C  
ATOM    662  C   THR A 201       7.129  32.160  18.541  1.00 16.59           C  
ATOM    663  O   THR A 201       7.041  31.373  19.478  1.00 16.24           O  
ATOM    664  CB  THR A 201       6.751  34.610  18.926  1.00 18.94           C  
ATOM    665  OG1 THR A 201       7.426  35.830  19.261  1.00 21.18           O  
ATOM    666  CG2 THR A 201       5.826  34.248  20.070  1.00 20.67           C  
ATOM    667  N   ASP A 202       6.683  31.885  17.333  1.00 15.24           N  
ATOM    668  CA  ASP A 202       6.029  30.593  17.053  1.00 13.98           C  
ATOM    669  C   ASP A 202       6.978  29.437  17.307  1.00 13.52           C  
ATOM    670  O   ASP A 202       6.572  28.404  17.829  1.00 12.66           O  
ATOM    671  CB  ASP A 202       5.569  30.496  15.613  1.00 14.16           C  
ATOM    672  CG  ASP A 202       4.431  31.418  15.288  1.00 15.07           C  
ATOM    673  OD1 ASP A 202       3.518  31.568  16.121  1.00 15.23           O  
ATOM    674  OD2 ASP A 202       4.459  31.977  14.164  1.00 16.05           O  
ATOM    675  N   VAL A 203       8.239  29.588  16.909  1.00 13.12           N  
ATOM    676  CA  VAL A 203       9.212  28.473  17.086  1.00 13.88           C  
ATOM    677  C   VAL A 203       9.493  28.215  18.557  1.00 13.66           C  
ATOM    678  O   VAL A 203       9.513  27.059  18.996  1.00 12.59           O  
ATOM    679  CB  VAL A 203      10.504  28.693  16.278  1.00 14.18           C  
ATOM    680  CG1 VAL A 203      11.598  27.709  16.675  1.00 14.81           C  
ATOM    681  CG2 VAL A 203      10.199  28.563  14.789  1.00 12.64           C  
ATOM    682  N   LYS A 204       9.655  29.293  19.328  1.00 13.97           N  
ATOM    683  CA  LYS A 204       9.807  29.165  20.771  1.00 15.10           C  
ATOM    684  C   LYS A 204       8.594  28.477  21.384  1.00 14.60           C  
ATOM    685  O   LYS A 204       8.735  27.619  22.261  1.00 13.71           O  
ATOM    686  CB  LYS A 204       9.970  30.529  21.433  1.00 16.11           C  
ATOM    687  CG  LYS A 204      11.322  31.164  21.165  1.00 21.10           C  
ATOM    688  CD  LYS A 204      11.572  32.327  22.157  1.00 29.03           C  
ATOM    689  CE  LYS A 204      12.517  33.370  21.552  1.00 33.15           C  
ATOM    690  NZ  LYS A 204      11.770  34.381  20.728  1.00 33.48           N  
ATOM    691  N   MET A 205       7.401  28.879  20.955  1.00 14.56           N  
ATOM    692  CA  MET A 205       6.177  28.205  21.450  1.00 15.01           C  
ATOM    693  C   MET A 205       6.155  26.721  21.104  1.00 14.04           C  
ATOM    694  O   MET A 205       5.827  25.869  21.944  1.00 13.25           O  
ATOM    695  CB  MET A 205       4.922  28.832  20.848  1.00 15.60           C  
ATOM    696  CG  MET A 205       4.858  30.333  20.811  1.00 20.89           C  
ATOM    697  SD  MET A 205       3.813  30.843  22.177  1.00 22.96           S  
ATOM    698  CE  MET A 205       5.078  31.435  23.287  1.00 29.59           C  
ATOM    699  N   MET A 206       6.498  26.406  19.859  1.00 13.63           N  
ATOM    700  CA  MET A 206       6.499  25.011  19.389  1.00 13.49           C  
ATOM    701  C   MET A 206       7.563  24.217  20.127  1.00 13.78           C  
ATOM    702  O   MET A 206       7.334  23.069  20.489  1.00 13.97           O  
ATOM    703  CB  MET A 206       6.749  24.923  17.889  1.00 13.58           C  
ATOM    704  CG  MET A 206       5.486  25.238  17.066  1.00 14.39           C  
