CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 22110116252193344

Job options:

ID        	=	 22110116252193344
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   20-OCT-22 1MOD    1       18:17
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   MONOMER (USER)
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.39
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.71
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   2ec8
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-10-14
REMARK   3  SMTLE   2ec8.1.A
REMARK   3  SMTLV   2022-10-19
REMARK   3  MTHD    X-RAY DIFFRACTION 3.00 A
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.47
REMARK   3  SIM     0.62
REMARK   3  SID     99.41
REMARK   3  OSTAT   monomer
REMARK   3  LIGND   NAG
REMARK   3  LIGND 2 NAG
REMARK   3  LIGND 3 NAG
REMARK   3  LIGND 4 NAG
REMARK   3  LIGND 5 NAG
REMARK   3  ALN A TRG MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLC
REMARK   3  ALN A TRG TDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAK
REMARK   3  ALN A TRG LFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKS
REMARK   3  ALN A TRG VKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVT
REMARK   3  ALN A TRG CTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMC
REMARK   3  ALN A TRG YANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQW
REMARK   3  ALN A TRG IYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFN
REMARK   3  ALN A TRG VYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNS
REMARK   3  ALN A TRG SGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHTLFTPLL
REMARK   3  ALN A TRG IGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEF
REMARK   3  ALN A TRG PRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELK
REMARK   3  ALN A TRG VLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEA
REMARK   3  ALN A TRG ALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIME
REMARK   3  ALN A TRG DDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARD
REMARK   3  ALN A TRG IKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMP
REMARK   3  ALN A TRG VDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISEST
REMARK   3  ALN A TRG NHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV
REMARK   3  ALN A TPL MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLC
REMARK   3  ALN A TPL TDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAK
REMARK   3  ALN A TPL LFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKS
REMARK   3  ALN A TPL VKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVT
REMARK   3  ALN A TPL CTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMC
REMARK   3  ALN A TPL YANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQW
REMARK   3  ALN A TPL IYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFN
REMARK   3  ALN A TPL VYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNS
REMARK   3  ALN A TPL SGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNN----------
REMARK   3  ALN A TPL ----------------------------------------------------------
REMARK   3  ALN A TPL ----------------------------------------------------------
REMARK   3  ALN A TPL ----------------------------------------------------------
REMARK   3  ALN A TPL ----------------------------------------------------------
REMARK   3  ALN A TPL ----------------------------------------------------------
REMARK   3  ALN A TPL ----------------------------------------------------------
REMARK   3  ALN A TPL ----------------------------------------------------------
REMARK   3  ALN A TPL --------------------------------------------
REMARK   3  ALN A OFF 0
ATOM      1  N   LEU A  11      31.677  -5.746  37.431  1.00  0.41           N  
ATOM      2  CA  LEU A  11      32.758  -6.760  37.179  1.00  0.41           C  
ATOM      3  C   LEU A  11      32.305  -7.714  36.105  1.00  0.41           C  
ATOM      4  O   LEU A  11      31.104  -7.819  35.874  1.00  0.41           O  
ATOM      5  CB  LEU A  11      33.035  -7.560  38.485  1.00  0.41           C  
ATOM      6  CG  LEU A  11      33.675  -6.734  39.622  1.00  0.41           C  
ATOM      7  CD1 LEU A  11      33.758  -7.579  40.904  1.00  0.41           C  
ATOM      8  CD2 LEU A  11      35.080  -6.233  39.242  1.00  0.41           C  
ATOM      9  N   CYS A  12      33.234  -8.422  35.424  1.00  0.38           N  
ATOM     10  CA  CYS A  12      32.896  -9.579  34.614  1.00  0.38           C  
ATOM     11  C   CYS A  12      32.290 -10.679  35.459  1.00  0.38           C  
ATOM     12  O   CYS A  12      32.596 -10.841  36.642  1.00  0.38           O  
ATOM     13  CB  CYS A  12      34.107 -10.117  33.812  1.00  0.38           C  
ATOM     14  SG  CYS A  12      34.632  -8.924  32.540  1.00  0.38           S  
ATOM     15  N   VAL A  13      31.345 -11.403  34.856  1.00  0.46           N  
ATOM     16  CA  VAL A  13      30.409 -12.272  35.518  1.00  0.46           C  
ATOM     17  C   VAL A  13      31.122 -13.605  35.745  1.00  0.46           C  
ATOM     18  O   VAL A  13      31.863 -14.035  34.865  1.00  0.46           O  
ATOM     19  CB  VAL A  13      29.089 -12.351  34.700  1.00  0.46           C  
ATOM     20  CG1 VAL A  13      29.084 -11.436  33.444  1.00  0.46           C  
ATOM     21  CG2 VAL A  13      28.758 -13.775  34.214  1.00  0.46           C  
ATOM     22  N   LEU A  14      30.976 -14.272  36.918  1.00  0.49           N  
ATOM     23  CA  LEU A  14      31.483 -15.616  37.230  1.00  0.49           C  
ATOM     24  C   LEU A  14      31.336 -16.675  36.135  1.00  0.49           C  
ATOM     25  O   LEU A  14      30.261 -16.906  35.577  1.00  0.49           O  
ATOM     26  CB  LEU A  14      30.842 -16.195  38.520  1.00  0.49           C  
ATOM     27  CG  LEU A  14      31.481 -15.753  39.859  1.00  0.49           C  
ATOM     28  CD1 LEU A  14      31.641 -14.233  40.058  1.00  0.49           C  
ATOM     29  CD2 LEU A  14      30.631 -16.342  40.995  1.00  0.49           C  
ATOM     30  N   LEU A  15      32.446 -17.380  35.830  1.00  0.47           N  
ATOM     31  CA  LEU A  15      32.553 -18.274  34.695  1.00  0.47           C  
ATOM     32  C   LEU A  15      32.039 -19.639  35.109  1.00  0.47           C  
ATOM     33  O   LEU A  15      32.781 -20.569  35.419  1.00  0.47           O  
ATOM     34  CB  LEU A  15      34.026 -18.353  34.183  1.00  0.47           C  
ATOM     35  CG  LEU A  15      34.540 -17.146  33.340  1.00  0.47           C  
ATOM     36  CD1 LEU A  15      34.041 -15.766  33.789  1.00  0.47           C  
ATOM     37  CD2 LEU A  15      36.076 -17.112  33.318  1.00  0.47           C  
ATOM     38  N   LEU A  16      30.709 -19.789  35.120  1.00  0.48           N  
ATOM     39  CA  LEU A  16      30.060 -21.029  35.445  1.00  0.48           C  
ATOM     40  C   LEU A  16      30.108 -21.922  34.235  1.00  0.48           C  
ATOM     41  O   LEU A  16      29.328 -21.763  33.287  1.00  0.48           O  
ATOM     42  CB  LEU A  16      28.615 -20.751  35.864  1.00  0.48           C  
ATOM     43  CG  LEU A  16      28.524 -20.039  37.223  1.00  0.48           C  
ATOM     44  CD1 LEU A  16      27.446 -18.976  37.091  1.00  0.48           C  
ATOM     45  CD2 LEU A  16      28.161 -21.004  38.359  1.00  0.48           C  
ATOM     46  N   LEU A  17      31.059 -22.860  34.207  1.00  0.45           N  
ATOM     47  CA  LEU A  17      31.245 -23.827  33.135  1.00  0.45           C  
ATOM     48  C   LEU A  17      30.147 -24.881  33.053  1.00  0.45           C  
ATOM     49  O   LEU A  17      29.944 -25.527  32.027  1.00  0.45           O  
ATOM     50  CB  LEU A  17      32.568 -24.607  33.351  1.00  0.45           C  
ATOM     51  CG  LEU A  17      33.856 -23.761  33.285  1.00  0.45           C  
ATOM     52  CD1 LEU A  17      35.049 -24.615  33.747  1.00  0.45           C  
ATOM     53  CD2 LEU A  17      34.113 -23.219  31.868  1.00  0.45           C  
ATOM     54  N   LEU A  18      29.419 -25.062  34.164  1.00  0.47           N  
ATOM     55  CA  LEU A  18      28.232 -25.871  34.283  1.00  0.47           C  
ATOM     56  C   LEU A  18      27.034 -25.073  33.794  1.00  0.47           C  
ATOM     57  O   LEU A  18      27.130 -23.982  33.238  1.00  0.47           O  
ATOM     58  CB  LEU A  18      28.012 -26.322  35.756  1.00  0.47           C  
ATOM     59  CG  LEU A  18      29.216 -27.078  36.362  1.00  0.47           C  
ATOM     60  CD1 LEU A  18      28.930 -27.412  37.835  1.00  0.47           C  
ATOM     61  CD2 LEU A  18      29.562 -28.355  35.571  1.00  0.47           C  
ATOM     62  N   ARG A  19      25.825 -25.618  33.928  1.00  0.31           N  
ATOM     63  CA  ARG A  19      24.629 -24.903  33.551  1.00  0.31           C  
ATOM     64  C   ARG A  19      24.396 -23.576  34.301  1.00  0.31           C  
ATOM     65  O   ARG A  19      24.344 -23.540  35.527  1.00  0.31           O  
ATOM     66  CB  ARG A  19      23.446 -25.864  33.800  1.00  0.31           C  
ATOM     67  CG  ARG A  19      22.082 -25.318  33.347  1.00  0.31           C  
ATOM     68  CD  ARG A  19      20.902 -26.244  33.674  1.00  0.31           C  
ATOM     69  NE  ARG A  19      21.053 -27.488  32.864  1.00  0.31           N  
ATOM     70  CZ  ARG A  19      20.687 -27.621  31.582  1.00  0.31           C  
ATOM     71  NH1 ARG A  19      20.918 -28.776  30.965  1.00  0.31           N  
ATOM     72  NH2 ARG A  19      20.092 -26.640  30.911  1.00  0.31           N  
ATOM     73  N   VAL A  20      24.195 -22.450  33.575  1.00  0.36           N  
ATOM     74  CA  VAL A  20      23.961 -21.122  34.150  1.00  0.36           C  
ATOM     75  C   VAL A  20      22.511 -20.911  34.571  1.00  0.36           C  
ATOM     76  O   VAL A  20      22.145 -20.024  35.329  1.00  0.36           O  
ATOM     77  CB  VAL A  20      24.336 -20.013  33.163  1.00  0.36           C  
ATOM     78  CG1 VAL A  20      25.803 -20.194  32.718  1.00  0.36           C  
ATOM     79  CG2 VAL A  20      23.386 -20.001  31.938  1.00  0.36           C  
ATOM     80  N   GLN A  21      21.615 -21.779  34.081  1.00  0.37           N  
ATOM     81  CA  GLN A  21      20.219 -21.815  34.475  1.00  0.37           C  
ATOM     82  C   GLN A  21      20.043 -22.379  35.889  1.00  0.37           C  
ATOM     83  O   GLN A  21      19.081 -22.077  36.585  1.00  0.37           O  
ATOM     84  CB  GLN A  21      19.414 -22.705  33.485  1.00  0.37           C  
ATOM     85  CG  GLN A  21      19.514 -22.330  31.984  1.00  0.37           C  
ATOM     86  CD  GLN A  21      18.807 -20.997  31.750  1.00  0.37           C  
ATOM     87  OE1 GLN A  21      17.679 -20.797  32.194  1.00  0.37           O  
ATOM     88  NE2 GLN A  21      19.454 -20.059  31.026  1.00  0.37           N  
ATOM     89  N   THR A  22      21.001 -23.221  36.340  1.00  0.38           N  
ATOM     90  CA  THR A  22      21.050 -23.794  37.684  1.00  0.38           C  
ATOM     91  C   THR A  22      22.282 -23.286  38.390  1.00  0.38           C  
ATOM     92  O   THR A  22      22.711 -23.816  39.413  1.00  0.38           O  
ATOM     93  CB  THR A  22      21.053 -25.326  37.735  1.00  0.38           C  
ATOM     94  OG1 THR A  22      22.024 -25.929  36.893  1.00  0.38           O  
ATOM     95  CG2 THR A  22      19.700 -25.830  37.221  1.00  0.38           C  
ATOM     96  N   GLY A  23      22.862 -22.201  37.855  1.00  0.39           N  
ATOM     97  CA  GLY A  23      24.064 -21.571  38.355  1.00  0.39           C  
ATOM     98  C   GLY A  23      23.935 -20.113  38.105  1.00  0.39           C  
ATOM     99  O   GLY A  23      24.287 -19.610  37.040  1.00  0.39           O  
ATOM    100  N   SER A  24      23.402 -19.359  39.068  1.00  0.40           N  
ATOM    101  CA  SER A  24      23.315 -17.915  38.943  1.00  0.40           C  
ATOM    102  C   SER A  24      24.646 -17.220  38.879  1.00  0.40           C  
ATOM    103  O   SER A  24      25.496 -17.383  39.757  1.00  0.40           O  
ATOM    104  CB  SER A  24      22.618 -17.250  40.137  1.00  0.40           C  
ATOM    105  OG  SER A  24      21.291 -17.748  40.255  1.00  0.40           O  
ATOM    106  N   SER A  25      24.860 -16.389  37.858  1.00  0.38           N  
ATOM    107  CA  SER A  25      26.152 -15.773  37.638  1.00  0.38           C  
ATOM    108  C   SER A  25      26.317 -14.399  38.262  1.00  0.38           C  
ATOM    109  O   SER A  25      27.403 -14.034  38.713  1.00  0.38           O  
ATOM    110  CB  SER A  25      26.403 -15.675  36.120  1.00  0.38           C  
ATOM    111  OG  SER A  25      25.473 -14.802  35.469  1.00  0.38           O  
ATOM    112  N   GLN A  26      25.215 -13.627  38.316  1.00  0.37           N  
ATOM    113  CA  GLN A  26      25.108 -12.295  38.896  1.00  0.37           C  
ATOM    114  C   GLN A  26      23.958 -12.289  39.935  1.00  0.37           C  
ATOM    115  O   GLN A  26      23.018 -11.491  39.885  1.00  0.37           O  
ATOM    116  CB  GLN A  26      24.951 -11.245  37.755  1.00  0.37           C  
ATOM    117  CG  GLN A  26      24.743  -9.772  38.193  1.00  0.37           C  
ATOM    118  CD  GLN A  26      25.983  -9.244  38.908  1.00  0.37           C  
ATOM    119  OE1 GLN A  26      27.025  -9.041  38.284  1.00  0.37           O  
ATOM    120  NE2 GLN A  26      25.885  -8.980  40.228  1.00  0.37           N  
ATOM    121  N   PRO A  27      24.014 -13.248  40.863  1.00  0.40           N  
ATOM    122  CA  PRO A  27      22.908 -13.699  41.722  1.00  0.40           C  
ATOM    123  C   PRO A  27      21.431 -13.433  41.466  1.00  0.40           C  
ATOM    124  O   PRO A  27      20.912 -13.678  40.345  1.00  0.40           O  
ATOM    125  CB  PRO A  27      23.305 -13.231  43.117  1.00  0.40           C  
ATOM    126  CG  PRO A  27      24.819 -13.421  43.136  1.00  0.40           C  
ATOM    127  CD  PRO A  27      25.257 -13.259  41.665  1.00  0.40           C  
ATOM    128  N   SER A  28      20.703 -12.989  42.481  1.00  0.47           N  
ATOM    129  CA  SER A  28      19.418 -12.346  42.443  1.00  0.47           C  
ATOM    130  C   SER A  28      19.513 -10.890  42.880  1.00  0.47           C  
ATOM    131  O   SER A  28      20.348 -10.134  42.392  1.00  0.47           O  
ATOM    132  CB  SER A  28      18.370 -13.181  43.241  1.00  0.47           C  
ATOM    133  OG  SER A  28      18.746 -13.404  44.611  1.00  0.47           O  
ATOM    134  N   VAL A  29      18.653 -10.450  43.814  1.00  0.55           N  
ATOM    135  CA  VAL A  29      18.695  -9.148  44.445  1.00  0.55           C  
ATOM    136  C   VAL A  29      19.159  -9.469  45.852  1.00  0.55           C  
ATOM    137  O   VAL A  29      18.771 -10.486  46.434  1.00  0.55           O  
ATOM    138  CB  VAL A  29      17.346  -8.402  44.424  1.00  0.55           C  
ATOM    139  CG1 VAL A  29      17.003  -8.059  42.960  1.00  0.55           C  
ATOM    140  CG2 VAL A  29      16.204  -9.228  45.058  1.00  0.55           C  
ATOM    141  N   SER A  30      20.079  -8.668  46.417  1.00  0.51           N  
ATOM    142  CA  SER A  30      20.506  -8.760  47.804  1.00  0.51           C  
ATOM    143  C   SER A  30      19.360  -8.457  48.791  1.00  0.51           C  
ATOM    144  O   SER A  30      18.376  -7.830  48.390  1.00  0.51           O  
ATOM    145  CB  SER A  30      21.787  -7.905  48.052  1.00  0.51           C  
ATOM    146  OG  SER A  30      21.570  -6.511  47.841  1.00  0.51           O  
ATOM    147  N   PRO A  31      19.347  -8.924  50.047  1.00  0.49           N  
ATOM    148  CA  PRO A  31      18.331  -8.519  51.006  1.00  0.49           C  
ATOM    149  C   PRO A  31      18.735  -7.223  51.690  1.00  0.49           C  
ATOM    150  O   PRO A  31      19.643  -6.525  51.248  1.00  0.49           O  
ATOM    151  CB  PRO A  31      18.360  -9.700  51.988  1.00  0.49           C  
ATOM    152  CG  PRO A  31      19.850 -10.062  52.083  1.00  0.49           C  
ATOM    153  CD  PRO A  31      20.411  -9.700  50.694  1.00  0.49           C  
ATOM    154  N   GLY A  32      18.036  -6.881  52.786  1.00  0.56           N  
ATOM    155  CA  GLY A  32      18.138  -5.621  53.510  1.00  0.56           C  
ATOM    156  C   GLY A  32      17.195  -4.584  52.961  1.00  0.56           C  
ATOM    157  O   GLY A  32      16.731  -3.725  53.702  1.00  0.56           O  
ATOM    158  N   GLU A  33      16.856  -4.715  51.664  1.00  0.68           N  
ATOM    159  CA  GLU A  33      16.078  -3.790  50.868  1.00  0.68           C  
ATOM    160  C   GLU A  33      15.971  -4.374  49.437  1.00  0.68           C  
ATOM    161  O   GLU A  33      17.012  -4.702  48.861  1.00  0.68           O  
ATOM    162  CB  GLU A  33      16.746  -2.395  50.818  1.00  0.68           C  
ATOM    163  CG  GLU A  33      15.902  -1.325  50.090  1.00  0.68           C  
ATOM    164  CD  GLU A  33      16.513   0.071  50.232  1.00  0.68           C  
ATOM    165  OE1 GLU A  33      17.587   0.211  50.871  1.00  0.68           O  
ATOM    166  OE2 GLU A  33      15.880   1.021  49.703  1.00  0.68           O  
ATOM    167  N   PRO A  34      14.796  -4.629  48.827  1.00  0.67           N  
ATOM    168  CA  PRO A  34      14.651  -5.078  47.425  1.00  0.67           C  
ATOM    169  C   PRO A  34      15.297  -4.148  46.384  1.00  0.67           C  
ATOM    170  O   PRO A  34      15.082  -2.941  46.419  1.00  0.67           O  
ATOM    171  CB  PRO A  34      13.124  -5.228  47.237  1.00  0.67           C  
ATOM    172  CG  PRO A  34      12.540  -4.251  48.267  1.00  0.67           C  
ATOM    173  CD  PRO A  34      13.493  -4.389  49.452  1.00  0.67           C  
ATOM    174  N   SER A  35      16.101  -4.683  45.442  1.00  0.70           N  
ATOM    175  CA  SER A  35      17.128  -3.923  44.734  1.00  0.70           C  
ATOM    176  C   SER A  35      16.763  -3.713  43.252  1.00  0.70           C  
ATOM    177  O   SER A  35      15.975  -4.500  42.723  1.00  0.70           O  
ATOM    178  CB  SER A  35      18.453  -4.726  44.876  1.00  0.70           C  
ATOM    179  OG  SER A  35      19.615  -3.981  44.524  1.00  0.70           O  
ATOM    180  N   PRO A  36      17.215  -2.683  42.521  1.00  0.78           N  
ATOM    181  CA  PRO A  36      16.960  -2.543  41.086  1.00  0.78           C  
ATOM    182  C   PRO A  36      17.793  -3.508  40.228  1.00  0.78           C  
ATOM    183  O   PRO A  36      18.789  -4.045  40.719  1.00  0.78           O  
ATOM    184  CB  PRO A  36      17.333  -1.067  40.814  1.00  0.78           C  
ATOM    185  CG  PRO A  36      18.457  -0.803  41.817  1.00  0.78           C  
ATOM    186  CD  PRO A  36      17.945  -1.533  43.060  1.00  0.78           C  
ATOM    187  N   PRO A  37      17.412  -3.759  38.971  1.00  0.86           N  
ATOM    188  CA  PRO A  37      18.005  -4.804  38.150  1.00  0.86           C  
ATOM    189  C   PRO A  37      19.408  -4.444  37.674  1.00  0.86           C  
ATOM    190  O   PRO A  37      19.702  -3.282  37.380  1.00  0.86           O  
ATOM    191  CB  PRO A  37      17.037  -4.931  36.957  1.00  0.86           C  
ATOM    192  CG  PRO A  37      16.319  -3.589  36.867  1.00  0.86           C  
ATOM    193  CD  PRO A  37      16.238  -3.170  38.331  1.00  0.86           C  
ATOM    194  N   SER A  38      20.304  -5.448  37.585  1.00  0.83           N  
ATOM    195  CA  SER A  38      21.683  -5.271  37.151  1.00  0.83           C  
ATOM    196  C   SER A  38      21.799  -5.422  35.642  1.00  0.83           C  
ATOM    197  O   SER A  38      21.147  -6.268  35.034  1.00  0.83           O  
ATOM    198  CB  SER A  38      22.628  -6.306  37.826  1.00  0.83           C  
ATOM    199  OG  SER A  38      24.001  -6.089  37.486  1.00  0.83           O  
ATOM    200  N   ILE A  39      22.653  -4.606  34.992  1.00  0.84           N  
ATOM    201  CA  ILE A  39      22.877  -4.614  33.551  1.00  0.84           C  
ATOM    202  C   ILE A  39      24.342  -4.915  33.314  1.00  0.84           C  
ATOM    203  O   ILE A  39      25.227  -4.418  34.013  1.00  0.84           O  
ATOM    204  CB  ILE A  39      22.482  -3.301  32.849  1.00  0.84           C  
ATOM    205  CG1 ILE A  39      20.944  -3.135  32.931  1.00  0.84           C  
ATOM    206  CG2 ILE A  39      22.964  -3.258  31.367  1.00  0.84           C  
ATOM    207  CD1 ILE A  39      20.472  -1.754  32.459  1.00  0.84           C  
ATOM    208  N   HIS A  40      24.624  -5.761  32.306  1.00  0.77           N  
ATOM    209  CA  HIS A  40      25.952  -5.979  31.772  1.00  0.77           C  
ATOM    210  C   HIS A  40      25.970  -5.593  30.288  1.00  0.77           C  
ATOM    211  O   HIS A  40      25.053  -5.984  29.558  1.00  0.77           O  
ATOM    212  CB  HIS A  40      26.408  -7.434  31.949  1.00  0.77           C  
ATOM    213  CG  HIS A  40      26.541  -7.743  33.402  1.00  0.77           C  
ATOM    214  ND1 HIS A  40      27.809  -7.936  33.915  1.00  0.77           N  
ATOM    215  CD2 HIS A  40      25.606  -7.859  34.383  1.00  0.77           C  
ATOM    216  CE1 HIS A  40      27.626  -8.173  35.196  1.00  0.77           C  
ATOM    217  NE2 HIS A  40      26.315  -8.137  35.530  1.00  0.77           N  
ATOM    218  N   PRO A  41      26.957  -4.848  29.777  1.00  0.80           N  
ATOM    219  CA  PRO A  41      28.095  -4.292  30.507  1.00  0.80           C  
ATOM    220  C   PRO A  41      27.678  -3.166  31.447  1.00  0.80           C  
ATOM    221  O   PRO A  41      26.706  -2.459  31.191  1.00  0.80           O  
ATOM    222  CB  PRO A  41      29.015  -3.764  29.391  1.00  0.80           C  
ATOM    223  CG  PRO A  41      28.029  -3.341  28.296  1.00  0.80           C  
ATOM    224  CD  PRO A  41      26.973  -4.456  28.363  1.00  0.80           C  
ATOM    225  N   GLY A  42      28.411  -2.998  32.567  1.00  0.71           N  
ATOM    226  CA  GLY A  42      28.200  -1.911  33.518  1.00  0.71           C  
ATOM    227  C   GLY A  42      28.825  -0.636  33.021  1.00  0.71           C  
ATOM    228  O   GLY A  42      29.927  -0.269  33.420  1.00  0.71           O  
ATOM    229  N   LYS A  43      28.128   0.055  32.109  1.00  0.77           N  
ATOM    230  CA  LYS A  43      28.545   1.295  31.496  1.00  0.77           C  
ATOM    231  C   LYS A  43      27.302   2.160  31.379  1.00  0.77           C  
ATOM    232  O   LYS A  43      26.184   1.656  31.402  1.00  0.77           O  
ATOM    233  CB  LYS A  43      29.112   1.060  30.066  1.00  0.77           C  
ATOM    234  CG  LYS A  43      30.500   0.396  30.022  1.00  0.77           C  
ATOM    235  CD  LYS A  43      30.902   0.049  28.574  1.00  0.77           C  
ATOM    236  CE  LYS A  43      32.333   0.436  28.184  1.00  0.77           C  
ATOM    237  NZ  LYS A  43      32.415   1.905  28.004  1.00  0.77           N  
ATOM    238  N   SER A  44      27.473   3.494  31.274  1.00  0.80           N  
ATOM    239  CA  SER A  44      26.366   4.443  31.128  1.00  0.80           C  
ATOM    240  C   SER A  44      25.908   4.567  29.702  1.00  0.80           C  
ATOM    241  O   SER A  44      24.715   4.568  29.390  1.00  0.80           O  
ATOM    242  CB  SER A  44      26.783   5.882  31.533  1.00  0.80           C  
ATOM    243  OG  SER A  44      26.595   6.059  32.933  1.00  0.80           O  
ATOM    244  N   ASP A  45      26.872   4.700  28.787  1.00  0.82           N  
ATOM    245  CA  ASP A  45      26.635   4.745  27.385  1.00  0.82           C  
ATOM    246  C   ASP A  45      27.480   3.647  26.762  1.00  0.82           C  
ATOM    247  O   ASP A  45      28.409   3.079  27.355  1.00  0.82           O  
ATOM    248  CB  ASP A  45      26.876   6.172  26.804  1.00  0.82           C  
ATOM    249  CG  ASP A  45      28.334   6.626  26.813  1.00  0.82           C  
ATOM    250  OD1 ASP A  45      28.669   7.399  25.885  1.00  0.82           O  
ATOM    251  OD2 ASP A  45      29.090   6.233  27.741  1.00  0.82           O  
ATOM    252  N   LEU A  46      27.120   3.259  25.544  1.00  0.86           N  
ATOM    253  CA  LEU A  46      27.885   2.311  24.797  1.00  0.86           C  
ATOM    254  C   LEU A  46      27.876   2.708  23.341  1.00  0.86           C  
ATOM    255  O   LEU A  46      26.838   2.894  22.712  1.00  0.86           O  
ATOM    256  CB  LEU A  46      27.340   0.886  25.040  1.00  0.86           C  
ATOM    257  CG  LEU A  46      28.071  -0.227  24.265  1.00  0.86           C  
ATOM    258  CD1 LEU A  46      29.518  -0.448  24.756  1.00  0.86           C  
ATOM    259  CD2 LEU A  46      27.229  -1.514  24.307  1.00  0.86           C  
ATOM    260  N   ILE A  47      29.080   2.862  22.779  1.00  0.86           N  
ATOM    261  CA  ILE A  47      29.348   3.190  21.406  1.00  0.86           C  
ATOM    262  C   ILE A  47      29.559   1.884  20.663  1.00  0.86           C  
ATOM    263  O   ILE A  47      30.414   1.070  21.020  1.00  0.86           O  
ATOM    264  CB  ILE A  47      30.590   4.063  21.219  1.00  0.86           C  
ATOM    265  CG1 ILE A  47      30.656   5.323  22.134  1.00  0.86           C  
ATOM    266  CG2 ILE A  47      30.604   4.515  19.736  1.00  0.86           C  
ATOM    267  CD1 ILE A  47      31.019   5.130  23.622  1.00  0.86           C  
ATOM    268  N   VAL A  48      28.774   1.649  19.611  1.00  0.87           N  
ATOM    269  CA  VAL A  48      28.743   0.422  18.859  1.00  0.87           C  
ATOM    270  C   VAL A  48      29.002   0.829  17.423  1.00  0.87           C  
ATOM    271  O   VAL A  48      28.514   1.867  16.955  1.00  0.87           O  
ATOM    272  CB  VAL A  48      27.410  -0.296  19.082  1.00  0.87           C  
ATOM    273  CG1 VAL A  48      27.318  -1.593  18.258  1.00  0.87           C  
ATOM    274  CG2 VAL A  48      27.289  -0.643  20.584  1.00  0.87           C  
ATOM    275  N   ARG A  49      29.847   0.118  16.663  1.00  0.77           N  
ATOM    276  CA  ARG A  49      29.945   0.315  15.226  1.00  0.77           C  
ATOM    277  C   ARG A  49      28.653  -0.091  14.506  1.00  0.77           C  
ATOM    278  O   ARG A  49      27.928  -0.986  14.935  1.00  0.77           O  
ATOM    279  CB  ARG A  49      31.177  -0.406  14.608  1.00  0.77           C  
ATOM    280  CG  ARG A  49      32.525   0.298  14.892  1.00  0.77           C  
ATOM    281  CD  ARG A  49      33.246  -0.263  16.125  1.00  0.77           C  
ATOM    282  NE  ARG A  49      33.918   0.901  16.807  1.00  0.77           N  
ATOM    283  CZ  ARG A  49      34.393   0.837  18.058  1.00  0.77           C  
ATOM    284  NH1 ARG A  49      34.375  -0.305  18.735  1.00  0.77           N  
ATOM    285  NH2 ARG A  49      34.938   1.908  18.631  1.00  0.77           N  
ATOM    286  N   VAL A  50      28.305   0.571  13.389  1.00  0.82           N  
ATOM    287  CA  VAL A  50      27.241   0.113  12.496  1.00  0.82           C  
ATOM    288  C   VAL A  50      27.505  -1.248  11.905  1.00  0.82           C  
ATOM    289  O   VAL A  50      28.600  -1.533  11.420  1.00  0.82           O  
ATOM    290  CB  VAL A  50      27.064   0.990  11.270  1.00  0.82           C  
ATOM    291  CG1 VAL A  50      25.731   0.743  10.534  1.00  0.82           C  
ATOM    292  CG2 VAL A  50      27.080   2.444  11.694  1.00  0.82           C  
ATOM    293  N   GLY A  51      26.479  -2.103  11.882  1.00  0.83           N  
ATOM    294  CA  GLY A  51      26.557  -3.452  11.366  1.00  0.83           C  
ATOM    295  C   GLY A  51      27.111  -4.448  12.353  1.00  0.83           C  
ATOM    296  O   GLY A  51      27.092  -5.641  12.064  1.00  0.83           O  
ATOM    297  N   ASP A  52      27.529  -3.998  13.557  1.00  0.81           N  
ATOM    298  CA  ASP A  52      27.994  -4.848  14.638  1.00  0.81           C  
ATOM    299  C   ASP A  52      26.838  -5.150  15.584  1.00  0.81           C  
ATOM    300  O   ASP A  52      25.813  -4.467  15.632  1.00  0.81           O  
ATOM    301  CB  ASP A  52      29.167  -4.210  15.456  1.00  0.81           C  
ATOM    302  CG  ASP A  52      30.534  -4.296  14.782  1.00  0.81           C  
ATOM    303  OD1 ASP A  52      31.490  -3.757  15.412  1.00  0.81           O  
ATOM    304  OD2 ASP A  52      30.657  -4.898  13.691  1.00  0.81           O  
ATOM    305  N   GLU A  53      26.954  -6.239  16.358  1.00  0.79           N  
ATOM    306  CA  GLU A  53      25.911  -6.661  17.266  1.00  0.79           C  
ATOM    307  C   GLU A  53      25.826  -5.810  18.536  1.00  0.79           C  
ATOM    308  O   GLU A  53      26.819  -5.429  19.160  1.00  0.79           O  
ATOM    309  CB  GLU A  53      26.048  -8.180  17.569  1.00  0.79           C  
ATOM    310  CG  GLU A  53      25.081  -8.734  18.650  1.00  0.79           C  
ATOM    311  CD  GLU A  53      25.442 -10.147  19.082  1.00  0.79           C  
ATOM    312  OE1 GLU A  53      25.248 -11.136  18.343  1.00  0.79           O  
ATOM    313  OE2 GLU A  53      25.932 -10.267  20.233  1.00  0.79           O  
ATOM    314  N   ILE A  54      24.585  -5.516  18.970  1.00  0.83           N  
ATOM    315  CA  ILE A  54      24.276  -4.914  20.257  1.00  0.83           C  
ATOM    316  C   ILE A  54      23.836  -6.048  21.143  1.00  0.83           C  
ATOM    317  O   ILE A  54      22.777  -6.630  20.917  1.00  0.83           O  
ATOM    318  CB  ILE A  54      23.138  -3.889  20.217  1.00  0.83           C  
ATOM    319  CG1 ILE A  54      23.496  -2.773  19.215  1.00  0.83           C  
ATOM    320  CG2 ILE A  54      22.876  -3.326  21.641  1.00  0.83           C  
ATOM    321  CD1 ILE A  54      22.355  -1.784  18.941  1.00  0.83           C  
ATOM    322  N   ARG A  55      24.644  -6.388  22.159  1.00  0.77           N  
ATOM    323  CA  ARG A  55      24.344  -7.427  23.118  1.00  0.77           C  
ATOM    324  C   ARG A  55      24.281  -6.824  24.506  1.00  0.77           C  
ATOM    325  O   ARG A  55      25.288  -6.381  25.065  1.00  0.77           O  
ATOM    326  CB  ARG A  55      25.431  -8.522  23.072  1.00  0.77           C  
ATOM    327  CG  ARG A  55      25.223  -9.652  24.107  1.00  0.77           C  
ATOM    328  CD  ARG A  55      26.198 -10.831  23.996  1.00  0.77           C  
ATOM    329  NE  ARG A  55      26.070 -11.376  22.610  1.00  0.77           N  
ATOM    330  CZ  ARG A  55      26.432 -12.588  22.188  1.00  0.77           C  
ATOM    331  NH1 ARG A  55      26.979 -13.464  23.018  1.00  0.77           N  
ATOM    332  NH2 ARG A  55      26.270 -12.863  20.895  1.00  0.77           N  
ATOM    333  N   LEU A  56      23.077  -6.786  25.096  1.00  0.85           N  
ATOM    334  CA  LEU A  56      22.827  -6.240  26.412  1.00  0.85           C  
ATOM    335  C   LEU A  56      22.188  -7.288  27.273  1.00  0.85           C  
ATOM    336  O   LEU A  56      21.235  -7.946  26.875  1.00  0.85           O  
ATOM    337  CB  LEU A  56      21.844  -5.047  26.381  1.00  0.85           C  
ATOM    338  CG  LEU A  56      22.363  -3.805  25.641  1.00  0.85           C  
ATOM    339  CD1 LEU A  56      21.343  -2.669  25.793  1.00  0.85           C  
ATOM    340  CD2 LEU A  56      23.740  -3.371  26.170  1.00  0.85           C  
ATOM    341  N   LEU A  57      22.673  -7.449  28.505  1.00  0.85           N  
ATOM    342  CA  LEU A  57      22.189  -8.460  29.402  1.00  0.85           C  
ATOM    343  C   LEU A  57      21.605  -7.772  30.607  1.00  0.85           C  
ATOM    344  O   LEU A  57      22.202  -6.841  31.165  1.00  0.85           O  
ATOM    345  CB  LEU A  57      23.367  -9.378  29.806  1.00  0.85           C  
ATOM    346  CG  LEU A  57      23.069 -10.371  30.952  1.00  0.85           C  
ATOM    347  CD1 LEU A  57      22.116 -11.485  30.476  1.00  0.85           C  
ATOM    348  CD2 LEU A  57      24.370 -10.926  31.562  1.00  0.85           C  
ATOM    349  N   CYS A  58      20.419  -8.196  31.053  1.00  0.87           N  
ATOM    350  CA  CYS A  58      19.885  -7.811  32.330  1.00  0.87           C  
ATOM    351  C   CYS A  58      19.798  -9.022  33.237  1.00  0.87           C  
ATOM    352  O   CYS A  58      19.286 -10.082  32.867  1.00  0.87           O  
ATOM    353  CB  CYS A  58      18.498  -7.158  32.219  1.00  0.87           C  
ATOM    354  SG  CYS A  58      18.155  -6.248  33.741  1.00  0.87           S  
ATOM    355  N   THR A  59      20.289  -8.878  34.472  1.00  0.81           N  
ATOM    356  CA  THR A  59      20.162  -9.895  35.497  1.00  0.81           C  
ATOM    357  C   THR A  59      19.305  -9.337  36.590  1.00  0.81           C  
ATOM    358  O   THR A  59      19.689  -8.410  37.305  1.00  0.81           O  
ATOM    359  CB  THR A  59      21.461 -10.357  36.126  1.00  0.81           C  
ATOM    360  OG1 THR A  59      22.244 -11.026  35.148  1.00  0.81           O  
ATOM    361  CG2 THR A  59      21.158 -11.396  37.222  1.00  0.81           C  
ATOM    362  N   ASP A  60      18.109  -9.927  36.731  1.00  0.78           N  
ATOM    363  CA  ASP A  60      17.228  -9.730  37.841  1.00  0.78           C  
ATOM    364  C   ASP A  60      16.380 -11.015  37.935  1.00  0.78           C  
ATOM    365  O   ASP A  60      16.007 -11.538  36.879  1.00  0.78           O  
ATOM    366  CB  ASP A  60      16.376  -8.471  37.587  1.00  0.78           C  
ATOM    367  CG  ASP A  60      15.580  -8.156  38.833  1.00  0.78           C  
ATOM    368  OD1 ASP A  60      16.158  -7.577  39.779  1.00  0.78           O  
ATOM    369  OD2 ASP A  60      14.392  -8.560  38.879  1.00  0.78           O  
ATOM    370  N   PRO A  61      16.048 -11.585  39.092  1.00  0.75           N  
ATOM    371  CA  PRO A  61      15.230 -12.798  39.240  1.00  0.75           C  
ATOM    372  C   PRO A  61      13.769 -12.520  38.931  1.00  0.75           C  
ATOM    373  O   PRO A  61      13.004 -13.447  38.668  1.00  0.75           O  
ATOM    374  CB  PRO A  61      15.381 -13.130  40.739  1.00  0.75           C  
ATOM    375  CG  PRO A  61      15.502 -11.722  41.330  1.00  0.75           C  
ATOM    376  CD  PRO A  61      16.505 -11.093  40.382  1.00  0.75           C  
ATOM    377  N   GLY A  62      13.349 -11.250  39.028  1.00  0.78           N  
ATOM    378  CA  GLY A  62      12.002 -10.781  38.838  1.00  0.78           C  
ATOM    379  C   GLY A  62      11.938  -9.943  37.601  1.00  0.78           C  
ATOM    380  O   GLY A  62      11.095  -9.058  37.524  1.00  0.78           O  
ATOM    381  N   PHE A  63      12.827 -10.158  36.606  1.00  0.80           N  
ATOM    382  CA  PHE A  63      12.803  -9.461  35.325  1.00  0.80           C  
ATOM    383  C   PHE A  63      11.413  -9.457  34.650  1.00  0.80           C  
ATOM    384  O   PHE A  63      10.648 -10.421  34.733  1.00  0.80           O  
ATOM    385  CB  PHE A  63      13.878 -10.076  34.362  1.00  0.80           C  
ATOM    386  CG  PHE A  63      13.927  -9.434  32.989  1.00  0.80           C  
ATOM    387  CD1 PHE A  63      14.596  -8.217  32.779  1.00  0.80           C  
ATOM    388  CD2 PHE A  63      13.264 -10.037  31.903  1.00  0.80           C  
ATOM    389  CE1 PHE A  63      14.612  -7.622  31.505  1.00  0.80           C  
ATOM    390  CE2 PHE A  63      13.272  -9.439  30.637  1.00  0.80           C  
ATOM    391  CZ  PHE A  63      13.952  -8.236  30.434  1.00  0.80           C  
ATOM    392  N   VAL A  64      11.061  -8.341  33.972  1.00  0.84           N  
ATOM    393  CA  VAL A  64       9.885  -8.265  33.113  1.00  0.84           C  
ATOM    394  C   VAL A  64      10.300  -8.004  31.684  1.00  0.84           C  
ATOM    395  O   VAL A  64      10.086  -8.826  30.794  1.00  0.84           O  
ATOM    396  CB  VAL A  64       8.871  -7.197  33.533  1.00  0.84           C  
ATOM    397  CG1 VAL A  64       7.645  -7.230  32.593  1.00  0.84           C  
ATOM    398  CG2 VAL A  64       8.405  -7.532  34.954  1.00  0.84           C  
ATOM    399  N   LYS A  65      10.859  -6.813  31.403  1.00  0.85           N  
ATOM    400  CA  LYS A  65      11.042  -6.404  30.034  1.00  0.85           C  
ATOM    401  C   LYS A  65      12.180  -5.429  29.901  1.00  0.85           C  
ATOM    402  O   LYS A  65      12.574  -4.735  30.843  1.00  0.85           O  
ATOM    403  CB  LYS A  65       9.748  -5.774  29.446  1.00  0.85           C  
ATOM    404  CG  LYS A  65       9.290  -4.471  30.132  1.00  0.85           C  
ATOM    405  CD  LYS A  65       7.853  -4.113  29.724  1.00  0.85           C  
ATOM    406  CE  LYS A  65       7.379  -2.735  30.216  1.00  0.85           C  
ATOM    407  NZ  LYS A  65       7.878  -1.679  29.289  1.00  0.85           N  
ATOM    408  N   TRP A  66      12.724  -5.366  28.677  1.00  0.88           N  
ATOM    409  CA  TRP A  66      13.534  -4.275  28.200  1.00  0.88           C  
ATOM    410  C   TRP A  66      12.639  -3.384  27.374  1.00  0.88           C  
ATOM    411  O   TRP A  66      11.871  -3.843  26.528  1.00  0.88           O  
ATOM    412  CB  TRP A  66      14.688  -4.733  27.274  1.00  0.88           C  
ATOM    413  CG  TRP A  66      15.910  -5.315  27.960  1.00  0.88           C  
ATOM    414  CD1 TRP A  66      16.210  -6.629  28.158  1.00  0.88           C  
ATOM    415  CD2 TRP A  66      17.060  -4.568  28.406  1.00  0.88           C  
ATOM    416  NE1 TRP A  66      17.464  -6.759  28.707  1.00  0.88           N  
ATOM    417  CE2 TRP A  66      18.011  -5.510  28.860  1.00  0.88           C  
ATOM    418  CE3 TRP A  66      17.338  -3.204  28.427  1.00  0.88           C  
ATOM    419  CZ2 TRP A  66      19.249  -5.103  29.342  1.00  0.88           C  
ATOM    420  CZ3 TRP A  66      18.573  -2.797  28.960  1.00  0.88           C  
ATOM    421  CH2 TRP A  66      19.516  -3.731  29.407  1.00  0.88           C  
ATOM    422  N   THR A  67      12.749  -2.073  27.600  1.00  0.86           N  
ATOM    423  CA  THR A  67      12.117  -1.056  26.781  1.00  0.86           C  
ATOM    424  C   THR A  67      13.225  -0.369  26.028  1.00  0.86           C  
ATOM    425  O   THR A  67      14.238   0.005  26.615  1.00  0.86           O  
ATOM    426  CB  THR A  67      11.405   0.033  27.584  1.00  0.86           C  
ATOM    427  OG1 THR A  67      10.337  -0.465  28.377  1.00  0.86           O  
ATOM    428  CG2 THR A  67      10.734   1.077  26.681  1.00  0.86           C  
ATOM    429  N   PHE A  68      13.060  -0.186  24.710  1.00  0.83           N  
ATOM    430  CA  PHE A  68      13.920   0.642  23.893  1.00  0.83           C  
ATOM    431  C   PHE A  68      13.114   1.872  23.504  1.00  0.83           C  
ATOM    432  O   PHE A  68      11.908   1.782  23.259  1.00  0.83           O  
ATOM    433  CB  PHE A  68      14.446  -0.120  22.631  1.00  0.83           C  
ATOM    434  CG  PHE A  68      15.151   0.793  21.649  1.00  0.83           C  
ATOM    435  CD1 PHE A  68      16.321   1.471  22.029  1.00  0.83           C  
ATOM    436  CD2 PHE A  68      14.583   1.067  20.388  1.00  0.83           C  
ATOM    437  CE1 PHE A  68      16.932   2.374  21.151  1.00  0.83           C  
ATOM    438  CE2 PHE A  68      15.175   2.002  19.525  1.00  0.83           C  
ATOM    439  CZ  PHE A  68      16.356   2.650  19.904  1.00  0.83           C  
ATOM    440  N   GLU A  69      13.800   3.029  23.454  1.00  0.78           N  
ATOM    441  CA  GLU A  69      13.240   4.299  23.057  1.00  0.78           C  
ATOM    442  C   GLU A  69      14.331   5.230  22.508  1.00  0.78           C  
ATOM    443  O   GLU A  69      15.192   5.770  23.217  1.00  0.78           O  
ATOM    444  CB  GLU A  69      12.377   4.924  24.206  1.00  0.78           C  
ATOM    445  CG  GLU A  69      13.092   5.006  25.594  1.00  0.78           C  
ATOM    446  CD  GLU A  69      12.231   5.238  26.851  1.00  0.78           C  
ATOM    447  OE1 GLU A  69      10.994   5.414  26.761  1.00  0.78           O  
ATOM    448  OE2 GLU A  69      12.854   5.203  27.958  1.00  0.78           O  
ATOM    449  N   ILE A  70      14.319   5.432  21.166  1.00  0.77           N  
ATOM    450  CA  ILE A  70      14.667   6.700  20.536  1.00  0.77           C  
ATOM    451  C   ILE A  70      13.394   7.561  20.523  1.00  0.77           C  
ATOM    452  O   ILE A  70      12.517   7.385  21.356  1.00  0.77           O  
ATOM    453  CB  ILE A  70      15.379   6.509  19.174  1.00  0.77           C  
