CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 220606145819125505

Job options:

ID        	=	 220606145819125505
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   02-JUN-22 1MOD    1       19:46
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   MONOMER (USER)
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.88
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.84
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   7vgg
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2022-05-27
REMARK   3  SMTLE   7vgg.1.B
REMARK   3  SMTLV   2022-06-01
REMARK   3  MTHD    ELECTRON MICROSCOPY 0.00 A
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.88
REMARK   3  SIM     0.62
REMARK   3  SID     99.55
REMARK   3  OSTAT   monomer
REMARK   3  ALN B TRG MAEDMAADEVTAPPRKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHGDAEDRPSP
REMARK   3  ALN B TRG TQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKA
REMARK   3  ALN B TRG LHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRI
REMARK   3  ALN B TRG KMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVASG
REMARK   3  ALN B TRG WRHTISVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMA
REMARK   3  ALN B TRG LTSDGKLYGWGWNKFGQVGVGNNLDQCSPVQVRFPDDQKVVQVSSGWRHTLAVTERNN
REMARK   3  ALN B TRG VFAWGRGTNGQLGIGESVDRNFPKIIEALSVDGASGQHIESSNIDPSSGKSWVSPAER
REMARK   3  ALN B TRG YAVVPDETGLTDGSSKGNGGDISVPQTDVKRVRI
REMARK   3  ALN B TPL MAEDMAADEVTAPPRKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHGDAEDRPSP
REMARK   3  ALN B TPL TQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKA
REMARK   3  ALN B TPL LHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRI
REMARK   3  ALN B TPL KMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACG
REMARK   3  ALN B TPL WRHTISVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMA
REMARK   3  ALN B TPL LTSDGKLYGWGWNKFGQVGVGNNLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNN
REMARK   3  ALN B TPL VFAWGRGTNGQLGIGESVDRNFPKIIEALSVDGASGQHIESSNIDPSSGKSWVSPAER
REMARK   3  ALN B TPL YAVVPDETGLTDGSSKGNGGDISVPQTDVKRVRI
REMARK   3  ALN B OFF 28
ATOM      1  N   PRO B  13     143.936 114.477  86.231  1.00  0.47           N  
ATOM      2  CA  PRO B  13     142.920 115.606  86.163  1.00  0.47           C  
ATOM      3  C   PRO B  13     142.027 115.525  87.392  1.00  0.47           C  
ATOM      4  O   PRO B  13     142.048 114.478  88.045  1.00  0.47           O  
ATOM      5  CB  PRO B  13     142.231 115.289  84.847  1.00  0.47           C  
ATOM      6  CG  PRO B  13     142.250 113.767  84.697  1.00  0.47           C  
ATOM      7  CD  PRO B  13     143.554 113.334  85.289  1.00  0.47           C  
ATOM      8  N   PRO B  14     141.304 116.599  87.711  1.00  0.60           N  
ATOM      9  CA  PRO B  14     140.251 116.627  88.720  1.00  0.60           C  
ATOM     10  C   PRO B  14     139.082 115.739  88.364  1.00  0.60           C  
ATOM     11  O   PRO B  14     138.852 115.439  87.194  1.00  0.60           O  
ATOM     12  CB  PRO B  14     139.823 118.105  88.788  1.00  0.60           C  
ATOM     13  CG  PRO B  14     140.141 118.661  87.403  1.00  0.60           C  
ATOM     14  CD  PRO B  14     141.380 117.874  86.988  1.00  0.60           C  
ATOM     15  N   ARG B  15     138.330 115.294  89.383  1.00  0.70           N  
ATOM     16  CA  ARG B  15     137.233 114.390  89.190  1.00  0.70           C  
ATOM     17  C   ARG B  15     135.949 115.149  89.381  1.00  0.70           C  
ATOM     18  O   ARG B  15     135.611 115.574  90.479  1.00  0.70           O  
ATOM     19  CB  ARG B  15     137.355 113.250  90.206  1.00  0.70           C  
ATOM     20  CG  ARG B  15     136.646 111.969  89.763  1.00  0.70           C  
ATOM     21  CD  ARG B  15     137.259 110.711  90.371  1.00  0.70           C  
ATOM     22  NE  ARG B  15     138.600 110.494  89.738  1.00  0.70           N  
ATOM     23  CZ  ARG B  15     139.780 110.589  90.361  1.00  0.70           C  
ATOM     24  NH1 ARG B  15     139.865 110.962  91.633  1.00  0.70           N  
ATOM     25  NH2 ARG B  15     140.895 110.301  89.692  1.00  0.70           N  
ATOM     26  N   LYS B  16     135.218 115.380  88.279  1.00  0.77           N  
ATOM     27  CA  LYS B  16     134.036 116.208  88.302  1.00  0.77           C  
ATOM     28  C   LYS B  16     132.882 115.639  89.097  1.00  0.77           C  
ATOM     29  O   LYS B  16     132.708 114.430  89.221  1.00  0.77           O  
ATOM     30  CB  LYS B  16     133.544 116.529  86.874  1.00  0.77           C  
ATOM     31  CG  LYS B  16     132.830 115.357  86.183  1.00  0.77           C  
ATOM     32  CD  LYS B  16     132.545 115.604  84.696  1.00  0.77           C  
ATOM     33  CE  LYS B  16     131.338 116.500  84.405  1.00  0.77           C  
ATOM     34  NZ  LYS B  16     130.087 115.829  84.817  1.00  0.77           N  
ATOM     35  N   VAL B  17     132.025 116.528  89.617  1.00  0.90           N  
ATOM     36  CA  VAL B  17     130.839 116.126  90.334  1.00  0.90           C  
ATOM     37  C   VAL B  17     129.730 115.749  89.356  1.00  0.90           C  
ATOM     38  O   VAL B  17     129.410 116.459  88.411  1.00  0.90           O  
ATOM     39  CB  VAL B  17     130.423 117.225  91.285  1.00  0.90           C  
ATOM     40  CG1 VAL B  17     129.168 116.851  92.075  1.00  0.90           C  
ATOM     41  CG2 VAL B  17     131.551 117.474  92.296  1.00  0.90           C  
ATOM     42  N   LEU B  18     129.176 114.532  89.532  1.00  0.88           N  
ATOM     43  CA  LEU B  18     128.014 114.062  88.814  1.00  0.88           C  
ATOM     44  C   LEU B  18     126.731 114.437  89.552  1.00  0.88           C  
ATOM     45  O   LEU B  18     125.800 114.965  88.962  1.00  0.88           O  
ATOM     46  CB  LEU B  18     128.119 112.535  88.573  1.00  0.88           C  
ATOM     47  CG  LEU B  18     129.324 112.104  87.706  1.00  0.88           C  
ATOM     48  CD1 LEU B  18     129.378 110.574  87.594  1.00  0.88           C  
ATOM     49  CD2 LEU B  18     129.286 112.742  86.309  1.00  0.88           C  
ATOM     50  N   ILE B  19     126.693 114.224  90.887  1.00  0.88           N  
ATOM     51  CA  ILE B  19     125.501 114.429  91.707  1.00  0.88           C  
ATOM     52  C   ILE B  19     125.941 114.992  93.041  1.00  0.88           C  
ATOM     53  O   ILE B  19     127.029 114.693  93.526  1.00  0.88           O  
ATOM     54  CB  ILE B  19     124.691 113.134  91.924  1.00  0.88           C  
ATOM     55  CG1 ILE B  19     123.976 112.671  90.634  1.00  0.88           C  
ATOM     56  CG2 ILE B  19     123.682 113.175  93.100  1.00  0.88           C  
ATOM     57  CD1 ILE B  19     122.913 113.643  90.116  1.00  0.88           C  
ATOM     58  N   ILE B  20     125.096 115.846  93.655  1.00  0.89           N  
ATOM     59  CA  ILE B  20     125.256 116.316  95.016  1.00  0.89           C  
ATOM     60  C   ILE B  20     123.973 116.085  95.770  1.00  0.89           C  
ATOM     61  O   ILE B  20     122.887 116.021  95.206  1.00  0.89           O  
ATOM     62  CB  ILE B  20     125.589 117.801  95.131  1.00  0.89           C  
ATOM     63  CG1 ILE B  20     124.642 118.682  94.283  1.00  0.89           C  
ATOM     64  CG2 ILE B  20     127.052 117.955  94.700  1.00  0.89           C  
ATOM     65  CD1 ILE B  20     124.669 120.163  94.659  1.00  0.89           C  
ATOM     66  N   SER B  21     124.076 115.973  97.101  1.00  0.91           N  
ATOM     67  CA  SER B  21     122.915 115.832  97.945  1.00  0.91           C  
ATOM     68  C   SER B  21     123.273 116.345  99.329  1.00  0.91           C  
ATOM     69  O   SER B  21     124.444 116.427  99.687  1.00  0.91           O  
ATOM     70  CB  SER B  21     122.391 114.381  97.996  1.00  0.91           C  
ATOM     71  OG  SER B  21     121.163 114.306  98.722  1.00  0.91           O  
ATOM     72  N   ALA B  22     122.267 116.737 100.130  1.00  0.93           N  
ATOM     73  CA  ALA B  22     122.463 117.315 101.434  1.00  0.93           C  
ATOM     74  C   ALA B  22     121.356 116.794 102.334  1.00  0.93           C  
ATOM     75  O   ALA B  22     120.216 116.662 101.905  1.00  0.93           O  
ATOM     76  CB  ALA B  22     122.402 118.853 101.358  1.00  0.93           C  
ATOM     77  N   GLY B  23     121.700 116.443 103.592  1.00  0.94           N  
ATOM     78  CA  GLY B  23     120.764 115.971 104.610  1.00  0.94           C  
ATOM     79  C   GLY B  23     120.636 116.991 105.714  1.00  0.94           C  
ATOM     80  O   GLY B  23     120.763 118.193 105.495  1.00  0.94           O  
ATOM     81  N   ALA B  24     120.393 116.541 106.965  1.00  0.91           N  
ATOM     82  CA  ALA B  24     120.239 117.429 108.102  1.00  0.91           C  
ATOM     83  C   ALA B  24     121.455 118.255 108.470  1.00  0.91           C  
ATOM     84  O   ALA B  24     121.401 119.470 108.629  1.00  0.91           O  
ATOM     85  CB  ALA B  24     119.848 116.609 109.342  1.00  0.91           C  
ATOM     86  N   SER B  25     122.602 117.568 108.554  1.00  0.90           N  
ATOM     87  CA  SER B  25     123.857 118.205 108.885  1.00  0.90           C  
ATOM     88  C   SER B  25     124.975 117.485 108.169  1.00  0.90           C  
ATOM     89  O   SER B  25     126.129 117.536 108.588  1.00  0.90           O  
ATOM     90  CB  SER B  25     124.193 118.170 110.401  1.00  0.90           C  
ATOM     91  OG  SER B  25     123.439 119.086 111.206  1.00  0.90           O  
ATOM     92  N   HIS B  26     124.698 116.787 107.061  1.00  0.89           N  
ATOM     93  CA  HIS B  26     125.722 116.135 106.277  1.00  0.89           C  
ATOM     94  C   HIS B  26     125.486 116.397 104.808  1.00  0.89           C  
ATOM     95  O   HIS B  26     124.408 116.812 104.393  1.00  0.89           O  
ATOM     96  CB  HIS B  26     125.762 114.610 106.512  1.00  0.89           C  
ATOM     97  CG  HIS B  26     124.642 113.841 105.895  1.00  0.89           C  
ATOM     98  ND1 HIS B  26     123.367 113.936 106.406  1.00  0.89           N  
ATOM     99  CD2 HIS B  26     124.685 112.946 104.879  1.00  0.89           C  
ATOM    100  CE1 HIS B  26     122.652 113.080 105.699  1.00  0.89           C  
ATOM    101  NE2 HIS B  26     123.406 112.452 104.765  1.00  0.89           N  
ATOM    102  N   SER B  27     126.517 116.147 103.988  1.00  0.94           N  
ATOM    103  CA  SER B  27     126.454 116.351 102.559  1.00  0.94           C  
ATOM    104  C   SER B  27     127.154 115.215 101.875  1.00  0.94           C  
ATOM    105  O   SER B  27     128.047 114.571 102.423  1.00  0.94           O  
ATOM    106  CB  SER B  27     127.190 117.623 102.107  1.00  0.94           C  
ATOM    107  OG  SER B  27     126.530 118.812 102.551  1.00  0.94           O  
ATOM    108  N   VAL B  28     126.746 114.936 100.630  1.00  0.93           N  
ATOM    109  CA  VAL B  28     127.262 113.819  99.872  1.00  0.93           C  
ATOM    110  C   VAL B  28     127.398 114.275  98.438  1.00  0.93           C  
ATOM    111  O   VAL B  28     126.654 115.125  97.955  1.00  0.93           O  
ATOM    112  CB  VAL B  28     126.348 112.595  99.959  1.00  0.93           C  
ATOM    113  CG1 VAL B  28     126.813 111.414  99.093  1.00  0.93           C  
ATOM    114  CG2 VAL B  28     126.276 112.084 101.407  1.00  0.93           C  
ATOM    115  N   ALA B  29     128.385 113.720  97.722  1.00  0.93           N  
ATOM    116  CA  ALA B  29     128.572 113.964  96.323  1.00  0.93           C  
ATOM    117  C   ALA B  29     128.958 112.662  95.662  1.00  0.93           C  
ATOM    118  O   ALA B  29     129.590 111.795  96.257  1.00  0.93           O  
ATOM    119  CB  ALA B  29     129.677 115.012  96.093  1.00  0.93           C  
ATOM    120  N   LEU B  30     128.571 112.508  94.391  1.00  0.92           N  
ATOM    121  CA  LEU B  30     128.957 111.397  93.563  1.00  0.92           C  
ATOM    122  C   LEU B  30     129.822 112.016  92.494  1.00  0.92           C  
ATOM    123  O   LEU B  30     129.420 112.961  91.818  1.00  0.92           O  
ATOM    124  CB  LEU B  30     127.728 110.731  92.910  1.00  0.92           C  
ATOM    125  CG  LEU B  30     128.004 109.506  92.023  1.00  0.92           C  
ATOM    126  CD1 LEU B  30     128.481 108.298  92.839  1.00  0.92           C  
ATOM    127  CD2 LEU B  30     126.742 109.154  91.223  1.00  0.92           C  
ATOM    128  N   LEU B  31     131.056 111.523  92.353  1.00  0.90           N  
ATOM    129  CA  LEU B  31     132.038 112.055  91.447  1.00  0.90           C  
ATOM    130  C   LEU B  31     132.198 111.108  90.268  1.00  0.90           C  
ATOM    131  O   LEU B  31     131.866 109.933  90.353  1.00  0.90           O  
ATOM    132  CB  LEU B  31     133.401 112.211  92.161  1.00  0.90           C  
ATOM    133  CG  LEU B  31     133.342 112.959  93.506  1.00  0.90           C  
ATOM    134  CD1 LEU B  31     134.605 112.715  94.345  1.00  0.90           C  
ATOM    135  CD2 LEU B  31     133.109 114.447  93.267  1.00  0.90           C  
ATOM    136  N   SER B  32     132.718 111.623  89.127  1.00  0.89           N  
ATOM    137  CA  SER B  32     133.140 110.837  87.957  1.00  0.89           C  
ATOM    138  C   SER B  32     133.899 109.559  88.281  1.00  0.89           C  
ATOM    139  O   SER B  32     134.678 109.509  89.222  1.00  0.89           O  
ATOM    140  CB  SER B  32     133.910 111.685  86.908  1.00  0.89           C  
ATOM    141  OG  SER B  32     134.220 110.963  85.713  1.00  0.89           O  
ATOM    142  N   GLY B  33     133.659 108.464  87.531  1.00  0.88           N  
ATOM    143  CA  GLY B  33     134.197 107.157  87.904  1.00  0.88           C  
ATOM    144  C   GLY B  33     133.432 106.468  89.010  1.00  0.88           C  
ATOM    145  O   GLY B  33     133.895 105.456  89.534  1.00  0.88           O  
ATOM    146  N   ASP B  34     132.268 107.020  89.396  1.00  0.85           N  
ATOM    147  CA  ASP B  34     131.363 106.515  90.406  1.00  0.85           C  
ATOM    148  C   ASP B  34     131.964 106.443  91.803  1.00  0.85           C  
ATOM    149  O   ASP B  34     131.885 105.450  92.514  1.00  0.85           O  
ATOM    150  CB  ASP B  34     130.676 105.203  89.973  1.00  0.85           C  
ATOM    151  CG  ASP B  34     129.888 105.402  88.686  1.00  0.85           C  
ATOM    152  OD1 ASP B  34     129.711 104.373  87.975  1.00  0.85           O  
ATOM    153  OD2 ASP B  34     129.473 106.551  88.399  1.00  0.85           O  
ATOM    154  N   ILE B  35     132.568 107.571  92.236  1.00  0.91           N  
ATOM    155  CA  ILE B  35     133.202 107.661  93.537  1.00  0.91           C  
ATOM    156  C   ILE B  35     132.294 108.466  94.427  1.00  0.91           C  
ATOM    157  O   ILE B  35     131.961 109.618  94.157  1.00  0.91           O  
ATOM    158  CB  ILE B  35     134.605 108.255  93.478  1.00  0.91           C  
ATOM    159  CG1 ILE B  35     135.548 107.225  92.820  1.00  0.91           C  
ATOM    160  CG2 ILE B  35     135.123 108.624  94.885  1.00  0.91           C  
ATOM    161  CD1 ILE B  35     136.905 107.809  92.431  1.00  0.91           C  
ATOM    162  N   VAL B  36     131.849 107.854  95.537  1.00  0.95           N  
ATOM    163  CA  VAL B  36     130.984 108.510  96.492  1.00  0.95           C  
ATOM    164  C   VAL B  36     131.867 109.231  97.489  1.00  0.95           C  
ATOM    165  O   VAL B  36     132.801 108.684  98.049  1.00  0.95           O  
ATOM    166  CB  VAL B  36     130.034 107.534  97.176  1.00  0.95           C  
ATOM    167  CG1 VAL B  36     129.171 108.230  98.249  1.00  0.95           C  
ATOM    168  CG2 VAL B  36     129.121 106.937  96.091  1.00  0.95           C  
ATOM    169  N   CYS B  37     131.607 110.530  97.701  1.00  0.92           N  
ATOM    170  CA  CYS B  37     132.312 111.313  98.684  1.00  0.92           C  
ATOM    171  C   CYS B  37     131.287 111.862  99.655  1.00  0.92           C  
ATOM    172  O   CYS B  37     130.184 112.229  99.264  1.00  0.92           O  
ATOM    173  CB  CYS B  37     133.120 112.433  97.992  1.00  0.92           C  
ATOM    174  SG  CYS B  37     134.280 113.254  99.111  1.00  0.92           S  
ATOM    175  N   SER B  38     131.605 111.910 100.961  1.00  0.95           N  
ATOM    176  CA  SER B  38     130.645 112.353 101.955  1.00  0.95           C  
ATOM    177  C   SER B  38     131.348 113.130 103.042  1.00  0.95           C  
ATOM    178  O   SER B  38     132.519 112.916 103.341  1.00  0.95           O  
ATOM    179  CB  SER B  38     129.854 111.182 102.602  1.00  0.95           C  
ATOM    180  OG  SER B  38     130.721 110.321 103.343  1.00  0.95           O  
ATOM    181  N   TRP B  39     130.633 114.103 103.638  1.00  0.90           N  
ATOM    182  CA  TRP B  39     131.206 114.934 104.666  1.00  0.90           C  
ATOM    183  C   TRP B  39     130.136 115.619 105.498  1.00  0.90           C  
ATOM    184  O   TRP B  39     128.948 115.560 105.205  1.00  0.90           O  
ATOM    185  CB  TRP B  39     132.183 115.973 104.068  1.00  0.90           C  
ATOM    186  CG  TRP B  39     131.532 117.026 103.191  1.00  0.90           C  
ATOM    187  CD1 TRP B  39     131.025 118.209 103.626  1.00  0.90           C  
ATOM    188  CD2 TRP B  39     131.205 116.944 101.791  1.00  0.90           C  
ATOM    189  NE1 TRP B  39     130.420 118.884 102.595  1.00  0.90           N  
ATOM    190  CE2 TRP B  39     130.537 118.135 101.456  1.00  0.90           C  
ATOM    191  CE3 TRP B  39     131.419 115.958 100.837  1.00  0.90           C  
ATOM    192  CZ2 TRP B  39     130.099 118.376 100.162  1.00  0.90           C  
ATOM    193  CZ3 TRP B  39     130.946 116.183  99.540  1.00  0.90           C  
ATOM    194  CH2 TRP B  39     130.303 117.378  99.204  1.00  0.90           C  
ATOM    195  N   GLY B  40     130.560 116.287 106.586  1.00  0.95           N  
ATOM    196  CA  GLY B  40     129.701 116.957 107.543  1.00  0.95           C  
ATOM    197  C   GLY B  40     129.647 116.202 108.822  1.00  0.95           C  
ATOM    198  O   GLY B  40     130.595 115.537 109.207  1.00  0.95           O  
ATOM    199  N   ARG B  41     128.492 116.307 109.504  1.00  0.84           N  
ATOM    200  CA  ARG B  41     128.174 115.516 110.665  1.00  0.84           C  
ATOM    201  C   ARG B  41     128.085 114.058 110.299  1.00  0.84           C  
ATOM    202  O   ARG B  41     127.554 113.708 109.251  1.00  0.84           O  
ATOM    203  CB  ARG B  41     126.842 115.960 111.304  1.00  0.84           C  
ATOM    204  CG  ARG B  41     126.427 115.282 112.620  1.00  0.84           C  
ATOM    205  CD  ARG B  41     125.236 115.999 113.249  1.00  0.84           C  
ATOM    206  NE  ARG B  41     124.720 115.177 114.350  1.00  0.84           N  
ATOM    207  CZ  ARG B  41     123.822 114.193 114.271  1.00  0.84           C  
ATOM    208  NH1 ARG B  41     123.266 113.796 113.137  1.00  0.84           N  
ATOM    209  NH2 ARG B  41     123.529 113.511 115.377  1.00  0.84           N  
ATOM    210  N   GLY B  42     128.575 113.182 111.182  1.00  0.91           N  
ATOM    211  CA  GLY B  42     128.540 111.757 110.949  1.00  0.91           C  
ATOM    212  C   GLY B  42     128.312 110.988 112.197  1.00  0.91           C  
ATOM    213  O   GLY B  42     128.487 109.776 112.216  1.00  0.91           O  
ATOM    214  N   GLU B  43     127.841 111.660 113.254  1.00  0.85           N  
ATOM    215  CA  GLU B  43     127.634 111.100 114.574  1.00  0.85           C  
ATOM    216  C   GLU B  43     126.674 109.897 114.628  1.00  0.85           C  
ATOM    217  O   GLU B  43     126.878 108.976 115.419  1.00  0.85           O  
ATOM    218  CB  GLU B  43     127.181 112.200 115.550  1.00  0.85           C  
ATOM    219  CG  GLU B  43     128.019 113.510 115.557  1.00  0.85           C  
ATOM    220  CD  GLU B  43     127.165 114.677 116.044  1.00  0.85           C  
ATOM    221  OE1 GLU B  43     126.033 114.412 116.538  1.00  0.85           O  
ATOM    222  OE2 GLU B  43     127.542 115.853 115.849  1.00  0.85           O  
ATOM    223  N   ASP B  44     125.644 109.855 113.746  1.00  0.89           N  
ATOM    224  CA  ASP B  44     124.710 108.748 113.582  1.00  0.89           C  
ATOM    225  C   ASP B  44     125.156 107.802 112.470  1.00  0.89           C  
ATOM    226  O   ASP B  44     124.455 106.873 112.077  1.00  0.89           O  
ATOM    227  CB  ASP B  44     123.302 109.271 113.232  1.00  0.89           C  
ATOM    228  CG  ASP B  44     122.750 109.942 114.467  1.00  0.89           C  
ATOM    229  OD1 ASP B  44     122.304 109.223 115.391  1.00  0.89           O  
ATOM    230  OD2 ASP B  44     122.799 111.196 114.505  1.00  0.89           O  
ATOM    231  N   GLY B  45     126.369 107.997 111.914  1.00  0.95           N  
ATOM    232  CA  GLY B  45     126.923 107.109 110.905  1.00  0.95           C  
ATOM    233  C   GLY B  45     126.503 107.341 109.482  1.00  0.95           C  
ATOM    234  O   GLY B  45     126.868 106.581 108.593  1.00  0.95           O  
ATOM    235  N   GLN B  46     125.774 108.435 109.203  1.00  0.91           N  
ATOM    236  CA  GLN B  46     125.250 108.814 107.898  1.00  0.91           C  
ATOM    237  C   GLN B  46     126.277 109.213 106.862  1.00  0.91           C  
ATOM    238  O   GLN B  46     125.974 109.402 105.686  1.00  0.91           O  
ATOM    239  CB  GLN B  46     124.255 109.983 108.012  1.00  0.91           C  
ATOM    240  CG  GLN B  46     124.856 111.358 108.396  1.00  0.91           C  
ATOM    241  CD  GLN B  46     124.964 111.587 109.913  1.00  0.91           C  
ATOM    242  OE1 GLN B  46     125.180 110.704 110.707  1.00  0.91           O  
ATOM    243  NE2 GLN B  46     124.868 112.888 110.300  1.00  0.91           N  
ATOM    244  N   LEU B  47     127.542 109.349 107.279  1.00  0.94           N  
ATOM    245  CA  LEU B  47     128.636 109.513 106.359  1.00  0.94           C  
ATOM    246  C   LEU B  47     129.132 108.219 105.771  1.00  0.94           C  
ATOM    247  O   LEU B  47     129.671 108.230 104.672  1.00  0.94           O  
ATOM    248  CB  LEU B  47     129.808 110.234 107.027  1.00  0.94           C  
ATOM    249  CG  LEU B  47     129.448 111.647 107.482  1.00  0.94           C  
ATOM    250  CD1 LEU B  47     130.685 112.299 108.091  1.00  0.94           C  
ATOM    251  CD2 LEU B  47     128.916 112.519 106.343  1.00  0.94           C  
ATOM    252  N   GLY B  48     128.930 107.068 106.441  1.00  0.97           N  
ATOM    253  CA  GLY B  48     129.297 105.792 105.843  1.00  0.97           C  
ATOM    254  C   GLY B  48     130.759 105.404 105.877  1.00  0.97           C  
ATOM    255  O   GLY B  48     131.211 104.645 105.039  1.00  0.97           O  
ATOM    256  N   HIS B  49     131.515 105.917 106.876  1.00  0.93           N  
ATOM    257  CA  HIS B  49     132.957 105.722 106.980  1.00  0.93           C  
ATOM    258  C   HIS B  49     133.335 104.682 108.025  1.00  0.93           C  
ATOM    259  O   HIS B  49     134.508 104.375 108.222  1.00  0.93           O  
ATOM    260  CB  HIS B  49     133.688 107.049 107.321  1.00  0.93           C  
ATOM    261  CG  HIS B  49     133.577 108.083 106.242  1.00  0.93           C  
ATOM    262  ND1 HIS B  49     133.957 107.748 104.962  1.00  0.93           N  
ATOM    263  CD2 HIS B  49     133.126 109.366 106.280  1.00  0.93           C  
ATOM    264  CE1 HIS B  49     133.726 108.823 104.237  1.00  0.93           C  
ATOM    265  NE2 HIS B  49     133.217 109.831 104.984  1.00  0.93           N  
ATOM    266  N   GLY B  50     132.349 104.072 108.716  1.00  0.96           N  
ATOM    267  CA  GLY B  50     132.603 103.098 109.778  1.00  0.96           C  
ATOM    268  C   GLY B  50     132.813 103.671 111.140  1.00  0.96           C  
ATOM    269  O   GLY B  50     132.951 102.932 112.113  1.00  0.96           O  
ATOM    270  N   ASP B  51     132.773 104.996 111.254  1.00  0.90           N  
ATOM    271  CA  ASP B  51     132.938 105.675 112.504  1.00  0.90           C  
ATOM    272  C   ASP B  51     131.891 106.782 112.581  1.00  0.90           C  
ATOM    273  O   ASP B  51     131.208 107.084 111.626  1.00  0.90           O  
ATOM    274  CB  ASP B  51     134.415 106.125 112.658  1.00  0.90           C  
ATOM    275  CG  ASP B  51     134.838 107.115 111.593  1.00  0.90           C  
ATOM    276  OD1 ASP B  51     134.357 108.272 111.633  1.00  0.90           O  
ATOM    277  OD2 ASP B  51     135.653 106.752 110.712  1.00  0.90           O  
ATOM    278  N   ALA B  52     131.745 107.352 113.806  1.00  0.92           N  
ATOM    279  CA  ALA B  52     130.859 108.451 114.091  1.00  0.92           C  
ATOM    280  C   ALA B  52     131.577 109.798 114.028  1.00  0.92           C  
ATOM    281  O   ALA B  52     131.011 110.818 114.387  1.00  0.92           O  
ATOM    282  CB  ALA B  52     130.313 108.287 115.529  1.00  0.92           C  
ATOM    283  N   GLU B  53     132.865 109.837 113.613  1.00  0.79           N  
ATOM    284  CA  GLU B  53     133.616 111.078 113.555  1.00  0.79           C  
ATOM    285  C   GLU B  53     133.122 111.969 112.425  1.00  0.79           C  
ATOM    286  O   GLU B  53     132.854 111.517 111.311  1.00  0.79           O  
ATOM    287  CB  GLU B  53     135.134 110.823 113.374  1.00  0.79           C  
ATOM    288  CG  GLU B  53     136.069 111.993 113.773  1.00  0.79           C  
ATOM    289  CD  GLU B  53     137.412 111.939 113.037  1.00  0.79           C  
ATOM    290  OE1 GLU B  53     138.071 110.869 113.060  1.00  0.79           O  
ATOM    291  OE2 GLU B  53     137.797 112.979 112.440  1.00  0.79           O  
ATOM    292  N   ASP B  54     132.987 113.278 112.697  1.00  0.84           N  
ATOM    293  CA  ASP B  54     132.621 114.257 111.699  1.00  0.84           C  
ATOM    294  C   ASP B  54     133.713 114.503 110.684  1.00  0.84           C  
ATOM    295  O   ASP B  54     134.902 114.361 110.935  1.00  0.84           O  
ATOM    296  CB  ASP B  54     132.251 115.602 112.339  1.00  0.84           C  
ATOM    297  CG  ASP B  54     130.984 115.432 113.156  1.00  0.84           C  
ATOM    298  OD1 ASP B  54     130.194 114.495 112.855  1.00  0.84           O  
ATOM    299  OD2 ASP B  54     130.805 116.235 114.094  1.00  0.84           O  
ATOM    300  N   ARG B  55     133.318 114.900 109.465  1.00  0.77           N  
ATOM    301  CA  ARG B  55     134.268 115.133 108.409  1.00  0.77           C  
ATOM    302  C   ARG B  55     134.132 116.570 107.911  1.00  0.77           C  
ATOM    303  O   ARG B  55     133.116 116.902 107.332  1.00  0.77           O  
ATOM    304  CB  ARG B  55     134.031 114.131 107.260  1.00  0.77           C  
ATOM    305  CG  ARG B  55     134.234 112.654 107.678  1.00  0.77           C  
ATOM    306  CD  ARG B  55     135.613 112.301 108.241  1.00  0.77           C  
ATOM    307  NE  ARG B  55     135.570 110.865 108.659  1.00  0.77           N  
ATOM    308  CZ  ARG B  55     136.661 110.093 108.749  1.00  0.77           C  
ATOM    309  NH1 ARG B  55     137.839 110.527 108.309  1.00  0.77           N  
ATOM    310  NH2 ARG B  55     136.627 108.927 109.372  1.00  0.77           N  
ATOM    311  N   PRO B  56     135.102 117.462 108.069  1.00  0.86           N  
ATOM    312  CA  PRO B  56     134.867 118.855 107.715  1.00  0.86           C  
ATOM    313  C   PRO B  56     135.074 119.117 106.259  1.00  0.86           C  
ATOM    314  O   PRO B  56     134.712 120.182 105.763  1.00  0.86           O  
ATOM    315  CB  PRO B  56     135.980 119.614 108.443  1.00  0.86           C  
ATOM    316  CG  PRO B  56     136.961 118.599 109.016  1.00  0.86           C  
ATOM    317  CD  PRO B  56     136.178 117.311 109.048  1.00  0.86           C  
ATOM    318  N   SER B  57     135.760 118.195 105.597  1.00  0.85           N  
ATOM    319  CA  SER B  57     136.216 118.337 104.247  1.00  0.85           C  
ATOM    320  C   SER B  57     135.676 117.083 103.583  1.00  0.85           C  
ATOM    321  O   SER B  57     135.423 116.107 104.290  1.00  0.85           O  
ATOM    322  CB  SER B  57     137.763 118.504 104.228  1.00  0.85           C  
ATOM    323  OG  SER B  57     138.371 118.356 102.946  1.00  0.85           O  
ATOM    324  N   PRO B  58     135.399 117.078 102.287  1.00  0.87           N  
ATOM    325  CA  PRO B  58     134.994 115.912 101.525  1.00  0.87           C  
ATOM    326  C   PRO B  58     135.876 114.701 101.752  1.00  0.87           C  
ATOM    327  O   PRO B  58     137.049 114.716 101.389  1.00  0.87           O  
ATOM    328  CB  PRO B  58     134.959 116.419 100.073  1.00  0.87           C  
ATOM    329  CG  PRO B  58     134.737 117.918 100.198  1.00  0.87           C  