ATOM    705  SD  MET A 206       5.640  24.793  15.345  1.00 14.14           S  
ATOM    706  CE  MET A 206       6.687  26.149  14.758  1.00 14.25           C  
ATOM    707  N   GLU A 207       8.706  24.834  20.389  1.00 13.75           N  
ATOM    708  CA  GLU A 207       9.751  24.110  21.138  1.00 14.48           C  
ATOM    709  C   GLU A 207       9.212  23.630  22.487  1.00 14.22           C  
ATOM    710  O   GLU A 207       9.476  22.500  22.918  1.00 13.55           O  
ATOM    711  CB  GLU A 207      10.964  24.983  21.356  1.00 15.31           C  
ATOM    712  CG  GLU A 207      11.737  25.280  20.066  1.00 21.25           C  
ATOM    713  CD  GLU A 207      12.965  26.104  20.341  1.00 27.33           C  
ATOM    714  OE1 GLU A 207      13.907  25.565  20.966  1.00 29.54           O  
ATOM    715  OE2 GLU A 207      12.980  27.283  19.941  1.00 28.99           O  
ATOM    716  N   ARG A 208       8.445  24.492  23.153  1.00 13.70           N  
ATOM    717  CA  ARG A 208       7.884  24.129  24.460  1.00 14.11           C  
ATOM    718  C   ARG A 208       6.902  22.986  24.377  1.00 13.39           C  
ATOM    719  O   ARG A 208       7.074  21.979  25.082  1.00 13.02           O  
ATOM    720  CB  ARG A 208       7.203  25.323  25.131  1.00 14.95           C  
ATOM    721  CG  ARG A 208       8.150  26.282  25.772  1.00 19.33           C  
ATOM    722  CD  ARG A 208       8.785  25.704  27.047  1.00 25.70           C  
ATOM    723  NE  ARG A 208       7.820  25.025  27.914  1.00 29.44           N  
ATOM    724  CZ  ARG A 208       7.106  25.632  28.862  1.00 32.37           C  
ATOM    725  NH1 ARG A 208       7.238  26.940  29.049  1.00 32.34           N  
ATOM    726  NH2 ARG A 208       6.255  24.937  29.619  1.00 31.98           N  
ATOM    727  N   VAL A 209       5.873  23.128  23.531  1.00 12.12           N  
ATOM    728  CA  VAL A 209       4.825  22.098  23.427  1.00 12.44           C  
ATOM    729  C   VAL A 209       5.351  20.830  22.778  1.00 11.36           C  
ATOM    730  O   VAL A 209       5.048  19.751  23.262  1.00 10.77           O  
ATOM    731  CB  VAL A 209       3.490  22.591  22.736  1.00 12.21           C  
ATOM    732  CG1 VAL A 209       3.712  22.979  21.281  1.00 12.17           C  
ATOM    733  CG2 VAL A 209       2.412  21.497  22.779  1.00 12.15           C  
ATOM    734  N   VAL A 210       6.159  20.950  21.724  1.00 11.42           N  
ATOM    735  CA  VAL A 210       6.704  19.747  21.069  1.00 10.78           C  
ATOM    736  C   VAL A 210       7.633  19.016  22.019  1.00 11.26           C  
ATOM    737  O   VAL A 210       7.618  17.795  22.071  1.00 10.70           O  
ATOM    738  CB  VAL A 210       7.371  20.065  19.707  1.00 10.91           C  
ATOM    739  CG1 VAL A 210       7.987  18.808  19.087  1.00 11.43           C  
ATOM    740  CG2 VAL A 210       6.316  20.620  18.757  1.00 11.68           C  
ATOM    741  N   GLU A 211       8.390  19.745  22.835  1.00 11.06           N  
ATOM    742  CA  GLU A 211       9.221  19.037  23.817  1.00 11.77           C  
ATOM    743  C   GLU A 211       8.350  18.197  24.760  1.00 12.71           C  
ATOM    744  O   GLU A 211       8.662  17.033  25.046  1.00 11.73           O  
ATOM    745  CB  GLU A 211      10.123  19.987  24.610  1.00 12.76           C  
ATOM    746  CG  GLU A 211      10.836  19.192  25.718  1.00 16.66           C  
ATOM    747  CD  GLU A 211      12.123  19.792  26.174  1.00 23.59           C  
ATOM    748  OE1 GLU A 211      12.494  20.863  25.652  1.00 24.50           O  