ATOM    454  CG1 ILE A  70      16.107   7.744  18.561  1.00  0.77           C  
ATOM    455  CG2 ILE A  70      14.463   5.825  18.139  1.00  0.77           C  
ATOM    456  CD1 ILE A  70      17.082   8.473  19.502  1.00  0.77           C  
ATOM    457  N   LEU A  71      13.293   8.548  19.620  1.00  0.80           N  
ATOM    458  CA  LEU A  71      12.509   9.775  19.715  1.00  0.80           C  
ATOM    459  C   LEU A  71      11.104   9.695  20.292  1.00  0.80           C  
ATOM    460  O   LEU A  71      10.893  10.027  21.458  1.00  0.80           O  
ATOM    461  CB  LEU A  71      12.464  10.412  18.304  1.00  0.80           C  
ATOM    462  CG  LEU A  71      13.828  10.961  17.842  1.00  0.80           C  
ATOM    463  CD1 LEU A  71      13.942  10.910  16.317  1.00  0.80           C  
ATOM    464  CD2 LEU A  71      13.948  12.417  18.279  1.00  0.80           C  
ATOM    465  N   ASP A  72      10.152   9.228  19.470  1.00  0.73           N  
ATOM    466  CA  ASP A  72       8.819   8.832  19.861  1.00  0.73           C  
ATOM    467  C   ASP A  72       8.673   7.325  19.564  1.00  0.73           C  
ATOM    468  O   ASP A  72       7.632   6.713  19.805  1.00  0.73           O  
ATOM    469  CB  ASP A  72       7.793   9.651  19.020  1.00  0.73           C  
ATOM    470  CG  ASP A  72       7.796  11.151  19.332  1.00  0.73           C  
ATOM    471  OD1 ASP A  72       8.390  11.621  20.333  1.00  0.73           O  
ATOM    472  OD2 ASP A  72       7.210  11.893  18.505  1.00  0.73           O  
ATOM    473  N   GLU A  73       9.732   6.668  19.021  1.00  0.69           N  
ATOM    474  CA  GLU A  73       9.807   5.224  18.850  1.00  0.69           C  
ATOM    475  C   GLU A  73       9.856   4.478  20.168  1.00  0.69           C  
ATOM    476  O   GLU A  73      10.564   4.853  21.095  1.00  0.69           O  
ATOM    477  CB  GLU A  73      11.059   4.777  18.058  1.00  0.69           C  
ATOM    478  CG  GLU A  73      11.081   5.250  16.584  1.00  0.69           C  
ATOM    479  CD  GLU A  73      12.330   4.784  15.821  1.00  0.69           C  
ATOM    480  OE1 GLU A  73      12.933   3.757  16.225  1.00  0.69           O  
ATOM    481  OE2 GLU A  73      12.683   5.473  14.829  1.00  0.69           O  
ATOM    482  N   THR A  74       9.151   3.344  20.254  1.00  0.74           N  
ATOM    483  CA  THR A  74       9.020   2.607  21.499  1.00  0.74           C  
ATOM    484  C   THR A  74       9.065   1.175  21.097  1.00  0.74           C  
ATOM    485  O   THR A  74       8.511   0.774  20.071  1.00  0.74           O  
ATOM    486  CB  THR A  74       7.710   2.869  22.255  1.00  0.74           C  
ATOM    487  OG1 THR A  74       7.790   4.135  22.880  1.00  0.74           O  
ATOM    488  CG2 THR A  74       7.433   1.880  23.405  1.00  0.74           C  
ATOM    489  N   ASN A  75       9.757   0.330  21.871  1.00  0.79           N  
ATOM    490  CA  ASN A  75       9.790  -1.070  21.550  1.00  0.79           C  
ATOM    491  C   ASN A  75       9.987  -1.862  22.823  1.00  0.79           C  
ATOM    492  O   ASN A  75      10.599  -1.375  23.774  1.00  0.79           O  
ATOM    493  CB  ASN A  75      10.939  -1.317  20.529  1.00  0.79           C  
ATOM    494  CG  ASN A  75      10.632  -2.397  19.500  1.00  0.79           C  
ATOM    495  OD1 ASN A  75      11.521  -3.148  19.103  1.00  0.79           O  
ATOM    496  ND2 ASN A  75       9.374  -2.476  19.012  1.00  0.79           N  
ATOM    497  N   GLU A  76       9.464  -3.099  22.880  1.00  0.79           N  
ATOM    498  CA  GLU A  76       9.578  -3.943  24.046  1.00  0.79           C  
ATOM    499  C   GLU A  76      10.079  -5.299  23.650  1.00  0.79           C  
ATOM    500  O   GLU A  76       9.821  -5.797  22.557  1.00  0.79           O  
ATOM    501  CB  GLU A  76       8.249  -4.120  24.795  1.00  0.79           C  
ATOM    502  CG  GLU A  76       7.871  -2.824  25.525  1.00  0.79           C  
ATOM    503  CD  GLU A  76       6.625  -3.003  26.441  1.00  0.79           C  
ATOM    504  OE1 GLU A  76       6.248  -1.925  27.009  1.00  0.79           O  
ATOM    505  OE2 GLU A  76       6.235  -4.187  26.712  1.00  0.79           O  
ATOM    506  N   ASN A  77      10.836  -5.922  24.561  1.00  0.78           N  
ATOM    507  CA  ASN A  77      11.353  -7.248  24.393  1.00  0.78           C  
ATOM    508  C   ASN A  77      11.287  -7.878  25.787  1.00  0.78           C  
ATOM    509  O   ASN A  77      11.733  -7.277  26.768  1.00  0.78           O  
ATOM    510  CB  ASN A  77      12.792  -7.131  23.806  1.00  0.78           C  
ATOM    511  CG  ASN A  77      13.371  -8.502  23.516  1.00  0.78           C  
ATOM    512  OD1 ASN A  77      12.620  -9.457  23.321  1.00  0.78           O  
ATOM    513  ND2 ASN A  77      14.715  -8.637  23.524  1.00  0.78           N  
ATOM    514  N   LYS A  78      10.707  -9.091  25.919  1.00  0.73           N  
ATOM    515  CA  LYS A  78      10.480  -9.788  27.184  1.00  0.73           C  
ATOM    516  C   LYS A  78      11.553 -10.837  27.443  1.00  0.73           C  
ATOM    517  O   LYS A  78      11.378 -11.766  28.228  1.00  0.73           O  
ATOM    518  CB  LYS A  78       9.089 -10.474  27.225  1.00  0.73           C  
ATOM    519  CG  LYS A  78       7.943  -9.451  27.185  1.00  0.73           C  
ATOM    520  CD  LYS A  78       6.566 -10.121  27.336  1.00  0.73           C  
ATOM    521  CE  LYS A  78       5.413  -9.109  27.336  1.00  0.73           C  
ATOM    522  NZ  LYS A  78       4.113  -9.811  27.463  1.00  0.73           N  
ATOM    523  N   GLN A  79      12.713 -10.713  26.780  1.00  0.70           N  
ATOM    524  CA  GLN A  79      13.846 -11.595  26.941  1.00  0.70           C  
ATOM    525  C   GLN A  79      14.900 -10.769  27.662  1.00  0.70           C  
ATOM    526  O   GLN A  79      15.154  -9.631  27.276  1.00  0.70           O  
ATOM    527  CB  GLN A  79      14.421 -12.080  25.568  1.00  0.70           C  
ATOM    528  CG  GLN A  79      13.387 -12.284  24.418  1.00  0.70           C  
ATOM    529  CD  GLN A  79      12.772 -13.676  24.255  1.00  0.70           C  
ATOM    530  OE1 GLN A  79      12.433 -14.083  23.144  1.00  0.70           O  
ATOM    531  NE2 GLN A  79      12.590 -14.429  25.357  1.00  0.70           N  
ATOM    532  N   ASN A  80      15.521 -11.316  28.729  1.00  0.79           N  
ATOM    533  CA  ASN A  80      16.518 -10.691  29.597  1.00  0.79           C  
ATOM    534  C   ASN A  80      17.787 -10.236  28.895  1.00  0.79           C  
ATOM    535  O   ASN A  80      18.442  -9.285  29.319  1.00  0.79           O  
ATOM    536  CB  ASN A  80      16.911 -11.605  30.801  1.00  0.79           C  
ATOM    537  CG  ASN A  80      17.458 -12.973  30.379  1.00  0.79           C  
ATOM    538  OD1 ASN A  80      17.033 -13.576  29.394  1.00  0.79           O  
ATOM    539  ND2 ASN A  80      18.429 -13.500  31.158  1.00  0.79           N  
ATOM    540  N   GLU A  81      18.167 -10.924  27.812  1.00  0.78           N  
ATOM    541  CA  GLU A  81      19.247 -10.527  26.950  1.00  0.78           C  
ATOM    542  C   GLU A  81      18.627  -9.916  25.703  1.00  0.78           C  
ATOM    543  O   GLU A  81      17.796 -10.517  25.013  1.00  0.78           O  
ATOM    544  CB  GLU A  81      20.197 -11.705  26.618  1.00  0.78           C  
ATOM    545  CG  GLU A  81      21.421 -11.284  25.758  1.00  0.78           C  
ATOM    546  CD  GLU A  81      22.427 -12.417  25.542  1.00  0.78           C  
ATOM    547  OE1 GLU A  81      22.016 -13.491  25.035  1.00  0.78           O  
ATOM    548  OE2 GLU A  81      23.629 -12.205  25.865  1.00  0.78           O  
ATOM    549  N   TRP A  82      18.995  -8.658  25.411  1.00  0.84           N  
ATOM    550  CA  TRP A  82      18.657  -7.954  24.198  1.00  0.84           C  
ATOM    551  C   TRP A  82      19.807  -8.169  23.230  1.00  0.84           C  
ATOM    552  O   TRP A  82      20.938  -7.760  23.493  1.00  0.84           O  
ATOM    553  CB  TRP A  82      18.428  -6.423  24.429  1.00  0.84           C  
ATOM    554  CG  TRP A  82      18.050  -5.635  23.175  1.00  0.84           C  
ATOM    555  CD1 TRP A  82      18.778  -5.439  22.031  1.00  0.84           C  
ATOM    556  CD2 TRP A  82      16.777  -5.009  22.954  1.00  0.84           C  
ATOM    557  NE1 TRP A  82      17.993  -4.848  21.071  1.00  0.84           N  
ATOM    558  CE2 TRP A  82      16.772  -4.533  21.621  1.00  0.84           C  
ATOM    559  CE3 TRP A  82      15.676  -4.841  23.778  1.00  0.84           C  
ATOM    560  CZ2 TRP A  82      15.668  -3.864  21.107  1.00  0.84           C  
ATOM    561  CZ3 TRP A  82      14.574  -4.135  23.276  1.00  0.84           C  
ATOM    562  CH2 TRP A  82      14.568  -3.657  21.955  1.00  0.84           C  
ATOM    563  N   ILE A  83      19.521  -8.790  22.072  1.00  0.81           N  
ATOM    564  CA  ILE A  83      20.455  -8.961  20.975  1.00  0.81           C  
ATOM    565  C   ILE A  83      19.841  -8.330  19.747  1.00  0.81           C  
ATOM    566  O   ILE A  83      18.722  -8.663  19.339  1.00  0.81           O  
ATOM    567  CB  ILE A  83      20.858 -10.419  20.746  1.00  0.81           C  
ATOM    568  CG1 ILE A  83      21.885 -10.778  21.842  1.00  0.81           C  
ATOM    569  CG2 ILE A  83      21.457 -10.684  19.334  1.00  0.81           C  
ATOM    570  CD1 ILE A  83      22.139 -12.281  21.956  1.00  0.81           C  
ATOM    571  N   THR A  84      20.571  -7.389  19.125  1.00  0.81           N  
ATOM    572  CA  THR A  84      20.310  -6.901  17.769  1.00  0.81           C  
ATOM    573  C   THR A  84      21.562  -7.166  16.971  1.00  0.81           C  
ATOM    574  O   THR A  84      22.579  -6.513  17.178  1.00  0.81           O  
ATOM    575  CB  THR A  84      20.060  -5.395  17.626  1.00  0.81           C  
ATOM    576  OG1 THR A  84      18.903  -4.990  18.333  1.00  0.81           O  
ATOM    577  CG2 THR A  84      19.766  -5.015  16.163  1.00  0.81           C  
ATOM    578  N   GLU A  85      21.543  -8.137  16.042  1.00  0.76           N  
ATOM    579  CA  GLU A  85      22.743  -8.611  15.370  1.00  0.76           C  
ATOM    580  C   GLU A  85      23.482  -7.660  14.415  1.00  0.76           C  
ATOM    581  O   GLU A  85      24.709  -7.656  14.390  1.00  0.76           O  
ATOM    582  CB  GLU A  85      22.414  -9.882  14.589  1.00  0.76           C  
ATOM    583  CG  GLU A  85      22.279 -11.195  15.383  1.00  0.76           C  
ATOM    584  CD  GLU A  85      22.058 -12.309  14.352  1.00  0.76           C  
ATOM    585  OE1 GLU A  85      21.808 -11.948  13.159  1.00  0.76           O  
ATOM    586  OE2 GLU A  85      22.087 -13.497  14.743  1.00  0.76           O  
ATOM    587  N   LYS A  86      22.802  -6.854  13.569  1.00  0.78           N  
ATOM    588  CA  LYS A  86      23.468  -5.919  12.667  1.00  0.78           C  
ATOM    589  C   LYS A  86      22.915  -4.561  13.052  1.00  0.78           C  
ATOM    590  O   LYS A  86      21.889  -4.147  12.518  1.00  0.78           O  
ATOM    591  CB  LYS A  86      23.216  -6.140  11.127  1.00  0.78           C  
ATOM    592  CG  LYS A  86      23.356  -7.579  10.576  1.00  0.78           C  
ATOM    593  CD  LYS A  86      22.002  -8.233  10.202  1.00  0.78           C  
ATOM    594  CE  LYS A  86      21.511  -9.181  11.301  1.00  0.78           C  
ATOM    595  NZ  LYS A  86      20.086  -8.986  11.645  1.00  0.78           N  
ATOM    596  N   ALA A  87      23.521  -3.852  14.024  1.00  0.87           N  
ATOM    597  CA  ALA A  87      23.057  -2.545  14.449  1.00  0.87           C  
ATOM    598  C   ALA A  87      22.990  -1.490  13.348  1.00  0.87           C  
ATOM    599  O   ALA A  87      23.937  -1.272  12.591  1.00  0.87           O  
ATOM    600  CB  ALA A  87      23.968  -2.001  15.563  1.00  0.87           C  
ATOM    601  N   GLU A  88      21.846  -0.800  13.265  1.00  0.80           N  
ATOM    602  CA  GLU A  88      21.567   0.272  12.345  1.00  0.80           C  
ATOM    603  C   GLU A  88      21.564   1.559  13.099  1.00  0.80           C  
ATOM    604  O   GLU A  88      21.419   1.553  14.320  1.00  0.80           O  
ATOM    605  CB  GLU A  88      20.138   0.181  11.795  1.00  0.80           C  
ATOM    606  CG  GLU A  88      19.945  -1.034  10.871  1.00  0.80           C  
ATOM    607  CD  GLU A  88      18.860  -0.792   9.823  1.00  0.80           C  
ATOM    608  OE1 GLU A  88      18.678  -1.706   8.982  1.00  0.80           O  
ATOM    609  OE2 GLU A  88      18.228   0.299   9.834  1.00  0.80           O  
ATOM    610  N   ALA A  89      21.630   2.711  12.416  1.00  0.87           N  
ATOM    611  CA  ALA A  89      21.631   4.025  13.036  1.00  0.87           C  
ATOM    612  C   ALA A  89      20.408   4.322  13.913  1.00  0.87           C  
ATOM    613  O   ALA A  89      20.495   5.029  14.916  1.00  0.87           O  
ATOM    614  CB  ALA A  89      21.718   5.115  11.954  1.00  0.87           C  
ATOM    615  N   THR A  90      19.231   3.785  13.542  1.00  0.85           N  
ATOM    616  CA  THR A  90      17.935   3.866  14.213  1.00  0.85           C  
ATOM    617  C   THR A  90      17.922   3.172  15.569  1.00  0.85           C  
ATOM    618  O   THR A  90      17.160   3.529  16.458  1.00  0.85           O  
ATOM    619  CB  THR A  90      16.853   3.242  13.341  1.00  0.85           C  
ATOM    620  OG1 THR A  90      17.229   1.914  12.998  1.00  0.85           O  
ATOM    621  CG2 THR A  90      16.762   4.016  12.012  1.00  0.85           C  
ATOM    622  N   ASN A  91      18.828   2.192  15.790  1.00  0.87           N  
ATOM    623  CA  ASN A  91      18.950   1.434  17.027  1.00  0.87           C  
ATOM    624  C   ASN A  91      19.657   2.217  18.149  1.00  0.87           C  
ATOM    625  O   ASN A  91      19.897   1.664  19.226  1.00  0.87           O  
ATOM    626  CB  ASN A  91      19.764   0.124  16.774  1.00  0.87           C  
ATOM    627  CG  ASN A  91      19.041  -0.871  15.868  1.00  0.87           C  
ATOM    628  OD1 ASN A  91      19.668  -1.511  15.022  1.00  0.87           O  
ATOM    629  ND2 ASN A  91      17.717  -1.058  16.060  1.00  0.87           N  
ATOM    630  N   THR A  92      19.978   3.521  17.926  1.00  0.90           N  
ATOM    631  CA  THR A  92      20.507   4.467  18.926  1.00  0.90           C  
ATOM    632  C   THR A  92      19.454   4.826  19.935  1.00  0.90           C  
ATOM    633  O   THR A  92      18.390   5.295  19.558  1.00  0.90           O  
ATOM    634  CB  THR A  92      20.935   5.853  18.387  1.00  0.90           C  
ATOM    635  OG1 THR A  92      21.994   5.763  17.463  1.00  0.90           O  
ATOM    636  CG2 THR A  92      21.504   6.804  19.465  1.00  0.90           C  
ATOM    637  N   GLY A  93      19.696   4.703  21.246  1.00  0.90           N  
ATOM    638  CA  GLY A  93      18.781   5.320  22.199  1.00  0.90           C  
ATOM    639  C   GLY A  93      18.856   4.682  23.543  1.00  0.90           C  
ATOM    640  O   GLY A  93      19.885   4.128  23.934  1.00  0.90           O  
ATOM    641  N   LYS A  94      17.764   4.754  24.315  1.00  0.85           N  
ATOM    642  CA  LYS A  94      17.760   4.346  25.698  1.00  0.85           C  
ATOM    643  C   LYS A  94      17.209   2.945  25.829  1.00  0.85           C  
ATOM    644  O   LYS A  94      16.135   2.638  25.326  1.00  0.85           O  
ATOM    645  CB  LYS A  94      16.890   5.310  26.531  1.00  0.85           C  
ATOM    646  CG  LYS A  94      17.135   5.204  28.042  1.00  0.85           C  
ATOM    647  CD  LYS A  94      16.231   6.192  28.797  1.00  0.85           C  
ATOM    648  CE  LYS A  94      16.708   6.470  30.220  1.00  0.85           C  
ATOM    649  NZ  LYS A  94      15.622   7.068  31.019  1.00  0.85           N  
ATOM    650  N   TYR A  95      17.942   2.055  26.513  1.00  0.90           N  
ATOM    651  CA  TYR A  95      17.546   0.691  26.755  1.00  0.90           C  
ATOM    652  C   TYR A  95      17.311   0.592  28.247  1.00  0.90           C  
ATOM    653  O   TYR A  95      18.250   0.732  29.028  1.00  0.90           O  
ATOM    654  CB  TYR A  95      18.699  -0.264  26.358  1.00  0.90           C  
ATOM    655  CG  TYR A  95      18.786  -0.359  24.868  1.00  0.90           C  
ATOM    656  CD1 TYR A  95      18.188  -1.448  24.215  1.00  0.90           C  
ATOM    657  CD2 TYR A  95      19.447   0.622  24.108  1.00  0.90           C  
ATOM    658  CE1 TYR A  95      18.297  -1.581  22.826  1.00  0.90           C  
ATOM    659  CE2 TYR A  95      19.492   0.519  22.711  1.00  0.90           C  
ATOM    660  CZ  TYR A  95      18.956  -0.604  22.072  1.00  0.90           C  
ATOM    661  OH  TYR A  95      19.063  -0.725  20.670  1.00  0.90           O  
ATOM    662  N   THR A  96      16.060   0.372  28.695  1.00  0.91           N  
ATOM    663  CA  THR A  96      15.691   0.343  30.116  1.00  0.91           C  
ATOM    664  C   THR A  96      15.223  -1.051  30.497  1.00  0.91           C  
ATOM    665  O   THR A  96      14.234  -1.544  29.962  1.00  0.91           O  
ATOM    666  CB  THR A  96      14.573   1.329  30.493  1.00  0.91           C  
ATOM    667  OG1 THR A  96      14.871   2.660  30.082  1.00  0.91           O  
ATOM    668  CG2 THR A  96      14.416   1.411  32.024  1.00  0.91           C  
ATOM    669  N   CYS A  97      15.922  -1.727  31.437  1.00  0.93           N  
ATOM    670  CA  CYS A  97      15.573  -3.025  32.012  1.00  0.93           C  
ATOM    671  C   CYS A  97      14.679  -2.817  33.232  1.00  0.93           C  
ATOM    672  O   CYS A  97      15.075  -2.104  34.153  1.00  0.93           O  
ATOM    673  CB  CYS A  97      16.837  -3.778  32.526  1.00  0.93           C  
ATOM    674  SG  CYS A  97      16.415  -5.343  33.360  1.00  0.93           S  
ATOM    675  N   THR A  98      13.487  -3.448  33.298  1.00  0.88           N  
ATOM    676  CA  THR A  98      12.511  -3.211  34.372  1.00  0.88           C  
ATOM    677  C   THR A  98      12.059  -4.521  34.989  1.00  0.88           C  
ATOM    678  O   THR A  98      11.771  -5.489  34.281  1.00  0.88           O  
ATOM    679  CB  THR A  98      11.262  -2.474  33.884  1.00  0.88           C  
ATOM    680  OG1 THR A  98      11.624  -1.325  33.132  1.00  0.88           O  
ATOM    681  CG2 THR A  98      10.384  -1.931  35.026  1.00  0.88           C  
ATOM    682  N   ASN A  99      11.999  -4.588  36.339  1.00  0.80           N  
ATOM    683  CA  ASN A  99      11.558  -5.741  37.117  1.00  0.80           C  
ATOM    684  C   ASN A  99      10.074  -5.705  37.538  1.00  0.80           C  
ATOM    685  O   ASN A  99       9.356  -4.720  37.355  1.00  0.80           O  
ATOM    686  CB  ASN A  99      12.540  -6.065  38.297  1.00  0.80           C  
ATOM    687  CG  ASN A  99      12.550  -5.114  39.497  1.00  0.80           C  
ATOM    688  OD1 ASN A  99      11.530  -4.566  39.919  1.00  0.80           O  
ATOM    689  ND2 ASN A  99      13.735  -4.962  40.138  1.00  0.80           N  
ATOM    690  N   LYS A 100       9.573  -6.836  38.091  1.00  0.74           N  
ATOM    691  CA  LYS A 100       8.233  -7.036  38.644  1.00  0.74           C  
ATOM    692  C   LYS A 100       7.937  -6.198  39.877  1.00  0.74           C  
ATOM    693  O   LYS A 100       6.794  -5.826  40.124  1.00  0.74           O  
ATOM    694  CB  LYS A 100       7.967  -8.521  39.026  1.00  0.74           C  
ATOM    695  CG  LYS A 100       7.840  -9.453  37.812  1.00  0.74           C  
ATOM    696  CD  LYS A 100       7.517 -10.898  38.223  1.00  0.74           C  
ATOM    697  CE  LYS A 100       7.405 -11.832  37.013  1.00  0.74           C  
ATOM    698  NZ  LYS A 100       7.139 -13.219  37.460  1.00  0.74           N  
ATOM    699  N   HIS A 101       8.974  -5.848  40.661  1.00  0.73           N  
ATOM    700  CA  HIS A 101       8.876  -5.077  41.891  1.00  0.73           C  
ATOM    701  C   HIS A 101       8.862  -3.574  41.592  1.00  0.73           C  
ATOM    702  O   HIS A 101       9.039  -2.746  42.482  1.00  0.73           O  
ATOM    703  CB  HIS A 101      10.095  -5.398  42.812  1.00  0.73           C  
ATOM    704  CG  HIS A 101       9.703  -5.928  44.151  1.00  0.73           C  
ATOM    705  ND1 HIS A 101       9.061  -7.148  44.221  1.00  0.73           N  
ATOM    706  CD2 HIS A 101       9.858  -5.401  45.394  1.00  0.73           C  
ATOM    707  CE1 HIS A 101       8.831  -7.344  45.501  1.00  0.73           C  
ATOM    708  NE2 HIS A 101       9.294  -6.318  46.258  1.00  0.73           N  
ATOM    709  N   GLY A 102       8.634  -3.188  40.313  1.00  0.81           N  
ATOM    710  CA  GLY A 102       8.487  -1.814  39.838  1.00  0.81           C  
ATOM    711  C   GLY A 102       9.782  -1.074  39.594  1.00  0.81           C  
ATOM    712  O   GLY A 102       9.769   0.098  39.233  1.00  0.81           O  
ATOM    713  N   LEU A 103      10.939  -1.729  39.779  1.00  0.81           N  
ATOM    714  CA  LEU A 103      12.248  -1.095  39.791  1.00  0.81           C  
ATOM    715  C   LEU A 103      12.998  -1.311  38.476  1.00  0.81           C  
ATOM    716  O   LEU A 103      12.841  -2.321  37.785  1.00  0.81           O  
ATOM    717  CB  LEU A 103      13.077  -1.650  40.983  1.00  0.81           C  
ATOM    718  CG  LEU A 103      12.803  -0.956  42.333  1.00  0.81           C  
ATOM    719  CD1 LEU A 103      13.159  -1.899  43.496  1.00  0.81           C  
ATOM    720  CD2 LEU A 103      13.605   0.353  42.435  1.00  0.81           C  
ATOM    721  N   SER A 104      13.856  -0.348  38.078  1.00  0.86           N  
ATOM    722  CA  SER A 104      14.525  -0.383  36.785  1.00  0.86           C  
ATOM    723  C   SER A 104      15.894   0.255  36.764  1.00  0.86           C  
ATOM    724  O   SER A 104      16.373   0.819  37.746  1.00  0.86           O  
ATOM    725  CB  SER A 104      13.683   0.221  35.632  1.00  0.86           C  
ATOM    726  OG  SER A 104      13.285   1.571  35.862  1.00  0.86           O  
ATOM    727  N   ASN A 105      16.580   0.113  35.615  1.00  0.84           N  
ATOM    728  CA  ASN A 105      17.866   0.704  35.341  1.00  0.84           C  
ATOM    729  C   ASN A 105      17.986   0.811  33.822  1.00  0.84           C  
ATOM    730  O   ASN A 105      17.252   0.144  33.090  1.00  0.84           O  
ATOM    731  CB  ASN A 105      18.974  -0.206  35.931  1.00  0.84           C  
ATOM    732  CG  ASN A 105      20.320   0.501  35.954  1.00  0.84           C  
ATOM    733  OD1 ASN A 105      20.442   1.696  35.687  1.00  0.84           O  
ATOM    734  ND2 ASN A 105      21.378  -0.265  36.291  1.00  0.84           N  
ATOM    735  N   SER A 106      18.891   1.649  33.291  1.00  0.85           N  
ATOM    736  CA  SER A 106      19.016   1.890  31.865  1.00  0.85           C  
ATOM    737  C   SER A 106      20.460   1.987  31.407  1.00  0.85           C  
ATOM    738  O   SER A 106      21.387   2.161  32.194  1.00  0.85           O  
ATOM    739  CB  SER A 106      18.245   3.159  31.388  1.00  0.85           C  
ATOM    740  OG  SER A 106      18.796   4.378  31.902  1.00  0.85           O  
ATOM    741  N   ILE A 107      20.672   1.871  30.084  1.00  0.83           N  
ATOM    742  CA  ILE A 107      21.936   2.122  29.418  1.00  0.83           C  
ATOM    743  C   ILE A 107      21.591   2.809  28.103  1.00  0.83           C  
ATOM    744  O   ILE A 107      20.504   2.624  27.547  1.00  0.83           O  
ATOM    745  CB  ILE A 107      22.773   0.843  29.223  1.00  0.83           C  
ATOM    746  CG1 ILE A 107      24.198   1.139  28.673  1.00  0.83           C  
ATOM    747  CG2 ILE A 107      21.995  -0.214  28.395  1.00  0.83           C  
ATOM    748  CD1 ILE A 107      25.150  -0.070  28.698  1.00  0.83           C  
ATOM    749  N   TYR A 108      22.475   3.683  27.585  1.00  0.85           N  
ATOM    750  CA  TYR A 108      22.275   4.380  26.326  1.00  0.85           C  
ATOM    751  C   TYR A 108      23.181   3.752  25.276  1.00  0.85           C  
ATOM    752  O   TYR A 108      24.355   3.510  25.527  1.00  0.85           O  
ATOM    753  CB  TYR A 108      22.601   5.895  26.482  1.00  0.85           C  
ATOM    754  CG  TYR A 108      21.834   6.712  25.467  1.00  0.85           C  
ATOM    755  CD1 TYR A 108      22.290   6.870  24.145  1.00  0.85           C  
ATOM    756  CD2 TYR A 108      20.612   7.304  25.840  1.00  0.85           C  
ATOM    757  CE1 TYR A 108      21.549   7.626  23.226  1.00  0.85           C  
ATOM    758  CE2 TYR A 108      19.876   8.075  24.923  1.00  0.85           C  
ATOM    759  CZ  TYR A 108      20.352   8.241  23.611  1.00  0.85           C  
ATOM    760  OH  TYR A 108      19.639   8.969  22.629  1.00  0.85           O  
ATOM    761  N   VAL A 109      22.685   3.459  24.066  1.00  0.88           N  
ATOM    762  CA  VAL A 109      23.506   2.880  23.010  1.00  0.88           C  
ATOM    763  C   VAL A 109      23.596   3.879  21.883  1.00  0.88           C  
ATOM    764  O   VAL A 109      22.579   4.284  21.324  1.00  0.88           O  
ATOM    765  CB  VAL A 109      22.965   1.548  22.504  1.00  0.88           C  
ATOM    766  CG1 VAL A 109      23.771   1.008  21.297  1.00  0.88           C  
ATOM    767  CG2 VAL A 109      23.022   0.555  23.686  1.00  0.88           C  
ATOM    768  N   PHE A 110      24.814   4.309  21.531  1.00  0.88           N  
ATOM    769  CA  PHE A 110      25.159   5.110  20.377  1.00  0.88           C  
ATOM    770  C   PHE A 110      25.732   4.208  19.304  1.00  0.88           C  
ATOM    771  O   PHE A 110      26.773   3.584  19.474  1.00  0.88           O  
ATOM    772  CB  PHE A 110      26.267   6.127  20.730  1.00  0.88           C  
ATOM    773  CG  PHE A 110      25.742   7.156  21.682  1.00  0.88           C  
ATOM    774  CD1 PHE A 110      24.840   8.142  21.242  1.00  0.88           C  
ATOM    775  CD2 PHE A 110      26.258   7.228  22.985  1.00  0.88           C  
ATOM    776  CE1 PHE A 110      24.507   9.220  22.075  1.00  0.88           C  
ATOM    777  CE2 PHE A 110      25.942   8.314  23.812  1.00  0.88           C  
ATOM    778  CZ  PHE A 110      25.072   9.314  23.356  1.00  0.88           C  
ATOM    779  N   VAL A 111      25.082   4.096  18.144  1.00  0.86           N  
ATOM    780  CA  VAL A 111      25.616   3.322  17.037  1.00  0.86           C  
ATOM    781  C   VAL A 111      26.239   4.305  16.048  1.00  0.86           C  
ATOM    782  O   VAL A 111      25.575   4.941  15.229  1.00  0.86           O  
ATOM    783  CB  VAL A 111      24.543   2.401  16.462  1.00  0.86           C  
ATOM    784  CG1 VAL A 111      23.256   3.238  16.288  1.00  0.86           C  
ATOM    785  CG2 VAL A 111      25.054   1.602  15.230  1.00  0.86           C  
ATOM    786  N   ARG A 112      27.570   4.518  16.128  1.00  0.77           N  
ATOM    787  CA  ARG A 112      28.200   5.551  15.324  1.00  0.77           C  
ATOM    788  C   ARG A 112      28.313   5.187  13.846  1.00  0.77           C  
ATOM    789  O   ARG A 112      29.005   4.244  13.453  1.00  0.77           O  
ATOM    790  CB  ARG A 112      29.563   6.060  15.859  1.00  0.77           C  
ATOM    791  CG  ARG A 112      30.780   5.112  15.721  1.00  0.77           C  
ATOM    792  CD  ARG A 112      32.066   5.886  15.450  1.00  0.77           C  
ATOM    793  NE  ARG A 112      32.361   6.602  16.696  1.00  0.77           N  
ATOM    794  CZ  ARG A 112      33.166   6.214  17.676  1.00  0.77           C  
ATOM    795  NH1 ARG A 112      33.738   5.018  17.647  1.00  0.77           N  
ATOM    796  NH2 ARG A 112      33.405   7.033  18.682  1.00  0.77           N  
ATOM    797  N   ASP A 113      27.649   5.945  12.967  1.00  0.76           N  
ATOM    798  CA  ASP A 113      27.685   5.750  11.539  1.00  0.76           C  
ATOM    799  C   ASP A 113      28.532   6.907  11.017  1.00  0.76           C  
ATOM    800  O   ASP A 113      28.302   8.033  11.466  1.00  0.76           O  
ATOM    801  CB  ASP A 113      26.213   5.736  11.014  1.00  0.76           C  
ATOM    802  CG  ASP A 113      26.037   5.577   9.512  1.00  0.76           C  
ATOM    803  OD1 ASP A 113      24.861   5.674   9.080  1.00  0.76           O  
ATOM    804  OD2 ASP A 113      27.040   5.438   8.772  1.00  0.76           O  
ATOM    805  N   PRO A 114      29.529   6.750  10.135  1.00  0.71           N  
ATOM    806  CA  PRO A 114      30.161   7.881   9.453  1.00  0.71           C  
ATOM    807  C   PRO A 114      29.179   8.706   8.626  1.00  0.71           C  
ATOM    808  O   PRO A 114      29.432   9.896   8.434  1.00  0.71           O  
ATOM    809  CB  PRO A 114      31.226   7.221   8.548  1.00  0.71           C  
ATOM    810  CG  PRO A 114      30.660   5.815   8.304  1.00  0.71           C  
ATOM    811  CD  PRO A 114      30.055   5.462   9.662  1.00  0.71           C  
ATOM    812  N   ALA A 115      28.099   8.103   8.081  1.00  0.74           N  
ATOM    813  CA  ALA A 115      27.122   8.796   7.272  1.00  0.74           C  
ATOM    814  C   ALA A 115      26.075   9.512   8.109  1.00  0.74           C  
ATOM    815  O   ALA A 115      25.844  10.712   7.961  1.00  0.74           O  
ATOM    816  CB  ALA A 115      26.384   7.752   6.406  1.00  0.74           C  
ATOM    817  N   LYS A 116      25.408   8.795   9.035  1.00  0.75           N  
ATOM    818  CA  LYS A 116      24.356   9.386   9.834  1.00  0.75           C  
ATOM    819  C   LYS A 116      24.809   9.747  11.224  1.00  0.75           C  
ATOM    820  O   LYS A 116      24.878   8.896  12.108  1.00  0.75           O  
ATOM    821  CB  LYS A 116      23.151   8.446  10.044  1.00  0.75           C  
ATOM    822  CG  LYS A 116      22.457   8.034   8.741  1.00  0.75           C  
ATOM    823  CD  LYS A 116      21.004   7.600   8.991  1.00  0.75           C  
ATOM    824  CE  LYS A 116      20.105   8.796   9.345  1.00  0.75           C  
ATOM    825  NZ  LYS A 116      18.740   8.349   9.691  1.00  0.75           N  
ATOM    826  N   LEU A 117      25.023  11.052  11.471  1.00  0.78           N  
ATOM    827  CA  LEU A 117      25.388  11.550  12.781  1.00  0.78           C  
ATOM    828  C   LEU A 117      24.157  12.037  13.514  1.00  0.78           C  
ATOM    829  O   LEU A 117      24.232  12.369  14.689  1.00  0.78           O  
ATOM    830  CB  LEU A 117      26.434  12.695  12.717  1.00  0.78           C  
ATOM    831  CG  LEU A 117      27.774  12.250  12.083  1.00  0.78           C  
ATOM    832  CD1 LEU A 117      27.794  12.364  10.546  1.00  0.78           C  
ATOM    833  CD2 LEU A 117      28.953  13.038  12.680  1.00  0.78           C  
ATOM    834  N   PHE A 118      22.986  12.046  12.851  1.00  0.81           N  
ATOM    835  CA  PHE A 118      21.731  12.527  13.377  1.00  0.81           C  
ATOM    836  C   PHE A 118      20.649  11.555  12.983  1.00  0.81           C  
ATOM    837  O   PHE A 118      20.584  11.036  11.862  1.00  0.81           O  
ATOM    838  CB  PHE A 118      21.329  13.915  12.816  1.00  0.81           C  
ATOM    839  CG  PHE A 118      22.343  14.935  13.224  1.00  0.81           C  
ATOM    840  CD1 PHE A 118      22.584  15.225  14.580  1.00  0.81           C  
ATOM    841  CD2 PHE A 118      23.065  15.618  12.238  1.00  0.81           C  
ATOM    842  CE1 PHE A 118      23.519  16.200  14.949  1.00  0.81           C  
ATOM    843  CE2 PHE A 118      23.927  16.656  12.599  1.00  0.81           C  
ATOM    844  CZ  PHE A 118      24.152  16.947  13.951  1.00  0.81           C  
ATOM    845  N   LEU A 119      19.739  11.274  13.909  1.00  0.83           N  
ATOM    846  CA  LEU A 119      18.401  10.860  13.585  1.00  0.83           C  
ATOM    847  C   LEU A 119      17.532  11.930  14.177  1.00  0.83           C  
ATOM    848  O   LEU A 119      17.945  12.671  15.070  1.00  0.83           O  
ATOM    849  CB  LEU A 119      18.038   9.419  14.022  1.00  0.83           C  
ATOM    850  CG  LEU A 119      18.781   8.869  15.257  1.00  0.83           C  
ATOM    851  CD1 LEU A 119      18.418   9.579  16.568  1.00  0.83           C  
ATOM    852  CD2 LEU A 119      18.472   7.370  15.355  1.00  0.83           C  
ATOM    853  N   VAL A 120      16.353  12.155  13.603  1.00  0.82           N  
ATOM    854  CA  VAL A 120      15.731  13.446  13.722  1.00  0.82           C  
ATOM    855  C   VAL A 120      14.250  13.254  13.764  1.00  0.82           C  
ATOM    856  O   VAL A 120      13.704  12.282  13.243  1.00  0.82           O  
ATOM    857  CB  VAL A 120      16.060  14.374  12.546  1.00  0.82           C  
ATOM    858  CG1 VAL A 120      17.523  14.854  12.647  1.00  0.82           C  
ATOM    859  CG2 VAL A 120      15.821  13.668  11.191  1.00  0.82           C  
ATOM    860  N   ASP A 121      13.561  14.218  14.379  1.00  0.80           N  
ATOM    861  CA  ASP A 121      12.178  14.449  14.089  1.00  0.80           C  
ATOM    862  C   ASP A 121      12.127  15.919  13.713  1.00  0.80           C  
ATOM    863  O   ASP A 121      12.397  16.813  14.523  1.00  0.80           O  
ATOM    864  CB  ASP A 121      11.263  14.040  15.266  1.00  0.80           C  
ATOM    865  CG  ASP A 121       9.785  14.247  14.929  1.00  0.80           C  
ATOM    866  OD1 ASP A 121       8.949  13.981  15.826  1.00  0.80           O  
ATOM    867  OD2 ASP A 121       9.477  14.787  13.837  1.00  0.80           O  
ATOM    868  N   ARG A 122      11.825  16.174  12.430  1.00  0.68           N  
ATOM    869  CA  ARG A 122      11.780  17.466  11.783  1.00  0.68           C  
ATOM    870  C   ARG A 122      10.588  18.303  12.184  1.00  0.68           C  
ATOM    871  O   ARG A 122      10.573  19.514  11.945  1.00  0.68           O  
ATOM    872  CB  ARG A 122      11.689  17.298  10.238  1.00  0.68           C  
ATOM    873  CG  ARG A 122      12.790  16.422   9.594  1.00  0.68           C  
ATOM    874  CD  ARG A 122      12.419  15.832   8.214  1.00  0.68           C  
ATOM    875  NE  ARG A 122      11.933  16.932   7.307  1.00  0.68           N  
ATOM    876  CZ  ARG A 122      12.710  17.859   6.729  1.00  0.68           C  
ATOM    877  NH1 ARG A 122      14.027  17.846   6.863  1.00  0.68           N  
ATOM    878  NH2 ARG A 122      12.155  18.875   6.068  1.00  0.68           N  
ATOM    879  N   SER A 123       9.550  17.678  12.769  1.00  0.78           N  
ATOM    880  CA  SER A 123       8.396  18.364  13.318  1.00  0.78           C  
ATOM    881  C   SER A 123       8.797  19.215  14.512  1.00  0.78           C  
ATOM    882  O   SER A 123       9.007  18.730  15.624  1.00  0.78           O  
ATOM    883  CB  SER A 123       7.305  17.344  13.725  1.00  0.78           C  
ATOM    884  OG  SER A 123       6.033  17.965  13.929  1.00  0.78           O  
ATOM    885  N   LEU A 124       8.964  20.532  14.285  1.00  0.81           N  
ATOM    886  CA  LEU A 124       9.431  21.449  15.297  1.00  0.81           C  
ATOM    887  C   LEU A 124       8.343  22.471  15.599  1.00  0.81           C  
ATOM    888  O   LEU A 124       7.971  23.302  14.768  1.00  0.81           O  
ATOM    889  CB  LEU A 124      10.738  22.163  14.854  1.00  0.81           C  
ATOM    890  CG  LEU A 124      11.744  22.440  15.999  1.00  0.81           C  
ATOM    891  CD1 LEU A 124      12.723  23.552  15.599  1.00  0.81           C  
ATOM    892  CD2 LEU A 124      11.130  22.821  17.352  1.00  0.81           C  
ATOM    893  N   TYR A 125       7.811  22.447  16.833  1.00  0.80           N  
ATOM    894  CA  TYR A 125       6.827  23.400  17.285  1.00  0.80           C  
ATOM    895  C   TYR A 125       7.204  23.798  18.688  1.00  0.80           C  
ATOM    896  O   TYR A 125       7.521  22.952  19.522  1.00  0.80           O  
ATOM    897  CB  TYR A 125       5.392  22.804  17.358  1.00  0.80           C  
ATOM    898  CG  TYR A 125       4.824  22.566  15.987  1.00  0.80           C  
ATOM    899  CD1 TYR A 125       4.284  23.646  15.275  1.00  0.80           C  
ATOM    900  CD2 TYR A 125       4.773  21.280  15.417  1.00  0.80           C  
ATOM    901  CE1 TYR A 125       3.722  23.461  14.005  1.00  0.80           C  
ATOM    902  CE2 TYR A 125       4.189  21.084  14.154  1.00  0.80           C  
ATOM    903  CZ  TYR A 125       3.690  22.183  13.438  1.00  0.80           C  
ATOM    904  OH  TYR A 125       3.156  22.027  12.143  1.00  0.80           O  
ATOM    905  N   GLY A 126       7.172  25.106  18.984  1.00  0.84           N  
ATOM    906  CA  GLY A 126       7.356  25.609  20.331  1.00  0.84           C  
ATOM    907  C   GLY A 126       6.221  26.494  20.697  1.00  0.84           C  
ATOM    908  O   GLY A 126       5.449  26.941  19.852  1.00  0.84           O  
ATOM    909  N   LYS A 127       6.104  26.818  21.981  1.00  0.78           N  
ATOM    910  CA  LYS A 127       5.121  27.736  22.504  1.00  0.78           C  
ATOM    911  C   LYS A 127       5.908  28.884  23.099  1.00  0.78           C  
ATOM    912  O   LYS A 127       6.764  28.644  23.947  1.00  0.78           O  
ATOM    913  CB  LYS A 127       4.321  27.034  23.638  1.00  0.78           C  
ATOM    914  CG  LYS A 127       3.529  27.945  24.599  1.00  0.78           C  
ATOM    915  CD  LYS A 127       2.113  28.340  24.136  1.00  0.78           C  
ATOM    916  CE  LYS A 127       1.286  28.937  25.282  1.00  0.78           C  
ATOM    917  NZ  LYS A 127       2.085  30.002  25.926  1.00  0.78           N  
ATOM    918  N   GLU A 128       5.628  30.142  22.680  1.00  0.78           N  
ATOM    919  CA  GLU A 128       6.100  31.394  23.277  1.00  0.78           C  
ATOM    920  C   GLU A 128       6.182  31.398  24.798  1.00  0.78           C  
ATOM    921  O   GLU A 128       5.193  31.055  25.463  1.00  0.78           O  
ATOM    922  CB  GLU A 128       5.237  32.585  22.828  1.00  0.78           C  
ATOM    923  CG  GLU A 128       5.815  33.974  23.218  1.00  0.78           C  
ATOM    924  CD  GLU A 128       4.889  35.088  22.771  1.00  0.78           C  
ATOM    925  OE1 GLU A 128       3.722  34.767  22.420  1.00  0.78           O  
ATOM    926  OE2 GLU A 128       5.310  36.271  22.723  1.00  0.78           O  
ATOM    927  N   ASP A 129       7.374  31.762  25.328  1.00  0.78           N  
ATOM    928  CA  ASP A 129       7.740  31.861  26.731  1.00  0.78           C  
ATOM    929  C   ASP A 129       8.036  30.497  27.387  1.00  0.78           C  
ATOM    930  O   ASP A 129       8.379  30.423  28.565  1.00  0.78           O  
ATOM    931  CB  ASP A 129       6.730  32.682  27.581  1.00  0.78           C  
ATOM    932  CG  ASP A 129       6.557  34.132  27.179  1.00  0.78           C  
ATOM    933  OD1 ASP A 129       7.402  34.807  26.540  1.00  0.78           O  
ATOM    934  OD2 ASP A 129       5.489  34.657  27.591  1.00  0.78           O  
ATOM    935  N   ASN A 130       7.974  29.371  26.642  1.00  0.80           N  
ATOM    936  CA  ASN A 130       8.350  28.057  27.136  1.00  0.80           C  
ATOM    937  C   ASN A 130       9.603  27.599  26.391  1.00  0.80           C  
ATOM    938  O   ASN A 130      10.020  28.179  25.390  1.00  0.80           O  
ATOM    939  CB  ASN A 130       7.195  27.014  26.963  1.00  0.80           C  
ATOM    940  CG  ASN A 130       5.997  27.345  27.855  1.00  0.80           C  
ATOM    941  OD1 ASN A 130       4.994  27.945  27.460  1.00  0.80           O  
ATOM    942  ND2 ASN A 130       6.061  26.875  29.125  1.00  0.80           N  
ATOM    943  N   ASP A 131      10.282  26.547  26.875  1.00  0.81           N  
ATOM    944  CA  ASP A 131      11.364  25.940  26.132  1.00  0.81           C  
ATOM    945  C   ASP A 131      10.853  25.070  24.991  1.00  0.81           C  
ATOM    946  O   ASP A 131       9.676  24.714  24.891  1.00  0.81           O  
ATOM    947  CB  ASP A 131      12.283  25.115  27.066  1.00  0.81           C  
ATOM    948  CG  ASP A 131      13.070  26.023  28.002  1.00  0.81           C  
ATOM    949  OD1 ASP A 131      13.671  25.476  28.959  1.00  0.81           O  
ATOM    950  OD2 ASP A 131      13.112  27.262  27.773  1.00  0.81           O  
ATOM    951  N   THR A 132      11.778  24.724  24.086  1.00  0.83           N  