ATOM    330  CD  PRO B  58     135.528 118.247 101.441  1.00  0.87           C  
ATOM    331  N   THR B  59     135.309 113.619 102.311  1.00  0.86           N  
ATOM    332  CA  THR B  59     136.068 112.423 102.621  1.00  0.86           C  
ATOM    333  C   THR B  59     135.522 111.331 101.751  1.00  0.86           C  
ATOM    334  O   THR B  59     134.324 111.053 101.732  1.00  0.86           O  
ATOM    335  CB  THR B  59     135.922 111.994 104.066  1.00  0.86           C  
ATOM    336  OG1 THR B  59     136.406 112.995 104.948  1.00  0.86           O  
ATOM    337  CG2 THR B  59     136.740 110.744 104.400  1.00  0.86           C  
ATOM    338  N   GLN B  60     136.403 110.692 100.958  1.00  0.85           N  
ATOM    339  CA  GLN B  60     136.018 109.624 100.056  1.00  0.85           C  
ATOM    340  C   GLN B  60     135.408 108.441 100.793  1.00  0.85           C  
ATOM    341  O   GLN B  60     136.010 107.859 101.689  1.00  0.85           O  
ATOM    342  CB  GLN B  60     137.213 109.138  99.203  1.00  0.85           C  
ATOM    343  CG  GLN B  60     136.773 108.438  97.899  1.00  0.85           C  
ATOM    344  CD  GLN B  60     137.850 107.492  97.356  1.00  0.85           C  
ATOM    345  OE1 GLN B  60     139.039 107.637  97.636  1.00  0.85           O  
ATOM    346  NE2 GLN B  60     137.434 106.490  96.536  1.00  0.85           N  
ATOM    347  N   LEU B  61     134.169 108.069 100.429  1.00  0.91           N  
ATOM    348  CA  LEU B  61     133.462 106.972 101.036  1.00  0.91           C  
ATOM    349  C   LEU B  61     133.902 105.696 100.336  1.00  0.91           C  
ATOM    350  O   LEU B  61     133.294 105.235  99.374  1.00  0.91           O  
ATOM    351  CB  LEU B  61     131.943 107.217 100.905  1.00  0.91           C  
ATOM    352  CG  LEU B  61     131.065 106.415 101.874  1.00  0.91           C  
ATOM    353  CD1 LEU B  61     129.642 106.983 101.893  1.00  0.91           C  
ATOM    354  CD2 LEU B  61     130.998 104.922 101.555  1.00  0.91           C  
ATOM    355  N   SER B  62     134.991 105.087 100.847  1.00  0.93           N  
ATOM    356  CA  SER B  62     135.718 104.003 100.195  1.00  0.93           C  
ATOM    357  C   SER B  62     134.971 102.680 100.139  1.00  0.93           C  
ATOM    358  O   SER B  62     135.264 101.791  99.344  1.00  0.93           O  
ATOM    359  CB  SER B  62     137.073 103.743 100.904  1.00  0.93           C  
ATOM    360  OG  SER B  62     136.895 103.358 102.274  1.00  0.93           O  
ATOM    361  N   ALA B  63     133.945 102.518 100.992  1.00  0.94           N  
ATOM    362  CA  ALA B  63     133.110 101.336 101.076  1.00  0.94           C  
ATOM    363  C   ALA B  63     132.306 101.024  99.812  1.00  0.94           C  
ATOM    364  O   ALA B  63     131.984  99.867  99.546  1.00  0.94           O  
ATOM    365  CB  ALA B  63     132.146 101.459 102.273  1.00  0.94           C  
ATOM    366  N   LEU B  64     131.961 102.064  99.020  1.00  0.93           N  
ATOM    367  CA  LEU B  64     131.193 101.931  97.794  1.00  0.93           C  
ATOM    368  C   LEU B  64     132.052 101.975  96.541  1.00  0.93           C  
ATOM    369  O   LEU B  64     131.534 102.012  95.420  1.00  0.93           O  
ATOM    370  CB  LEU B  64     130.134 103.050  97.677  1.00  0.93           C  
ATOM    371  CG  LEU B  64     129.011 102.977  98.718  1.00  0.93           C  
ATOM    372  CD1 LEU B  64     128.079 104.178  98.548  1.00  0.93           C  
ATOM    373  CD2 LEU B  64     128.211 101.669  98.636  1.00  0.93           C  
ATOM    374  N   ASP B  65     133.393 101.975  96.680  1.00  0.91           N  
ATOM    375  CA  ASP B  65     134.287 101.993  95.541  1.00  0.91           C  
ATOM    376  C   ASP B  65     134.102 100.780  94.625  1.00  0.91           C  
ATOM    377  O   ASP B  65     134.069  99.624  95.046  1.00  0.91           O  
ATOM    378  CB  ASP B  65     135.770 102.103  95.976  1.00  0.91           C  
ATOM    379  CG  ASP B  65     136.137 103.469  96.540  1.00  0.91           C  
ATOM    380  OD1 ASP B  65     135.389 104.457  96.313  1.00  0.91           O  
ATOM    381  OD2 ASP B  65     137.226 103.561  97.166  1.00  0.91           O  
ATOM    382  N   GLY B  66     133.947 101.027  93.305  1.00  0.92           N  
ATOM    383  CA  GLY B  66     133.770  99.949  92.336  1.00  0.92           C  
ATOM    384  C   GLY B  66     132.378  99.381  92.241  1.00  0.92           C  
ATOM    385  O   GLY B  66     132.151  98.432  91.495  1.00  0.92           O  
ATOM    386  N   HIS B  67     131.389  99.958  92.949  1.00  0.88           N  
ATOM    387  CA  HIS B  67     130.025  99.447  92.927  1.00  0.88           C  
ATOM    388  C   HIS B  67     129.175 100.069  91.842  1.00  0.88           C  
ATOM    389  O   HIS B  67     127.987  99.760  91.730  1.00  0.88           O  
ATOM    390  CB  HIS B  67     129.319  99.692  94.272  1.00  0.88           C  
ATOM    391  CG  HIS B  67     129.836  98.832  95.365  1.00  0.88           C  
ATOM    392  ND1 HIS B  67     129.406  99.074  96.646  1.00  0.88           N  
ATOM    393  CD2 HIS B  67     130.672  97.759  95.333  1.00  0.88           C  
ATOM    394  CE1 HIS B  67     129.994  98.153  97.383  1.00  0.88           C  
ATOM    395  NE2 HIS B  67     130.768  97.334  96.636  1.00  0.88           N  
ATOM    396  N   GLN B  68     129.741 100.959  91.011  1.00  0.85           N  
ATOM    397  CA  GLN B  68     129.071 101.627  89.901  1.00  0.85           C  
ATOM    398  C   GLN B  68     127.846 102.429  90.335  1.00  0.85           C  
ATOM    399  O   GLN B  68     126.783 102.380  89.722  1.00  0.85           O  
ATOM    400  CB  GLN B  68     128.673 100.664  88.754  1.00  0.85           C  
ATOM    401  CG  GLN B  68     129.835  99.841  88.154  1.00  0.85           C  
ATOM    402  CD  GLN B  68     129.737  98.348  88.465  1.00  0.85           C  
ATOM    403  OE1 GLN B  68     129.015  97.887  89.354  1.00  0.85           O  
ATOM    404  NE2 GLN B  68     130.478  97.533  87.680  1.00  0.85           N  
ATOM    405  N   ILE B  69     127.965 103.148  91.468  1.00  0.90           N  
ATOM    406  CA  ILE B  69     126.893 103.916  92.075  1.00  0.90           C  
ATOM    407  C   ILE B  69     126.380 105.008  91.146  1.00  0.90           C  
ATOM    408  O   ILE B  69     127.043 105.985  90.899  1.00  0.90           O  
ATOM    409  CB  ILE B  69     127.319 104.547  93.396  1.00  0.90           C  
ATOM    410  CG1 ILE B  69     127.923 103.528  94.394  1.00  0.90           C  
ATOM    411  CG2 ILE B  69     126.140 105.319  94.019  1.00  0.90           C  
ATOM    412  CD1 ILE B  69     126.966 102.441  94.888  1.00  0.90           C  
ATOM    413  N   VAL B  70     125.138 104.846  90.640  1.00  0.87           N  
ATOM    414  CA  VAL B  70     124.577 105.710  89.621  1.00  0.87           C  
ATOM    415  C   VAL B  70     123.980 106.951  90.255  1.00  0.87           C  
ATOM    416  O   VAL B  70     123.963 108.032  89.670  1.00  0.87           O  
ATOM    417  CB  VAL B  70     123.568 104.927  88.777  1.00  0.87           C  
ATOM    418  CG1 VAL B  70     122.702 105.849  87.897  1.00  0.87           C  
ATOM    419  CG2 VAL B  70     124.356 103.952  87.877  1.00  0.87           C  
ATOM    420  N   SER B  71     123.495 106.846  91.507  1.00  0.89           N  
ATOM    421  CA  SER B  71     122.956 108.006  92.188  1.00  0.89           C  
ATOM    422  C   SER B  71     122.979 107.793  93.680  1.00  0.89           C  
ATOM    423  O   SER B  71     123.121 106.678  94.178  1.00  0.89           O  
ATOM    424  CB  SER B  71     121.524 108.361  91.707  1.00  0.89           C  
ATOM    425  OG  SER B  71     120.987 109.543  92.306  1.00  0.89           O  
ATOM    426  N   VAL B  72     122.871 108.908  94.421  1.00  0.90           N  
ATOM    427  CA  VAL B  72     122.957 108.962  95.860  1.00  0.90           C  
ATOM    428  C   VAL B  72     122.021 110.052  96.334  1.00  0.90           C  
ATOM    429  O   VAL B  72     121.856 111.075  95.684  1.00  0.90           O  
ATOM    430  CB  VAL B  72     124.390 109.185  96.352  1.00  0.90           C  
ATOM    431  CG1 VAL B  72     124.972 110.550  95.922  1.00  0.90           C  
ATOM    432  CG2 VAL B  72     124.478 108.953  97.872  1.00  0.90           C  
ATOM    433  N   THR B  73     121.343 109.831  97.479  1.00  0.89           N  
ATOM    434  CA  THR B  73     120.413 110.792  98.047  1.00  0.89           C  
ATOM    435  C   THR B  73     120.498 110.683  99.554  1.00  0.89           C  
ATOM    436  O   THR B  73     120.900 109.665 100.106  1.00  0.89           O  
ATOM    437  CB  THR B  73     118.967 110.627  97.580  1.00  0.89           C  
ATOM    438  OG1 THR B  73     118.102 111.622  98.118  1.00  0.89           O  
ATOM    439  CG2 THR B  73     118.419 109.255  97.984  1.00  0.89           C  
ATOM    440  N   CYS B  74     120.140 111.764 100.268  1.00  0.90           N  
ATOM    441  CA  CYS B  74     120.361 111.884 101.690  1.00  0.90           C  
ATOM    442  C   CYS B  74     119.019 112.160 102.318  1.00  0.90           C  
ATOM    443  O   CYS B  74     118.255 112.979 101.830  1.00  0.90           O  
ATOM    444  CB  CYS B  74     121.339 113.032 102.036  1.00  0.90           C  
ATOM    445  SG  CYS B  74     122.980 112.757 101.316  1.00  0.90           S  
ATOM    446  N   GLY B  75     118.698 111.422 103.400  1.00  0.91           N  
ATOM    447  CA  GLY B  75     117.537 111.656 104.246  1.00  0.91           C  
ATOM    448  C   GLY B  75     117.937 112.590 105.346  1.00  0.91           C  
ATOM    449  O   GLY B  75     118.944 113.283 105.241  1.00  0.91           O  
ATOM    450  N   ALA B  76     117.185 112.584 106.468  1.00  0.89           N  
ATOM    451  CA  ALA B  76     117.513 113.368 107.646  1.00  0.89           C  
ATOM    452  C   ALA B  76     118.923 113.101 108.164  1.00  0.89           C  
ATOM    453  O   ALA B  76     119.841 113.893 107.948  1.00  0.89           O  
ATOM    454  CB  ALA B  76     116.461 113.095 108.747  1.00  0.89           C  
ATOM    455  N   ASP B  77     119.125 111.907 108.739  1.00  0.88           N  
ATOM    456  CA  ASP B  77     120.380 111.467 109.299  1.00  0.88           C  
ATOM    457  C   ASP B  77     120.675 110.086 108.732  1.00  0.88           C  
ATOM    458  O   ASP B  77     121.273 109.226 109.372  1.00  0.88           O  
ATOM    459  CB  ASP B  77     120.358 111.467 110.853  1.00  0.88           C  
ATOM    460  CG  ASP B  77     120.776 112.809 111.463  1.00  0.88           C  
ATOM    461  OD1 ASP B  77     121.213 113.732 110.732  1.00  0.88           O  
ATOM    462  OD2 ASP B  77     120.746 112.902 112.719  1.00  0.88           O  
ATOM    463  N   HIS B  78     120.272 109.829 107.472  1.00  0.86           N  
ATOM    464  CA  HIS B  78     120.610 108.602 106.788  1.00  0.86           C  
ATOM    465  C   HIS B  78     120.893 108.896 105.337  1.00  0.86           C  
ATOM    466  O   HIS B  78     120.529 109.946 104.823  1.00  0.86           O  
ATOM    467  CB  HIS B  78     119.509 107.527 106.913  1.00  0.86           C  
ATOM    468  CG  HIS B  78     118.192 107.870 106.285  1.00  0.86           C  
ATOM    469  ND1 HIS B  78     117.288 108.678 106.943  1.00  0.86           N  
ATOM    470  CD2 HIS B  78     117.694 107.496 105.075  1.00  0.86           C  
ATOM    471  CE1 HIS B  78     116.254 108.780 106.128  1.00  0.86           C  
ATOM    472  NE2 HIS B  78     116.453 108.082 104.988  1.00  0.86           N  
ATOM    473  N   THR B  79     121.559 107.974 104.625  1.00  0.89           N  
ATOM    474  CA  THR B  79     121.917 108.198 103.229  1.00  0.89           C  
ATOM    475  C   THR B  79     121.663 106.914 102.485  1.00  0.89           C  
ATOM    476  O   THR B  79     121.877 105.826 103.008  1.00  0.89           O  
ATOM    477  CB  THR B  79     123.373 108.593 103.011  1.00  0.89           C  
ATOM    478  OG1 THR B  79     123.713 109.761 103.751  1.00  0.89           O  
ATOM    479  CG2 THR B  79     123.681 108.943 101.547  1.00  0.89           C  
ATOM    480  N   VAL B  80     121.156 107.015 101.242  1.00  0.90           N  
ATOM    481  CA  VAL B  80     120.871 105.871 100.395  1.00  0.90           C  
ATOM    482  C   VAL B  80     121.559 106.116  99.071  1.00  0.90           C  
ATOM    483  O   VAL B  80     121.657 107.244  98.601  1.00  0.90           O  
ATOM    484  CB  VAL B  80     119.377 105.643 100.165  1.00  0.90           C  
ATOM    485  CG1 VAL B  80     119.087 104.436  99.251  1.00  0.90           C  
ATOM    486  CG2 VAL B  80     118.696 105.396 101.521  1.00  0.90           C  
ATOM    487  N   ALA B  81     122.064 105.054  98.425  1.00  0.93           N  
ATOM    488  CA  ALA B  81     122.642 105.151  97.111  1.00  0.93           C  
ATOM    489  C   ALA B  81     122.204 103.952  96.308  1.00  0.93           C  
ATOM    490  O   ALA B  81     121.846 102.925  96.867  1.00  0.93           O  
ATOM    491  CB  ALA B  81     124.180 105.163  97.193  1.00  0.93           C  
ATOM    492  N   TYR B  82     122.237 104.040  94.966  1.00  0.89           N  
ATOM    493  CA  TYR B  82     121.879 102.903  94.148  1.00  0.89           C  
ATOM    494  C   TYR B  82     122.757 102.819  92.913  1.00  0.89           C  
ATOM    495  O   TYR B  82     123.172 103.814  92.334  1.00  0.89           O  
ATOM    496  CB  TYR B  82     120.360 102.828  93.798  1.00  0.89           C  
ATOM    497  CG  TYR B  82     119.853 103.897  92.869  1.00  0.89           C  
ATOM    498  CD1 TYR B  82     119.306 105.092  93.356  1.00  0.89           C  
ATOM    499  CD2 TYR B  82     119.897 103.693  91.483  1.00  0.89           C  
ATOM    500  CE1 TYR B  82     118.839 106.071  92.471  1.00  0.89           C  
ATOM    501  CE2 TYR B  82     119.447 104.681  90.599  1.00  0.89           C  
ATOM    502  CZ  TYR B  82     118.935 105.881  91.093  1.00  0.89           C  
ATOM    503  OH  TYR B  82     118.580 106.937  90.229  1.00  0.89           O  
ATOM    504  N   SER B  83     123.066 101.577  92.504  1.00  0.91           N  
ATOM    505  CA  SER B  83     123.834 101.260  91.318  1.00  0.91           C  
ATOM    506  C   SER B  83     122.894 100.539  90.402  1.00  0.91           C  
ATOM    507  O   SER B  83     122.278  99.550  90.776  1.00  0.91           O  
ATOM    508  CB  SER B  83     125.030 100.334  91.636  1.00  0.91           C  
ATOM    509  OG  SER B  83     125.616  99.712  90.484  1.00  0.91           O  
ATOM    510  N   GLN B  84     122.729 101.050  89.165  1.00  0.85           N  
ATOM    511  CA  GLN B  84     121.951 100.346  88.170  1.00  0.85           C  
ATOM    512  C   GLN B  84     122.716  99.203  87.551  1.00  0.85           C  
ATOM    513  O   GLN B  84     122.153  98.156  87.262  1.00  0.85           O  
ATOM    514  CB  GLN B  84     121.419 101.275  87.073  1.00  0.85           C  
ATOM    515  CG  GLN B  84     120.768 102.537  87.666  1.00  0.85           C  
ATOM    516  CD  GLN B  84     119.702 103.109  86.743  1.00  0.85           C  
ATOM    517  OE1 GLN B  84     119.130 102.404  85.906  1.00  0.85           O  
ATOM    518  NE2 GLN B  84     119.395 104.414  86.901  1.00  0.85           N  
ATOM    519  N   SER B  85     124.037  99.342  87.357  1.00  0.85           N  
ATOM    520  CA  SER B  85     124.865  98.275  86.812  1.00  0.85           C  
ATOM    521  C   SER B  85     124.902  97.044  87.689  1.00  0.85           C  
ATOM    522  O   SER B  85     124.846  95.916  87.203  1.00  0.85           O  
ATOM    523  CB  SER B  85     126.316  98.734  86.583  1.00  0.85           C  
ATOM    524  OG  SER B  85     126.355  99.799  85.631  1.00  0.85           O  
ATOM    525  N   GLY B  86     124.980  97.237  89.020  1.00  0.91           N  
ATOM    526  CA  GLY B  86     124.866  96.147  89.977  1.00  0.91           C  
ATOM    527  C   GLY B  86     123.450  95.798  90.379  1.00  0.91           C  
ATOM    528  O   GLY B  86     123.231  94.781  91.030  1.00  0.91           O  
ATOM    529  N   MET B  87     122.458  96.638  90.019  1.00  0.87           N  
ATOM    530  CA  MET B  87     121.052  96.539  90.405  1.00  0.87           C  
ATOM    531  C   MET B  87     120.801  96.461  91.912  1.00  0.87           C  
ATOM    532  O   MET B  87     119.948  95.722  92.392  1.00  0.87           O  
ATOM    533  CB  MET B  87     120.296  95.420  89.646  1.00  0.87           C  
ATOM    534  CG  MET B  87     120.180  95.663  88.129  1.00  0.87           C  
ATOM    535  SD  MET B  87     119.103  97.067  87.695  1.00  0.87           S  
ATOM    536  CE  MET B  87     119.483  97.034  85.918  1.00  0.87           C  
ATOM    537  N   GLU B  88     121.537  97.297  92.672  1.00  0.88           N  
ATOM    538  CA  GLU B  88     121.640  97.187  94.112  1.00  0.88           C  
ATOM    539  C   GLU B  88     121.463  98.553  94.731  1.00  0.88           C  
ATOM    540  O   GLU B  88     121.833  99.581  94.158  1.00  0.88           O  
ATOM    541  CB  GLU B  88     123.023  96.636  94.530  1.00  0.88           C  
ATOM    542  CG  GLU B  88     123.188  96.249  96.022  1.00  0.88           C  
ATOM    543  CD  GLU B  88     122.578  94.898  96.384  1.00  0.88           C  
ATOM    544  OE1 GLU B  88     123.235  93.863  96.098  1.00  0.88           O  
ATOM    545  OE2 GLU B  88     121.488  94.902  97.013  1.00  0.88           O  
ATOM    546  N   VAL B  89     120.873  98.583  95.937  1.00  0.92           N  
ATOM    547  CA  VAL B  89     120.612  99.793  96.680  1.00  0.92           C  
ATOM    548  C   VAL B  89     121.323  99.660  98.011  1.00  0.92           C  
ATOM    549  O   VAL B  89     121.176  98.665  98.709  1.00  0.92           O  
ATOM    550  CB  VAL B  89     119.123 100.027  96.899  1.00  0.92           C  
ATOM    551  CG1 VAL B  89     118.906 101.346  97.662  1.00  0.92           C  
ATOM    552  CG2 VAL B  89     118.413 100.067  95.532  1.00  0.92           C  
ATOM    553  N   TYR B  90     122.119 100.660  98.416  1.00  0.88           N  
ATOM    554  CA  TYR B  90     122.888 100.627  99.641  1.00  0.88           C  
ATOM    555  C   TYR B  90     122.356 101.711 100.554  1.00  0.88           C  
ATOM    556  O   TYR B  90     121.944 102.770 100.091  1.00  0.88           O  
ATOM    557  CB  TYR B  90     124.401 100.877  99.426  1.00  0.88           C  
ATOM    558  CG  TYR B  90     125.017  99.834  98.542  1.00  0.88           C  
ATOM    559  CD1 TYR B  90     125.015  99.995  97.150  1.00  0.88           C  
ATOM    560  CD2 TYR B  90     125.622  98.693  99.088  1.00  0.88           C  
ATOM    561  CE1 TYR B  90     125.598  99.034  96.320  1.00  0.88           C  
ATOM    562  CE2 TYR B  90     126.210  97.729  98.255  1.00  0.88           C  
ATOM    563  CZ  TYR B  90     126.203  97.905  96.867  1.00  0.88           C  
ATOM    564  OH  TYR B  90     126.775  96.959  95.996  1.00  0.88           O  
ATOM    565  N   SER B  91     122.352 101.478 101.879  1.00  0.89           N  
ATOM    566  CA  SER B  91     121.872 102.460 102.842  1.00  0.89           C  
ATOM    567  C   SER B  91     122.738 102.394 104.078  1.00  0.89           C  
ATOM    568  O   SER B  91     123.355 101.369 104.352  1.00  0.89           O  
ATOM    569  CB  SER B  91     120.389 102.221 103.233  1.00  0.89           C  
ATOM    570  OG  SER B  91     119.868 103.147 104.192  1.00  0.89           O  
ATOM    571  N   TRP B  92     122.836 103.535 104.793  1.00  0.87           N  
ATOM    572  CA  TRP B  92     123.586 103.683 106.019  1.00  0.87           C  
ATOM    573  C   TRP B  92     123.117 104.919 106.781  1.00  0.87           C  
ATOM    574  O   TRP B  92     122.424 105.778 106.242  1.00  0.87           O  
ATOM    575  CB  TRP B  92     125.114 103.772 105.753  1.00  0.87           C  
ATOM    576  CG  TRP B  92     125.594 104.914 104.858  1.00  0.87           C  
ATOM    577  CD1 TRP B  92     126.031 106.125 105.288  1.00  0.87           C  
ATOM    578  CD2 TRP B  92     125.622 104.980 103.417  1.00  0.87           C  
ATOM    579  NE1 TRP B  92     126.363 106.934 104.228  1.00  0.87           N  
ATOM    580  CE2 TRP B  92     126.118 106.252 103.068  1.00  0.87           C  
ATOM    581  CE3 TRP B  92     125.250 104.077 102.431  1.00  0.87           C  
ATOM    582  CZ2 TRP B  92     126.261 106.629 101.739  1.00  0.87           C  
ATOM    583  CZ3 TRP B  92     125.361 104.470 101.094  1.00  0.87           C  
ATOM    584  CH2 TRP B  92     125.859 105.727 100.751  1.00  0.87           C  
ATOM    585  N   GLY B  93     123.498 105.035 108.076  1.00  0.92           N  
ATOM    586  CA  GLY B  93     123.059 106.112 108.961  1.00  0.92           C  
ATOM    587  C   GLY B  93     121.903 105.654 109.791  1.00  0.92           C  
ATOM    588  O   GLY B  93     121.738 104.466 110.027  1.00  0.92           O  
ATOM    589  N   TRP B  94     121.061 106.596 110.252  1.00  0.83           N  
ATOM    590  CA  TRP B  94     119.861 106.293 111.013  1.00  0.83           C  
ATOM    591  C   TRP B  94     118.831 105.480 110.210  1.00  0.83           C  
ATOM    592  O   TRP B  94     118.083 105.979 109.386  1.00  0.83           O  
ATOM    593  CB  TRP B  94     119.253 107.622 111.551  1.00  0.83           C  
ATOM    594  CG  TRP B  94     118.115 107.495 112.538  1.00  0.83           C  
ATOM    595  CD1 TRP B  94     118.011 106.646 113.595  1.00  0.83           C  
ATOM    596  CD2 TRP B  94     116.863 108.212 112.481  1.00  0.83           C  
ATOM    597  NE1 TRP B  94     116.779 106.774 114.198  1.00  0.83           N  
ATOM    598  CE2 TRP B  94     116.070 107.734 113.528  1.00  0.83           C  
ATOM    599  CE3 TRP B  94     116.374 109.160 111.592  1.00  0.83           C  
ATOM    600  CZ2 TRP B  94     114.769 108.186 113.723  1.00  0.83           C  
ATOM    601  CZ3 TRP B  94     115.067 109.627 111.787  1.00  0.83           C  
ATOM    602  CH2 TRP B  94     114.276 109.150 112.834  1.00  0.83           C  
ATOM    603  N   GLY B  95     118.733 104.166 110.464  1.00  0.75           N  
ATOM    604  CA  GLY B  95     118.038 103.211 109.628  1.00  0.75           C  
ATOM    605  C   GLY B  95     116.950 102.489 110.373  1.00  0.75           C  
ATOM    606  O   GLY B  95     116.271 101.643 109.813  1.00  0.75           O  
ATOM    607  N   ASP B  96     116.740 102.806 111.669  1.00  0.78           N  
ATOM    608  CA  ASP B  96     115.569 102.369 112.413  1.00  0.78           C  
ATOM    609  C   ASP B  96     114.191 102.540 111.735  1.00  0.78           C  
ATOM    610  O   ASP B  96     114.031 103.114 110.657  1.00  0.78           O  
ATOM    611  CB  ASP B  96     115.613 102.715 113.933  1.00  0.78           C  
ATOM    612  CG  ASP B  96     115.199 104.128 114.273  1.00  0.78           C  
ATOM    613  OD1 ASP B  96     114.831 104.885 113.338  1.00  0.78           O  
ATOM    614  OD2 ASP B  96     115.181 104.482 115.473  1.00  0.78           O  
ATOM    615  N   PHE B  97     113.135 101.944 112.329  1.00  0.80           N  
ATOM    616  CA  PHE B  97     111.755 102.030 111.853  1.00  0.80           C  
ATOM    617  C   PHE B  97     111.550 101.423 110.471  1.00  0.80           C  
ATOM    618  O   PHE B  97     110.535 101.630 109.806  1.00  0.80           O  
ATOM    619  CB  PHE B  97     111.218 103.484 111.874  1.00  0.80           C  
ATOM    620  CG  PHE B  97     110.772 103.925 113.238  1.00  0.80           C  
ATOM    621  CD1 PHE B  97     109.528 103.515 113.736  1.00  0.80           C  
ATOM    622  CD2 PHE B  97     111.566 104.758 114.039  1.00  0.80           C  
ATOM    623  CE1 PHE B  97     109.082 103.931 114.994  1.00  0.80           C  
ATOM    624  CE2 PHE B  97     111.140 105.149 115.313  1.00  0.80           C  
ATOM    625  CZ  PHE B  97     109.887 104.753 115.785  1.00  0.80           C  
ATOM    626  N   GLY B  98     112.526 100.629 110.012  1.00  0.82           N  
ATOM    627  CA  GLY B  98     112.515  99.971 108.728  1.00  0.82           C  
ATOM    628  C   GLY B  98     113.023 100.754 107.564  1.00  0.82           C  
ATOM    629  O   GLY B  98     113.162 100.174 106.494  1.00  0.82           O  
ATOM    630  N   ARG B  99     113.401 102.043 107.721  1.00  0.73           N  
ATOM    631  CA  ARG B  99     113.820 102.896 106.607  1.00  0.73           C  
ATOM    632  C   ARG B  99     115.160 102.487 106.030  1.00  0.73           C  
ATOM    633  O   ARG B  99     115.530 102.861 104.918  1.00  0.73           O  
ATOM    634  CB  ARG B  99     113.869 104.401 106.950  1.00  0.73           C  
ATOM    635  CG  ARG B  99     115.137 104.848 107.699  1.00  0.73           C  
ATOM    636  CD  ARG B  99     115.120 106.307 108.130  1.00  0.73           C  
ATOM    637  NE  ARG B  99     114.151 106.373 109.252  1.00  0.73           N  
ATOM    638  CZ  ARG B  99     114.478 106.152 110.530  1.00  0.73           C  
ATOM    639  NH1 ARG B  99     115.691 105.827 110.950  1.00  0.73           N  
ATOM    640  NH2 ARG B  99     113.541 106.160 111.478  1.00  0.73           N  
ATOM    641  N   LEU B 100     115.908 101.666 106.791  1.00  0.76           N  
ATOM    642  CA  LEU B 100     117.054 100.932 106.314  1.00  0.76           C  
ATOM    643  C   LEU B 100     116.717  99.961 105.193  1.00  0.76           C  
ATOM    644  O   LEU B 100     117.486  99.824 104.252  1.00  0.76           O  
ATOM    645  CB  LEU B 100     117.702 100.136 107.461  1.00  0.76           C  
ATOM    646  CG  LEU B 100     118.975  99.368 107.083  1.00  0.76           C  
ATOM    647  CD1 LEU B 100     120.130 100.315 106.733  1.00  0.76           C  
ATOM    648  CD2 LEU B 100     119.364  98.426 108.218  1.00  0.76           C  
ATOM    649  N   GLY B 101     115.565  99.262 105.255  1.00  0.80           N  
ATOM    650  CA  GLY B 101     115.138  98.313 104.231  1.00  0.80           C  
ATOM    651  C   GLY B 101     115.658  96.905 104.362  1.00  0.80           C  
ATOM    652  O   GLY B 101     115.379  96.048 103.527  1.00  0.80           O  
ATOM    653  N   HIS B 102     116.407  96.597 105.432  1.00  0.76           N  
ATOM    654  CA  HIS B 102     117.003  95.281 105.634  1.00  0.76           C  
ATOM    655  C   HIS B 102     116.133  94.350 106.456  1.00  0.76           C  
ATOM    656  O   HIS B 102     116.547  93.253 106.830  1.00  0.76           O  
ATOM    657  CB  HIS B 102     118.367  95.397 106.336  1.00  0.76           C  
ATOM    658  CG  HIS B 102     119.449  95.856 105.417  1.00  0.76           C  
ATOM    659  ND1 HIS B 102     120.550  95.050 105.268  1.00  0.76           N  
ATOM    660  CD2 HIS B 102     119.568  96.970 104.643  1.00  0.76           C  
ATOM    661  CE1 HIS B 102     121.324  95.681 104.409  1.00  0.76           C  
ATOM    662  NE2 HIS B 102     120.778  96.850 104.009  1.00  0.76           N  
ATOM    663  N   GLY B 103     114.885  94.751 106.764  1.00  0.84           N  
ATOM    664  CA  GLY B 103     113.998  93.927 107.577  1.00  0.84           C  
ATOM    665  C   GLY B 103     114.268  94.007 109.053  1.00  0.84           C  
ATOM    666  O   GLY B 103     113.678  93.276 109.843  1.00  0.84           O  
ATOM    667  N   ASN B 104     115.148  94.926 109.476  1.00  0.79           N  
ATOM    668  CA  ASN B 104     115.402  95.178 110.871  1.00  0.79           C  
ATOM    669  C   ASN B 104     115.780  96.639 111.043  1.00  0.79           C  
ATOM    670  O   ASN B 104     116.115  97.332 110.087  1.00  0.79           O  
ATOM    671  CB  ASN B 104     116.443  94.191 111.474  1.00  0.79           C  
ATOM    672  CG  ASN B 104     117.773  94.210 110.729  1.00  0.79           C  
ATOM    673  OD1 ASN B 104     118.480  95.221 110.728  1.00  0.79           O  
ATOM    674  ND2 ASN B 104     118.155  93.081 110.094  1.00  0.79           N  
ATOM    675  N   SER B 105     115.679  97.134 112.292  1.00  0.84           N  
ATOM    676  CA  SER B 105     116.070  98.480 112.666  1.00  0.84           C  
ATOM    677  C   SER B 105     117.530  98.500 113.083  1.00  0.84           C  
ATOM    678  O   SER B 105     117.851  98.417 114.261  1.00  0.84           O  
ATOM    679  CB  SER B 105     115.216  98.995 113.851  1.00  0.84           C  
ATOM    680  OG  SER B 105     113.861  99.228 113.442  1.00  0.84           O  
ATOM    681  N   SER B 106     118.441  98.594 112.092  1.00  0.77           N  
ATOM    682  CA  SER B 106     119.881  98.672 112.297  1.00  0.77           C  
ATOM    683  C   SER B 106     120.376 100.025 111.811  1.00  0.77           C  
ATOM    684  O   SER B 106     119.953 100.525 110.771  1.00  0.77           O  