ATOM    749  OE2 GLU A 211      12.773  19.173  27.055  1.00 23.95           O  
ATOM    750  N   GLN A 212       7.248  18.752  25.261  1.00 12.04           N  
ATOM    751  CA AGLN A 212       6.386  17.958  26.132  0.50 11.89           C  
ATOM    752  CA BGLN A 212       6.363  17.975  26.125  0.50 11.87           C  
ATOM    753  C   GLN A 212       5.741  16.788  25.386  1.00 11.90           C  
ATOM    754  O   GLN A 212       5.692  15.678  25.906  1.00 10.46           O  
ATOM    755  CB AGLN A 212       5.345  18.834  26.844  0.50 11.76           C  
ATOM    756  CB BGLN A 212       5.275  18.859  26.749  0.50 11.84           C  
ATOM    757  CG AGLN A 212       5.947  19.801  27.852  0.50 12.05           C  
ATOM    758  CG BGLN A 212       4.444  18.120  27.781  0.50 11.63           C  
ATOM    759  CD AGLN A 212       6.938  19.143  28.804  0.50 11.07           C  
ATOM    760  CD BGLN A 212       3.329  18.957  28.362  0.50 15.65           C  
ATOM    761  OE1AGLN A 212       6.605  18.192  29.507  0.50 10.95           O  
ATOM    762  OE1BGLN A 212       3.524  20.125  28.682  0.50 17.91           O  
ATOM    763  NE2AGLN A 212       8.167  19.656  28.826  0.50  9.08           N  
ATOM    764  NE2BGLN A 212       2.152  18.354  28.511  0.50 13.82           N  
ATOM    765  N   MET A 213       5.280  17.003  24.158  1.00 11.30           N  
ATOM    766  CA  MET A 213       4.736  15.880  23.384  1.00 11.93           C  
ATOM    767  C   MET A 213       5.788  14.795  23.102  1.00 11.92           C  
ATOM    768  O   MET A 213       5.490  13.614  23.150  1.00 11.34           O  
ATOM    769  CB  MET A 213       4.099  16.393  22.094  1.00 11.87           C  
ATOM    770  CG  MET A 213       2.812  17.142  22.368  1.00 14.85           C  
ATOM    771  SD  MET A 213       2.004  17.637  20.824  1.00 18.96           S  
ATOM    772  CE  MET A 213       3.239  18.630  20.202  1.00 10.99           C  
ATOM    773  N   CYS A 214       7.034  15.189  22.863  1.00 11.69           N  
ATOM    774  CA  CYS A 214       8.100  14.200  22.667  1.00 11.99           C  
ATOM    775  C   CYS A 214       8.411  13.389  23.931  1.00 12.04           C  
ATOM    776  O   CYS A 214       8.767  12.209  23.851  1.00 12.74           O  
ATOM    777  CB  CYS A 214       9.378  14.891  22.148  1.00 10.76           C  
ATOM    778  SG  CYS A 214       9.169  15.547  20.456  1.00 12.33           S  
ATOM    779  N   ILE A 215       8.323  14.030  25.086  1.00 11.99           N  
ATOM    780  CA  ILE A 215       8.559  13.323  26.344  1.00 12.90           C  
ATOM    781  C   ILE A 215       7.407  12.332  26.567  1.00 13.49           C  
ATOM    782  O   ILE A 215       7.611  11.182  26.975  1.00 12.20           O  
ATOM    783  CB  ILE A 215       8.658  14.322  27.502  1.00 13.41           C  
ATOM    784  CG1 ILE A 215       9.956  15.112  27.392  1.00 12.77           C  
ATOM    785  CG2 ILE A 215       8.564  13.616  28.853  1.00 14.04           C  
ATOM    786  CD1 ILE A 215      10.003  16.297  28.371  1.00 14.06           C  
ATOM    787  N   THR A 216       6.198  12.779  26.247  1.00 12.56           N  
ATOM    788  CA  THR A 216       5.034  11.919  26.372  1.00 13.25           C  
ATOM    789  C   THR A 216       5.213  10.709  25.478  1.00 13.16           C  
ATOM    790  O   THR A 216       4.940   9.585  25.880  1.00 12.40           O  
ATOM    791  CB  THR A 216       3.770  12.646  25.941  1.00 13.38           C  