ATOM    952  CA  THR A 132      11.502  23.940  22.902  1.00  0.83           C  
ATOM    953  C   THR A 132      12.703  23.077  22.680  1.00  0.83           C  
ATOM    954  O   THR A 132      13.838  23.546  22.742  1.00  0.83           O  
ATOM    955  CB  THR A 132      11.381  24.797  21.652  1.00  0.83           C  
ATOM    956  OG1 THR A 132      10.173  25.524  21.656  1.00  0.83           O  
ATOM    957  CG2 THR A 132      11.331  23.990  20.354  1.00  0.83           C  
ATOM    958  N   LEU A 133      12.499  21.791  22.358  1.00  0.82           N  
ATOM    959  CA  LEU A 133      13.562  20.867  22.028  1.00  0.82           C  
ATOM    960  C   LEU A 133      13.589  20.676  20.529  1.00  0.82           C  
ATOM    961  O   LEU A 133      12.621  20.219  19.915  1.00  0.82           O  
ATOM    962  CB  LEU A 133      13.321  19.482  22.687  1.00  0.82           C  
ATOM    963  CG  LEU A 133      14.258  18.329  22.261  1.00  0.82           C  
ATOM    964  CD1 LEU A 133      15.689  18.521  22.774  1.00  0.82           C  
ATOM    965  CD2 LEU A 133      13.675  16.996  22.758  1.00  0.82           C  
ATOM    966  N   VAL A 134      14.736  20.994  19.904  1.00  0.84           N  
ATOM    967  CA  VAL A 134      15.057  20.594  18.552  1.00  0.84           C  
ATOM    968  C   VAL A 134      15.501  19.144  18.575  1.00  0.84           C  
ATOM    969  O   VAL A 134      16.469  18.774  19.241  1.00  0.84           O  
ATOM    970  CB  VAL A 134      16.164  21.408  17.879  1.00  0.84           C  
ATOM    971  CG1 VAL A 134      16.017  21.186  16.367  1.00  0.84           C  
ATOM    972  CG2 VAL A 134      16.042  22.909  18.195  1.00  0.84           C  
ATOM    973  N   ARG A 135      14.791  18.269  17.849  1.00  0.79           N  
ATOM    974  CA  ARG A 135      15.050  16.855  17.860  1.00  0.79           C  
ATOM    975  C   ARG A 135      16.109  16.537  16.811  1.00  0.79           C  
ATOM    976  O   ARG A 135      15.811  16.174  15.673  1.00  0.79           O  
ATOM    977  CB  ARG A 135      13.727  16.068  17.630  1.00  0.79           C  
ATOM    978  CG  ARG A 135      12.959  15.700  18.935  1.00  0.79           C  
ATOM    979  CD  ARG A 135      11.709  16.527  19.313  1.00  0.79           C  
ATOM    980  NE  ARG A 135      10.520  15.578  19.416  1.00  0.79           N  
ATOM    981  CZ  ARG A 135       9.604  15.385  18.457  1.00  0.79           C  
ATOM    982  NH1 ARG A 135       8.733  14.377  18.503  1.00  0.79           N  
ATOM    983  NH2 ARG A 135       9.580  16.112  17.345  1.00  0.79           N  
ATOM    984  N   CYS A 136      17.388  16.630  17.205  1.00  0.85           N  
ATOM    985  CA  CYS A 136      18.508  16.057  16.478  1.00  0.85           C  
ATOM    986  C   CYS A 136      19.462  15.379  17.473  1.00  0.85           C  
ATOM    987  O   CYS A 136      20.607  15.824  17.580  1.00  0.85           O  
ATOM    988  CB  CYS A 136      19.238  17.102  15.563  1.00  0.85           C  
ATOM    989  SG  CYS A 136      19.612  18.690  16.364  1.00  0.85           S  
ATOM    990  N   PRO A 137      19.091  14.337  18.267  1.00  0.89           N  
ATOM    991  CA  PRO A 137      20.076  13.493  18.950  1.00  0.89           C  
ATOM    992  C   PRO A 137      21.128  12.926  18.022  1.00  0.89           C  
ATOM    993  O   PRO A 137      20.813  12.488  16.913  1.00  0.89           O  
ATOM    994  CB  PRO A 137      19.295  12.343  19.620  1.00  0.89           C  
ATOM    995  CG  PRO A 137      17.825  12.745  19.476  1.00  0.89           C  
ATOM    996  CD  PRO A 137      17.810  13.625  18.222  1.00  0.89           C  
ATOM    997  N   LEU A 138      22.389  12.916  18.469  1.00  0.86           N  
ATOM    998  CA  LEU A 138      23.466  12.396  17.669  1.00  0.86           C  
ATOM    999  C   LEU A 138      23.770  10.966  18.030  1.00  0.86           C  
ATOM   1000  O   LEU A 138      23.497  10.456  19.115  1.00  0.86           O  
ATOM   1001  CB  LEU A 138      24.739  13.295  17.605  1.00  0.86           C  
ATOM   1002  CG  LEU A 138      24.997  14.166  18.842  1.00  0.86           C  
ATOM   1003  CD1 LEU A 138      25.316  13.322  20.074  1.00  0.86           C  
ATOM   1004  CD2 LEU A 138      26.182  15.118  18.621  1.00  0.86           C  
ATOM   1005  N   THR A 139      24.322  10.256  17.046  1.00  0.87           N  
ATOM   1006  CA  THR A 139      24.587   8.835  17.102  1.00  0.87           C  
ATOM   1007  C   THR A 139      26.052   8.612  17.454  1.00  0.87           C  
ATOM   1008  O   THR A 139      26.488   7.480  17.636  1.00  0.87           O  
ATOM   1009  CB  THR A 139      24.271   8.214  15.747  1.00  0.87           C  
ATOM   1010  OG1 THR A 139      24.983   8.934  14.755  1.00  0.87           O  
ATOM   1011  CG2 THR A 139      22.770   8.398  15.431  1.00  0.87           C  
ATOM   1012  N   ASP A 140      26.838   9.703  17.604  1.00  0.86           N  
ATOM   1013  CA  ASP A 140      28.221   9.667  18.024  1.00  0.86           C  
ATOM   1014  C   ASP A 140      28.436  10.767  19.083  1.00  0.86           C  
ATOM   1015  O   ASP A 140      28.202  11.945  18.791  1.00  0.86           O  
ATOM   1016  CB  ASP A 140      29.173   9.758  16.803  1.00  0.86           C  
ATOM   1017  CG  ASP A 140      30.555   9.224  17.152  1.00  0.86           C  
ATOM   1018  OD1 ASP A 140      30.911   9.035  18.346  1.00  0.86           O  
ATOM   1019  OD2 ASP A 140      31.277   8.885  16.184  1.00  0.86           O  
ATOM   1020  N   PRO A 141      28.822  10.454  20.327  1.00  0.88           N  
ATOM   1021  CA  PRO A 141      29.056  11.451  21.362  1.00  0.88           C  
ATOM   1022  C   PRO A 141      30.525  11.813  21.386  1.00  0.88           C  
ATOM   1023  O   PRO A 141      30.866  12.723  22.142  1.00  0.88           O  
ATOM   1024  CB  PRO A 141      28.678  10.732  22.670  1.00  0.88           C  
ATOM   1025  CG  PRO A 141      29.043   9.278  22.367  1.00  0.88           C  
ATOM   1026  CD  PRO A 141      28.591   9.136  20.915  1.00  0.88           C  
ATOM   1027  N   GLU A 142      31.416  11.145  20.606  1.00  0.78           N  
ATOM   1028  CA  GLU A 142      32.852  11.433  20.605  1.00  0.78           C  
ATOM   1029  C   GLU A 142      33.164  12.666  19.795  1.00  0.78           C  
ATOM   1030  O   GLU A 142      33.850  12.670  18.772  1.00  0.78           O  
ATOM   1031  CB  GLU A 142      33.724  10.256  20.120  1.00  0.78           C  
ATOM   1032  CG  GLU A 142      33.664   9.053  21.092  1.00  0.78           C  
ATOM   1033  CD  GLU A 142      34.399   9.222  22.424  1.00  0.78           C  
ATOM   1034  OE1 GLU A 142      35.066  10.259  22.652  1.00  0.78           O  
ATOM   1035  OE2 GLU A 142      34.346   8.220  23.186  1.00  0.78           O  
ATOM   1036  N   VAL A 143      32.618  13.777  20.275  1.00  0.78           N  
ATOM   1037  CA  VAL A 143      32.508  14.990  19.544  1.00  0.78           C  
ATOM   1038  C   VAL A 143      32.785  16.149  20.539  1.00  0.78           C  
ATOM   1039  O   VAL A 143      32.419  16.098  21.707  1.00  0.78           O  
ATOM   1040  CB  VAL A 143      31.160  15.061  18.827  1.00  0.78           C  
ATOM   1041  CG1 VAL A 143      31.149  16.481  18.325  1.00  0.78           C  
ATOM   1042  CG2 VAL A 143      31.091  14.182  17.561  1.00  0.78           C  
ATOM   1043  N   THR A 144      33.502  17.218  20.099  1.00  0.69           N  
ATOM   1044  CA  THR A 144      34.053  18.261  20.967  1.00  0.69           C  
ATOM   1045  C   THR A 144      33.059  19.374  21.344  1.00  0.69           C  
ATOM   1046  O   THR A 144      32.825  19.550  22.546  1.00  0.69           O  
ATOM   1047  CB  THR A 144      35.439  18.746  20.479  1.00  0.69           C  
ATOM   1048  OG1 THR A 144      35.915  19.946  21.058  1.00  0.69           O  
ATOM   1049  CG2 THR A 144      35.503  18.980  18.969  1.00  0.69           C  
ATOM   1050  N   ASN A 145      32.361  20.122  20.443  1.00  0.75           N  
ATOM   1051  CA  ASN A 145      31.524  21.234  20.905  1.00  0.75           C  
ATOM   1052  C   ASN A 145      30.084  21.119  20.470  1.00  0.75           C  
ATOM   1053  O   ASN A 145      29.745  21.393  19.322  1.00  0.75           O  
ATOM   1054  CB  ASN A 145      32.062  22.619  20.413  1.00  0.75           C  
ATOM   1055  CG  ASN A 145      31.594  23.819  21.247  1.00  0.75           C  
ATOM   1056  OD1 ASN A 145      31.602  24.971  20.817  1.00  0.75           O  
ATOM   1057  ND2 ASN A 145      31.162  23.580  22.508  1.00  0.75           N  
ATOM   1058  N   TYR A 146      29.151  20.777  21.374  1.00  0.80           N  
ATOM   1059  CA  TYR A 146      27.751  20.735  21.018  1.00  0.80           C  
ATOM   1060  C   TYR A 146      27.175  22.123  21.172  1.00  0.80           C  
ATOM   1061  O   TYR A 146      27.238  22.732  22.239  1.00  0.80           O  
ATOM   1062  CB  TYR A 146      27.039  19.618  21.835  1.00  0.80           C  
ATOM   1063  CG  TYR A 146      25.837  18.971  21.170  1.00  0.80           C  
ATOM   1064  CD1 TYR A 146      24.864  18.418  22.006  1.00  0.80           C  
ATOM   1065  CD2 TYR A 146      25.620  18.873  19.778  1.00  0.80           C  
ATOM   1066  CE1 TYR A 146      23.702  17.863  21.460  1.00  0.80           C  
ATOM   1067  CE2 TYR A 146      24.530  18.173  19.233  1.00  0.80           C  
ATOM   1068  CZ  TYR A 146      23.560  17.654  20.092  1.00  0.80           C  
ATOM   1069  OH  TYR A 146      22.410  16.951  19.666  1.00  0.80           O  
ATOM   1070  N   SER A 147      26.675  22.691  20.068  1.00  0.83           N  
ATOM   1071  CA  SER A 147      26.284  24.082  20.009  1.00  0.83           C  
ATOM   1072  C   SER A 147      25.041  24.193  19.130  1.00  0.83           C  
ATOM   1073  O   SER A 147      24.467  23.188  18.699  1.00  0.83           O  
ATOM   1074  CB  SER A 147      27.450  24.995  19.520  1.00  0.83           C  
ATOM   1075  OG  SER A 147      27.128  26.378  19.684  1.00  0.83           O  
ATOM   1076  N   LEU A 148      24.552  25.399  18.816  1.00  0.77           N  
ATOM   1077  CA  LEU A 148      23.511  25.622  17.823  1.00  0.77           C  
ATOM   1078  C   LEU A 148      24.032  26.519  16.716  1.00  0.77           C  
ATOM   1079  O   LEU A 148      24.917  27.346  16.937  1.00  0.77           O  
ATOM   1080  CB  LEU A 148      22.245  26.254  18.438  1.00  0.77           C  
ATOM   1081  CG  LEU A 148      20.997  25.354  18.319  1.00  0.77           C  
ATOM   1082  CD1 LEU A 148      19.833  26.025  19.046  1.00  0.77           C  
ATOM   1083  CD2 LEU A 148      20.562  24.930  16.904  1.00  0.77           C  
ATOM   1084  N   LYS A 149      23.526  26.387  15.472  1.00  0.69           N  
ATOM   1085  CA  LYS A 149      23.985  27.240  14.395  1.00  0.69           C  
ATOM   1086  C   LYS A 149      22.915  27.529  13.362  1.00  0.69           C  
ATOM   1087  O   LYS A 149      21.757  27.126  13.474  1.00  0.69           O  
ATOM   1088  CB  LYS A 149      25.279  26.723  13.706  1.00  0.69           C  
ATOM   1089  CG  LYS A 149      25.102  25.496  12.791  1.00  0.69           C  
ATOM   1090  CD  LYS A 149      26.474  24.960  12.339  1.00  0.69           C  
ATOM   1091  CE  LYS A 149      26.398  23.573  11.682  1.00  0.69           C  
ATOM   1092  NZ  LYS A 149      27.724  23.143  11.184  1.00  0.69           N  
ATOM   1093  N   GLY A 150      23.343  28.326  12.361  1.00  0.66           N  
ATOM   1094  CA  GLY A 150      22.635  28.903  11.223  1.00  0.66           C  
ATOM   1095  C   GLY A 150      21.825  27.986  10.331  1.00  0.66           C  
ATOM   1096  O   GLY A 150      21.604  26.819  10.623  1.00  0.66           O  
ATOM   1097  N   CYS A 151      21.337  28.493   9.188  1.00  0.63           N  
ATOM   1098  CA  CYS A 151      20.311  27.800   8.401  1.00  0.63           C  
ATOM   1099  C   CYS A 151      20.696  27.567   6.947  1.00  0.63           C  
ATOM   1100  O   CYS A 151      20.861  26.436   6.481  1.00  0.63           O  
ATOM   1101  CB  CYS A 151      19.009  28.650   8.507  1.00  0.63           C  
ATOM   1102  SG  CYS A 151      17.724  28.496   7.199  1.00  0.63           S  
ATOM   1103  N   GLN A 152      20.809  28.640   6.162  1.00  0.51           N  
ATOM   1104  CA  GLN A 152      20.866  28.599   4.711  1.00  0.51           C  
ATOM   1105  C   GLN A 152      21.952  29.569   4.297  1.00  0.51           C  
ATOM   1106  O   GLN A 152      21.965  30.136   3.209  1.00  0.51           O  
ATOM   1107  CB  GLN A 152      19.490  28.978   4.080  1.00  0.51           C  
ATOM   1108  CG  GLN A 152      18.967  30.401   4.424  1.00  0.51           C  
ATOM   1109  CD  GLN A 152      17.599  30.636   3.775  1.00  0.51           C  
ATOM   1110  OE1 GLN A 152      16.709  29.789   3.800  1.00  0.51           O  
ATOM   1111  NE2 GLN A 152      17.406  31.832   3.171  1.00  0.51           N  
ATOM   1112  N   GLY A 153      22.884  29.807   5.240  1.00  0.53           N  
ATOM   1113  CA  GLY A 153      23.923  30.821   5.173  1.00  0.53           C  
ATOM   1114  C   GLY A 153      23.969  31.573   6.475  1.00  0.53           C  
ATOM   1115  O   GLY A 153      24.923  31.475   7.237  1.00  0.53           O  
ATOM   1116  N   LYS A 154      22.905  32.350   6.762  1.00  0.53           N  
ATOM   1117  CA  LYS A 154      22.788  33.241   7.909  1.00  0.53           C  
ATOM   1118  C   LYS A 154      22.955  32.603   9.295  1.00  0.53           C  
ATOM   1119  O   LYS A 154      22.592  31.435   9.475  1.00  0.53           O  
ATOM   1120  CB  LYS A 154      21.429  33.990   7.889  1.00  0.53           C  
ATOM   1121  CG  LYS A 154      21.355  35.046   6.778  1.00  0.53           C  
ATOM   1122  CD  LYS A 154      20.050  35.856   6.866  1.00  0.53           C  
ATOM   1123  CE  LYS A 154      19.923  36.912   5.759  1.00  0.53           C  
ATOM   1124  NZ  LYS A 154      18.637  37.643   5.873  1.00  0.53           N  
ATOM   1125  N   PRO A 155      23.490  33.347  10.282  1.00  0.59           N  
ATOM   1126  CA  PRO A 155      23.700  32.856  11.639  1.00  0.59           C  
ATOM   1127  C   PRO A 155      22.423  33.012  12.471  1.00  0.59           C  
ATOM   1128  O   PRO A 155      21.321  32.894  11.940  1.00  0.59           O  
ATOM   1129  CB  PRO A 155      24.820  33.811  12.113  1.00  0.59           C  
ATOM   1130  CG  PRO A 155      24.401  35.166  11.538  1.00  0.59           C  
ATOM   1131  CD  PRO A 155      23.898  34.759  10.152  1.00  0.59           C  
ATOM   1132  N   LEU A 156      22.549  33.274  13.784  1.00  0.66           N  
ATOM   1133  CA  LEU A 156      21.475  33.266  14.750  1.00  0.66           C  
ATOM   1134  C   LEU A 156      21.143  34.669  15.230  1.00  0.66           C  
ATOM   1135  O   LEU A 156      21.993  35.561  15.154  1.00  0.66           O  
ATOM   1136  CB  LEU A 156      21.919  32.447  15.989  1.00  0.66           C  
ATOM   1137  CG  LEU A 156      22.191  30.969  15.661  1.00  0.66           C  
ATOM   1138  CD1 LEU A 156      22.624  30.242  16.939  1.00  0.66           C  
ATOM   1139  CD2 LEU A 156      20.963  30.280  15.037  1.00  0.66           C  
ATOM   1140  N   PRO A 157      19.942  34.933  15.744  1.00  0.68           N  
ATOM   1141  CA  PRO A 157      19.715  36.095  16.601  1.00  0.68           C  
ATOM   1142  C   PRO A 157      20.545  36.083  17.896  1.00  0.68           C  
ATOM   1143  O   PRO A 157      20.979  35.030  18.363  1.00  0.68           O  
ATOM   1144  CB  PRO A 157      18.203  36.001  16.887  1.00  0.68           C  
ATOM   1145  CG  PRO A 157      17.950  34.491  16.949  1.00  0.68           C  
ATOM   1146  CD  PRO A 157      18.823  33.975  15.806  1.00  0.68           C  
ATOM   1147  N   LYS A 158      20.761  37.273  18.498  1.00  0.72           N  
ATOM   1148  CA  LYS A 158      21.245  37.448  19.859  1.00  0.72           C  
ATOM   1149  C   LYS A 158      20.120  37.211  20.848  1.00  0.72           C  
ATOM   1150  O   LYS A 158      18.987  36.943  20.442  1.00  0.72           O  
ATOM   1151  CB  LYS A 158      21.816  38.862  20.093  1.00  0.72           C  
ATOM   1152  CG  LYS A 158      22.938  39.214  19.114  1.00  0.72           C  
ATOM   1153  CD  LYS A 158      23.437  40.634  19.403  1.00  0.72           C  
ATOM   1154  CE  LYS A 158      24.560  41.060  18.461  1.00  0.72           C  
ATOM   1155  NZ  LYS A 158      24.975  42.441  18.781  1.00  0.72           N  
ATOM   1156  N   ASP A 159      20.428  37.229  22.168  1.00  0.60           N  
ATOM   1157  CA  ASP A 159      19.506  37.016  23.283  1.00  0.60           C  
ATOM   1158  C   ASP A 159      19.026  35.578  23.424  1.00  0.60           C  
ATOM   1159  O   ASP A 159      18.495  35.153  24.451  1.00  0.60           O  
ATOM   1160  CB  ASP A 159      18.313  38.005  23.235  1.00  0.60           C  
ATOM   1161  CG  ASP A 159      18.867  39.414  23.330  1.00  0.60           C  
ATOM   1162  OD1 ASP A 159      19.824  39.617  24.122  1.00  0.60           O  
ATOM   1163  OD2 ASP A 159      18.344  40.292  22.602  1.00  0.60           O  
ATOM   1164  N   LEU A 160      19.253  34.785  22.375  1.00  0.65           N  
ATOM   1165  CA  LEU A 160      18.874  33.417  22.226  1.00  0.65           C  
ATOM   1166  C   LEU A 160      19.796  32.475  22.985  1.00  0.65           C  
ATOM   1167  O   LEU A 160      21.014  32.457  22.815  1.00  0.65           O  
ATOM   1168  CB  LEU A 160      18.861  33.082  20.714  1.00  0.65           C  
ATOM   1169  CG  LEU A 160      18.467  31.627  20.417  1.00  0.65           C  
ATOM   1170  CD1 LEU A 160      17.106  31.317  21.039  1.00  0.65           C  
ATOM   1171  CD2 LEU A 160      18.401  31.308  18.914  1.00  0.65           C  
ATOM   1172  N   ARG A 161      19.211  31.645  23.864  1.00  0.65           N  
ATOM   1173  CA  ARG A 161      19.938  30.677  24.641  1.00  0.65           C  
ATOM   1174  C   ARG A 161      19.597  29.273  24.207  1.00  0.65           C  
ATOM   1175  O   ARG A 161      18.528  28.991  23.664  1.00  0.65           O  
ATOM   1176  CB  ARG A 161      19.569  30.808  26.128  1.00  0.65           C  
ATOM   1177  CG  ARG A 161      19.970  32.145  26.761  1.00  0.65           C  
ATOM   1178  CD  ARG A 161      19.604  32.136  28.241  1.00  0.65           C  
ATOM   1179  NE  ARG A 161      19.960  33.483  28.784  1.00  0.65           N  
ATOM   1180  CZ  ARG A 161      19.853  33.854  30.066  1.00  0.65           C  
ATOM   1181  NH1 ARG A 161      20.200  35.082  30.439  1.00  0.65           N  
ATOM   1182  NH2 ARG A 161      19.359  33.026  30.982  1.00  0.65           N  
ATOM   1183  N   PHE A 162      20.539  28.350  24.446  1.00  0.76           N  
ATOM   1184  CA  PHE A 162      20.384  26.972  24.082  1.00  0.76           C  
ATOM   1185  C   PHE A 162      21.209  26.112  25.021  1.00  0.76           C  
ATOM   1186  O   PHE A 162      22.371  26.410  25.294  1.00  0.76           O  
ATOM   1187  CB  PHE A 162      20.719  26.723  22.579  1.00  0.76           C  
ATOM   1188  CG  PHE A 162      22.055  27.306  22.156  1.00  0.76           C  
ATOM   1189  CD1 PHE A 162      22.170  28.676  21.835  1.00  0.76           C  
ATOM   1190  CD2 PHE A 162      23.211  26.502  22.097  1.00  0.76           C  
ATOM   1191  CE1 PHE A 162      23.420  29.248  21.563  1.00  0.76           C  
ATOM   1192  CE2 PHE A 162      24.460  27.069  21.799  1.00  0.76           C  
ATOM   1193  CZ  PHE A 162      24.567  28.444  21.548  1.00  0.76           C  
ATOM   1194  N   ILE A 163      20.631  25.028  25.567  1.00  0.76           N  
ATOM   1195  CA  ILE A 163      21.348  24.097  26.427  1.00  0.76           C  
ATOM   1196  C   ILE A 163      21.293  22.745  25.708  1.00  0.76           C  
ATOM   1197  O   ILE A 163      20.241  22.097  25.712  1.00  0.76           O  
ATOM   1198  CB  ILE A 163      20.742  24.048  27.834  1.00  0.76           C  
ATOM   1199  CG1 ILE A 163      20.754  25.471  28.466  1.00  0.76           C  
ATOM   1200  CG2 ILE A 163      21.550  23.050  28.699  1.00  0.76           C  
ATOM   1201  CD1 ILE A 163      20.011  25.544  29.806  1.00  0.76           C  
ATOM   1202  N   PRO A 164      22.354  22.289  25.030  1.00  0.84           N  
ATOM   1203  CA  PRO A 164      22.238  21.116  24.160  1.00  0.84           C  
ATOM   1204  C   PRO A 164      22.557  19.817  24.914  1.00  0.84           C  
ATOM   1205  O   PRO A 164      23.359  19.845  25.842  1.00  0.84           O  
ATOM   1206  CB  PRO A 164      23.260  21.423  23.047  1.00  0.84           C  
ATOM   1207  CG  PRO A 164      24.326  22.307  23.683  1.00  0.84           C  
ATOM   1208  CD  PRO A 164      23.482  23.152  24.630  1.00  0.84           C  
ATOM   1209  N   ASP A 165      21.922  18.673  24.553  1.00  0.82           N  
ATOM   1210  CA  ASP A 165      22.101  17.376  25.195  1.00  0.82           C  
ATOM   1211  C   ASP A 165      22.244  16.290  24.106  1.00  0.82           C  
ATOM   1212  O   ASP A 165      21.299  16.132  23.330  1.00  0.82           O  
ATOM   1213  CB  ASP A 165      20.871  17.065  26.101  1.00  0.82           C  
ATOM   1214  CG  ASP A 165      20.977  15.757  26.889  1.00  0.82           C  
ATOM   1215  OD1 ASP A 165      21.706  14.822  26.458  1.00  0.82           O  
ATOM   1216  OD2 ASP A 165      20.280  15.660  27.926  1.00  0.82           O  
ATOM   1217  N   PRO A 166      23.333  15.509  23.980  1.00  0.86           N  
ATOM   1218  CA  PRO A 166      23.520  14.450  22.977  1.00  0.86           C  
ATOM   1219  C   PRO A 166      22.386  13.443  22.868  1.00  0.86           C  
ATOM   1220  O   PRO A 166      22.146  12.907  21.786  1.00  0.86           O  
ATOM   1221  CB  PRO A 166      24.812  13.757  23.481  1.00  0.86           C  
ATOM   1222  CG  PRO A 166      25.603  14.914  24.087  1.00  0.86           C  
ATOM   1223  CD  PRO A 166      24.490  15.601  24.868  1.00  0.86           C  
ATOM   1224  N   LYS A 167      21.741  13.143  24.010  1.00  0.82           N  
ATOM   1225  CA  LYS A 167      20.687  12.170  24.188  1.00  0.82           C  
ATOM   1226  C   LYS A 167      19.319  12.685  23.759  1.00  0.82           C  
ATOM   1227  O   LYS A 167      18.501  11.912  23.259  1.00  0.82           O  
ATOM   1228  CB  LYS A 167      20.651  11.769  25.684  1.00  0.82           C  
ATOM   1229  CG  LYS A 167      21.889  10.951  26.088  1.00  0.82           C  
ATOM   1230  CD  LYS A 167      22.002  10.801  27.610  1.00  0.82           C  
ATOM   1231  CE  LYS A 167      23.168   9.894  28.011  1.00  0.82           C  
ATOM   1232  NZ  LYS A 167      23.402   9.995  29.467  1.00  0.82           N  
ATOM   1233  N   ALA A 168      19.036  13.991  23.983  1.00  0.85           N  
ATOM   1234  CA  ALA A 168      17.726  14.588  23.731  1.00  0.85           C  
ATOM   1235  C   ALA A 168      17.685  15.458  22.495  1.00  0.85           C  
ATOM   1236  O   ALA A 168      16.746  15.369  21.686  1.00  0.85           O  
ATOM   1237  CB  ALA A 168      17.294  15.503  24.900  1.00  0.85           C  
ATOM   1238  N   GLY A 169      18.659  16.337  22.284  1.00  0.86           N  
ATOM   1239  CA  GLY A 169      18.785  17.206  21.137  1.00  0.86           C  
ATOM   1240  C   GLY A 169      19.210  18.549  21.622  1.00  0.86           C  
ATOM   1241  O   GLY A 169      20.013  18.662  22.555  1.00  0.86           O  
ATOM   1242  N   ILE A 170      18.729  19.651  21.044  1.00  0.83           N  
ATOM   1243  CA  ILE A 170      19.183  20.960  21.483  1.00  0.83           C  
ATOM   1244  C   ILE A 170      17.967  21.689  21.967  1.00  0.83           C  
ATOM   1245  O   ILE A 170      16.990  21.869  21.245  1.00  0.83           O  
ATOM   1246  CB  ILE A 170      19.986  21.826  20.505  1.00  0.83           C  
ATOM   1247  CG1 ILE A 170      21.325  21.192  20.051  1.00  0.83           C  
ATOM   1248  CG2 ILE A 170      20.321  23.133  21.272  1.00  0.83           C  
ATOM   1249  CD1 ILE A 170      21.226  19.994  19.122  1.00  0.83           C  
ATOM   1250  N   MET A 171      17.975  22.123  23.236  1.00  0.81           N  
ATOM   1251  CA  MET A 171      16.877  22.881  23.776  1.00  0.81           C  
ATOM   1252  C   MET A 171      17.147  24.347  23.641  1.00  0.81           C  
ATOM   1253  O   MET A 171      17.995  24.916  24.325  1.00  0.81           O  
ATOM   1254  CB  MET A 171      16.595  22.523  25.246  1.00  0.81           C  
ATOM   1255  CG  MET A 171      15.753  21.236  25.332  1.00  0.81           C  
ATOM   1256  SD  MET A 171      13.978  21.521  25.644  1.00  0.81           S  
ATOM   1257  CE  MET A 171      14.140  22.057  27.362  1.00  0.81           C  
ATOM   1258  N   ILE A 172      16.394  24.974  22.728  1.00  0.81           N  
ATOM   1259  CA  ILE A 172      16.227  26.396  22.572  1.00  0.81           C  
ATOM   1260  C   ILE A 172      15.461  26.939  23.766  1.00  0.81           C  
ATOM   1261  O   ILE A 172      14.362  26.479  24.077  1.00  0.81           O  
ATOM   1262  CB  ILE A 172      15.467  26.704  21.290  1.00  0.81           C  
ATOM   1263  CG1 ILE A 172      16.163  26.052  20.074  1.00  0.81           C  
ATOM   1264  CG2 ILE A 172      15.512  28.221  21.114  1.00  0.81           C  
ATOM   1265  CD1 ILE A 172      15.433  26.280  18.742  1.00  0.81           C  
ATOM   1266  N   LYS A 173      16.036  27.918  24.482  1.00  0.76           N  
ATOM   1267  CA  LYS A 173      15.536  28.275  25.788  1.00  0.76           C  
ATOM   1268  C   LYS A 173      14.763  29.570  25.748  1.00  0.76           C  
ATOM   1269  O   LYS A 173      15.267  30.593  25.279  1.00  0.76           O  
ATOM   1270  CB  LYS A 173      16.701  28.400  26.791  1.00  0.76           C  
ATOM   1271  CG  LYS A 173      16.270  28.848  28.199  1.00  0.76           C  
ATOM   1272  CD  LYS A 173      17.454  28.896  29.177  1.00  0.76           C  
ATOM   1273  CE  LYS A 173      17.016  29.268  30.600  1.00  0.76           C  
ATOM   1274  NZ  LYS A 173      18.169  29.234  31.536  1.00  0.76           N  
ATOM   1275  N   SER A 174      13.526  29.546  26.289  1.00  0.78           N  
ATOM   1276  CA  SER A 174      12.622  30.689  26.377  1.00  0.78           C  
ATOM   1277  C   SER A 174      12.331  31.323  25.020  1.00  0.78           C  
ATOM   1278  O   SER A 174      12.659  32.484  24.751  1.00  0.78           O  
ATOM   1279  CB  SER A 174      13.075  31.745  27.424  1.00  0.78           C  
ATOM   1280  OG  SER A 174      12.000  32.603  27.815  1.00  0.78           O  
ATOM   1281  N   VAL A 175      11.747  30.520  24.096  1.00  0.81           N  
ATOM   1282  CA  VAL A 175      11.348  30.912  22.745  1.00  0.81           C  
ATOM   1283  C   VAL A 175      10.570  32.232  22.692  1.00  0.81           C  
ATOM   1284  O   VAL A 175       9.687  32.533  23.497  1.00  0.81           O  
ATOM   1285  CB  VAL A 175      10.585  29.787  22.024  1.00  0.81           C  
ATOM   1286  CG1 VAL A 175       9.197  29.640  22.637  1.00  0.81           C  
ATOM   1287  CG2 VAL A 175      10.368  30.008  20.510  1.00  0.81           C  
ATOM   1288  N   LYS A 176      10.898  33.076  21.703  1.00  0.77           N  
ATOM   1289  CA  LYS A 176      10.250  34.342  21.500  1.00  0.77           C  
ATOM   1290  C   LYS A 176       9.388  34.193  20.268  1.00  0.77           C  
ATOM   1291  O   LYS A 176       9.697  33.423  19.357  1.00  0.77           O  
ATOM   1292  CB  LYS A 176      11.303  35.483  21.321  1.00  0.77           C  
ATOM   1293  CG  LYS A 176      11.134  36.623  22.346  1.00  0.77           C  
ATOM   1294  CD  LYS A 176      11.553  36.172  23.766  1.00  0.77           C  
ATOM   1295  CE  LYS A 176      13.070  36.204  24.033  1.00  0.77           C  
ATOM   1296  NZ  LYS A 176      13.439  37.492  24.668  1.00  0.77           N  
ATOM   1297  N   ARG A 177       8.293  34.967  20.186  1.00  0.74           N  
ATOM   1298  CA  ARG A 177       7.401  35.039  19.041  1.00  0.74           C  
ATOM   1299  C   ARG A 177       8.101  35.400  17.725  1.00  0.74           C  
ATOM   1300  O   ARG A 177       7.754  34.924  16.643  1.00  0.74           O  
ATOM   1301  CB  ARG A 177       6.336  36.106  19.357  1.00  0.74           C  
ATOM   1302  CG  ARG A 177       5.107  35.994  18.445  1.00  0.74           C  
ATOM   1303  CD  ARG A 177       3.995  36.972  18.806  1.00  0.74           C  
ATOM   1304  NE  ARG A 177       3.344  36.445  20.037  1.00  0.74           N  
ATOM   1305  CZ  ARG A 177       2.307  37.027  20.644  1.00  0.74           C  
ATOM   1306  NH1 ARG A 177       1.746  38.141  20.197  1.00  0.74           N  
ATOM   1307  NH2 ARG A 177       1.892  36.491  21.781  1.00  0.74           N  
ATOM   1308  N   ALA A 178       9.157  36.229  17.845  1.00  0.80           N  
ATOM   1309  CA  ALA A 178      10.132  36.637  16.850  1.00  0.80           C  
ATOM   1310  C   ALA A 178      10.858  35.493  16.138  1.00  0.80           C  
ATOM   1311  O   ALA A 178      11.371  35.676  15.038  1.00  0.80           O  
ATOM   1312  CB  ALA A 178      11.205  37.507  17.549  1.00  0.80           C  
ATOM   1313  N   TYR A 179      10.932  34.280  16.731  1.00  0.78           N  
ATOM   1314  CA  TYR A 179      11.637  33.156  16.133  1.00  0.78           C  
ATOM   1315  C   TYR A 179      10.675  32.327  15.283  1.00  0.78           C  
ATOM   1316  O   TYR A 179      10.998  31.227  14.841  1.00  0.78           O  
ATOM   1317  CB  TYR A 179      12.275  32.207  17.203  1.00  0.78           C  
ATOM   1318  CG  TYR A 179      13.139  32.882  18.249  1.00  0.78           C  
ATOM   1319  CD1 TYR A 179      13.321  32.206  19.468  1.00  0.78           C  
ATOM   1320  CD2 TYR A 179      13.757  34.139  18.088  1.00  0.78           C  
ATOM   1321  CE1 TYR A 179      13.968  32.818  20.549  1.00  0.78           C  
ATOM   1322  CE2 TYR A 179      14.446  34.738  19.154  1.00  0.78           C  
ATOM   1323  CZ  TYR A 179      14.525  34.091  20.391  1.00  0.78           C  
ATOM   1324  OH  TYR A 179      15.163  34.726  21.474  1.00  0.78           O  
ATOM   1325  N   HIS A 180       9.443  32.805  15.020  1.00  0.80           N  
ATOM   1326  CA  HIS A 180       8.532  32.149  14.098  1.00  0.80           C  
ATOM   1327  C   HIS A 180       9.009  32.076  12.661  1.00  0.80           C  
ATOM   1328  O   HIS A 180       9.582  33.023  12.123  1.00  0.80           O  
ATOM   1329  CB  HIS A 180       7.145  32.799  14.062  1.00  0.80           C  
ATOM   1330  CG  HIS A 180       6.131  31.912  13.415  1.00  0.80           C  
ATOM   1331  ND1 HIS A 180       5.988  30.608  13.849  1.00  0.80           N  
ATOM   1332  CD2 HIS A 180       5.263  32.168  12.413  1.00  0.80           C  
ATOM   1333  CE1 HIS A 180       5.018  30.104  13.114  1.00  0.80           C  
ATOM   1334  NE2 HIS A 180       4.546  31.006  12.224  1.00  0.80           N  
ATOM   1335  N   ARG A 181       8.774  30.922  12.011  1.00  0.73           N  
ATOM   1336  CA  ARG A 181       9.206  30.587  10.662  1.00  0.73           C  
ATOM   1337  C   ARG A 181      10.704  30.611  10.451  1.00  0.73           C  
ATOM   1338  O   ARG A 181      11.195  30.625   9.323  1.00  0.73           O  
ATOM   1339  CB  ARG A 181       8.469  31.399   9.570  1.00  0.73           C  
ATOM   1340  CG  ARG A 181       6.967  31.091   9.588  1.00  0.73           C  
ATOM   1341  CD  ARG A 181       6.203  31.613   8.369  1.00  0.73           C  
ATOM   1342  NE  ARG A 181       4.799  31.074   8.454  1.00  0.73           N  
ATOM   1343  CZ  ARG A 181       4.446  29.802   8.213  1.00  0.73           C  
ATOM   1344  NH1 ARG A 181       5.360  28.859   7.976  1.00  0.73           N  
ATOM   1345  NH2 ARG A 181       3.161  29.461   8.191  1.00  0.73           N  
ATOM   1346  N   LEU A 182      11.466  30.561  11.552  1.00  0.77           N  
ATOM   1347  CA  LEU A 182      12.899  30.476  11.556  1.00  0.77           C  
ATOM   1348  C   LEU A 182      13.356  29.118  11.075  1.00  0.77           C  
ATOM   1349  O   LEU A 182      12.716  28.091  11.277  1.00  0.77           O  
ATOM   1350  CB  LEU A 182      13.434  30.790  12.974  1.00  0.77           C  
ATOM   1351  CG  LEU A 182      14.966  30.741  13.165  1.00  0.77           C  
ATOM   1352  CD1 LEU A 182      15.717  31.733  12.256  1.00  0.77           C  
ATOM   1353  CD2 LEU A 182      15.326  30.988  14.638  1.00  0.77           C  
ATOM   1354  N   CYS A 183      14.507  29.078  10.419  1.00  0.77           N  
ATOM   1355  CA  CYS A 183      15.145  27.864  10.009  1.00  0.77           C  
ATOM   1356  C   CYS A 183      16.486  27.871  10.710  1.00  0.77           C  
ATOM   1357  O   CYS A 183      16.990  28.929  11.099  1.00  0.77           O  
ATOM   1358  CB  CYS A 183      15.161  27.822   8.457  1.00  0.77           C  
ATOM   1359  SG  CYS A 183      16.530  26.927   7.657  1.00  0.77           S  
ATOM   1360  N   LEU A 184      17.050  26.680  10.967  1.00  0.75           N  
ATOM   1361  CA  LEU A 184      18.236  26.489  11.774  1.00  0.75           C  
ATOM   1362  C   LEU A 184      18.745  25.069  11.625  1.00  0.75           C  
ATOM   1363  O   LEU A 184      18.005  24.182  11.193  1.00  0.75           O  
ATOM   1364  CB  LEU A 184      18.034  26.835  13.273  1.00  0.75           C  
ATOM   1365  CG  LEU A 184      16.996  26.017  14.091  1.00  0.75           C  
ATOM   1366  CD1 LEU A 184      16.761  26.787  15.392  1.00  0.75           C  
ATOM   1367  CD2 LEU A 184      15.609  25.748  13.462  1.00  0.75           C  
ATOM   1368  N   HIS A 185      20.027  24.845  11.992  1.00  0.77           N  
ATOM   1369  CA  HIS A 185      20.727  23.577  11.896  1.00  0.77           C  
ATOM   1370  C   HIS A 185      21.449  23.241  13.193  1.00  0.77           C  
ATOM   1371  O   HIS A 185      21.898  24.084  13.967  1.00  0.77           O  
ATOM   1372  CB  HIS A 185      21.812  23.571  10.777  1.00  0.77           C  
ATOM   1373  CG  HIS A 185      21.264  23.454   9.397  1.00  0.77           C  
ATOM   1374  ND1 HIS A 185      20.245  22.553   9.191  1.00  0.77           N  
ATOM   1375  CD2 HIS A 185      21.632  24.029   8.223  1.00  0.77           C  
ATOM   1376  CE1 HIS A 185      19.989  22.605   7.906  1.00  0.77           C  
ATOM   1377  NE2 HIS A 185      20.802  23.482   7.268  1.00  0.77           N  
ATOM   1378  N   CYS A 186      21.590  21.930  13.447  1.00  0.81           N  
ATOM   1379  CA  CYS A 186      22.175  21.322  14.633  1.00  0.81           C  
ATOM   1380  C   CYS A 186      23.708  21.478  14.631  1.00  0.81           C  
ATOM   1381  O   CYS A 186      24.331  21.138  13.629  1.00  0.81           O  
ATOM   1382  CB  CYS A 186      21.723  19.829  14.561  1.00  0.81           C  
ATOM   1383  SG  CYS A 186      21.624  18.916  16.108  1.00  0.81           S  
ATOM   1384  N   SER A 187      24.410  22.006  15.663  1.00  0.79           N  
ATOM   1385  CA  SER A 187      25.848  22.257  15.511  1.00  0.79           C  
ATOM   1386  C   SER A 187      26.644  21.368  16.413  1.00  0.79           C  
ATOM   1387  O   SER A 187      26.328  21.175  17.583  1.00  0.79           O  
ATOM   1388  CB  SER A 187      26.275  23.719  15.782  1.00  0.79           C  
ATOM   1389  OG  SER A 187      27.662  23.983  15.533  1.00  0.79           O  
ATOM   1390  N   VAL A 188      27.706  20.787  15.850  1.00  0.77           N  
ATOM   1391  CA  VAL A 188      28.632  19.967  16.562  1.00  0.77           C  
ATOM   1392  C   VAL A 188      29.868  19.936  15.667  1.00  0.77           C  
ATOM   1393  O   VAL A 188      29.738  20.073  14.442  1.00  0.77           O  
ATOM   1394  CB  VAL A 188      28.058  18.612  17.025  1.00  0.77           C  
ATOM   1395  CG1 VAL A 188      28.328  17.439  16.082  1.00  0.77           C  
ATOM   1396  CG2 VAL A 188      28.642  18.303  18.404  1.00  0.77           C  
ATOM   1397  N   ASP A 189      31.074  19.813  16.235  1.00  0.72           N  
ATOM   1398  CA  ASP A 189      32.359  19.853  15.569  1.00  0.72           C  
ATOM   1399  C   ASP A 189      32.802  18.449  15.235  1.00  0.72           C  
ATOM   1400  O   ASP A 189      32.337  17.503  15.909  1.00  0.72           O  
ATOM   1401  CB  ASP A 189      33.356  20.451  16.594  1.00  0.72           C  
ATOM   1402  CG  ASP A 189      33.204  21.953  16.794  1.00  0.72           C  
ATOM   1403  OD1 ASP A 189      32.433  22.607  16.057  1.00  0.72           O  
ATOM   1404  OD2 ASP A 189      33.879  22.431  17.744  1.00  0.72           O  
ATOM   1405  N   GLN A 190      33.735  18.157  14.314  1.00  0.60           N  
ATOM   1406  CA  GLN A 190      34.172  16.790  14.074  1.00  0.60           C  
ATOM   1407  C   GLN A 190      35.494  16.852  13.365  1.00  0.60           C  
ATOM   1408  O   GLN A 190      35.563  17.216  12.189  1.00  0.60           O  
ATOM   1409  CB  GLN A 190      33.149  15.980  13.218  1.00  0.60           C  
ATOM   1410  CG  GLN A 190      33.605  14.558  12.770  1.00  0.60           C  
ATOM   1411  CD  GLN A 190      33.728  13.591  13.950  1.00  0.60           C  
ATOM   1412  OE1 GLN A 190      32.984  13.714  14.923  1.00  0.60           O  
ATOM   1413  NE2 GLN A 190      34.649  12.609  13.902  1.00  0.60           N  
ATOM   1414  N   GLU A 191      36.595  16.540  14.079  1.00  0.56           N  
ATOM   1415  CA  GLU A 191      37.941  16.476  13.521  1.00  0.56           C  
ATOM   1416  C   GLU A 191      38.373  17.779  12.844  1.00  0.56           C  
ATOM   1417  O   GLU A 191      38.935  17.806  11.752  1.00  0.56           O  
ATOM   1418  CB  GLU A 191      38.088  15.239  12.605  1.00  0.56           C  
ATOM   1419  CG  GLU A 191      37.834  13.923  13.375  1.00  0.56           C  
ATOM   1420  CD  GLU A 191      37.826  12.754  12.400  1.00  0.56           C  
ATOM   1421  OE1 GLU A 191      38.925  12.270  12.039  1.00  0.56           O  
ATOM   1422  OE2 GLU A 191      36.695  12.361  12.006  1.00  0.56           O  
ATOM   1423  N   GLY A 192      38.069  18.930  13.485  1.00  0.63           N  
ATOM   1424  CA  GLY A 192      38.309  20.257  12.921  1.00  0.63           C  
ATOM   1425  C   GLY A 192      37.210  20.751  12.001  1.00  0.63           C  
ATOM   1426  O   GLY A 192      37.073  21.952  11.796  1.00  0.63           O  
ATOM   1427  N   LYS A 193      36.389  19.849  11.426  1.00  0.54           N  
ATOM   1428  CA  LYS A 193      35.250  20.180  10.583  1.00  0.54           C  
ATOM   1429  C   LYS A 193      34.002  20.297  11.420  1.00  0.54           C  
ATOM   1430  O   LYS A 193      34.038  20.205  12.636  1.00  0.54           O  
ATOM   1431  CB  LYS A 193      35.004  19.141   9.458  1.00  0.54           C  
ATOM   1432  CG  LYS A 193      36.163  19.084   8.464  1.00  0.54           C  
ATOM   1433  CD  LYS A 193      35.851  18.080   7.349  1.00  0.54           C  
ATOM   1434  CE  LYS A 193      36.978  17.996   6.322  1.00  0.54           C  
ATOM   1435  NZ  LYS A 193      36.642  16.991   5.291  1.00  0.54           N  
ATOM   1436  N   SER A 194      32.853  20.537  10.771  1.00  0.65           N  
ATOM   1437  CA  SER A 194      31.609  20.797  11.459  1.00  0.65           C  
ATOM   1438  C   SER A 194      30.548  19.949  10.854  1.00  0.65           C  
ATOM   1439  O   SER A 194      30.450  19.836   9.633  1.00  0.65           O  
ATOM   1440  CB  SER A 194      31.121  22.245  11.279  1.00  0.65           C  
ATOM   1441  OG  SER A 194      32.096  23.124  11.819  1.00  0.65           O  
ATOM   1442  N   VAL A 195      29.697  19.346  11.687  1.00  0.68           N  
ATOM   1443  CA  VAL A 195      28.612  18.491  11.260  1.00  0.68           C  
ATOM   1444  C   VAL A 195      27.639  19.125  10.259  1.00  0.68           C  
ATOM   1445  O   VAL A 195      27.457  20.372  10.232  1.00  0.68           O  
ATOM   1446  CB  VAL A 195      27.902  17.969  12.489  1.00  0.68           C  
ATOM   1447  CG1 VAL A 195      27.011  19.097  13.060  1.00  0.68           C  
ATOM   1448  CG2 VAL A 195      27.238  16.605  12.201  1.00  0.68           C  