ATOM    685  CB  SER B 106     120.647  97.526 111.562  1.00  0.77           C  
ATOM    686  OG  SER B 106     122.073  97.595 111.685  1.00  0.77           O  
ATOM    687  N   ASP B 107     121.299 100.636 112.579  1.00  0.89           N  
ATOM    688  CA  ASP B 107     121.813 101.974 112.376  1.00  0.89           C  
ATOM    689  C   ASP B 107     123.326 101.890 112.198  1.00  0.89           C  
ATOM    690  O   ASP B 107     124.114 102.575 112.841  1.00  0.89           O  
ATOM    691  CB  ASP B 107     121.491 102.887 113.584  1.00  0.89           C  
ATOM    692  CG  ASP B 107     119.998 102.990 113.834  1.00  0.89           C  
ATOM    693  OD1 ASP B 107     119.240 103.165 112.845  1.00  0.89           O  
ATOM    694  OD2 ASP B 107     119.598 102.915 115.020  1.00  0.89           O  
ATOM    695  N   LEU B 108     123.788 100.954 111.346  1.00  0.76           N  
ATOM    696  CA  LEU B 108     125.205 100.786 111.060  1.00  0.76           C  
ATOM    697  C   LEU B 108     125.873 101.974 110.348  1.00  0.76           C  
ATOM    698  O   LEU B 108     125.270 102.723 109.582  1.00  0.76           O  
ATOM    699  CB  LEU B 108     125.502  99.436 110.357  1.00  0.76           C  
ATOM    700  CG  LEU B 108     126.931  98.864 110.523  1.00  0.76           C  
ATOM    701  CD1 LEU B 108     127.253  98.450 111.970  1.00  0.76           C  
ATOM    702  CD2 LEU B 108     127.134  97.675 109.573  1.00  0.76           C  
ATOM    703  N   PHE B 109     127.192 102.143 110.597  1.00  0.92           N  
ATOM    704  CA  PHE B 109     127.982 103.288 110.194  1.00  0.92           C  
ATOM    705  C   PHE B 109     128.649 103.085 108.839  1.00  0.92           C  
ATOM    706  O   PHE B 109     129.484 103.886 108.423  1.00  0.92           O  
ATOM    707  CB  PHE B 109     129.126 103.552 111.217  1.00  0.92           C  
ATOM    708  CG  PHE B 109     128.617 103.975 112.567  1.00  0.92           C  
ATOM    709  CD1 PHE B 109     128.016 103.085 113.471  1.00  0.92           C  
ATOM    710  CD2 PHE B 109     128.713 105.320 112.936  1.00  0.92           C  
ATOM    711  CE1 PHE B 109     127.487 103.545 114.683  1.00  0.92           C  
ATOM    712  CE2 PHE B 109     128.141 105.794 114.116  1.00  0.92           C  
ATOM    713  CZ  PHE B 109     127.542 104.903 115.004  1.00  0.92           C  
ATOM    714  N   THR B 110     128.307 102.009 108.106  1.00  0.91           N  
ATOM    715  CA  THR B 110     128.878 101.696 106.804  1.00  0.91           C  
ATOM    716  C   THR B 110     127.740 101.358 105.857  1.00  0.91           C  
ATOM    717  O   THR B 110     126.686 100.932 106.326  1.00  0.91           O  
ATOM    718  CB  THR B 110     129.881 100.536 106.795  1.00  0.91           C  
ATOM    719  OG1 THR B 110     129.358  99.316 107.303  1.00  0.91           O  
ATOM    720  CG2 THR B 110     131.064 100.901 107.688  1.00  0.91           C  
ATOM    721  N   PRO B 111     127.851 101.547 104.542  1.00  0.93           N  
ATOM    722  CA  PRO B 111     126.876 101.078 103.562  1.00  0.93           C  
ATOM    723  C   PRO B 111     126.580  99.597 103.583  1.00  0.93           C  
ATOM    724  O   PRO B 111     127.483  98.799 103.429  1.00  0.93           O  
ATOM    725  CB  PRO B 111     127.477 101.445 102.202  1.00  0.93           C  
ATOM    726  CG  PRO B 111     128.446 102.579 102.496  1.00  0.93           C  
ATOM    727  CD  PRO B 111     128.947 102.262 103.899  1.00  0.93           C  
ATOM    728  N   LEU B 112     125.286  99.236 103.687  1.00  0.88           N  
ATOM    729  CA  LEU B 112     124.865  97.858 103.618  1.00  0.88           C  
ATOM    730  C   LEU B 112     123.872  97.683 102.475  1.00  0.88           C  
ATOM    731  O   LEU B 112     123.082  98.596 102.224  1.00  0.88           O  
ATOM    732  CB  LEU B 112     124.176  97.430 104.927  1.00  0.88           C  
ATOM    733  CG  LEU B 112     125.077  97.353 106.170  1.00  0.88           C  
ATOM    734  CD1 LEU B 112     124.269  96.710 107.305  1.00  0.88           C  
ATOM    735  CD2 LEU B 112     126.368  96.554 105.939  1.00  0.88           C  
ATOM    736  N   PRO B 113     123.813  96.543 101.786  1.00  0.89           N  
ATOM    737  CA  PRO B 113     122.992  96.419 100.592  1.00  0.89           C  
ATOM    738  C   PRO B 113     121.591  95.997 100.985  1.00  0.89           C  
ATOM    739  O   PRO B 113     121.400  94.998 101.675  1.00  0.89           O  
ATOM    740  CB  PRO B 113     123.666  95.309  99.767  1.00  0.89           C  
ATOM    741  CG  PRO B 113     124.400  94.461 100.802  1.00  0.89           C  
ATOM    742  CD  PRO B 113     124.824  95.488 101.847  1.00  0.89           C  
ATOM    743  N   ILE B 114     120.581  96.793 100.583  1.00  0.85           N  
ATOM    744  CA  ILE B 114     119.174  96.563 100.853  1.00  0.85           C  
ATOM    745  C   ILE B 114     118.686  95.403 100.026  1.00  0.85           C  
ATOM    746  O   ILE B 114     118.228  95.536  98.897  1.00  0.85           O  
ATOM    747  CB  ILE B 114     118.313  97.793 100.576  1.00  0.85           C  
ATOM    748  CG1 ILE B 114     118.712  98.934 101.528  1.00  0.85           C  
ATOM    749  CG2 ILE B 114     116.808  97.467 100.740  1.00  0.85           C  
ATOM    750  CD1 ILE B 114     117.979 100.254 101.264  1.00  0.85           C  
ATOM    751  N   LYS B 115     118.729  94.198 100.620  1.00  0.81           N  
ATOM    752  CA  LYS B 115     118.413  92.993  99.891  1.00  0.81           C  
ATOM    753  C   LYS B 115     116.944  92.830  99.540  1.00  0.81           C  
ATOM    754  O   LYS B 115     116.588  92.109  98.619  1.00  0.81           O  
ATOM    755  CB  LYS B 115     118.855  91.754 100.690  1.00  0.81           C  
ATOM    756  CG  LYS B 115     118.085  91.535 102.002  1.00  0.81           C  
ATOM    757  CD  LYS B 115     118.584  90.311 102.780  1.00  0.81           C  
ATOM    758  CE  LYS B 115     118.240  88.992 102.086  1.00  0.81           C  
ATOM    759  NZ  LYS B 115     118.699  87.856 102.912  1.00  0.81           N  
ATOM    760  N   ALA B 116     116.053  93.547 100.258  1.00  0.81           N  
ATOM    761  CA  ALA B 116     114.630  93.573 100.007  1.00  0.81           C  
ATOM    762  C   ALA B 116     114.287  94.305  98.717  1.00  0.81           C  
ATOM    763  O   ALA B 116     113.207  94.125  98.160  1.00  0.81           O  
ATOM    764  CB  ALA B 116     113.930  94.264 101.192  1.00  0.81           C  
ATOM    765  N   LEU B 117     115.229  95.126  98.205  1.00  0.81           N  
ATOM    766  CA  LEU B 117     115.081  95.857  96.969  1.00  0.81           C  
ATOM    767  C   LEU B 117     116.106  95.410  95.931  1.00  0.81           C  
ATOM    768  O   LEU B 117     116.290  96.059  94.903  1.00  0.81           O  
ATOM    769  CB  LEU B 117     115.192  97.375  97.254  1.00  0.81           C  
ATOM    770  CG  LEU B 117     114.477  98.306  96.253  1.00  0.81           C  
ATOM    771  CD1 LEU B 117     112.989  97.968  96.074  1.00  0.81           C  
ATOM    772  CD2 LEU B 117     114.613  99.758  96.727  1.00  0.81           C  
ATOM    773  N   HIS B 118     116.800  94.269  96.168  1.00  0.84           N  
ATOM    774  CA  HIS B 118     117.765  93.713  95.223  1.00  0.84           C  
ATOM    775  C   HIS B 118     117.091  93.330  93.913  1.00  0.84           C  
ATOM    776  O   HIS B 118     116.009  92.745  93.897  1.00  0.84           O  
ATOM    777  CB  HIS B 118     118.529  92.486  95.806  1.00  0.84           C  
ATOM    778  CG  HIS B 118     119.793  92.046  95.115  1.00  0.84           C  
ATOM    779  ND1 HIS B 118     119.847  91.871  93.745  1.00  0.84           N  
ATOM    780  CD2 HIS B 118     121.021  91.863  95.652  1.00  0.84           C  
ATOM    781  CE1 HIS B 118     121.105  91.621  93.477  1.00  0.84           C  
ATOM    782  NE2 HIS B 118     121.871  91.606  94.595  1.00  0.84           N  
ATOM    783  N   GLY B 119     117.709  93.692  92.770  1.00  0.92           N  
ATOM    784  CA  GLY B 119     117.254  93.273  91.451  1.00  0.92           C  
ATOM    785  C   GLY B 119     116.131  94.087  90.893  1.00  0.92           C  
ATOM    786  O   GLY B 119     115.656  93.848  89.782  1.00  0.92           O  
ATOM    787  N   ILE B 120     115.688  95.107  91.634  1.00  0.88           N  
ATOM    788  CA  ILE B 120     114.641  95.999  91.197  1.00  0.88           C  
ATOM    789  C   ILE B 120     115.287  97.119  90.415  1.00  0.88           C  
ATOM    790  O   ILE B 120     116.268  97.738  90.821  1.00  0.88           O  
ATOM    791  CB  ILE B 120     113.768  96.514  92.335  1.00  0.88           C  
ATOM    792  CG1 ILE B 120     113.189  95.345  93.169  1.00  0.88           C  
ATOM    793  CG2 ILE B 120     112.639  97.422  91.803  1.00  0.88           C  
ATOM    794  CD1 ILE B 120     112.262  94.392  92.409  1.00  0.88           C  
ATOM    795  N   ARG B 121     114.752  97.400  89.216  1.00  0.82           N  
ATOM    796  CA  ARG B 121     115.280  98.444  88.374  1.00  0.82           C  
ATOM    797  C   ARG B 121     114.760  99.792  88.824  1.00  0.82           C  
ATOM    798  O   ARG B 121     113.688 100.245  88.432  1.00  0.82           O  
ATOM    799  CB  ARG B 121     114.890  98.212  86.903  1.00  0.82           C  
ATOM    800  CG  ARG B 121     115.709  97.100  86.226  1.00  0.82           C  
ATOM    801  CD  ARG B 121     115.190  96.587  84.873  1.00  0.82           C  
ATOM    802  NE  ARG B 121     114.820  97.756  84.004  1.00  0.82           N  
ATOM    803  CZ  ARG B 121     113.655  97.913  83.374  1.00  0.82           C  
ATOM    804  NH1 ARG B 121     112.681  97.003  83.474  1.00  0.82           N  
ATOM    805  NH2 ARG B 121     113.394  99.004  82.658  1.00  0.82           N  
ATOM    806  N   ILE B 122     115.538 100.456  89.688  1.00  0.89           N  
ATOM    807  CA  ILE B 122     115.173 101.714  90.294  1.00  0.89           C  
ATOM    808  C   ILE B 122     115.551 102.907  89.422  1.00  0.89           C  
ATOM    809  O   ILE B 122     116.700 103.140  89.056  1.00  0.89           O  
ATOM    810  CB  ILE B 122     115.786 101.820  91.679  1.00  0.89           C  
ATOM    811  CG1 ILE B 122     115.413 100.642  92.612  1.00  0.89           C  
ATOM    812  CG2 ILE B 122     115.395 103.137  92.352  1.00  0.89           C  
ATOM    813  CD1 ILE B 122     113.914 100.460  92.843  1.00  0.89           C  
ATOM    814  N   LYS B 123     114.526 103.702  89.063  1.00  0.87           N  
ATOM    815  CA  LYS B 123     114.636 104.948  88.351  1.00  0.87           C  
ATOM    816  C   LYS B 123     115.033 106.081  89.286  1.00  0.87           C  
ATOM    817  O   LYS B 123     115.818 106.951  88.918  1.00  0.87           O  
ATOM    818  CB  LYS B 123     113.293 105.242  87.645  1.00  0.87           C  
ATOM    819  CG  LYS B 123     113.276 106.560  86.863  1.00  0.87           C  
ATOM    820  CD  LYS B 123     111.992 106.741  86.041  1.00  0.87           C  
ATOM    821  CE  LYS B 123     111.944 108.082  85.310  1.00  0.87           C  
ATOM    822  NZ  LYS B 123     110.718 108.162  84.486  1.00  0.87           N  
ATOM    823  N   GLN B 124     114.497 106.083  90.527  1.00  0.85           N  
ATOM    824  CA  GLN B 124     114.786 107.124  91.493  1.00  0.85           C  
ATOM    825  C   GLN B 124     114.557 106.627  92.912  1.00  0.85           C  
ATOM    826  O   GLN B 124     113.698 105.787  93.146  1.00  0.85           O  
ATOM    827  CB  GLN B 124     113.839 108.330  91.247  1.00  0.85           C  
ATOM    828  CG  GLN B 124     113.879 109.460  92.305  1.00  0.85           C  
ATOM    829  CD  GLN B 124     112.820 110.534  92.077  1.00  0.85           C  
ATOM    830  OE1 GLN B 124     111.672 110.251  91.742  1.00  0.85           O  
ATOM    831  NE2 GLN B 124     113.186 111.809  92.347  1.00  0.85           N  
ATOM    832  N   ILE B 125     115.298 107.175  93.907  1.00  0.88           N  
ATOM    833  CA  ILE B 125     115.011 106.997  95.325  1.00  0.88           C  
ATOM    834  C   ILE B 125     114.893 108.379  95.936  1.00  0.88           C  
ATOM    835  O   ILE B 125     115.714 109.254  95.692  1.00  0.88           O  
ATOM    836  CB  ILE B 125     116.054 106.147  96.063  1.00  0.88           C  
ATOM    837  CG1 ILE B 125     115.910 104.710  95.525  1.00  0.88           C  
ATOM    838  CG2 ILE B 125     115.894 106.206  97.603  1.00  0.88           C  
ATOM    839  CD1 ILE B 125     116.747 103.624  96.200  1.00  0.88           C  
ATOM    840  N   ALA B 126     113.830 108.602  96.735  1.00  0.91           N  
ATOM    841  CA  ALA B 126     113.647 109.809  97.504  1.00  0.91           C  
ATOM    842  C   ALA B 126     113.638 109.412  98.969  1.00  0.91           C  
ATOM    843  O   ALA B 126     112.899 108.521  99.384  1.00  0.91           O  
ATOM    844  CB  ALA B 126     112.327 110.531  97.156  1.00  0.91           C  
ATOM    845  N   CYS B 127     114.483 110.067  99.786  1.00  0.87           N  
ATOM    846  CA  CYS B 127     114.603 109.787 101.199  1.00  0.87           C  
ATOM    847  C   CYS B 127     114.002 110.927 101.975  1.00  0.87           C  
ATOM    848  O   CYS B 127     114.462 112.059 101.906  1.00  0.87           O  
ATOM    849  CB  CYS B 127     116.077 109.635 101.624  1.00  0.87           C  
ATOM    850  SG  CYS B 127     116.776 108.102 100.974  1.00  0.87           S  
ATOM    851  N   GLY B 128     112.926 110.625 102.719  1.00  0.87           N  
ATOM    852  CA  GLY B 128     112.313 111.512 103.689  1.00  0.87           C  
ATOM    853  C   GLY B 128     113.063 111.421 104.983  1.00  0.87           C  
ATOM    854  O   GLY B 128     114.064 110.719 105.107  1.00  0.87           O  
ATOM    855  N   ASP B 129     112.537 112.095 106.019  1.00  0.88           N  
ATOM    856  CA  ASP B 129     113.131 112.097 107.342  1.00  0.88           C  
ATOM    857  C   ASP B 129     113.178 110.735 107.976  1.00  0.88           C  
ATOM    858  O   ASP B 129     114.147 110.362 108.639  1.00  0.88           O  
ATOM    859  CB  ASP B 129     112.418 113.092 108.284  1.00  0.88           C  
ATOM    860  CG  ASP B 129     112.853 114.517 107.975  1.00  0.88           C  
ATOM    861  OD1 ASP B 129     113.608 114.721 106.993  1.00  0.88           O  
ATOM    862  OD2 ASP B 129     112.444 115.415 108.750  1.00  0.88           O  
ATOM    863  N   SER B 130     112.131 109.929 107.767  1.00  0.89           N  
ATOM    864  CA  SER B 130     112.071 108.644 108.400  1.00  0.89           C  
ATOM    865  C   SER B 130     111.445 107.571 107.552  1.00  0.89           C  
ATOM    866  O   SER B 130     111.070 106.503 108.040  1.00  0.89           O  
ATOM    867  CB  SER B 130     111.330 108.740 109.734  1.00  0.89           C  
ATOM    868  OG  SER B 130     110.074 109.400 109.544  1.00  0.89           O  
ATOM    869  N   HIS B 131     111.409 107.810 106.240  1.00  0.89           N  
ATOM    870  CA  HIS B 131     110.808 106.919 105.293  1.00  0.89           C  
ATOM    871  C   HIS B 131     111.451 107.158 103.960  1.00  0.89           C  
ATOM    872  O   HIS B 131     112.058 108.196 103.728  1.00  0.89           O  
ATOM    873  CB  HIS B 131     109.284 107.139 105.155  1.00  0.89           C  
ATOM    874  CG  HIS B 131     108.864 108.511 104.720  1.00  0.89           C  
ATOM    875  ND1 HIS B 131     108.970 109.587 105.575  1.00  0.89           N  
ATOM    876  CD2 HIS B 131     108.384 108.913 103.512  1.00  0.89           C  
ATOM    877  CE1 HIS B 131     108.559 110.630 104.873  1.00  0.89           C  
ATOM    878  NE2 HIS B 131     108.192 110.270 103.624  1.00  0.89           N  
ATOM    879  N   CYS B 132     111.348 106.195 103.038  1.00  0.91           N  
ATOM    880  CA  CYS B 132     112.001 106.322 101.760  1.00  0.91           C  
ATOM    881  C   CYS B 132     111.075 105.741 100.717  1.00  0.91           C  
ATOM    882  O   CYS B 132     110.241 104.881 100.998  1.00  0.91           O  
ATOM    883  CB  CYS B 132     113.380 105.597 101.692  1.00  0.91           C  
ATOM    884  SG  CYS B 132     114.566 106.012 103.017  1.00  0.91           S  
ATOM    885  N   LEU B 133     111.179 106.242  99.475  1.00  0.92           N  
ATOM    886  CA  LEU B 133     110.367 105.781  98.376  1.00  0.92           C  
ATOM    887  C   LEU B 133     111.264 105.546  97.205  1.00  0.92           C  
ATOM    888  O   LEU B 133     112.251 106.239  96.999  1.00  0.92           O  
ATOM    889  CB  LEU B 133     109.281 106.783  97.917  1.00  0.92           C  
ATOM    890  CG  LEU B 133     108.292 107.156  99.025  1.00  0.92           C  
ATOM    891  CD1 LEU B 133     108.693 108.489  99.663  1.00  0.92           C  
ATOM    892  CD2 LEU B 133     106.845 107.189  98.515  1.00  0.92           C  
ATOM    893  N   ALA B 134     110.910 104.542  96.399  1.00  0.94           N  
ATOM    894  CA  ALA B 134     111.680 104.175  95.253  1.00  0.94           C  
ATOM    895  C   ALA B 134     110.772 104.035  94.055  1.00  0.94           C  
ATOM    896  O   ALA B 134     109.831 103.251  94.051  1.00  0.94           O  
ATOM    897  CB  ALA B 134     112.390 102.861  95.577  1.00  0.94           C  
ATOM    898  N   VAL B 135     111.051 104.830  93.004  1.00  0.93           N  
ATOM    899  CA  VAL B 135     110.312 104.805  91.760  1.00  0.93           C  
ATOM    900  C   VAL B 135     111.049 103.838  90.871  1.00  0.93           C  
ATOM    901  O   VAL B 135     112.255 103.936  90.675  1.00  0.93           O  
ATOM    902  CB  VAL B 135     110.201 106.164  91.078  1.00  0.93           C  
ATOM    903  CG1 VAL B 135     109.321 106.080  89.813  1.00  0.93           C  
ATOM    904  CG2 VAL B 135     109.603 107.166  92.074  1.00  0.93           C  
ATOM    905  N   THR B 136     110.345 102.835  90.332  1.00  0.92           N  
ATOM    906  CA  THR B 136     110.953 101.852  89.456  1.00  0.92           C  
ATOM    907  C   THR B 136     110.883 102.350  88.021  1.00  0.92           C  
ATOM    908  O   THR B 136     110.267 103.351  87.699  1.00  0.92           O  
ATOM    909  CB  THR B 136     110.377 100.448  89.591  1.00  0.92           C  
ATOM    910  OG1 THR B 136     109.049 100.349  89.098  1.00  0.92           O  
ATOM    911  CG2 THR B 136     110.369 100.058  91.081  1.00  0.92           C  
ATOM    912  N   MET B 137     111.556 101.661  87.084  1.00  0.91           N  
ATOM    913  CA  MET B 137     111.508 102.029  85.676  1.00  0.91           C  
ATOM    914  C   MET B 137     110.168 101.761  84.977  1.00  0.91           C  
ATOM    915  O   MET B 137     109.923 102.235  83.869  1.00  0.91           O  
ATOM    916  CB  MET B 137     112.510 101.215  84.863  1.00  0.91           C  
ATOM    917  CG  MET B 137     113.985 101.475  85.183  1.00  0.91           C  
ATOM    918  SD  MET B 137     114.728 102.812  84.215  1.00  0.91           S  
ATOM    919  CE  MET B 137     116.276 102.680  85.140  1.00  0.91           C  
ATOM    920  N   GLU B 138     109.245 101.043  85.631  1.00  0.88           N  
ATOM    921  CA  GLU B 138     107.914 100.784  85.138  1.00  0.88           C  
ATOM    922  C   GLU B 138     106.934 101.844  85.611  1.00  0.88           C  
ATOM    923  O   GLU B 138     105.750 101.800  85.282  1.00  0.88           O  
ATOM    924  CB  GLU B 138     107.430  99.387  85.595  1.00  0.88           C  
ATOM    925  CG  GLU B 138     108.177  98.208  84.913  1.00  0.88           C  
ATOM    926  CD  GLU B 138     109.621  97.972  85.367  1.00  0.88           C  
ATOM    927  OE1 GLU B 138     110.022  98.416  86.476  1.00  0.88           O  
ATOM    928  OE2 GLU B 138     110.382  97.405  84.535  1.00  0.88           O  
ATOM    929  N   GLY B 139     107.413 102.874  86.346  1.00  0.94           N  
ATOM    930  CA  GLY B 139     106.563 103.955  86.823  1.00  0.94           C  
ATOM    931  C   GLY B 139     105.882 103.627  88.120  1.00  0.94           C  
ATOM    932  O   GLY B 139     105.064 104.404  88.605  1.00  0.94           O  
ATOM    933  N   GLU B 140     106.201 102.475  88.724  1.00  0.89           N  
ATOM    934  CA  GLU B 140     105.672 102.071  90.006  1.00  0.89           C  
ATOM    935  C   GLU B 140     106.432 102.735  91.138  1.00  0.89           C  
ATOM    936  O   GLU B 140     107.524 103.261  90.961  1.00  0.89           O  
ATOM    937  CB  GLU B 140     105.788 100.551  90.230  1.00  0.89           C  
ATOM    938  CG  GLU B 140     104.978  99.672  89.254  1.00  0.89           C  
ATOM    939  CD  GLU B 140     105.055  98.192  89.643  1.00  0.89           C  
ATOM    940  OE1 GLU B 140     105.834  97.848  90.573  1.00  0.89           O  
ATOM    941  OE2 GLU B 140     104.264  97.399  89.073  1.00  0.89           O  
ATOM    942  N   VAL B 141     105.855 102.706  92.359  1.00  0.93           N  
ATOM    943  CA  VAL B 141     106.491 103.251  93.545  1.00  0.93           C  
ATOM    944  C   VAL B 141     106.433 102.210  94.626  1.00  0.93           C  
ATOM    945  O   VAL B 141     105.395 101.602  94.871  1.00  0.93           O  
ATOM    946  CB  VAL B 141     105.841 104.520  94.078  1.00  0.93           C  
ATOM    947  CG1 VAL B 141     106.557 105.064  95.335  1.00  0.93           C  
ATOM    948  CG2 VAL B 141     105.930 105.581  92.981  1.00  0.93           C  
ATOM    949  N   GLN B 142     107.573 101.998  95.304  1.00  0.87           N  
ATOM    950  CA  GLN B 142     107.663 101.155  96.467  1.00  0.87           C  
ATOM    951  C   GLN B 142     108.148 101.999  97.629  1.00  0.87           C  
ATOM    952  O   GLN B 142     109.092 102.769  97.504  1.00  0.87           O  
ATOM    953  CB  GLN B 142     108.601  99.962  96.199  1.00  0.87           C  
ATOM    954  CG  GLN B 142     108.124  99.139  94.983  1.00  0.87           C  
ATOM    955  CD  GLN B 142     108.942  97.867  94.814  1.00  0.87           C  
ATOM    956  OE1 GLN B 142     109.272  97.185  95.785  1.00  0.87           O  
ATOM    957  NE2 GLN B 142     109.264  97.503  93.553  1.00  0.87           N  
ATOM    958  N   SER B 143     107.472 101.909  98.784  1.00  0.93           N  
ATOM    959  CA  SER B 143     107.727 102.743  99.941  1.00  0.93           C  
ATOM    960  C   SER B 143     108.010 101.921 101.178  1.00  0.93           C  
ATOM    961  O   SER B 143     107.537 100.800 101.336  1.00  0.93           O  
ATOM    962  CB  SER B 143     106.546 103.710 100.217  1.00  0.93           C  
ATOM    963  OG  SER B 143     105.325 103.019 100.483  1.00  0.93           O  
ATOM    964  N   TRP B 144     108.844 102.471 102.081  1.00  0.89           N  
ATOM    965  CA  TRP B 144     109.167 101.803 103.318  1.00  0.89           C  
ATOM    966  C   TRP B 144     109.620 102.818 104.346  1.00  0.89           C  
ATOM    967  O   TRP B 144     109.865 103.980 104.037  1.00  0.89           O  
ATOM    968  CB  TRP B 144     110.227 100.686 103.115  1.00  0.89           C  
ATOM    969  CG  TRP B 144     111.622 101.141 102.709  1.00  0.89           C  
ATOM    970  CD1 TRP B 144     112.649 101.356 103.563  1.00  0.89           C  
ATOM    971  CD2 TRP B 144     112.115 101.485 101.405  1.00  0.89           C  
ATOM    972  NE1 TRP B 144     113.759 101.813 102.899  1.00  0.89           N  
ATOM    973  CE2 TRP B 144     113.460 101.890 101.565  1.00  0.89           C  
ATOM    974  CE3 TRP B 144     111.520 101.487 100.158  1.00  0.89           C  
ATOM    975  CZ2 TRP B 144     114.219 102.291 100.474  1.00  0.89           C  
ATOM    976  CZ3 TRP B 144     112.288 101.873  99.059  1.00  0.89           C  
ATOM    977  CH2 TRP B 144     113.619 102.275  99.209  1.00  0.89           C  
ATOM    978  N   GLY B 145     109.728 102.393 105.621  1.00  0.93           N  
ATOM    979  CA  GLY B 145     110.015 103.283 106.728  1.00  0.93           C  
ATOM    980  C   GLY B 145     108.838 103.288 107.632  1.00  0.93           C  
ATOM    981  O   GLY B 145     108.024 102.371 107.647  1.00  0.93           O  
ATOM    982  N   ARG B 146     108.710 104.355 108.430  1.00  0.80           N  
ATOM    983  CA  ARG B 146     107.576 104.440 109.314  1.00  0.80           C  
ATOM    984  C   ARG B 146     106.417 105.145 108.671  1.00  0.80           C  
ATOM    985  O   ARG B 146     106.575 106.020 107.828  1.00  0.80           O  
ATOM    986  CB  ARG B 146     107.878 105.097 110.664  1.00  0.80           C  
ATOM    987  CG  ARG B 146     108.389 106.545 110.634  1.00  0.80           C  
ATOM    988  CD  ARG B 146     108.284 107.122 112.042  1.00  0.80           C  
ATOM    989  NE  ARG B 146     108.987 108.443 112.152  1.00  0.80           N  
ATOM    990  CZ  ARG B 146     109.939 108.721 113.066  1.00  0.80           C  
ATOM    991  NH1 ARG B 146     110.288 107.855 113.994  1.00  0.80           N  
ATOM    992  NH2 ARG B 146     110.557 109.904 113.030  1.00  0.80           N  
ATOM    993  N   ASN B 147     105.205 104.754 109.100  1.00  0.88           N  
ATOM    994  CA  ASN B 147     103.988 105.190 108.472  1.00  0.88           C  
ATOM    995  C   ASN B 147     103.017 105.808 109.458  1.00  0.88           C  
ATOM    996  O   ASN B 147     101.809 105.669 109.341  1.00  0.88           O  
ATOM    997  CB  ASN B 147     103.336 103.997 107.761  1.00  0.88           C  
ATOM    998  CG  ASN B 147     102.510 104.484 106.572  1.00  0.88           C  
ATOM    999  OD1 ASN B 147     102.598 105.592 106.103  1.00  0.88           O  
ATOM   1000  ND2 ASN B 147     101.622 103.570 106.086  1.00  0.88           N  
ATOM   1001  N   GLN B 148     103.532 106.554 110.452  1.00  0.85           N  
ATOM   1002  CA  GLN B 148     102.718 107.182 111.484  1.00  0.85           C  
ATOM   1003  C   GLN B 148     101.645 108.128 110.967  1.00  0.85           C  
ATOM   1004  O   GLN B 148     100.516 108.111 111.456  1.00  0.85           O  
ATOM   1005  CB  GLN B 148     103.630 107.895 112.512  1.00  0.85           C  
ATOM   1006  CG  GLN B 148     104.123 106.913 113.602  1.00  0.85           C  
ATOM   1007  CD  GLN B 148     105.525 107.226 114.113  1.00  0.85           C  
ATOM   1008  OE1 GLN B 148     105.999 108.362 114.156  1.00  0.85           O  
ATOM   1009  NE2 GLN B 148     106.281 106.155 114.462  1.00  0.85           N  
ATOM   1010  N   ASN B 149     101.958 108.928 109.935  1.00  0.90           N  
ATOM   1011  CA  ASN B 149     101.052 109.907 109.373  1.00  0.90           C  
ATOM   1012  C   ASN B 149     100.574 109.475 108.007  1.00  0.90           C  
ATOM   1013  O   ASN B 149     100.064 110.276 107.223  1.00  0.90           O  
ATOM   1014  CB  ASN B 149     101.777 111.249 109.216  1.00  0.90           C  
ATOM   1015  CG  ASN B 149     102.211 111.698 110.599  1.00  0.90           C  
ATOM   1016  OD1 ASN B 149     101.405 111.818 111.523  1.00  0.90           O  
ATOM   1017  ND2 ASN B 149     103.524 111.973 110.741  1.00  0.90           N  
ATOM   1018  N   GLY B 150     100.756 108.191 107.645  1.00  0.95           N  
ATOM   1019  CA  GLY B 150     100.258 107.691 106.373  1.00  0.95           C  
ATOM   1020  C   GLY B 150     101.077 108.041 105.158  1.00  0.95           C  
ATOM   1021  O   GLY B 150     100.664 107.816 104.028  1.00  0.95           O  
ATOM   1022  N   GLN B 151     102.292 108.585 105.364  1.00  0.89           N  
ATOM   1023  CA  GLN B 151     103.189 109.094 104.351  1.00  0.89           C  
ATOM   1024  C   GLN B 151     103.810 108.069 103.429  1.00  0.89           C  
ATOM   1025  O   GLN B 151     104.436 108.396 102.446  1.00  0.89           O  
ATOM   1026  CB  GLN B 151     104.376 109.836 104.982  1.00  0.89           C  
ATOM   1027  CG  GLN B 151     105.348 108.957 105.809  1.00  0.89           C  
ATOM   1028  CD  GLN B 151     105.137 109.052 107.322  1.00  0.89           C  
ATOM   1029  OE1 GLN B 151     104.030 108.957 107.844  1.00  0.89           O  
ATOM   1030  NE2 GLN B 151     106.262 109.229 108.060  1.00  0.89           N  
ATOM   1031  N   LEU B 152     103.594 106.774 103.711  1.00  0.93           N  
ATOM   1032  CA  LEU B 152     104.026 105.727 102.818  1.00  0.93           C  
ATOM   1033  C   LEU B 152     102.988 105.465 101.763  1.00  0.93           C  
ATOM   1034  O   LEU B 152     103.298 104.884 100.726  1.00  0.93           O  
ATOM   1035  CB  LEU B 152     104.282 104.417 103.573  1.00  0.93           C  
ATOM   1036  CG  LEU B 152     105.357 104.498 104.660  1.00  0.93           C  
ATOM   1037  CD1 LEU B 152     105.648 103.084 105.152  1.00  0.93           C  
ATOM   1038  CD2 LEU B 152     106.655 105.142 104.190  1.00  0.93           C  
ATOM   1039  N   GLY B 153     101.736 105.924 101.968  1.00  0.97           N  
ATOM   1040  CA  GLY B 153     100.704 105.825 100.947  1.00  0.97           C  