ATOM    792  OG1 THR A 216       3.477  13.677  26.890  1.00 15.41           O  
ATOM    793  CG2 THR A 216       2.600  11.671  25.861  1.00 14.27           C  
ATOM    794  N   GLN A 217       5.668  10.959  24.244  1.00 12.65           N  
ATOM    795  CA  GLN A 217       5.923   9.880  23.299  1.00 13.32           C  
ATOM    796  C   GLN A 217       6.961   8.897  23.860  1.00 13.93           C  
ATOM    797  O   GLN A 217       6.766   7.667  23.800  1.00 14.61           O  
ATOM    798  CB  GLN A 217       6.379  10.438  21.942  1.00 12.77           C  
ATOM    799  CG  GLN A 217       6.475   9.368  20.849  1.00 13.93           C  
ATOM    800  CD  GLN A 217       5.136   8.810  20.505  1.00 14.85           C  
ATOM    801  OE1 GLN A 217       4.158   9.560  20.301  1.00 13.72           O  
ATOM    802  NE2 GLN A 217       5.057   7.475  20.414  1.00 15.35           N  
ATOM    803  N   TYR A 218       8.050   9.433  24.405  1.00 13.93           N  
ATOM    804  CA  TYR A 218       9.079   8.586  25.001  1.00 14.17           C  
ATOM    805  C   TYR A 218       8.489   7.739  26.125  1.00 14.85           C  
ATOM    806  O   TYR A 218       8.725   6.524  26.204  1.00 16.06           O  
ATOM    807  CB  TYR A 218      10.242   9.431  25.534  1.00 13.68           C  
ATOM    808  CG  TYR A 218      11.415   8.581  26.009  1.00 12.79           C  
ATOM    809  CD1 TYR A 218      12.339   8.074  25.104  1.00 13.31           C  
ATOM    810  CD2 TYR A 218      11.569   8.260  27.355  1.00 14.82           C  
ATOM    811  CE1 TYR A 218      13.403   7.284  25.519  1.00 15.07           C  
ATOM    812  CE2 TYR A 218      12.646   7.467  27.791  1.00 14.85           C  
ATOM    813  CZ  TYR A 218      13.554   6.990  26.860  1.00 15.55           C  
ATOM    814  OH  TYR A 218      14.603   6.184  27.270  1.00 15.64           O  
ATOM    815  N   GLU A 219       7.711   8.382  26.987  1.00 14.67           N  
ATOM    816  CA  GLU A 219       7.166   7.701  28.141  1.00 15.79           C  
ATOM    817  C   GLU A 219       6.186   6.628  27.713  1.00 16.09           C  
ATOM    818  O   GLU A 219       6.123   5.557  28.334  1.00 16.58           O  
ATOM    819  CB  GLU A 219       6.522   8.707  29.094  1.00 15.96           C  
ATOM    820  CG  GLU A 219       7.564   9.472  29.876  1.00 18.14           C  
ATOM    821  CD  GLU A 219       6.947  10.491  30.785  1.00 27.89           C  
ATOM    822  OE1 GLU A 219       5.726  10.750  30.611  1.00 31.45           O  
ATOM    823  OE2 GLU A 219       7.676  11.052  31.644  1.00 29.69           O  
ATOM    824  N   ARG A 220       5.448   6.881  26.637  1.00 16.76           N  
ATOM    825  CA  ARG A 220       4.587   5.844  26.075  1.00 17.71           C  
ATOM    826  C   ARG A 220       5.374   4.673  25.461  1.00 17.79           C  
ATOM    827  O   ARG A 220       5.014   3.494  25.686  1.00 18.47           O  
ATOM    828  CB  ARG A 220       3.591   6.446  25.089  1.00 17.07           C  
ATOM    829  CG  ARG A 220       2.537   7.299  25.808  1.00 17.93           C  
ATOM    830  CD  ARG A 220       1.536   7.852  24.830  1.00 19.40           C  
ATOM    831  NE  ARG A 220       0.553   8.701  25.498  1.00 19.13           N  
ATOM    832  CZ  ARG A 220      -0.189   9.587  24.858  1.00 21.28           C  
ATOM    833  NH1 ARG A 220      -0.071   9.715  23.540  1.00 20.89           N  
ATOM    834  NH2 ARG A 220      -1.063  10.328  25.528  1.00 21.61           N  