ATOM   1449  N   LEU A 196      27.027  18.306   9.401  1.00  0.56           N  
ATOM   1450  CA  LEU A 196      25.970  18.581   8.454  1.00  0.56           C  
ATOM   1451  C   LEU A 196      24.703  17.958   9.012  1.00  0.56           C  
ATOM   1452  O   LEU A 196      24.638  16.749   9.239  1.00  0.56           O  
ATOM   1453  CB  LEU A 196      26.236  17.882   7.093  1.00  0.56           C  
ATOM   1454  CG  LEU A 196      27.315  18.524   6.182  1.00  0.56           C  
ATOM   1455  CD1 LEU A 196      26.717  19.685   5.373  1.00  0.56           C  
ATOM   1456  CD2 LEU A 196      28.613  18.978   6.881  1.00  0.56           C  
ATOM   1457  N   SER A 197      23.685  18.783   9.271  1.00  0.77           N  
ATOM   1458  CA  SER A 197      22.387  18.383   9.791  1.00  0.77           C  
ATOM   1459  C   SER A 197      21.338  18.404   8.706  1.00  0.77           C  
ATOM   1460  O   SER A 197      21.623  18.617   7.527  1.00  0.77           O  
ATOM   1461  CB  SER A 197      21.934  19.341  10.924  1.00  0.77           C  
ATOM   1462  OG  SER A 197      23.119  19.751  11.613  1.00  0.77           O  
ATOM   1463  N   GLU A 198      20.069  18.203   9.092  1.00  0.75           N  
ATOM   1464  CA  GLU A 198      18.939  18.233   8.194  1.00  0.75           C  
ATOM   1465  C   GLU A 198      18.067  19.441   8.491  1.00  0.75           C  
ATOM   1466  O   GLU A 198      18.148  20.090   9.529  1.00  0.75           O  
ATOM   1467  CB  GLU A 198      18.098  16.935   8.294  1.00  0.75           C  
ATOM   1468  CG  GLU A 198      18.745  15.733   7.552  1.00  0.75           C  
ATOM   1469  CD  GLU A 198      18.990  14.549   8.490  1.00  0.75           C  
ATOM   1470  OE1 GLU A 198      19.855  14.685   9.393  1.00  0.75           O  
ATOM   1471  OE2 GLU A 198      18.288  13.515   8.335  1.00  0.75           O  
ATOM   1472  N   LYS A 199      17.212  19.798   7.518  1.00  0.71           N  
ATOM   1473  CA  LYS A 199      16.493  21.059   7.464  1.00  0.71           C  
ATOM   1474  C   LYS A 199      15.275  21.168   8.369  1.00  0.71           C  
ATOM   1475  O   LYS A 199      14.325  20.394   8.219  1.00  0.71           O  
ATOM   1476  CB  LYS A 199      16.040  21.240   5.996  1.00  0.71           C  
ATOM   1477  CG  LYS A 199      15.612  22.668   5.600  1.00  0.71           C  
ATOM   1478  CD  LYS A 199      15.452  22.841   4.071  1.00  0.71           C  
ATOM   1479  CE  LYS A 199      16.754  22.573   3.290  1.00  0.71           C  
ATOM   1480  NZ  LYS A 199      16.511  22.511   1.830  1.00  0.71           N  
ATOM   1481  N   PHE A 200      15.265  22.158   9.286  1.00  0.73           N  
ATOM   1482  CA  PHE A 200      14.209  22.394  10.252  1.00  0.73           C  
ATOM   1483  C   PHE A 200      13.615  23.780  10.078  1.00  0.73           C  
ATOM   1484  O   PHE A 200      14.314  24.758   9.822  1.00  0.73           O  
ATOM   1485  CB  PHE A 200      14.759  22.280  11.700  1.00  0.73           C  
ATOM   1486  CG  PHE A 200      15.210  20.880  12.066  1.00  0.73           C  
ATOM   1487  CD1 PHE A 200      16.214  20.760  13.041  1.00  0.73           C  
ATOM   1488  CD2 PHE A 200      14.657  19.696  11.529  1.00  0.73           C  
ATOM   1489  CE1 PHE A 200      16.610  19.505  13.523  1.00  0.73           C  
ATOM   1490  CE2 PHE A 200      15.112  18.437  11.963  1.00  0.73           C  
ATOM   1491  CZ  PHE A 200      16.047  18.341  12.996  1.00  0.73           C  
ATOM   1492  N   ILE A 201      12.276  23.859  10.198  1.00  0.74           N  
ATOM   1493  CA  ILE A 201      11.462  25.051  10.112  1.00  0.74           C  
ATOM   1494  C   ILE A 201      10.723  25.190  11.434  1.00  0.74           C  
ATOM   1495  O   ILE A 201       9.747  24.493  11.715  1.00  0.74           O  
ATOM   1496  CB  ILE A 201      10.469  25.045   8.928  1.00  0.74           C  
ATOM   1497  CG1 ILE A 201       9.607  23.757   8.673  1.00  0.74           C  
ATOM   1498  CG2 ILE A 201      11.237  25.504   7.670  1.00  0.74           C  
ATOM   1499  CD1 ILE A 201      10.297  22.481   8.153  1.00  0.74           C  
ATOM   1500  N   LEU A 202      11.180  26.117  12.295  1.00  0.78           N  
ATOM   1501  CA  LEU A 202      10.604  26.443  13.585  1.00  0.78           C  
ATOM   1502  C   LEU A 202       9.235  27.084  13.417  1.00  0.78           C  
ATOM   1503  O   LEU A 202       9.024  27.955  12.570  1.00  0.78           O  
ATOM   1504  CB  LEU A 202      11.527  27.419  14.374  1.00  0.78           C  
ATOM   1505  CG  LEU A 202      11.535  27.320  15.930  1.00  0.78           C  
ATOM   1506  CD1 LEU A 202      12.144  28.600  16.513  1.00  0.78           C  
ATOM   1507  CD2 LEU A 202      10.181  27.100  16.635  1.00  0.78           C  
ATOM   1508  N   LYS A 203       8.258  26.674  14.233  1.00  0.79           N  
ATOM   1509  CA  LYS A 203       6.959  27.283  14.305  1.00  0.79           C  
ATOM   1510  C   LYS A 203       6.628  27.585  15.766  1.00  0.79           C  
ATOM   1511  O   LYS A 203       6.578  26.689  16.612  1.00  0.79           O  
ATOM   1512  CB  LYS A 203       5.925  26.269  13.780  1.00  0.79           C  
ATOM   1513  CG  LYS A 203       6.282  25.557  12.463  1.00  0.79           C  
ATOM   1514  CD  LYS A 203       6.216  26.449  11.214  1.00  0.79           C  
ATOM   1515  CE  LYS A 203       6.335  25.639   9.921  1.00  0.79           C  
ATOM   1516  NZ  LYS A 203       5.229  24.656   9.887  1.00  0.79           N  
ATOM   1517  N   VAL A 204       6.382  28.858  16.106  1.00  0.81           N  
ATOM   1518  CA  VAL A 204       6.099  29.324  17.451  1.00  0.81           C  
ATOM   1519  C   VAL A 204       4.600  29.538  17.559  1.00  0.81           C  
ATOM   1520  O   VAL A 204       3.991  30.236  16.751  1.00  0.81           O  
ATOM   1521  CB  VAL A 204       6.821  30.639  17.770  1.00  0.81           C  
ATOM   1522  CG1 VAL A 204       6.556  31.067  19.232  1.00  0.81           C  
ATOM   1523  CG2 VAL A 204       8.338  30.457  17.549  1.00  0.81           C  
ATOM   1524  N   ARG A 205       3.941  28.930  18.565  1.00  0.73           N  
ATOM   1525  CA  ARG A 205       2.577  29.268  18.933  1.00  0.73           C  
ATOM   1526  C   ARG A 205       2.596  30.367  19.977  1.00  0.73           C  
ATOM   1527  O   ARG A 205       3.452  30.328  20.866  1.00  0.73           O  
ATOM   1528  CB  ARG A 205       1.772  28.102  19.557  1.00  0.73           C  
ATOM   1529  CG  ARG A 205       1.697  26.860  18.651  1.00  0.73           C  
ATOM   1530  CD  ARG A 205       2.743  25.782  18.983  1.00  0.73           C  
ATOM   1531  NE  ARG A 205       2.020  24.486  19.237  1.00  0.73           N  
ATOM   1532  CZ  ARG A 205       1.617  23.634  18.284  1.00  0.73           C  
ATOM   1533  NH1 ARG A 205       1.761  23.918  16.997  1.00  0.73           N  
ATOM   1534  NH2 ARG A 205       1.068  22.471  18.623  1.00  0.73           N  
ATOM   1535  N   PRO A 206       1.712  31.345  19.942  1.00  0.82           N  
ATOM   1536  CA  PRO A 206       1.867  32.518  20.777  1.00  0.82           C  
ATOM   1537  C   PRO A 206       1.249  32.295  22.147  1.00  0.82           C  
ATOM   1538  O   PRO A 206       0.400  31.422  22.346  1.00  0.82           O  
ATOM   1539  CB  PRO A 206       1.109  33.591  19.985  1.00  0.82           C  
ATOM   1540  CG  PRO A 206      -0.036  32.822  19.323  1.00  0.82           C  
ATOM   1541  CD  PRO A 206       0.610  31.480  18.977  1.00  0.82           C  
ATOM   1542  N   ALA A 207       1.686  33.076  23.141  1.00  0.85           N  
ATOM   1543  CA  ALA A 207       1.032  33.205  24.415  1.00  0.85           C  
ATOM   1544  C   ALA A 207       0.093  34.403  24.377  1.00  0.85           C  
ATOM   1545  O   ALA A 207       0.432  35.484  23.899  1.00  0.85           O  
ATOM   1546  CB  ALA A 207       2.107  33.412  25.505  1.00  0.85           C  
ATOM   1547  N   PHE A 208      -1.147  34.273  24.883  1.00  0.75           N  
ATOM   1548  CA  PHE A 208      -2.011  35.427  25.043  1.00  0.75           C  
ATOM   1549  C   PHE A 208      -1.420  36.384  26.072  1.00  0.75           C  
ATOM   1550  O   PHE A 208      -1.150  35.995  27.207  1.00  0.75           O  
ATOM   1551  CB  PHE A 208      -3.431  34.998  25.459  1.00  0.75           C  
ATOM   1552  CG  PHE A 208      -4.053  34.225  24.333  1.00  0.75           C  
ATOM   1553  CD1 PHE A 208      -4.532  34.892  23.198  1.00  0.75           C  
ATOM   1554  CD2 PHE A 208      -4.225  32.835  24.415  1.00  0.75           C  
ATOM   1555  CE1 PHE A 208      -5.252  34.198  22.219  1.00  0.75           C  
ATOM   1556  CE2 PHE A 208      -5.022  32.149  23.488  1.00  0.75           C  
ATOM   1557  CZ  PHE A 208      -5.545  32.843  22.391  1.00  0.75           C  
ATOM   1558  N   LYS A 209      -1.148  37.638  25.665  1.00  0.70           N  
ATOM   1559  CA  LYS A 209      -0.563  38.661  26.521  1.00  0.70           C  
ATOM   1560  C   LYS A 209      -1.442  39.881  26.551  1.00  0.70           C  
ATOM   1561  O   LYS A 209      -1.041  40.960  26.978  1.00  0.70           O  
ATOM   1562  CB  LYS A 209       0.860  39.080  26.077  1.00  0.70           C  
ATOM   1563  CG  LYS A 209       1.798  37.874  26.110  1.00  0.70           C  
ATOM   1564  CD  LYS A 209       3.280  38.233  26.286  1.00  0.70           C  
ATOM   1565  CE  LYS A 209       4.028  36.999  26.788  1.00  0.70           C  
ATOM   1566  NZ  LYS A 209       5.497  37.101  26.673  1.00  0.70           N  
ATOM   1567  N   ALA A 210      -2.677  39.730  26.065  1.00  0.73           N  
ATOM   1568  CA  ALA A 210      -3.636  40.782  26.066  1.00  0.73           C  
ATOM   1569  C   ALA A 210      -4.977  40.088  26.005  1.00  0.73           C  
ATOM   1570  O   ALA A 210      -5.089  38.951  25.539  1.00  0.73           O  
ATOM   1571  CB  ALA A 210      -3.420  41.758  24.885  1.00  0.73           C  
ATOM   1572  N   VAL A 211      -6.006  40.764  26.530  1.00  0.73           N  
ATOM   1573  CA  VAL A 211      -7.419  40.458  26.416  1.00  0.73           C  
ATOM   1574  C   VAL A 211      -7.884  40.438  24.954  1.00  0.73           C  
ATOM   1575  O   VAL A 211      -7.276  41.168  24.165  1.00  0.73           O  
ATOM   1576  CB  VAL A 211      -8.189  41.496  27.247  1.00  0.73           C  
ATOM   1577  CG1 VAL A 211      -8.529  42.805  26.491  1.00  0.73           C  
ATOM   1578  CG2 VAL A 211      -9.466  40.869  27.795  1.00  0.73           C  
ATOM   1579  N   PRO A 212      -8.891  39.691  24.475  1.00  0.80           N  
ATOM   1580  CA  PRO A 212      -9.285  39.784  23.072  1.00  0.80           C  
ATOM   1581  C   PRO A 212      -9.861  41.147  22.727  1.00  0.80           C  
ATOM   1582  O   PRO A 212     -10.613  41.718  23.519  1.00  0.80           O  
ATOM   1583  CB  PRO A 212     -10.360  38.698  22.891  1.00  0.80           C  
ATOM   1584  CG  PRO A 212     -10.056  37.691  24.005  1.00  0.80           C  
ATOM   1585  CD  PRO A 212      -9.557  38.573  25.153  1.00  0.80           C  
ATOM   1586  N   VAL A 213      -9.549  41.691  21.538  1.00  0.82           N  
ATOM   1587  CA  VAL A 213     -10.145  42.931  21.082  1.00  0.82           C  
ATOM   1588  C   VAL A 213     -11.439  42.551  20.406  1.00  0.82           C  
ATOM   1589  O   VAL A 213     -11.457  41.912  19.350  1.00  0.82           O  
ATOM   1590  CB  VAL A 213      -9.254  43.703  20.110  1.00  0.82           C  
ATOM   1591  CG1 VAL A 213      -9.962  44.987  19.610  1.00  0.82           C  
ATOM   1592  CG2 VAL A 213      -7.935  44.064  20.827  1.00  0.82           C  
ATOM   1593  N   VAL A 214     -12.575  42.916  21.015  1.00  0.84           N  
ATOM   1594  CA  VAL A 214     -13.876  42.582  20.490  1.00  0.84           C  
ATOM   1595  C   VAL A 214     -14.613  43.856  20.123  1.00  0.84           C  
ATOM   1596  O   VAL A 214     -14.483  44.898  20.768  1.00  0.84           O  
ATOM   1597  CB  VAL A 214     -14.641  41.643  21.423  1.00  0.84           C  
ATOM   1598  CG1 VAL A 214     -15.054  42.282  22.751  1.00  0.84           C  
ATOM   1599  CG2 VAL A 214     -15.926  41.183  20.732  1.00  0.84           C  
ATOM   1600  N   SER A 215     -15.368  43.819  19.014  1.00  0.83           N  
ATOM   1601  CA  SER A 215     -16.175  44.920  18.541  1.00  0.83           C  
ATOM   1602  C   SER A 215     -17.498  44.409  18.011  1.00  0.83           C  
ATOM   1603  O   SER A 215     -17.718  43.211  17.806  1.00  0.83           O  
ATOM   1604  CB  SER A 215     -15.455  45.847  17.508  1.00  0.83           C  
ATOM   1605  OG  SER A 215     -15.168  45.225  16.254  1.00  0.83           O  
ATOM   1606  N   VAL A 216     -18.455  45.318  17.815  1.00  0.82           N  
ATOM   1607  CA  VAL A 216     -19.783  45.048  17.311  1.00  0.82           C  
ATOM   1608  C   VAL A 216     -19.917  45.934  16.080  1.00  0.82           C  
ATOM   1609  O   VAL A 216     -19.287  46.991  16.014  1.00  0.82           O  
ATOM   1610  CB  VAL A 216     -20.803  45.350  18.423  1.00  0.82           C  
ATOM   1611  CG1 VAL A 216     -21.963  46.253  18.004  1.00  0.82           C  
ATOM   1612  CG2 VAL A 216     -21.370  44.034  18.983  1.00  0.82           C  
ATOM   1613  N   SER A 217     -20.709  45.531  15.050  1.00  0.79           N  
ATOM   1614  CA  SER A 217     -21.006  46.378  13.893  1.00  0.79           C  
ATOM   1615  C   SER A 217     -21.790  47.620  14.251  1.00  0.79           C  
ATOM   1616  O   SER A 217     -21.417  48.730  13.884  1.00  0.79           O  
ATOM   1617  CB  SER A 217     -21.740  45.634  12.734  1.00  0.79           C  
ATOM   1618  OG  SER A 217     -22.976  45.019  13.123  1.00  0.79           O  
ATOM   1619  N   LYS A 218     -22.860  47.484  15.057  1.00  0.77           N  
ATOM   1620  CA  LYS A 218     -23.479  48.647  15.642  1.00  0.77           C  
ATOM   1621  C   LYS A 218     -24.048  48.361  17.017  1.00  0.77           C  
ATOM   1622  O   LYS A 218     -24.693  47.341  17.251  1.00  0.77           O  
ATOM   1623  CB  LYS A 218     -24.551  49.280  14.709  1.00  0.77           C  
ATOM   1624  CG  LYS A 218     -24.941  50.739  15.037  1.00  0.77           C  
ATOM   1625  CD  LYS A 218     -23.713  51.671  15.199  1.00  0.77           C  
ATOM   1626  CE  LYS A 218     -23.995  53.074  15.728  1.00  0.77           C  
ATOM   1627  NZ  LYS A 218     -24.761  52.916  16.980  1.00  0.77           N  
ATOM   1628  N   ALA A 219     -23.760  49.265  17.984  1.00  0.78           N  
ATOM   1629  CA  ALA A 219     -24.075  49.131  19.399  1.00  0.78           C  
ATOM   1630  C   ALA A 219     -25.549  49.255  19.786  1.00  0.78           C  
ATOM   1631  O   ALA A 219     -25.901  49.046  20.942  1.00  0.78           O  
ATOM   1632  CB  ALA A 219     -23.278  50.183  20.210  1.00  0.78           C  
ATOM   1633  N   SER A 220     -26.459  49.650  18.879  1.00  0.77           N  
ATOM   1634  CA  SER A 220     -27.853  49.770  19.266  1.00  0.77           C  
ATOM   1635  C   SER A 220     -28.670  49.705  18.007  1.00  0.77           C  
ATOM   1636  O   SER A 220     -28.200  50.134  16.946  1.00  0.77           O  
ATOM   1637  CB  SER A 220     -28.151  51.082  20.065  1.00  0.77           C  
ATOM   1638  OG  SER A 220     -29.542  51.346  20.255  1.00  0.77           O  
ATOM   1639  N   TYR A 221     -29.886  49.148  18.123  1.00  0.77           N  
ATOM   1640  CA  TYR A 221     -30.850  48.945  17.067  1.00  0.77           C  
ATOM   1641  C   TYR A 221     -32.257  49.300  17.552  1.00  0.77           C  
ATOM   1642  O   TYR A 221     -32.760  48.750  18.534  1.00  0.77           O  
ATOM   1643  CB  TYR A 221     -30.879  47.455  16.651  1.00  0.77           C  
ATOM   1644  CG  TYR A 221     -29.650  47.074  15.895  1.00  0.77           C  
ATOM   1645  CD1 TYR A 221     -29.623  47.226  14.500  1.00  0.77           C  
ATOM   1646  CD2 TYR A 221     -28.530  46.543  16.559  1.00  0.77           C  
ATOM   1647  CE1 TYR A 221     -28.481  46.865  13.772  1.00  0.77           C  
ATOM   1648  CE2 TYR A 221     -27.388  46.180  15.831  1.00  0.77           C  
ATOM   1649  CZ  TYR A 221     -27.359  46.360  14.441  1.00  0.77           C  
ATOM   1650  OH  TYR A 221     -26.185  46.046  13.728  1.00  0.77           O  
ATOM   1651  N   LEU A 222     -32.939  50.206  16.819  1.00  0.75           N  
ATOM   1652  CA  LEU A 222     -34.311  50.634  17.041  1.00  0.75           C  
ATOM   1653  C   LEU A 222     -35.133  50.037  15.921  1.00  0.75           C  
ATOM   1654  O   LEU A 222     -34.984  50.416  14.757  1.00  0.75           O  
ATOM   1655  CB  LEU A 222     -34.459  52.180  16.924  1.00  0.75           C  
ATOM   1656  CG  LEU A 222     -33.553  52.995  17.869  1.00  0.75           C  
ATOM   1657  CD1 LEU A 222     -33.700  54.498  17.573  1.00  0.75           C  
ATOM   1658  CD2 LEU A 222     -33.879  52.713  19.340  1.00  0.75           C  
ATOM   1659  N   LEU A 223     -36.000  49.059  16.220  1.00  0.74           N  
ATOM   1660  CA  LEU A 223     -36.569  48.231  15.187  1.00  0.74           C  
ATOM   1661  C   LEU A 223     -38.068  48.245  15.199  1.00  0.74           C  
ATOM   1662  O   LEU A 223     -38.754  48.783  16.065  1.00  0.74           O  
ATOM   1663  CB  LEU A 223     -36.021  46.776  15.234  1.00  0.74           C  
ATOM   1664  CG  LEU A 223     -35.322  46.310  13.933  1.00  0.74           C  
ATOM   1665  CD1 LEU A 223     -34.178  47.246  13.502  1.00  0.74           C  
ATOM   1666  CD2 LEU A 223     -34.761  44.891  14.098  1.00  0.74           C  
ATOM   1667  N   ARG A 224     -38.588  47.660  14.128  1.00  0.66           N  
ATOM   1668  CA  ARG A 224     -39.937  47.735  13.679  1.00  0.66           C  
ATOM   1669  C   ARG A 224     -40.343  46.290  13.502  1.00  0.66           C  
ATOM   1670  O   ARG A 224     -39.668  45.556  12.770  1.00  0.66           O  
ATOM   1671  CB  ARG A 224     -39.993  48.549  12.359  1.00  0.66           C  
ATOM   1672  CG  ARG A 224     -38.728  48.420  11.472  1.00  0.66           C  
ATOM   1673  CD  ARG A 224     -38.849  49.231  10.186  1.00  0.66           C  
ATOM   1674  NE  ARG A 224     -37.766  48.759   9.269  1.00  0.66           N  
ATOM   1675  CZ  ARG A 224     -37.681  49.132   7.982  1.00  0.66           C  
ATOM   1676  NH1 ARG A 224     -38.541  50.015   7.480  1.00  0.66           N  
ATOM   1677  NH2 ARG A 224     -36.785  48.591   7.171  1.00  0.66           N  
ATOM   1678  N   GLU A 225     -41.395  45.831  14.207  1.00  0.70           N  
ATOM   1679  CA  GLU A 225     -41.938  44.481  14.134  1.00  0.70           C  
ATOM   1680  C   GLU A 225     -42.214  44.020  12.698  1.00  0.70           C  
ATOM   1681  O   GLU A 225     -43.082  44.549  12.005  1.00  0.70           O  
ATOM   1682  CB  GLU A 225     -43.218  44.325  14.995  1.00  0.70           C  
ATOM   1683  CG  GLU A 225     -43.752  42.872  14.973  1.00  0.70           C  
ATOM   1684  CD  GLU A 225     -44.957  42.642  15.873  1.00  0.70           C  
ATOM   1685  OE1 GLU A 225     -46.108  42.828  15.414  1.00  0.70           O  
ATOM   1686  OE2 GLU A 225     -44.694  42.178  17.014  1.00  0.70           O  
ATOM   1687  N   GLY A 226     -41.434  43.034  12.201  1.00  0.74           N  
ATOM   1688  CA  GLY A 226     -41.486  42.588  10.812  1.00  0.74           C  
ATOM   1689  C   GLY A 226     -40.173  42.614  10.057  1.00  0.74           C  
ATOM   1690  O   GLY A 226     -40.007  41.830   9.131  1.00  0.74           O  
ATOM   1691  N   GLU A 227     -39.217  43.513  10.385  1.00  0.73           N  
ATOM   1692  CA  GLU A 227     -37.959  43.652   9.635  1.00  0.73           C  
ATOM   1693  C   GLU A 227     -36.870  42.688  10.116  1.00  0.73           C  
ATOM   1694  O   GLU A 227     -36.974  42.073  11.175  1.00  0.73           O  
ATOM   1695  CB  GLU A 227     -37.471  45.144   9.675  1.00  0.73           C  
ATOM   1696  CG  GLU A 227     -36.269  45.543   8.770  1.00  0.73           C  
ATOM   1697  CD  GLU A 227     -36.526  45.198   7.310  1.00  0.73           C  
ATOM   1698  OE1 GLU A 227     -37.152  46.061   6.641  1.00  0.73           O  
ATOM   1699  OE2 GLU A 227     -36.066  44.127   6.867  1.00  0.73           O  
ATOM   1700  N   GLU A 228     -35.792  42.517   9.335  1.00  0.75           N  
ATOM   1701  CA  GLU A 228     -34.667  41.663   9.644  1.00  0.75           C  
ATOM   1702  C   GLU A 228     -33.688  42.303  10.634  1.00  0.75           C  
ATOM   1703  O   GLU A 228     -33.178  43.412  10.449  1.00  0.75           O  
ATOM   1704  CB  GLU A 228     -33.977  41.296   8.310  1.00  0.75           C  
ATOM   1705  CG  GLU A 228     -33.104  40.012   8.368  1.00  0.75           C  
ATOM   1706  CD  GLU A 228     -33.345  39.067   7.178  1.00  0.75           C  
ATOM   1707  OE1 GLU A 228     -34.496  38.598   7.014  1.00  0.75           O  
ATOM   1708  OE2 GLU A 228     -32.355  38.771   6.456  1.00  0.75           O  
ATOM   1709  N   PHE A 229     -33.397  41.618  11.756  1.00  0.78           N  
ATOM   1710  CA  PHE A 229     -32.385  42.028  12.709  1.00  0.78           C  
ATOM   1711  C   PHE A 229     -31.097  41.319  12.322  1.00  0.78           C  
ATOM   1712  O   PHE A 229     -31.088  40.105  12.131  1.00  0.78           O  
ATOM   1713  CB  PHE A 229     -32.820  41.651  14.158  1.00  0.78           C  
ATOM   1714  CG  PHE A 229     -31.717  41.749  15.199  1.00  0.78           C  
ATOM   1715  CD1 PHE A 229     -30.968  42.928  15.388  1.00  0.78           C  
ATOM   1716  CD2 PHE A 229     -31.375  40.607  15.947  1.00  0.78           C  
ATOM   1717  CE1 PHE A 229     -29.907  42.955  16.309  1.00  0.78           C  
ATOM   1718  CE2 PHE A 229     -30.363  40.654  16.914  1.00  0.78           C  
ATOM   1719  CZ  PHE A 229     -29.620  41.827  17.089  1.00  0.78           C  
ATOM   1720  N   THR A 230     -29.981  42.063  12.221  1.00  0.80           N  
ATOM   1721  CA  THR A 230     -28.708  41.543  11.748  1.00  0.80           C  
ATOM   1722  C   THR A 230     -27.650  42.323  12.481  1.00  0.80           C  
ATOM   1723  O   THR A 230     -27.825  43.510  12.743  1.00  0.80           O  
ATOM   1724  CB  THR A 230     -28.478  41.748  10.250  1.00  0.80           C  
ATOM   1725  OG1 THR A 230     -29.531  41.149   9.518  1.00  0.80           O  
ATOM   1726  CG2 THR A 230     -27.218  41.024   9.754  1.00  0.80           C  
ATOM   1727  N   VAL A 231     -26.529  41.687  12.856  1.00  0.83           N  
ATOM   1728  CA  VAL A 231     -25.426  42.321  13.550  1.00  0.83           C  
ATOM   1729  C   VAL A 231     -24.233  41.418  13.333  1.00  0.83           C  
ATOM   1730  O   VAL A 231     -24.389  40.209  13.178  1.00  0.83           O  
ATOM   1731  CB  VAL A 231     -25.718  42.498  15.052  1.00  0.83           C  
ATOM   1732  CG1 VAL A 231     -26.227  41.171  15.645  1.00  0.83           C  
ATOM   1733  CG2 VAL A 231     -24.510  43.015  15.873  1.00  0.83           C  
ATOM   1734  N   THR A 232     -23.002  41.956  13.318  1.00  0.82           N  
ATOM   1735  CA  THR A 232     -21.802  41.141  13.186  1.00  0.82           C  
ATOM   1736  C   THR A 232     -20.929  41.460  14.368  1.00  0.82           C  
ATOM   1737  O   THR A 232     -20.526  42.608  14.553  1.00  0.82           O  
ATOM   1738  CB  THR A 232     -21.033  41.398  11.894  1.00  0.82           C  
ATOM   1739  OG1 THR A 232     -21.858  41.069  10.786  1.00  0.82           O  
ATOM   1740  CG2 THR A 232     -19.805  40.489  11.786  1.00  0.82           C  
ATOM   1741  N   CYS A 233     -20.617  40.467  15.232  1.00  0.85           N  
ATOM   1742  CA  CYS A 233     -19.560  40.639  16.219  1.00  0.85           C  
ATOM   1743  C   CYS A 233     -18.245  40.311  15.553  1.00  0.85           C  
ATOM   1744  O   CYS A 233     -18.139  39.303  14.859  1.00  0.85           O  
ATOM   1745  CB  CYS A 233     -19.670  39.736  17.476  1.00  0.85           C  
ATOM   1746  SG  CYS A 233     -18.405  40.146  18.716  1.00  0.85           S  
ATOM   1747  N   THR A 234     -17.225  41.154  15.773  1.00  0.82           N  
ATOM   1748  CA  THR A 234     -15.898  41.017  15.195  1.00  0.82           C  
ATOM   1749  C   THR A 234     -14.934  40.853  16.336  1.00  0.82           C  
ATOM   1750  O   THR A 234     -14.877  41.662  17.260  1.00  0.82           O  
ATOM   1751  CB  THR A 234     -15.468  42.244  14.400  1.00  0.82           C  
ATOM   1752  OG1 THR A 234     -16.239  42.362  13.214  1.00  0.82           O  
ATOM   1753  CG2 THR A 234     -13.999  42.199  13.933  1.00  0.82           C  
ATOM   1754  N   ILE A 235     -14.145  39.771  16.312  1.00  0.82           N  
ATOM   1755  CA  ILE A 235     -13.162  39.442  17.330  1.00  0.82           C  
ATOM   1756  C   ILE A 235     -11.826  39.376  16.675  1.00  0.82           C  
ATOM   1757  O   ILE A 235     -11.670  38.647  15.700  1.00  0.82           O  
ATOM   1758  CB  ILE A 235     -13.465  38.090  17.950  1.00  0.82           C  
ATOM   1759  CG1 ILE A 235     -14.860  38.277  18.585  1.00  0.82           C  
ATOM   1760  CG2 ILE A 235     -12.339  37.655  18.941  1.00  0.82           C  
ATOM   1761  CD1 ILE A 235     -14.979  37.623  19.939  1.00  0.82           C  
ATOM   1762  N   LYS A 236     -10.831  40.116  17.184  1.00  0.80           N  
ATOM   1763  CA  LYS A 236      -9.464  40.053  16.714  1.00  0.80           C  
ATOM   1764  C   LYS A 236      -8.557  39.600  17.846  1.00  0.80           C  
ATOM   1765  O   LYS A 236      -8.634  40.124  18.958  1.00  0.80           O  
ATOM   1766  CB  LYS A 236      -8.982  41.438  16.223  1.00  0.80           C  
ATOM   1767  CG  LYS A 236      -9.890  42.023  15.128  1.00  0.80           C  
ATOM   1768  CD  LYS A 236      -9.348  43.352  14.575  1.00  0.80           C  
ATOM   1769  CE  LYS A 236     -10.152  43.931  13.397  1.00  0.80           C  
ATOM   1770  NZ  LYS A 236     -10.181  42.997  12.259  1.00  0.80           N  
ATOM   1771  N   ASP A 237      -7.683  38.609  17.582  1.00  0.79           N  
ATOM   1772  CA  ASP A 237      -6.781  38.065  18.577  1.00  0.79           C  
ATOM   1773  C   ASP A 237      -5.609  37.365  17.872  1.00  0.79           C  
ATOM   1774  O   ASP A 237      -5.527  37.305  16.646  1.00  0.79           O  
ATOM   1775  CB  ASP A 237      -7.524  37.084  19.525  1.00  0.79           C  
ATOM   1776  CG  ASP A 237      -6.950  37.055  20.937  1.00  0.79           C  
ATOM   1777  OD1 ASP A 237      -7.731  36.805  21.884  1.00  0.79           O  
ATOM   1778  OD2 ASP A 237      -5.710  37.198  21.086  1.00  0.79           O  
ATOM   1779  N   VAL A 238      -4.651  36.831  18.650  1.00  0.77           N  
ATOM   1780  CA  VAL A 238      -3.374  36.301  18.193  1.00  0.77           C  
ATOM   1781  C   VAL A 238      -3.399  34.836  17.809  1.00  0.77           C  
ATOM   1782  O   VAL A 238      -2.444  34.314  17.236  1.00  0.77           O  
ATOM   1783  CB  VAL A 238      -2.255  36.505  19.225  1.00  0.77           C  
ATOM   1784  CG1 VAL A 238      -2.198  37.999  19.602  1.00  0.77           C  
ATOM   1785  CG2 VAL A 238      -2.469  35.650  20.494  1.00  0.77           C  
ATOM   1786  N   SER A 239      -4.491  34.116  18.087  1.00  0.76           N  
ATOM   1787  CA  SER A 239      -4.549  32.704  17.799  1.00  0.76           C  
ATOM   1788  C   SER A 239      -5.984  32.341  17.541  1.00  0.76           C  
ATOM   1789  O   SER A 239      -6.906  32.988  18.034  1.00  0.76           O  
ATOM   1790  CB  SER A 239      -3.966  31.864  18.970  1.00  0.76           C  
ATOM   1791  OG  SER A 239      -4.082  30.449  18.787  1.00  0.76           O  
ATOM   1792  N   SER A 240      -6.220  31.281  16.753  1.00  0.74           N  
ATOM   1793  CA  SER A 240      -7.514  30.681  16.437  1.00  0.74           C  
ATOM   1794  C   SER A 240      -8.266  30.128  17.660  1.00  0.74           C  
ATOM   1795  O   SER A 240      -9.480  29.928  17.627  1.00  0.74           O  
ATOM   1796  CB  SER A 240      -7.304  29.544  15.400  1.00  0.74           C  
ATOM   1797  OG  SER A 240      -8.519  29.211  14.730  1.00  0.74           O  
ATOM   1798  N   SER A 241      -7.558  29.947  18.804  1.00  0.74           N  
ATOM   1799  CA  SER A 241      -8.046  29.379  20.055  1.00  0.74           C  
ATOM   1800  C   SER A 241      -8.872  30.351  20.899  1.00  0.74           C  
ATOM   1801  O   SER A 241      -9.344  29.974  21.969  1.00  0.74           O  
ATOM   1802  CB  SER A 241      -6.887  28.847  20.969  1.00  0.74           C  
ATOM   1803  OG  SER A 241      -5.833  29.803  21.130  1.00  0.74           O  
ATOM   1804  N   VAL A 242      -9.123  31.610  20.442  1.00  0.77           N  
ATOM   1805  CA  VAL A 242     -10.058  32.539  21.097  1.00  0.77           C  
ATOM   1806  C   VAL A 242     -11.445  31.957  21.277  1.00  0.77           C  
ATOM   1807  O   VAL A 242     -12.099  31.480  20.344  1.00  0.77           O  
ATOM   1808  CB  VAL A 242     -10.285  33.913  20.431  1.00  0.77           C  
ATOM   1809  CG1 VAL A 242     -10.256  35.006  21.524  1.00  0.77           C  
ATOM   1810  CG2 VAL A 242      -9.234  34.179  19.353  1.00  0.77           C  
ATOM   1811  N   TYR A 243     -11.980  32.045  22.495  1.00  0.75           N  
ATOM   1812  CA  TYR A 243     -13.334  31.653  22.749  1.00  0.75           C  
ATOM   1813  C   TYR A 243     -14.197  32.856  22.418  1.00  0.75           C  
ATOM   1814  O   TYR A 243     -13.884  33.987  22.801  1.00  0.75           O  
ATOM   1815  CB  TYR A 243     -13.468  31.155  24.210  1.00  0.75           C  
ATOM   1816  CG  TYR A 243     -14.896  30.807  24.516  1.00  0.75           C  
ATOM   1817  CD1 TYR A 243     -15.723  31.711  25.211  1.00  0.75           C  
ATOM   1818  CD2 TYR A 243     -15.446  29.619  24.004  1.00  0.75           C  
ATOM   1819  CE1 TYR A 243     -17.076  31.407  25.425  1.00  0.75           C  
ATOM   1820  CE2 TYR A 243     -16.800  29.319  24.213  1.00  0.75           C  
ATOM   1821  CZ  TYR A 243     -17.609  30.210  24.933  1.00  0.75           C  
ATOM   1822  OH  TYR A 243     -18.965  29.901  25.154  1.00  0.75           O  
ATOM   1823  N   SER A 244     -15.286  32.657  21.667  1.00  0.83           N  
ATOM   1824  CA  SER A 244     -16.243  33.704  21.426  1.00  0.83           C  
ATOM   1825  C   SER A 244     -17.608  33.132  21.499  1.00  0.83           C  
ATOM   1826  O   SER A 244     -17.784  31.922  21.312  1.00  0.83           O  
ATOM   1827  CB  SER A 244     -16.047  34.520  20.124  1.00  0.83           C  
ATOM   1828  OG  SER A 244     -16.383  33.921  18.868  1.00  0.83           O  
ATOM   1829  N   THR A 245     -18.593  33.959  21.854  1.00  0.81           N  
ATOM   1830  CA  THR A 245     -19.971  33.524  21.855  1.00  0.81           C  
ATOM   1831  C   THR A 245     -20.838  34.756  21.875  1.00  0.81           C  
ATOM   1832  O   THR A 245     -20.452  35.814  22.390  1.00  0.81           O  
ATOM   1833  CB  THR A 245     -20.260  32.614  23.066  1.00  0.81           C  
ATOM   1834  OG1 THR A 245     -21.491  31.905  23.040  1.00  0.81           O  
ATOM   1835  CG2 THR A 245     -20.215  33.387  24.397  1.00  0.81           C  
ATOM   1836  N   TRP A 246     -22.047  34.636  21.318  1.00  0.75           N  
ATOM   1837  CA  TRP A 246     -23.145  35.546  21.538  1.00  0.75           C  
ATOM   1838  C   TRP A 246     -23.970  35.083  22.724  1.00  0.75           C  
ATOM   1839  O   TRP A 246     -24.139  33.900  23.024  1.00  0.75           O  
ATOM   1840  CB  TRP A 246     -24.066  35.634  20.290  1.00  0.75           C  
ATOM   1841  CG  TRP A 246     -23.612  36.632  19.231  1.00  0.75           C  
ATOM   1842  CD1 TRP A 246     -23.207  36.392  17.948  1.00  0.75           C  
ATOM   1843  CD2 TRP A 246     -23.601  38.064  19.398  1.00  0.75           C  
ATOM   1844  NE1 TRP A 246     -22.956  37.583  17.289  1.00  0.75           N  
ATOM   1845  CE2 TRP A 246     -23.219  38.625  18.157  1.00  0.75           C  
ATOM   1846  CE3 TRP A 246     -23.886  38.875  20.495  1.00  0.75           C  
ATOM   1847  CZ2 TRP A 246     -23.155  40.008  17.989  1.00  0.75           C  
ATOM   1848  CZ3 TRP A 246     -23.725  40.261  20.348  1.00  0.75           C  
ATOM   1849  CH2 TRP A 246     -23.384  40.821  19.111  1.00  0.75           C  
ATOM   1850  N   LYS A 247     -24.529  36.051  23.458  1.00  0.75           N  
ATOM   1851  CA  LYS A 247     -25.401  35.752  24.554  1.00  0.75           C  
ATOM   1852  C   LYS A 247     -26.625  36.635  24.468  1.00  0.75           C  
ATOM   1853  O   LYS A 247     -26.610  37.814  24.830  1.00  0.75           O  
ATOM   1854  CB  LYS A 247     -24.628  35.878  25.886  1.00  0.75           C  
ATOM   1855  CG  LYS A 247     -25.376  35.281  27.088  1.00  0.75           C  
ATOM   1856  CD  LYS A 247     -24.516  35.314  28.363  1.00  0.75           C  
ATOM   1857  CE  LYS A 247     -25.234  34.714  29.579  1.00  0.75           C  
ATOM   1858  NZ  LYS A 247     -24.370  34.799  30.779  1.00  0.75           N  
ATOM   1859  N   ARG A 248     -27.746  36.068  23.982  1.00  0.69           N  
ATOM   1860  CA  ARG A 248     -29.101  36.526  24.244  1.00  0.69           C  
ATOM   1861  C   ARG A 248     -29.393  36.511  25.731  1.00  0.69           C  
ATOM   1862  O   ARG A 248     -29.449  35.423  26.312  1.00  0.69           O  
ATOM   1863  CB  ARG A 248     -30.124  35.602  23.535  1.00  0.69           C  
ATOM   1864  CG  ARG A 248     -31.565  36.155  23.589  1.00  0.69           C  
ATOM   1865  CD  ARG A 248     -32.602  35.219  22.968  1.00  0.69           C  
ATOM   1866  NE  ARG A 248     -32.269  35.067  21.518  1.00  0.69           N  
ATOM   1867  CZ  ARG A 248     -32.767  35.809  20.517  1.00  0.69           C  
ATOM   1868  NH1 ARG A 248     -32.383  35.547  19.267  1.00  0.69           N  
ATOM   1869  NH2 ARG A 248     -33.616  36.812  20.715  1.00  0.69           N  
ATOM   1870  N   GLU A 249     -29.484  37.680  26.394  1.00  0.68           N  
ATOM   1871  CA  GLU A 249     -29.009  37.771  27.768  1.00  0.68           C  
ATOM   1872  C   GLU A 249     -29.733  36.919  28.798  1.00  0.68           C  
ATOM   1873  O   GLU A 249     -29.091  36.221  29.581  1.00  0.68           O  
ATOM   1874  CB  GLU A 249     -28.818  39.225  28.235  1.00  0.68           C  
ATOM   1875  CG  GLU A 249     -27.635  39.317  29.225  1.00  0.68           C  
ATOM   1876  CD  GLU A 249     -27.216  40.767  29.417  1.00  0.68           C  
ATOM   1877  OE1 GLU A 249     -26.090  41.097  28.964  1.00  0.68           O  
ATOM   1878  OE2 GLU A 249     -28.018  41.546  29.990  1.00  0.68           O  
ATOM   1879  N   ASN A 250     -31.086  36.887  28.748  1.00  0.59           N  
ATOM   1880  CA  ASN A 250     -31.889  35.947  29.515  1.00  0.59           C  
ATOM   1881  C   ASN A 250     -32.322  34.787  28.611  1.00  0.59           C  
ATOM   1882  O   ASN A 250     -33.485  34.397  28.521  1.00  0.59           O  
ATOM   1883  CB  ASN A 250     -33.053  36.652  30.285  1.00  0.59           C  
ATOM   1884  CG  ASN A 250     -33.245  35.973  31.645  1.00  0.59           C  
ATOM   1885  OD1 ASN A 250     -32.486  35.111  32.081  1.00  0.59           O  
ATOM   1886  ND2 ASN A 250     -34.274  36.400  32.409  1.00  0.59           N  
ATOM   1887  N   SER A 251     -31.324  34.230  27.898  1.00  0.60           N  
ATOM   1888  CA  SER A 251     -30.931  32.832  28.017  1.00  0.60           C  
ATOM   1889  C   SER A 251     -31.928  31.770  27.605  1.00  0.60           C  
ATOM   1890  O   SER A 251     -32.340  30.926  28.392  1.00  0.60           O  
ATOM   1891  CB  SER A 251     -30.277  32.472  29.382  1.00  0.60           C  
ATOM   1892  OG  SER A 251     -31.175  32.668  30.469  1.00  0.60           O  
ATOM   1893  N   GLN A 252     -32.316  31.739  26.317  1.00  0.55           N  
ATOM   1894  CA  GLN A 252     -33.205  30.685  25.862  1.00  0.55           C  
ATOM   1895  C   GLN A 252     -32.603  29.899  24.727  1.00  0.55           C  
ATOM   1896  O   GLN A 252     -32.640  28.672  24.707  1.00  0.55           O  
ATOM   1897  CB  GLN A 252     -34.581  31.283  25.432  1.00  0.55           C  
ATOM   1898  CG  GLN A 252     -34.511  32.524  24.497  1.00  0.55           C  
ATOM   1899  CD  GLN A 252     -35.777  32.757  23.666  1.00  0.55           C  
ATOM   1900  OE1 GLN A 252     -36.534  31.841  23.354  1.00  0.55           O  
ATOM   1901  NE2 GLN A 252     -35.962  34.008  23.178  1.00  0.55           N  
ATOM   1902  N   THR A 253     -32.017  30.565  23.722  1.00  0.57           N  
ATOM   1903  CA  THR A 253     -31.908  29.923  22.424  1.00  0.57           C  
ATOM   1904  C   THR A 253     -30.524  29.408  22.115  1.00  0.57           C  
ATOM   1905  O   THR A 253     -30.396  28.318  21.574  1.00  0.57           O  
ATOM   1906  CB  THR A 253     -32.220  30.847  21.246  1.00  0.57           C  
ATOM   1907  OG1 THR A 253     -31.594  32.128  21.334  1.00  0.57           O  
ATOM   1908  CG2 THR A 253     -33.698  31.123  20.956  1.00  0.57           C  
ATOM   1909  N   LYS A 254     -29.480  30.259  22.318  1.00  0.62           N  
ATOM   1910  CA  LYS A 254     -28.142  30.139  21.725  1.00  0.62           C  
ATOM   1911  C   LYS A 254     -28.178  30.534  20.227  1.00  0.62           C  
ATOM   1912  O   LYS A 254     -27.139  30.534  19.551  1.00  0.62           O  
ATOM   1913  CB  LYS A 254     -27.468  28.772  22.134  1.00  0.62           C  
ATOM   1914  CG  LYS A 254     -26.720  27.924  21.081  1.00  0.62           C  
ATOM   1915  CD  LYS A 254     -25.170  27.953  21.097  1.00  0.62           C  
ATOM   1916  CE  LYS A 254     -24.482  29.245  21.571  1.00  0.62           C  
ATOM   1917  NZ  LYS A 254     -23.115  28.928  22.055  1.00  0.62           N  
ATOM   1918  N   LEU A 255     -29.379  30.942  19.730  1.00  0.58           N  
ATOM   1919  CA  LEU A 255     -29.916  31.039  18.359  1.00  0.58           C  
ATOM   1920  C   LEU A 255     -28.874  31.345  17.344  1.00  0.58           C  
ATOM   1921  O   LEU A 255     -28.392  32.483  17.295  1.00  0.58           O  
ATOM   1922  CB  LEU A 255     -31.068  32.074  18.169  1.00  0.58           C  
ATOM   1923  CG  LEU A 255     -31.719  32.132  16.765  1.00  0.58           C  
ATOM   1924  CD1 LEU A 255     -32.464  30.830  16.418  1.00  0.58           C  
ATOM   1925  CD2 LEU A 255     -32.679  33.331  16.697  1.00  0.58           C  
ATOM   1926  N   GLN A 256     -28.510  30.307  16.580  1.00  0.60           N  
ATOM   1927  CA  GLN A 256     -27.288  30.181  15.824  1.00  0.60           C  
ATOM   1928  C   GLN A 256     -26.684  31.428  15.213  1.00  0.60           C  
ATOM   1929  O   GLN A 256     -27.331  32.261  14.579  1.00  0.60           O  
ATOM   1930  CB  GLN A 256     -27.397  29.079  14.751  1.00  0.60           C  
ATOM   1931  CG  GLN A 256     -27.519  27.645  15.328  1.00  0.60           C  
ATOM   1932  CD  GLN A 256     -26.216  27.192  15.998  1.00  0.60           C  
ATOM   1933  OE1 GLN A 256     -25.128  27.297  15.437  1.00  0.60           O  
ATOM   1934  NE2 GLN A 256     -26.302  26.639  17.229  1.00  0.60           N  
ATOM   1935  N   GLU A 257     -25.367  31.519  15.390  1.00  0.69           N  
ATOM   1936  CA  GLU A 257     -24.533  32.548  14.862  1.00  0.69           C  
ATOM   1937  C   GLU A 257     -24.036  32.054  13.516  1.00  0.69           C  
ATOM   1938  O   GLU A 257     -23.930  30.856  13.253  1.00  0.69           O  
ATOM   1939  CB  GLU A 257     -23.328  32.812  15.822  1.00  0.69           C  
ATOM   1940  CG  GLU A 257     -23.529  32.297  17.285  1.00  0.69           C  
ATOM   1941  CD  GLU A 257     -22.298  32.449  18.188  1.00  0.69           C  
ATOM   1942  OE1 GLU A 257     -22.498  32.568  19.429  1.00  0.69           O  
ATOM   1943  OE2 GLU A 257     -21.156  32.408  17.667  1.00  0.69           O  
ATOM   1944  N   LYS A 258     -23.705  32.969  12.602  1.00  0.70           N  
ATOM   1945  CA  LYS A 258     -23.075  32.613  11.358  1.00  0.70           C  
ATOM   1946  C   LYS A 258     -21.608  32.982  11.450  1.00  0.70           C  