ATOM   1041  C   GLY B 153      99.976 104.525 100.874  1.00  0.97           C  
ATOM   1042  O   GLY B 153      99.319 104.229  99.881  1.00  0.97           O  
ATOM   1043  N   LEU B 154     100.074 103.718 101.934  1.00  0.93           N  
ATOM   1044  CA  LEU B 154      99.602 102.352 101.947  1.00  0.93           C  
ATOM   1045  C   LEU B 154      98.105 102.242 102.257  1.00  0.93           C  
ATOM   1046  O   LEU B 154      97.492 101.213 102.052  1.00  0.93           O  
ATOM   1047  CB  LEU B 154     100.490 101.513 102.902  1.00  0.93           C  
ATOM   1048  CG  LEU B 154     101.989 101.464 102.506  1.00  0.93           C  
ATOM   1049  CD1 LEU B 154     102.800 100.709 103.572  1.00  0.93           C  
ATOM   1050  CD2 LEU B 154     102.214 100.839 101.117  1.00  0.93           C  
ATOM   1051  N   GLY B 155      97.474 103.380 102.653  1.00  0.92           N  
ATOM   1052  CA  GLY B 155      96.054 103.456 102.980  1.00  0.92           C  
ATOM   1053  C   GLY B 155      95.745 103.442 104.454  1.00  0.92           C  
ATOM   1054  O   GLY B 155      94.621 103.716 104.855  1.00  0.92           O  
ATOM   1055  N   ASP B 156      96.758 103.169 105.281  1.00  0.88           N  
ATOM   1056  CA  ASP B 156      96.634 102.894 106.681  1.00  0.88           C  
ATOM   1057  C   ASP B 156      97.937 103.374 107.353  1.00  0.88           C  
ATOM   1058  O   ASP B 156      98.858 103.784 106.732  1.00  0.88           O  
ATOM   1059  CB  ASP B 156      96.168 101.422 106.877  1.00  0.88           C  
ATOM   1060  CG  ASP B 156      96.743 100.408 105.871  1.00  0.88           C  
ATOM   1061  OD1 ASP B 156      97.734 100.730 105.174  1.00  0.88           O  
ATOM   1062  OD2 ASP B 156      96.066  99.341 105.745  1.00  0.88           O  
ATOM   1063  N   THR B 157      97.987 103.254 108.728  1.00  0.88           N  
ATOM   1064  CA  THR B 157      99.120 103.746 109.506  1.00  0.88           C  
ATOM   1065  C   THR B 157      99.848 102.673 110.283  1.00  0.88           C  
ATOM   1066  O   THR B 157      99.909 102.690 111.507  1.00  0.88           O  
ATOM   1067  CB  THR B 157      98.770 104.868 110.487  1.00  0.88           C  
ATOM   1068  OG1 THR B 157      97.590 104.627 111.244  1.00  0.88           O  
ATOM   1069  CG2 THR B 157      98.502 106.133 109.680  1.00  0.88           C  
ATOM   1070  N   GLU B 158     100.514 101.745 109.571  1.00  0.84           N  
ATOM   1071  CA  GLU B 158     101.420 100.800 110.182  1.00  0.84           C  
ATOM   1072  C   GLU B 158     102.783 100.837 109.529  1.00  0.84           C  
ATOM   1073  O   GLU B 158     102.926 101.057 108.331  1.00  0.84           O  
ATOM   1074  CB  GLU B 158     100.869  99.359 110.189  1.00  0.84           C  
ATOM   1075  CG  GLU B 158     100.763  98.632 108.826  1.00  0.84           C  
ATOM   1076  CD  GLU B 158      99.472  98.888 108.046  1.00  0.84           C  
ATOM   1077  OE1 GLU B 158      98.694  99.784 108.458  1.00  0.84           O  
ATOM   1078  OE2 GLU B 158      99.279  98.127 107.065  1.00  0.84           O  
ATOM   1079  N   ASP B 159     103.849 100.689 110.340  1.00  0.85           N  
ATOM   1080  CA  ASP B 159     105.222 100.704 109.873  1.00  0.85           C  
ATOM   1081  C   ASP B 159     105.597  99.537 108.958  1.00  0.85           C  
ATOM   1082  O   ASP B 159     105.166  98.402 109.139  1.00  0.85           O  
ATOM   1083  CB  ASP B 159     106.185 100.795 111.081  1.00  0.85           C  
ATOM   1084  CG  ASP B 159     105.981 102.098 111.848  1.00  0.85           C  
ATOM   1085  OD1 ASP B 159     105.394 103.059 111.281  1.00  0.85           O  
ATOM   1086  OD2 ASP B 159     106.455 102.173 113.010  1.00  0.85           O  
ATOM   1087  N   SER B 160     106.451  99.800 107.942  1.00  0.89           N  
ATOM   1088  CA  SER B 160     106.847  98.783 106.983  1.00  0.89           C  
ATOM   1089  C   SER B 160     108.354  98.752 106.836  1.00  0.89           C  
ATOM   1090  O   SER B 160     109.023  99.755 106.596  1.00  0.89           O  
ATOM   1091  CB  SER B 160     106.148  98.897 105.595  1.00  0.89           C  
ATOM   1092  OG  SER B 160     106.551 100.034 104.835  1.00  0.89           O  
ATOM   1093  N   LEU B 161     108.962  97.556 106.996  1.00  0.85           N  
ATOM   1094  CA  LEU B 161     110.407  97.422 106.939  1.00  0.85           C  
ATOM   1095  C   LEU B 161     110.893  96.943 105.586  1.00  0.85           C  
ATOM   1096  O   LEU B 161     112.094  96.829 105.338  1.00  0.85           O  
ATOM   1097  CB  LEU B 161     110.915  96.417 107.999  1.00  0.85           C  
ATOM   1098  CG  LEU B 161     110.847  96.881 109.470  1.00  0.85           C  
ATOM   1099  CD1 LEU B 161     109.459  96.898 110.124  1.00  0.85           C  
ATOM   1100  CD2 LEU B 161     111.821  96.046 110.304  1.00  0.85           C  
ATOM   1101  N   VAL B 162     109.952  96.669 104.673  1.00  0.82           N  
ATOM   1102  CA  VAL B 162     110.198  96.136 103.359  1.00  0.82           C  
ATOM   1103  C   VAL B 162     109.606  97.145 102.393  1.00  0.82           C  
ATOM   1104  O   VAL B 162     108.534  97.666 102.699  1.00  0.82           O  
ATOM   1105  CB  VAL B 162     109.597  94.733 103.195  1.00  0.82           C  
ATOM   1106  CG1 VAL B 162     108.098  94.652 103.556  1.00  0.82           C  
ATOM   1107  CG2 VAL B 162     109.849  94.175 101.784  1.00  0.82           C  
ATOM   1108  N   PRO B 163     110.234  97.521 101.274  1.00  0.86           N  
ATOM   1109  CA  PRO B 163     109.581  98.194 100.156  1.00  0.86           C  
ATOM   1110  C   PRO B 163     108.251  97.580  99.779  1.00  0.86           C  
ATOM   1111  O   PRO B 163     108.198  96.477  99.247  1.00  0.86           O  
ATOM   1112  CB  PRO B 163     110.626  98.174  99.028  1.00  0.86           C  
ATOM   1113  CG  PRO B 163     111.969  98.020  99.746  1.00  0.86           C  
ATOM   1114  CD  PRO B 163     111.609  97.171 100.953  1.00  0.86           C  
ATOM   1115  N   GLN B 164     107.159  98.308 100.037  1.00  0.84           N  
ATOM   1116  CA  GLN B 164     105.842  97.867  99.691  1.00  0.84           C  
ATOM   1117  C   GLN B 164     105.393  98.748  98.571  1.00  0.84           C  
ATOM   1118  O   GLN B 164     105.510  99.960  98.607  1.00  0.84           O  
ATOM   1119  CB  GLN B 164     104.876  97.940 100.890  1.00  0.84           C  
ATOM   1120  CG  GLN B 164     105.117  96.771 101.865  1.00  0.84           C  
ATOM   1121  CD  GLN B 164     104.004  96.646 102.895  1.00  0.84           C  
ATOM   1122  OE1 GLN B 164     104.044  97.284 103.950  1.00  0.84           O  
ATOM   1123  NE2 GLN B 164     102.987  95.800 102.616  1.00  0.84           N  
ATOM   1124  N   LYS B 165     104.886  98.122  97.493  1.00  0.86           N  
ATOM   1125  CA  LYS B 165     104.290  98.854  96.403  1.00  0.86           C  
ATOM   1126  C   LYS B 165     103.127  99.696  96.883  1.00  0.86           C  
ATOM   1127  O   LYS B 165     102.348  99.285  97.733  1.00  0.86           O  
ATOM   1128  CB  LYS B 165     103.839  97.893  95.277  1.00  0.86           C  
ATOM   1129  CG  LYS B 165     103.266  98.590  94.031  1.00  0.86           C  
ATOM   1130  CD  LYS B 165     102.929  97.630  92.880  1.00  0.86           C  
ATOM   1131  CE  LYS B 165     101.706  96.760  93.156  1.00  0.86           C  
ATOM   1132  NZ  LYS B 165     101.409  95.933  91.967  1.00  0.86           N  
ATOM   1133  N   ILE B 166     102.974 100.911  96.350  1.00  0.90           N  
ATOM   1134  CA  ILE B 166     101.805 101.698  96.655  1.00  0.90           C  
ATOM   1135  C   ILE B 166     100.694 101.263  95.702  1.00  0.90           C  
ATOM   1136  O   ILE B 166     100.637 101.659  94.543  1.00  0.90           O  
ATOM   1137  CB  ILE B 166     102.117 103.180  96.565  1.00  0.90           C  
ATOM   1138  CG1 ILE B 166     103.182 103.569  97.615  1.00  0.90           C  
ATOM   1139  CG2 ILE B 166     100.840 104.018  96.761  1.00  0.90           C  
ATOM   1140  CD1 ILE B 166     103.712 104.992  97.426  1.00  0.90           C  
ATOM   1141  N   GLN B 167      99.759 100.403  96.183  1.00  0.85           N  
ATOM   1142  CA  GLN B 167      98.639  99.904  95.381  1.00  0.85           C  
ATOM   1143  C   GLN B 167      97.641 100.966  94.937  1.00  0.85           C  
ATOM   1144  O   GLN B 167      96.874 100.749  94.001  1.00  0.85           O  
ATOM   1145  CB  GLN B 167      97.836  98.762  96.072  1.00  0.85           C  
ATOM   1146  CG  GLN B 167      98.396  97.334  95.857  1.00  0.85           C  
ATOM   1147  CD  GLN B 167      99.290  96.897  97.011  1.00  0.85           C  
ATOM   1148  OE1 GLN B 167     100.018  97.706  97.581  1.00  0.85           O  
ATOM   1149  NE2 GLN B 167      99.272  95.596  97.377  1.00  0.85           N  
ATOM   1150  N   ALA B 168      97.665 102.161  95.548  1.00  0.93           N  
ATOM   1151  CA  ALA B 168      96.885 103.308  95.133  1.00  0.93           C  
ATOM   1152  C   ALA B 168      97.313 103.876  93.778  1.00  0.93           C  
ATOM   1153  O   ALA B 168      96.573 104.624  93.139  1.00  0.93           O  
ATOM   1154  CB  ALA B 168      97.025 104.384  96.216  1.00  0.93           C  
ATOM   1155  N   PHE B 169      98.514 103.496  93.299  1.00  0.91           N  
ATOM   1156  CA  PHE B 169      99.039 103.850  91.998  1.00  0.91           C  
ATOM   1157  C   PHE B 169      98.993 102.698  91.024  1.00  0.91           C  
ATOM   1158  O   PHE B 169      99.833 102.587  90.131  1.00  0.91           O  
ATOM   1159  CB  PHE B 169     100.487 104.357  92.097  1.00  0.91           C  
ATOM   1160  CG  PHE B 169     100.506 105.689  92.749  1.00  0.91           C  
ATOM   1161  CD1 PHE B 169      99.833 106.762  92.147  1.00  0.91           C  
ATOM   1162  CD2 PHE B 169     101.312 105.926  93.867  1.00  0.91           C  
ATOM   1163  CE1 PHE B 169      99.995 108.059  92.631  1.00  0.91           C  
ATOM   1164  CE2 PHE B 169     101.466 107.224  94.360  1.00  0.91           C  
ATOM   1165  CZ  PHE B 169     100.814 108.292  93.736  1.00  0.91           C  
ATOM   1166  N   GLU B 170      98.008 101.787  91.152  1.00  0.83           N  
ATOM   1167  CA  GLU B 170      97.796 100.764  90.139  1.00  0.83           C  
ATOM   1168  C   GLU B 170      97.514 101.392  88.774  1.00  0.83           C  
ATOM   1169  O   GLU B 170      96.676 102.277  88.639  1.00  0.83           O  
ATOM   1170  CB  GLU B 170      96.677  99.772  90.539  1.00  0.83           C  
ATOM   1171  CG  GLU B 170      96.797  98.343  89.942  1.00  0.83           C  
ATOM   1172  CD  GLU B 170      96.679  98.230  88.418  1.00  0.83           C  
ATOM   1173  OE1 GLU B 170      95.729  98.794  87.829  1.00  0.83           O  
ATOM   1174  OE2 GLU B 170      97.570  97.539  87.852  1.00  0.83           O  
ATOM   1175  N   GLY B 171      98.312 101.009  87.751  1.00  0.91           N  
ATOM   1176  CA  GLY B 171      98.097 101.451  86.379  1.00  0.91           C  
ATOM   1177  C   GLY B 171      98.536 102.857  86.073  1.00  0.91           C  
ATOM   1178  O   GLY B 171      98.342 103.346  84.962  1.00  0.91           O  
ATOM   1179  N   ILE B 172      99.162 103.548  87.038  1.00  0.91           N  
ATOM   1180  CA  ILE B 172      99.573 104.930  86.888  1.00  0.91           C  
ATOM   1181  C   ILE B 172     101.071 104.964  86.939  1.00  0.91           C  
ATOM   1182  O   ILE B 172     101.704 104.577  87.918  1.00  0.91           O  
ATOM   1183  CB  ILE B 172      99.014 105.856  87.964  1.00  0.91           C  
ATOM   1184  CG1 ILE B 172      97.471 105.845  87.919  1.00  0.91           C  
ATOM   1185  CG2 ILE B 172      99.560 107.289  87.764  1.00  0.91           C  
ATOM   1186  CD1 ILE B 172      96.803 106.556  89.101  1.00  0.91           C  
ATOM   1187  N   ARG B 173     101.693 105.456  85.858  1.00  0.84           N  
ATOM   1188  CA  ARG B 173     103.122 105.577  85.812  1.00  0.84           C  
ATOM   1189  C   ARG B 173     103.552 106.888  86.450  1.00  0.84           C  
ATOM   1190  O   ARG B 173     103.020 107.955  86.164  1.00  0.84           O  
ATOM   1191  CB  ARG B 173     103.641 105.488  84.367  1.00  0.84           C  
ATOM   1192  CG  ARG B 173     103.408 104.114  83.704  1.00  0.84           C  
ATOM   1193  CD  ARG B 173     104.129 103.927  82.361  1.00  0.84           C  
ATOM   1194  NE  ARG B 173     105.591 104.040  82.603  1.00  0.84           N  
ATOM   1195  CZ  ARG B 173     106.526 103.112  82.385  1.00  0.84           C  
ATOM   1196  NH1 ARG B 173     106.244 101.890  81.950  1.00  0.84           N  
ATOM   1197  NH2 ARG B 173     107.787 103.460  82.658  1.00  0.84           N  
ATOM   1198  N   ILE B 174     104.527 106.832  87.369  1.00  0.91           N  
ATOM   1199  CA  ILE B 174     105.022 107.987  88.086  1.00  0.91           C  
ATOM   1200  C   ILE B 174     106.394 108.389  87.600  1.00  0.91           C  
ATOM   1201  O   ILE B 174     107.341 107.613  87.521  1.00  0.91           O  
ATOM   1202  CB  ILE B 174     104.985 107.738  89.577  1.00  0.91           C  
ATOM   1203  CG1 ILE B 174     103.511 107.545  89.963  1.00  0.91           C  
ATOM   1204  CG2 ILE B 174     105.603 108.895  90.385  1.00  0.91           C  
ATOM   1205  CD1 ILE B 174     103.326 107.059  91.385  1.00  0.91           C  
ATOM   1206  N   LYS B 175     106.502 109.674  87.210  1.00  0.86           N  
ATOM   1207  CA  LYS B 175     107.712 110.273  86.716  1.00  0.86           C  
ATOM   1208  C   LYS B 175     108.746 110.463  87.794  1.00  0.86           C  
ATOM   1209  O   LYS B 175     109.920 110.145  87.596  1.00  0.86           O  
ATOM   1210  CB  LYS B 175     107.385 111.645  86.098  1.00  0.86           C  
ATOM   1211  CG  LYS B 175     108.607 112.372  85.528  1.00  0.86           C  
ATOM   1212  CD  LYS B 175     108.206 113.648  84.787  1.00  0.86           C  
ATOM   1213  CE  LYS B 175     109.404 114.373  84.183  1.00  0.86           C  
ATOM   1214  NZ  LYS B 175     108.914 115.529  83.413  1.00  0.86           N  
ATOM   1215  N   MET B 176     108.298 110.988  88.949  1.00  0.87           N  
ATOM   1216  CA  MET B 176     109.154 111.196  90.084  1.00  0.87           C  
ATOM   1217  C   MET B 176     108.352 111.363  91.354  1.00  0.87           C  
ATOM   1218  O   MET B 176     107.150 111.625  91.325  1.00  0.87           O  
ATOM   1219  CB  MET B 176     110.087 112.422  89.917  1.00  0.87           C  
ATOM   1220  CG  MET B 176     109.435 113.816  89.955  1.00  0.87           C  
ATOM   1221  SD  MET B 176     110.671 115.148  90.023  1.00  0.87           S  
ATOM   1222  CE  MET B 176     111.121 114.946  91.770  1.00  0.87           C  
ATOM   1223  N   VAL B 177     109.027 111.225  92.513  1.00  0.91           N  
ATOM   1224  CA  VAL B 177     108.432 111.452  93.813  1.00  0.91           C  
ATOM   1225  C   VAL B 177     109.386 112.278  94.648  1.00  0.91           C  
ATOM   1226  O   VAL B 177     110.601 112.239  94.470  1.00  0.91           O  
ATOM   1227  CB  VAL B 177     108.062 110.165  94.570  1.00  0.91           C  
ATOM   1228  CG1 VAL B 177     107.141 109.296  93.700  1.00  0.91           C  
ATOM   1229  CG2 VAL B 177     109.296 109.339  94.979  1.00  0.91           C  
ATOM   1230  N   ALA B 178     108.846 113.064  95.598  1.00  0.91           N  
ATOM   1231  CA  ALA B 178     109.644 113.761  96.572  1.00  0.91           C  
ATOM   1232  C   ALA B 178     109.068 113.489  97.950  1.00  0.91           C  
ATOM   1233  O   ALA B 178     107.860 113.368  98.128  1.00  0.91           O  
ATOM   1234  CB  ALA B 178     109.672 115.268  96.265  1.00  0.91           C  
ATOM   1235  N   ALA B 179     109.944 113.344  98.962  1.00  0.91           N  
ATOM   1236  CA  ALA B 179     109.549 113.060 100.316  1.00  0.91           C  
ATOM   1237  C   ALA B 179     110.049 114.170 101.214  1.00  0.91           C  
ATOM   1238  O   ALA B 179     111.205 114.568 101.142  1.00  0.91           O  
ATOM   1239  CB  ALA B 179     110.135 111.708 100.759  1.00  0.91           C  
ATOM   1240  N   GLY B 180     109.143 114.717 102.048  1.00  0.92           N  
ATOM   1241  CA  GLY B 180     109.446 115.691 103.081  1.00  0.92           C  
ATOM   1242  C   GLY B 180     109.608 114.950 104.374  1.00  0.92           C  
ATOM   1243  O   GLY B 180     109.855 113.746 104.399  1.00  0.92           O  
ATOM   1244  N   ALA B 181     109.413 115.649 105.504  1.00  0.92           N  
ATOM   1245  CA  ALA B 181     109.555 115.039 106.811  1.00  0.92           C  
ATOM   1246  C   ALA B 181     108.563 113.934 107.115  1.00  0.92           C  
ATOM   1247  O   ALA B 181     108.914 112.826 107.528  1.00  0.92           O  
ATOM   1248  CB  ALA B 181     109.421 116.125 107.882  1.00  0.92           C  
ATOM   1249  N   GLU B 182     107.283 114.206 106.839  1.00  0.87           N  
ATOM   1250  CA  GLU B 182     106.212 113.304 107.160  1.00  0.87           C  
ATOM   1251  C   GLU B 182     105.184 113.324 106.048  1.00  0.87           C  
ATOM   1252  O   GLU B 182     104.063 112.850 106.212  1.00  0.87           O  
ATOM   1253  CB  GLU B 182     105.554 113.738 108.488  1.00  0.87           C  
ATOM   1254  CG  GLU B 182     106.389 113.461 109.763  1.00  0.87           C  
ATOM   1255  CD  GLU B 182     105.954 114.347 110.936  1.00  0.87           C  
ATOM   1256  OE1 GLU B 182     105.388 113.773 111.903  1.00  0.87           O  
ATOM   1257  OE2 GLU B 182     106.199 115.579 110.876  1.00  0.87           O  
ATOM   1258  N   HIS B 183     105.526 113.848 104.858  1.00  0.89           N  
ATOM   1259  CA  HIS B 183     104.623 113.860 103.732  1.00  0.89           C  
ATOM   1260  C   HIS B 183     105.389 113.624 102.468  1.00  0.89           C  
ATOM   1261  O   HIS B 183     106.611 113.714 102.423  1.00  0.89           O  
ATOM   1262  CB  HIS B 183     103.840 115.183 103.582  1.00  0.89           C  
ATOM   1263  CG  HIS B 183     104.641 116.374 103.154  1.00  0.89           C  
ATOM   1264  ND1 HIS B 183     105.513 116.961 104.039  1.00  0.89           N  
ATOM   1265  CD2 HIS B 183     104.649 117.039 101.966  1.00  0.89           C  
ATOM   1266  CE1 HIS B 183     106.037 117.982 103.383  1.00  0.89           C  
ATOM   1267  NE2 HIS B 183     105.544 118.072 102.125  1.00  0.89           N  
ATOM   1268  N   THR B 184     104.682 113.279 101.388  1.00  0.91           N  
ATOM   1269  CA  THR B 184     105.325 113.011 100.127  1.00  0.91           C  
ATOM   1270  C   THR B 184     104.448 113.563  99.041  1.00  0.91           C  
ATOM   1271  O   THR B 184     103.283 113.897  99.246  1.00  0.91           O  
ATOM   1272  CB  THR B 184     105.596 111.531  99.867  1.00  0.91           C  
ATOM   1273  OG1 THR B 184     104.393 110.804  99.772  1.00  0.91           O  
ATOM   1274  CG2 THR B 184     106.347 110.889 101.032  1.00  0.91           C  
ATOM   1275  N   ALA B 185     105.026 113.702  97.842  1.00  0.94           N  
ATOM   1276  CA  ALA B 185     104.269 114.115  96.704  1.00  0.94           C  
ATOM   1277  C   ALA B 185     104.846 113.409  95.483  1.00  0.94           C  
ATOM   1278  O   ALA B 185     106.022 113.493  95.192  1.00  0.94           O  
ATOM   1279  CB  ALA B 185     104.330 115.650  96.620  1.00  0.94           C  
ATOM   1280  N   ALA B 186     103.988 112.638  94.770  1.00  0.88           N  
ATOM   1281  CA  ALA B 186     104.329 111.988  93.522  1.00  0.88           C  
ATOM   1282  C   ALA B 186     103.785 112.760  92.341  1.00  0.88           C  
ATOM   1283  O   ALA B 186     102.729 113.381  92.404  1.00  0.88           O  
ATOM   1284  CB  ALA B 186     103.777 110.550  93.451  1.00  0.88           C  
ATOM   1285  N   VAL B 187     104.511 112.705  91.214  1.00  0.91           N  
ATOM   1286  CA  VAL B 187     104.105 113.331  89.973  1.00  0.91           C  
ATOM   1287  C   VAL B 187     103.994 112.258  88.922  1.00  0.91           C  
ATOM   1288  O   VAL B 187     104.952 111.552  88.610  1.00  0.91           O  
ATOM   1289  CB  VAL B 187     105.104 114.372  89.510  1.00  0.91           C  
ATOM   1290  CG1 VAL B 187     104.742 114.931  88.126  1.00  0.91           C  
ATOM   1291  CG2 VAL B 187     105.074 115.515  90.525  1.00  0.91           C  
ATOM   1292  N   THR B 188     102.792 112.085  88.350  1.00  0.91           N  
ATOM   1293  CA  THR B 188     102.543 111.111  87.294  1.00  0.91           C  
ATOM   1294  C   THR B 188     103.281 111.464  86.007  1.00  0.91           C  
ATOM   1295  O   THR B 188     103.606 112.612  85.754  1.00  0.91           O  
ATOM   1296  CB  THR B 188     101.076 110.780  87.027  1.00  0.91           C  
ATOM   1297  OG1 THR B 188     100.355 111.811  86.371  1.00  0.91           O  
ATOM   1298  CG2 THR B 188     100.370 110.528  88.363  1.00  0.91           C  
ATOM   1299  N   GLU B 189     103.603 110.466  85.153  1.00  0.88           N  
ATOM   1300  CA  GLU B 189     104.200 110.685  83.836  1.00  0.88           C  
ATOM   1301  C   GLU B 189     103.266 111.451  82.896  1.00  0.88           C  
ATOM   1302  O   GLU B 189     103.720 112.157  81.996  1.00  0.88           O  
ATOM   1303  CB  GLU B 189     104.679 109.341  83.194  1.00  0.88           C  
ATOM   1304  CG  GLU B 189     105.917 108.690  83.892  1.00  0.88           C  
ATOM   1305  CD  GLU B 189     106.525 107.398  83.307  1.00  0.88           C  
ATOM   1306  OE1 GLU B 189     105.908 106.713  82.458  1.00  0.88           O  
ATOM   1307  OE2 GLU B 189     107.657 107.047  83.759  1.00  0.88           O  
ATOM   1308  N   ASP B 190     101.939 111.380  83.133  1.00  0.88           N  
ATOM   1309  CA  ASP B 190     100.929 112.150  82.440  1.00  0.88           C  
ATOM   1310  C   ASP B 190     100.896 113.619  82.860  1.00  0.88           C  
ATOM   1311  O   ASP B 190     100.380 114.473  82.138  1.00  0.88           O  
ATOM   1312  CB  ASP B 190      99.535 111.518  82.661  1.00  0.88           C  
ATOM   1313  CG  ASP B 190      99.513 110.116  82.077  1.00  0.88           C  
ATOM   1314  OD1 ASP B 190     100.005 109.194  82.779  1.00  0.88           O  
ATOM   1315  OD2 ASP B 190      98.991 109.963  80.945  1.00  0.88           O  
ATOM   1316  N   GLY B 191     101.481 113.969  84.027  1.00  0.94           N  
ATOM   1317  CA  GLY B 191     101.565 115.342  84.510  1.00  0.94           C  
ATOM   1318  C   GLY B 191     100.643 115.702  85.651  1.00  0.94           C  
ATOM   1319  O   GLY B 191     100.575 116.856  86.059  1.00  0.94           O  
ATOM   1320  N   ASP B 192      99.884 114.744  86.204  1.00  0.91           N  
ATOM   1321  CA  ASP B 192      99.127 114.936  87.432  1.00  0.91           C  
ATOM   1322  C   ASP B 192     100.039 114.995  88.653  1.00  0.91           C  
ATOM   1323  O   ASP B 192     101.175 114.547  88.649  1.00  0.91           O  
ATOM   1324  CB  ASP B 192      98.034 113.863  87.667  1.00  0.91           C  
ATOM   1325  CG  ASP B 192      96.832 114.030  86.757  1.00  0.91           C  
ATOM   1326  OD1 ASP B 192      96.724 115.058  86.033  1.00  0.91           O  
ATOM   1327  OD2 ASP B 192      95.910 113.190  86.858  1.00  0.91           O  
ATOM   1328  N   LEU B 193      99.514 115.579  89.748  1.00  0.92           N  
ATOM   1329  CA  LEU B 193     100.241 115.776  90.977  1.00  0.92           C  
ATOM   1330  C   LEU B 193      99.454 115.101  92.078  1.00  0.92           C  
ATOM   1331  O   LEU B 193      98.233 115.208  92.146  1.00  0.92           O  
ATOM   1332  CB  LEU B 193     100.409 117.282  91.261  1.00  0.92           C  
ATOM   1333  CG  LEU B 193     101.128 117.640  92.572  1.00  0.92           C  
ATOM   1334  CD1 LEU B 193     102.570 117.115  92.623  1.00  0.92           C  
ATOM   1335  CD2 LEU B 193     101.099 119.160  92.768  1.00  0.92           C  
ATOM   1336  N   TYR B 194     100.152 114.345  92.939  1.00  0.89           N  
ATOM   1337  CA  TYR B 194      99.578 113.612  94.036  1.00  0.89           C  
ATOM   1338  C   TYR B 194     100.270 114.052  95.304  1.00  0.89           C  
ATOM   1339  O   TYR B 194     101.458 114.354  95.303  1.00  0.89           O  
ATOM   1340  CB  TYR B 194      99.785 112.087  93.879  1.00  0.89           C  
ATOM   1341  CG  TYR B 194      98.808 111.509  92.899  1.00  0.89           C  
ATOM   1342  CD1 TYR B 194      98.876 111.775  91.523  1.00  0.89           C  
ATOM   1343  CD2 TYR B 194      97.789 110.671  93.364  1.00  0.89           C  
ATOM   1344  CE1 TYR B 194      97.905 111.267  90.650  1.00  0.89           C  
ATOM   1345  CE2 TYR B 194      96.865 110.098  92.484  1.00  0.89           C  
ATOM   1346  CZ  TYR B 194      96.911 110.415  91.125  1.00  0.89           C  
ATOM   1347  OH  TYR B 194      95.972 109.875  90.229  1.00  0.89           O  
ATOM   1348  N   GLY B 195      99.541 114.089  96.431  1.00  0.95           N  
ATOM   1349  CA  GLY B 195     100.134 114.410  97.719  1.00  0.95           C  
ATOM   1350  C   GLY B 195      99.505 113.575  98.792  1.00  0.95           C  
ATOM   1351  O   GLY B 195      98.308 113.305  98.762  1.00  0.95           O  
ATOM   1352  N   TRP B 196     100.309 113.140  99.778  1.00  0.90           N  
ATOM   1353  CA  TRP B 196      99.802 112.357 100.880  1.00  0.90           C  
ATOM   1354  C   TRP B 196     100.744 112.418 102.068  1.00  0.90           C  
ATOM   1355  O   TRP B 196     101.844 112.955 101.992  1.00  0.90           O  
ATOM   1356  CB  TRP B 196      99.479 110.902 100.471  1.00  0.90           C  
ATOM   1357  CG  TRP B 196     100.641 110.008 100.100  1.00  0.90           C  
ATOM   1358  CD1 TRP B 196     101.279 109.168 100.956  1.00  0.90           C  
ATOM   1359  CD2 TRP B 196     101.360 109.906  98.854  1.00  0.90           C  
ATOM   1360  NE1 TRP B 196     102.325 108.528 100.333  1.00  0.90           N  
ATOM   1361  CE2 TRP B 196     102.368 108.962  99.033  1.00  0.90           C  
ATOM   1362  CE3 TRP B 196     101.215 110.567  97.637  1.00  0.90           C  
ATOM   1363  CZ2 TRP B 196     103.246 108.616  98.013  1.00  0.90           C  
ATOM   1364  CZ3 TRP B 196     102.133 110.269  96.623  1.00  0.90           C  
ATOM   1365  CH2 TRP B 196     103.131 109.312  96.808  1.00  0.90           C  
ATOM   1366  N   GLY B 197     100.298 111.902 103.233  1.00  0.94           N  
ATOM   1367  CA  GLY B 197     101.036 111.993 104.480  1.00  0.94           C  
ATOM   1368  C   GLY B 197     100.587 113.196 105.252  1.00  0.94           C  
ATOM   1369  O   GLY B 197      99.477 113.668 105.109  1.00  0.94           O  
ATOM   1370  N   TRP B 198     101.483 113.723 106.109  1.00  0.87           N  
ATOM   1371  CA  TRP B 198     101.232 114.864 106.965  1.00  0.87           C  
ATOM   1372  C   TRP B 198     100.838 116.121 106.214  1.00  0.87           C  
ATOM   1373  O   TRP B 198     101.655 116.835 105.650  1.00  0.87           O  
ATOM   1374  CB  TRP B 198     102.467 115.153 107.842  1.00  0.87           C  
ATOM   1375  CG  TRP B 198     102.330 116.297 108.835  1.00  0.87           C  
ATOM   1376  CD1 TRP B 198     102.759 117.585 108.721  1.00  0.87           C  
ATOM   1377  CD2 TRP B 198     101.757 116.172 110.133  1.00  0.87           C  
ATOM   1378  NE1 TRP B 198     102.430 118.296 109.848  1.00  0.87           N  
ATOM   1379  CE2 TRP B 198     101.853 117.443 110.751  1.00  0.87           C  
ATOM   1380  CE3 TRP B 198     101.217 115.096 110.804  1.00  0.87           C  
ATOM   1381  CZ2 TRP B 198     101.426 117.622 112.054  1.00  0.87           C  
ATOM   1382  CZ3 TRP B 198     100.845 115.262 112.137  1.00  0.87           C  
ATOM   1383  CH2 TRP B 198     100.954 116.509 112.760  1.00  0.87           C  
ATOM   1384  N   GLY B 199      99.527 116.425 106.230  1.00  0.91           N  
ATOM   1385  CA  GLY B 199      98.947 117.507 105.458  1.00  0.91           C  
ATOM   1386  C   GLY B 199      98.499 118.678 106.266  1.00  0.91           C  
ATOM   1387  O   GLY B 199      97.823 119.564 105.775  1.00  0.91           O  
ATOM   1388  N   ARG B 200      98.912 118.749 107.541  1.00  0.79           N  
ATOM   1389  CA  ARG B 200      98.275 119.612 108.516  1.00  0.79           C  
ATOM   1390  C   ARG B 200      98.738 121.066 108.506  1.00  0.79           C  
ATOM   1391  O   ARG B 200      98.504 121.833 109.433  1.00  0.79           O  
ATOM   1392  CB  ARG B 200      98.423 118.981 109.909  1.00  0.79           C  
ATOM   1393  CG  ARG B 200      97.554 117.719 110.073  1.00  0.79           C  
ATOM   1394  CD  ARG B 200      97.933 116.944 111.329  1.00  0.79           C  
ATOM   1395  NE  ARG B 200      96.719 116.282 111.877  1.00  0.79           N  