ATOM    835  N   GLU A 221       6.432   4.981  24.718  1.00 17.69           N  
ATOM    836  CA  GLU A 221       7.379   3.955  24.243  1.00 18.09           C  
ATOM    837  C   GLU A 221       7.963   3.118  25.406  1.00 18.26           C  
ATOM    838  O   GLU A 221       8.036   1.884  25.329  1.00 17.65           O  
ATOM    839  CB  GLU A 221       8.545   4.587  23.477  1.00 18.69           C  
ATOM    840  CG  GLU A 221       8.191   5.265  22.148  1.00 19.13           C  
ATOM    841  CD  GLU A 221       7.567   4.310  21.165  1.00 23.84           C  
ATOM    842  OE1 GLU A 221       8.272   3.385  20.695  1.00 23.59           O  
ATOM    843  OE2 GLU A 221       6.371   4.505  20.856  1.00 24.58           O  
ATOM    844  N   SER A 222       8.386   3.796  26.468  1.00 18.50           N  
ATOM    845  CA  SER A 222       8.961   3.108  27.617  1.00 19.83           C  
ATOM    846  C   SER A 222       7.919   2.205  28.270  1.00 21.37           C  
ATOM    847  O   SER A 222       8.187   1.027  28.544  1.00 21.71           O  
ATOM    848  CB  SER A 222       9.515   4.113  28.626  1.00 19.69           C  
ATOM    849  OG  SER A 222      10.122   3.428  29.721  1.00 19.95           O  
ATOM    850  N   GLN A 223       6.726   2.741  28.496  1.00 22.20           N  
ATOM    851  CA  GLN A 223       5.655   1.951  29.114  1.00 24.36           C  
ATOM    852  C   GLN A 223       5.364   0.690  28.331  1.00 24.42           C  
ATOM    853  O   GLN A 223       5.234  -0.381  28.934  1.00 26.09           O  
ATOM    854  CB  GLN A 223       4.401   2.797  29.330  1.00 24.71           C  
ATOM    855  CG  GLN A 223       4.551   3.701  30.561  1.00 28.44           C  
ATOM    856  CD  GLN A 223       3.582   4.888  30.603  1.00 33.79           C  
ATOM    857  OE1 GLN A 223       3.669   5.733  31.500  1.00 36.39           O  
ATOM    858  NE2 GLN A 223       2.665   4.960  29.628  1.00 36.34           N  
ATOM    859  N   ALA A 224       5.304   0.800  27.011  1.00 24.12           N  
ATOM    860  CA  ALA A 224       5.066  -0.344  26.127  1.00 24.93           C  
ATOM    861  C   ALA A 224       6.214  -1.347  26.208  1.00 24.85           C  
ATOM    862  O   ALA A 224       5.996  -2.562  26.240  1.00 25.55           O  
ATOM    863  CB  ALA A 224       4.888   0.122  24.679  1.00 24.79           C  
ATOM    864  N   TYR A 225       7.436  -0.832  26.253  1.00 23.79           N  
ATOM    865  CA  TYR A 225       8.637  -1.674  26.210  1.00 23.28           C  
ATOM    866  C   TYR A 225       8.741  -2.536  27.467  1.00 23.22           C  
ATOM    867  O   TYR A 225       9.203  -3.684  27.421  1.00 22.97           O  
ATOM    868  CB  TYR A 225       9.911  -0.810  26.052  1.00 22.98           C  
ATOM    869  CG  TYR A 225      11.171  -1.649  26.061  1.00 22.06           C  
ATOM    870  CD1 TYR A 225      11.472  -2.497  24.997  1.00 22.05           C  
ATOM    871  CD2 TYR A 225      12.037  -1.629  27.151  1.00 19.14           C  
ATOM    872  CE1 TYR A 225      12.616  -3.308  25.011  1.00 21.69           C  
ATOM    873  CE2 TYR A 225      13.184  -2.418  27.168  1.00 20.47           C  
ATOM    874  CZ  TYR A 225      13.462  -3.254  26.099  1.00 21.03           C  
ATOM    875  OH  TYR A 225      14.590  -4.046  26.124  1.00 23.21           O  
ATOM    876  N   TYR A 226       8.323  -1.982  28.590  1.00 23.30           N  
ATOM    877  CA  TYR A 226       8.469  -2.675  29.862  1.00 24.77           C  
ATOM    878  C   TYR A 226       7.196  -3.410  30.265  1.00 27.25           C  