ATOM   1947  O   LYS A 258     -21.209  34.134  11.293  1.00  0.70           O  
ATOM   1948  CB  LYS A 258     -23.832  33.290  10.186  1.00  0.70           C  
ATOM   1949  CG  LYS A 258     -24.340  32.281   9.138  1.00  0.70           C  
ATOM   1950  CD  LYS A 258     -23.369  32.136   7.949  1.00  0.70           C  
ATOM   1951  CE  LYS A 258     -23.817  31.130   6.880  1.00  0.70           C  
ATOM   1952  NZ  LYS A 258     -23.826  29.776   7.472  1.00  0.70           N  
ATOM   1953  N   TYR A 259     -20.764  31.976  11.750  1.00  0.67           N  
ATOM   1954  CA  TYR A 259     -19.327  32.109  11.847  1.00  0.67           C  
ATOM   1955  C   TYR A 259     -18.636  32.258  10.488  1.00  0.67           C  
ATOM   1956  O   TYR A 259     -19.042  31.674   9.480  1.00  0.67           O  
ATOM   1957  CB  TYR A 259     -18.773  30.939  12.734  1.00  0.67           C  
ATOM   1958  CG  TYR A 259     -17.327  30.572  12.515  1.00  0.67           C  
ATOM   1959  CD1 TYR A 259     -16.960  29.749  11.434  1.00  0.67           C  
ATOM   1960  CD2 TYR A 259     -16.333  31.048  13.379  1.00  0.67           C  
ATOM   1961  CE1 TYR A 259     -15.620  29.391  11.237  1.00  0.67           C  
ATOM   1962  CE2 TYR A 259     -14.991  30.680  13.194  1.00  0.67           C  
ATOM   1963  CZ  TYR A 259     -14.645  29.828  12.137  1.00  0.67           C  
ATOM   1964  OH  TYR A 259     -13.325  29.367  12.000  1.00  0.67           O  
ATOM   1965  N   ASN A 260     -17.531  33.027  10.480  1.00  0.72           N  
ATOM   1966  CA  ASN A 260     -16.534  33.029   9.441  1.00  0.72           C  
ATOM   1967  C   ASN A 260     -15.260  33.550  10.114  1.00  0.72           C  
ATOM   1968  O   ASN A 260     -15.324  34.176  11.179  1.00  0.72           O  
ATOM   1969  CB  ASN A 260     -17.034  33.908   8.257  1.00  0.72           C  
ATOM   1970  CG  ASN A 260     -16.211  33.703   6.995  1.00  0.72           C  
ATOM   1971  OD1 ASN A 260     -15.239  32.953   6.944  1.00  0.72           O  
ATOM   1972  ND2 ASN A 260     -16.613  34.405   5.910  1.00  0.72           N  
ATOM   1973  N   SER A 261     -14.064  33.299   9.563  1.00  0.76           N  
ATOM   1974  CA  SER A 261     -12.831  33.763  10.166  1.00  0.76           C  
ATOM   1975  C   SER A 261     -11.724  33.919   9.156  1.00  0.76           C  
ATOM   1976  O   SER A 261     -11.722  33.327   8.077  1.00  0.76           O  
ATOM   1977  CB  SER A 261     -12.321  32.884  11.351  1.00  0.76           C  
ATOM   1978  OG  SER A 261     -11.721  31.659  10.922  1.00  0.76           O  
ATOM   1979  N   TRP A 262     -10.742  34.760   9.510  1.00  0.68           N  
ATOM   1980  CA  TRP A 262      -9.597  35.040   8.685  1.00  0.68           C  
ATOM   1981  C   TRP A 262      -8.354  35.024   9.534  1.00  0.68           C  
ATOM   1982  O   TRP A 262      -8.362  35.229  10.748  1.00  0.68           O  
ATOM   1983  CB  TRP A 262      -9.698  36.419   7.975  1.00  0.68           C  
ATOM   1984  CG  TRP A 262     -10.750  36.414   6.880  1.00  0.68           C  
ATOM   1985  CD1 TRP A 262     -10.617  36.032   5.573  1.00  0.68           C  
ATOM   1986  CD2 TRP A 262     -12.151  36.675   7.087  1.00  0.68           C  
ATOM   1987  NE1 TRP A 262     -11.843  36.051   4.939  1.00  0.68           N  
ATOM   1988  CE2 TRP A 262     -12.801  36.436   5.854  1.00  0.68           C  
ATOM   1989  CE3 TRP A 262     -12.868  37.052   8.220  1.00  0.68           C  
ATOM   1990  CZ2 TRP A 262     -14.179  36.588   5.732  1.00  0.68           C  
ATOM   1991  CZ3 TRP A 262     -14.259  37.174   8.100  1.00  0.68           C  
ATOM   1992  CH2 TRP A 262     -14.903  36.972   6.873  1.00  0.68           C  
ATOM   1993  N   HIS A 263      -7.228  34.774   8.862  1.00  0.72           N  
ATOM   1994  CA  HIS A 263      -5.902  34.757   9.420  1.00  0.72           C  
ATOM   1995  C   HIS A 263      -5.099  35.724   8.592  1.00  0.72           C  
ATOM   1996  O   HIS A 263      -4.756  35.438   7.447  1.00  0.72           O  
ATOM   1997  CB  HIS A 263      -5.263  33.356   9.266  1.00  0.72           C  
ATOM   1998  CG  HIS A 263      -5.478  32.489  10.453  1.00  0.72           C  
ATOM   1999  ND1 HIS A 263      -5.822  31.163  10.290  1.00  0.72           N  
ATOM   2000  CD2 HIS A 263      -5.200  32.750  11.753  1.00  0.72           C  
ATOM   2001  CE1 HIS A 263      -5.752  30.638  11.493  1.00  0.72           C  
ATOM   2002  NE2 HIS A 263      -5.381  31.557  12.420  1.00  0.72           N  
ATOM   2003  N   HIS A 264      -4.751  36.895   9.149  1.00  0.72           N  
ATOM   2004  CA  HIS A 264      -4.027  37.919   8.420  1.00  0.72           C  
ATOM   2005  C   HIS A 264      -2.563  37.856   8.791  1.00  0.72           C  
ATOM   2006  O   HIS A 264      -1.997  38.805   9.334  1.00  0.72           O  
ATOM   2007  CB  HIS A 264      -4.534  39.350   8.688  1.00  0.72           C  
ATOM   2008  CG  HIS A 264      -6.010  39.440   8.775  1.00  0.72           C  
ATOM   2009  ND1 HIS A 264      -6.724  39.326   7.607  1.00  0.72           N  
ATOM   2010  CD2 HIS A 264      -6.837  39.703   9.823  1.00  0.72           C  
ATOM   2011  CE1 HIS A 264      -7.978  39.530   7.950  1.00  0.72           C  
ATOM   2012  NE2 HIS A 264      -8.093  39.770   9.274  1.00  0.72           N  
ATOM   2013  N   GLY A 265      -1.923  36.706   8.528  1.00  0.77           N  
ATOM   2014  CA  GLY A 265      -0.515  36.476   8.813  1.00  0.77           C  
ATOM   2015  C   GLY A 265      -0.357  35.366   9.810  1.00  0.77           C  
ATOM   2016  O   GLY A 265      -1.082  34.374   9.761  1.00  0.77           O  
ATOM   2017  N   ASP A 266       0.627  35.490  10.718  1.00  0.74           N  
ATOM   2018  CA  ASP A 266       0.998  34.438  11.646  1.00  0.74           C  
ATOM   2019  C   ASP A 266       0.217  34.531  12.959  1.00  0.74           C  
ATOM   2020  O   ASP A 266      -0.467  33.600  13.376  1.00  0.74           O  
ATOM   2021  CB  ASP A 266       2.517  34.563  11.937  1.00  0.74           C  
ATOM   2022  CG  ASP A 266       3.336  34.266  10.682  1.00  0.74           C  
ATOM   2023  OD1 ASP A 266       3.229  33.141  10.106  1.00  0.74           O  
ATOM   2024  OD2 ASP A 266       4.141  35.159  10.322  1.00  0.74           O  
ATOM   2025  N   PHE A 267       0.281  35.699  13.630  1.00  0.76           N  
ATOM   2026  CA  PHE A 267      -0.274  35.925  14.959  1.00  0.76           C  
ATOM   2027  C   PHE A 267      -1.379  36.944  14.894  1.00  0.76           C  
ATOM   2028  O   PHE A 267      -1.541  37.753  15.810  1.00  0.76           O  
ATOM   2029  CB  PHE A 267       0.766  36.486  15.963  1.00  0.76           C  
ATOM   2030  CG  PHE A 267       1.963  35.599  15.944  1.00  0.76           C  
ATOM   2031  CD1 PHE A 267       1.846  34.310  16.477  1.00  0.76           C  
ATOM   2032  CD2 PHE A 267       3.169  35.990  15.335  1.00  0.76           C  
ATOM   2033  CE1 PHE A 267       2.929  33.430  16.459  1.00  0.76           C  
ATOM   2034  CE2 PHE A 267       4.244  35.091  15.267  1.00  0.76           C  
ATOM   2035  CZ  PHE A 267       4.123  33.819  15.849  1.00  0.76           C  
ATOM   2036  N   ASN A 268      -2.134  37.001  13.794  1.00  0.78           N  
ATOM   2037  CA  ASN A 268      -3.292  37.854  13.720  1.00  0.78           C  
ATOM   2038  C   ASN A 268      -4.427  37.048  13.109  1.00  0.78           C  
ATOM   2039  O   ASN A 268      -4.379  36.618  11.958  1.00  0.78           O  
ATOM   2040  CB  ASN A 268      -2.955  39.130  12.911  1.00  0.78           C  
ATOM   2041  CG  ASN A 268      -4.099  40.126  13.030  1.00  0.78           C  
ATOM   2042  OD1 ASN A 268      -4.696  40.351  14.081  1.00  0.78           O  
ATOM   2043  ND2 ASN A 268      -4.466  40.743  11.889  1.00  0.78           N  
ATOM   2044  N   TYR A 269      -5.486  36.827  13.887  1.00  0.72           N  
ATOM   2045  CA  TYR A 269      -6.659  36.079  13.529  1.00  0.72           C  
ATOM   2046  C   TYR A 269      -7.812  37.014  13.785  1.00  0.72           C  
ATOM   2047  O   TYR A 269      -7.812  37.807  14.729  1.00  0.72           O  
ATOM   2048  CB  TYR A 269      -6.727  34.793  14.410  1.00  0.72           C  
ATOM   2049  CG  TYR A 269      -8.050  34.070  14.402  1.00  0.72           C  
ATOM   2050  CD1 TYR A 269      -8.343  33.110  13.424  1.00  0.72           C  
ATOM   2051  CD2 TYR A 269      -8.992  34.324  15.415  1.00  0.72           C  
ATOM   2052  CE1 TYR A 269      -9.514  32.355  13.500  1.00  0.72           C  
ATOM   2053  CE2 TYR A 269     -10.188  33.596  15.476  1.00  0.72           C  
ATOM   2054  CZ  TYR A 269     -10.440  32.596  14.518  1.00  0.72           C  
ATOM   2055  OH  TYR A 269     -11.630  31.835  14.527  1.00  0.72           O  
ATOM   2056  N   GLU A 270      -8.850  36.939  12.954  1.00  0.76           N  
ATOM   2057  CA  GLU A 270     -10.084  37.574  13.293  1.00  0.76           C  
ATOM   2058  C   GLU A 270     -11.202  36.655  12.945  1.00  0.76           C  
ATOM   2059  O   GLU A 270     -11.086  35.768  12.105  1.00  0.76           O  
ATOM   2060  CB  GLU A 270     -10.313  38.948  12.634  1.00  0.76           C  
ATOM   2061  CG  GLU A 270     -10.733  38.938  11.152  1.00  0.76           C  
ATOM   2062  CD  GLU A 270     -11.087  40.377  10.845  1.00  0.76           C  
ATOM   2063  OE1 GLU A 270     -10.172  41.123  10.404  1.00  0.76           O  
ATOM   2064  OE2 GLU A 270     -12.194  40.819  11.243  1.00  0.76           O  
ATOM   2065  N   ARG A 271     -12.337  36.838  13.606  1.00  0.73           N  
ATOM   2066  CA  ARG A 271     -13.492  36.032  13.372  1.00  0.73           C  
ATOM   2067  C   ARG A 271     -14.684  36.907  13.508  1.00  0.73           C  
ATOM   2068  O   ARG A 271     -14.768  37.764  14.389  1.00  0.73           O  
ATOM   2069  CB  ARG A 271     -13.549  34.904  14.425  1.00  0.73           C  
ATOM   2070  CG  ARG A 271     -14.861  34.083  14.533  1.00  0.73           C  
ATOM   2071  CD  ARG A 271     -15.064  33.436  15.913  1.00  0.73           C  
ATOM   2072  NE  ARG A 271     -13.784  32.716  16.206  1.00  0.73           N  
ATOM   2073  CZ  ARG A 271     -13.459  32.162  17.379  1.00  0.73           C  
ATOM   2074  NH1 ARG A 271     -14.305  32.113  18.402  1.00  0.73           N  
ATOM   2075  NH2 ARG A 271     -12.249  31.676  17.669  1.00  0.73           N  
ATOM   2076  N   GLN A 272     -15.651  36.675  12.620  1.00  0.79           N  
ATOM   2077  CA  GLN A 272     -16.894  37.372  12.621  1.00  0.79           C  
ATOM   2078  C   GLN A 272     -17.986  36.364  12.873  1.00  0.79           C  
ATOM   2079  O   GLN A 272     -18.039  35.305  12.251  1.00  0.79           O  
ATOM   2080  CB  GLN A 272     -17.089  38.126  11.297  1.00  0.79           C  
ATOM   2081  CG  GLN A 272     -15.903  39.080  11.031  1.00  0.79           C  
ATOM   2082  CD  GLN A 272     -16.225  39.983   9.850  1.00  0.79           C  
ATOM   2083  OE1 GLN A 272     -16.774  39.560   8.832  1.00  0.79           O  
ATOM   2084  NE2 GLN A 272     -15.886  41.282   9.987  1.00  0.79           N  
ATOM   2085  N   ALA A 273     -18.864  36.652  13.841  1.00  0.82           N  
ATOM   2086  CA  ALA A 273     -20.006  35.822  14.126  1.00  0.82           C  
ATOM   2087  C   ALA A 273     -21.209  36.720  13.918  1.00  0.82           C  
ATOM   2088  O   ALA A 273     -21.494  37.629  14.709  1.00  0.82           O  
ATOM   2089  CB  ALA A 273     -19.900  35.230  15.552  1.00  0.82           C  
ATOM   2090  N   THR A 274     -21.936  36.525  12.799  1.00  0.79           N  
ATOM   2091  CA  THR A 274     -23.136  37.302  12.521  1.00  0.79           C  
ATOM   2092  C   THR A 274     -24.316  36.692  13.236  1.00  0.79           C  
ATOM   2093  O   THR A 274     -24.514  35.477  13.240  1.00  0.79           O  
ATOM   2094  CB  THR A 274     -23.420  37.732  11.063  1.00  0.79           C  
ATOM   2095  OG1 THR A 274     -24.314  36.922  10.320  1.00  0.79           O  
ATOM   2096  CG2 THR A 274     -22.128  37.748  10.237  1.00  0.79           C  
ATOM   2097  N   LEU A 275     -25.111  37.515  13.923  1.00  0.79           N  
ATOM   2098  CA  LEU A 275     -26.324  37.094  14.591  1.00  0.79           C  
ATOM   2099  C   LEU A 275     -27.446  37.650  13.741  1.00  0.79           C  
ATOM   2100  O   LEU A 275     -27.394  38.805  13.315  1.00  0.79           O  
ATOM   2101  CB  LEU A 275     -26.390  37.655  16.042  1.00  0.79           C  
ATOM   2102  CG  LEU A 275     -27.331  36.956  17.052  1.00  0.79           C  
ATOM   2103  CD1 LEU A 275     -28.826  37.210  16.785  1.00  0.79           C  
ATOM   2104  CD2 LEU A 275     -27.003  35.464  17.212  1.00  0.79           C  
ATOM   2105  N   THR A 276     -28.480  36.847  13.431  1.00  0.80           N  
ATOM   2106  CA  THR A 276     -29.606  37.326  12.639  1.00  0.80           C  
ATOM   2107  C   THR A 276     -30.904  36.774  13.192  1.00  0.80           C  
ATOM   2108  O   THR A 276     -30.960  35.694  13.792  1.00  0.80           O  
ATOM   2109  CB  THR A 276     -29.470  37.226  11.089  1.00  0.80           C  
ATOM   2110  OG1 THR A 276     -30.510  36.543  10.399  1.00  0.80           O  
ATOM   2111  CG2 THR A 276     -28.175  36.505  10.684  1.00  0.80           C  
ATOM   2112  N   ILE A 277     -31.985  37.561  13.055  1.00  0.76           N  
ATOM   2113  CA  ILE A 277     -33.363  37.147  13.259  1.00  0.76           C  
ATOM   2114  C   ILE A 277     -34.121  37.654  12.041  1.00  0.76           C  
ATOM   2115  O   ILE A 277     -34.226  38.861  11.839  1.00  0.76           O  
ATOM   2116  CB  ILE A 277     -33.989  37.716  14.543  1.00  0.76           C  
ATOM   2117  CG1 ILE A 277     -33.269  37.150  15.795  1.00  0.76           C  
ATOM   2118  CG2 ILE A 277     -35.530  37.519  14.584  1.00  0.76           C  
ATOM   2119  CD1 ILE A 277     -33.673  37.877  17.084  1.00  0.76           C  
ATOM   2120  N   SER A 278     -34.663  36.730  11.213  1.00  0.74           N  
ATOM   2121  CA  SER A 278     -35.382  37.009   9.958  1.00  0.74           C  
ATOM   2122  C   SER A 278     -36.625  37.876  10.118  1.00  0.74           C  
ATOM   2123  O   SER A 278     -36.834  38.871   9.436  1.00  0.74           O  
ATOM   2124  CB  SER A 278     -35.803  35.651   9.298  1.00  0.74           C  
ATOM   2125  OG  SER A 278     -36.469  35.768   8.041  1.00  0.74           O  
ATOM   2126  N   SER A 279     -37.481  37.560  11.100  1.00  0.72           N  
ATOM   2127  CA  SER A 279     -38.662  38.356  11.365  1.00  0.72           C  
ATOM   2128  C   SER A 279     -38.500  38.827  12.784  1.00  0.72           C  
ATOM   2129  O   SER A 279     -38.657  38.042  13.725  1.00  0.72           O  
ATOM   2130  CB  SER A 279     -39.945  37.494  11.153  1.00  0.72           C  
ATOM   2131  OG  SER A 279     -41.156  38.121  11.585  1.00  0.72           O  
ATOM   2132  N   ALA A 280     -38.127  40.109  12.975  1.00  0.79           N  
ATOM   2133  CA  ALA A 280     -38.046  40.769  14.259  1.00  0.79           C  
ATOM   2134  C   ALA A 280     -39.421  40.960  14.867  1.00  0.79           C  
ATOM   2135  O   ALA A 280     -40.288  41.623  14.303  1.00  0.79           O  
ATOM   2136  CB  ALA A 280     -37.383  42.159  14.116  1.00  0.79           C  
ATOM   2137  N   ARG A 281     -39.649  40.397  16.057  1.00  0.65           N  
ATOM   2138  CA  ARG A 281     -40.897  40.515  16.767  1.00  0.65           C  
ATOM   2139  C   ARG A 281     -40.649  41.245  18.072  1.00  0.65           C  
ATOM   2140  O   ARG A 281     -39.568  41.154  18.646  1.00  0.65           O  
ATOM   2141  CB  ARG A 281     -41.493  39.116  17.058  1.00  0.65           C  
ATOM   2142  CG  ARG A 281     -42.096  38.462  15.794  1.00  0.65           C  
ATOM   2143  CD  ARG A 281     -43.308  37.549  16.057  1.00  0.65           C  
ATOM   2144  NE  ARG A 281     -42.841  36.131  16.307  1.00  0.65           N  
ATOM   2145  CZ  ARG A 281     -42.450  35.619  17.483  1.00  0.65           C  
ATOM   2146  NH1 ARG A 281     -42.370  36.362  18.575  1.00  0.65           N  
ATOM   2147  NH2 ARG A 281     -42.072  34.341  17.557  1.00  0.65           N  
ATOM   2148  N   VAL A 282     -41.645  41.982  18.609  1.00  0.70           N  
ATOM   2149  CA  VAL A 282     -41.565  42.722  19.875  1.00  0.70           C  
ATOM   2150  C   VAL A 282     -40.885  42.024  21.052  1.00  0.70           C  
ATOM   2151  O   VAL A 282     -40.073  42.627  21.749  1.00  0.70           O  
ATOM   2152  CB  VAL A 282     -42.953  43.144  20.342  1.00  0.70           C  
ATOM   2153  CG1 VAL A 282     -43.353  44.400  19.545  1.00  0.70           C  
ATOM   2154  CG2 VAL A 282     -43.983  41.996  20.186  1.00  0.70           C  
ATOM   2155  N   ASN A 283     -41.200  40.733  21.269  1.00  0.70           N  
ATOM   2156  CA  ASN A 283     -40.696  39.854  22.313  1.00  0.70           C  
ATOM   2157  C   ASN A 283     -39.175  39.593  22.256  1.00  0.70           C  
ATOM   2158  O   ASN A 283     -38.573  39.241  23.271  1.00  0.70           O  
ATOM   2159  CB  ASN A 283     -41.458  38.492  22.204  1.00  0.70           C  
ATOM   2160  CG  ASN A 283     -41.365  37.685  23.501  1.00  0.70           C  
ATOM   2161  OD1 ASN A 283     -41.617  38.191  24.591  1.00  0.70           O  
ATOM   2162  ND2 ASN A 283     -41.052  36.371  23.401  1.00  0.70           N  
ATOM   2163  N   ASP A 284     -38.528  39.685  21.071  1.00  0.74           N  
ATOM   2164  CA  ASP A 284     -37.114  39.395  20.851  1.00  0.74           C  
ATOM   2165  C   ASP A 284     -36.155  40.261  21.659  1.00  0.74           C  
ATOM   2166  O   ASP A 284     -35.120  39.776  22.142  1.00  0.74           O  
ATOM   2167  CB  ASP A 284     -36.731  39.667  19.372  1.00  0.74           C  
ATOM   2168  CG  ASP A 284     -37.195  38.536  18.474  1.00  0.74           C  
ATOM   2169  OD1 ASP A 284     -37.070  37.355  18.896  1.00  0.74           O  
ATOM   2170  OD2 ASP A 284     -37.626  38.850  17.334  1.00  0.74           O  
ATOM   2171  N   SER A 285     -36.472  41.568  21.709  1.00  0.77           N  
ATOM   2172  CA  SER A 285     -35.831  42.676  22.404  1.00  0.77           C  
ATOM   2173  C   SER A 285     -35.095  42.403  23.693  1.00  0.77           C  
ATOM   2174  O   SER A 285     -35.570  41.814  24.660  1.00  0.77           O  
ATOM   2175  CB  SER A 285     -36.724  43.935  22.566  1.00  0.77           C  
ATOM   2176  OG  SER A 285     -37.844  43.721  23.419  1.00  0.77           O  
ATOM   2177  N   GLY A 286     -33.849  42.879  23.742  1.00  0.78           N  
ATOM   2178  CA  GLY A 286     -33.041  42.675  24.907  1.00  0.78           C  
ATOM   2179  C   GLY A 286     -31.651  43.023  24.553  1.00  0.78           C  
ATOM   2180  O   GLY A 286     -31.359  43.587  23.496  1.00  0.78           O  
ATOM   2181  N   VAL A 287     -30.740  42.702  25.466  1.00  0.79           N  
ATOM   2182  CA  VAL A 287     -29.348  42.959  25.277  1.00  0.79           C  
ATOM   2183  C   VAL A 287     -28.711  41.718  24.660  1.00  0.79           C  
ATOM   2184  O   VAL A 287     -28.948  40.583  25.094  1.00  0.79           O  
ATOM   2185  CB  VAL A 287     -28.685  43.384  26.580  1.00  0.79           C  
ATOM   2186  CG1 VAL A 287     -27.421  44.123  26.165  1.00  0.79           C  
ATOM   2187  CG2 VAL A 287     -29.581  44.330  27.423  1.00  0.79           C  
ATOM   2188  N   PHE A 288     -27.918  41.881  23.590  1.00  0.79           N  
ATOM   2189  CA  PHE A 288     -27.092  40.828  23.045  1.00  0.79           C  
ATOM   2190  C   PHE A 288     -25.661  41.196  23.385  1.00  0.79           C  
ATOM   2191  O   PHE A 288     -25.157  42.251  23.001  1.00  0.79           O  
ATOM   2192  CB  PHE A 288     -27.230  40.685  21.504  1.00  0.79           C  
ATOM   2193  CG  PHE A 288     -28.619  40.250  21.141  1.00  0.79           C  
ATOM   2194  CD1 PHE A 288     -28.981  38.899  21.271  1.00  0.79           C  
ATOM   2195  CD2 PHE A 288     -29.558  41.171  20.637  1.00  0.79           C  
ATOM   2196  CE1 PHE A 288     -30.257  38.466  20.881  1.00  0.79           C  
ATOM   2197  CE2 PHE A 288     -30.839  40.740  20.258  1.00  0.79           C  
ATOM   2198  CZ  PHE A 288     -31.188  39.387  20.375  1.00  0.79           C  
ATOM   2199  N   MET A 289     -24.953  40.329  24.125  1.00  0.77           N  
ATOM   2200  CA  MET A 289     -23.572  40.568  24.497  1.00  0.77           C  
ATOM   2201  C   MET A 289     -22.669  39.642  23.707  1.00  0.77           C  
ATOM   2202  O   MET A 289     -22.898  38.435  23.617  1.00  0.77           O  
ATOM   2203  CB  MET A 289     -23.360  40.396  26.029  1.00  0.77           C  
ATOM   2204  CG  MET A 289     -21.943  39.938  26.470  1.00  0.77           C  
ATOM   2205  SD  MET A 289     -21.538  40.222  28.223  1.00  0.77           S  
ATOM   2206  CE  MET A 289     -22.870  39.226  28.933  1.00  0.77           C  
ATOM   2207  N   CYS A 290     -21.601  40.205  23.106  1.00  0.84           N  
ATOM   2208  CA  CYS A 290     -20.544  39.449  22.479  1.00  0.84           C  
ATOM   2209  C   CYS A 290     -19.438  39.282  23.497  1.00  0.84           C  
ATOM   2210  O   CYS A 290     -18.790  40.249  23.896  1.00  0.84           O  
ATOM   2211  CB  CYS A 290     -19.973  40.155  21.230  1.00  0.84           C  
ATOM   2212  SG  CYS A 290     -18.919  39.014  20.284  1.00  0.84           S  
ATOM   2213  N   TYR A 291     -19.219  38.045  23.961  1.00  0.79           N  
ATOM   2214  CA  TYR A 291     -18.210  37.702  24.936  1.00  0.79           C  
ATOM   2215  C   TYR A 291     -17.031  37.103  24.190  1.00  0.79           C  
ATOM   2216  O   TYR A 291     -17.193  36.346  23.230  1.00  0.79           O  
ATOM   2217  CB  TYR A 291     -18.787  36.679  25.962  1.00  0.79           C  
ATOM   2218  CG  TYR A 291     -17.826  36.338  27.076  1.00  0.79           C  
ATOM   2219  CD1 TYR A 291     -17.520  37.296  28.056  1.00  0.79           C  
ATOM   2220  CD2 TYR A 291     -17.246  35.057  27.170  1.00  0.79           C  
ATOM   2221  CE1 TYR A 291     -16.674  36.979  29.126  1.00  0.79           C  
ATOM   2222  CE2 TYR A 291     -16.413  34.728  28.253  1.00  0.79           C  
ATOM   2223  CZ  TYR A 291     -16.139  35.690  29.236  1.00  0.79           C  
ATOM   2224  OH  TYR A 291     -15.331  35.392  30.354  1.00  0.79           O  
ATOM   2225  N   ALA A 292     -15.811  37.441  24.628  1.00  0.84           N  
ATOM   2226  CA  ALA A 292     -14.575  36.914  24.121  1.00  0.84           C  
ATOM   2227  C   ALA A 292     -13.677  36.552  25.280  1.00  0.84           C  
ATOM   2228  O   ALA A 292     -13.663  37.229  26.303  1.00  0.84           O  
ATOM   2229  CB  ALA A 292     -13.865  37.987  23.286  1.00  0.84           C  
ATOM   2230  N   ASN A 293     -12.913  35.457  25.175  1.00  0.76           N  
ATOM   2231  CA  ASN A 293     -12.110  34.983  26.277  1.00  0.76           C  
ATOM   2232  C   ASN A 293     -10.891  34.267  25.730  1.00  0.76           C  
ATOM   2233  O   ASN A 293     -10.958  33.574  24.713  1.00  0.76           O  
ATOM   2234  CB  ASN A 293     -13.013  34.038  27.119  1.00  0.76           C  
ATOM   2235  CG  ASN A 293     -12.376  33.557  28.415  1.00  0.76           C  
ATOM   2236  OD1 ASN A 293     -11.725  34.313  29.127  1.00  0.76           O  
ATOM   2237  ND2 ASN A 293     -12.605  32.276  28.783  1.00  0.76           N  
ATOM   2238  N   ASN A 294      -9.752  34.398  26.421  1.00  0.70           N  
ATOM   2239  CA  ASN A 294      -8.546  33.663  26.146  1.00  0.70           C  
ATOM   2240  C   ASN A 294      -7.945  33.343  27.524  1.00  0.70           C  
ATOM   2241  O   ASN A 294      -8.525  33.696  28.551  1.00  0.70           O  
ATOM   2242  CB  ASN A 294      -7.613  34.376  25.093  1.00  0.70           C  
ATOM   2243  CG  ASN A 294      -7.132  35.781  25.477  1.00  0.70           C  
ATOM   2244  OD1 ASN A 294      -6.968  36.070  26.662  1.00  0.70           O  
ATOM   2245  ND2 ASN A 294      -6.825  36.664  24.494  1.00  0.70           N  
ATOM   2246  N   THR A 295      -6.815  32.608  27.615  1.00  0.62           N  
ATOM   2247  CA  THR A 295      -6.127  32.300  28.890  1.00  0.62           C  
ATOM   2248  C   THR A 295      -5.617  33.544  29.617  1.00  0.62           C  
ATOM   2249  O   THR A 295      -5.589  33.573  30.844  1.00  0.62           O  
ATOM   2250  CB  THR A 295      -5.103  31.120  28.830  1.00  0.62           C  
ATOM   2251  OG1 THR A 295      -3.920  31.246  29.608  1.00  0.62           O  
ATOM   2252  CG2 THR A 295      -4.577  30.907  27.412  1.00  0.62           C  
ATOM   2253  N   PHE A 296      -5.248  34.629  28.897  1.00  0.57           N  
ATOM   2254  CA  PHE A 296      -4.902  35.894  29.523  1.00  0.57           C  
ATOM   2255  C   PHE A 296      -6.086  36.584  30.211  1.00  0.57           C  
ATOM   2256  O   PHE A 296      -5.999  37.019  31.358  1.00  0.57           O  
ATOM   2257  CB  PHE A 296      -4.333  36.830  28.430  1.00  0.57           C  
ATOM   2258  CG  PHE A 296      -3.777  38.086  29.016  1.00  0.57           C  
ATOM   2259  CD1 PHE A 296      -4.578  39.235  29.115  1.00  0.57           C  
ATOM   2260  CD2 PHE A 296      -2.453  38.120  29.470  1.00  0.57           C  
ATOM   2261  CE1 PHE A 296      -4.035  40.435  29.587  1.00  0.57           C  
ATOM   2262  CE2 PHE A 296      -1.905  39.318  29.947  1.00  0.57           C  
ATOM   2263  CZ  PHE A 296      -2.690  40.481  29.985  1.00  0.57           C  
ATOM   2264  N   GLY A 297      -7.237  36.703  29.522  1.00  0.67           N  
ATOM   2265  CA  GLY A 297      -8.407  37.310  30.134  1.00  0.67           C  
ATOM   2266  C   GLY A 297      -9.576  37.390  29.194  1.00  0.67           C  
ATOM   2267  O   GLY A 297      -9.566  36.841  28.093  1.00  0.67           O  
ATOM   2268  N   SER A 298     -10.644  38.106  29.601  1.00  0.71           N  
ATOM   2269  CA  SER A 298     -11.888  38.154  28.849  1.00  0.71           C  
ATOM   2270  C   SER A 298     -12.401  39.554  28.587  1.00  0.71           C  
ATOM   2271  O   SER A 298     -12.124  40.500  29.322  1.00  0.71           O  
ATOM   2272  CB  SER A 298     -12.992  37.291  29.514  1.00  0.71           C  
ATOM   2273  OG  SER A 298     -13.720  37.915  30.573  1.00  0.71           O  
ATOM   2274  N   ALA A 299     -13.160  39.734  27.492  1.00  0.76           N  
ATOM   2275  CA  ALA A 299     -13.639  41.035  27.093  1.00  0.76           C  
ATOM   2276  C   ALA A 299     -15.043  40.880  26.563  1.00  0.76           C  
ATOM   2277  O   ALA A 299     -15.414  39.846  26.005  1.00  0.76           O  
ATOM   2278  CB  ALA A 299     -12.730  41.671  26.014  1.00  0.76           C  
ATOM   2279  N   ASN A 300     -15.896  41.898  26.748  1.00  0.78           N  
ATOM   2280  CA  ASN A 300     -17.240  41.836  26.236  1.00  0.78           C  
ATOM   2281  C   ASN A 300     -17.633  43.157  25.614  1.00  0.78           C  
ATOM   2282  O   ASN A 300     -17.099  44.211  25.964  1.00  0.78           O  
ATOM   2283  CB  ASN A 300     -18.268  41.332  27.297  1.00  0.78           C  
ATOM   2284  CG  ASN A 300     -18.377  42.204  28.551  1.00  0.78           C  
ATOM   2285  OD1 ASN A 300     -18.797  43.359  28.501  1.00  0.78           O  
ATOM   2286  ND2 ASN A 300     -18.043  41.643  29.737  1.00  0.78           N  
ATOM   2287  N   VAL A 301     -18.562  43.112  24.641  1.00  0.79           N  
ATOM   2288  CA  VAL A 301     -19.170  44.290  24.041  1.00  0.79           C  
ATOM   2289  C   VAL A 301     -20.638  44.007  23.894  1.00  0.79           C  
ATOM   2290  O   VAL A 301     -21.072  42.916  23.519  1.00  0.79           O  
ATOM   2291  CB  VAL A 301     -18.580  44.697  22.687  1.00  0.79           C  
ATOM   2292  CG1 VAL A 301     -19.308  45.883  22.007  1.00  0.79           C  
ATOM   2293  CG2 VAL A 301     -17.149  45.183  22.952  1.00  0.79           C  
ATOM   2294  N   THR A 302     -21.454  45.005  24.241  1.00  0.78           N  
ATOM   2295  CA  THR A 302     -22.890  44.896  24.311  1.00  0.78           C  
ATOM   2296  C   THR A 302     -23.560  45.647  23.173  1.00  0.78           C  
ATOM   2297  O   THR A 302     -23.075  46.672  22.689  1.00  0.78           O  
ATOM   2298  CB  THR A 302     -23.390  45.335  25.681  1.00  0.78           C  
ATOM   2299  OG1 THR A 302     -24.778  45.156  25.791  1.00  0.78           O  
ATOM   2300  CG2 THR A 302     -23.147  46.814  26.007  1.00  0.78           C  
ATOM   2301  N   THR A 303     -24.689  45.104  22.682  1.00  0.80           N  
ATOM   2302  CA  THR A 303     -25.592  45.765  21.753  1.00  0.80           C  
ATOM   2303  C   THR A 303     -27.020  45.590  22.253  1.00  0.80           C  
ATOM   2304  O   THR A 303     -27.477  44.483  22.551  1.00  0.80           O  
ATOM   2305  CB  THR A 303     -25.405  45.318  20.296  1.00  0.80           C  
ATOM   2306  OG1 THR A 303     -26.326  45.944  19.414  1.00  0.80           O  
ATOM   2307  CG2 THR A 303     -25.549  43.801  20.103  1.00  0.80           C  
ATOM   2308  N   THR A 304     -27.770  46.703  22.418  1.00  0.79           N  
ATOM   2309  CA  THR A 304     -29.169  46.672  22.842  1.00  0.79           C  
ATOM   2310  C   THR A 304     -30.073  46.729  21.623  1.00  0.79           C  
ATOM   2311  O   THR A 304     -29.780  47.364  20.606  1.00  0.79           O  
ATOM   2312  CB  THR A 304     -29.607  47.701  23.910  1.00  0.79           C  
ATOM   2313  OG1 THR A 304     -29.745  49.030  23.435  1.00  0.79           O  
ATOM   2314  CG2 THR A 304     -28.574  47.807  25.043  1.00  0.79           C  
ATOM   2315  N   LEU A 305     -31.201  46.010  21.658  1.00  0.79           N  
ATOM   2316  CA  LEU A 305     -32.130  45.975  20.552  1.00  0.79           C  
ATOM   2317  C   LEU A 305     -33.520  46.143  21.128  1.00  0.79           C  
ATOM   2318  O   LEU A 305     -33.924  45.385  22.009  1.00  0.79           O  
ATOM   2319  CB  LEU A 305     -31.907  44.628  19.802  1.00  0.79           C  
ATOM   2320  CG  LEU A 305     -32.923  44.154  18.724  1.00  0.79           C  
ATOM   2321  CD1 LEU A 305     -34.111  43.372  19.297  1.00  0.79           C  
ATOM   2322  CD2 LEU A 305     -33.458  45.225  17.761  1.00  0.79           C  
ATOM   2323  N   GLU A 306     -34.295  47.145  20.659  1.00  0.77           N  
ATOM   2324  CA  GLU A 306     -35.692  47.287  21.018  1.00  0.77           C  
ATOM   2325  C   GLU A 306     -36.529  47.230  19.746  1.00  0.77           C  
ATOM   2326  O   GLU A 306     -36.227  47.861  18.734  1.00  0.77           O  
ATOM   2327  CB  GLU A 306     -35.973  48.535  21.893  1.00  0.77           C  
ATOM   2328  CG  GLU A 306     -35.940  49.909  21.181  1.00  0.77           C  
ATOM   2329  CD  GLU A 306     -36.124  51.042  22.192  1.00  0.77           C  
ATOM   2330  OE1 GLU A 306     -36.817  50.815  23.218  1.00  0.77           O  
ATOM   2331  OE2 GLU A 306     -35.564  52.137  21.943  1.00  0.77           O  
ATOM   2332  N   VAL A 307     -37.593  46.403  19.727  1.00  0.75           N  
ATOM   2333  CA  VAL A 307     -38.460  46.240  18.572  1.00  0.75           C  
ATOM   2334  C   VAL A 307     -39.808  46.808  18.971  1.00  0.75           C  
ATOM   2335  O   VAL A 307     -40.364  46.436  20.005  1.00  0.75           O  
ATOM   2336  CB  VAL A 307     -38.643  44.772  18.167  1.00  0.75           C  
ATOM   2337  CG1 VAL A 307     -39.630  44.636  16.987  1.00  0.75           C  
ATOM   2338  CG2 VAL A 307     -37.289  44.142  17.786  1.00  0.75           C  
ATOM   2339  N   VAL A 308     -40.358  47.735  18.172  1.00  0.70           N  
ATOM   2340  CA  VAL A 308     -41.645  48.374  18.388  1.00  0.70           C  
ATOM   2341  C   VAL A 308     -42.553  48.026  17.197  1.00  0.70           C  
ATOM   2342  O   VAL A 308     -42.075  47.867  16.076  1.00  0.70           O  
ATOM   2343  CB  VAL A 308     -41.426  49.881  18.554  1.00  0.70           C  
ATOM   2344  CG1 VAL A 308     -42.761  50.632  18.572  1.00  0.70           C  
ATOM   2345  CG2 VAL A 308     -40.687  50.139  19.882  1.00  0.70           C  
ATOM   2346  N   ASP A 309     -43.879  47.839  17.379  1.00  0.66           N  
ATOM   2347  CA  ASP A 309     -44.821  47.440  16.341  1.00  0.66           C  
ATOM   2348  C   ASP A 309     -45.548  48.619  15.672  1.00  0.66           C  
ATOM   2349  O   ASP A 309     -46.142  48.504  14.600  1.00  0.66           O  
ATOM   2350  CB  ASP A 309     -45.835  46.450  16.995  1.00  0.66           C  
ATOM   2351  CG  ASP A 309     -46.572  47.013  18.215  1.00  0.66           C  
ATOM   2352  OD1 ASP A 309     -47.411  46.273  18.780  1.00  0.66           O  
ATOM   2353  OD2 ASP A 309     -46.295  48.178  18.615  1.00  0.66           O  
ATOM   2354  N   LYS A 310     -45.468  49.812  16.275  1.00  0.69           N  
ATOM   2355  CA  LYS A 310     -46.121  51.017  15.830  1.00  0.69           C  
ATOM   2356  C   LYS A 310     -45.106  52.123  15.838  1.00  0.69           C  
ATOM   2357  O   LYS A 310     -44.462  52.372  16.854  1.00  0.69           O  
ATOM   2358  CB  LYS A 310     -47.266  51.388  16.824  1.00  0.69           C  
ATOM   2359  CG  LYS A 310     -48.619  50.846  16.337  1.00  0.69           C  
ATOM   2360  CD  LYS A 310     -49.229  51.759  15.250  1.00  0.69           C  
ATOM   2361  CE  LYS A 310     -50.135  52.872  15.791  1.00  0.69           C  
ATOM   2362  NZ  LYS A 310     -51.385  52.245  16.269  1.00  0.69           N  
ATOM   2363  N   GLY A 311     -44.932  52.883  14.736  1.00  0.76           N  
ATOM   2364  CA  GLY A 311     -44.260  54.172  14.837  1.00  0.76           C  
ATOM   2365  C   GLY A 311     -44.870  55.071  15.878  1.00  0.76           C  
ATOM   2366  O   GLY A 311     -46.084  55.078  16.082  1.00  0.76           O  
ATOM   2367  N   PHE A 312     -44.045  55.824  16.605  1.00  0.74           N  
ATOM   2368  CA  PHE A 312     -44.470  56.420  17.844  1.00  0.74           C  
ATOM   2369  C   PHE A 312     -43.833  57.782  17.991  1.00  0.74           C  
ATOM   2370  O   PHE A 312     -42.771  58.068  17.430  1.00  0.74           O  
ATOM   2371  CB  PHE A 312     -44.197  55.497  19.082  1.00  0.74           C  
ATOM   2372  CG  PHE A 312     -42.781  55.606  19.616  1.00  0.74           C  
ATOM   2373  CD1 PHE A 312     -41.669  54.963  19.036  1.00  0.74           C  
ATOM   2374  CD2 PHE A 312     -42.569  56.493  20.685  1.00  0.74           C  
ATOM   2375  CE1 PHE A 312     -40.386  55.157  19.581  1.00  0.74           C  
ATOM   2376  CE2 PHE A 312     -41.288  56.737  21.183  1.00  0.74           C  
ATOM   2377  CZ  PHE A 312     -40.200  56.043  20.649  1.00  0.74           C  
ATOM   2378  N   ILE A 313     -44.507  58.658  18.756  1.00  0.77           N  
ATOM   2379  CA  ILE A 313     -44.013  59.972  19.100  1.00  0.77           C  
ATOM   2380  C   ILE A 313     -44.540  60.286  20.499  1.00  0.77           C  
ATOM   2381  O   ILE A 313     -45.720  60.065  20.772  1.00  0.77           O  
ATOM   2382  CB  ILE A 313     -44.473  61.086  18.137  1.00  0.77           C  
ATOM   2383  CG1 ILE A 313     -44.107  60.784  16.663  1.00  0.77           C  
ATOM   2384  CG2 ILE A 313     -43.850  62.440  18.567  1.00  0.77           C  
ATOM   2385  CD1 ILE A 313     -44.781  61.719  15.657  1.00  0.77           C  
ATOM   2386  N   ASN A 314     -43.707  60.845  21.409  1.00  0.79           N  
ATOM   2387  CA  ASN A 314     -44.172  61.420  22.672  1.00  0.79           C  
ATOM   2388  C   ASN A 314     -43.441  62.729  22.989  1.00  0.79           C  
ATOM   2389  O   ASN A 314     -42.235  62.865  22.792  1.00  0.79           O  
ATOM   2390  CB  ASN A 314     -44.188  60.488  23.942  1.00  0.79           C  
ATOM   2391  CG  ASN A 314     -43.478  59.136  23.788  1.00  0.79           C  
ATOM   2392  OD1 ASN A 314     -43.981  58.252  23.094  1.00  0.79           O  
ATOM   2393  ND2 ASN A 314     -42.343  58.920  24.490  1.00  0.79           N  
ATOM   2394  N   ILE A 315     -44.198  63.747  23.467  1.00  0.80           N  
ATOM   2395  CA  ILE A 315     -43.753  65.119  23.710  1.00  0.80           C  
ATOM   2396  C   ILE A 315     -43.327  65.321  25.158  1.00  0.80           C  
ATOM   2397  O   ILE A 315     -43.854  64.682  26.070  1.00  0.80           O  
ATOM   2398  CB  ILE A 315     -44.841  66.153  23.364  1.00  0.80           C  
ATOM   2399  CG1 ILE A 315     -45.506  65.894  21.988  1.00  0.80           C  
ATOM   2400  CG2 ILE A 315     -44.289  67.601  23.371  1.00  0.80           C  
ATOM   2401  CD1 ILE A 315     -44.532  65.936  20.800  1.00  0.80           C  
ATOM   2402  N   PHE A 316     -42.380  66.246  25.409  1.00  0.76           N  
ATOM   2403  CA  PHE A 316     -41.939  66.726  26.708  1.00  0.76           C  
ATOM   2404  C   PHE A 316     -41.858  68.269  26.705  1.00  0.76           C  
ATOM   2405  O   PHE A 316     -40.819  68.804  26.303  1.00  0.76           O  
ATOM   2406  CB  PHE A 316     -40.532  66.145  27.025  1.00  0.76           C  
ATOM   2407  CG  PHE A 316     -40.691  64.658  27.189  1.00  0.76           C  
ATOM   2408  CD1 PHE A 316     -41.401  64.164  28.298  1.00  0.76           C  
ATOM   2409  CD2 PHE A 316     -40.307  63.764  26.169  1.00  0.76           C  
ATOM   2410  CE1 PHE A 316     -41.715  62.802  28.393  1.00  0.76           C  
ATOM   2411  CE2 PHE A 316     -40.607  62.395  26.272  1.00  0.76           C  
ATOM   2412  CZ  PHE A 316     -41.302  61.913  27.391  1.00  0.76           C  
ATOM   2413  N   PRO A 317     -42.868  69.067  27.101  1.00  0.78           N  
ATOM   2414  CA  PRO A 317     -42.676  70.483  27.470  1.00  0.78           C  
ATOM   2415  C   PRO A 317     -41.605  70.753  28.521  1.00  0.78           C  
ATOM   2416  O   PRO A 317     -41.525  70.011  29.497  1.00  0.78           O  
ATOM   2417  CB  PRO A 317     -44.063  70.953  27.948  1.00  0.78           C  
ATOM   2418  CG  PRO A 317     -44.732  69.663  28.441  1.00  0.78           C  
ATOM   2419  CD  PRO A 317     -44.203  68.587  27.487  1.00  0.78           C  
ATOM   2420  N   MET A 318     -40.788  71.818  28.355  1.00  0.71           N  
ATOM   2421  CA  MET A 318     -39.656  72.098  29.234  1.00  0.71           C  
ATOM   2422  C   MET A 318     -39.908  73.247  30.191  1.00  0.71           C  
ATOM   2423  O   MET A 318     -39.024  73.681  30.928  1.00  0.71           O  
ATOM   2424  CB  MET A 318     -38.366  72.345  28.406  1.00  0.71           C  
ATOM   2425  CG  MET A 318     -37.310  71.250  28.661  1.00  0.71           C  
ATOM   2426  SD  MET A 318     -37.678  69.672  27.821  1.00  0.71           S  
ATOM   2427  CE  MET A 318     -38.318  68.736  29.240  1.00  0.71           C  
ATOM   2428  N   ILE A 319     -41.145  73.750  30.229  1.00  0.69           N  
ATOM   2429  CA  ILE A 319     -41.580  74.838  31.069  1.00  0.69           C  
ATOM   2430  C   ILE A 319     -43.016  74.457  31.373  1.00  0.69           C  
ATOM   2431  O   ILE A 319     -43.530  73.499  30.787  1.00  0.69           O  
ATOM   2432  CB  ILE A 319     -41.494  76.226  30.391  1.00  0.69           C  
ATOM   2433  CG1 ILE A 319     -42.153  76.251  28.985  1.00  0.69           C  
ATOM   2434  CG2 ILE A 319     -40.010  76.655  30.311  1.00  0.69           C  
ATOM   2435  CD1 ILE A 319     -42.358  77.665  28.411  1.00  0.69           C  
ATOM   2436  N   ASN A 320     -43.725  75.171  32.278  1.00  0.74           N  
ATOM   2437  CA  ASN A 320     -45.174  75.032  32.403  1.00  0.74           C  
ATOM   2438  C   ASN A 320     -45.868  75.309  31.073  1.00  0.74           C  
ATOM   2439  O   ASN A 320     -45.503  76.227  30.340  1.00  0.74           O  
ATOM   2440  CB  ASN A 320     -45.821  76.029  33.416  1.00  0.74           C  
ATOM   2441  CG  ASN A 320     -45.519  75.683  34.867  1.00  0.74           C  
ATOM   2442  OD1 ASN A 320     -44.691  74.840  35.199  1.00  0.74           O  
ATOM   2443  ND2 ASN A 320     -46.246  76.355  35.794  1.00  0.74           N  
ATOM   2444  N   THR A 321     -46.922  74.535  30.730  1.00  0.77           N  