ATOM   1396  CZ  ARG B 200      96.663 115.803 113.132  1.00  0.79           C  
ATOM   1397  NH1 ARG B 200      97.708 115.881 113.942  1.00  0.79           N  
ATOM   1398  NH2 ARG B 200      95.576 115.140 113.511  1.00  0.79           N  
ATOM   1399  N   TYR B 201      99.345 121.492 107.386  1.00  0.87           N  
ATOM   1400  CA  TYR B 201      99.781 122.851 107.161  1.00  0.87           C  
ATOM   1401  C   TYR B 201      99.475 123.255 105.731  1.00  0.87           C  
ATOM   1402  O   TYR B 201     100.013 124.235 105.222  1.00  0.87           O  
ATOM   1403  CB  TYR B 201     101.301 123.015 107.395  1.00  0.87           C  
ATOM   1404  CG  TYR B 201     101.643 122.947 108.854  1.00  0.87           C  
ATOM   1405  CD1 TYR B 201     101.607 124.108 109.636  1.00  0.87           C  
ATOM   1406  CD2 TYR B 201     102.004 121.738 109.464  1.00  0.87           C  
ATOM   1407  CE1 TYR B 201     101.939 124.068 110.995  1.00  0.87           C  
ATOM   1408  CE2 TYR B 201     102.313 121.690 110.831  1.00  0.87           C  
ATOM   1409  CZ  TYR B 201     102.302 122.862 111.592  1.00  0.87           C  
ATOM   1410  OH  TYR B 201     102.683 122.835 112.948  1.00  0.87           O  
ATOM   1411  N   GLY B 202      98.599 122.514 105.014  1.00  0.94           N  
ATOM   1412  CA  GLY B 202      98.390 122.793 103.595  1.00  0.94           C  
ATOM   1413  C   GLY B 202      99.412 122.175 102.682  1.00  0.94           C  
ATOM   1414  O   GLY B 202      99.486 122.492 101.502  1.00  0.94           O  
ATOM   1415  N   ASN B 203     100.228 121.251 103.225  1.00  0.87           N  
ATOM   1416  CA  ASN B 203     101.394 120.637 102.596  1.00  0.87           C  
ATOM   1417  C   ASN B 203     101.132 119.918 101.297  1.00  0.87           C  
ATOM   1418  O   ASN B 203     102.005 119.767 100.452  1.00  0.87           O  
ATOM   1419  CB  ASN B 203     102.014 119.539 103.483  1.00  0.87           C  
ATOM   1420  CG  ASN B 203     102.504 120.173 104.762  1.00  0.87           C  
ATOM   1421  OD1 ASN B 203     102.981 121.294 104.778  1.00  0.87           O  
ATOM   1422  ND2 ASN B 203     102.406 119.448 105.900  1.00  0.87           N  
ATOM   1423  N   LEU B 204      99.907 119.396 101.155  1.00  0.92           N  
ATOM   1424  CA  LEU B 204      99.593 118.479 100.093  1.00  0.92           C  
ATOM   1425  C   LEU B 204      98.846 119.138  98.962  1.00  0.92           C  
ATOM   1426  O   LEU B 204      98.656 118.533  97.912  1.00  0.92           O  
ATOM   1427  CB  LEU B 204      98.725 117.333 100.644  1.00  0.92           C  
ATOM   1428  CG  LEU B 204      99.221 116.723 101.964  1.00  0.92           C  
ATOM   1429  CD1 LEU B 204      98.310 115.566 102.384  1.00  0.92           C  
ATOM   1430  CD2 LEU B 204     100.690 116.277 101.928  1.00  0.92           C  
ATOM   1431  N   GLY B 205      98.422 120.407  99.112  1.00  0.96           N  
ATOM   1432  CA  GLY B 205      97.706 121.096  98.053  1.00  0.96           C  
ATOM   1433  C   GLY B 205      96.240 120.759  97.901  1.00  0.96           C  
ATOM   1434  O   GLY B 205      95.619 121.120  96.915  1.00  0.96           O  
ATOM   1435  N   LEU B 206      95.655 120.055  98.893  1.00  0.93           N  
ATOM   1436  CA  LEU B 206      94.335 119.451  98.791  1.00  0.93           C  
ATOM   1437  C   LEU B 206      93.221 120.375  99.260  1.00  0.93           C  
ATOM   1438  O   LEU B 206      92.049 120.006  99.267  1.00  0.93           O  
ATOM   1439  CB  LEU B 206      94.280 118.132  99.605  1.00  0.93           C  
ATOM   1440  CG  LEU B 206      95.275 117.049  99.137  1.00  0.93           C  
ATOM   1441  CD1 LEU B 206      95.213 115.842 100.079  1.00  0.93           C  
ATOM   1442  CD2 LEU B 206      95.047 116.595  97.688  1.00  0.93           C  
ATOM   1443  N   GLY B 207      93.552 121.629  99.630  1.00  0.96           N  
ATOM   1444  CA  GLY B 207      92.564 122.621 100.042  1.00  0.96           C  
ATOM   1445  C   GLY B 207      92.170 122.565 101.489  1.00  0.96           C  
ATOM   1446  O   GLY B 207      91.366 123.373 101.947  1.00  0.96           O  
ATOM   1447  N   ASP B 208      92.770 121.641 102.251  1.00  0.91           N  
ATOM   1448  CA  ASP B 208      92.492 121.425 103.647  1.00  0.91           C  
ATOM   1449  C   ASP B 208      93.802 121.228 104.403  1.00  0.91           C  
ATOM   1450  O   ASP B 208      94.895 121.418 103.877  1.00  0.91           O  
ATOM   1451  CB  ASP B 208      91.421 120.315 103.878  1.00  0.91           C  
ATOM   1452  CG  ASP B 208      91.829 118.918 103.477  1.00  0.91           C  
ATOM   1453  OD1 ASP B 208      92.810 118.386 104.060  1.00  0.91           O  
ATOM   1454  OD2 ASP B 208      91.136 118.304 102.635  1.00  0.91           O  
ATOM   1455  N   ARG B 209      93.690 120.918 105.711  1.00  0.83           N  
ATOM   1456  CA  ARG B 209      94.818 120.683 106.583  1.00  0.83           C  
ATOM   1457  C   ARG B 209      94.660 119.336 107.274  1.00  0.83           C  
ATOM   1458  O   ARG B 209      94.922 119.208 108.468  1.00  0.83           O  
ATOM   1459  CB  ARG B 209      94.958 121.799 107.648  1.00  0.83           C  
ATOM   1460  CG  ARG B 209      95.253 123.198 107.069  1.00  0.83           C  
ATOM   1461  CD  ARG B 209      94.602 124.313 107.898  1.00  0.83           C  
ATOM   1462  NE  ARG B 209      95.146 125.659 107.507  1.00  0.83           N  
ATOM   1463  CZ  ARG B 209      96.358 126.125 107.845  1.00  0.83           C  
ATOM   1464  NH1 ARG B 209      97.224 125.403 108.545  1.00  0.83           N  
ATOM   1465  NH2 ARG B 209      96.717 127.343 107.451  1.00  0.83           N  
ATOM   1466  N   THR B 210      94.228 118.296 106.539  1.00  0.88           N  
ATOM   1467  CA  THR B 210      94.084 116.953 107.092  1.00  0.88           C  
ATOM   1468  C   THR B 210      95.098 116.032 106.450  1.00  0.88           C  
ATOM   1469  O   THR B 210      95.270 115.980 105.234  1.00  0.88           O  
ATOM   1470  CB  THR B 210      92.698 116.369 106.868  1.00  0.88           C  
ATOM   1471  OG1 THR B 210      91.719 117.144 107.541  1.00  0.88           O  
ATOM   1472  CG2 THR B 210      92.551 114.947 107.421  1.00  0.88           C  
ATOM   1473  N   ASP B 211      95.830 115.251 107.267  1.00  0.92           N  
ATOM   1474  CA  ASP B 211      96.744 114.245 106.787  1.00  0.92           C  
ATOM   1475  C   ASP B 211      96.017 113.104 106.047  1.00  0.92           C  
ATOM   1476  O   ASP B 211      94.917 112.704 106.364  1.00  0.92           O  
ATOM   1477  CB  ASP B 211      97.691 113.819 107.935  1.00  0.92           C  
ATOM   1478  CG  ASP B 211      96.918 113.437 109.190  1.00  0.92           C  
ATOM   1479  OD1 ASP B 211      96.407 114.386 109.861  1.00  0.92           O  
ATOM   1480  OD2 ASP B 211      96.861 112.230 109.506  1.00  0.92           O  
ATOM   1481  N   ARG B 212      96.624 112.626 104.935  1.00  0.86           N  
ATOM   1482  CA  ARG B 212      96.014 111.614 104.092  1.00  0.86           C  
ATOM   1483  C   ARG B 212      96.842 110.359 104.095  1.00  0.86           C  
ATOM   1484  O   ARG B 212      98.064 110.390 104.007  1.00  0.86           O  
ATOM   1485  CB  ARG B 212      95.891 112.049 102.616  1.00  0.86           C  
ATOM   1486  CG  ARG B 212      94.941 113.232 102.363  1.00  0.86           C  
ATOM   1487  CD  ARG B 212      93.487 112.987 102.776  1.00  0.86           C  
ATOM   1488  NE  ARG B 212      92.604 113.933 102.015  1.00  0.86           N  
ATOM   1489  CZ  ARG B 212      92.381 115.221 102.322  1.00  0.86           C  
ATOM   1490  NH1 ARG B 212      93.004 115.848 103.309  1.00  0.86           N  
ATOM   1491  NH2 ARG B 212      91.513 115.930 101.605  1.00  0.86           N  
ATOM   1492  N   LEU B 213      96.155 109.204 104.137  1.00  0.93           N  
ATOM   1493  CA  LEU B 213      96.808 107.922 104.225  1.00  0.93           C  
ATOM   1494  C   LEU B 213      97.067 107.302 102.860  1.00  0.93           C  
ATOM   1495  O   LEU B 213      97.734 106.280 102.739  1.00  0.93           O  
ATOM   1496  CB  LEU B 213      95.923 106.970 105.065  1.00  0.93           C  
ATOM   1497  CG  LEU B 213      95.542 107.498 106.463  1.00  0.93           C  
ATOM   1498  CD1 LEU B 213      94.686 106.471 107.216  1.00  0.93           C  
ATOM   1499  CD2 LEU B 213      96.798 107.839 107.265  1.00  0.93           C  
ATOM   1500  N   VAL B 214      96.573 107.934 101.780  1.00  0.93           N  
ATOM   1501  CA  VAL B 214      96.598 107.397 100.441  1.00  0.93           C  
ATOM   1502  C   VAL B 214      97.022 108.538  99.541  1.00  0.93           C  
ATOM   1503  O   VAL B 214      96.699 109.680  99.877  1.00  0.93           O  
ATOM   1504  CB  VAL B 214      95.224 106.841 100.041  1.00  0.93           C  
ATOM   1505  CG1 VAL B 214      94.133 107.924  99.903  1.00  0.93           C  
ATOM   1506  CG2 VAL B 214      95.323 106.012  98.754  1.00  0.93           C  
ATOM   1507  N   PRO B 215      97.751 108.342  98.444  1.00  0.94           N  
ATOM   1508  CA  PRO B 215      97.939 109.343  97.408  1.00  0.94           C  
ATOM   1509  C   PRO B 215      96.664 109.966  96.900  1.00  0.94           C  
ATOM   1510  O   PRO B 215      95.861 109.272  96.287  1.00  0.94           O  
ATOM   1511  CB  PRO B 215      98.675 108.594  96.295  1.00  0.94           C  
ATOM   1512  CG  PRO B 215      99.436 107.485  97.011  1.00  0.94           C  
ATOM   1513  CD  PRO B 215      98.530 107.138  98.179  1.00  0.94           C  
ATOM   1514  N   GLU B 216      96.520 111.288  97.072  1.00  0.89           N  
ATOM   1515  CA  GLU B 216      95.357 112.004  96.618  1.00  0.89           C  
ATOM   1516  C   GLU B 216      95.779 112.989  95.565  1.00  0.89           C  
ATOM   1517  O   GLU B 216      96.790 113.673  95.677  1.00  0.89           O  
ATOM   1518  CB  GLU B 216      94.669 112.749  97.778  1.00  0.89           C  
ATOM   1519  CG  GLU B 216      93.759 111.835  98.630  1.00  0.89           C  
ATOM   1520  CD  GLU B 216      92.491 111.380  97.907  1.00  0.89           C  
ATOM   1521  OE1 GLU B 216      91.675 110.718  98.599  1.00  0.89           O  
ATOM   1522  OE2 GLU B 216      92.311 111.707  96.705  1.00  0.89           O  
ATOM   1523  N   ARG B 217      95.009 113.024  94.464  1.00  0.84           N  
ATOM   1524  CA  ARG B 217      95.257 113.897  93.341  1.00  0.84           C  
ATOM   1525  C   ARG B 217      94.992 115.361  93.657  1.00  0.84           C  
ATOM   1526  O   ARG B 217      93.934 115.745  94.139  1.00  0.84           O  
ATOM   1527  CB  ARG B 217      94.429 113.449  92.119  1.00  0.84           C  
ATOM   1528  CG  ARG B 217      94.890 114.064  90.787  1.00  0.84           C  
ATOM   1529  CD  ARG B 217      94.193 113.404  89.592  1.00  0.84           C  
ATOM   1530  NE  ARG B 217      94.201 114.342  88.436  1.00  0.84           N  
ATOM   1531  CZ  ARG B 217      93.414 115.404  88.313  1.00  0.84           C  
ATOM   1532  NH1 ARG B 217      92.606 115.754  89.311  1.00  0.84           N  
ATOM   1533  NH2 ARG B 217      93.430 116.149  87.213  1.00  0.84           N  
ATOM   1534  N   VAL B 218      95.960 116.236  93.342  1.00  0.94           N  
ATOM   1535  CA  VAL B 218      95.833 117.656  93.578  1.00  0.94           C  
ATOM   1536  C   VAL B 218      95.120 118.286  92.392  1.00  0.94           C  
ATOM   1537  O   VAL B 218      95.613 118.319  91.269  1.00  0.94           O  
ATOM   1538  CB  VAL B 218      97.194 118.282  93.822  1.00  0.94           C  
ATOM   1539  CG1 VAL B 218      97.079 119.804  93.995  1.00  0.94           C  
ATOM   1540  CG2 VAL B 218      97.790 117.652  95.093  1.00  0.94           C  
ATOM   1541  N   THR B 219      93.885 118.783  92.613  1.00  0.90           N  
ATOM   1542  CA  THR B 219      93.053 119.329  91.550  1.00  0.90           C  
ATOM   1543  C   THR B 219      93.289 120.803  91.307  1.00  0.90           C  
ATOM   1544  O   THR B 219      92.957 121.347  90.252  1.00  0.90           O  
ATOM   1545  CB  THR B 219      91.568 119.164  91.865  1.00  0.90           C  
ATOM   1546  OG1 THR B 219      91.228 119.728  93.123  1.00  0.90           O  
ATOM   1547  CG2 THR B 219      91.226 117.675  91.972  1.00  0.90           C  
ATOM   1548  N   SER B 220      93.902 121.490  92.280  1.00  0.89           N  
ATOM   1549  CA  SER B 220      93.980 122.938  92.318  1.00  0.89           C  
ATOM   1550  C   SER B 220      95.178 123.505  91.587  1.00  0.89           C  
ATOM   1551  O   SER B 220      96.034 124.172  92.158  1.00  0.89           O  
ATOM   1552  CB  SER B 220      93.989 123.474  93.754  1.00  0.89           C  
ATOM   1553  OG  SER B 220      92.735 123.225  94.386  1.00  0.89           O  
ATOM   1554  N   THR B 221      95.250 123.237  90.274  1.00  0.84           N  
ATOM   1555  CA  THR B 221      96.319 123.704  89.406  1.00  0.84           C  
ATOM   1556  C   THR B 221      95.796 124.317  88.122  1.00  0.84           C  
ATOM   1557  O   THR B 221      96.548 124.934  87.370  1.00  0.84           O  
ATOM   1558  CB  THR B 221      97.275 122.589  88.997  1.00  0.84           C  
ATOM   1559  OG1 THR B 221      96.609 121.479  88.402  1.00  0.84           O  
ATOM   1560  CG2 THR B 221      98.032 122.077  90.229  1.00  0.84           C  
ATOM   1561  N   GLY B 222      94.486 124.193  87.821  1.00  0.67           N  
ATOM   1562  CA  GLY B 222      93.910 124.796  86.618  1.00  0.67           C  
ATOM   1563  C   GLY B 222      94.170 124.050  85.338  1.00  0.67           C  
ATOM   1564  O   GLY B 222      94.160 124.624  84.256  1.00  0.67           O  
ATOM   1565  N   GLY B 223      94.431 122.733  85.433  1.00  0.78           N  
ATOM   1566  CA  GLY B 223      94.767 121.891  84.289  1.00  0.78           C  
ATOM   1567  C   GLY B 223      96.239 121.841  84.025  1.00  0.78           C  
ATOM   1568  O   GLY B 223      96.688 121.074  83.174  1.00  0.78           O  
ATOM   1569  N   GLU B 224      97.026 122.620  84.788  1.00  0.83           N  
ATOM   1570  CA  GLU B 224      98.466 122.677  84.672  1.00  0.83           C  
ATOM   1571  C   GLU B 224      99.126 121.348  85.019  1.00  0.83           C  
ATOM   1572  O   GLU B 224      98.923 120.777  86.093  1.00  0.83           O  
ATOM   1573  CB  GLU B 224      99.052 123.807  85.547  1.00  0.83           C  
ATOM   1574  CG  GLU B 224     100.506 124.203  85.210  1.00  0.83           C  
ATOM   1575  CD  GLU B 224     100.705 125.067  83.954  1.00  0.83           C  
ATOM   1576  OE1 GLU B 224      99.729 125.311  83.213  1.00  0.83           O  
ATOM   1577  OE2 GLU B 224     101.872 125.502  83.746  1.00  0.83           O  
ATOM   1578  N   LYS B 225      99.928 120.817  84.077  1.00  0.86           N  
ATOM   1579  CA  LYS B 225     100.642 119.574  84.245  1.00  0.86           C  
ATOM   1580  C   LYS B 225     101.985 119.824  84.896  1.00  0.86           C  
ATOM   1581  O   LYS B 225     102.723 120.730  84.526  1.00  0.86           O  
ATOM   1582  CB  LYS B 225     100.870 118.866  82.890  1.00  0.86           C  
ATOM   1583  CG  LYS B 225      99.588 118.445  82.147  1.00  0.86           C  
ATOM   1584  CD  LYS B 225      98.815 117.324  82.864  1.00  0.86           C  
ATOM   1585  CE  LYS B 225      97.309 117.544  82.970  1.00  0.86           C  
ATOM   1586  NZ  LYS B 225      96.724 116.545  83.880  1.00  0.86           N  
ATOM   1587  N   MET B 226     102.318 118.999  85.901  1.00  0.89           N  
ATOM   1588  CA  MET B 226     103.492 119.142  86.722  1.00  0.89           C  
ATOM   1589  C   MET B 226     104.599 118.226  86.245  1.00  0.89           C  
ATOM   1590  O   MET B 226     104.385 117.092  85.845  1.00  0.89           O  
ATOM   1591  CB  MET B 226     103.130 118.946  88.213  1.00  0.89           C  
ATOM   1592  CG  MET B 226     102.132 120.019  88.705  1.00  0.89           C  
ATOM   1593  SD  MET B 226     102.695 121.720  88.384  1.00  0.89           S  
ATOM   1594  CE  MET B 226     101.337 122.583  89.191  1.00  0.89           C  
ATOM   1595  N   SER B 227     105.844 118.754  86.220  1.00  0.90           N  
ATOM   1596  CA  SER B 227     107.010 118.001  85.795  1.00  0.90           C  
ATOM   1597  C   SER B 227     107.840 117.521  86.951  1.00  0.90           C  
ATOM   1598  O   SER B 227     108.395 116.422  86.897  1.00  0.90           O  
ATOM   1599  CB  SER B 227     107.965 118.821  84.875  1.00  0.90           C  
ATOM   1600  OG  SER B 227     108.628 119.905  85.529  1.00  0.90           O  
ATOM   1601  N   MET B 228     107.930 118.354  87.997  1.00  0.86           N  
ATOM   1602  CA  MET B 228     108.788 118.148  89.131  1.00  0.86           C  
ATOM   1603  C   MET B 228     108.076 118.563  90.386  1.00  0.86           C  
ATOM   1604  O   MET B 228     107.165 119.361  90.380  1.00  0.86           O  
ATOM   1605  CB  MET B 228     110.028 119.062  89.094  1.00  0.86           C  
ATOM   1606  CG  MET B 228     111.035 118.708  88.001  1.00  0.86           C  
ATOM   1607  SD  MET B 228     112.499 119.780  87.984  1.00  0.86           S  
ATOM   1608  CE  MET B 228     111.659 121.378  87.794  1.00  0.86           C  
ATOM   1609  N   VAL B 229     108.571 118.019  91.514  1.00  0.91           N  
ATOM   1610  CA  VAL B 229     108.028 118.336  92.806  1.00  0.91           C  
ATOM   1611  C   VAL B 229     109.190 118.230  93.773  1.00  0.91           C  
ATOM   1612  O   VAL B 229     110.104 117.453  93.577  1.00  0.91           O  
ATOM   1613  CB  VAL B 229     106.855 117.422  93.153  1.00  0.91           C  
ATOM   1614  CG1 VAL B 229     107.265 115.935  93.214  1.00  0.91           C  
ATOM   1615  CG2 VAL B 229     106.119 117.900  94.415  1.00  0.91           C  
ATOM   1616  N   ALA B 230     109.194 119.075  94.823  1.00  0.91           N  
ATOM   1617  CA  ALA B 230     110.165 119.001  95.882  1.00  0.91           C  
ATOM   1618  C   ALA B 230     109.435 119.342  97.161  1.00  0.91           C  
ATOM   1619  O   ALA B 230     108.630 120.265  97.203  1.00  0.91           O  
ATOM   1620  CB  ALA B 230     111.339 119.979  95.670  1.00  0.91           C  
ATOM   1621  N   SER B 231     109.695 118.593  98.242  1.00  0.88           N  
ATOM   1622  CA  SER B 231     109.015 118.765  99.506  1.00  0.88           C  
ATOM   1623  C   SER B 231     110.049 119.183 100.514  1.00  0.88           C  
ATOM   1624  O   SER B 231     111.113 118.582 100.602  1.00  0.88           O  
ATOM   1625  CB  SER B 231     108.379 117.457 100.018  1.00  0.88           C  
ATOM   1626  OG  SER B 231     107.333 117.030  99.142  1.00  0.88           O  
ATOM   1627  N   GLY B 232     109.757 120.250 101.281  1.00  0.91           N  
ATOM   1628  CA  GLY B 232     110.593 120.712 102.376  1.00  0.91           C  
ATOM   1629  C   GLY B 232     110.084 120.114 103.653  1.00  0.91           C  
ATOM   1630  O   GLY B 232     109.635 118.973 103.694  1.00  0.91           O  
ATOM   1631  N   TRP B 233     110.096 120.897 104.753  1.00  0.83           N  
ATOM   1632  CA  TRP B 233     109.521 120.401 105.990  1.00  0.83           C  
ATOM   1633  C   TRP B 233     108.006 120.452 105.984  1.00  0.83           C  
ATOM   1634  O   TRP B 233     107.317 119.446 106.141  1.00  0.83           O  
ATOM   1635  CB  TRP B 233     110.024 121.217 107.213  1.00  0.83           C  
ATOM   1636  CG  TRP B 233     109.550 120.696 108.568  1.00  0.83           C  
ATOM   1637  CD1 TRP B 233     109.176 119.419 108.845  1.00  0.83           C  
ATOM   1638  CD2 TRP B 233     109.382 121.427 109.792  1.00  0.83           C  
ATOM   1639  NE1 TRP B 233     108.870 119.277 110.170  1.00  0.83           N  
ATOM   1640  CE2 TRP B 233     109.011 120.487 110.782  1.00  0.83           C  
ATOM   1641  CE3 TRP B 233     109.523 122.768 110.108  1.00  0.83           C  
ATOM   1642  CZ2 TRP B 233     108.848 120.871 112.100  1.00  0.83           C  
ATOM   1643  CZ3 TRP B 233     109.374 123.152 111.445  1.00  0.83           C  
ATOM   1644  CH2 TRP B 233     109.059 122.214 112.434  1.00  0.83           C  
ATOM   1645  N   ARG B 234     107.462 121.650 105.767  1.00  0.81           N  
ATOM   1646  CA  ARG B 234     106.047 121.890 105.843  1.00  0.81           C  
ATOM   1647  C   ARG B 234     105.682 122.733 104.653  1.00  0.81           C  
ATOM   1648  O   ARG B 234     104.775 123.558 104.701  1.00  0.81           O  
ATOM   1649  CB  ARG B 234     105.663 122.654 107.129  1.00  0.81           C  
ATOM   1650  CG  ARG B 234     105.857 121.903 108.457  1.00  0.81           C  
ATOM   1651  CD  ARG B 234     105.687 122.842 109.647  1.00  0.81           C  
ATOM   1652  NE  ARG B 234     105.769 122.005 110.878  1.00  0.81           N  
ATOM   1653  CZ  ARG B 234     105.804 122.518 112.112  1.00  0.81           C  
ATOM   1654  NH1 ARG B 234     105.838 123.835 112.308  1.00  0.81           N  
ATOM   1655  NH2 ARG B 234     105.818 121.709 113.169  1.00  0.81           N  
ATOM   1656  N   HIS B 235     106.386 122.562 103.537  1.00  0.89           N  
ATOM   1657  CA  HIS B 235     106.023 123.220 102.322  1.00  0.89           C  
ATOM   1658  C   HIS B 235     106.421 122.334 101.181  1.00  0.89           C  
ATOM   1659  O   HIS B 235     107.238 121.428 101.329  1.00  0.89           O  
ATOM   1660  CB  HIS B 235     106.684 124.606 102.157  1.00  0.89           C  
ATOM   1661  CG  HIS B 235     108.177 124.585 102.066  1.00  0.89           C  
ATOM   1662  ND1 HIS B 235     108.975 124.428 103.185  1.00  0.89           N  
ATOM   1663  CD2 HIS B 235     108.940 124.691 100.950  1.00  0.89           C  
ATOM   1664  CE1 HIS B 235     110.212 124.446 102.721  1.00  0.89           C  
ATOM   1665  NE2 HIS B 235     110.245 124.610 101.378  1.00  0.89           N  
ATOM   1666  N   THR B 236     105.839 122.597 100.006  1.00  0.91           N  
ATOM   1667  CA  THR B 236     106.087 121.805  98.819  1.00  0.91           C  
ATOM   1668  C   THR B 236     106.171 122.780  97.675  1.00  0.91           C  
ATOM   1669  O   THR B 236     105.532 123.829  97.650  1.00  0.91           O  
ATOM   1670  CB  THR B 236     105.013 120.756  98.538  1.00  0.91           C  
ATOM   1671  OG1 THR B 236     104.827 119.890  99.655  1.00  0.91           O  
ATOM   1672  CG2 THR B 236     105.361 119.835  97.359  1.00  0.91           C  
ATOM   1673  N   ILE B 237     107.047 122.466  96.714  1.00  0.90           N  
ATOM   1674  CA  ILE B 237     107.338 123.250  95.546  1.00  0.90           C  
ATOM   1675  C   ILE B 237     107.045 122.365  94.363  1.00  0.90           C  
ATOM   1676  O   ILE B 237     107.425 121.200  94.344  1.00  0.90           O  
ATOM   1677  CB  ILE B 237     108.804 123.647  95.505  1.00  0.90           C  
ATOM   1678  CG1 ILE B 237     109.243 124.324  96.821  1.00  0.90           C  
ATOM   1679  CG2 ILE B 237     109.055 124.563  94.294  1.00  0.90           C  
ATOM   1680  CD1 ILE B 237     110.046 123.399  97.747  1.00  0.90           C  
ATOM   1681  N   SER B 238     106.353 122.882  93.341  1.00  0.91           N  
ATOM   1682  CA  SER B 238     105.997 122.086  92.189  1.00  0.91           C  
ATOM   1683  C   SER B 238     106.262 122.919  90.963  1.00  0.91           C  
ATOM   1684  O   SER B 238     106.030 124.123  90.994  1.00  0.91           O  
ATOM   1685  CB  SER B 238     104.508 121.703  92.274  1.00  0.91           C  
ATOM   1686  OG  SER B 238     104.135 120.759  91.271  1.00  0.91           O  
ATOM   1687  N   VAL B 239     106.799 122.337  89.875  1.00  0.91           N  
ATOM   1688  CA  VAL B 239     107.125 123.069  88.656  1.00  0.91           C  
ATOM   1689  C   VAL B 239     106.329 122.442  87.562  1.00  0.91           C  
ATOM   1690  O   VAL B 239     106.246 121.219  87.436  1.00  0.91           O  
ATOM   1691  CB  VAL B 239     108.594 123.037  88.243  1.00  0.91           C  
ATOM   1692  CG1 VAL B 239     108.896 123.782  86.922  1.00  0.91           C  
ATOM   1693  CG2 VAL B 239     109.405 123.693  89.355  1.00  0.91           C  
ATOM   1694  N   SER B 240     105.689 123.288  86.750  1.00  0.90           N  
ATOM   1695  CA  SER B 240     104.885 122.829  85.655  1.00  0.90           C  
ATOM   1696  C   SER B 240     105.685 122.471  84.412  1.00  0.90           C  
ATOM   1697  O   SER B 240     106.891 122.649  84.337  1.00  0.90           O  
ATOM   1698  CB  SER B 240     103.723 123.776  85.363  1.00  0.90           C  
ATOM   1699  OG  SER B 240     104.127 125.076  84.943  1.00  0.90           O  
ATOM   1700  N   TYR B 241     105.030 121.875  83.388  1.00  0.85           N  
ATOM   1701  CA  TYR B 241     105.662 121.541  82.114  1.00  0.85           C  
ATOM   1702  C   TYR B 241     106.277 122.725  81.373  1.00  0.85           C  
ATOM   1703  O   TYR B 241     107.329 122.601  80.756  1.00  0.85           O  
ATOM   1704  CB  TYR B 241     104.670 120.835  81.131  1.00  0.85           C  
ATOM   1705  CG  TYR B 241     104.378 119.368  81.370  1.00  0.85           C  
ATOM   1706  CD1 TYR B 241     105.122 118.581  82.254  1.00  0.85           C  
ATOM   1707  CD2 TYR B 241     103.361 118.727  80.632  1.00  0.85           C  
ATOM   1708  CE1 TYR B 241     104.856 117.222  82.419  1.00  0.85           C  
ATOM   1709  CE2 TYR B 241     103.092 117.354  80.789  1.00  0.85           C  
ATOM   1710  CZ  TYR B 241     103.854 116.602  81.686  1.00  0.85           C  
ATOM   1711  OH  TYR B 241     103.696 115.221  81.895  1.00  0.85           O  
ATOM   1712  N   SER B 242     105.625 123.897  81.416  1.00  0.84           N  
ATOM   1713  CA  SER B 242     106.071 125.050  80.663  1.00  0.84           C  
ATOM   1714  C   SER B 242     105.887 126.337  81.434  1.00  0.84           C  
ATOM   1715  O   SER B 242     105.663 127.404  80.863  1.00  0.84           O  
ATOM   1716  CB  SER B 242     105.364 125.127  79.286  1.00  0.84           C  
ATOM   1717  OG  SER B 242     103.942 125.035  79.410  1.00  0.84           O  
ATOM   1718  N   GLY B 243     106.015 126.276  82.774  1.00  0.66           N  
ATOM   1719  CA  GLY B 243     105.865 127.442  83.624  1.00  0.66           C  
ATOM   1720  C   GLY B 243     106.923 127.537  84.681  1.00  0.66           C  
ATOM   1721  O   GLY B 243     108.119 127.401  84.438  1.00  0.66           O  
ATOM   1722  N   ALA B 244     106.482 127.824  85.913  1.00  0.73           N  
ATOM   1723  CA  ALA B 244     107.362 128.138  87.006  1.00  0.73           C  
ATOM   1724  C   ALA B 244     106.821 127.452  88.244  1.00  0.73           C  
ATOM   1725  O   ALA B 244     106.003 126.541  88.168  1.00  0.73           O  
ATOM   1726  CB  ALA B 244     107.498 129.667  87.190  1.00  0.73           C  
ATOM   1727  N   LEU B 245     107.318 127.848  89.425  1.00  0.82           N  
ATOM   1728  CA  LEU B 245     106.908 127.307  90.702  1.00  0.82           C  
ATOM   1729  C   LEU B 245     105.459 127.559  91.081  1.00  0.82           C  
ATOM   1730  O   LEU B 245     104.918 128.633  90.925  1.00  0.82           O  
ATOM   1731  CB  LEU B 245     107.770 127.815  91.874  1.00  0.82           C  
ATOM   1732  CG  LEU B 245     109.205 127.287  91.937  1.00  0.82           C  
ATOM   1733  CD1 LEU B 245     110.123 127.844  90.858  1.00  0.82           C  
ATOM   1734  CD2 LEU B 245     109.766 127.676  93.293  1.00  0.82           C  
ATOM   1735  N   TYR B 246     104.860 126.515  91.678  1.00  0.87           N  
ATOM   1736  CA  TYR B 246     103.574 126.518  92.316  1.00  0.87           C  
ATOM   1737  C   TYR B 246     103.874 125.999  93.709  1.00  0.87           C  
ATOM   1738  O   TYR B 246     103.916 124.804  93.957  1.00  0.87           O  
ATOM   1739  CB  TYR B 246     102.577 125.564  91.604  1.00  0.87           C  
ATOM   1740  CG  TYR B 246     102.045 126.127  90.315  1.00  0.87           C  
ATOM   1741  CD1 TYR B 246     100.684 126.434  90.145  1.00  0.87           C  
ATOM   1742  CD2 TYR B 246     102.904 126.317  89.229  1.00  0.87           C  
ATOM   1743  CE1 TYR B 246     100.230 127.027  88.958  1.00  0.87           C  
ATOM   1744  CE2 TYR B 246     102.471 126.952  88.068  1.00  0.87           C  
ATOM   1745  CZ  TYR B 246     101.140 127.333  87.941  1.00  0.87           C  
ATOM   1746  OH  TYR B 246     100.778 127.992  86.742  1.00  0.87           O  
ATOM   1747  N   THR B 247     104.158 126.929  94.643  1.00  0.91           N  
ATOM   1748  CA  THR B 247     104.530 126.621  96.013  1.00  0.91           C  
ATOM   1749  C   THR B 247     103.296 126.640  96.892  1.00  0.91           C  
ATOM   1750  O   THR B 247     102.305 127.311  96.612  1.00  0.91           O  