ATOM    879  O   TYR A 226       7.180  -4.130  31.257  1.00 27.82           O  
ATOM    880  CB  TYR A 226       8.890  -1.706  30.968  1.00 23.32           C  
ATOM    881  CG  TYR A 226      10.321  -1.199  30.834  1.00 20.31           C  
ATOM    882  CD1 TYR A 226      10.588   0.154  30.645  1.00 16.44           C  
ATOM    883  CD2 TYR A 226      11.399  -2.091  30.856  1.00 18.78           C  
ATOM    884  CE1 TYR A 226      11.885   0.623  30.528  1.00 12.63           C  
ATOM    885  CE2 TYR A 226      12.708  -1.640  30.721  1.00 16.73           C  
ATOM    886  CZ  TYR A 226      12.948  -0.287  30.571  1.00 13.43           C  
ATOM    887  OH  TYR A 226      14.248   0.162  30.440  1.00 14.86           O  
ATOM    888  N   GLN A 227       6.130  -3.233  29.498  1.00 29.93           N  
ATOM    889  CA  GLN A 227       4.827  -3.763  29.920  1.00 32.79           C  
ATOM    890  C   GLN A 227       4.613  -5.154  29.383  1.00 33.50           C  
ATOM    891  O   GLN A 227       5.070  -5.502  28.284  1.00 34.30           O  
ATOM    892  CB  GLN A 227       3.677  -2.853  29.476  1.00 33.34           C  
ATOM    893  CG  GLN A 227       3.062  -3.190  28.098  1.00 36.27           C  
ATOM    894  CD  GLN A 227       1.920  -2.233  27.725  1.00 40.80           C  
ATOM    895  OE1 GLN A 227       1.652  -1.262  28.449  1.00 43.31           O  
ATOM    896  NE2 GLN A 227       1.251  -2.494  26.590  1.00 41.05           N  
ATOM    897  OXT GLN A 227       3.966  -5.961  30.061  1.00 34.69           O  
TER     898      GLN A 227                                                      
HETATM  899  O   HOH A 300       2.201  15.694  26.182  1.00 26.62           O  
HETATM  900  O   HOH A 301      -1.695  15.014  12.753  1.00 46.65           O  
HETATM  901  O   HOH A 302     -11.816  27.909  16.902  1.00 34.99           O  
HETATM  902  O   HOH A 303      -5.415  27.921  18.747  1.00 18.12           O  
HETATM  903  O   HOH A 304       2.902  11.695  18.444  1.00 14.07           O  
HETATM  904  O   HOH A 305       8.142  22.069  27.531  1.00 18.15           O  
HETATM  905  O   HOH A 306      20.888   4.606  18.745  1.00 35.79           O  
HETATM  906  O   HOH A 307      14.866   4.547  13.942  1.00 15.14           O  
HETATM  907  O   HOH A 308      10.581  27.614  24.264  1.00 19.96           O  
HETATM  908  O   HOH A 309      -2.527  29.317  26.926  1.00 16.58           O  
HETATM  909  O   HOH A 310      13.714  10.519  18.442  1.00 13.48           O  
HETATM  910  O   HOH A 311      11.282  -5.212  28.447  1.00 24.17           O  
HETATM  911  O   HOH A 312      14.377  23.115  21.848  1.00 31.02           O  
HETATM  912  O   HOH A 313      16.308   5.440  25.516  1.00 22.93           O  
HETATM  913  O   HOH A 314      -1.974  36.875  20.783  1.00 29.28           O  
HETATM  914  O   HOH A 315       5.947  17.635  11.888  1.00 13.70           O  
HETATM  915  O   HOH A 316       8.618  36.732  16.868  1.00 26.08           O  
HETATM  916  O   HOH A 317       0.736  28.645  10.231  1.00 23.32           O  
HETATM  917  O   HOH A 318      -1.381  22.662  23.501  1.00 14.48           O  
HETATM  918  O   HOH A 319      -5.369  22.643  14.201  1.00 38.71           O  
HETATM  919  O   HOH A 320      13.647   0.959  13.492  1.00 37.60           O  
HETATM  920  O   HOH A 321      12.751  31.102  17.406  1.00 23.91           O  
HETATM  921  O   HOH A 322      13.277   9.016   8.298  1.00 26.03           O  