ATOM   2445  CA  THR A 321     -47.636  74.716  29.464  1.00  0.77           C  
ATOM   2446  C   THR A 321     -48.405  76.017  29.488  1.00  0.77           C  
ATOM   2447  O   THR A 321     -48.700  76.647  28.481  1.00  0.77           O  
ATOM   2448  CB  THR A 321     -48.576  73.565  29.088  1.00  0.77           C  
ATOM   2449  OG1 THR A 321     -49.726  73.468  29.914  1.00  0.77           O  
ATOM   2450  CG2 THR A 321     -47.846  72.224  29.254  1.00  0.77           C  
ATOM   2451  N   THR A 322     -48.688  76.450  30.713  1.00  0.74           N  
ATOM   2452  CA  THR A 322     -49.300  77.690  31.100  1.00  0.74           C  
ATOM   2453  C   THR A 322     -48.257  78.735  31.436  1.00  0.74           C  
ATOM   2454  O   THR A 322     -47.467  78.560  32.365  1.00  0.74           O  
ATOM   2455  CB  THR A 322     -50.122  77.498  32.353  1.00  0.74           C  
ATOM   2456  OG1 THR A 322     -50.995  76.386  32.232  1.00  0.74           O  
ATOM   2457  CG2 THR A 322     -51.021  78.708  32.433  1.00  0.74           C  
ATOM   2458  N   VAL A 323     -48.232  79.864  30.703  1.00  0.76           N  
ATOM   2459  CA  VAL A 323     -47.161  80.842  30.787  1.00  0.76           C  
ATOM   2460  C   VAL A 323     -47.757  82.233  30.933  1.00  0.76           C  
ATOM   2461  O   VAL A 323     -48.762  82.557  30.298  1.00  0.76           O  
ATOM   2462  CB  VAL A 323     -46.269  80.803  29.544  1.00  0.76           C  
ATOM   2463  CG1 VAL A 323     -45.045  81.726  29.723  1.00  0.76           C  
ATOM   2464  CG2 VAL A 323     -45.783  79.357  29.303  1.00  0.76           C  
ATOM   2465  N   PHE A 324     -47.144  83.093  31.778  1.00  0.72           N  
ATOM   2466  CA  PHE A 324     -47.535  84.482  31.968  1.00  0.72           C  
ATOM   2467  C   PHE A 324     -46.376  85.356  31.565  1.00  0.72           C  
ATOM   2468  O   PHE A 324     -45.228  85.083  31.916  1.00  0.72           O  
ATOM   2469  CB  PHE A 324     -47.916  84.874  33.421  1.00  0.72           C  
ATOM   2470  CG  PHE A 324     -48.943  83.901  33.901  1.00  0.72           C  
ATOM   2471  CD1 PHE A 324     -50.254  84.006  33.427  1.00  0.72           C  
ATOM   2472  CD2 PHE A 324     -48.603  82.832  34.744  1.00  0.72           C  
ATOM   2473  CE1 PHE A 324     -51.213  83.044  33.768  1.00  0.72           C  
ATOM   2474  CE2 PHE A 324     -49.575  81.900  35.137  1.00  0.72           C  
ATOM   2475  CZ  PHE A 324     -50.884  82.004  34.646  1.00  0.72           C  
ATOM   2476  N   VAL A 325     -46.653  86.416  30.790  1.00  0.72           N  
ATOM   2477  CA  VAL A 325     -45.643  87.340  30.309  1.00  0.72           C  
ATOM   2478  C   VAL A 325     -46.072  88.768  30.635  1.00  0.72           C  
ATOM   2479  O   VAL A 325     -47.233  89.146  30.472  1.00  0.72           O  
ATOM   2480  CB  VAL A 325     -45.385  87.210  28.807  1.00  0.72           C  
ATOM   2481  CG1 VAL A 325     -44.008  87.835  28.502  1.00  0.72           C  
ATOM   2482  CG2 VAL A 325     -45.374  85.726  28.385  1.00  0.72           C  
ATOM   2483  N   ASN A 326     -45.151  89.620  31.133  1.00  0.65           N  
ATOM   2484  CA  ASN A 326     -45.364  91.053  31.292  1.00  0.65           C  
ATOM   2485  C   ASN A 326     -45.343  91.740  29.935  1.00  0.65           C  
ATOM   2486  O   ASN A 326     -44.715  91.212  29.027  1.00  0.65           O  
ATOM   2487  CB  ASN A 326     -44.301  91.691  32.220  1.00  0.65           C  
ATOM   2488  CG  ASN A 326     -44.583  91.223  33.639  1.00  0.65           C  
ATOM   2489  OD1 ASN A 326     -44.426  90.062  34.006  1.00  0.65           O  
ATOM   2490  ND2 ASN A 326     -45.096  92.142  34.491  1.00  0.65           N  
ATOM   2491  N   ASP A 327     -46.032  92.908  29.775  1.00  0.62           N  
ATOM   2492  CA  ASP A 327     -46.286  93.594  28.502  1.00  0.62           C  
ATOM   2493  C   ASP A 327     -45.140  93.513  27.489  1.00  0.62           C  
ATOM   2494  O   ASP A 327     -45.219  92.795  26.509  1.00  0.62           O  
ATOM   2495  CB  ASP A 327     -46.733  95.070  28.762  1.00  0.62           C  
ATOM   2496  CG  ASP A 327     -47.076  95.821  27.467  1.00  0.62           C  
ATOM   2497  OD1 ASP A 327     -47.903  95.314  26.662  1.00  0.62           O  
ATOM   2498  OD2 ASP A 327     -46.483  96.913  27.290  1.00  0.62           O  
ATOM   2499  N   GLY A 328     -44.004  94.189  27.720  1.00  0.61           N  
ATOM   2500  CA  GLY A 328     -42.974  94.278  26.689  1.00  0.61           C  
ATOM   2501  C   GLY A 328     -42.025  93.109  26.544  1.00  0.61           C  
ATOM   2502  O   GLY A 328     -41.091  93.195  25.747  1.00  0.61           O  
ATOM   2503  N   GLU A 329     -42.151  92.027  27.344  1.00  0.62           N  
ATOM   2504  CA  GLU A 329     -41.048  91.086  27.510  1.00  0.62           C  
ATOM   2505  C   GLU A 329     -40.933  90.017  26.401  1.00  0.62           C  
ATOM   2506  O   GLU A 329     -41.296  90.198  25.233  1.00  0.62           O  
ATOM   2507  CB  GLU A 329     -41.044  90.487  28.954  1.00  0.62           C  
ATOM   2508  CG  GLU A 329     -39.632  90.044  29.457  1.00  0.62           C  
ATOM   2509  CD  GLU A 329     -39.233  90.547  30.852  1.00  0.62           C  
ATOM   2510  OE1 GLU A 329     -40.106  91.049  31.605  1.00  0.62           O  
ATOM   2511  OE2 GLU A 329     -38.017  90.430  31.152  1.00  0.62           O  
ATOM   2512  N   ASN A 330     -40.367  88.843  26.725  1.00  0.71           N  
ATOM   2513  CA  ASN A 330     -40.022  87.786  25.798  1.00  0.71           C  
ATOM   2514  C   ASN A 330     -40.282  86.460  26.460  1.00  0.71           C  
ATOM   2515  O   ASN A 330     -40.247  86.341  27.684  1.00  0.71           O  
ATOM   2516  CB  ASN A 330     -38.500  87.765  25.431  1.00  0.71           C  
ATOM   2517  CG  ASN A 330     -38.012  89.062  24.800  1.00  0.71           C  
ATOM   2518  OD1 ASN A 330     -36.955  89.627  25.065  1.00  0.71           O  
ATOM   2519  ND2 ASN A 330     -38.840  89.556  23.855  1.00  0.71           N  
ATOM   2520  N   VAL A 331     -40.536  85.423  25.648  1.00  0.77           N  
ATOM   2521  CA  VAL A 331     -40.692  84.074  26.142  1.00  0.77           C  
ATOM   2522  C   VAL A 331     -40.273  83.109  25.074  1.00  0.77           C  
ATOM   2523  O   VAL A 331     -40.510  83.307  23.883  1.00  0.77           O  
ATOM   2524  CB  VAL A 331     -42.106  83.663  26.577  1.00  0.77           C  
ATOM   2525  CG1 VAL A 331     -42.154  83.691  28.117  1.00  0.77           C  
ATOM   2526  CG2 VAL A 331     -43.182  84.548  25.908  1.00  0.77           C  
ATOM   2527  N   ASP A 332     -39.705  81.996  25.544  1.00  0.81           N  
ATOM   2528  CA  ASP A 332     -39.233  80.898  24.763  1.00  0.81           C  
ATOM   2529  C   ASP A 332     -40.089  79.711  25.112  1.00  0.81           C  
ATOM   2530  O   ASP A 332     -40.103  79.230  26.248  1.00  0.81           O  
ATOM   2531  CB  ASP A 332     -37.766  80.632  25.153  1.00  0.81           C  
ATOM   2532  CG  ASP A 332     -37.003  81.363  24.075  1.00  0.81           C  
ATOM   2533  OD1 ASP A 332     -36.861  82.607  24.182  1.00  0.81           O  
ATOM   2534  OD2 ASP A 332     -36.726  80.670  23.071  1.00  0.81           O  
ATOM   2535  N   LEU A 333     -40.867  79.207  24.139  1.00  0.82           N  
ATOM   2536  CA  LEU A 333     -41.638  77.995  24.328  1.00  0.82           C  
ATOM   2537  C   LEU A 333     -40.791  76.813  23.887  1.00  0.82           C  
ATOM   2538  O   LEU A 333     -40.584  76.601  22.694  1.00  0.82           O  
ATOM   2539  CB  LEU A 333     -42.974  77.985  23.536  1.00  0.82           C  
ATOM   2540  CG  LEU A 333     -43.851  79.247  23.707  1.00  0.82           C  
ATOM   2541  CD1 LEU A 333     -45.056  79.166  22.753  1.00  0.82           C  
ATOM   2542  CD2 LEU A 333     -44.318  79.471  25.158  1.00  0.82           C  
ATOM   2543  N   ILE A 334     -40.275  76.013  24.842  1.00  0.80           N  
ATOM   2544  CA  ILE A 334     -39.314  74.949  24.576  1.00  0.80           C  
ATOM   2545  C   ILE A 334     -39.989  73.617  24.782  1.00  0.80           C  
ATOM   2546  O   ILE A 334     -40.617  73.363  25.819  1.00  0.80           O  
ATOM   2547  CB  ILE A 334     -38.095  74.955  25.506  1.00  0.80           C  
ATOM   2548  CG1 ILE A 334     -37.428  76.350  25.581  1.00  0.80           C  
ATOM   2549  CG2 ILE A 334     -37.079  73.863  25.056  1.00  0.80           C  
ATOM   2550  CD1 ILE A 334     -36.317  76.392  26.641  1.00  0.80           C  
ATOM   2551  N   VAL A 335     -39.855  72.710  23.804  1.00  0.83           N  
ATOM   2552  CA  VAL A 335     -40.322  71.348  23.920  1.00  0.83           C  
ATOM   2553  C   VAL A 335     -39.251  70.408  23.404  1.00  0.83           C  
ATOM   2554  O   VAL A 335     -38.643  70.644  22.351  1.00  0.83           O  
ATOM   2555  CB  VAL A 335     -41.657  71.096  23.205  1.00  0.83           C  
ATOM   2556  CG1 VAL A 335     -42.748  71.985  23.804  1.00  0.83           C  
ATOM   2557  CG2 VAL A 335     -41.635  71.427  21.697  1.00  0.83           C  
ATOM   2558  N   GLU A 336     -38.977  69.312  24.129  1.00  0.80           N  
ATOM   2559  CA  GLU A 336     -38.206  68.166  23.668  1.00  0.80           C  
ATOM   2560  C   GLU A 336     -39.191  67.057  23.355  1.00  0.80           C  
ATOM   2561  O   GLU A 336     -40.317  67.044  23.837  1.00  0.80           O  
ATOM   2562  CB  GLU A 336     -37.136  67.644  24.678  1.00  0.80           C  
ATOM   2563  CG  GLU A 336     -35.936  68.633  24.839  1.00  0.80           C  
ATOM   2564  CD  GLU A 336     -34.839  68.205  25.793  1.00  0.80           C  
ATOM   2565  OE1 GLU A 336     -34.757  66.994  26.074  1.00  0.80           O  
ATOM   2566  OE2 GLU A 336     -33.930  68.976  26.179  1.00  0.80           O  
ATOM   2567  N   TYR A 337     -38.834  66.104  22.485  1.00  0.81           N  
ATOM   2568  CA  TYR A 337     -39.740  65.018  22.182  1.00  0.81           C  
ATOM   2569  C   TYR A 337     -38.990  63.836  21.630  1.00  0.81           C  
ATOM   2570  O   TYR A 337     -37.834  63.936  21.215  1.00  0.81           O  
ATOM   2571  CB  TYR A 337     -40.947  65.421  21.281  1.00  0.81           C  
ATOM   2572  CG  TYR A 337     -40.565  65.845  19.910  1.00  0.81           C  
ATOM   2573  CD1 TYR A 337     -40.227  67.177  19.618  1.00  0.81           C  
ATOM   2574  CD2 TYR A 337     -40.557  64.873  18.899  1.00  0.81           C  
ATOM   2575  CE1 TYR A 337     -39.888  67.534  18.304  1.00  0.81           C  
ATOM   2576  CE2 TYR A 337     -40.205  65.224  17.596  1.00  0.81           C  
ATOM   2577  CZ  TYR A 337     -39.875  66.552  17.304  1.00  0.81           C  
ATOM   2578  OH  TYR A 337     -39.481  66.865  15.998  1.00  0.81           O  
ATOM   2579  N   GLU A 338     -39.645  62.681  21.635  1.00  0.80           N  
ATOM   2580  CA  GLU A 338     -39.121  61.416  21.214  1.00  0.80           C  
ATOM   2581  C   GLU A 338     -39.950  60.947  20.018  1.00  0.80           C  
ATOM   2582  O   GLU A 338     -41.165  60.842  20.156  1.00  0.80           O  
ATOM   2583  CB  GLU A 338     -39.274  60.491  22.436  1.00  0.80           C  
ATOM   2584  CG  GLU A 338     -38.495  59.187  22.261  1.00  0.80           C  
ATOM   2585  CD  GLU A 338     -38.230  58.551  23.612  1.00  0.80           C  
ATOM   2586  OE1 GLU A 338     -39.208  58.054  24.225  1.00  0.80           O  
ATOM   2587  OE2 GLU A 338     -37.061  58.657  24.068  1.00  0.80           O  
ATOM   2588  N   ALA A 339     -39.369  60.719  18.812  1.00  0.84           N  
ATOM   2589  CA  ALA A 339     -40.086  60.281  17.610  1.00  0.84           C  
ATOM   2590  C   ALA A 339     -39.348  59.232  16.754  1.00  0.84           C  
ATOM   2591  O   ALA A 339     -38.226  59.450  16.283  1.00  0.84           O  
ATOM   2592  CB  ALA A 339     -40.349  61.480  16.669  1.00  0.84           C  
ATOM   2593  N   PHE A 340     -39.990  58.074  16.478  1.00  0.77           N  
ATOM   2594  CA  PHE A 340     -39.483  57.028  15.599  1.00  0.77           C  
ATOM   2595  C   PHE A 340     -40.648  56.523  14.724  1.00  0.77           C  
ATOM   2596  O   PHE A 340     -41.667  56.133  15.288  1.00  0.77           O  
ATOM   2597  CB  PHE A 340     -38.839  55.865  16.415  1.00  0.77           C  
ATOM   2598  CG  PHE A 340     -38.561  54.602  15.639  1.00  0.77           C  
ATOM   2599  CD1 PHE A 340     -37.817  54.626  14.446  1.00  0.77           C  
ATOM   2600  CD2 PHE A 340     -39.130  53.391  16.069  1.00  0.77           C  
ATOM   2601  CE1 PHE A 340     -37.753  53.486  13.628  1.00  0.77           C  
ATOM   2602  CE2 PHE A 340     -39.017  52.237  15.284  1.00  0.77           C  
ATOM   2603  CZ  PHE A 340     -38.353  52.291  14.051  1.00  0.77           C  
ATOM   2604  N   PRO A 341     -40.596  56.475  13.386  1.00  0.76           N  
ATOM   2605  CA  PRO A 341     -39.608  57.115  12.534  1.00  0.76           C  
ATOM   2606  C   PRO A 341     -39.381  58.581  12.775  1.00  0.76           C  
ATOM   2607  O   PRO A 341     -40.144  59.250  13.460  1.00  0.76           O  
ATOM   2608  CB  PRO A 341     -40.046  56.818  11.088  1.00  0.76           C  
ATOM   2609  CG  PRO A 341     -40.920  55.566  11.225  1.00  0.76           C  
ATOM   2610  CD  PRO A 341     -41.592  55.748  12.593  1.00  0.76           C  
ATOM   2611  N   LYS A 342     -38.266  59.044  12.187  1.00  0.78           N  
ATOM   2612  CA  LYS A 342     -37.800  60.394  12.119  1.00  0.78           C  
ATOM   2613  C   LYS A 342     -38.941  61.296  11.619  1.00  0.78           C  
ATOM   2614  O   LYS A 342     -39.718  60.844  10.772  1.00  0.78           O  
ATOM   2615  CB  LYS A 342     -36.504  60.475  11.233  1.00  0.78           C  
ATOM   2616  CG  LYS A 342     -36.379  59.588   9.956  1.00  0.78           C  
ATOM   2617  CD  LYS A 342     -36.178  58.051  10.100  1.00  0.78           C  
ATOM   2618  CE  LYS A 342     -35.100  57.619  11.111  1.00  0.78           C  
ATOM   2619  NZ  LYS A 342     -35.231  56.178  11.454  1.00  0.78           N  
ATOM   2620  N   PRO A 343     -39.148  62.493  12.167  1.00  0.76           N  
ATOM   2621  CA  PRO A 343     -40.201  63.412  11.737  1.00  0.76           C  
ATOM   2622  C   PRO A 343     -40.168  63.745  10.260  1.00  0.76           C  
ATOM   2623  O   PRO A 343     -39.087  63.705   9.686  1.00  0.76           O  
ATOM   2624  CB  PRO A 343     -39.922  64.702  12.545  1.00  0.76           C  
ATOM   2625  CG  PRO A 343     -39.115  64.240  13.762  1.00  0.76           C  
ATOM   2626  CD  PRO A 343     -38.304  63.069  13.211  1.00  0.76           C  
ATOM   2627  N   GLU A 344     -41.308  64.143   9.662  1.00  0.67           N  
ATOM   2628  CA  GLU A 344     -41.267  64.695   8.314  1.00  0.67           C  
ATOM   2629  C   GLU A 344     -42.226  65.869   8.171  1.00  0.67           C  
ATOM   2630  O   GLU A 344     -42.401  66.464   7.115  1.00  0.67           O  
ATOM   2631  CB  GLU A 344     -41.582  63.576   7.283  1.00  0.67           C  
ATOM   2632  CG  GLU A 344     -41.072  63.864   5.844  1.00  0.67           C  
ATOM   2633  CD  GLU A 344     -39.583  64.220   5.804  1.00  0.67           C  
ATOM   2634  OE1 GLU A 344     -38.749  63.288   5.932  1.00  0.67           O  
ATOM   2635  OE2 GLU A 344     -39.274  65.426   5.620  1.00  0.67           O  
ATOM   2636  N   HIS A 345     -42.878  66.286   9.272  1.00  0.69           N  
ATOM   2637  CA  HIS A 345     -43.695  67.480   9.258  1.00  0.69           C  
ATOM   2638  C   HIS A 345     -43.716  68.019  10.663  1.00  0.69           C  
ATOM   2639  O   HIS A 345     -43.856  67.251  11.616  1.00  0.69           O  
ATOM   2640  CB  HIS A 345     -45.138  67.169   8.800  1.00  0.69           C  
ATOM   2641  CG  HIS A 345     -45.264  67.225   7.318  1.00  0.69           C  
ATOM   2642  ND1 HIS A 345     -45.272  68.472   6.725  1.00  0.69           N  
ATOM   2643  CD2 HIS A 345     -45.310  66.246   6.377  1.00  0.69           C  
ATOM   2644  CE1 HIS A 345     -45.312  68.232   5.431  1.00  0.69           C  
ATOM   2645  NE2 HIS A 345     -45.340  66.902   5.164  1.00  0.69           N  
ATOM   2646  N   GLN A 346     -43.550  69.342  10.859  1.00  0.75           N  
ATOM   2647  CA  GLN A 346     -43.651  69.913  12.180  1.00  0.75           C  
ATOM   2648  C   GLN A 346     -43.878  71.396  12.088  1.00  0.75           C  
ATOM   2649  O   GLN A 346     -43.457  72.031  11.122  1.00  0.75           O  
ATOM   2650  CB  GLN A 346     -42.397  69.609  13.032  1.00  0.75           C  
ATOM   2651  CG  GLN A 346     -41.103  70.349  12.623  1.00  0.75           C  
ATOM   2652  CD  GLN A 346     -39.923  69.837  13.449  1.00  0.75           C  
ATOM   2653  OE1 GLN A 346     -39.238  70.620  14.110  1.00  0.75           O  
ATOM   2654  NE2 GLN A 346     -39.736  68.505  13.511  1.00  0.75           N  
ATOM   2655  N   GLN A 347     -44.583  71.994  13.061  1.00  0.77           N  
ATOM   2656  CA  GLN A 347     -44.912  73.395  12.978  1.00  0.77           C  
ATOM   2657  C   GLN A 347     -45.470  73.927  14.282  1.00  0.77           C  
ATOM   2658  O   GLN A 347     -45.943  73.183  15.141  1.00  0.77           O  
ATOM   2659  CB  GLN A 347     -45.931  73.689  11.846  1.00  0.77           C  
ATOM   2660  CG  GLN A 347     -46.934  72.538  11.585  1.00  0.77           C  
ATOM   2661  CD  GLN A 347     -48.167  73.063  10.860  1.00  0.77           C  
ATOM   2662  OE1 GLN A 347     -48.117  74.014  10.081  1.00  0.77           O  
ATOM   2663  NE2 GLN A 347     -49.335  72.441  11.143  1.00  0.77           N  
ATOM   2664  N   TRP A 348     -45.466  75.263  14.425  1.00  0.74           N  
ATOM   2665  CA  TRP A 348     -46.061  75.991  15.522  1.00  0.74           C  
ATOM   2666  C   TRP A 348     -47.208  76.766  14.937  1.00  0.74           C  
ATOM   2667  O   TRP A 348     -47.069  77.302  13.845  1.00  0.74           O  
ATOM   2668  CB  TRP A 348     -45.078  77.023  16.112  1.00  0.74           C  
ATOM   2669  CG  TRP A 348     -43.931  76.361  16.829  1.00  0.74           C  
ATOM   2670  CD1 TRP A 348     -42.704  76.022  16.341  1.00  0.74           C  
ATOM   2671  CD2 TRP A 348     -43.926  76.018  18.224  1.00  0.74           C  
ATOM   2672  NE1 TRP A 348     -41.913  75.531  17.356  1.00  0.74           N  
ATOM   2673  CE2 TRP A 348     -42.648  75.494  18.514  1.00  0.74           C  
ATOM   2674  CE3 TRP A 348     -44.894  76.153  19.213  1.00  0.74           C  
ATOM   2675  CZ2 TRP A 348     -42.313  75.084  19.801  1.00  0.74           C  
ATOM   2676  CZ3 TRP A 348     -44.537  75.803  20.525  1.00  0.74           C  
ATOM   2677  CH2 TRP A 348     -43.271  75.263  20.813  1.00  0.74           C  
ATOM   2678  N   ILE A 349     -48.370  76.840  15.606  1.00  0.73           N  
ATOM   2679  CA  ILE A 349     -49.523  77.581  15.122  1.00  0.73           C  
ATOM   2680  C   ILE A 349     -50.006  78.496  16.234  1.00  0.73           C  
ATOM   2681  O   ILE A 349     -49.929  78.148  17.414  1.00  0.73           O  
ATOM   2682  CB  ILE A 349     -50.659  76.691  14.579  1.00  0.73           C  
ATOM   2683  CG1 ILE A 349     -51.374  75.882  15.682  1.00  0.73           C  
ATOM   2684  CG2 ILE A 349     -50.060  75.738  13.520  1.00  0.73           C  
ATOM   2685  CD1 ILE A 349     -52.548  75.029  15.180  1.00  0.73           C  
ATOM   2686  N   TYR A 350     -50.484  79.708  15.884  1.00  0.69           N  
ATOM   2687  CA  TYR A 350     -51.039  80.670  16.832  1.00  0.69           C  
ATOM   2688  C   TYR A 350     -52.563  80.735  16.629  1.00  0.69           C  
ATOM   2689  O   TYR A 350     -53.333  80.109  17.357  1.00  0.69           O  
ATOM   2690  CB  TYR A 350     -50.297  82.050  16.690  1.00  0.69           C  
ATOM   2691  CG  TYR A 350     -50.866  83.168  17.521  1.00  0.69           C  
ATOM   2692  CD1 TYR A 350     -51.300  82.940  18.837  1.00  0.69           C  
ATOM   2693  CD2 TYR A 350     -51.016  84.453  16.962  1.00  0.69           C  
ATOM   2694  CE1 TYR A 350     -51.980  83.942  19.536  1.00  0.69           C  
ATOM   2695  CE2 TYR A 350     -51.707  85.453  17.656  1.00  0.69           C  
ATOM   2696  CZ  TYR A 350     -52.233  85.174  18.920  1.00  0.69           C  
ATOM   2697  OH  TYR A 350     -53.108  86.084  19.534  1.00  0.69           O  
ATOM   2698  N   MET A 351     -53.069  81.461  15.615  1.00  0.58           N  
ATOM   2699  CA  MET A 351     -54.500  81.645  15.397  1.00  0.58           C  
ATOM   2700  C   MET A 351     -54.951  80.888  14.173  1.00  0.58           C  
ATOM   2701  O   MET A 351     -55.335  81.488  13.171  1.00  0.58           O  
ATOM   2702  CB  MET A 351     -54.861  83.126  15.161  1.00  0.58           C  
ATOM   2703  CG  MET A 351     -54.655  83.974  16.420  1.00  0.58           C  
ATOM   2704  SD  MET A 351     -55.061  85.729  16.181  1.00  0.58           S  
ATOM   2705  CE  MET A 351     -56.855  85.482  16.046  1.00  0.58           C  
ATOM   2706  N   ASN A 352     -54.855  79.540  14.186  1.00  0.62           N  
ATOM   2707  CA  ASN A 352     -55.185  78.695  13.037  1.00  0.62           C  
ATOM   2708  C   ASN A 352     -54.205  78.916  11.865  1.00  0.62           C  
ATOM   2709  O   ASN A 352     -54.448  78.579  10.705  1.00  0.62           O  
ATOM   2710  CB  ASN A 352     -56.669  78.948  12.615  1.00  0.62           C  
ATOM   2711  CG  ASN A 352     -57.360  77.725  12.028  1.00  0.62           C  
ATOM   2712  OD1 ASN A 352     -56.793  76.923  11.293  1.00  0.62           O  
ATOM   2713  ND2 ASN A 352     -58.670  77.581  12.337  1.00  0.62           N  
ATOM   2714  N   ARG A 353     -53.059  79.553  12.148  1.00  0.57           N  
ATOM   2715  CA  ARG A 353     -52.086  79.971  11.177  1.00  0.57           C  
ATOM   2716  C   ARG A 353     -50.752  79.626  11.781  1.00  0.57           C  
ATOM   2717  O   ARG A 353     -50.475  79.946  12.943  1.00  0.57           O  
ATOM   2718  CB  ARG A 353     -52.185  81.493  10.863  1.00  0.57           C  
ATOM   2719  CG  ARG A 353     -53.513  81.899  10.182  1.00  0.57           C  
ATOM   2720  CD  ARG A 353     -53.681  81.323   8.769  1.00  0.57           C  
ATOM   2721  NE  ARG A 353     -54.999  81.820   8.248  1.00  0.57           N  
ATOM   2722  CZ  ARG A 353     -56.169  81.186   8.406  1.00  0.57           C  
ATOM   2723  NH1 ARG A 353     -57.274  81.737   7.899  1.00  0.57           N  
ATOM   2724  NH2 ARG A 353     -56.274  80.022   9.039  1.00  0.57           N  
ATOM   2725  N   THR A 354     -49.949  78.892  10.996  1.00  0.69           N  
ATOM   2726  CA  THR A 354     -48.590  78.488  11.285  1.00  0.69           C  
ATOM   2727  C   THR A 354     -47.595  79.593  11.037  1.00  0.69           C  
ATOM   2728  O   THR A 354     -47.893  80.616  10.421  1.00  0.69           O  
ATOM   2729  CB  THR A 354     -48.202  77.197  10.550  1.00  0.69           C  
ATOM   2730  OG1 THR A 354     -46.980  76.626  10.969  1.00  0.69           O  
ATOM   2731  CG2 THR A 354     -48.078  77.367   9.037  1.00  0.69           C  
ATOM   2732  N   PHE A 355     -46.395  79.373  11.579  1.00  0.64           N  
ATOM   2733  CA  PHE A 355     -45.249  80.242  11.594  1.00  0.64           C  
ATOM   2734  C   PHE A 355     -44.293  79.818  10.497  1.00  0.64           C  
ATOM   2735  O   PHE A 355     -44.279  78.683  10.014  1.00  0.64           O  
ATOM   2736  CB  PHE A 355     -44.442  80.120  12.929  1.00  0.64           C  
ATOM   2737  CG  PHE A 355     -45.127  80.771  14.109  1.00  0.64           C  
ATOM   2738  CD1 PHE A 355     -44.469  81.817  14.780  1.00  0.64           C  
ATOM   2739  CD2 PHE A 355     -46.397  80.392  14.579  1.00  0.64           C  
ATOM   2740  CE1 PHE A 355     -45.081  82.532  15.815  1.00  0.64           C  
ATOM   2741  CE2 PHE A 355     -46.977  81.040  15.672  1.00  0.64           C  
ATOM   2742  CZ  PHE A 355     -46.345  82.140  16.255  1.00  0.64           C  
ATOM   2743  N   THR A 356     -43.407  80.744  10.129  1.00  0.61           N  
ATOM   2744  CA  THR A 356     -42.246  80.518   9.276  1.00  0.61           C  
ATOM   2745  C   THR A 356     -41.097  81.345   9.814  1.00  0.61           C  
ATOM   2746  O   THR A 356     -40.044  81.427   9.185  1.00  0.61           O  
ATOM   2747  CB  THR A 356     -42.449  80.989   7.830  1.00  0.61           C  
ATOM   2748  OG1 THR A 356     -43.253  82.160   7.784  1.00  0.61           O  
ATOM   2749  CG2 THR A 356     -43.167  79.909   7.010  1.00  0.61           C  
ATOM   2750  N   ASP A 357     -41.253  81.992  10.988  1.00  0.60           N  
ATOM   2751  CA  ASP A 357     -40.627  83.288  11.184  1.00  0.60           C  
ATOM   2752  C   ASP A 357     -39.724  83.407  12.425  1.00  0.60           C  
ATOM   2753  O   ASP A 357     -38.764  84.185  12.410  1.00  0.60           O  
ATOM   2754  CB  ASP A 357     -41.778  84.341  11.181  1.00  0.60           C  
ATOM   2755  CG  ASP A 357     -42.893  84.005  12.188  1.00  0.60           C  
ATOM   2756  OD1 ASP A 357     -42.716  84.351  13.386  1.00  0.60           O  
ATOM   2757  OD2 ASP A 357     -43.858  83.329  11.753  1.00  0.60           O  
ATOM   2758  N   LYS A 358     -39.961  82.648  13.516  1.00  0.70           N  
ATOM   2759  CA  LYS A 358     -39.392  82.926  14.835  1.00  0.70           C  
ATOM   2760  C   LYS A 358     -39.187  81.656  15.660  1.00  0.70           C  
ATOM   2761  O   LYS A 358     -39.265  81.666  16.888  1.00  0.70           O  
ATOM   2762  CB  LYS A 358     -40.284  83.911  15.653  1.00  0.70           C  
ATOM   2763  CG  LYS A 358     -40.164  85.368  15.172  1.00  0.70           C  
ATOM   2764  CD  LYS A 358     -40.992  86.345  16.021  1.00  0.70           C  
ATOM   2765  CE  LYS A 358     -40.846  87.785  15.525  1.00  0.70           C  
ATOM   2766  NZ  LYS A 358     -41.658  88.697  16.362  1.00  0.70           N  
ATOM   2767  N   TRP A 359     -38.918  80.498  15.032  1.00  0.68           N  
ATOM   2768  CA  TRP A 359     -38.801  79.253  15.765  1.00  0.68           C  
ATOM   2769  C   TRP A 359     -37.592  78.465  15.299  1.00  0.68           C  
ATOM   2770  O   TRP A 359     -37.109  78.622  14.176  1.00  0.68           O  
ATOM   2771  CB  TRP A 359     -40.110  78.410  15.681  1.00  0.68           C  
ATOM   2772  CG  TRP A 359     -40.550  77.996  14.284  1.00  0.68           C  
ATOM   2773  CD1 TRP A 359     -41.071  78.753  13.270  1.00  0.68           C  
ATOM   2774  CD2 TRP A 359     -40.448  76.655  13.780  1.00  0.68           C  
ATOM   2775  NE1 TRP A 359     -41.298  77.968  12.157  1.00  0.68           N  
ATOM   2776  CE2 TRP A 359     -40.915  76.674  12.449  1.00  0.68           C  
ATOM   2777  CE3 TRP A 359     -40.000  75.477  14.372  1.00  0.68           C  
ATOM   2778  CZ2 TRP A 359     -40.928  75.513  11.682  1.00  0.68           C  
ATOM   2779  CZ3 TRP A 359     -40.000  74.311  13.599  1.00  0.68           C  
ATOM   2780  CH2 TRP A 359     -40.454  74.328  12.272  1.00  0.68           C  
ATOM   2781  N   GLU A 360     -37.081  77.624  16.209  1.00  0.73           N  
ATOM   2782  CA  GLU A 360     -35.905  76.795  16.090  1.00  0.73           C  
ATOM   2783  C   GLU A 360     -36.322  75.333  16.077  1.00  0.73           C  
ATOM   2784  O   GLU A 360     -37.471  74.995  16.345  1.00  0.73           O  
ATOM   2785  CB  GLU A 360     -34.954  77.039  17.289  1.00  0.73           C  
ATOM   2786  CG  GLU A 360     -33.463  76.917  16.892  1.00  0.73           C  
ATOM   2787  CD  GLU A 360     -32.519  77.464  17.961  1.00  0.73           C  
ATOM   2788  OE1 GLU A 360     -32.698  78.651  18.328  1.00  0.73           O  
ATOM   2789  OE2 GLU A 360     -31.576  76.724  18.336  1.00  0.73           O  
ATOM   2790  N   ASP A 361     -35.389  74.427  15.774  1.00  0.78           N  
ATOM   2791  CA  ASP A 361     -35.611  73.016  15.574  1.00  0.78           C  
ATOM   2792  C   ASP A 361     -34.198  72.484  15.572  1.00  0.78           C  
ATOM   2793  O   ASP A 361     -33.317  73.073  14.940  1.00  0.78           O  
ATOM   2794  CB  ASP A 361     -36.382  72.766  14.229  1.00  0.78           C  
ATOM   2795  CG  ASP A 361     -36.103  71.485  13.422  1.00  0.78           C  
ATOM   2796  OD1 ASP A 361     -36.330  71.561  12.185  1.00  0.78           O  
ATOM   2797  OD2 ASP A 361     -35.658  70.456  13.992  1.00  0.78           O  
ATOM   2798  N   TYR A 362     -33.932  71.413  16.346  1.00  0.74           N  
ATOM   2799  CA  TYR A 362     -32.661  70.729  16.241  1.00  0.74           C  
ATOM   2800  C   TYR A 362     -32.736  69.289  16.787  1.00  0.74           C  
ATOM   2801  O   TYR A 362     -33.620  68.953  17.590  1.00  0.74           O  
ATOM   2802  CB  TYR A 362     -31.460  71.557  16.826  1.00  0.74           C  
ATOM   2803  CG  TYR A 362     -31.709  72.082  18.216  1.00  0.74           C  
ATOM   2804  CD1 TYR A 362     -32.379  73.304  18.448  1.00  0.74           C  
ATOM   2805  CD2 TYR A 362     -31.209  71.361  19.310  1.00  0.74           C  
ATOM   2806  CE1 TYR A 362     -32.550  73.784  19.756  1.00  0.74           C  
ATOM   2807  CE2 TYR A 362     -31.367  71.844  20.615  1.00  0.74           C  
ATOM   2808  CZ  TYR A 362     -32.031  73.054  20.833  1.00  0.74           C  
ATOM   2809  OH  TYR A 362     -32.211  73.503  22.151  1.00  0.74           O  
ATOM   2810  N   PRO A 363     -31.836  68.376  16.389  1.00  0.77           N  
ATOM   2811  CA  PRO A 363     -31.636  67.086  17.050  1.00  0.77           C  
ATOM   2812  C   PRO A 363     -30.957  67.255  18.395  1.00  0.77           C  
ATOM   2813  O   PRO A 363     -30.073  68.095  18.530  1.00  0.77           O  
ATOM   2814  CB  PRO A 363     -30.707  66.292  16.097  1.00  0.77           C  
ATOM   2815  CG  PRO A 363     -30.782  67.035  14.757  1.00  0.77           C  
ATOM   2816  CD  PRO A 363     -31.027  68.487  15.172  1.00  0.77           C  
ATOM   2817  N   LYS A 364     -31.344  66.484  19.428  1.00  0.77           N  
ATOM   2818  CA  LYS A 364     -30.691  66.585  20.718  1.00  0.77           C  
ATOM   2819  C   LYS A 364     -29.249  66.086  20.759  1.00  0.77           C  
ATOM   2820  O   LYS A 364     -28.354  66.727  21.308  1.00  0.77           O  
ATOM   2821  CB  LYS A 364     -31.516  65.770  21.734  1.00  0.77           C  
ATOM   2822  CG  LYS A 364     -30.932  65.865  23.150  1.00  0.77           C  
ATOM   2823  CD  LYS A 364     -31.967  66.209  24.226  1.00  0.77           C  
ATOM   2824  CE  LYS A 364     -31.320  67.019  25.363  1.00  0.77           C  
ATOM   2825  NZ  LYS A 364     -32.167  66.992  26.562  1.00  0.77           N  
ATOM   2826  N   SER A 365     -29.001  64.907  20.169  1.00  0.72           N  
ATOM   2827  CA  SER A 365     -27.679  64.340  20.009  1.00  0.72           C  
ATOM   2828  C   SER A 365     -27.545  64.001  18.544  1.00  0.72           C  
ATOM   2829  O   SER A 365     -28.529  63.696  17.873  1.00  0.72           O  
ATOM   2830  CB  SER A 365     -27.405  63.096  20.923  1.00  0.72           C  
ATOM   2831  OG  SER A 365     -28.140  61.923  20.555  1.00  0.72           O  
ATOM   2832  N   GLU A 366     -26.331  64.058  17.977  1.00  0.67           N  
ATOM   2833  CA  GLU A 366     -26.105  63.642  16.605  1.00  0.67           C  
ATOM   2834  C   GLU A 366     -25.435  62.284  16.607  1.00  0.67           C  
ATOM   2835  O   GLU A 366     -24.382  62.030  16.027  1.00  0.67           O  
ATOM   2836  CB  GLU A 366     -25.361  64.734  15.815  1.00  0.67           C  
ATOM   2837  CG  GLU A 366     -26.082  65.038  14.481  1.00  0.67           C  
ATOM   2838  CD  GLU A 366     -25.538  66.317  13.860  1.00  0.67           C  
ATOM   2839  OE1 GLU A 366     -24.307  66.386  13.617  1.00  0.67           O  
ATOM   2840  OE2 GLU A 366     -26.361  67.244  13.639  1.00  0.67           O  
ATOM   2841  N   ASN A 367     -26.082  61.342  17.313  1.00  0.69           N  
ATOM   2842  CA  ASN A 367     -25.652  59.969  17.390  1.00  0.69           C  
ATOM   2843  C   ASN A 367     -26.479  59.207  16.364  1.00  0.69           C  
ATOM   2844  O   ASN A 367     -27.311  59.763  15.653  1.00  0.69           O  
ATOM   2845  CB  ASN A 367     -25.857  59.333  18.805  1.00  0.69           C  
ATOM   2846  CG  ASN A 367     -25.213  60.165  19.919  1.00  0.69           C  
ATOM   2847  OD1 ASN A 367     -24.410  61.074  19.738  1.00  0.69           O  
ATOM   2848  ND2 ASN A 367     -25.567  59.817  21.181  1.00  0.69           N  
ATOM   2849  N   GLU A 368     -26.311  57.881  16.284  1.00  0.66           N  
ATOM   2850  CA  GLU A 368     -27.161  57.064  15.436  1.00  0.66           C  
ATOM   2851  C   GLU A 368     -28.381  56.565  16.196  1.00  0.66           C  
ATOM   2852  O   GLU A 368     -29.404  56.176  15.641  1.00  0.66           O  
ATOM   2853  CB  GLU A 368     -26.308  55.891  14.927  1.00  0.66           C  
ATOM   2854  CG  GLU A 368     -27.090  54.886  14.045  1.00  0.66           C  
ATOM   2855  CD  GLU A 368     -26.218  54.175  13.010  1.00  0.66           C  
ATOM   2856  OE1 GLU A 368     -26.718  53.181  12.436  1.00  0.66           O  
ATOM   2857  OE2 GLU A 368     -25.032  54.566  12.858  1.00  0.66           O  
ATOM   2858  N   SER A 369     -28.335  56.641  17.539  1.00  0.72           N  
ATOM   2859  CA  SER A 369     -29.398  56.143  18.382  1.00  0.72           C  
ATOM   2860  C   SER A 369     -30.354  57.260  18.723  1.00  0.72           C  
ATOM   2861  O   SER A 369     -31.305  57.084  19.482  1.00  0.72           O  
ATOM   2862  CB  SER A 369     -28.831  55.444  19.653  1.00  0.72           C  
ATOM   2863  OG  SER A 369     -28.329  56.318  20.672  1.00  0.72           O  
ATOM   2864  N   ASN A 370     -30.144  58.461  18.126  1.00  0.76           N  
ATOM   2865  CA  ASN A 370     -30.952  59.620  18.395  1.00  0.76           C  
ATOM   2866  C   ASN A 370     -32.351  59.466  17.831  1.00  0.76           C  
ATOM   2867  O   ASN A 370     -32.600  59.353  16.630  1.00  0.76           O  
ATOM   2868  CB  ASN A 370     -30.301  60.943  17.917  1.00  0.76           C  
ATOM   2869  CG  ASN A 370     -31.065  62.100  18.552  1.00  0.76           C  
ATOM   2870  OD1 ASN A 370     -31.422  62.057  19.733  1.00  0.76           O  
ATOM   2871  ND2 ASN A 370     -31.409  63.131  17.757  1.00  0.76           N  
ATOM   2872  N   ILE A 371     -33.304  59.467  18.751  1.00  0.79           N  
ATOM   2873  CA  ILE A 371     -34.703  59.356  18.478  1.00  0.79           C  
ATOM   2874  C   ILE A 371     -35.353  60.641  18.995  1.00  0.79           C  
ATOM   2875  O   ILE A 371     -36.553  60.882  18.889  1.00  0.79           O  
ATOM   2876  CB  ILE A 371     -35.077  58.045  19.167  1.00  0.79           C  
ATOM   2877  CG1 ILE A 371     -36.325  57.355  18.594  1.00  0.79           C  
ATOM   2878  CG2 ILE A 371     -35.047  58.177  20.708  1.00  0.79           C  
ATOM   2879  CD1 ILE A 371     -37.613  57.771  19.282  1.00  0.79           C  
ATOM   2880  N   ARG A 372     -34.528  61.559  19.539  1.00  0.74           N  
ATOM   2881  CA  ARG A 372     -34.941  62.644  20.389  1.00  0.74           C  
ATOM   2882  C   ARG A 372     -34.597  64.001  19.786  1.00  0.74           C  
ATOM   2883  O   ARG A 372     -33.483  64.289  19.342  1.00  0.74           O  
ATOM   2884  CB  ARG A 372     -34.201  62.467  21.732  1.00  0.74           C  
ATOM   2885  CG  ARG A 372     -34.395  63.570  22.792  1.00  0.74           C  
ATOM   2886  CD  ARG A 372     -35.592  63.335  23.705  1.00  0.74           C  
ATOM   2887  NE  ARG A 372     -35.385  64.231  24.883  1.00  0.74           N  
ATOM   2888  CZ  ARG A 372     -36.144  64.170  25.987  1.00  0.74           C  
ATOM   2889  NH1 ARG A 372     -37.164  63.332  26.091  1.00  0.74           N  
ATOM   2890  NH2 ARG A 372     -35.885  64.967  27.010  1.00  0.74           N  
ATOM   2891  N   TYR A 373     -35.581  64.906  19.782  1.00  0.79           N  
ATOM   2892  CA  TYR A 373     -35.495  66.185  19.110  1.00  0.79           C  
ATOM   2893  C   TYR A 373     -36.002  67.246  20.052  1.00  0.79           C  
ATOM   2894  O   TYR A 373     -36.488  66.953  21.148  1.00  0.79           O  
ATOM   2895  CB  TYR A 373     -36.348  66.248  17.815  1.00  0.79           C  
ATOM   2896  CG  TYR A 373     -36.037  65.073  16.938  1.00  0.79           C  
ATOM   2897  CD1 TYR A 373     -34.972  65.129  16.023  1.00  0.79           C  
ATOM   2898  CD2 TYR A 373     -36.770  63.878  17.071  1.00  0.79           C  
ATOM   2899  CE1 TYR A 373     -34.644  64.005  15.248  1.00  0.79           C  
ATOM   2900  CE2 TYR A 373     -36.437  62.754  16.308  1.00  0.79           C  
ATOM   2901  CZ  TYR A 373     -35.386  62.822  15.389  1.00  0.79           C  
ATOM   2902  OH  TYR A 373     -35.098  61.669  14.634  1.00  0.79           O  
ATOM   2903  N   VAL A 374     -35.843  68.514  19.649  1.00  0.82           N  
ATOM   2904  CA  VAL A 374     -36.242  69.680  20.406  1.00  0.82           C  
ATOM   2905  C   VAL A 374     -36.706  70.745  19.439  1.00  0.82           C  
ATOM   2906  O   VAL A 374     -36.235  70.825  18.300  1.00  0.82           O  
ATOM   2907  CB  VAL A 374     -35.159  70.186  21.393  1.00  0.82           C  
ATOM   2908  CG1 VAL A 374     -33.800  69.463  21.208  1.00  0.82           C  
ATOM   2909  CG2 VAL A 374     -34.970  71.719  21.473  1.00  0.82           C  
ATOM   2910  N   SER A 375     -37.670  71.580  19.852  1.00  0.83           N  
ATOM   2911  CA  SER A 375     -38.091  72.752  19.118  1.00  0.83           C  
ATOM   2912  C   SER A 375     -38.321  73.870  20.109  1.00  0.83           C  
ATOM   2913  O   SER A 375     -38.825  73.657  21.216  1.00  0.83           O  
ATOM   2914  CB  SER A 375     -39.394  72.501  18.313  1.00  0.83           C  
ATOM   2915  OG  SER A 375     -39.811  73.626  17.544  1.00  0.83           O  
ATOM   2916  N   GLU A 376     -37.916  75.093  19.727  1.00  0.80           N  
ATOM   2917  CA  GLU A 376     -38.097  76.305  20.496  1.00  0.80           C  
ATOM   2918  C   GLU A 376     -38.906  77.271  19.663  1.00  0.80           C  
ATOM   2919  O   GLU A 376     -38.669  77.430  18.467  1.00  0.80           O  
ATOM   2920  CB  GLU A 376     -36.765  77.003  20.859  1.00  0.80           C  
ATOM   2921  CG  GLU A 376     -35.830  76.103  21.699  1.00  0.80           C  
ATOM   2922  CD  GLU A 376     -34.555  76.800  22.190  1.00  0.80           C  
ATOM   2923  OE1 GLU A 376     -34.523  78.049  22.235  1.00  0.80           O  
ATOM   2924  OE2 GLU A 376     -33.625  76.051  22.578  1.00  0.80           O  
ATOM   2925  N   LEU A 377     -39.889  77.954  20.268  1.00  0.82           N  
ATOM   2926  CA  LEU A 377     -40.618  79.035  19.628  1.00  0.82           C  
ATOM   2927  C   LEU A 377     -40.306  80.321  20.375  1.00  0.82           C  
ATOM   2928  O   LEU A 377     -40.726  80.507  21.520  1.00  0.82           O  
ATOM   2929  CB  LEU A 377     -42.149  78.803  19.656  1.00  0.82           C  
ATOM   2930  CG  LEU A 377     -42.976  79.444  18.511  1.00  0.82           C  
ATOM   2931  CD1 LEU A 377     -44.406  79.710  19.001  1.00  0.82           C  
ATOM   2932  CD2 LEU A 377     -42.389  80.717  17.872  1.00  0.82           C  
ATOM   2933  N   HIS A 378     -39.566  81.241  19.727  1.00  0.77           N  
ATOM   2934  CA  HIS A 378     -39.012  82.424  20.355  1.00  0.77           C  
ATOM   2935  C   HIS A 378     -39.949  83.601  20.151  1.00  0.77           C  
ATOM   2936  O   HIS A 378     -39.912  84.309  19.142  1.00  0.77           O  
ATOM   2937  CB  HIS A 378     -37.635  82.812  19.754  1.00  0.77           C  
ATOM   2938  CG  HIS A 378     -36.592  81.738  19.842  1.00  0.77           C  
ATOM   2939  ND1 HIS A 378     -35.407  82.086  20.451  1.00  0.77           N  
ATOM   2940  CD2 HIS A 378     -36.612  80.403  19.556  1.00  0.77           C  
ATOM   2941  CE1 HIS A 378     -34.742  80.951  20.571  1.00  0.77           C  