ATOM   1751  CB  THR B 247     105.590 127.559  96.603  1.00  0.91           C  
ATOM   1752  OG1 THR B 247     105.149 128.900  96.643  1.00  0.91           O  
ATOM   1753  CG2 THR B 247     106.847 127.588  95.738  1.00  0.91           C  
ATOM   1754  N   TYR B 248     103.318 125.842  97.973  1.00  0.93           N  
ATOM   1755  CA  TYR B 248     102.201 125.738  98.879  1.00  0.93           C  
ATOM   1756  C   TYR B 248     102.683 125.142 100.185  1.00  0.93           C  
ATOM   1757  O   TYR B 248     103.789 124.622 100.282  1.00  0.93           O  
ATOM   1758  CB  TYR B 248     101.002 124.935  98.296  1.00  0.93           C  
ATOM   1759  CG  TYR B 248     101.373 123.624  97.648  1.00  0.93           C  
ATOM   1760  CD1 TYR B 248     101.920 123.592  96.356  1.00  0.93           C  
ATOM   1761  CD2 TYR B 248     101.150 122.402  98.295  1.00  0.93           C  
ATOM   1762  CE1 TYR B 248     102.297 122.389  95.757  1.00  0.93           C  
ATOM   1763  CE2 TYR B 248     101.464 121.190  97.665  1.00  0.93           C  
ATOM   1764  CZ  TYR B 248     102.069 121.185  96.412  1.00  0.93           C  
ATOM   1765  OH  TYR B 248     102.480 119.974  95.834  1.00  0.93           O  
ATOM   1766  N   GLY B 249     101.846 125.256 101.234  1.00  0.95           N  
ATOM   1767  CA  GLY B 249     102.131 124.788 102.577  1.00  0.95           C  
ATOM   1768  C   GLY B 249     102.339 125.929 103.527  1.00  0.95           C  
ATOM   1769  O   GLY B 249     101.906 127.049 103.317  1.00  0.95           O  
ATOM   1770  N   TRP B 250     103.019 125.620 104.642  1.00  0.87           N  
ATOM   1771  CA  TRP B 250     103.382 126.550 105.681  1.00  0.87           C  
ATOM   1772  C   TRP B 250     104.329 127.612 105.176  1.00  0.87           C  
ATOM   1773  O   TRP B 250     105.342 127.317 104.549  1.00  0.87           O  
ATOM   1774  CB  TRP B 250     104.092 125.784 106.822  1.00  0.87           C  
ATOM   1775  CG  TRP B 250     104.341 126.535 108.112  1.00  0.87           C  
ATOM   1776  CD1 TRP B 250     103.437 127.244 108.840  1.00  0.87           C  
ATOM   1777  CD2 TRP B 250     105.571 126.564 108.848  1.00  0.87           C  
ATOM   1778  NE1 TRP B 250     104.018 127.714 109.991  1.00  0.87           N  
ATOM   1779  CE2 TRP B 250     105.320 127.292 110.033  1.00  0.87           C  
ATOM   1780  CE3 TRP B 250     106.822 126.025 108.598  1.00  0.87           C  
ATOM   1781  CZ2 TRP B 250     106.309 127.448 110.988  1.00  0.87           C  
ATOM   1782  CZ3 TRP B 250     107.824 126.206 109.552  1.00  0.87           C  
ATOM   1783  CH2 TRP B 250     107.569 126.893 110.741  1.00  0.87           C  
ATOM   1784  N   SER B 251     104.037 128.881 105.494  1.00  0.89           N  
ATOM   1785  CA  SER B 251     104.887 129.976 105.104  1.00  0.89           C  
ATOM   1786  C   SER B 251     105.016 130.889 106.284  1.00  0.89           C  
ATOM   1787  O   SER B 251     104.250 131.826 106.455  1.00  0.89           O  
ATOM   1788  CB  SER B 251     104.270 130.767 103.938  1.00  0.89           C  
ATOM   1789  OG  SER B 251     105.225 131.578 103.239  1.00  0.89           O  
ATOM   1790  N   LYS B 252     105.991 130.636 107.171  1.00  0.87           N  
ATOM   1791  CA  LYS B 252     106.194 131.515 108.300  1.00  0.87           C  
ATOM   1792  C   LYS B 252     107.448 132.352 108.143  1.00  0.87           C  
ATOM   1793  O   LYS B 252     107.556 133.444 108.702  1.00  0.87           O  
ATOM   1794  CB  LYS B 252     106.279 130.681 109.595  1.00  0.87           C  
ATOM   1795  CG  LYS B 252     106.549 131.544 110.837  1.00  0.87           C  
ATOM   1796  CD  LYS B 252     106.478 130.779 112.163  1.00  0.87           C  
ATOM   1797  CE  LYS B 252     106.528 131.655 113.423  1.00  0.87           C  
ATOM   1798  NZ  LYS B 252     107.541 132.719 113.263  1.00  0.87           N  
ATOM   1799  N   TYR B 253     108.417 131.874 107.346  1.00  0.88           N  
ATOM   1800  CA  TYR B 253     109.690 132.535 107.146  1.00  0.88           C  
ATOM   1801  C   TYR B 253     109.806 132.902 105.686  1.00  0.88           C  
ATOM   1802  O   TYR B 253     110.881 133.188 105.167  1.00  0.88           O  
ATOM   1803  CB  TYR B 253     110.871 131.615 107.527  1.00  0.88           C  
ATOM   1804  CG  TYR B 253     110.787 131.227 108.974  1.00  0.88           C  
ATOM   1805  CD1 TYR B 253     111.415 132.009 109.947  1.00  0.88           C  
ATOM   1806  CD2 TYR B 253     110.061 130.100 109.386  1.00  0.88           C  
ATOM   1807  CE1 TYR B 253     111.343 131.657 111.300  1.00  0.88           C  
ATOM   1808  CE2 TYR B 253     109.946 129.774 110.746  1.00  0.88           C  
ATOM   1809  CZ  TYR B 253     110.601 130.549 111.705  1.00  0.88           C  
ATOM   1810  OH  TYR B 253     110.493 130.243 113.077  1.00  0.88           O  
ATOM   1811  N   GLY B 254     108.675 132.878 104.952  1.00  0.95           N  
ATOM   1812  CA  GLY B 254     108.677 133.274 103.556  1.00  0.95           C  
ATOM   1813  C   GLY B 254     109.150 132.211 102.599  1.00  0.95           C  
ATOM   1814  O   GLY B 254     109.443 132.501 101.445  1.00  0.95           O  
ATOM   1815  N   GLN B 255     109.214 130.933 103.027  1.00  0.91           N  
ATOM   1816  CA  GLN B 255     109.696 129.801 102.241  1.00  0.91           C  
ATOM   1817  C   GLN B 255     108.877 129.439 101.019  1.00  0.91           C  
ATOM   1818  O   GLN B 255     109.332 128.695 100.144  1.00  0.91           O  
ATOM   1819  CB  GLN B 255     109.818 128.541 103.120  1.00  0.91           C  
ATOM   1820  CG  GLN B 255     108.501 128.067 103.768  1.00  0.91           C  
ATOM   1821  CD  GLN B 255     108.422 128.327 105.279  1.00  0.91           C  
ATOM   1822  OE1 GLN B 255     108.676 129.388 105.813  1.00  0.91           O  
ATOM   1823  NE2 GLN B 255     107.935 127.276 105.989  1.00  0.91           N  
ATOM   1824  N   LEU B 256     107.656 129.982 100.905  1.00  0.93           N  
ATOM   1825  CA  LEU B 256     106.896 129.896  99.682  1.00  0.93           C  
ATOM   1826  C   LEU B 256     107.259 130.956  98.668  1.00  0.93           C  
ATOM   1827  O   LEU B 256     107.008 130.769  97.484  1.00  0.93           O  
ATOM   1828  CB  LEU B 256     105.391 129.978  99.950  1.00  0.93           C  
ATOM   1829  CG  LEU B 256     104.868 128.889 100.890  1.00  0.93           C  
ATOM   1830  CD1 LEU B 256     103.342 128.945 100.875  1.00  0.93           C  
ATOM   1831  CD2 LEU B 256     105.338 127.474 100.546  1.00  0.93           C  
ATOM   1832  N   GLY B 257     107.900 132.062  99.095  1.00  0.96           N  
ATOM   1833  CA  GLY B 257     108.412 133.097  98.209  1.00  0.96           C  
ATOM   1834  C   GLY B 257     107.422 133.969  97.474  1.00  0.96           C  
ATOM   1835  O   GLY B 257     107.701 134.462  96.398  1.00  0.96           O  
ATOM   1836  N   HIS B 258     106.240 134.213  98.071  1.00  0.91           N  
ATOM   1837  CA  HIS B 258     105.166 134.944  97.412  1.00  0.91           C  
ATOM   1838  C   HIS B 258     105.136 136.418  97.772  1.00  0.91           C  
ATOM   1839  O   HIS B 258     104.266 137.165  97.338  1.00  0.91           O  
ATOM   1840  CB  HIS B 258     103.801 134.307  97.722  1.00  0.91           C  
ATOM   1841  CG  HIS B 258     103.656 132.973  97.086  1.00  0.91           C  
ATOM   1842  ND1 HIS B 258     103.746 132.864  95.717  1.00  0.91           N  
ATOM   1843  CD2 HIS B 258     103.320 131.783  97.642  1.00  0.91           C  
ATOM   1844  CE1 HIS B 258     103.444 131.607  95.457  1.00  0.91           C  
ATOM   1845  NE2 HIS B 258     103.186 130.915  96.588  1.00  0.91           N  
ATOM   1846  N   GLY B 259     106.131 136.904  98.543  1.00  0.95           N  
ATOM   1847  CA  GLY B 259     106.185 138.296  98.974  1.00  0.95           C  
ATOM   1848  C   GLY B 259     105.553 138.562 100.309  1.00  0.95           C  
ATOM   1849  O   GLY B 259     105.613 139.682 100.811  1.00  0.95           O  
ATOM   1850  N   ASP B 260     104.988 137.532 100.945  1.00  0.91           N  
ATOM   1851  CA  ASP B 260     104.337 137.640 102.222  1.00  0.91           C  
ATOM   1852  C   ASP B 260     104.576 136.352 103.012  1.00  0.91           C  
ATOM   1853  O   ASP B 260     105.278 135.435 102.590  1.00  0.91           O  
ATOM   1854  CB  ASP B 260     102.838 138.012 102.042  1.00  0.91           C  
ATOM   1855  CG  ASP B 260     102.161 137.009 101.126  1.00  0.91           C  
ATOM   1856  OD1 ASP B 260     101.658 137.427 100.059  1.00  0.91           O  
ATOM   1857  OD2 ASP B 260     102.195 135.804 101.488  1.00  0.91           O  
ATOM   1858  N   LEU B 261     104.019 136.322 104.238  1.00  0.92           N  
ATOM   1859  CA  LEU B 261     104.070 135.209 105.157  1.00  0.92           C  
ATOM   1860  C   LEU B 261     102.693 134.575 105.279  1.00  0.92           C  
ATOM   1861  O   LEU B 261     102.326 134.054 106.321  1.00  0.92           O  
ATOM   1862  CB  LEU B 261     104.564 135.653 106.557  1.00  0.92           C  
ATOM   1863  CG  LEU B 261     105.891 136.434 106.556  1.00  0.92           C  
ATOM   1864  CD1 LEU B 261     106.259 136.876 107.977  1.00  0.92           C  
ATOM   1865  CD2 LEU B 261     107.035 135.611 105.961  1.00  0.92           C  
ATOM   1866  N   GLU B 262     101.869 134.629 104.211  1.00  0.85           N  
ATOM   1867  CA  GLU B 262     100.613 133.910 104.195  1.00  0.85           C  
ATOM   1868  C   GLU B 262     100.863 132.481 103.711  1.00  0.85           C  
ATOM   1869  O   GLU B 262     101.584 132.234 102.747  1.00  0.85           O  
ATOM   1870  CB  GLU B 262      99.575 134.668 103.334  1.00  0.85           C  
ATOM   1871  CG  GLU B 262      98.182 134.001 103.222  1.00  0.85           C  
ATOM   1872  CD  GLU B 262      97.176 134.800 102.383  1.00  0.85           C  
ATOM   1873  OE1 GLU B 262      97.481 135.953 101.987  1.00  0.85           O  
ATOM   1874  OE2 GLU B 262      96.058 134.263 102.161  1.00  0.85           O  
ATOM   1875  N   ASP B 263     100.347 131.479 104.472  1.00  0.91           N  
ATOM   1876  CA  ASP B 263     100.335 130.087 104.073  1.00  0.91           C  
ATOM   1877  C   ASP B 263      99.305 129.830 102.974  1.00  0.91           C  
ATOM   1878  O   ASP B 263      98.251 130.447 102.921  1.00  0.91           O  
ATOM   1879  CB  ASP B 263     100.292 129.095 105.285  1.00  0.91           C  
ATOM   1880  CG  ASP B 263      99.109 129.098 106.250  1.00  0.91           C  
ATOM   1881  OD1 ASP B 263      98.173 129.925 106.175  1.00  0.91           O  
ATOM   1882  OD2 ASP B 263      99.155 128.188 107.130  1.00  0.91           O  
ATOM   1883  N   HIS B 264      99.602 128.906 102.031  1.00  0.91           N  
ATOM   1884  CA  HIS B 264      98.694 128.609 100.935  1.00  0.91           C  
ATOM   1885  C   HIS B 264      98.383 127.137 100.967  1.00  0.91           C  
ATOM   1886  O   HIS B 264      99.279 126.299 101.004  1.00  0.91           O  
ATOM   1887  CB  HIS B 264      99.254 128.974  99.543  1.00  0.91           C  
ATOM   1888  CG  HIS B 264      99.461 130.438  99.415  1.00  0.91           C  
ATOM   1889  ND1 HIS B 264      98.366 131.252  99.275  1.00  0.91           N  
ATOM   1890  CD2 HIS B 264     100.600 131.170  99.512  1.00  0.91           C  
ATOM   1891  CE1 HIS B 264      98.859 132.483  99.295  1.00  0.91           C  
ATOM   1892  NE2 HIS B 264     100.205 132.483  99.435  1.00  0.91           N  
ATOM   1893  N   LEU B 265      97.085 126.769 100.945  1.00  0.91           N  
ATOM   1894  CA  LEU B 265      96.674 125.384 101.112  1.00  0.91           C  
ATOM   1895  C   LEU B 265      96.516 124.633  99.805  1.00  0.91           C  
ATOM   1896  O   LEU B 265      96.188 123.445  99.787  1.00  0.91           O  
ATOM   1897  CB  LEU B 265      95.309 125.302 101.836  1.00  0.91           C  
ATOM   1898  CG  LEU B 265      95.255 126.003 103.203  1.00  0.91           C  
ATOM   1899  CD1 LEU B 265      93.839 125.893 103.786  1.00  0.91           C  
ATOM   1900  CD2 LEU B 265      96.291 125.432 104.174  1.00  0.91           C  
ATOM   1901  N   ILE B 266      96.757 125.316  98.677  1.00  0.92           N  
ATOM   1902  CA  ILE B 266      96.626 124.785  97.343  1.00  0.92           C  
ATOM   1903  C   ILE B 266      97.820 125.304  96.568  1.00  0.92           C  
ATOM   1904  O   ILE B 266      98.348 126.341  96.972  1.00  0.92           O  
ATOM   1905  CB  ILE B 266      95.323 125.192  96.653  1.00  0.92           C  
ATOM   1906  CG1 ILE B 266      95.115 126.719  96.490  1.00  0.92           C  
ATOM   1907  CG2 ILE B 266      94.164 124.499  97.398  1.00  0.92           C  
ATOM   1908  CD1 ILE B 266      93.930 127.062  95.576  1.00  0.92           C  
ATOM   1909  N   PRO B 267      98.321 124.658  95.511  1.00  0.93           N  
ATOM   1910  CA  PRO B 267      99.327 125.214  94.610  1.00  0.93           C  
ATOM   1911  C   PRO B 267      99.095 126.647  94.188  1.00  0.93           C  
ATOM   1912  O   PRO B 267      98.206 126.920  93.391  1.00  0.93           O  
ATOM   1913  CB  PRO B 267      99.368 124.232  93.421  1.00  0.93           C  
ATOM   1914  CG  PRO B 267      98.807 122.926  93.971  1.00  0.93           C  
ATOM   1915  CD  PRO B 267      97.779 123.413  94.982  1.00  0.93           C  
ATOM   1916  N   HIS B 268      99.938 127.574  94.675  1.00  0.89           N  
ATOM   1917  CA  HIS B 268      99.800 128.962  94.333  1.00  0.89           C  
ATOM   1918  C   HIS B 268     101.002 129.285  93.492  1.00  0.89           C  
ATOM   1919  O   HIS B 268     102.141 129.066  93.880  1.00  0.89           O  
ATOM   1920  CB  HIS B 268      99.725 129.863  95.574  1.00  0.89           C  
ATOM   1921  CG  HIS B 268      99.465 131.299  95.267  1.00  0.89           C  
ATOM   1922  ND1 HIS B 268      99.888 132.224  96.185  1.00  0.89           N  
ATOM   1923  CD2 HIS B 268      98.881 131.915  94.206  1.00  0.89           C  
ATOM   1924  CE1 HIS B 268      99.571 133.392  95.673  1.00  0.89           C  
ATOM   1925  NE2 HIS B 268      98.965 133.268  94.466  1.00  0.89           N  
ATOM   1926  N   LYS B 269     100.750 129.751  92.253  1.00  0.86           N  
ATOM   1927  CA  LYS B 269     101.800 130.109  91.331  1.00  0.86           C  
ATOM   1928  C   LYS B 269     102.678 131.214  91.862  1.00  0.86           C  
ATOM   1929  O   LYS B 269     102.212 132.266  92.270  1.00  0.86           O  
ATOM   1930  CB  LYS B 269     101.217 130.571  89.979  1.00  0.86           C  
ATOM   1931  CG  LYS B 269     102.292 130.843  88.914  1.00  0.86           C  
ATOM   1932  CD  LYS B 269     101.693 131.253  87.563  1.00  0.86           C  
ATOM   1933  CE  LYS B 269     102.762 131.487  86.497  1.00  0.86           C  
ATOM   1934  NZ  LYS B 269     102.130 131.864  85.215  1.00  0.86           N  
ATOM   1935  N   LEU B 270     104.000 131.017  91.822  1.00  0.89           N  
ATOM   1936  CA  LEU B 270     104.921 132.027  92.247  1.00  0.89           C  
ATOM   1937  C   LEU B 270     105.111 132.998  91.086  1.00  0.89           C  
ATOM   1938  O   LEU B 270     105.841 132.760  90.129  1.00  0.89           O  
ATOM   1939  CB  LEU B 270     106.215 131.351  92.746  1.00  0.89           C  
ATOM   1940  CG  LEU B 270     107.157 132.266  93.535  1.00  0.89           C  
ATOM   1941  CD1 LEU B 270     108.085 131.468  94.457  1.00  0.89           C  
ATOM   1942  CD2 LEU B 270     108.019 133.120  92.620  1.00  0.89           C  
ATOM   1943  N   GLU B 271     104.387 134.136  91.133  1.00  0.86           N  
ATOM   1944  CA  GLU B 271     104.337 135.095  90.044  1.00  0.86           C  
ATOM   1945  C   GLU B 271     105.623 135.879  89.824  1.00  0.86           C  
ATOM   1946  O   GLU B 271     105.906 136.323  88.714  1.00  0.86           O  
ATOM   1947  CB  GLU B 271     103.171 136.075  90.267  1.00  0.86           C  
ATOM   1948  CG  GLU B 271     101.782 135.395  90.276  1.00  0.86           C  
ATOM   1949  CD  GLU B 271     100.769 136.192  91.100  1.00  0.86           C  
ATOM   1950  OE1 GLU B 271     100.578 137.391  90.776  1.00  0.86           O  
ATOM   1951  OE2 GLU B 271     100.169 135.597  92.032  1.00  0.86           O  
ATOM   1952  N   ALA B 272     106.474 136.022  90.857  1.00  0.92           N  
ATOM   1953  CA  ALA B 272     107.774 136.670  90.772  1.00  0.92           C  
ATOM   1954  C   ALA B 272     108.740 135.997  89.785  1.00  0.92           C  
ATOM   1955  O   ALA B 272     109.539 136.660  89.121  1.00  0.92           O  
ATOM   1956  CB  ALA B 272     108.403 136.782  92.179  1.00  0.92           C  
ATOM   1957  N   LEU B 273     108.662 134.656  89.648  1.00  0.91           N  
ATOM   1958  CA  LEU B 273     109.477 133.862  88.743  1.00  0.91           C  
ATOM   1959  C   LEU B 273     108.691 133.410  87.527  1.00  0.91           C  
ATOM   1960  O   LEU B 273     109.045 132.445  86.860  1.00  0.91           O  
ATOM   1961  CB  LEU B 273     110.083 132.615  89.432  1.00  0.91           C  
ATOM   1962  CG  LEU B 273     111.092 132.930  90.547  1.00  0.91           C  
ATOM   1963  CD1 LEU B 273     111.571 131.625  91.200  1.00  0.91           C  
ATOM   1964  CD2 LEU B 273     112.285 133.760  90.050  1.00  0.91           C  
ATOM   1965  N   SER B 274     107.602 134.111  87.157  1.00  0.90           N  
ATOM   1966  CA  SER B 274     106.820 133.748  85.981  1.00  0.90           C  
ATOM   1967  C   SER B 274     107.504 134.070  84.662  1.00  0.90           C  
ATOM   1968  O   SER B 274     107.080 133.587  83.611  1.00  0.90           O  
ATOM   1969  CB  SER B 274     105.427 134.424  85.970  1.00  0.90           C  
ATOM   1970  OG  SER B 274     105.536 135.841  85.835  1.00  0.90           O  
ATOM   1971  N   ASN B 275     108.582 134.879  84.712  1.00  0.87           N  
ATOM   1972  CA  ASN B 275     109.298 135.402  83.567  1.00  0.87           C  
ATOM   1973  C   ASN B 275     110.469 134.516  83.162  1.00  0.87           C  
ATOM   1974  O   ASN B 275     111.220 134.850  82.247  1.00  0.87           O  
ATOM   1975  CB  ASN B 275     109.893 136.797  83.890  1.00  0.87           C  
ATOM   1976  CG  ASN B 275     108.789 137.804  84.171  1.00  0.87           C  
ATOM   1977  OD1 ASN B 275     107.739 137.811  83.520  1.00  0.87           O  
ATOM   1978  ND2 ASN B 275     109.021 138.721  85.136  1.00  0.87           N  
ATOM   1979  N   SER B 276     110.670 133.360  83.819  1.00  0.88           N  
ATOM   1980  CA  SER B 276     111.778 132.484  83.495  1.00  0.88           C  
ATOM   1981  C   SER B 276     111.359 131.041  83.622  1.00  0.88           C  
ATOM   1982  O   SER B 276     110.554 130.663  84.465  1.00  0.88           O  
ATOM   1983  CB  SER B 276     113.067 132.759  84.331  1.00  0.88           C  
ATOM   1984  OG  SER B 276     112.906 132.517  85.732  1.00  0.88           O  
ATOM   1985  N   PHE B 277     111.880 130.176  82.726  1.00  0.88           N  
ATOM   1986  CA  PHE B 277     111.624 128.751  82.787  1.00  0.88           C  
ATOM   1987  C   PHE B 277     112.454 128.127  83.911  1.00  0.88           C  
ATOM   1988  O   PHE B 277     113.664 128.329  84.007  1.00  0.88           O  
ATOM   1989  CB  PHE B 277     111.912 128.109  81.402  1.00  0.88           C  
ATOM   1990  CG  PHE B 277     111.511 126.658  81.293  1.00  0.88           C  
ATOM   1991  CD1 PHE B 277     112.253 125.645  81.920  1.00  0.88           C  
ATOM   1992  CD2 PHE B 277     110.382 126.287  80.545  1.00  0.88           C  
ATOM   1993  CE1 PHE B 277     111.854 124.307  81.845  1.00  0.88           C  
ATOM   1994  CE2 PHE B 277     110.003 124.944  80.437  1.00  0.88           C  
ATOM   1995  CZ  PHE B 277     110.729 123.954  81.098  1.00  0.88           C  
ATOM   1996  N   ILE B 278     111.808 127.347  84.798  1.00  0.90           N  
ATOM   1997  CA  ILE B 278     112.474 126.709  85.923  1.00  0.90           C  
ATOM   1998  C   ILE B 278     112.853 125.273  85.574  1.00  0.90           C  
ATOM   1999  O   ILE B 278     112.025 124.461  85.177  1.00  0.90           O  
ATOM   2000  CB  ILE B 278     111.628 126.801  87.186  1.00  0.90           C  
ATOM   2001  CG1 ILE B 278     111.258 128.283  87.480  1.00  0.90           C  
ATOM   2002  CG2 ILE B 278     112.338 126.102  88.369  1.00  0.90           C  
ATOM   2003  CD1 ILE B 278     112.440 129.186  87.825  1.00  0.90           C  
ATOM   2004  N   SER B 279     114.157 124.935  85.703  1.00  0.89           N  
ATOM   2005  CA  SER B 279     114.706 123.640  85.315  1.00  0.89           C  
ATOM   2006  C   SER B 279     114.816 122.706  86.502  1.00  0.89           C  
ATOM   2007  O   SER B 279     114.658 121.496  86.371  1.00  0.89           O  
ATOM   2008  CB  SER B 279     116.128 123.799  84.711  1.00  0.89           C  
ATOM   2009  OG  SER B 279     116.644 122.588  84.149  1.00  0.89           O  
ATOM   2010  N   GLN B 280     115.039 123.247  87.718  1.00  0.84           N  
ATOM   2011  CA  GLN B 280     115.156 122.434  88.911  1.00  0.84           C  
ATOM   2012  C   GLN B 280     114.707 123.230  90.120  1.00  0.84           C  
ATOM   2013  O   GLN B 280     114.762 124.454  90.146  1.00  0.84           O  
ATOM   2014  CB  GLN B 280     116.608 121.904  89.097  1.00  0.84           C  
ATOM   2015  CG  GLN B 280     116.860 121.026  90.350  1.00  0.84           C  
ATOM   2016  CD  GLN B 280     118.310 120.555  90.508  1.00  0.84           C  
ATOM   2017  OE1 GLN B 280     119.278 121.288  90.304  1.00  0.84           O  
ATOM   2018  NE2 GLN B 280     118.472 119.292  90.970  1.00  0.84           N  
ATOM   2019  N   ILE B 281     114.222 122.530  91.162  1.00  0.87           N  
ATOM   2020  CA  ILE B 281     113.781 123.106  92.410  1.00  0.87           C  
ATOM   2021  C   ILE B 281     114.363 122.277  93.524  1.00  0.87           C  
ATOM   2022  O   ILE B 281     114.765 121.139  93.323  1.00  0.87           O  
ATOM   2023  CB  ILE B 281     112.266 123.082  92.558  1.00  0.87           C  
ATOM   2024  CG1 ILE B 281     111.671 121.688  92.228  1.00  0.87           C  
ATOM   2025  CG2 ILE B 281     111.723 124.206  91.663  1.00  0.87           C  
ATOM   2026  CD1 ILE B 281     110.200 121.537  92.607  1.00  0.87           C  
ATOM   2027  N   SER B 282     114.414 122.852  94.738  1.00  0.89           N  
ATOM   2028  CA  SER B 282     114.820 122.122  95.919  1.00  0.89           C  
ATOM   2029  C   SER B 282     114.278 122.860  97.126  1.00  0.89           C  
ATOM   2030  O   SER B 282     114.077 124.069  97.081  1.00  0.89           O  
ATOM   2031  CB  SER B 282     116.357 122.022  96.015  1.00  0.89           C  
ATOM   2032  OG  SER B 282     116.781 121.173  97.081  1.00  0.89           O  
ATOM   2033  N   GLY B 283     114.018 122.150  98.242  1.00  0.89           N  
ATOM   2034  CA  GLY B 283     113.482 122.742  99.456  1.00  0.89           C  
ATOM   2035  C   GLY B 283     114.176 122.110 100.620  1.00  0.89           C  
ATOM   2036  O   GLY B 283     114.357 120.901 100.654  1.00  0.89           O  
ATOM   2037  N   GLY B 284     114.584 122.934 101.601  1.00  0.92           N  
ATOM   2038  CA  GLY B 284     115.217 122.479 102.830  1.00  0.92           C  
ATOM   2039  C   GLY B 284     114.233 122.535 103.961  1.00  0.92           C  
ATOM   2040  O   GLY B 284     113.026 122.425 103.765  1.00  0.92           O  
ATOM   2041  N   TRP B 285     114.722 122.768 105.206  1.00  0.88           N  
ATOM   2042  CA  TRP B 285     113.854 122.846 106.385  1.00  0.88           C  
ATOM   2043  C   TRP B 285     112.851 123.984 106.245  1.00  0.88           C  
ATOM   2044  O   TRP B 285     111.643 123.800 106.401  1.00  0.88           O  
ATOM   2045  CB  TRP B 285     114.700 123.011 107.707  1.00  0.88           C  
ATOM   2046  CG  TRP B 285     114.032 122.918 109.100  1.00  0.88           C  
ATOM   2047  CD1 TRP B 285     112.736 123.167 109.422  1.00  0.88           C  
ATOM   2048  CD2 TRP B 285     114.623 122.410 110.320  1.00  0.88           C  
ATOM   2049  NE1 TRP B 285     112.488 122.909 110.750  1.00  0.88           N  
ATOM   2050  CE2 TRP B 285     113.612 122.398 111.303  1.00  0.88           C  
ATOM   2051  CE3 TRP B 285     115.874 121.895 110.612  1.00  0.88           C  
ATOM   2052  CZ2 TRP B 285     113.821 121.846 112.552  1.00  0.88           C  
ATOM   2053  CZ3 TRP B 285     116.073 121.276 111.855  1.00  0.88           C  
ATOM   2054  CH2 TRP B 285     115.056 121.250 112.812  1.00  0.88           C  
ATOM   2055  N   ARG B 286     113.323 125.187 105.880  1.00  0.85           N  
ATOM   2056  CA  ARG B 286     112.466 126.349 105.789  1.00  0.85           C  
ATOM   2057  C   ARG B 286     112.953 127.279 104.704  1.00  0.85           C  
ATOM   2058  O   ARG B 286     112.693 128.479 104.729  1.00  0.85           O  
ATOM   2059  CB  ARG B 286     112.427 127.137 107.119  1.00  0.85           C  
ATOM   2060  CG  ARG B 286     111.625 126.461 108.236  1.00  0.85           C  
ATOM   2061  CD  ARG B 286     111.652 127.213 109.565  1.00  0.85           C  
ATOM   2062  NE  ARG B 286     112.550 126.482 110.515  1.00  0.85           N  
ATOM   2063  CZ  ARG B 286     112.363 126.402 111.838  1.00  0.85           C  
ATOM   2064  NH1 ARG B 286     111.294 126.954 112.406  1.00  0.85           N  
ATOM   2065  NH2 ARG B 286     113.256 125.791 112.610  1.00  0.85           N  
ATOM   2066  N   HIS B 287     113.682 126.773 103.710  1.00  0.90           N  
ATOM   2067  CA  HIS B 287     114.133 127.597 102.620  1.00  0.90           C  
ATOM   2068  C   HIS B 287     113.978 126.825 101.341  1.00  0.90           C  
ATOM   2069  O   HIS B 287     113.781 125.611 101.346  1.00  0.90           O  
ATOM   2070  CB  HIS B 287     115.592 128.077 102.796  1.00  0.90           C  
ATOM   2071  CG  HIS B 287     116.618 127.007 102.632  1.00  0.90           C  
ATOM   2072  ND1 HIS B 287     116.788 126.033 103.595  1.00  0.90           N  
ATOM   2073  CD2 HIS B 287     117.482 126.819 101.602  1.00  0.90           C  
ATOM   2074  CE1 HIS B 287     117.767 125.272 103.133  1.00  0.90           C  
ATOM   2075  NE2 HIS B 287     118.222 125.711 101.937  1.00  0.90           N  
ATOM   2076  N   THR B 288     114.047 127.538 100.212  1.00  0.92           N  
ATOM   2077  CA  THR B 288     113.740 126.972  98.914  1.00  0.92           C  
ATOM   2078  C   THR B 288     114.696 127.567  97.919  1.00  0.92           C  
ATOM   2079  O   THR B 288     115.074 128.733  98.005  1.00  0.92           O  
ATOM   2080  CB  THR B 288     112.324 127.291  98.462  1.00  0.92           C  
ATOM   2081  OG1 THR B 288     111.361 126.781  99.382  1.00  0.92           O  
ATOM   2082  CG2 THR B 288     111.979 126.671  97.102  1.00  0.92           C  
ATOM   2083  N   MET B 289     115.139 126.740  96.959  1.00  0.90           N  
ATOM   2084  CA  MET B 289     115.992 127.138  95.868  1.00  0.90           C  
ATOM   2085  C   MET B 289     115.314 126.758  94.571  1.00  0.90           C  
ATOM   2086  O   MET B 289     114.658 125.725  94.462  1.00  0.90           O  
ATOM   2087  CB  MET B 289     117.375 126.451  95.943  1.00  0.90           C  
ATOM   2088  CG  MET B 289     118.257 127.014  97.064  1.00  0.90           C  
ATOM   2089  SD  MET B 289     118.946 128.632  96.645  1.00  0.90           S  
ATOM   2090  CE  MET B 289     119.241 129.083  98.367  1.00  0.90           C  
ATOM   2091  N   ALA B 290     115.455 127.614  93.549  1.00  0.94           N  
ATOM   2092  CA  ALA B 290     114.952 127.351  92.230  1.00  0.94           C  
ATOM   2093  C   ALA B 290     116.019 127.677  91.217  1.00  0.94           C  
ATOM   2094  O   ALA B 290     116.558 128.777  91.168  1.00  0.94           O  
ATOM   2095  CB  ALA B 290     113.697 128.188  91.963  1.00  0.94           C  
ATOM   2096  N   LEU B 291     116.350 126.691  90.376  1.00  0.91           N  
ATOM   2097  CA  LEU B 291     117.369 126.815  89.376  1.00  0.91           C  
ATOM   2098  C   LEU B 291     116.684 126.933  88.035  1.00  0.91           C  
ATOM   2099  O   LEU B 291     115.898 126.084  87.618  1.00  0.91           O  
ATOM   2100  CB  LEU B 291     118.282 125.576  89.399  1.00  0.91           C  
ATOM   2101  CG  LEU B 291     119.400 125.576  88.350  1.00  0.91           C  
ATOM   2102  CD1 LEU B 291     120.370 126.730  88.605  1.00  0.91           C  
ATOM   2103  CD2 LEU B 291     120.127 124.225  88.337  1.00  0.91           C  
ATOM   2104  N   THR B 292     116.951 128.039  87.324  1.00  0.90           N  
ATOM   2105  CA  THR B 292     116.362 128.286  86.019  1.00  0.90           C  