HETATM  922  O   HOH A 323      -0.974  37.882  23.376  1.00 30.99           O  
HETATM  923  O   HOH A 324      -7.679  26.500  18.570  1.00 20.99           O  
HETATM  924  O   HOH A 325       2.192  21.391  19.105  1.00 32.16           O  
HETATM  925  O   HOH A 326       9.522  33.356   9.769  1.00 33.22           O  
HETATM  926  O   HOH A 327       1.132  30.162  32.673  1.00 29.49           O  
HETATM  927  O   HOH A 328       8.505   7.083   7.531  1.00 48.46           O  
HETATM  928  O   HOH A 329       8.012   2.583  17.336  1.00 29.42           O  
HETATM  929  O   HOH A 330      13.424  17.308   8.542  1.00 52.33           O  
HETATM  930  O   HOH A 331       0.565  25.887  10.756  1.00 26.71           O  
HETATM  931  O   HOH A 332       4.633  35.893  16.233  1.00 29.00           O  
HETATM  932  O   HOH A 333       9.486   0.746  22.331  1.00 39.55           O  
HETATM  933  O   HOH A 334      10.383  11.622  31.403  1.00 36.17           O  
HETATM  934  O   HOH A 335      -7.462  34.911  24.266  1.00 40.81           O  
HETATM  935  O   HOH A 336      -9.358  26.364  16.125  1.00 30.31           O  
HETATM  936  O   HOH A 337      14.061  29.445  19.917  1.00 41.03           O  
HETATM  937  O   HOH A 338       5.923  22.474  29.162  1.00 30.06           O  
HETATM  938  O   HOH A 339      -6.294  23.691  19.006  1.00 37.78           O  
HETATM  939  O   HOH A 340       5.924  27.281   7.708  1.00 44.27           O  
HETATM  940  O   HOH A 341      -1.142  22.401  12.627  1.00 28.64           O  
HETATM  941  O   HOH A 342      20.623  10.020  17.581  1.00 33.02           O  
HETATM  942  O   HOH A 343      10.386   1.008  18.820  1.00 42.36           O  
HETATM  943  O   HOH A 344       2.307  15.281  11.315  1.00 51.97           O  
HETATM  944  O   HOH A 345      15.555  21.039  20.345  1.00 33.24           O  
HETATM  945  O   HOH A 346       3.739  16.389  12.957  1.00 20.03           O  
HETATM  946  O   HOH A 347       2.074  19.027   9.777  1.00 45.17           O  
HETATM  947  O   HOH A 348       8.499   3.063  31.723  1.00 26.55           O  
HETATM  948  O   HOH A 349      -3.366  34.995  29.744  1.00 53.48           O  
HETATM  949  O   HOH A 350       2.204  39.322  19.024  1.00 54.34           O  
HETATM  950  O   HOH A 351       9.780  -5.445  25.547  1.00 42.39           O  
HETATM  951  O   HOH A 352       5.707   1.938  19.300  1.00 41.61           O  
HETATM  952  O   HOH A 353      -0.091   9.076  27.947  1.00 34.18           O  
HETATM  953  O   HOH A 354       0.781  17.611  13.570  1.00 24.40           O  
HETATM  954  O   HOH A 355      -2.705  27.135   1.559  1.00 35.73           O  
HETATM  955  O   HOH A 356       7.665  16.276  31.406  1.00 29.74           O  
HETATM  956  O   HOH A 357       6.805   1.447  33.112  1.00 43.15           O  
HETATM  957  O   HOH A 358      15.612   9.501   7.227  1.00 47.70           O  
HETATM  958  O   HOH A 359      16.947  15.429  14.254  1.00 33.43           O  
HETATM  959  O   HOH A 360       7.315  17.822   5.858  1.00 25.22           O  
HETATM  960  O   HOH A 361      10.718  22.890  27.049  1.00 28.38           O  
HETATM  961  O   HOH A 362      10.678  36.115  13.437  1.00 38.56           O  
HETATM  962  O   HOH A 363       3.415  33.470   1.500  1.00 42.09           O  
HETATM  963  O   HOH A 364      14.005  16.874  27.691  1.00 45.53           O  
HETATM  964  O   HOH A 365       8.504  29.417   8.891  1.00 35.19           O  