ATOM   2942  NE2 HIS A 378     -35.418  79.911  20.034  1.00  0.77           N  
ATOM   2943  N   LEU A 379     -40.838  83.866  21.118  1.00  0.78           N  
ATOM   2944  CA  LEU A 379     -41.789  84.961  21.053  1.00  0.78           C  
ATOM   2945  C   LEU A 379     -41.191  86.224  21.616  1.00  0.78           C  
ATOM   2946  O   LEU A 379     -40.666  86.290  22.730  1.00  0.78           O  
ATOM   2947  CB  LEU A 379     -43.089  84.665  21.829  1.00  0.78           C  
ATOM   2948  CG  LEU A 379     -44.238  84.031  21.019  1.00  0.78           C  
ATOM   2949  CD1 LEU A 379     -43.776  83.149  19.852  1.00  0.78           C  
ATOM   2950  CD2 LEU A 379     -45.061  83.198  22.009  1.00  0.78           C  
ATOM   2951  N   THR A 380     -41.264  87.301  20.816  1.00  0.69           N  
ATOM   2952  CA  THR A 380     -40.450  88.471  21.064  1.00  0.69           C  
ATOM   2953  C   THR A 380     -41.178  89.771  20.934  1.00  0.69           C  
ATOM   2954  O   THR A 380     -41.885  90.021  19.961  1.00  0.69           O  
ATOM   2955  CB  THR A 380     -39.169  88.601  20.246  1.00  0.69           C  
ATOM   2956  OG1 THR A 380     -39.378  88.557  18.837  1.00  0.69           O  
ATOM   2957  CG2 THR A 380     -38.207  87.462  20.606  1.00  0.69           C  
ATOM   2958  N   ARG A 381     -40.963  90.620  21.966  1.00  0.54           N  
ATOM   2959  CA  ARG A 381     -41.396  91.993  22.158  1.00  0.54           C  
ATOM   2960  C   ARG A 381     -42.892  92.079  22.187  1.00  0.54           C  
ATOM   2961  O   ARG A 381     -43.476  93.081  21.770  1.00  0.54           O  
ATOM   2962  CB  ARG A 381     -40.827  92.954  21.089  1.00  0.54           C  
ATOM   2963  CG  ARG A 381     -39.292  93.020  21.071  1.00  0.54           C  
ATOM   2964  CD  ARG A 381     -38.824  94.013  20.008  1.00  0.54           C  
ATOM   2965  NE  ARG A 381     -37.325  93.985  20.005  1.00  0.54           N  
ATOM   2966  CZ  ARG A 381     -36.566  94.741  19.200  1.00  0.54           C  
ATOM   2967  NH1 ARG A 381     -35.239  94.667  19.279  1.00  0.54           N  
ATOM   2968  NH2 ARG A 381     -37.105  95.579  18.321  1.00  0.54           N  
ATOM   2969  N   LEU A 382     -43.511  90.973  22.644  1.00  0.61           N  
ATOM   2970  CA  LEU A 382     -44.874  90.630  22.332  1.00  0.61           C  
ATOM   2971  C   LEU A 382     -45.796  91.509  23.098  1.00  0.61           C  
ATOM   2972  O   LEU A 382     -45.910  91.428  24.316  1.00  0.61           O  
ATOM   2973  CB  LEU A 382     -45.240  89.120  22.489  1.00  0.61           C  
ATOM   2974  CG  LEU A 382     -45.358  88.499  23.906  1.00  0.61           C  
ATOM   2975  CD1 LEU A 382     -45.910  87.061  23.850  1.00  0.61           C  
ATOM   2976  CD2 LEU A 382     -44.028  88.507  24.664  1.00  0.61           C  
ATOM   2977  N   LYS A 383     -46.475  92.414  22.393  1.00  0.61           N  
ATOM   2978  CA  LYS A 383     -47.343  93.374  23.015  1.00  0.61           C  
ATOM   2979  C   LYS A 383     -48.502  92.641  23.660  1.00  0.61           C  
ATOM   2980  O   LYS A 383     -48.816  91.509  23.293  1.00  0.61           O  
ATOM   2981  CB  LYS A 383     -47.835  94.406  21.974  1.00  0.61           C  
ATOM   2982  CG  LYS A 383     -46.683  95.279  21.442  1.00  0.61           C  
ATOM   2983  CD  LYS A 383     -47.158  96.293  20.389  1.00  0.61           C  
ATOM   2984  CE  LYS A 383     -46.018  97.179  19.877  1.00  0.61           C  
ATOM   2985  NZ  LYS A 383     -46.530  98.129  18.862  1.00  0.61           N  
ATOM   2986  N   GLY A 384     -49.181  93.240  24.651  1.00  0.69           N  
ATOM   2987  CA  GLY A 384     -50.363  92.641  25.276  1.00  0.69           C  
ATOM   2988  C   GLY A 384     -51.529  92.138  24.416  1.00  0.69           C  
ATOM   2989  O   GLY A 384     -52.527  91.627  24.932  1.00  0.69           O  
ATOM   2990  N   THR A 385     -51.450  92.307  23.089  1.00  0.67           N  
ATOM   2991  CA  THR A 385     -52.244  91.746  22.010  1.00  0.67           C  
ATOM   2992  C   THR A 385     -51.912  90.289  21.649  1.00  0.67           C  
ATOM   2993  O   THR A 385     -52.826  89.514  21.389  1.00  0.67           O  
ATOM   2994  CB  THR A 385     -52.153  92.628  20.769  1.00  0.67           C  
ATOM   2995  OG1 THR A 385     -50.807  92.836  20.367  1.00  0.67           O  
ATOM   2996  CG2 THR A 385     -52.664  94.037  21.128  1.00  0.67           C  
ATOM   2997  N   GLU A 386     -50.623  89.862  21.658  1.00  0.71           N  
ATOM   2998  CA  GLU A 386     -50.137  88.506  21.349  1.00  0.71           C  
ATOM   2999  C   GLU A 386     -50.487  87.407  22.372  1.00  0.71           C  
ATOM   3000  O   GLU A 386     -49.965  86.296  22.333  1.00  0.71           O  
ATOM   3001  CB  GLU A 386     -48.588  88.524  21.189  1.00  0.71           C  
ATOM   3002  CG  GLU A 386     -48.053  88.545  19.728  1.00  0.71           C  
ATOM   3003  CD  GLU A 386     -47.856  89.959  19.188  1.00  0.71           C  
ATOM   3004  OE1 GLU A 386     -46.843  90.601  19.578  1.00  0.71           O  
ATOM   3005  OE2 GLU A 386     -48.693  90.402  18.361  1.00  0.71           O  
ATOM   3006  N   GLY A 387     -51.389  87.671  23.333  1.00  0.77           N  
ATOM   3007  CA  GLY A 387     -51.948  86.661  24.229  1.00  0.77           C  
ATOM   3008  C   GLY A 387     -52.808  85.641  23.548  1.00  0.77           C  
ATOM   3009  O   GLY A 387     -53.530  85.961  22.599  1.00  0.77           O  
ATOM   3010  N   GLY A 388     -52.845  84.388  24.003  1.00  0.79           N  
ATOM   3011  CA  GLY A 388     -53.584  83.371  23.285  1.00  0.79           C  
ATOM   3012  C   GLY A 388     -52.995  82.009  23.445  1.00  0.79           C  
ATOM   3013  O   GLY A 388     -52.196  81.731  24.335  1.00  0.79           O  
ATOM   3014  N   THR A 389     -53.401  81.081  22.576  1.00  0.78           N  
ATOM   3015  CA  THR A 389     -53.036  79.677  22.675  1.00  0.78           C  
ATOM   3016  C   THR A 389     -52.113  79.350  21.522  1.00  0.78           C  
ATOM   3017  O   THR A 389     -52.339  79.747  20.378  1.00  0.78           O  
ATOM   3018  CB  THR A 389     -54.264  78.761  22.745  1.00  0.78           C  
ATOM   3019  OG1 THR A 389     -53.947  77.382  22.646  1.00  0.78           O  
ATOM   3020  CG2 THR A 389     -55.291  79.088  21.647  1.00  0.78           C  
ATOM   3021  N   TYR A 390     -50.984  78.685  21.818  1.00  0.80           N  
ATOM   3022  CA  TYR A 390     -49.937  78.391  20.866  1.00  0.80           C  
ATOM   3023  C   TYR A 390     -49.752  76.895  20.858  1.00  0.80           C  
ATOM   3024  O   TYR A 390     -49.570  76.266  21.895  1.00  0.80           O  
ATOM   3025  CB  TYR A 390     -48.567  79.013  21.256  1.00  0.80           C  
ATOM   3026  CG  TYR A 390     -48.550  80.497  20.991  1.00  0.80           C  
ATOM   3027  CD1 TYR A 390     -49.346  81.411  21.711  1.00  0.80           C  
ATOM   3028  CD2 TYR A 390     -47.678  80.992  20.009  1.00  0.80           C  
ATOM   3029  CE1 TYR A 390     -49.265  82.788  21.457  1.00  0.80           C  
ATOM   3030  CE2 TYR A 390     -47.598  82.366  19.751  1.00  0.80           C  
ATOM   3031  CZ  TYR A 390     -48.380  83.263  20.485  1.00  0.80           C  
ATOM   3032  OH  TYR A 390     -48.234  84.648  20.293  1.00  0.80           O  
ATOM   3033  N   THR A 391     -49.768  76.271  19.679  1.00  0.82           N  
ATOM   3034  CA  THR A 391     -49.721  74.816  19.567  1.00  0.82           C  
ATOM   3035  C   THR A 391     -48.495  74.438  18.791  1.00  0.82           C  
ATOM   3036  O   THR A 391     -48.151  75.091  17.809  1.00  0.82           O  
ATOM   3037  CB  THR A 391     -50.973  74.262  18.889  1.00  0.82           C  
ATOM   3038  OG1 THR A 391     -52.008  74.121  19.844  1.00  0.82           O  
ATOM   3039  CG2 THR A 391     -50.832  72.874  18.236  1.00  0.82           C  
ATOM   3040  N   PHE A 392     -47.805  73.360  19.211  1.00  0.80           N  
ATOM   3041  CA  PHE A 392     -46.716  72.739  18.481  1.00  0.80           C  
ATOM   3042  C   PHE A 392     -47.223  71.393  17.982  1.00  0.80           C  
ATOM   3043  O   PHE A 392     -47.788  70.610  18.747  1.00  0.80           O  
ATOM   3044  CB  PHE A 392     -45.465  72.527  19.387  1.00  0.80           C  
ATOM   3045  CG  PHE A 392     -44.356  71.782  18.676  1.00  0.80           C  
ATOM   3046  CD1 PHE A 392     -44.098  70.438  19.005  1.00  0.80           C  
ATOM   3047  CD2 PHE A 392     -43.642  72.375  17.618  1.00  0.80           C  
ATOM   3048  CE1 PHE A 392     -43.129  69.705  18.304  1.00  0.80           C  
ATOM   3049  CE2 PHE A 392     -42.672  71.643  16.915  1.00  0.80           C  
ATOM   3050  CZ  PHE A 392     -42.407  70.311  17.265  1.00  0.80           C  
ATOM   3051  N   LEU A 393     -47.023  71.118  16.683  1.00  0.78           N  
ATOM   3052  CA  LEU A 393     -47.421  69.929  15.962  1.00  0.78           C  
ATOM   3053  C   LEU A 393     -46.214  69.238  15.383  1.00  0.78           C  
ATOM   3054  O   LEU A 393     -45.284  69.882  14.902  1.00  0.78           O  
ATOM   3055  CB  LEU A 393     -48.363  70.311  14.786  1.00  0.78           C  
ATOM   3056  CG  LEU A 393     -49.810  69.904  15.094  1.00  0.78           C  
ATOM   3057  CD1 LEU A 393     -50.832  70.841  14.437  1.00  0.78           C  
ATOM   3058  CD2 LEU A 393     -50.043  68.428  14.716  1.00  0.78           C  
ATOM   3059  N   VAL A 394     -46.216  67.894  15.382  1.00  0.80           N  
ATOM   3060  CA  VAL A 394     -45.185  67.111  14.739  1.00  0.80           C  
ATOM   3061  C   VAL A 394     -45.791  65.811  14.254  1.00  0.80           C  
ATOM   3062  O   VAL A 394     -46.790  65.323  14.790  1.00  0.80           O  
ATOM   3063  CB  VAL A 394     -43.981  66.890  15.666  1.00  0.80           C  
ATOM   3064  CG1 VAL A 394     -44.311  65.997  16.881  1.00  0.80           C  
ATOM   3065  CG2 VAL A 394     -42.766  66.332  14.901  1.00  0.80           C  
ATOM   3066  N   SER A 395     -45.238  65.208  13.193  1.00  0.77           N  
ATOM   3067  CA  SER A 395     -45.676  63.909  12.738  1.00  0.77           C  
ATOM   3068  C   SER A 395     -44.553  63.158  12.060  1.00  0.77           C  
ATOM   3069  O   SER A 395     -43.554  63.723  11.604  1.00  0.77           O  
ATOM   3070  CB  SER A 395     -46.932  63.962  11.822  1.00  0.77           C  
ATOM   3071  OG  SER A 395     -46.712  64.684  10.612  1.00  0.77           O  
ATOM   3072  N   ASN A 396     -44.699  61.824  12.030  1.00  0.76           N  
ATOM   3073  CA  ASN A 396     -43.888  60.897  11.272  1.00  0.76           C  
ATOM   3074  C   ASN A 396     -44.857  60.186  10.342  1.00  0.76           C  
ATOM   3075  O   ASN A 396     -45.999  60.608  10.164  1.00  0.76           O  
ATOM   3076  CB  ASN A 396     -43.026  59.919  12.157  1.00  0.76           C  
ATOM   3077  CG  ASN A 396     -43.823  59.121  13.193  1.00  0.76           C  
ATOM   3078  OD1 ASN A 396     -45.038  58.959  13.096  1.00  0.76           O  
ATOM   3079  ND2 ASN A 396     -43.139  58.576  14.220  1.00  0.76           N  
ATOM   3080  N   SER A 397     -44.410  59.103   9.693  1.00  0.72           N  
ATOM   3081  CA  SER A 397     -45.197  58.282   8.788  1.00  0.72           C  
ATOM   3082  C   SER A 397     -46.420  57.612   9.412  1.00  0.72           C  
ATOM   3083  O   SER A 397     -47.425  57.416   8.733  1.00  0.72           O  
ATOM   3084  CB  SER A 397     -44.309  57.205   8.097  1.00  0.72           C  
ATOM   3085  OG  SER A 397     -42.956  57.666   7.966  1.00  0.72           O  
ATOM   3086  N   ASP A 398     -46.350  57.249  10.713  1.00  0.71           N  
ATOM   3087  CA  ASP A 398     -47.331  56.413  11.378  1.00  0.71           C  
ATOM   3088  C   ASP A 398     -48.193  57.168  12.415  1.00  0.71           C  
ATOM   3089  O   ASP A 398     -49.316  56.759  12.716  1.00  0.71           O  
ATOM   3090  CB  ASP A 398     -46.554  55.311  12.153  1.00  0.71           C  
ATOM   3091  CG  ASP A 398     -45.788  54.321  11.274  1.00  0.71           C  
ATOM   3092  OD1 ASP A 398     -45.799  54.422  10.025  1.00  0.71           O  
ATOM   3093  OD2 ASP A 398     -45.152  53.431  11.900  1.00  0.71           O  
ATOM   3094  N   VAL A 399     -47.714  58.290  13.006  1.00  0.72           N  
ATOM   3095  CA  VAL A 399     -48.386  59.000  14.095  1.00  0.72           C  
ATOM   3096  C   VAL A 399     -48.194  60.501  13.908  1.00  0.72           C  
ATOM   3097  O   VAL A 399     -47.198  60.995  13.376  1.00  0.72           O  
ATOM   3098  CB  VAL A 399     -47.866  58.588  15.496  1.00  0.72           C  
ATOM   3099  CG1 VAL A 399     -48.470  59.380  16.679  1.00  0.72           C  
ATOM   3100  CG2 VAL A 399     -48.225  57.117  15.750  1.00  0.72           C  
ATOM   3101  N   ASN A 400     -49.171  61.297  14.374  1.00  0.73           N  
ATOM   3102  CA  ASN A 400     -49.033  62.718  14.598  1.00  0.73           C  
ATOM   3103  C   ASN A 400     -49.141  62.997  16.092  1.00  0.73           C  
ATOM   3104  O   ASN A 400     -49.838  62.283  16.811  1.00  0.73           O  
ATOM   3105  CB  ASN A 400     -50.081  63.517  13.763  1.00  0.73           C  
ATOM   3106  CG  ASN A 400     -51.569  63.167  13.936  1.00  0.73           C  
ATOM   3107  OD1 ASN A 400     -52.332  63.353  12.990  1.00  0.73           O  
ATOM   3108  ND2 ASN A 400     -52.037  62.683  15.106  1.00  0.73           N  
ATOM   3109  N   ALA A 401     -48.480  64.037  16.619  1.00  0.78           N  
ATOM   3110  CA  ALA A 401     -48.641  64.368  18.015  1.00  0.78           C  
ATOM   3111  C   ALA A 401     -48.481  65.861  18.184  1.00  0.78           C  
ATOM   3112  O   ALA A 401     -47.836  66.539  17.383  1.00  0.78           O  
ATOM   3113  CB  ALA A 401     -47.652  63.579  18.913  1.00  0.78           C  
ATOM   3114  N   ALA A 402     -49.135  66.430  19.209  1.00  0.79           N  
ATOM   3115  CA  ALA A 402     -49.102  67.848  19.410  1.00  0.79           C  
ATOM   3116  C   ALA A 402     -49.535  68.175  20.813  1.00  0.79           C  
ATOM   3117  O   ALA A 402     -50.258  67.405  21.445  1.00  0.79           O  
ATOM   3118  CB  ALA A 402     -50.077  68.524  18.430  1.00  0.79           C  
ATOM   3119  N   ILE A 403     -49.108  69.342  21.323  1.00  0.73           N  
ATOM   3120  CA  ILE A 403     -49.545  69.857  22.606  1.00  0.73           C  
ATOM   3121  C   ILE A 403     -49.664  71.360  22.479  1.00  0.73           C  
ATOM   3122  O   ILE A 403     -49.104  71.979  21.568  1.00  0.73           O  
ATOM   3123  CB  ILE A 403     -48.623  69.536  23.788  1.00  0.73           C  
ATOM   3124  CG1 ILE A 403     -47.166  69.973  23.504  1.00  0.73           C  
ATOM   3125  CG2 ILE A 403     -48.741  68.028  24.121  1.00  0.73           C  
ATOM   3126  CD1 ILE A 403     -46.314  70.000  24.778  1.00  0.73           C  
ATOM   3127  N   ALA A 404     -50.412  71.979  23.407  1.00  0.81           N  
ATOM   3128  CA  ALA A 404     -50.706  73.388  23.394  1.00  0.81           C  
ATOM   3129  C   ALA A 404     -50.155  74.079  24.634  1.00  0.81           C  
ATOM   3130  O   ALA A 404     -50.254  73.593  25.765  1.00  0.81           O  
ATOM   3131  CB  ALA A 404     -52.226  73.612  23.267  1.00  0.81           C  
ATOM   3132  N   PHE A 405     -49.543  75.251  24.397  1.00  0.78           N  
ATOM   3133  CA  PHE A 405     -49.054  76.211  25.359  1.00  0.78           C  
ATOM   3134  C   PHE A 405     -50.059  77.336  25.460  1.00  0.78           C  
ATOM   3135  O   PHE A 405     -50.381  78.014  24.485  1.00  0.78           O  
ATOM   3136  CB  PHE A 405     -47.716  76.877  24.935  1.00  0.78           C  
ATOM   3137  CG  PHE A 405     -46.603  75.943  25.238  1.00  0.78           C  
ATOM   3138  CD1 PHE A 405     -45.950  76.001  26.480  1.00  0.78           C  
ATOM   3139  CD2 PHE A 405     -46.241  74.963  24.307  1.00  0.78           C  
ATOM   3140  CE1 PHE A 405     -44.935  75.085  26.780  1.00  0.78           C  
ATOM   3141  CE2 PHE A 405     -45.207  74.071  24.600  1.00  0.78           C  
ATOM   3142  CZ  PHE A 405     -44.537  74.137  25.831  1.00  0.78           C  
ATOM   3143  N   ASN A 406     -50.561  77.588  26.674  1.00  0.78           N  
ATOM   3144  CA  ASN A 406     -51.519  78.636  26.947  1.00  0.78           C  
ATOM   3145  C   ASN A 406     -50.731  79.848  27.392  1.00  0.78           C  
ATOM   3146  O   ASN A 406     -50.125  79.846  28.466  1.00  0.78           O  
ATOM   3147  CB  ASN A 406     -52.513  78.259  28.075  1.00  0.78           C  
ATOM   3148  CG  ASN A 406     -53.220  76.969  27.691  1.00  0.78           C  
ATOM   3149  OD1 ASN A 406     -54.174  76.972  26.914  1.00  0.78           O  
ATOM   3150  ND2 ASN A 406     -52.747  75.822  28.232  1.00  0.78           N  
ATOM   3151  N   VAL A 407     -50.695  80.910  26.572  1.00  0.79           N  
ATOM   3152  CA  VAL A 407     -49.813  82.033  26.801  1.00  0.79           C  
ATOM   3153  C   VAL A 407     -50.693  83.210  27.167  1.00  0.79           C  
ATOM   3154  O   VAL A 407     -51.427  83.764  26.350  1.00  0.79           O  
ATOM   3155  CB  VAL A 407     -48.941  82.377  25.587  1.00  0.79           C  
ATOM   3156  CG1 VAL A 407     -47.798  83.306  26.060  1.00  0.79           C  
ATOM   3157  CG2 VAL A 407     -48.377  81.082  24.949  1.00  0.79           C  
ATOM   3158  N   TYR A 408     -50.658  83.637  28.436  1.00  0.73           N  
ATOM   3159  CA  TYR A 408     -51.433  84.772  28.886  1.00  0.73           C  
ATOM   3160  C   TYR A 408     -50.453  85.908  29.010  1.00  0.73           C  
ATOM   3161  O   TYR A 408     -49.344  85.770  29.525  1.00  0.73           O  
ATOM   3162  CB  TYR A 408     -52.134  84.571  30.251  1.00  0.73           C  
ATOM   3163  CG  TYR A 408     -52.940  83.315  30.275  1.00  0.73           C  
ATOM   3164  CD1 TYR A 408     -54.290  83.310  29.892  1.00  0.73           C  
ATOM   3165  CD2 TYR A 408     -52.370  82.134  30.766  1.00  0.73           C  
ATOM   3166  CE1 TYR A 408     -55.039  82.121  29.898  1.00  0.73           C  
ATOM   3167  CE2 TYR A 408     -53.166  80.994  30.897  1.00  0.73           C  
ATOM   3168  CZ  TYR A 408     -54.471  80.959  30.413  1.00  0.73           C  
ATOM   3169  OH  TYR A 408     -55.209  79.763  30.498  1.00  0.73           O  
ATOM   3170  N   VAL A 409     -50.822  87.076  28.501  1.00  0.76           N  
ATOM   3171  CA  VAL A 409     -49.961  88.229  28.482  1.00  0.76           C  
ATOM   3172  C   VAL A 409     -50.648  89.289  29.302  1.00  0.76           C  
ATOM   3173  O   VAL A 409     -51.867  89.438  29.256  1.00  0.76           O  
ATOM   3174  CB  VAL A 409     -49.722  88.688  27.052  1.00  0.76           C  
ATOM   3175  CG1 VAL A 409     -51.057  89.098  26.390  1.00  0.76           C  
ATOM   3176  CG2 VAL A 409     -48.660  89.806  27.004  1.00  0.76           C  
ATOM   3177  N   ASN A 410     -49.897  90.040  30.119  1.00  0.76           N  
ATOM   3178  CA  ASN A 410     -50.450  91.103  30.932  1.00  0.76           C  
ATOM   3179  C   ASN A 410     -50.805  92.309  30.082  1.00  0.76           C  
ATOM   3180  O   ASN A 410     -49.977  92.799  29.320  1.00  0.76           O  
ATOM   3181  CB  ASN A 410     -49.421  91.580  31.981  1.00  0.76           C  
ATOM   3182  CG  ASN A 410     -49.169  90.479  33.000  1.00  0.76           C  
ATOM   3183  OD1 ASN A 410     -49.969  89.575  33.222  1.00  0.76           O  
ATOM   3184  ND2 ASN A 410     -48.008  90.556  33.689  1.00  0.76           N  
ATOM   3185  N   THR A 411     -52.033  92.842  30.193  1.00  0.73           N  
ATOM   3186  CA  THR A 411     -52.413  93.976  29.367  1.00  0.73           C  
ATOM   3187  C   THR A 411     -53.546  94.713  30.011  1.00  0.73           C  
ATOM   3188  O   THR A 411     -54.311  94.169  30.814  1.00  0.73           O  
ATOM   3189  CB  THR A 411     -52.770  93.595  27.931  1.00  0.73           C  
ATOM   3190  OG1 THR A 411     -53.125  94.695  27.101  1.00  0.73           O  
ATOM   3191  CG2 THR A 411     -53.924  92.591  27.866  1.00  0.73           C  
ATOM   3192  N   LYS A 412     -53.657  96.010  29.671  1.00  0.70           N  
ATOM   3193  CA  LYS A 412     -54.622  96.911  30.237  1.00  0.70           C  
ATOM   3194  C   LYS A 412     -56.045  96.482  29.856  1.00  0.70           C  
ATOM   3195  O   LYS A 412     -56.281  96.222  28.673  1.00  0.70           O  
ATOM   3196  CB  LYS A 412     -54.348  98.379  29.825  1.00  0.70           C  
ATOM   3197  CG  LYS A 412     -55.294  99.388  30.496  1.00  0.70           C  
ATOM   3198  CD  LYS A 412     -54.882 100.832  30.168  1.00  0.70           C  
ATOM   3199  CE  LYS A 412     -55.789 101.859  30.843  1.00  0.70           C  
ATOM   3200  NZ  LYS A 412     -55.401 103.248  30.516  1.00  0.70           N  
ATOM   3201  N   PRO A 413     -57.011  96.358  30.774  1.00  0.79           N  
ATOM   3202  CA  PRO A 413     -58.380  95.956  30.466  1.00  0.79           C  
ATOM   3203  C   PRO A 413     -59.046  96.756  29.361  1.00  0.79           C  
ATOM   3204  O   PRO A 413     -58.964  97.981  29.360  1.00  0.79           O  
ATOM   3205  CB  PRO A 413     -59.125  95.993  31.820  1.00  0.79           C  
ATOM   3206  CG  PRO A 413     -58.141  96.657  32.794  1.00  0.79           C  
ATOM   3207  CD  PRO A 413     -56.777  96.315  32.211  1.00  0.79           C  
ATOM   3208  N   GLU A 414     -59.715  96.081  28.416  1.00  0.71           N  
ATOM   3209  CA  GLU A 414     -60.382  96.720  27.309  1.00  0.71           C  
ATOM   3210  C   GLU A 414     -61.862  96.528  27.525  1.00  0.71           C  
ATOM   3211  O   GLU A 414     -62.328  95.417  27.786  1.00  0.71           O  
ATOM   3212  CB  GLU A 414     -59.936  96.100  25.974  1.00  0.71           C  
ATOM   3213  CG  GLU A 414     -60.569  96.738  24.718  1.00  0.71           C  
ATOM   3214  CD  GLU A 414     -59.970  96.084  23.470  1.00  0.71           C  
ATOM   3215  OE1 GLU A 414     -60.326  96.540  22.358  1.00  0.71           O  
ATOM   3216  OE2 GLU A 414     -59.152  95.125  23.624  1.00  0.71           O  
ATOM   3217  N   ILE A 415     -62.639  97.630  27.485  1.00  0.73           N  
ATOM   3218  CA  ILE A 415     -64.086  97.606  27.582  1.00  0.73           C  
ATOM   3219  C   ILE A 415     -64.674  97.031  26.295  1.00  0.73           C  
ATOM   3220  O   ILE A 415     -64.796  97.702  25.272  1.00  0.73           O  
ATOM   3221  CB  ILE A 415     -64.670  98.967  28.020  1.00  0.73           C  
ATOM   3222  CG1 ILE A 415     -66.161  98.853  28.434  1.00  0.73           C  
ATOM   3223  CG2 ILE A 415     -64.439 100.114  26.996  1.00  0.73           C  
ATOM   3224  CD1 ILE A 415     -66.352  98.226  29.822  1.00  0.73           C  
ATOM   3225  N   LEU A 416     -65.026  95.730  26.291  1.00  0.61           N  
ATOM   3226  CA  LEU A 416     -65.645  95.058  25.169  1.00  0.61           C  
ATOM   3227  C   LEU A 416     -66.981  95.639  24.788  1.00  0.61           C  
ATOM   3228  O   LEU A 416     -67.235  95.860  23.607  1.00  0.61           O  
ATOM   3229  CB  LEU A 416     -65.877  93.557  25.483  1.00  0.61           C  
ATOM   3230  CG  LEU A 416     -64.588  92.718  25.538  1.00  0.61           C  
ATOM   3231  CD1 LEU A 416     -64.963  91.268  25.876  1.00  0.61           C  
ATOM   3232  CD2 LEU A 416     -63.819  92.770  24.204  1.00  0.61           C  
ATOM   3233  N   THR A 417     -67.865  95.906  25.764  1.00  0.63           N  
ATOM   3234  CA  THR A 417     -69.139  96.502  25.421  1.00  0.63           C  
ATOM   3235  C   THR A 417     -69.783  97.075  26.670  1.00  0.63           C  
ATOM   3236  O   THR A 417     -69.575  96.599  27.793  1.00  0.63           O  
ATOM   3237  CB  THR A 417     -70.048  95.553  24.628  1.00  0.63           C  
ATOM   3238  OG1 THR A 417     -71.241  96.177  24.187  1.00  0.63           O  
ATOM   3239  CG2 THR A 417     -70.365  94.257  25.397  1.00  0.63           C  
ATOM   3240  N   TYR A 418     -70.520  98.183  26.497  1.00  0.59           N  
ATOM   3241  CA  TYR A 418     -71.284  98.919  27.480  1.00  0.59           C  
ATOM   3242  C   TYR A 418     -72.762  98.798  27.092  1.00  0.59           C  
ATOM   3243  O   TYR A 418     -73.179  99.232  26.019  1.00  0.59           O  
ATOM   3244  CB  TYR A 418     -70.833 100.426  27.554  1.00  0.59           C  
ATOM   3245  CG  TYR A 418     -70.769 101.112  26.200  1.00  0.59           C  
ATOM   3246  CD1 TYR A 418     -69.644 100.953  25.367  1.00  0.59           C  
ATOM   3247  CD2 TYR A 418     -71.843 101.903  25.743  1.00  0.59           C  
ATOM   3248  CE1 TYR A 418     -69.615 101.529  24.089  1.00  0.59           C  
ATOM   3249  CE2 TYR A 418     -71.809 102.494  24.469  1.00  0.59           C  
ATOM   3250  CZ  TYR A 418     -70.693 102.301  23.642  1.00  0.59           C  
ATOM   3251  OH  TYR A 418     -70.640 102.878  22.356  1.00  0.59           O  
ATOM   3252  N   ASP A 419     -73.610  98.227  27.973  1.00  0.60           N  
ATOM   3253  CA  ASP A 419     -74.983  97.894  27.642  1.00  0.60           C  
ATOM   3254  C   ASP A 419     -75.935  98.555  28.630  1.00  0.60           C  
ATOM   3255  O   ASP A 419     -75.584  98.980  29.732  1.00  0.60           O  
ATOM   3256  CB  ASP A 419     -75.260  96.364  27.633  1.00  0.60           C  
ATOM   3257  CG  ASP A 419     -74.483  95.665  26.529  1.00  0.60           C  
ATOM   3258  OD1 ASP A 419     -73.284  95.353  26.735  1.00  0.60           O  
ATOM   3259  OD2 ASP A 419     -75.111  95.423  25.466  1.00  0.60           O  
ATOM   3260  N   ARG A 420     -77.211  98.671  28.226  1.00  0.55           N  
ATOM   3261  CA  ARG A 420     -78.277  99.241  29.032  1.00  0.55           C  
ATOM   3262  C   ARG A 420     -79.545  98.442  28.797  1.00  0.55           C  
ATOM   3263  O   ARG A 420     -80.504  98.927  28.201  1.00  0.55           O  
ATOM   3264  CB  ARG A 420     -78.566 100.744  28.734  1.00  0.55           C  
ATOM   3265  CG  ARG A 420     -77.397 101.666  29.131  1.00  0.55           C  
ATOM   3266  CD  ARG A 420     -77.726 103.161  29.082  1.00  0.55           C  
ATOM   3267  NE  ARG A 420     -77.896 103.505  27.632  1.00  0.55           N  
ATOM   3268  CZ  ARG A 420     -78.433 104.647  27.181  1.00  0.55           C  
ATOM   3269  NH1 ARG A 420     -78.582 104.836  25.872  1.00  0.55           N  
ATOM   3270  NH2 ARG A 420     -78.822 105.607  28.013  1.00  0.55           N  
ATOM   3271  N   LEU A 421     -79.591  97.174  29.248  1.00  0.48           N  
ATOM   3272  CA  LEU A 421     -80.837  96.434  29.362  1.00  0.48           C  
ATOM   3273  C   LEU A 421     -81.677  96.913  30.553  1.00  0.48           C  
ATOM   3274  O   LEU A 421     -81.289  96.819  31.718  1.00  0.48           O  
ATOM   3275  CB  LEU A 421     -80.571  94.915  29.491  1.00  0.48           C  
ATOM   3276  CG  LEU A 421     -81.846  94.041  29.455  1.00  0.48           C  
ATOM   3277  CD1 LEU A 421     -82.570  94.116  28.097  1.00  0.48           C  
ATOM   3278  CD2 LEU A 421     -81.493  92.582  29.783  1.00  0.48           C  
ATOM   3279  N   VAL A 422     -82.877  97.468  30.316  1.00  0.47           N  
ATOM   3280  CA  VAL A 422     -83.480  98.367  31.282  1.00  0.47           C  
ATOM   3281  C   VAL A 422     -84.491  97.680  32.179  1.00  0.47           C  
ATOM   3282  O   VAL A 422     -85.624  97.366  31.814  1.00  0.47           O  
ATOM   3283  CB  VAL A 422     -83.986  99.640  30.588  1.00  0.47           C  
ATOM   3284  CG1 VAL A 422     -85.069 100.466  31.319  1.00  0.47           C  
ATOM   3285  CG2 VAL A 422     -82.760 100.555  30.382  1.00  0.47           C  
ATOM   3286  N   ASN A 423     -84.077  97.514  33.444  1.00  0.57           N  
ATOM   3287  CA  ASN A 423     -84.884  97.815  34.621  1.00  0.57           C  
ATOM   3288  C   ASN A 423     -84.397  99.160  35.203  1.00  0.57           C  
ATOM   3289  O   ASN A 423     -84.626  99.485  36.365  1.00  0.57           O  
ATOM   3290  CB  ASN A 423     -84.672  96.753  35.725  1.00  0.57           C  
ATOM   3291  CG  ASN A 423     -85.030  95.339  35.293  1.00  0.57           C  
ATOM   3292  OD1 ASN A 423     -86.122  95.038  34.822  1.00  0.57           O  
ATOM   3293  ND2 ASN A 423     -84.072  94.403  35.509  1.00  0.57           N  
ATOM   3294  N   GLY A 424     -83.662  99.918  34.360  1.00  0.62           N  
ATOM   3295  CA  GLY A 424     -82.728 101.022  34.597  1.00  0.62           C  
ATOM   3296  C   GLY A 424     -81.316 100.525  34.750  1.00  0.62           C  
ATOM   3297  O   GLY A 424     -80.373 101.310  34.845  1.00  0.62           O  
ATOM   3298  N   MET A 425     -81.139  99.196  34.718  1.00  0.64           N  
ATOM   3299  CA  MET A 425     -79.908  98.490  35.004  1.00  0.64           C  
ATOM   3300  C   MET A 425     -78.851  98.765  33.943  1.00  0.64           C  
ATOM   3301  O   MET A 425     -79.030  98.520  32.750  1.00  0.64           O  
ATOM   3302  CB  MET A 425     -80.158  96.961  35.216  1.00  0.64           C  
ATOM   3303  CG  MET A 425     -80.553  96.568  36.668  1.00  0.64           C  
ATOM   3304  SD  MET A 425     -81.797  97.627  37.480  1.00  0.64           S  
ATOM   3305  CE  MET A 425     -82.480  96.408  38.631  1.00  0.64           C  
ATOM   3306  N   LEU A 426     -77.705  99.321  34.359  1.00  0.67           N  
ATOM   3307  CA  LEU A 426     -76.631  99.666  33.455  1.00  0.67           C  
ATOM   3308  C   LEU A 426     -75.596  98.573  33.561  1.00  0.67           C  
ATOM   3309  O   LEU A 426     -75.318  98.073  34.654  1.00  0.67           O  
ATOM   3310  CB  LEU A 426     -75.968 101.025  33.784  1.00  0.67           C  
ATOM   3311  CG  LEU A 426     -76.966 102.174  34.053  1.00  0.67           C  
ATOM   3312  CD1 LEU A 426     -76.192 103.412  34.504  1.00  0.67           C  
ATOM   3313  CD2 LEU A 426     -77.832 102.562  32.845  1.00  0.67           C  
ATOM   3314  N   GLN A 427     -75.011  98.168  32.426  1.00  0.71           N  
ATOM   3315  CA  GLN A 427     -74.108  97.050  32.368  1.00  0.71           C  
ATOM   3316  C   GLN A 427     -72.828  97.447  31.697  1.00  0.71           C  
ATOM   3317  O   GLN A 427     -72.789  98.332  30.838  1.00  0.71           O  
ATOM   3318  CB  GLN A 427     -74.714  95.940  31.494  1.00  0.71           C  
ATOM   3319  CG  GLN A 427     -73.820  94.684  31.354  1.00  0.71           C  
ATOM   3320  CD  GLN A 427     -74.610  93.557  30.727  1.00  0.71           C  
ATOM   3321  OE1 GLN A 427     -74.792  93.395  29.527  1.00  0.71           O  
ATOM   3322  NE2 GLN A 427     -75.142  92.686  31.606  1.00  0.71           N  
ATOM   3323  N   CYS A 428     -71.723  96.787  32.044  1.00  0.75           N  
ATOM   3324  CA  CYS A 428     -70.480  97.031  31.375  1.00  0.75           C  
ATOM   3325  C   CYS A 428     -69.643  95.775  31.397  1.00  0.75           C  
ATOM   3326  O   CYS A 428     -69.640  95.034  32.383  1.00  0.75           O  
ATOM   3327  CB  CYS A 428     -69.766  98.134  32.164  1.00  0.75           C  
ATOM   3328  SG  CYS A 428     -69.343  99.657  31.274  1.00  0.75           S  
ATOM   3329  N   VAL A 429     -68.912  95.497  30.307  1.00  0.75           N  
ATOM   3330  CA  VAL A 429     -68.195  94.253  30.147  1.00  0.75           C  
ATOM   3331  C   VAL A 429     -66.803  94.544  29.644  1.00  0.75           C  
ATOM   3332  O   VAL A 429     -66.622  95.277  28.669  1.00  0.75           O  
ATOM   3333  CB  VAL A 429     -68.936  93.360  29.163  1.00  0.75           C  
ATOM   3334  CG1 VAL A 429     -68.172  92.044  28.917  1.00  0.75           C  
ATOM   3335  CG2 VAL A 429     -70.313  93.050  29.780  1.00  0.75           C  
ATOM   3336  N   ALA A 430     -65.758  93.993  30.285  1.00  0.76           N  
ATOM   3337  CA  ALA A 430     -64.382  94.231  29.900  1.00  0.76           C  
ATOM   3338  C   ALA A 430     -63.572  92.951  29.921  1.00  0.76           C  
ATOM   3339  O   ALA A 430     -64.000  91.923  30.438  1.00  0.76           O  
ATOM   3340  CB  ALA A 430     -63.704  95.277  30.817  1.00  0.76           C  
ATOM   3341  N   ALA A 431     -62.368  92.987  29.325  1.00  0.77           N  
ATOM   3342  CA  ALA A 431     -61.486  91.849  29.228  1.00  0.77           C  
ATOM   3343  C   ALA A 431     -60.040  92.272  29.346  1.00  0.77           C  
ATOM   3344  O   ALA A 431     -59.625  93.287  28.788  1.00  0.77           O  
ATOM   3345  CB  ALA A 431     -61.619  91.237  27.827  1.00  0.77           C  
ATOM   3346  N   GLY A 432     -59.192  91.513  30.048  1.00  0.80           N  
ATOM   3347  CA  GLY A 432     -57.809  91.930  30.193  1.00  0.80           C  
ATOM   3348  C   GLY A 432     -57.075  90.875  30.943  1.00  0.80           C  
ATOM   3349  O   GLY A 432     -57.575  89.757  31.079  1.00  0.80           O  
ATOM   3350  N   PHE A 433     -55.861  91.175  31.443  1.00  0.80           N  
ATOM   3351  CA  PHE A 433     -55.143  90.154  32.180  1.00  0.80           C  
ATOM   3352  C   PHE A 433     -54.253  90.745  33.295  1.00  0.80           C  
ATOM   3353  O   PHE A 433     -53.615  91.774  33.042  1.00  0.80           O  
ATOM   3354  CB  PHE A 433     -54.385  89.214  31.207  1.00  0.80           C  
ATOM   3355  CG  PHE A 433     -54.039  87.942  31.925  1.00  0.80           C  
ATOM   3356  CD1 PHE A 433     -52.804  87.835  32.579  1.00  0.80           C  
ATOM   3357  CD2 PHE A 433     -54.990  86.915  32.073  1.00  0.80           C  
ATOM   3358  CE1 PHE A 433     -52.521  86.736  33.395  1.00  0.80           C  
ATOM   3359  CE2 PHE A 433     -54.704  85.794  32.867  1.00  0.80           C  
ATOM   3360  CZ  PHE A 433     -53.475  85.719  33.540  1.00  0.80           C  
ATOM   3361  N   PRO A 434     -54.161  90.163  34.521  1.00  0.81           N  
ATOM   3362  CA  PRO A 434     -55.065  89.159  35.120  1.00  0.81           C  
ATOM   3363  C   PRO A 434     -56.519  89.607  35.125  1.00  0.81           C  
ATOM   3364  O   PRO A 434     -56.798  90.735  34.743  1.00  0.81           O  
ATOM   3365  CB  PRO A 434     -54.510  88.928  36.538  1.00  0.81           C  
ATOM   3366  CG  PRO A 434     -53.820  90.247  36.887  1.00  0.81           C  
ATOM   3367  CD  PRO A 434     -53.267  90.729  35.538  1.00  0.81           C  
ATOM   3368  N   GLU A 435     -57.484  88.731  35.461  1.00  0.77           N  
ATOM   3369  CA  GLU A 435     -58.912  89.045  35.485  1.00  0.77           C  
ATOM   3370  C   GLU A 435     -59.323  90.477  35.898  1.00  0.77           C  
ATOM   3371  O   GLU A 435     -58.893  90.957  36.951  1.00  0.77           O  
ATOM   3372  CB  GLU A 435     -59.696  88.013  36.323  1.00  0.77           C  
ATOM   3373  CG  GLU A 435     -61.147  88.451  36.665  1.00  0.77           C  
ATOM   3374  CD  GLU A 435     -62.045  87.298  37.105  1.00  0.77           C  
ATOM   3375  OE1 GLU A 435     -61.537  86.369  37.781  1.00  0.77           O  
ATOM   3376  OE2 GLU A 435     -63.249  87.339  36.741  1.00  0.77           O  
ATOM   3377  N   PRO A 436     -60.123  91.215  35.127  1.00  0.80           N  
ATOM   3378  CA  PRO A 436     -60.396  92.607  35.443  1.00  0.80           C  
ATOM   3379  C   PRO A 436     -61.587  92.687  36.387  1.00  0.80           C  
ATOM   3380  O   PRO A 436     -62.634  92.114  36.127  1.00  0.80           O  
ATOM   3381  CB  PRO A 436     -60.636  93.233  34.055  1.00  0.80           C  
ATOM   3382  CG  PRO A 436     -61.223  92.095  33.212  1.00  0.80           C  
ATOM   3383  CD  PRO A 436     -60.570  90.838  33.779  1.00  0.80           C  
ATOM   3384  N   THR A 437     -61.458  93.397  37.510  1.00  0.75           N  
ATOM   3385  CA  THR A 437     -62.486  93.587  38.515  1.00  0.75           C  
ATOM   3386  C   THR A 437     -63.131  94.909  38.222  1.00  0.75           C  
ATOM   3387  O   THR A 437     -62.464  95.845  37.778  1.00  0.75           O  
ATOM   3388  CB  THR A 437     -61.935  93.641  39.930  1.00  0.75           C  
ATOM   3389  OG1 THR A 437     -61.099  92.523  40.167  1.00  0.75           O  
ATOM   3390  CG2 THR A 437     -63.066  93.514  40.955  1.00  0.75           C  
ATOM   3391  N   ILE A 438     -64.453  95.036  38.395  1.00  0.75           N  
ATOM   3392  CA  ILE A 438     -65.157  96.231  37.995  1.00  0.75           C  
ATOM   3393  C   ILE A 438     -65.818  96.942  39.172  1.00  0.75           C  
ATOM   3394  O   ILE A 438     -66.804  96.452  39.725  1.00  0.75           O  
ATOM   3395  CB  ILE A 438     -66.260  95.894  37.024  1.00  0.75           C  
ATOM   3396  CG1 ILE A 438     -65.856  95.028  35.815  1.00  0.75           C  
ATOM   3397  CG2 ILE A 438     -66.784  97.220  36.488  1.00  0.75           C  
ATOM   3398  CD1 ILE A 438     -64.768  95.674  34.957  1.00  0.75           C  
ATOM   3399  N   ASP A 439     -65.348  98.157  39.505  1.00  0.74           N  
ATOM   3400  CA  ASP A 439     -65.868  98.977  40.586  1.00  0.74           C  
ATOM   3401  C   ASP A 439     -66.600 100.174  39.978  1.00  0.74           C  
ATOM   3402  O   ASP A 439     -66.107 100.784  39.022  1.00  0.74           O  
ATOM   3403  CB  ASP A 439     -64.726  99.562  41.457  1.00  0.74           C  
ATOM   3404  CG  ASP A 439     -64.110  98.555  42.415  1.00  0.74           C  
ATOM   3405  OD1 ASP A 439     -63.183  99.022  43.131  1.00  0.74           O  
ATOM   3406  OD2 ASP A 439     -64.524  97.375  42.448  1.00  0.74           O  
ATOM   3407  N   TRP A 440     -67.775 100.546  40.492  1.00  0.69           N  
ATOM   3408  CA  TRP A 440     -68.615 101.551  39.904  1.00  0.69           C  
ATOM   3409  C   TRP A 440     -68.467 102.797  40.710  1.00  0.69           C  
ATOM   3410  O   TRP A 440     -68.186 102.683  41.898  1.00  0.69           O  
ATOM   3411  CB  TRP A 440     -70.079 101.031  39.898  1.00  0.69           C  
ATOM   3412  CG  TRP A 440     -70.281  99.947  38.900  1.00  0.69           C  
ATOM   3413  CD1 TRP A 440     -70.122  98.596  38.996  1.00  0.69           C  
ATOM   3414  CD2 TRP A 440     -70.811 100.222  37.602  1.00  0.69           C  
ATOM   3415  NE1 TRP A 440     -70.528  98.001  37.821  1.00  0.69           N  
ATOM   3416  CE2 TRP A 440     -70.961  98.986  36.959  1.00  0.69           C  
ATOM   3417  CE3 TRP A 440     -71.183 101.420  36.995  1.00  0.69           C  
ATOM   3418  CZ2 TRP A 440     -71.491  98.907  35.680  1.00  0.69           C  
ATOM   3419  CZ3 TRP A 440     -71.779 101.337  35.728  1.00  0.69           C  
ATOM   3420  CH2 TRP A 440     -71.922 100.100  35.074  1.00  0.69           C  
ATOM   3421  N   TYR A 441     -68.892 104.008  40.248  1.00  0.61           N  
ATOM   3422  CA  TYR A 441     -68.917 105.147  41.164  1.00  0.61           C  
ATOM   3423  C   TYR A 441     -70.082 105.942  40.790  1.00  0.61           C  
ATOM   3424  O   TYR A 441     -70.333 106.187  39.606  1.00  0.61           O  
ATOM   3425  CB  TYR A 441     -67.639 106.038  41.187  1.00  0.61           C  
ATOM   3426  CG  TYR A 441     -66.488 105.274  41.773  1.00  0.61           C  
ATOM   3427  CD1 TYR A 441     -66.330 105.041  43.155  1.00  0.61           C  
ATOM   3428  CD2 TYR A 441     -65.557 104.736  40.879  1.00  0.61           C  
ATOM   3429  CE1 TYR A 441     -65.203 104.363  43.639  1.00  0.61           C  
ATOM   3430  CE2 TYR A 441     -64.457 104.038  41.355  1.00  0.61           C  
ATOM   3431  CZ  TYR A 441     -64.253 103.854  42.729  1.00  0.61           C  
ATOM   3432  OH  TYR A 441     -63.076 103.137  43.095  1.00  0.61           O  
ATOM   3433  N   PHE A 442     -70.839 106.356  41.789  1.00  0.55           N  
ATOM   3434  CA  PHE A 442     -71.633 107.534  41.683  1.00  0.55           C  
ATOM   3435  C   PHE A 442     -70.771 108.697  42.159  1.00  0.55           C  
ATOM   3436  O   PHE A 442     -69.752 108.549  42.848  1.00  0.55           O  
ATOM   3437  CB  PHE A 442     -72.930 107.461  42.533  1.00  0.55           C  
ATOM   3438  CG  PHE A 442     -73.797 106.286  42.204  1.00  0.55           C  
ATOM   3439  CD1 PHE A 442     -74.259 106.039  40.897  1.00  0.55           C  