ATOM   2106  C   THR B 292     117.024 127.488  84.916  1.00  0.90           C  
ATOM   2107  O   THR B 292     118.096 126.918  85.076  1.00  0.90           O  
ATOM   2108  CB  THR B 292     116.304 129.753  85.604  1.00  0.90           C  
ATOM   2109  OG1 THR B 292     117.560 130.324  85.258  1.00  0.90           O  
ATOM   2110  CG2 THR B 292     115.763 130.586  86.763  1.00  0.90           C  
ATOM   2111  N   SER B 293     116.404 127.444  83.721  1.00  0.90           N  
ATOM   2112  CA  SER B 293     117.018 126.832  82.546  1.00  0.90           C  
ATOM   2113  C   SER B 293     118.211 127.611  81.994  1.00  0.90           C  
ATOM   2114  O   SER B 293     119.015 127.061  81.242  1.00  0.90           O  
ATOM   2115  CB  SER B 293     115.979 126.581  81.426  1.00  0.90           C  
ATOM   2116  OG  SER B 293     115.368 127.799  80.998  1.00  0.90           O  
ATOM   2117  N   ASP B 294     118.386 128.883  82.416  1.00  0.89           N  
ATOM   2118  CA  ASP B 294     119.470 129.767  82.045  1.00  0.89           C  
ATOM   2119  C   ASP B 294     120.614 129.687  83.069  1.00  0.89           C  
ATOM   2120  O   ASP B 294     121.634 130.366  82.958  1.00  0.89           O  
ATOM   2121  CB  ASP B 294     118.863 131.199  81.968  1.00  0.89           C  
ATOM   2122  CG  ASP B 294     119.693 132.197  81.151  1.00  0.89           C  
ATOM   2123  OD1 ASP B 294     120.558 132.815  81.783  1.00  0.89           O  
ATOM   2124  OD2 ASP B 294     119.433 132.406  79.935  1.00  0.89           O  
ATOM   2125  N   GLY B 295     120.494 128.832  84.116  1.00  0.96           N  
ATOM   2126  CA  GLY B 295     121.567 128.643  85.088  1.00  0.96           C  
ATOM   2127  C   GLY B 295     121.606 129.665  86.187  1.00  0.96           C  
ATOM   2128  O   GLY B 295     122.635 129.862  86.830  1.00  0.96           O  
ATOM   2129  N   LYS B 296     120.489 130.366  86.438  1.00  0.89           N  
ATOM   2130  CA  LYS B 296     120.398 131.351  87.496  1.00  0.89           C  
ATOM   2131  C   LYS B 296     119.754 130.674  88.680  1.00  0.89           C  
ATOM   2132  O   LYS B 296     118.715 130.026  88.558  1.00  0.89           O  
ATOM   2133  CB  LYS B 296     119.533 132.581  87.116  1.00  0.89           C  
ATOM   2134  CG  LYS B 296     119.901 133.254  85.785  1.00  0.89           C  
ATOM   2135  CD  LYS B 296     120.895 134.419  85.913  1.00  0.89           C  
ATOM   2136  CE  LYS B 296     121.073 135.218  84.617  1.00  0.89           C  
ATOM   2137  NZ  LYS B 296     121.425 134.326  83.538  1.00  0.89           N  
ATOM   2138  N   LEU B 297     120.359 130.808  89.864  1.00  0.93           N  
ATOM   2139  CA  LEU B 297     119.829 130.210  91.055  1.00  0.93           C  
ATOM   2140  C   LEU B 297     119.106 131.281  91.843  1.00  0.93           C  
ATOM   2141  O   LEU B 297     119.681 132.312  92.174  1.00  0.93           O  
ATOM   2142  CB  LEU B 297     120.997 129.650  91.878  1.00  0.93           C  
ATOM   2143  CG  LEU B 297     120.586 128.934  93.165  1.00  0.93           C  
ATOM   2144  CD1 LEU B 297     119.803 127.651  92.880  1.00  0.93           C  
ATOM   2145  CD2 LEU B 297     121.821 128.610  93.999  1.00  0.93           C  
ATOM   2146  N   TYR B 298     117.820 131.066  92.157  1.00  0.92           N  
ATOM   2147  CA  TYR B 298     117.049 131.956  92.991  1.00  0.92           C  
ATOM   2148  C   TYR B 298     116.804 131.249  94.301  1.00  0.92           C  
ATOM   2149  O   TYR B 298     116.448 130.076  94.329  1.00  0.92           O  
ATOM   2150  CB  TYR B 298     115.679 132.330  92.380  1.00  0.92           C  
ATOM   2151  CG  TYR B 298     115.852 133.181  91.162  1.00  0.92           C  
ATOM   2152  CD1 TYR B 298     116.045 132.595  89.906  1.00  0.92           C  
ATOM   2153  CD2 TYR B 298     115.838 134.578  91.257  1.00  0.92           C  
ATOM   2154  CE1 TYR B 298     116.260 133.391  88.778  1.00  0.92           C  
ATOM   2155  CE2 TYR B 298     116.009 135.375  90.115  1.00  0.92           C  
ATOM   2156  CZ  TYR B 298     116.236 134.777  88.870  1.00  0.92           C  
ATOM   2157  OH  TYR B 298     116.437 135.537  87.700  1.00  0.92           O  
ATOM   2158  N   GLY B 299     117.008 131.960  95.422  1.00  0.97           N  
ATOM   2159  CA  GLY B 299     116.805 131.427  96.756  1.00  0.97           C  
ATOM   2160  C   GLY B 299     115.907 132.320  97.553  1.00  0.97           C  
ATOM   2161  O   GLY B 299     115.859 133.527  97.343  1.00  0.97           O  
ATOM   2162  N   TRP B 300     115.176 131.720  98.506  1.00  0.94           N  
ATOM   2163  CA  TRP B 300     114.330 132.439  99.425  1.00  0.94           C  
ATOM   2164  C   TRP B 300     114.004 131.558 100.620  1.00  0.94           C  
ATOM   2165  O   TRP B 300     114.371 130.389 100.684  1.00  0.94           O  
ATOM   2166  CB  TRP B 300     113.035 132.966  98.762  1.00  0.94           C  
ATOM   2167  CG  TRP B 300     112.120 131.898  98.214  1.00  0.94           C  
ATOM   2168  CD1 TRP B 300     111.154 131.211  98.876  1.00  0.94           C  
ATOM   2169  CD2 TRP B 300     112.188 131.341  96.902  1.00  0.94           C  
ATOM   2170  NE1 TRP B 300     110.572 130.289  98.047  1.00  0.94           N  
ATOM   2171  CE2 TRP B 300     111.184 130.355  96.826  1.00  0.94           C  
ATOM   2172  CE3 TRP B 300     113.027 131.587  95.831  1.00  0.94           C  
ATOM   2173  CZ2 TRP B 300     110.995 129.639  95.664  1.00  0.94           C  
ATOM   2174  CZ3 TRP B 300     112.835 130.867  94.658  1.00  0.94           C  
ATOM   2175  CH2 TRP B 300     111.824 129.915  94.571  1.00  0.94           C  
ATOM   2176  N   GLY B 301     113.297 132.138 101.608  1.00  0.98           N  
ATOM   2177  CA  GLY B 301     112.872 131.494 102.832  1.00  0.98           C  
ATOM   2178  C   GLY B 301     113.738 131.896 103.973  1.00  0.98           C  
ATOM   2179  O   GLY B 301     114.329 132.969 103.995  1.00  0.98           O  
ATOM   2180  N   TRP B 302     113.810 131.001 104.971  1.00  0.92           N  
ATOM   2181  CA  TRP B 302     114.579 131.187 106.177  1.00  0.92           C  
ATOM   2182  C   TRP B 302     116.045 131.382 105.891  1.00  0.92           C  
ATOM   2183  O   TRP B 302     116.649 130.622 105.142  1.00  0.92           O  
ATOM   2184  CB  TRP B 302     114.423 129.938 107.079  1.00  0.92           C  
ATOM   2185  CG  TRP B 302     114.816 130.072 108.537  1.00  0.92           C  
ATOM   2186  CD1 TRP B 302     114.657 131.188 109.295  1.00  0.92           C  
ATOM   2187  CD2 TRP B 302     115.299 129.045 109.426  1.00  0.92           C  
ATOM   2188  NE1 TRP B 302     115.041 130.950 110.584  1.00  0.92           N  
ATOM   2189  CE2 TRP B 302     115.429 129.645 110.702  1.00  0.92           C  
ATOM   2190  CE3 TRP B 302     115.611 127.701 109.242  1.00  0.92           C  
ATOM   2191  CZ2 TRP B 302     115.869 128.913 111.790  1.00  0.92           C  
ATOM   2192  CZ3 TRP B 302     116.036 126.959 110.352  1.00  0.92           C  
ATOM   2193  CH2 TRP B 302     116.165 127.558 111.610  1.00  0.92           C  
ATOM   2194  N   ASN B 303     116.646 132.394 106.522  1.00  0.93           N  
ATOM   2195  CA  ASN B 303     117.984 132.785 106.207  1.00  0.93           C  
ATOM   2196  C   ASN B 303     118.721 133.108 107.487  1.00  0.93           C  
ATOM   2197  O   ASN B 303     119.675 133.870 107.504  1.00  0.93           O  
ATOM   2198  CB  ASN B 303     117.912 134.003 105.271  1.00  0.93           C  
ATOM   2199  CG  ASN B 303     119.210 134.189 104.514  1.00  0.93           C  
ATOM   2200  OD1 ASN B 303     119.934 133.236 104.224  1.00  0.93           O  
ATOM   2201  ND2 ASN B 303     119.533 135.456 104.169  1.00  0.93           N  
ATOM   2202  N   LYS B 304     118.323 132.483 108.611  1.00  0.89           N  
ATOM   2203  CA  LYS B 304     118.979 132.678 109.890  1.00  0.89           C  
ATOM   2204  C   LYS B 304     120.465 132.325 109.931  1.00  0.89           C  
ATOM   2205  O   LYS B 304     121.251 132.955 110.624  1.00  0.89           O  
ATOM   2206  CB  LYS B 304     118.286 131.843 110.982  1.00  0.89           C  
ATOM   2207  CG  LYS B 304     118.908 132.021 112.376  1.00  0.89           C  
ATOM   2208  CD  LYS B 304     118.153 131.256 113.464  1.00  0.89           C  
ATOM   2209  CE  LYS B 304     118.577 131.630 114.883  1.00  0.89           C  
ATOM   2210  NZ  LYS B 304     120.014 131.335 115.059  1.00  0.89           N  
ATOM   2211  N   PHE B 305     120.858 131.267 109.193  1.00  0.93           N  
ATOM   2212  CA  PHE B 305     122.229 130.801 109.126  1.00  0.93           C  
ATOM   2213  C   PHE B 305     122.837 131.180 107.798  1.00  0.93           C  
ATOM   2214  O   PHE B 305     123.930 130.737 107.454  1.00  0.93           O  
ATOM   2215  CB  PHE B 305     122.318 129.260 109.223  1.00  0.93           C  
ATOM   2216  CG  PHE B 305     121.589 128.756 110.422  1.00  0.93           C  
ATOM   2217  CD1 PHE B 305     122.121 128.946 111.702  1.00  0.93           C  
ATOM   2218  CD2 PHE B 305     120.352 128.111 110.288  1.00  0.93           C  
ATOM   2219  CE1 PHE B 305     121.406 128.545 112.834  1.00  0.93           C  
ATOM   2220  CE2 PHE B 305     119.657 127.672 111.417  1.00  0.93           C  
ATOM   2221  CZ  PHE B 305     120.173 127.904 112.694  1.00  0.93           C  
ATOM   2222  N   GLY B 306     122.136 131.998 106.989  1.00  0.96           N  
ATOM   2223  CA  GLY B 306     122.666 132.407 105.702  1.00  0.96           C  
ATOM   2224  C   GLY B 306     122.471 131.430 104.567  1.00  0.96           C  
ATOM   2225  O   GLY B 306     123.071 131.566 103.504  1.00  0.96           O  
ATOM   2226  N   GLN B 307     121.609 130.412 104.745  1.00  0.91           N  
ATOM   2227  CA  GLN B 307     121.368 129.326 103.802  1.00  0.91           C  
ATOM   2228  C   GLN B 307     120.623 129.686 102.532  1.00  0.91           C  
ATOM   2229  O   GLN B 307     120.529 128.890 101.595  1.00  0.91           O  
ATOM   2230  CB  GLN B 307     120.667 128.126 104.469  1.00  0.91           C  
ATOM   2231  CG  GLN B 307     119.203 128.338 104.904  1.00  0.91           C  
ATOM   2232  CD  GLN B 307     119.041 128.893 106.323  1.00  0.91           C  
ATOM   2233  OE1 GLN B 307     119.883 129.539 106.924  1.00  0.91           O  
ATOM   2234  NE2 GLN B 307     117.826 128.638 106.875  1.00  0.91           N  
ATOM   2235  N   VAL B 308     120.092 130.915 102.451  1.00  0.97           N  
ATOM   2236  CA  VAL B 308     119.601 131.469 101.207  1.00  0.97           C  
ATOM   2237  C   VAL B 308     120.763 131.964 100.346  1.00  0.97           C  
ATOM   2238  O   VAL B 308     120.659 132.045  99.127  1.00  0.97           O  
ATOM   2239  CB  VAL B 308     118.560 132.550 101.462  1.00  0.97           C  
ATOM   2240  CG1 VAL B 308     118.039 133.159 100.161  1.00  0.97           C  
ATOM   2241  CG2 VAL B 308     117.379 131.924 102.225  1.00  0.97           C  
ATOM   2242  N   GLY B 309     121.950 132.257 100.927  1.00  0.98           N  
ATOM   2243  CA  GLY B 309     123.119 132.579 100.116  1.00  0.98           C  
ATOM   2244  C   GLY B 309     123.167 133.951  99.484  1.00  0.98           C  
ATOM   2245  O   GLY B 309     123.839 134.168  98.503  1.00  0.98           O  
ATOM   2246  N   VAL B 310     122.419 134.917 100.051  1.00  0.96           N  
ATOM   2247  CA  VAL B 310     122.233 136.239  99.477  1.00  0.96           C  
ATOM   2248  C   VAL B 310     123.099 137.290 100.141  1.00  0.96           C  
ATOM   2249  O   VAL B 310     122.943 138.491  99.926  1.00  0.96           O  
ATOM   2250  CB  VAL B 310     120.775 136.657  99.527  1.00  0.96           C  
ATOM   2251  CG1 VAL B 310     120.025 135.826  98.475  1.00  0.96           C  
ATOM   2252  CG2 VAL B 310     120.179 136.496 100.938  1.00  0.96           C  
ATOM   2253  N   GLY B 311     124.070 136.864 100.973  1.00  0.97           N  
ATOM   2254  CA  GLY B 311     125.020 137.781 101.588  1.00  0.97           C  
ATOM   2255  C   GLY B 311     124.547 138.427 102.859  1.00  0.97           C  
ATOM   2256  O   GLY B 311     125.125 139.408 103.320  1.00  0.97           O  
ATOM   2257  N   ASN B 312     123.489 137.891 103.487  1.00  0.92           N  
ATOM   2258  CA  ASN B 312     122.952 138.426 104.717  1.00  0.92           C  
ATOM   2259  C   ASN B 312     122.305 137.302 105.513  1.00  0.92           C  
ATOM   2260  O   ASN B 312     122.271 136.162 105.055  1.00  0.92           O  
ATOM   2261  CB  ASN B 312     122.005 139.646 104.486  1.00  0.92           C  
ATOM   2262  CG  ASN B 312     120.744 139.287 103.709  1.00  0.92           C  
ATOM   2263  OD1 ASN B 312     119.928 138.505 104.202  1.00  0.92           O  
ATOM   2264  ND2 ASN B 312     120.541 139.870 102.507  1.00  0.92           N  
ATOM   2265  N   ASN B 313     121.804 137.628 106.723  1.00  0.93           N  
ATOM   2266  CA  ASN B 313     121.127 136.722 107.632  1.00  0.93           C  
ATOM   2267  C   ASN B 313     119.693 137.186 107.883  1.00  0.93           C  
ATOM   2268  O   ASN B 313     119.155 137.042 108.978  1.00  0.93           O  
ATOM   2269  CB  ASN B 313     121.902 136.612 108.972  1.00  0.93           C  
ATOM   2270  CG  ASN B 313     122.899 135.460 108.919  1.00  0.93           C  
ATOM   2271  OD1 ASN B 313     123.104 134.806 107.902  1.00  0.93           O  
ATOM   2272  ND2 ASN B 313     123.550 135.186 110.077  1.00  0.93           N  
ATOM   2273  N   LEU B 314     119.032 137.791 106.874  1.00  0.95           N  
ATOM   2274  CA  LEU B 314     117.659 138.238 107.005  1.00  0.95           C  
ATOM   2275  C   LEU B 314     116.795 137.346 106.147  1.00  0.95           C  
ATOM   2276  O   LEU B 314     117.133 137.082 104.995  1.00  0.95           O  
ATOM   2277  CB  LEU B 314     117.462 139.690 106.510  1.00  0.95           C  
ATOM   2278  CG  LEU B 314     118.386 140.720 107.178  1.00  0.95           C  
ATOM   2279  CD1 LEU B 314     118.174 142.103 106.548  1.00  0.95           C  
ATOM   2280  CD2 LEU B 314     118.193 140.762 108.701  1.00  0.95           C  
ATOM   2281  N   ASP B 315     115.670 136.843 106.697  1.00  0.96           N  
ATOM   2282  CA  ASP B 315     114.731 135.989 105.994  1.00  0.96           C  
ATOM   2283  C   ASP B 315     114.198 136.618 104.718  1.00  0.96           C  
ATOM   2284  O   ASP B 315     113.811 137.784 104.667  1.00  0.96           O  
ATOM   2285  CB  ASP B 315     113.566 135.569 106.922  1.00  0.96           C  
ATOM   2286  CG  ASP B 315     114.092 134.746 108.086  1.00  0.96           C  
ATOM   2287  OD1 ASP B 315     115.168 134.109 107.926  1.00  0.96           O  
ATOM   2288  OD2 ASP B 315     113.421 134.709 109.144  1.00  0.96           O  
ATOM   2289  N   GLN B 316     114.208 135.839 103.622  1.00  0.92           N  
ATOM   2290  CA  GLN B 316     113.925 136.376 102.315  1.00  0.92           C  
ATOM   2291  C   GLN B 316     112.570 135.880 101.886  1.00  0.92           C  
ATOM   2292  O   GLN B 316     112.363 134.697 101.635  1.00  0.92           O  
ATOM   2293  CB  GLN B 316     114.994 135.958 101.281  1.00  0.92           C  
ATOM   2294  CG  GLN B 316     116.422 136.459 101.594  1.00  0.92           C  
ATOM   2295  CD  GLN B 316     116.505 137.985 101.594  1.00  0.92           C  
ATOM   2296  OE1 GLN B 316     116.017 138.661 100.692  1.00  0.92           O  
ATOM   2297  NE2 GLN B 316     117.156 138.579 102.620  1.00  0.92           N  
ATOM   2298  N   CYS B 317     111.586 136.787 101.781  1.00  0.96           N  
ATOM   2299  CA  CYS B 317     110.208 136.401 101.555  1.00  0.96           C  
ATOM   2300  C   CYS B 317     109.812 136.420 100.097  1.00  0.96           C  
ATOM   2301  O   CYS B 317     108.668 136.151  99.738  1.00  0.96           O  
ATOM   2302  CB  CYS B 317     109.265 137.339 102.334  1.00  0.96           C  
ATOM   2303  SG  CYS B 317     109.626 137.306 104.114  1.00  0.96           S  
ATOM   2304  N   SER B 318     110.768 136.697  99.204  1.00  0.96           N  
ATOM   2305  CA  SER B 318     110.558 136.691  97.779  1.00  0.96           C  
ATOM   2306  C   SER B 318     111.843 136.146  97.161  1.00  0.96           C  
ATOM   2307  O   SER B 318     112.859 136.119  97.847  1.00  0.96           O  
ATOM   2308  CB  SER B 318     110.183 138.097  97.233  1.00  0.96           C  
ATOM   2309  OG  SER B 318     111.164 139.083  97.558  1.00  0.96           O  
ATOM   2310  N   PRO B 319     111.854 135.622  95.936  1.00  0.96           N  
ATOM   2311  CA  PRO B 319     113.043 135.102  95.279  1.00  0.96           C  
ATOM   2312  C   PRO B 319     114.158 136.083  95.056  1.00  0.96           C  
ATOM   2313  O   PRO B 319     113.948 137.122  94.448  1.00  0.96           O  
ATOM   2314  CB  PRO B 319     112.557 134.564  93.932  1.00  0.96           C  
ATOM   2315  CG  PRO B 319     111.079 134.300  94.147  1.00  0.96           C  
ATOM   2316  CD  PRO B 319     110.667 135.380  95.135  1.00  0.96           C  
ATOM   2317  N   VAL B 320     115.377 135.711  95.470  1.00  0.97           N  
ATOM   2318  CA  VAL B 320     116.537 136.540  95.281  1.00  0.97           C  
ATOM   2319  C   VAL B 320     117.562 135.736  94.526  1.00  0.97           C  
ATOM   2320  O   VAL B 320     117.838 134.584  94.848  1.00  0.97           O  
ATOM   2321  CB  VAL B 320     117.127 136.951  96.606  1.00  0.97           C  
ATOM   2322  CG1 VAL B 320     118.276 137.951  96.388  1.00  0.97           C  
ATOM   2323  CG2 VAL B 320     116.037 137.571  97.493  1.00  0.97           C  
ATOM   2324  N   GLN B 321     118.145 136.314  93.460  1.00  0.91           N  
ATOM   2325  CA  GLN B 321     119.182 135.646  92.701  1.00  0.91           C  
ATOM   2326  C   GLN B 321     120.480 135.522  93.493  1.00  0.91           C  
ATOM   2327  O   GLN B 321     121.034 136.501  93.985  1.00  0.91           O  
ATOM   2328  CB  GLN B 321     119.374 136.326  91.321  1.00  0.91           C  
ATOM   2329  CG  GLN B 321     120.076 135.460  90.246  1.00  0.91           C  
ATOM   2330  CD  GLN B 321     121.599 135.503  90.354  1.00  0.91           C  
ATOM   2331  OE1 GLN B 321     122.194 136.451  90.870  1.00  0.91           O  
ATOM   2332  NE2 GLN B 321     122.299 134.490  89.795  1.00  0.91           N  
ATOM   2333  N   VAL B 322     120.970 134.278  93.642  1.00  0.96           N  
ATOM   2334  CA  VAL B 322     122.201 133.957  94.331  1.00  0.96           C  
ATOM   2335  C   VAL B 322     123.359 134.156  93.373  1.00  0.96           C  
ATOM   2336  O   VAL B 322     123.450 133.534  92.316  1.00  0.96           O  
ATOM   2337  CB  VAL B 322     122.193 132.535  94.875  1.00  0.96           C  
ATOM   2338  CG1 VAL B 322     123.524 132.231  95.581  1.00  0.96           C  
ATOM   2339  CG2 VAL B 322     121.013 132.375  95.850  1.00  0.96           C  
ATOM   2340  N   ARG B 323     124.279 135.074  93.721  1.00  0.87           N  
ATOM   2341  CA  ARG B 323     125.363 135.473  92.854  1.00  0.87           C  
ATOM   2342  C   ARG B 323     126.612 134.645  93.129  1.00  0.87           C  
ATOM   2343  O   ARG B 323     127.046 134.494  94.267  1.00  0.87           O  
ATOM   2344  CB  ARG B 323     125.683 136.979  93.048  1.00  0.87           C  
ATOM   2345  CG  ARG B 323     124.531 137.939  92.670  1.00  0.87           C  
ATOM   2346  CD  ARG B 323     124.642 138.454  91.231  1.00  0.87           C  
ATOM   2347  NE  ARG B 323     123.440 139.320  90.952  1.00  0.87           N  
ATOM   2348  CZ  ARG B 323     122.720 139.283  89.818  1.00  0.87           C  
ATOM   2349  NH1 ARG B 323     123.053 138.482  88.813  1.00  0.87           N  
ATOM   2350  NH2 ARG B 323     121.621 140.025  89.698  1.00  0.87           N  
ATOM   2351  N   PHE B 324     127.236 134.101  92.063  1.00  0.93           N  
ATOM   2352  CA  PHE B 324     128.420 133.269  92.164  1.00  0.93           C  
ATOM   2353  C   PHE B 324     129.600 134.063  91.603  1.00  0.93           C  
ATOM   2354  O   PHE B 324     129.388 134.860  90.687  1.00  0.93           O  
ATOM   2355  CB  PHE B 324     128.270 131.947  91.365  1.00  0.93           C  
ATOM   2356  CG  PHE B 324     127.248 131.062  92.010  1.00  0.93           C  
ATOM   2357  CD1 PHE B 324     125.876 131.284  91.820  1.00  0.93           C  
ATOM   2358  CD2 PHE B 324     127.648 129.992  92.823  1.00  0.93           C  
ATOM   2359  CE1 PHE B 324     124.927 130.482  92.458  1.00  0.93           C  
ATOM   2360  CE2 PHE B 324     126.699 129.152  93.413  1.00  0.93           C  
ATOM   2361  CZ  PHE B 324     125.338 129.401  93.238  1.00  0.93           C  
ATOM   2362  N   PRO B 325     130.836 133.937  92.097  1.00  0.90           N  
ATOM   2363  CA  PRO B 325     132.026 134.582  91.522  1.00  0.90           C  
ATOM   2364  C   PRO B 325     132.193 134.365  90.023  1.00  0.90           C  
ATOM   2365  O   PRO B 325     132.036 133.232  89.592  1.00  0.90           O  
ATOM   2366  CB  PRO B 325     133.208 133.944  92.271  1.00  0.90           C  
ATOM   2367  CG  PRO B 325     132.602 133.386  93.556  1.00  0.90           C  
ATOM   2368  CD  PRO B 325     131.201 132.967  93.127  1.00  0.90           C  
ATOM   2369  N   ASP B 326     132.485 135.419  89.234  1.00  0.84           N  
ATOM   2370  CA  ASP B 326     132.664 135.348  87.788  1.00  0.84           C  
ATOM   2371  C   ASP B 326     131.403 135.038  86.967  1.00  0.84           C  
ATOM   2372  O   ASP B 326     131.493 134.772  85.768  1.00  0.84           O  
ATOM   2373  CB  ASP B 326     133.868 134.450  87.383  1.00  0.84           C  
ATOM   2374  CG  ASP B 326     135.212 135.111  87.661  1.00  0.84           C  
ATOM   2375  OD1 ASP B 326     136.236 134.506  87.254  1.00  0.84           O  
ATOM   2376  OD2 ASP B 326     135.229 136.212  88.270  1.00  0.84           O  
ATOM   2377  N   ASP B 327     130.188 135.111  87.565  1.00  0.90           N  
ATOM   2378  CA  ASP B 327     128.914 134.804  86.906  1.00  0.90           C  
ATOM   2379  C   ASP B 327     128.874 133.370  86.367  1.00  0.90           C  
ATOM   2380  O   ASP B 327     128.528 133.106  85.217  1.00  0.90           O  
ATOM   2381  CB  ASP B 327     128.479 135.892  85.857  1.00  0.90           C  
ATOM   2382  CG  ASP B 327     127.033 135.812  85.344  1.00  0.90           C  
ATOM   2383  OD1 ASP B 327     126.185 135.087  85.931  1.00  0.90           O  
ATOM   2384  OD2 ASP B 327     126.727 136.493  84.328  1.00  0.90           O  
ATOM   2385  N   GLN B 328     129.254 132.373  87.205  1.00  0.86           N  
ATOM   2386  CA  GLN B 328     129.129 130.980  86.807  1.00  0.86           C  
ATOM   2387  C   GLN B 328     127.685 130.562  86.706  1.00  0.86           C  
ATOM   2388  O   GLN B 328     126.898 130.783  87.625  1.00  0.86           O  
ATOM   2389  CB  GLN B 328     129.837 129.979  87.753  1.00  0.86           C  
ATOM   2390  CG  GLN B 328     131.077 130.602  88.406  1.00  0.86           C  
ATOM   2391  CD  GLN B 328     131.954 129.611  89.150  1.00  0.86           C  
ATOM   2392  OE1 GLN B 328     131.779 128.392  89.092  1.00  0.86           O  
ATOM   2393  NE2 GLN B 328     132.961 130.152  89.872  1.00  0.86           N  
ATOM   2394  N   LYS B 329     127.295 129.903  85.605  1.00  0.91           N  
ATOM   2395  CA  LYS B 329     125.987 129.302  85.560  1.00  0.91           C  
ATOM   2396  C   LYS B 329     125.898 128.103  86.486  1.00  0.91           C  
ATOM   2397  O   LYS B 329     126.833 127.319  86.624  1.00  0.91           O  
ATOM   2398  CB  LYS B 329     125.604 128.945  84.115  1.00  0.91           C  
ATOM   2399  CG  LYS B 329     125.658 130.153  83.166  1.00  0.91           C  
ATOM   2400  CD  LYS B 329     124.780 131.322  83.631  1.00  0.91           C  
ATOM   2401  CE  LYS B 329     124.415 132.267  82.491  1.00  0.91           C  
ATOM   2402  NZ  LYS B 329     125.082 133.584  82.661  1.00  0.91           N  
ATOM   2403  N   VAL B 330     124.765 127.934  87.181  1.00  0.95           N  
ATOM   2404  CA  VAL B 330     124.565 126.791  88.048  1.00  0.95           C  
ATOM   2405  C   VAL B 330     123.914 125.675  87.238  1.00  0.95           C  
ATOM   2406  O   VAL B 330     122.990 125.908  86.466  1.00  0.95           O  
ATOM   2407  CB  VAL B 330     123.756 127.171  89.277  1.00  0.95           C  
ATOM   2408  CG1 VAL B 330     123.467 125.957  90.178  1.00  0.95           C  
ATOM   2409  CG2 VAL B 330     124.518 128.242  90.073  1.00  0.95           C  
ATOM   2410  N   VAL B 331     124.413 124.423  87.368  1.00  0.93           N  
ATOM   2411  CA  VAL B 331     123.851 123.278  86.669  1.00  0.93           C  
ATOM   2412  C   VAL B 331     123.148 122.339  87.627  1.00  0.93           C  
ATOM   2413  O   VAL B 331     122.362 121.489  87.207  1.00  0.93           O  
ATOM   2414  CB  VAL B 331     124.896 122.495  85.875  1.00  0.93           C  
ATOM   2415  CG1 VAL B 331     125.494 123.417  84.797  1.00  0.93           C  
ATOM   2416  CG2 VAL B 331     125.999 121.904  86.777  1.00  0.93           C  
ATOM   2417  N   GLN B 332     123.374 122.479  88.948  1.00  0.88           N  
ATOM   2418  CA  GLN B 332     122.680 121.665  89.923  1.00  0.88           C  
ATOM   2419  C   GLN B 332     122.668 122.353  91.273  1.00  0.88           C  
ATOM   2420  O   GLN B 332     123.599 123.073  91.625  1.00  0.88           O  
ATOM   2421  CB  GLN B 332     123.392 120.292  90.056  1.00  0.88           C  
ATOM   2422  CG  GLN B 332     122.652 119.193  90.859  1.00  0.88           C  
ATOM   2423  CD  GLN B 332     123.422 117.868  90.967  1.00  0.88           C  
ATOM   2424  OE1 GLN B 332     123.083 117.004  91.781  1.00  0.88           O  
ATOM   2425  NE2 GLN B 332     124.484 117.684  90.155  1.00  0.88           N  
ATOM   2426  N   VAL B 333     121.622 122.110  92.082  1.00  0.93           N  
ATOM   2427  CA  VAL B 333     121.511 122.640  93.425  1.00  0.93           C  
ATOM   2428  C   VAL B 333     120.918 121.570  94.307  1.00  0.93           C  
ATOM   2429  O   VAL B 333     120.145 120.729  93.859  1.00  0.93           O  
ATOM   2430  CB  VAL B 333     120.667 123.917  93.476  1.00  0.93           C  
ATOM   2431  CG1 VAL B 333     119.213 123.666  93.015  1.00  0.93           C  
ATOM   2432  CG2 VAL B 333     120.743 124.602  94.859  1.00  0.93           C  
ATOM   2433  N   SER B 334     121.299 121.559  95.598  1.00  0.91           N  
ATOM   2434  CA  SER B 334     120.667 120.693  96.570  1.00  0.91           C  
ATOM   2435  C   SER B 334     120.643 121.424  97.902  1.00  0.91           C  
ATOM   2436  O   SER B 334     121.631 122.010  98.316  1.00  0.91           O  
ATOM   2437  CB  SER B 334     121.387 119.334  96.703  1.00  0.91           C  
ATOM   2438  OG  SER B 334     120.693 118.481  97.615  1.00  0.91           O  
ATOM   2439  N   SER B 335     119.479 121.422  98.591  1.00  0.91           N  
ATOM   2440  CA  SER B 335     119.257 122.172  99.811  1.00  0.91           C  
ATOM   2441  C   SER B 335     119.163 121.179 100.925  1.00  0.91           C  
ATOM   2442  O   SER B 335     118.324 120.291 100.927  1.00  0.91           O  
ATOM   2443  CB  SER B 335     117.924 122.957  99.838  1.00  0.91           C  
ATOM   2444  OG  SER B 335     117.952 124.037  98.902  1.00  0.91           O  
ATOM   2445  N   GLY B 336     120.055 121.324 101.915  1.00  0.93           N  
ATOM   2446  CA  GLY B 336     120.005 120.603 103.165  1.00  0.93           C  
ATOM   2447  C   GLY B 336     119.027 121.281 104.063  1.00  0.93           C  
ATOM   2448  O   GLY B 336     118.322 122.217 103.696  1.00  0.93           O  
ATOM   2449  N   TRP B 337     118.987 120.846 105.321  1.00  0.89           N  
ATOM   2450  CA  TRP B 337     118.111 121.446 106.304  1.00  0.89           C  
ATOM   2451  C   TRP B 337     118.430 122.889 106.627  1.00  0.89           C  
ATOM   2452  O   TRP B 337     117.535 123.727 106.748  1.00  0.89           O  
ATOM   2453  CB  TRP B 337     118.142 120.603 107.586  1.00  0.89           C  
ATOM   2454  CG  TRP B 337     117.355 119.305 107.505  1.00  0.89           C  
ATOM   2455  CD1 TRP B 337     116.875 118.641 106.409  1.00  0.89           C  
ATOM   2456  CD2 TRP B 337     116.994 118.503 108.641  1.00  0.89           C  
ATOM   2457  NE1 TRP B 337     116.225 117.498 106.792  1.00  0.89           N  
ATOM   2458  CE2 TRP B 337     116.280 117.395 108.146  1.00  0.89           C  
ATOM   2459  CE3 TRP B 337     117.225 118.650 110.004  1.00  0.89           C  
ATOM   2460  CZ2 TRP B 337     115.775 116.438 108.994  1.00  0.89           C  