HETATM  965  O   HOH A 366      -5.628  17.935  26.377  1.00 37.55           O  
HETATM  966  O   HOH A 367       8.675  35.046  30.222  1.00 47.99           O  
HETATM  967  O   HOH A 368      -2.556  30.786   9.172  1.00 23.14           O  
HETATM  968  O   HOH A 369      19.245  24.317  12.509  1.00 32.89           O  
HETATM  969  O   HOH A 370      10.916  30.467  12.135  1.00 25.05           O  
HETATM  970  O   HOH A 371      14.318  -3.245  19.581  1.00 28.47           O  
HETATM  971  O   HOH A 372      13.992   0.607  18.849  1.00 27.78           O  
HETATM  972  O   HOH A 373       4.134   4.177  22.107  1.00 38.03           O  
HETATM  973  O   HOH A 374      -1.674  33.147   7.064  1.00 24.13           O  
HETATM  974  O   HOH A 375      14.944  22.039  26.515  1.00 52.45           O  
HETATM  975  O   HOH A 376      -2.739   9.474  21.293  1.00 34.78           O  
HETATM  976  O   HOH A 377      19.036   3.220  25.789  1.00 33.12           O  
HETATM  977  O   HOH A 378      17.643  -5.192  21.269  1.00 35.50           O  
HETATM  978  O   HOH A 379      -1.712  33.389  32.358  1.00 53.77           O  
HETATM  979  O   HOH A 380      -5.459  25.746  11.641  1.00 36.06           O  
HETATM  980  O   HOH A 381       9.320  29.380  25.967  1.00 35.26           O  
HETATM  981  O   HOH A 382      -3.131  24.433  34.867  1.00 21.38           O  
HETATM  982  O   HOH A 383       3.532  23.861  31.678  1.00 27.86           O  
HETATM  983  O   HOH A 384       6.212  31.054   3.235  1.00 42.63           O  
HETATM  984  O   HOH A 385      10.183  25.455   4.961  1.00 17.75           O  
HETATM  985  O   HOH A 386      21.889  15.069  23.901  1.00 38.53           O  
HETATM  986  O   HOH A 387      -3.285   8.740  16.442  1.00 24.28           O  
HETATM  987  O   HOH A 388       5.216  29.611   1.128  1.00 26.09           O  
HETATM  988  O   HOH A 389       7.104   5.390  31.354  1.00 42.21           O  
HETATM  989  O   HOH A 390      20.690  15.692  20.734  1.00 47.95           O  
HETATM  990  O   HOH A 391      12.453  22.164  23.231  1.00 37.14           O  
HETATM  991  O   HOH A 392       3.605  33.774   4.964  1.00 39.83           O  
HETATM  992  O   HOH A 393      -2.741  12.478  23.983  1.00 33.03           O  
HETATM  993  O   HOH A 394      -4.117  29.172  10.492  1.00 23.70           O  
HETATM  994  O   HOH A 395       8.816  28.781  28.255  1.00 35.10           O  
HETATM  995  O   HOH A 396      -0.272  28.820  28.271  1.00 24.12           O  
HETATM  996  O   HOH A 397      -7.572  27.967  22.286  1.00 31.34           O  
HETATM  997  O   HOH A 398      11.287   5.639   8.691  1.00 35.59           O  
HETATM  998  O   HOH A 399       0.194  15.401  25.231  1.00 42.16           O  
HETATM  999  O   HOH A 400       7.743  31.259  29.106  1.00 28.71           O  
HETATM 1000  O   HOH A 401      -2.991  23.849  11.214  1.00 47.18           O  
HETATM 1001  O   HOH A 402       5.054  17.646   9.151  1.00 21.79           O  
HETATM 1002  O   HOH A 403      21.201  13.386  18.418  1.00 30.54           O  
HETATM 1003  O   HOH A 404      10.806  37.665  18.595  1.00 39.93           O  
CONECT  489  778                                                                
CONECT  778  489                                                                
MASTER      267    0    0    5    2    0    0    6  971    1    2    8          
END                                                                             



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.