ATOM   3440  CD2 PHE A 442     -74.221 105.453  43.250  1.00  0.55           C  
ATOM   3441  CE1 PHE A 442     -75.087 104.934  40.636  1.00  0.55           C  
ATOM   3442  CE2 PHE A 442     -75.086 104.379  43.003  1.00  0.55           C  
ATOM   3443  CZ  PHE A 442     -75.502 104.105  41.690  1.00  0.55           C  
ATOM   3444  N   CYS A 443     -71.225 109.890  41.798  1.00  0.49           N  
ATOM   3445  CA  CYS A 443     -70.726 111.204  42.142  1.00  0.49           C  
ATOM   3446  C   CYS A 443     -71.854 112.139  42.573  1.00  0.49           C  
ATOM   3447  O   CYS A 443     -71.486 113.184  43.118  1.00  0.49           O  
ATOM   3448  CB  CYS A 443     -69.976 111.938  41.005  1.00  0.49           C  
ATOM   3449  SG  CYS A 443     -68.342 111.215  40.711  1.00  0.49           S  
ATOM   3450  N   PRO A 444     -73.186 111.968  42.485  1.00  0.42           N  
ATOM   3451  CA  PRO A 444     -74.076 113.030  42.962  1.00  0.42           C  
ATOM   3452  C   PRO A 444     -74.426 112.813  44.405  1.00  0.42           C  
ATOM   3453  O   PRO A 444     -74.704 113.732  45.168  1.00  0.42           O  
ATOM   3454  CB  PRO A 444     -75.395 112.835  42.193  1.00  0.42           C  
ATOM   3455  CG  PRO A 444     -75.352 111.462  41.529  1.00  0.42           C  
ATOM   3456  CD  PRO A 444     -73.881 111.078  41.542  1.00  0.42           C  
ATOM   3457  N   GLY A 445     -74.501 111.529  44.770  1.00  0.37           N  
ATOM   3458  CA  GLY A 445     -74.834 111.086  46.109  1.00  0.37           C  
ATOM   3459  C   GLY A 445     -73.706 111.431  47.026  1.00  0.37           C  
ATOM   3460  O   GLY A 445     -73.899 111.783  48.187  1.00  0.37           O  
ATOM   3461  N   THR A 446     -72.481 111.362  46.488  1.00  0.28           N  
ATOM   3462  CA  THR A 446     -71.254 111.811  47.125  1.00  0.28           C  
ATOM   3463  C   THR A 446     -71.153 113.301  47.303  1.00  0.28           C  
ATOM   3464  O   THR A 446     -70.745 113.777  48.358  1.00  0.28           O  
ATOM   3465  CB  THR A 446     -69.997 111.271  46.468  1.00  0.28           C  
ATOM   3466  OG1 THR A 446     -69.024 111.073  47.455  1.00  0.28           O  
ATOM   3467  CG2 THR A 446     -69.349 112.125  45.375  1.00  0.28           C  
ATOM   3468  N   GLU A 447     -71.579 114.083  46.287  1.00  0.28           N  
ATOM   3469  CA  GLU A 447     -71.576 115.530  46.295  1.00  0.28           C  
ATOM   3470  C   GLU A 447     -72.398 116.092  47.444  1.00  0.28           C  
ATOM   3471  O   GLU A 447     -71.947 116.942  48.208  1.00  0.28           O  
ATOM   3472  CB  GLU A 447     -72.186 115.997  44.958  1.00  0.28           C  
ATOM   3473  CG  GLU A 447     -72.268 117.532  44.811  1.00  0.28           C  
ATOM   3474  CD  GLU A 447     -72.929 117.952  43.500  1.00  0.28           C  
ATOM   3475  OE1 GLU A 447     -73.343 117.061  42.719  1.00  0.28           O  
ATOM   3476  OE2 GLU A 447     -73.035 119.187  43.286  1.00  0.28           O  
ATOM   3477  N   GLN A 448     -73.611 115.538  47.647  1.00  0.33           N  
ATOM   3478  CA  GLN A 448     -74.489 115.895  48.747  1.00  0.33           C  
ATOM   3479  C   GLN A 448     -73.956 115.529  50.122  1.00  0.33           C  
ATOM   3480  O   GLN A 448     -74.278 116.177  51.114  1.00  0.33           O  
ATOM   3481  CB  GLN A 448     -75.865 115.220  48.589  1.00  0.33           C  
ATOM   3482  CG  GLN A 448     -76.623 115.775  47.376  1.00  0.33           C  
ATOM   3483  CD  GLN A 448     -78.022 115.186  47.349  1.00  0.33           C  
ATOM   3484  OE1 GLN A 448     -78.373 114.155  47.940  1.00  0.33           O  
ATOM   3485  NE2 GLN A 448     -78.915 115.905  46.634  1.00  0.33           N  
ATOM   3486  N   ARG A 449     -73.155 114.451  50.211  1.00  0.26           N  
ATOM   3487  CA  ARG A 449     -72.609 113.960  51.466  1.00  0.26           C  
ATOM   3488  C   ARG A 449     -71.234 114.523  51.783  1.00  0.26           C  
ATOM   3489  O   ARG A 449     -70.706 114.273  52.867  1.00  0.26           O  
ATOM   3490  CB  ARG A 449     -72.428 112.427  51.414  1.00  0.26           C  
ATOM   3491  CG  ARG A 449     -73.756 111.665  51.352  1.00  0.26           C  
ATOM   3492  CD  ARG A 449     -73.492 110.166  51.308  1.00  0.26           C  
ATOM   3493  NE  ARG A 449     -74.838 109.523  51.232  1.00  0.26           N  
ATOM   3494  CZ  ARG A 449     -75.037 108.203  51.152  1.00  0.26           C  
ATOM   3495  NH1 ARG A 449     -76.277 107.724  51.091  1.00  0.26           N  
ATOM   3496  NH2 ARG A 449     -74.018 107.350  51.143  1.00  0.26           N  
ATOM   3497  N   CYS A 450     -70.631 115.279  50.845  1.00  0.30           N  
ATOM   3498  CA  CYS A 450     -69.366 115.986  50.992  1.00  0.30           C  
ATOM   3499  C   CYS A 450     -68.174 115.044  50.929  1.00  0.30           C  
ATOM   3500  O   CYS A 450     -67.100 115.314  51.468  1.00  0.30           O  
ATOM   3501  CB  CYS A 450     -69.285 116.948  52.218  1.00  0.30           C  
ATOM   3502  SG  CYS A 450     -70.592 118.223  52.209  1.00  0.30           S  
ATOM   3503  N   SER A 451     -68.322 113.902  50.232  1.00  0.32           N  
ATOM   3504  CA  SER A 451     -67.289 112.894  50.127  1.00  0.32           C  
ATOM   3505  C   SER A 451     -66.778 112.857  48.694  1.00  0.32           C  
ATOM   3506  O   SER A 451     -67.349 113.459  47.782  1.00  0.32           O  
ATOM   3507  CB  SER A 451     -67.685 111.513  50.769  1.00  0.32           C  
ATOM   3508  OG  SER A 451     -68.952 110.975  50.384  1.00  0.32           O  
ATOM   3509  N   ALA A 452     -65.611 112.234  48.431  1.00  0.39           N  
ATOM   3510  CA  ALA A 452     -65.062 112.072  47.089  1.00  0.39           C  
ATOM   3511  C   ALA A 452     -65.886 111.155  46.182  1.00  0.39           C  
ATOM   3512  O   ALA A 452     -66.084 111.444  45.006  1.00  0.39           O  
ATOM   3513  CB  ALA A 452     -63.628 111.507  47.168  1.00  0.39           C  
ATOM   3514  N   SER A 453     -66.411 110.023  46.702  1.00  0.38           N  
ATOM   3515  CA  SER A 453     -67.188 109.074  45.906  1.00  0.38           C  
ATOM   3516  C   SER A 453     -68.158 108.251  46.753  1.00  0.38           C  
ATOM   3517  O   SER A 453     -67.992 108.080  47.961  1.00  0.38           O  
ATOM   3518  CB  SER A 453     -66.321 108.158  45.001  1.00  0.38           C  
ATOM   3519  OG  SER A 453     -65.479 107.281  45.752  1.00  0.38           O  
ATOM   3520  N   VAL A 454     -69.253 107.767  46.118  1.00  0.38           N  
ATOM   3521  CA  VAL A 454     -70.225 106.844  46.700  1.00  0.38           C  
ATOM   3522  C   VAL A 454     -70.272 105.695  45.715  1.00  0.38           C  
ATOM   3523  O   VAL A 454     -70.752 105.825  44.588  1.00  0.38           O  
ATOM   3524  CB  VAL A 454     -71.626 107.453  46.920  1.00  0.38           C  
ATOM   3525  CG1 VAL A 454     -72.692 106.408  47.326  1.00  0.38           C  
ATOM   3526  CG2 VAL A 454     -71.530 108.453  48.085  1.00  0.38           C  
ATOM   3527  N   LEU A 455     -69.710 104.538  46.104  1.00  0.43           N  
ATOM   3528  CA  LEU A 455     -69.722 103.290  45.360  1.00  0.43           C  
ATOM   3529  C   LEU A 455     -71.159 102.691  45.322  1.00  0.43           C  
ATOM   3530  O   LEU A 455     -71.788 102.602  46.380  1.00  0.43           O  
ATOM   3531  CB  LEU A 455     -68.650 102.334  45.992  1.00  0.43           C  
ATOM   3532  CG  LEU A 455     -68.182 101.139  45.130  1.00  0.43           C  
ATOM   3533  CD1 LEU A 455     -66.994 101.523  44.246  1.00  0.43           C  
ATOM   3534  CD2 LEU A 455     -67.641  99.950  45.938  1.00  0.43           C  
ATOM   3535  N   PRO A 456     -71.760 102.309  44.180  1.00  0.49           N  
ATOM   3536  CA  PRO A 456     -72.870 101.344  44.081  1.00  0.49           C  
ATOM   3537  C   PRO A 456     -72.488  99.930  44.523  1.00  0.49           C  
ATOM   3538  O   PRO A 456     -71.429  99.726  45.112  1.00  0.49           O  
ATOM   3539  CB  PRO A 456     -73.194 101.318  42.560  1.00  0.49           C  
ATOM   3540  CG  PRO A 456     -72.466 102.522  41.960  1.00  0.49           C  
ATOM   3541  CD  PRO A 456     -71.255 102.651  42.861  1.00  0.49           C  
ATOM   3542  N   VAL A 457     -73.336  98.927  44.201  1.00  0.49           N  
ATOM   3543  CA  VAL A 457     -73.116  97.507  44.455  1.00  0.49           C  
ATOM   3544  C   VAL A 457     -72.822  96.797  43.131  1.00  0.49           C  
ATOM   3545  O   VAL A 457     -72.304  97.412  42.200  1.00  0.49           O  
ATOM   3546  CB  VAL A 457     -74.284  96.862  45.223  1.00  0.49           C  
ATOM   3547  CG1 VAL A 457     -74.404  97.587  46.580  1.00  0.49           C  
ATOM   3548  CG2 VAL A 457     -75.625  96.940  44.451  1.00  0.49           C  
ATOM   3549  N   ASP A 458     -73.147  95.489  43.021  1.00  0.54           N  
ATOM   3550  CA  ASP A 458     -73.002  94.668  41.837  1.00  0.54           C  
ATOM   3551  C   ASP A 458     -74.287  93.847  41.721  1.00  0.54           C  
ATOM   3552  O   ASP A 458     -75.073  93.754  42.667  1.00  0.54           O  
ATOM   3553  CB  ASP A 458     -71.774  93.712  41.938  1.00  0.54           C  
ATOM   3554  CG  ASP A 458     -71.294  93.224  40.568  1.00  0.54           C  
ATOM   3555  OD1 ASP A 458     -72.020  93.411  39.547  1.00  0.54           O  
ATOM   3556  OD2 ASP A 458     -70.195  92.629  40.529  1.00  0.54           O  
ATOM   3557  N   VAL A 459     -74.506  93.239  40.548  1.00  0.52           N  
ATOM   3558  CA  VAL A 459     -75.646  92.422  40.169  1.00  0.52           C  
ATOM   3559  C   VAL A 459     -75.102  91.214  39.384  1.00  0.52           C  
ATOM   3560  O   VAL A 459     -75.844  90.281  39.052  1.00  0.52           O  
ATOM   3561  CB  VAL A 459     -76.671  93.292  39.390  1.00  0.52           C  
ATOM   3562  CG1 VAL A 459     -77.743  92.520  38.581  1.00  0.52           C  
ATOM   3563  CG2 VAL A 459     -77.419  94.180  40.409  1.00  0.52           C  
ATOM   3564  N   GLN A 460     -73.783  91.131  39.084  1.00  0.50           N  
ATOM   3565  CA  GLN A 460     -73.230  90.194  38.116  1.00  0.50           C  
ATOM   3566  C   GLN A 460     -71.893  89.607  38.562  1.00  0.50           C  
ATOM   3567  O   GLN A 460     -71.613  89.478  39.752  1.00  0.50           O  
ATOM   3568  CB  GLN A 460     -73.269  90.766  36.665  1.00  0.50           C  
ATOM   3569  CG  GLN A 460     -74.689  90.656  36.065  1.00  0.50           C  
ATOM   3570  CD  GLN A 460     -74.781  91.222  34.660  1.00  0.50           C  
ATOM   3571  OE1 GLN A 460     -74.056  92.108  34.211  1.00  0.50           O  
ATOM   3572  NE2 GLN A 460     -75.767  90.716  33.886  1.00  0.50           N  
ATOM   3573  N   THR A 461     -71.124  89.035  37.622  1.00  0.46           N  
ATOM   3574  CA  THR A 461     -70.443  87.774  37.857  1.00  0.46           C  
ATOM   3575  C   THR A 461     -69.843  87.313  36.545  1.00  0.46           C  
ATOM   3576  O   THR A 461     -69.796  88.049  35.557  1.00  0.46           O  
ATOM   3577  CB  THR A 461     -71.359  86.690  38.494  1.00  0.46           C  
ATOM   3578  OG1 THR A 461     -70.700  85.477  38.843  1.00  0.46           O  
ATOM   3579  CG2 THR A 461     -72.557  86.334  37.592  1.00  0.46           C  
ATOM   3580  N   LEU A 462     -69.302  86.091  36.528  1.00  0.40           N  
ATOM   3581  CA  LEU A 462     -68.512  85.501  35.472  1.00  0.40           C  
ATOM   3582  C   LEU A 462     -69.186  85.382  34.129  1.00  0.40           C  
ATOM   3583  O   LEU A 462     -70.363  85.045  33.984  1.00  0.40           O  
ATOM   3584  CB  LEU A 462     -67.987  84.091  35.851  1.00  0.40           C  
ATOM   3585  CG  LEU A 462     -67.223  84.030  37.189  1.00  0.40           C  
ATOM   3586  CD1 LEU A 462     -66.936  82.560  37.535  1.00  0.40           C  
ATOM   3587  CD2 LEU A 462     -65.914  84.839  37.159  1.00  0.40           C  
ATOM   3588  N   ASN A 463     -68.397  85.604  33.082  1.00  0.48           N  
ATOM   3589  CA  ASN A 463     -68.816  85.371  31.742  1.00  0.48           C  
ATOM   3590  C   ASN A 463     -67.552  84.867  31.092  1.00  0.48           C  
ATOM   3591  O   ASN A 463     -66.469  85.034  31.676  1.00  0.48           O  
ATOM   3592  CB  ASN A 463     -69.397  86.701  31.185  1.00  0.48           C  
ATOM   3593  CG  ASN A 463     -70.067  86.521  29.835  1.00  0.48           C  
ATOM   3594  OD1 ASN A 463     -69.415  86.387  28.796  1.00  0.48           O  
ATOM   3595  ND2 ASN A 463     -71.416  86.509  29.818  1.00  0.48           N  
ATOM   3596  N   SER A 464     -67.620  84.214  29.932  1.00  0.47           N  
ATOM   3597  CA  SER A 464     -66.498  83.838  29.078  1.00  0.47           C  
ATOM   3598  C   SER A 464     -67.060  82.842  28.090  1.00  0.47           C  
ATOM   3599  O   SER A 464     -67.387  81.709  28.443  1.00  0.47           O  
ATOM   3600  CB  SER A 464     -65.220  83.236  29.751  1.00  0.47           C  
ATOM   3601  OG  SER A 464     -64.197  82.986  28.789  1.00  0.47           O  
ATOM   3602  N   SER A 465     -67.250  83.257  26.821  1.00  0.44           N  
ATOM   3603  CA  SER A 465     -67.841  82.408  25.794  1.00  0.44           C  
ATOM   3604  C   SER A 465     -66.778  82.074  24.774  1.00  0.44           C  
ATOM   3605  O   SER A 465     -66.646  82.750  23.758  1.00  0.44           O  
ATOM   3606  CB  SER A 465     -69.041  83.068  25.057  1.00  0.44           C  
ATOM   3607  OG  SER A 465     -69.691  82.144  24.177  1.00  0.44           O  
ATOM   3608  N   GLY A 466     -65.968  81.027  25.035  1.00  0.49           N  
ATOM   3609  CA  GLY A 466     -64.785  80.677  24.249  1.00  0.49           C  
ATOM   3610  C   GLY A 466     -63.810  81.819  23.989  1.00  0.49           C  
ATOM   3611  O   GLY A 466     -63.167  82.238  24.953  1.00  0.49           O  
ATOM   3612  N   PRO A 467     -63.573  82.321  22.775  1.00  0.55           N  
ATOM   3613  CA  PRO A 467     -62.821  83.557  22.559  1.00  0.55           C  
ATOM   3614  C   PRO A 467     -63.299  84.814  23.308  1.00  0.55           C  
ATOM   3615  O   PRO A 467     -64.508  85.020  23.420  1.00  0.55           O  
ATOM   3616  CB  PRO A 467     -62.772  83.716  21.028  1.00  0.55           C  
ATOM   3617  CG  PRO A 467     -64.016  82.971  20.524  1.00  0.55           C  
ATOM   3618  CD  PRO A 467     -64.256  81.868  21.558  1.00  0.55           C  
ATOM   3619  N   PRO A 468     -62.432  85.699  23.806  1.00  0.59           N  
ATOM   3620  CA  PRO A 468     -60.988  85.783  23.564  1.00  0.59           C  
ATOM   3621  C   PRO A 468     -60.181  84.683  24.245  1.00  0.59           C  
ATOM   3622  O   PRO A 468     -60.587  84.129  25.261  1.00  0.59           O  
ATOM   3623  CB  PRO A 468     -60.613  87.149  24.163  1.00  0.59           C  
ATOM   3624  CG  PRO A 468     -61.616  87.308  25.314  1.00  0.59           C  
ATOM   3625  CD  PRO A 468     -62.904  86.741  24.714  1.00  0.59           C  
ATOM   3626  N   PHE A 469     -59.009  84.335  23.692  1.00  0.52           N  
ATOM   3627  CA  PHE A 469     -58.161  83.300  24.242  1.00  0.52           C  
ATOM   3628  C   PHE A 469     -57.039  84.061  24.879  1.00  0.52           C  
ATOM   3629  O   PHE A 469     -56.479  84.979  24.287  1.00  0.52           O  
ATOM   3630  CB  PHE A 469     -57.568  82.330  23.179  1.00  0.52           C  
ATOM   3631  CG  PHE A 469     -58.551  81.234  22.864  1.00  0.52           C  
ATOM   3632  CD1 PHE A 469     -59.778  81.526  22.248  1.00  0.52           C  
ATOM   3633  CD2 PHE A 469     -58.250  79.892  23.167  1.00  0.52           C  
ATOM   3634  CE1 PHE A 469     -60.689  80.506  21.950  1.00  0.52           C  
ATOM   3635  CE2 PHE A 469     -59.149  78.865  22.845  1.00  0.52           C  
ATOM   3636  CZ  PHE A 469     -60.379  79.174  22.249  1.00  0.52           C  
ATOM   3637  N   GLY A 470     -56.707  83.721  26.130  1.00  0.55           N  
ATOM   3638  CA  GLY A 470     -55.655  84.401  26.865  1.00  0.55           C  
ATOM   3639  C   GLY A 470     -56.091  85.668  27.562  1.00  0.55           C  
ATOM   3640  O   GLY A 470     -55.270  86.383  28.129  1.00  0.55           O  
ATOM   3641  N   LYS A 471     -57.400  85.969  27.566  1.00  0.65           N  
ATOM   3642  CA  LYS A 471     -57.968  87.110  28.249  1.00  0.65           C  
ATOM   3643  C   LYS A 471     -59.238  86.657  28.928  1.00  0.65           C  
ATOM   3644  O   LYS A 471     -60.105  86.049  28.307  1.00  0.65           O  
ATOM   3645  CB  LYS A 471     -58.347  88.238  27.258  1.00  0.65           C  
ATOM   3646  CG  LYS A 471     -57.160  89.121  26.852  1.00  0.65           C  
ATOM   3647  CD  LYS A 471     -57.640  90.328  26.021  1.00  0.65           C  
ATOM   3648  CE  LYS A 471     -56.553  91.392  25.814  1.00  0.65           C  
ATOM   3649  NZ  LYS A 471     -57.124  92.715  25.433  1.00  0.65           N  
ATOM   3650  N   LEU A 472     -59.395  86.947  30.228  1.00  0.68           N  
ATOM   3651  CA  LEU A 472     -60.605  86.631  30.958  1.00  0.68           C  
ATOM   3652  C   LEU A 472     -61.546  87.834  30.866  1.00  0.68           C  
ATOM   3653  O   LEU A 472     -61.097  88.982  30.933  1.00  0.68           O  
ATOM   3654  CB  LEU A 472     -60.235  86.237  32.415  1.00  0.68           C  
ATOM   3655  CG  LEU A 472     -61.301  85.402  33.160  1.00  0.68           C  
ATOM   3656  CD1 LEU A 472     -60.664  84.598  34.301  1.00  0.68           C  
ATOM   3657  CD2 LEU A 472     -62.411  86.264  33.766  1.00  0.68           C  
ATOM   3658  N   VAL A 473     -62.863  87.607  30.656  1.00  0.75           N  
ATOM   3659  CA  VAL A 473     -63.867  88.651  30.524  1.00  0.75           C  
ATOM   3660  C   VAL A 473     -64.721  88.737  31.791  1.00  0.75           C  
ATOM   3661  O   VAL A 473     -65.146  87.739  32.370  1.00  0.75           O  
ATOM   3662  CB  VAL A 473     -64.770  88.487  29.294  1.00  0.75           C  
ATOM   3663  CG1 VAL A 473     -63.937  88.359  28.008  1.00  0.75           C  
ATOM   3664  CG2 VAL A 473     -65.637  87.223  29.371  1.00  0.75           C  
ATOM   3665  N   VAL A 474     -64.993  89.959  32.269  1.00  0.72           N  
ATOM   3666  CA  VAL A 474     -65.747  90.234  33.480  1.00  0.72           C  
ATOM   3667  C   VAL A 474     -67.018  90.946  33.090  1.00  0.72           C  
ATOM   3668  O   VAL A 474     -67.055  91.716  32.126  1.00  0.72           O  
ATOM   3669  CB  VAL A 474     -64.968  91.133  34.427  1.00  0.72           C  
ATOM   3670  CG1 VAL A 474     -64.700  92.495  33.752  1.00  0.72           C  
ATOM   3671  CG2 VAL A 474     -65.663  91.320  35.795  1.00  0.72           C  
ATOM   3672  N   GLN A 475     -68.114  90.710  33.816  1.00  0.69           N  
ATOM   3673  CA  GLN A 475     -69.359  91.355  33.537  1.00  0.69           C  
ATOM   3674  C   GLN A 475     -69.937  91.828  34.868  1.00  0.69           C  
ATOM   3675  O   GLN A 475     -70.185  91.003  35.746  1.00  0.69           O  
ATOM   3676  CB  GLN A 475     -70.218  90.276  32.837  1.00  0.69           C  
ATOM   3677  CG  GLN A 475     -71.630  90.752  32.487  1.00  0.69           C  
ATOM   3678  CD  GLN A 475     -72.447  89.649  31.833  1.00  0.69           C  
ATOM   3679  OE1 GLN A 475     -72.056  88.499  31.650  1.00  0.69           O  
ATOM   3680  NE2 GLN A 475     -73.692  90.007  31.472  1.00  0.69           N  
ATOM   3681  N   SER A 476     -70.160  93.137  35.100  1.00  0.76           N  
ATOM   3682  CA  SER A 476     -70.786  93.653  36.323  1.00  0.76           C  
ATOM   3683  C   SER A 476     -71.953  94.562  35.952  1.00  0.76           C  
ATOM   3684  O   SER A 476     -72.032  95.076  34.831  1.00  0.76           O  
ATOM   3685  CB  SER A 476     -69.829  94.441  37.260  1.00  0.76           C  
ATOM   3686  OG  SER A 476     -69.379  95.647  36.641  1.00  0.76           O  
ATOM   3687  N   SER A 477     -72.897  94.796  36.886  1.00  0.73           N  
ATOM   3688  CA  SER A 477     -74.059  95.636  36.599  1.00  0.73           C  
ATOM   3689  C   SER A 477     -74.489  96.378  37.833  1.00  0.73           C  
ATOM   3690  O   SER A 477     -74.229  95.970  38.960  1.00  0.73           O  
ATOM   3691  CB  SER A 477     -75.334  94.869  36.134  1.00  0.73           C  
ATOM   3692  OG  SER A 477     -75.358  94.649  34.727  1.00  0.73           O  
ATOM   3693  N   ILE A 478     -75.213  97.490  37.638  1.00  0.71           N  
ATOM   3694  CA  ILE A 478     -75.737  98.327  38.707  1.00  0.71           C  
ATOM   3695  C   ILE A 478     -77.191  98.593  38.432  1.00  0.71           C  
ATOM   3696  O   ILE A 478     -77.681  98.364  37.327  1.00  0.71           O  
ATOM   3697  CB  ILE A 478     -75.060  99.683  38.818  1.00  0.71           C  
ATOM   3698  CG1 ILE A 478     -75.013 100.386  37.445  1.00  0.71           C  
ATOM   3699  CG2 ILE A 478     -73.658  99.434  39.404  1.00  0.71           C  
ATOM   3700  CD1 ILE A 478     -74.465 101.804  37.563  1.00  0.71           C  
ATOM   3701  N   ASP A 479     -77.930  99.071  39.443  1.00  0.70           N  
ATOM   3702  CA  ASP A 479     -79.353  99.287  39.391  1.00  0.70           C  
ATOM   3703  C   ASP A 479     -79.795 100.656  38.867  1.00  0.70           C  
ATOM   3704  O   ASP A 479     -80.701 100.722  38.043  1.00  0.70           O  
ATOM   3705  CB  ASP A 479     -79.992  98.952  40.769  1.00  0.70           C  
ATOM   3706  CG  ASP A 479     -79.214  99.521  41.949  1.00  0.70           C  
ATOM   3707  OD1 ASP A 479     -79.440  99.011  43.070  1.00  0.70           O  
ATOM   3708  OD2 ASP A 479     -78.366 100.433  41.742  1.00  0.70           O  
ATOM   3709  N   SER A 480     -79.197 101.776  39.337  1.00  0.62           N  
ATOM   3710  CA  SER A 480     -79.475 103.152  38.886  1.00  0.62           C  
ATOM   3711  C   SER A 480     -80.811 103.707  39.418  1.00  0.62           C  
ATOM   3712  O   SER A 480     -81.100 104.903  39.351  1.00  0.62           O  
ATOM   3713  CB  SER A 480     -79.321 103.289  37.329  1.00  0.62           C  
ATOM   3714  OG  SER A 480     -79.503 104.595  36.791  1.00  0.62           O  
ATOM   3715  N   SER A 481     -81.647 102.863  40.072  1.00  0.54           N  
ATOM   3716  CA  SER A 481     -82.941 103.221  40.668  1.00  0.54           C  
ATOM   3717  C   SER A 481     -82.806 103.913  42.010  1.00  0.54           C  
ATOM   3718  O   SER A 481     -83.396 103.525  43.018  1.00  0.54           O  
ATOM   3719  CB  SER A 481     -83.921 102.027  40.794  1.00  0.54           C  
ATOM   3720  OG  SER A 481     -84.255 101.577  39.480  1.00  0.54           O  
ATOM   3721  N   ALA A 482     -82.041 105.013  41.992  1.00  0.45           N  
ATOM   3722  CA  ALA A 482     -81.679 105.885  43.081  1.00  0.45           C  
ATOM   3723  C   ALA A 482     -80.880 107.030  42.465  1.00  0.45           C  
ATOM   3724  O   ALA A 482     -79.861 106.850  41.797  1.00  0.45           O  
ATOM   3725  CB  ALA A 482     -80.896 105.176  44.211  1.00  0.45           C  
ATOM   3726  N   PHE A 483     -81.418 108.250  42.594  1.00  0.34           N  
ATOM   3727  CA  PHE A 483     -81.318 109.375  41.688  1.00  0.34           C  
ATOM   3728  C   PHE A 483     -80.280 110.405  42.149  1.00  0.34           C  
ATOM   3729  O   PHE A 483     -79.303 110.108  42.819  1.00  0.34           O  
ATOM   3730  CB  PHE A 483     -82.772 109.981  41.512  1.00  0.34           C  
ATOM   3731  CG  PHE A 483     -83.586 110.127  42.798  1.00  0.34           C  
ATOM   3732  CD1 PHE A 483     -84.215 108.997  43.361  1.00  0.34           C  
ATOM   3733  CD2 PHE A 483     -83.807 111.374  43.415  1.00  0.34           C  
ATOM   3734  CE1 PHE A 483     -84.906 109.076  44.577  1.00  0.34           C  
ATOM   3735  CE2 PHE A 483     -84.506 111.464  44.632  1.00  0.34           C  
ATOM   3736  CZ  PHE A 483     -85.035 110.310  45.225  1.00  0.34           C  
ATOM   3737  N   LYS A 484     -80.543 111.665  41.750  1.00  0.36           N  
ATOM   3738  CA  LYS A 484     -79.996 112.932  42.302  1.00  0.36           C  
ATOM   3739  C   LYS A 484     -79.085 113.957  41.637  1.00  0.36           C  
ATOM   3740  O   LYS A 484     -78.208 114.516  42.314  1.00  0.36           O  
ATOM   3741  CB  LYS A 484     -79.754 112.959  43.826  1.00  0.36           C  
ATOM   3742  CG  LYS A 484     -81.043 112.958  44.646  1.00  0.36           C  
ATOM   3743  CD  LYS A 484     -80.756 112.848  46.136  1.00  0.36           C  
ATOM   3744  CE  LYS A 484     -81.985 113.103  47.001  1.00  0.36           C  
ATOM   3745  NZ  LYS A 484     -81.567 113.105  48.417  1.00  0.36           N  
ATOM   3746  N   HIS A 485     -78.968 113.880  40.267  1.00  0.35           N  
ATOM   3747  CA  HIS A 485     -77.916 114.649  39.565  1.00  0.35           C  
ATOM   3748  C   HIS A 485     -77.566 116.127  40.022  1.00  0.35           C  
ATOM   3749  O   HIS A 485     -78.318 116.747  40.776  1.00  0.35           O  
ATOM   3750  CB  HIS A 485     -78.148 114.489  38.044  1.00  0.35           C  
ATOM   3751  CG  HIS A 485     -79.333 115.225  37.546  1.00  0.35           C  
ATOM   3752  ND1 HIS A 485     -79.286 116.597  37.460  1.00  0.35           N  
ATOM   3753  CD2 HIS A 485     -80.564 114.768  37.204  1.00  0.35           C  
ATOM   3754  CE1 HIS A 485     -80.490 116.962  37.079  1.00  0.35           C  
ATOM   3755  NE2 HIS A 485     -81.306 115.891  36.902  1.00  0.35           N  
ATOM   3756  N   ASN A 486     -76.439 116.802  39.659  1.00  0.39           N  
ATOM   3757  CA  ASN A 486     -75.379 116.469  38.711  1.00  0.39           C  
ATOM   3758  C   ASN A 486     -74.582 115.238  39.134  1.00  0.39           C  
ATOM   3759  O   ASN A 486     -74.049 115.117  40.227  1.00  0.39           O  
ATOM   3760  CB  ASN A 486     -74.453 117.659  38.279  1.00  0.39           C  
ATOM   3761  CG  ASN A 486     -73.544 117.218  37.126  1.00  0.39           C  
ATOM   3762  OD1 ASN A 486     -72.534 116.539  37.297  1.00  0.39           O  
ATOM   3763  ND2 ASN A 486     -73.928 117.535  35.870  1.00  0.39           N  
ATOM   3764  N   GLY A 487     -74.496 114.233  38.242  1.00  0.44           N  
ATOM   3765  CA  GLY A 487     -73.808 113.021  38.628  1.00  0.44           C  
ATOM   3766  C   GLY A 487     -73.203 112.206  37.538  1.00  0.44           C  
ATOM   3767  O   GLY A 487     -73.588 112.241  36.382  1.00  0.44           O  
ATOM   3768  N   THR A 488     -72.217 111.401  37.970  1.00  0.49           N  
ATOM   3769  CA  THR A 488     -71.336 110.644  37.104  1.00  0.49           C  
ATOM   3770  C   THR A 488     -71.386 109.222  37.554  1.00  0.49           C  
ATOM   3771  O   THR A 488     -71.083 108.926  38.708  1.00  0.49           O  
ATOM   3772  CB  THR A 488     -69.898 111.130  37.187  1.00  0.49           C  
ATOM   3773  OG1 THR A 488     -69.869 112.495  36.805  1.00  0.49           O  
ATOM   3774  CG2 THR A 488     -68.981 110.376  36.217  1.00  0.49           C  
ATOM   3775  N   VAL A 489     -71.815 108.323  36.654  1.00  0.68           N  
ATOM   3776  CA  VAL A 489     -71.832 106.889  36.838  1.00  0.68           C  
ATOM   3777  C   VAL A 489     -70.593 106.317  36.157  1.00  0.68           C  
ATOM   3778  O   VAL A 489     -70.539 106.159  34.937  1.00  0.68           O  
ATOM   3779  CB  VAL A 489     -73.087 106.269  36.237  1.00  0.68           C  
ATOM   3780  CG1 VAL A 489     -73.076 104.751  36.480  1.00  0.68           C  
ATOM   3781  CG2 VAL A 489     -74.338 106.884  36.898  1.00  0.68           C  
ATOM   3782  N   GLU A 490     -69.550 105.995  36.941  1.00  0.67           N  
ATOM   3783  CA  GLU A 490     -68.265 105.586  36.408  1.00  0.67           C  
ATOM   3784  C   GLU A 490     -68.074 104.124  36.607  1.00  0.67           C  
ATOM   3785  O   GLU A 490     -67.876 103.650  37.716  1.00  0.67           O  
ATOM   3786  CB  GLU A 490     -67.090 106.287  37.128  1.00  0.67           C  
ATOM   3787  CG  GLU A 490     -65.675 105.801  36.685  1.00  0.67           C  
ATOM   3788  CD  GLU A 490     -64.551 106.760  37.092  1.00  0.67           C  
ATOM   3789  OE1 GLU A 490     -64.855 107.890  37.546  1.00  0.67           O  
ATOM   3790  OE2 GLU A 490     -63.370 106.326  36.968  1.00  0.67           O  
ATOM   3791  N   CYS A 491     -68.099 103.343  35.530  1.00  0.75           N  
ATOM   3792  CA  CYS A 491     -67.691 101.972  35.640  1.00  0.75           C  
ATOM   3793  C   CYS A 491     -66.229 101.847  35.358  1.00  0.75           C  
ATOM   3794  O   CYS A 491     -65.773 102.044  34.227  1.00  0.75           O  
ATOM   3795  CB  CYS A 491     -68.444 101.152  34.605  1.00  0.75           C  
ATOM   3796  SG  CYS A 491     -68.155  99.398  34.762  1.00  0.75           S  
ATOM   3797  N   LYS A 492     -65.466 101.487  36.379  1.00  0.75           N  
ATOM   3798  CA  LYS A 492     -64.053 101.390  36.276  1.00  0.75           C  
ATOM   3799  C   LYS A 492     -63.633  99.939  36.345  1.00  0.75           C  
ATOM   3800  O   LYS A 492     -63.816  99.255  37.350  1.00  0.75           O  
ATOM   3801  CB  LYS A 492     -63.423 102.157  37.435  1.00  0.75           C  
ATOM   3802  CG  LYS A 492     -61.901 102.102  37.320  1.00  0.75           C  
ATOM   3803  CD  LYS A 492     -61.251 103.035  38.333  1.00  0.75           C  
ATOM   3804  CE  LYS A 492     -61.334 102.468  39.752  1.00  0.75           C  
ATOM   3805  NZ  LYS A 492     -60.833 103.471  40.711  1.00  0.75           N  
ATOM   3806  N   ALA A 493     -63.018  99.432  35.273  1.00  0.82           N  
ATOM   3807  CA  ALA A 493     -62.410  98.131  35.229  1.00  0.82           C  
ATOM   3808  C   ALA A 493     -60.976  98.238  35.686  1.00  0.82           C  
ATOM   3809  O   ALA A 493     -60.312  99.224  35.379  1.00  0.82           O  
ATOM   3810  CB  ALA A 493     -62.394  97.649  33.764  1.00  0.82           C  
ATOM   3811  N   TYR A 494     -60.447  97.251  36.427  1.00  0.78           N  
ATOM   3812  CA  TYR A 494     -59.051  97.273  36.804  1.00  0.78           C  
ATOM   3813  C   TYR A 494     -58.552  95.892  37.171  1.00  0.78           C  
ATOM   3814  O   TYR A 494     -59.319  94.998  37.493  1.00  0.78           O  
ATOM   3815  CB  TYR A 494     -58.710  98.303  37.933  1.00  0.78           C  
ATOM   3816  CG  TYR A 494     -59.285  97.911  39.262  1.00  0.78           C  
ATOM   3817  CD1 TYR A 494     -60.661  98.041  39.519  1.00  0.78           C  
ATOM   3818  CD2 TYR A 494     -58.455  97.301  40.219  1.00  0.78           C  
ATOM   3819  CE1 TYR A 494     -61.203  97.513  40.698  1.00  0.78           C  
ATOM   3820  CE2 TYR A 494     -58.991  96.819  41.418  1.00  0.78           C  
ATOM   3821  CZ  TYR A 494     -60.369  96.906  41.645  1.00  0.78           C  
ATOM   3822  OH  TYR A 494     -60.911  96.299  42.791  1.00  0.78           O  
ATOM   3823  N   ASN A 495     -57.238  95.672  37.159  1.00  0.75           N  
ATOM   3824  CA  ASN A 495     -56.647  94.457  37.680  1.00  0.75           C  
ATOM   3825  C   ASN A 495     -55.296  94.884  38.251  1.00  0.75           C  
ATOM   3826  O   ASN A 495     -55.061  96.084  38.413  1.00  0.75           O  
ATOM   3827  CB  ASN A 495     -56.593  93.322  36.607  1.00  0.75           C  
ATOM   3828  CG  ASN A 495     -55.951  93.796  35.311  1.00  0.75           C  
ATOM   3829  OD1 ASN A 495     -54.964  94.540  35.304  1.00  0.75           O  
ATOM   3830  ND2 ASN A 495     -56.482  93.373  34.147  1.00  0.75           N  
ATOM   3831  N   ASP A 496     -54.376  93.950  38.561  1.00  0.75           N  
ATOM   3832  CA  ASP A 496     -53.006  94.223  38.985  1.00  0.75           C  
ATOM   3833  C   ASP A 496     -52.122  95.003  37.980  1.00  0.75           C  
ATOM   3834  O   ASP A 496     -51.015  95.429  38.305  1.00  0.75           O  
ATOM   3835  CB  ASP A 496     -52.314  92.860  39.261  1.00  0.75           C  
ATOM   3836  CG  ASP A 496     -52.896  92.130  40.466  1.00  0.75           C  
ATOM   3837  OD1 ASP A 496     -53.664  92.741  41.249  1.00  0.75           O  
ATOM   3838  OD2 ASP A 496     -52.581  90.919  40.583  1.00  0.75           O  
ATOM   3839  N   VAL A 497     -52.574  95.195  36.720  1.00  0.74           N  
ATOM   3840  CA  VAL A 497     -51.863  95.896  35.656  1.00  0.74           C  
ATOM   3841  C   VAL A 497     -52.449  97.273  35.389  1.00  0.74           C  
ATOM   3842  O   VAL A 497     -51.769  98.292  35.501  1.00  0.74           O  
ATOM   3843  CB  VAL A 497     -51.889  95.076  34.360  1.00  0.74           C  
ATOM   3844  CG1 VAL A 497     -51.176  95.801  33.192  1.00  0.74           C  
ATOM   3845  CG2 VAL A 497     -51.198  93.733  34.661  1.00  0.74           C  
ATOM   3846  N   GLY A 498     -53.729  97.363  34.968  1.00  0.75           N  
ATOM   3847  CA  GLY A 498     -54.251  98.627  34.458  1.00  0.75           C  
ATOM   3848  C   GLY A 498     -55.661  98.886  34.860  1.00  0.75           C  
ATOM   3849  O   GLY A 498     -56.314  98.047  35.465  1.00  0.75           O  
ATOM   3850  N   LYS A 499     -56.188 100.069  34.490  1.00  0.75           N  
ATOM   3851  CA  LYS A 499     -57.563 100.421  34.768  1.00  0.75           C  
ATOM   3852  C   LYS A 499     -58.167 101.210  33.611  1.00  0.75           C  
ATOM   3853  O   LYS A 499     -57.582 102.194  33.147  1.00  0.75           O  
ATOM   3854  CB  LYS A 499     -57.689 101.192  36.118  1.00  0.75           C  
ATOM   3855  CG  LYS A 499     -57.069 102.605  36.151  1.00  0.75           C  
ATOM   3856  CD  LYS A 499     -56.989 103.168  37.585  1.00  0.75           C  
ATOM   3857  CE  LYS A 499     -57.004 104.703  37.675  1.00  0.75           C  
ATOM   3858  NZ  LYS A 499     -55.834 105.270  36.970  1.00  0.75           N  
ATOM   3859  N   THR A 500     -59.342 100.799  33.094  1.00  0.81           N  
ATOM   3860  CA  THR A 500     -60.037 101.459  31.985  1.00  0.81           C  
ATOM   3861  C   THR A 500     -61.441 101.764  32.438  1.00  0.81           C  
ATOM   3862  O   THR A 500     -61.925 101.167  33.397  1.00  0.81           O  
ATOM   3863  CB  THR A 500     -60.107 100.661  30.674  1.00  0.81           C  
ATOM   3864  OG1 THR A 500     -60.348 101.516  29.567  1.00  0.81           O  
ATOM   3865  CG2 THR A 500     -61.193  99.563  30.648  1.00  0.81           C  
ATOM   3866  N   SER A 501     -62.141 102.688  31.761  1.00  0.79           N  
ATOM   3867  CA  SER A 501     -63.435 103.163  32.216  1.00  0.79           C  
ATOM   3868  C   SER A 501     -64.280 103.511  31.010  1.00  0.79           C  
ATOM   3869  O   SER A 501     -63.770 103.974  29.990  1.00  0.79           O  
ATOM   3870  CB  SER A 501     -63.375 104.454  33.092  1.00  0.79           C  
ATOM   3871  OG  SER A 501     -62.698 104.250  34.335  1.00  0.79           O  
ATOM   3872  N   ALA A 502     -65.608 103.312  31.106  1.00  0.74           N  
ATOM   3873  CA  ALA A 502     -66.593 103.750  30.132  1.00  0.74           C  
ATOM   3874  C   ALA A 502     -67.697 104.416  30.944  1.00  0.74           C  
ATOM   3875  O   ALA A 502     -67.835 104.145  32.139  1.00  0.74           O  
ATOM   3876  CB  ALA A 502     -67.206 102.581  29.318  1.00  0.74           C  
ATOM   3877  N   TYR A 503     -68.500 105.319  30.337  1.00  0.69           N  
ATOM   3878  CA  TYR A 503     -69.378 106.200  31.096  1.00  0.69           C  
ATOM   3879  C   TYR A 503     -70.791 106.212  30.566  1.00  0.69           C  
ATOM   3880  O   TYR A 503     -71.041 106.301  29.364  1.00  0.69           O  
ATOM   3881  CB  TYR A 503     -68.896 107.673  31.124  1.00  0.69           C  
ATOM   3882  CG  TYR A 503     -67.577 107.726  31.821  1.00  0.69           C  
ATOM   3883  CD1 TYR A 503     -67.541 107.748  33.224  1.00  0.69           C  
ATOM   3884  CD2 TYR A 503     -66.374 107.730  31.094  1.00  0.69           C  
ATOM   3885  CE1 TYR A 503     -66.312 107.836  33.887  1.00  0.69           C  
ATOM   3886  CE2 TYR A 503     -65.142 107.739  31.765  1.00  0.69           C  
ATOM   3887  CZ  TYR A 503     -65.117 107.798  33.163  1.00  0.69           C  
ATOM   3888  OH  TYR A 503     -63.900 107.818  33.862  1.00  0.69           O  
ATOM   3889  N   PHE A 504     -71.754 106.152  31.501  1.00  0.62           N  
ATOM   3890  CA  PHE A 504     -73.170 106.308  31.249  1.00  0.62           C  
ATOM   3891  C   PHE A 504     -73.667 107.594  31.857  1.00  0.62           C  
ATOM   3892  O   PHE A 504     -73.063 108.186  32.749  1.00  0.62           O  
ATOM   3893  CB  PHE A 504     -74.001 105.179  31.900  1.00  0.62           C  
ATOM   3894  CG  PHE A 504     -73.756 103.910  31.159  1.00  0.62           C  
ATOM   3895  CD1 PHE A 504     -74.205 103.770  29.833  1.00  0.62           C  
ATOM   3896  CD2 PHE A 504     -73.089 102.845  31.784  1.00  0.62           C  
ATOM   3897  CE1 PHE A 504     -74.062 102.546  29.169  1.00  0.62           C  
ATOM   3898  CE2 PHE A 504     -72.942 101.623  31.118  1.00  0.62           C  
ATOM   3899  CZ  PHE A 504     -73.467 101.465  29.829  1.00  0.62           C  
ATOM   3900  N   ASN A 505     -74.834 108.041  31.381  1.00  0.55           N  
ATOM   3901  CA  ASN A 505     -75.474 109.231  31.856  1.00  0.55           C  
ATOM   3902  C   ASN A 505     -76.963 108.957  31.723  1.00  0.55           C  
ATOM   3903  O   ASN A 505     -77.394 108.131  30.908  1.00  0.55           O  
ATOM   3904  CB  ASN A 505     -74.945 110.451  31.031  1.00  0.55           C  
ATOM   3905  CG  ASN A 505     -75.687 111.765  31.272  1.00  0.55           C  
ATOM   3906  OD1 ASN A 505     -76.795 111.956  30.773  1.00  0.55           O  
ATOM   3907  ND2 ASN A 505     -75.085 112.710  32.025  1.00  0.55           N  
ATOM   3908  N   PHE A 506     -77.765 109.610  32.573  1.00  0.36           N  
ATOM   3909  CA  PHE A 506     -79.201 109.539  32.562  1.00  0.36           C  
ATOM   3910  C   PHE A 506     -79.701 110.827  33.206  1.00  0.36           C  
ATOM   3911  O   PHE A 506     -78.892 111.659  33.634  1.00  0.36           O  
ATOM   3912  CB  PHE A 506     -79.743 108.226  33.238  1.00  0.36           C  
ATOM   3913  CG  PHE A 506     -79.904 108.192  34.755  1.00  0.36           C  
ATOM   3914  CD1 PHE A 506     -80.884 107.322  35.265  1.00  0.36           C  
ATOM   3915  CD2 PHE A 506     -79.192 109.002  35.669  1.00  0.36           C  
ATOM   3916  CE1 PHE A 506     -81.198 107.311  36.629  1.00  0.36           C  
ATOM   3917  CE2 PHE A 506     -79.550 109.042  37.027  1.00  0.36           C  
ATOM   3918  CZ  PHE A 506     -80.555 108.192  37.504  1.00  0.36           C  
ATOM   3919  N   ALA A 507     -81.021 111.020  33.328  1.00  0.42           N  
ATOM   3920  CA  ALA A 507     -81.572 112.002  34.230  1.00  0.42           C  
ATOM   3921  C   ALA A 507     -82.768 111.351  34.919  1.00  0.42           C  
ATOM   3922  O   ALA A 507     -83.308 110.358  34.426  1.00  0.42           O  
ATOM   3923  CB  ALA A 507     -81.957 113.294  33.469  1.00  0.42           C  
ATOM   3924  N   PHE A 508     -83.151 111.882  36.095  1.00  0.34           N  
ATOM   3925  CA  PHE A 508     -84.394 111.600  36.788  1.00  0.34           C  
ATOM   3926  C   PHE A 508     -85.458 112.634  36.303  1.00  0.34           C  
ATOM   3927  O   PHE A 508     -85.058 113.637  35.645  1.00  0.34           O  
ATOM   3928  CB  PHE A 508     -84.155 111.755  38.326  1.00  0.34           C  
ATOM   3929  CG  PHE A 508     -85.331 111.308  39.167  1.00  0.34           C  
ATOM   3930  CD1 PHE A 508     -86.179 112.256  39.774  1.00  0.34           C  
ATOM   3931  CD2 PHE A 508     -85.610 109.941  39.340  1.00  0.34           C  
ATOM   3932  CE1 PHE A 508     -87.290 111.847  40.526  1.00  0.34           C  
ATOM   3933  CE2 PHE A 508     -86.716 109.527  40.099  1.00  0.34           C  
ATOM   3934  CZ  PHE A 508     -87.559 110.481  40.689  1.00  0.34           C  
ATOM   3935  OXT PHE A 508     -86.662 112.439  36.610  1.00  0.34           O  
TER    3936      PHE A 508                                                      
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.