ATOM   2461  CZ3 TRP B 337     116.694 117.681 110.865  1.00  0.89           C  
ATOM   2462  CH2 TRP B 337     115.982 116.587 110.364  1.00  0.89           C  
ATOM   2463  N   ARG B 338     119.720 123.219 106.770  1.00  0.86           N  
ATOM   2464  CA  ARG B 338     120.131 124.553 107.130  1.00  0.86           C  
ATOM   2465  C   ARG B 338     121.324 124.977 106.305  1.00  0.86           C  
ATOM   2466  O   ARG B 338     121.997 125.950 106.633  1.00  0.86           O  
ATOM   2467  CB  ARG B 338     120.532 124.594 108.622  1.00  0.86           C  
ATOM   2468  CG  ARG B 338     119.426 124.150 109.600  1.00  0.86           C  
ATOM   2469  CD  ARG B 338     119.936 124.012 111.030  1.00  0.86           C  
ATOM   2470  NE  ARG B 338     118.833 123.449 111.866  1.00  0.86           N  
ATOM   2471  CZ  ARG B 338     118.520 123.851 113.104  1.00  0.86           C  
ATOM   2472  NH1 ARG B 338     119.102 124.906 113.662  1.00  0.86           N  
ATOM   2473  NH2 ARG B 338     117.604 123.187 113.807  1.00  0.86           N  
ATOM   2474  N   HIS B 339     121.618 124.271 105.207  1.00  0.92           N  
ATOM   2475  CA  HIS B 339     122.716 124.608 104.342  1.00  0.92           C  
ATOM   2476  C   HIS B 339     122.320 124.263 102.931  1.00  0.92           C  
ATOM   2477  O   HIS B 339     121.294 123.630 102.713  1.00  0.92           O  
ATOM   2478  CB  HIS B 339     124.025 123.884 104.723  1.00  0.92           C  
ATOM   2479  CG  HIS B 339     124.043 122.416 104.459  1.00  0.92           C  
ATOM   2480  ND1 HIS B 339     123.308 121.538 105.232  1.00  0.92           N  
ATOM   2481  CD2 HIS B 339     124.735 121.749 103.501  1.00  0.92           C  
ATOM   2482  CE1 HIS B 339     123.575 120.343 104.728  1.00  0.92           C  
ATOM   2483  NE2 HIS B 339     124.438 120.422 103.689  1.00  0.92           N  
ATOM   2484  N   THR B 340     123.109 124.674 101.931  1.00  0.93           N  
ATOM   2485  CA  THR B 340     122.768 124.440 100.539  1.00  0.93           C  
ATOM   2486  C   THR B 340     124.060 124.252  99.785  1.00  0.93           C  
ATOM   2487  O   THR B 340     125.080 124.858 100.103  1.00  0.93           O  
ATOM   2488  CB  THR B 340     122.023 125.610  99.902  1.00  0.93           C  
ATOM   2489  OG1 THR B 340     120.848 125.954 100.628  1.00  0.93           O  
ATOM   2490  CG2 THR B 340     121.546 125.322  98.473  1.00  0.93           C  
ATOM   2491  N   LEU B 341     124.050 123.376  98.766  1.00  0.92           N  
ATOM   2492  CA  LEU B 341     125.176 123.115  97.904  1.00  0.92           C  
ATOM   2493  C   LEU B 341     124.764 123.400  96.471  1.00  0.92           C  
ATOM   2494  O   LEU B 341     123.603 123.250  96.097  1.00  0.92           O  
ATOM   2495  CB  LEU B 341     125.603 121.632  97.964  1.00  0.92           C  
ATOM   2496  CG  LEU B 341     125.745 121.029  99.368  1.00  0.92           C  
ATOM   2497  CD1 LEU B 341     125.878 119.508  99.232  1.00  0.92           C  
ATOM   2498  CD2 LEU B 341     126.895 121.644 100.172  1.00  0.92           C  
ATOM   2499  N   ALA B 342     125.722 123.795  95.618  1.00  0.96           N  
ATOM   2500  CA  ALA B 342     125.458 124.025  94.220  1.00  0.96           C  
ATOM   2501  C   ALA B 342     126.650 123.618  93.385  1.00  0.96           C  
ATOM   2502  O   ALA B 342     127.790 123.858  93.755  1.00  0.96           O  
ATOM   2503  CB  ALA B 342     125.171 125.514  93.974  1.00  0.96           C  
ATOM   2504  N   VAL B 343     126.393 123.000  92.217  1.00  0.94           N  
ATOM   2505  CA  VAL B 343     127.422 122.597  91.275  1.00  0.94           C  
ATOM   2506  C   VAL B 343     127.215 123.493  90.085  1.00  0.94           C  
ATOM   2507  O   VAL B 343     126.108 123.694  89.597  1.00  0.94           O  
ATOM   2508  CB  VAL B 343     127.372 121.129  90.849  1.00  0.94           C  
ATOM   2509  CG1 VAL B 343     128.510 120.753  89.871  1.00  0.94           C  
ATOM   2510  CG2 VAL B 343     127.482 120.266  92.111  1.00  0.94           C  
ATOM   2511  N   THR B 344     128.305 124.116  89.633  1.00  0.93           N  
ATOM   2512  CA  THR B 344     128.292 125.091  88.567  1.00  0.93           C  
ATOM   2513  C   THR B 344     128.725 124.480  87.245  1.00  0.93           C  
ATOM   2514  O   THR B 344     129.201 123.354  87.173  1.00  0.93           O  
ATOM   2515  CB  THR B 344     129.108 126.330  88.903  1.00  0.93           C  
ATOM   2516  OG1 THR B 344     130.510 126.095  88.838  1.00  0.93           O  
ATOM   2517  CG2 THR B 344     128.756 126.795  90.331  1.00  0.93           C  
ATOM   2518  N   GLU B 345     128.571 125.235  86.138  1.00  0.88           N  
ATOM   2519  CA  GLU B 345     128.937 124.822  84.789  1.00  0.88           C  
ATOM   2520  C   GLU B 345     130.417 124.524  84.602  1.00  0.88           C  
ATOM   2521  O   GLU B 345     130.824 123.773  83.713  1.00  0.88           O  
ATOM   2522  CB  GLU B 345     128.498 125.910  83.772  1.00  0.88           C  
ATOM   2523  CG  GLU B 345     129.381 127.185  83.752  1.00  0.88           C  
ATOM   2524  CD  GLU B 345     128.925 128.253  82.758  1.00  0.88           C  
ATOM   2525  OE1 GLU B 345     128.683 127.924  81.574  1.00  0.88           O  
ATOM   2526  OE2 GLU B 345     128.853 129.428  83.207  1.00  0.88           O  
ATOM   2527  N   ARG B 346     131.270 125.080  85.482  1.00  0.84           N  
ATOM   2528  CA  ARG B 346     132.703 124.911  85.440  1.00  0.84           C  
ATOM   2529  C   ARG B 346     133.136 123.762  86.337  1.00  0.84           C  
ATOM   2530  O   ARG B 346     134.325 123.556  86.556  1.00  0.84           O  
ATOM   2531  CB  ARG B 346     133.424 126.200  85.917  1.00  0.84           C  
ATOM   2532  CG  ARG B 346     132.921 127.501  85.262  1.00  0.84           C  
ATOM   2533  CD  ARG B 346     133.621 128.778  85.759  1.00  0.84           C  
ATOM   2534  NE  ARG B 346     135.066 128.739  85.379  1.00  0.84           N  
ATOM   2535  CZ  ARG B 346     135.527 128.922  84.134  1.00  0.84           C  
ATOM   2536  NH1 ARG B 346     134.704 129.145  83.110  1.00  0.84           N  
ATOM   2537  NH2 ARG B 346     136.838 128.858  83.914  1.00  0.84           N  
ATOM   2538  N   ASN B 347     132.176 122.994  86.898  1.00  0.88           N  
ATOM   2539  CA  ASN B 347     132.418 121.913  87.838  1.00  0.88           C  
ATOM   2540  C   ASN B 347     132.941 122.411  89.176  1.00  0.88           C  
ATOM   2541  O   ASN B 347     133.632 121.700  89.899  1.00  0.88           O  
ATOM   2542  CB  ASN B 347     133.309 120.767  87.282  1.00  0.88           C  
ATOM   2543  CG  ASN B 347     132.624 120.034  86.143  1.00  0.88           C  
ATOM   2544  OD1 ASN B 347     131.501 119.533  86.261  1.00  0.88           O  
ATOM   2545  ND2 ASN B 347     133.340 119.874  85.005  1.00  0.88           N  
ATOM   2546  N   ASN B 348     132.554 123.641  89.566  1.00  0.87           N  
ATOM   2547  CA  ASN B 348     132.855 124.150  90.881  1.00  0.87           C  
ATOM   2548  C   ASN B 348     131.665 123.849  91.759  1.00  0.87           C  
ATOM   2549  O   ASN B 348     130.520 124.012  91.389  1.00  0.87           O  
ATOM   2550  CB  ASN B 348     133.141 125.663  90.913  1.00  0.87           C  
ATOM   2551  CG  ASN B 348     134.367 125.975  90.082  1.00  0.87           C  
ATOM   2552  OD1 ASN B 348     135.387 125.283  90.170  1.00  0.87           O  
ATOM   2553  ND2 ASN B 348     134.302 127.072  89.296  1.00  0.87           N  
ATOM   2554  N   VAL B 349     131.957 123.370  92.973  1.00  0.93           N  
ATOM   2555  CA  VAL B 349     130.970 123.096  93.975  1.00  0.93           C  
ATOM   2556  C   VAL B 349     131.049 124.229  94.970  1.00  0.93           C  
ATOM   2557  O   VAL B 349     132.096 124.520  95.533  1.00  0.93           O  
ATOM   2558  CB  VAL B 349     131.239 121.796  94.698  1.00  0.93           C  
ATOM   2559  CG1 VAL B 349     130.045 121.439  95.604  1.00  0.93           C  
ATOM   2560  CG2 VAL B 349     131.470 120.690  93.668  1.00  0.93           C  
ATOM   2561  N   PHE B 350     129.923 124.915  95.202  1.00  0.93           N  
ATOM   2562  CA  PHE B 350     129.836 125.948  96.201  1.00  0.93           C  
ATOM   2563  C   PHE B 350     128.904 125.452  97.275  1.00  0.93           C  
ATOM   2564  O   PHE B 350     127.960 124.716  97.012  1.00  0.93           O  
ATOM   2565  CB  PHE B 350     129.272 127.277  95.656  1.00  0.93           C  
ATOM   2566  CG  PHE B 350     130.253 127.959  94.753  1.00  0.93           C  
ATOM   2567  CD1 PHE B 350     130.392 127.562  93.419  1.00  0.93           C  
ATOM   2568  CD2 PHE B 350     131.041 129.019  95.220  1.00  0.93           C  
ATOM   2569  CE1 PHE B 350     131.307 128.198  92.576  1.00  0.93           C  
ATOM   2570  CE2 PHE B 350     131.974 129.642  94.388  1.00  0.93           C  
ATOM   2571  CZ  PHE B 350     132.111 129.228  93.063  1.00  0.93           C  
ATOM   2572  N   ALA B 351     129.165 125.867  98.521  1.00  0.95           N  
ATOM   2573  CA  ALA B 351     128.339 125.540  99.646  1.00  0.95           C  
ATOM   2574  C   ALA B 351     128.182 126.761 100.522  1.00  0.95           C  
ATOM   2575  O   ALA B 351     129.067 127.605 100.620  1.00  0.95           O  
ATOM   2576  CB  ALA B 351     128.981 124.408 100.453  1.00  0.95           C  
ATOM   2577  N   TRP B 352     127.001 126.886 101.150  1.00  0.93           N  
ATOM   2578  CA  TRP B 352     126.692 127.997 102.008  1.00  0.93           C  
ATOM   2579  C   TRP B 352     125.604 127.595 102.980  1.00  0.93           C  
ATOM   2580  O   TRP B 352     125.012 126.528 102.880  1.00  0.93           O  
ATOM   2581  CB  TRP B 352     126.264 129.240 101.190  1.00  0.93           C  
ATOM   2582  CG  TRP B 352     124.991 129.099 100.376  1.00  0.93           C  
ATOM   2583  CD1 TRP B 352     123.724 129.332 100.803  1.00  0.93           C  
ATOM   2584  CD2 TRP B 352     124.883 128.666  99.014  1.00  0.93           C  
ATOM   2585  NE1 TRP B 352     122.823 129.087  99.798  1.00  0.93           N  
ATOM   2586  CE2 TRP B 352     123.511 128.691  98.682  1.00  0.93           C  
ATOM   2587  CE3 TRP B 352     125.832 128.261  98.090  1.00  0.93           C  
ATOM   2588  CZ2 TRP B 352     123.081 128.320  97.419  1.00  0.93           C  
ATOM   2589  CZ3 TRP B 352     125.401 127.910  96.811  1.00  0.93           C  
ATOM   2590  CH2 TRP B 352     124.045 127.927  96.485  1.00  0.93           C  
ATOM   2591  N   GLY B 353     125.338 128.467 103.966  1.00  0.97           N  
ATOM   2592  CA  GLY B 353     124.421 128.228 105.056  1.00  0.97           C  
ATOM   2593  C   GLY B 353     125.170 127.827 106.272  1.00  0.97           C  
ATOM   2594  O   GLY B 353     126.329 128.171 106.466  1.00  0.97           O  
ATOM   2595  N   ARG B 354     124.483 127.076 107.142  1.00  0.86           N  
ATOM   2596  CA  ARG B 354     125.064 126.551 108.350  1.00  0.86           C  
ATOM   2597  C   ARG B 354     126.193 125.590 108.099  1.00  0.86           C  
ATOM   2598  O   ARG B 354     126.097 124.685 107.277  1.00  0.86           O  
ATOM   2599  CB  ARG B 354     124.000 125.822 109.191  1.00  0.86           C  
ATOM   2600  CG  ARG B 354     124.480 125.242 110.536  1.00  0.86           C  
ATOM   2601  CD  ARG B 354     123.416 124.312 111.106  1.00  0.86           C  
ATOM   2602  NE  ARG B 354     123.665 123.964 112.546  1.00  0.86           N  
ATOM   2603  CZ  ARG B 354     123.571 124.831 113.564  1.00  0.86           C  
ATOM   2604  NH1 ARG B 354     123.238 126.096 113.353  1.00  0.86           N  
ATOM   2605  NH2 ARG B 354     123.876 124.462 114.807  1.00  0.86           N  
ATOM   2606  N   GLY B 355     127.263 125.736 108.895  1.00  0.91           N  
ATOM   2607  CA  GLY B 355     128.451 124.933 108.726  1.00  0.91           C  
ATOM   2608  C   GLY B 355     129.061 124.521 110.017  1.00  0.91           C  
ATOM   2609  O   GLY B 355     130.208 124.116 110.046  1.00  0.91           O  
ATOM   2610  N   THR B 356     128.291 124.543 111.114  1.00  0.81           N  
ATOM   2611  CA  THR B 356     128.734 124.181 112.460  1.00  0.81           C  
ATOM   2612  C   THR B 356     129.287 122.773 112.636  1.00  0.81           C  
ATOM   2613  O   THR B 356     130.116 122.542 113.516  1.00  0.81           O  
ATOM   2614  CB  THR B 356     127.665 124.394 113.525  1.00  0.81           C  
ATOM   2615  OG1 THR B 356     126.482 123.624 113.342  1.00  0.81           O  
ATOM   2616  CG2 THR B 356     127.211 125.856 113.532  1.00  0.81           C  
ATOM   2617  N   ASN B 357     128.834 121.811 111.807  1.00  0.81           N  
ATOM   2618  CA  ASN B 357     129.318 120.443 111.764  1.00  0.81           C  
ATOM   2619  C   ASN B 357     130.198 120.232 110.538  1.00  0.81           C  
ATOM   2620  O   ASN B 357     130.488 119.107 110.134  1.00  0.81           O  
ATOM   2621  CB  ASN B 357     128.137 119.452 111.685  1.00  0.81           C  
ATOM   2622  CG  ASN B 357     127.381 119.482 113.004  1.00  0.81           C  
ATOM   2623  OD1 ASN B 357     127.915 119.182 114.060  1.00  0.81           O  
ATOM   2624  ND2 ASN B 357     126.071 119.831 112.992  1.00  0.81           N  
ATOM   2625  N   GLY B 358     130.622 121.312 109.852  1.00  0.82           N  
ATOM   2626  CA  GLY B 358     131.502 121.196 108.698  1.00  0.82           C  
ATOM   2627  C   GLY B 358     130.872 120.650 107.433  1.00  0.82           C  
ATOM   2628  O   GLY B 358     131.559 120.293 106.482  1.00  0.82           O  
ATOM   2629  N   GLN B 359     129.525 120.607 107.355  1.00  0.85           N  
ATOM   2630  CA  GLN B 359     128.757 120.069 106.236  1.00  0.85           C  
ATOM   2631  C   GLN B 359     128.812 120.879 104.965  1.00  0.85           C  
ATOM   2632  O   GLN B 359     128.354 120.469 103.904  1.00  0.85           O  
ATOM   2633  CB  GLN B 359     127.271 119.908 106.593  1.00  0.85           C  
ATOM   2634  CG  GLN B 359     126.508 121.226 106.851  1.00  0.85           C  
ATOM   2635  CD  GLN B 359     126.366 121.595 108.328  1.00  0.85           C  
ATOM   2636  OE1 GLN B 359     127.295 121.578 109.123  1.00  0.85           O  
ATOM   2637  NE2 GLN B 359     125.118 121.981 108.697  1.00  0.85           N  
ATOM   2638  N   LEU B 360     129.415 122.068 105.058  1.00  0.92           N  
ATOM   2639  CA  LEU B 360     129.749 122.861 103.908  1.00  0.92           C  
ATOM   2640  C   LEU B 360     130.964 122.335 103.181  1.00  0.92           C  
ATOM   2641  O   LEU B 360     131.168 122.668 102.021  1.00  0.92           O  
ATOM   2642  CB  LEU B 360     130.008 124.319 104.315  1.00  0.92           C  
ATOM   2643  CG  LEU B 360     128.839 124.986 105.051  1.00  0.92           C  
ATOM   2644  CD1 LEU B 360     129.179 126.453 105.307  1.00  0.92           C  
ATOM   2645  CD2 LEU B 360     127.514 124.878 104.293  1.00  0.92           C  
ATOM   2646  N   GLY B 361     131.814 121.494 103.807  1.00  0.92           N  
ATOM   2647  CA  GLY B 361     132.925 120.873 103.089  1.00  0.92           C  
ATOM   2648  C   GLY B 361     134.113 121.751 102.883  1.00  0.92           C  
ATOM   2649  O   GLY B 361     135.053 121.406 102.178  1.00  0.92           O  
ATOM   2650  N   ILE B 362     134.110 122.936 103.493  1.00  0.82           N  
ATOM   2651  CA  ILE B 362     135.178 123.902 103.319  1.00  0.82           C  
ATOM   2652  C   ILE B 362     136.397 123.514 104.128  1.00  0.82           C  
ATOM   2653  O   ILE B 362     137.534 123.832 103.791  1.00  0.82           O  
ATOM   2654  CB  ILE B 362     134.669 125.301 103.635  1.00  0.82           C  
ATOM   2655  CG1 ILE B 362     133.424 125.551 102.751  1.00  0.82           C  
ATOM   2656  CG2 ILE B 362     135.784 126.341 103.389  1.00  0.82           C  
ATOM   2657  CD1 ILE B 362     132.881 126.971 102.822  1.00  0.82           C  
ATOM   2658  N   GLY B 363     136.198 122.734 105.204  1.00  0.78           N  
ATOM   2659  CA  GLY B 363     137.267 122.449 106.138  1.00  0.78           C  
ATOM   2660  C   GLY B 363     137.187 123.257 107.406  1.00  0.78           C  
ATOM   2661  O   GLY B 363     138.038 123.103 108.272  1.00  0.78           O  
ATOM   2662  N   GLU B 364     136.155 124.100 107.569  1.00  0.68           N  
ATOM   2663  CA  GLU B 364     135.918 124.933 108.735  1.00  0.68           C  
ATOM   2664  C   GLU B 364     134.568 124.586 109.353  1.00  0.68           C  
ATOM   2665  O   GLU B 364     133.786 123.821 108.792  1.00  0.68           O  
ATOM   2666  CB  GLU B 364     135.859 126.437 108.346  1.00  0.68           C  
ATOM   2667  CG  GLU B 364     137.192 127.055 107.857  1.00  0.68           C  
ATOM   2668  CD  GLU B 364     137.034 128.035 106.682  1.00  0.68           C  
ATOM   2669  OE1 GLU B 364     135.901 128.534 106.422  1.00  0.68           O  
ATOM   2670  OE2 GLU B 364     138.074 128.329 106.045  1.00  0.68           O  
ATOM   2671  N   SER B 365     134.269 125.202 110.523  1.00  0.69           N  
ATOM   2672  CA  SER B 365     133.009 125.051 111.241  1.00  0.69           C  
ATOM   2673  C   SER B 365     132.403 126.385 111.581  1.00  0.69           C  
ATOM   2674  O   SER B 365     131.981 126.678 112.698  1.00  0.69           O  
ATOM   2675  CB  SER B 365     133.116 124.241 112.539  1.00  0.69           C  
ATOM   2676  OG  SER B 365     132.914 122.858 112.266  1.00  0.69           O  
ATOM   2677  N   VAL B 366     132.349 127.261 110.580  1.00  0.86           N  
ATOM   2678  CA  VAL B 366     131.754 128.564 110.727  1.00  0.86           C  
ATOM   2679  C   VAL B 366     130.657 128.686 109.686  1.00  0.86           C  
ATOM   2680  O   VAL B 366     130.707 128.061 108.629  1.00  0.86           O  
ATOM   2681  CB  VAL B 366     132.822 129.652 110.636  1.00  0.86           C  
ATOM   2682  CG1 VAL B 366     133.366 129.786 109.206  1.00  0.86           C  
ATOM   2683  CG2 VAL B 366     132.297 130.993 111.176  1.00  0.86           C  
ATOM   2684  N   ASP B 367     129.619 129.488 109.984  1.00  0.95           N  
ATOM   2685  CA  ASP B 367     128.474 129.694 109.124  1.00  0.95           C  
ATOM   2686  C   ASP B 367     128.819 130.696 108.013  1.00  0.95           C  
ATOM   2687  O   ASP B 367     129.523 131.677 108.231  1.00  0.95           O  
ATOM   2688  CB  ASP B 367     127.280 130.166 109.997  1.00  0.95           C  
ATOM   2689  CG  ASP B 367     126.795 129.066 110.946  1.00  0.95           C  
ATOM   2690  OD1 ASP B 367     126.133 129.408 111.964  1.00  0.95           O  
ATOM   2691  OD2 ASP B 367     127.027 127.863 110.648  1.00  0.95           O  
ATOM   2692  N   ARG B 368     128.376 130.425 106.756  1.00  0.90           N  
ATOM   2693  CA  ARG B 368     128.673 131.272 105.604  1.00  0.90           C  
ATOM   2694  C   ARG B 368     127.374 131.659 104.936  1.00  0.90           C  
ATOM   2695  O   ARG B 368     126.557 130.811 104.604  1.00  0.90           O  
ATOM   2696  CB  ARG B 368     129.574 130.608 104.517  1.00  0.90           C  
ATOM   2697  CG  ARG B 368     130.683 129.686 105.058  1.00  0.90           C  
ATOM   2698  CD  ARG B 368     131.693 130.300 106.019  1.00  0.90           C  
ATOM   2699  NE  ARG B 368     132.747 131.004 105.235  1.00  0.90           N  
ATOM   2700  CZ  ARG B 368     133.569 131.902 105.794  1.00  0.90           C  
ATOM   2701  NH1 ARG B 368     133.403 132.368 107.019  1.00  0.90           N  
ATOM   2702  NH2 ARG B 368     134.664 132.281 105.115  1.00  0.90           N  
ATOM   2703  N   ASN B 369     127.149 132.958 104.679  1.00  0.95           N  
ATOM   2704  CA  ASN B 369     125.870 133.442 104.204  1.00  0.95           C  
ATOM   2705  C   ASN B 369     125.819 133.717 102.708  1.00  0.95           C  
ATOM   2706  O   ASN B 369     124.884 134.342 102.207  1.00  0.95           O  
ATOM   2707  CB  ASN B 369     125.428 134.678 105.028  1.00  0.95           C  
ATOM   2708  CG  ASN B 369     126.416 135.830 104.928  1.00  0.95           C  
ATOM   2709  OD1 ASN B 369     127.467 135.741 104.292  1.00  0.95           O  
ATOM   2710  ND2 ASN B 369     126.079 136.965 105.577  1.00  0.95           N  
ATOM   2711  N   PHE B 370     126.825 133.237 101.958  1.00  0.96           N  
ATOM   2712  CA  PHE B 370     126.923 133.430 100.534  1.00  0.96           C  
ATOM   2713  C   PHE B 370     127.724 132.262  99.981  1.00  0.96           C  
ATOM   2714  O   PHE B 370     128.381 131.589 100.778  1.00  0.96           O  
ATOM   2715  CB  PHE B 370     127.536 134.817 100.173  1.00  0.96           C  
ATOM   2716  CG  PHE B 370     129.031 134.908 100.369  1.00  0.96           C  
ATOM   2717  CD1 PHE B 370     129.584 135.093 101.643  1.00  0.96           C  
ATOM   2718  CD2 PHE B 370     129.903 134.804  99.274  1.00  0.96           C  
ATOM   2719  CE1 PHE B 370     130.967 135.221 101.814  1.00  0.96           C  
ATOM   2720  CE2 PHE B 370     131.287 134.921  99.442  1.00  0.96           C  
ATOM   2721  CZ  PHE B 370     131.820 135.156 100.710  1.00  0.96           C  
ATOM   2722  N   PRO B 371     127.692 131.946  98.690  1.00  0.97           N  
ATOM   2723  CA  PRO B 371     128.397 130.809  98.115  1.00  0.97           C  
ATOM   2724  C   PRO B 371     129.889 130.770  98.362  1.00  0.97           C  
ATOM   2725  O   PRO B 371     130.615 131.671  97.953  1.00  0.97           O  
ATOM   2726  CB  PRO B 371     128.080 130.881  96.613  1.00  0.97           C  
ATOM   2727  CG  PRO B 371     126.781 131.673  96.533  1.00  0.97           C  
ATOM   2728  CD  PRO B 371     126.911 132.658  97.684  1.00  0.97           C  
ATOM   2729  N   LYS B 372     130.389 129.684  98.972  1.00  0.90           N  
ATOM   2730  CA  LYS B 372     131.795 129.514  99.199  1.00  0.90           C  
ATOM   2731  C   LYS B 372     132.244 128.240  98.553  1.00  0.90           C  
ATOM   2732  O   LYS B 372     131.605 127.204  98.669  1.00  0.90           O  
ATOM   2733  CB  LYS B 372     132.052 129.388 100.700  1.00  0.90           C  
ATOM   2734  CG  LYS B 372     131.800 130.666 101.497  1.00  0.90           C  
ATOM   2735  CD  LYS B 372     132.719 131.833 101.126  1.00  0.90           C  
ATOM   2736  CE  LYS B 372     134.193 131.569 101.422  1.00  0.90           C  
ATOM   2737  NZ  LYS B 372     135.007 132.753 101.073  1.00  0.90           N  
ATOM   2738  N   ILE B 373     133.348 128.312  97.799  1.00  0.91           N  
ATOM   2739  CA  ILE B 373     133.867 127.188  97.062  1.00  0.91           C  
ATOM   2740  C   ILE B 373     134.334 126.041  97.954  1.00  0.91           C  
ATOM   2741  O   ILE B 373     134.919 126.245  99.010  1.00  0.91           O  
ATOM   2742  CB  ILE B 373     134.926 127.696  96.091  1.00  0.91           C  
ATOM   2743  CG1 ILE B 373     135.221 126.673  94.985  1.00  0.91           C  
ATOM   2744  CG2 ILE B 373     136.193 128.165  96.831  1.00  0.91           C  
ATOM   2745  CD1 ILE B 373     136.057 127.233  93.829  1.00  0.91           C  
ATOM   2746  N   ILE B 374     134.036 124.788  97.552  1.00  0.87           N  
ATOM   2747  CA  ILE B 374     134.600 123.602  98.160  1.00  0.87           C  
ATOM   2748  C   ILE B 374     135.818 123.193  97.348  1.00  0.87           C  
ATOM   2749  O   ILE B 374     135.732 122.460  96.373  1.00  0.87           O  
ATOM   2750  CB  ILE B 374     133.615 122.440  98.196  1.00  0.87           C  
ATOM   2751  CG1 ILE B 374     132.349 122.826  98.992  1.00  0.87           C  
ATOM   2752  CG2 ILE B 374     134.311 121.193  98.790  1.00  0.87           C  
ATOM   2753  CD1 ILE B 374     131.317 121.698  99.089  1.00  0.87           C  
ATOM   2754  N   GLU B 375     137.014 123.629  97.777  1.00  0.81           N  
ATOM   2755  CA  GLU B 375     138.264 123.442  97.060  1.00  0.81           C  
ATOM   2756  C   GLU B 375     138.699 122.012  96.818  1.00  0.81           C  
ATOM   2757  O   GLU B 375     139.364 121.668  95.845  1.00  0.81           O  
ATOM   2758  CB  GLU B 375     139.378 124.186  97.832  1.00  0.81           C  
ATOM   2759  CG  GLU B 375     139.183 125.721  97.893  1.00  0.81           C  
ATOM   2760  CD  GLU B 375     139.383 126.359  96.523  1.00  0.81           C  
ATOM   2761  OE1 GLU B 375     139.614 125.590  95.565  1.00  0.81           O  
ATOM   2762  OE2 GLU B 375     139.318 127.612  96.428  1.00  0.81           O  
ATOM   2763  N   ALA B 376     138.279 121.096  97.698  1.00  0.82           N  
ATOM   2764  CA  ALA B 376     138.537 119.683  97.556  1.00  0.82           C  
ATOM   2765  C   ALA B 376     137.739 119.014  96.427  1.00  0.82           C  
ATOM   2766  O   ALA B 376     138.031 117.876  96.054  1.00  0.82           O  
ATOM   2767  CB  ALA B 376     138.241 119.002  98.904  1.00  0.82           C  
ATOM   2768  N   LEU B 377     136.716 119.699  95.865  1.00  0.84           N  
ATOM   2769  CA  LEU B 377     135.875 119.168  94.805  1.00  0.84           C  
ATOM   2770  C   LEU B 377     135.815 120.069  93.594  1.00  0.84           C  
ATOM   2771  O   LEU B 377     135.564 119.618  92.478  1.00  0.84           O  
ATOM   2772  CB  LEU B 377     134.419 119.019  95.297  1.00  0.84           C  
ATOM   2773  CG  LEU B 377     134.266 118.056  96.479  1.00  0.84           C  
ATOM   2774  CD1 LEU B 377     132.830 118.086  97.012  1.00  0.84           C  
ATOM   2775  CD2 LEU B 377     134.690 116.628  96.111  1.00  0.84           C  
ATOM   2776  N   SER B 378     136.040 121.374  93.779  1.00  0.86           N  
ATOM   2777  CA  SER B 378     136.059 122.325  92.691  1.00  0.86           C  
ATOM   2778  C   SER B 378     137.360 122.315  91.934  1.00  0.86           C  
ATOM   2779  O   SER B 378     138.430 122.081  92.477  1.00  0.86           O  
ATOM   2780  CB  SER B 378     135.848 123.759  93.181  1.00  0.86           C  
ATOM   2781  OG  SER B 378     134.589 123.859  93.851  1.00  0.86           O  
ATOM   2782  N   VAL B 379     137.280 122.563  90.615  1.00  0.83           N  
ATOM   2783  CA  VAL B 379     138.453 122.680  89.770  1.00  0.83           C  
ATOM   2784  C   VAL B 379     139.278 123.936  89.992  1.00  0.83           C  
ATOM   2785  O   VAL B 379     140.504 123.901  89.913  1.00  0.83           O  
ATOM   2786  CB  VAL B 379     138.115 122.570  88.289  1.00  0.83           C  
ATOM   2787  CG1 VAL B 379     137.409 121.231  88.022  1.00  0.83           C  
ATOM   2788  CG2 VAL B 379     137.242 123.735  87.785  1.00  0.83           C  
ATOM   2789  N   ASP B 380     138.603 125.075  90.244  1.00  0.79           N  
ATOM   2790  CA  ASP B 380     139.205 126.359  90.508  1.00  0.79           C  
ATOM   2791  C   ASP B 380     139.726 126.368  91.938  1.00  0.79           C  
ATOM   2792  O   ASP B 380     138.984 126.038  92.853  1.00  0.79           O  
ATOM   2793  CB  ASP B 380     138.170 127.511  90.313  1.00  0.79           C  
ATOM   2794  CG  ASP B 380     137.706 127.704  88.870  1.00  0.79           C  
ATOM   2795  OD1 ASP B 380     138.448 127.351  87.921  1.00  0.79           O  
ATOM   2796  OD2 ASP B 380     136.589 128.262  88.677  1.00  0.79           O  
ATOM   2797  N   GLY B 381     141.008 126.762  92.118  1.00  0.66           N  
ATOM   2798  CA  GLY B 381     141.725 126.744  93.391  1.00  0.66           C  
ATOM   2799  C   GLY B 381     142.740 125.630  93.493  1.00  0.66           C  
ATOM   2800  O   GLY B 381     142.832 124.751  92.652  1.00  0.66           O  
ATOM   2801  N   ALA B 382     143.621 125.698  94.523  1.00  0.46           N  
ATOM   2802  CA  ALA B 382     144.724 124.766  94.708  1.00  0.46           C  
ATOM   2803  C   ALA B 382     144.338 123.309  95.006  1.00  0.46           C  
ATOM   2804  O   ALA B 382     143.616 123.002  95.941  1.00  0.46           O  
ATOM   2805  CB  ALA B 382     145.646 125.264  95.839  1.00  0.46           C  
ATOM   2806  N   SER B 383     144.901 122.366  94.215  1.00  0.47           N  
ATOM   2807  CA  SER B 383     144.584 120.950  94.282  1.00  0.47           C  
ATOM   2808  C   SER B 383     145.471 120.270  93.268  1.00  0.47           C  
ATOM   2809  O   SER B 383     146.280 120.907  92.605  1.00  0.47           O  
ATOM   2810  CB  SER B 383     143.087 120.543  94.074  1.00  0.47           C  
ATOM   2811  OG  SER B 383     142.576 120.679  92.737  1.00  0.47           O  
ATOM   2812  N   GLY B 384     145.387 118.924  93.177  1.00  0.30           N  
ATOM   2813  CA  GLY B 384     146.134 118.109  92.216  1.00  0.30           C  
ATOM   2814  C   GLY B 384     147.534 117.773  92.646  1.00  0.30           C  
ATOM   2815  O   GLY B 384     148.232 117.013  91.985  1.00  0.30           O  
ATOM   2816  N   GLN B 385     147.932 118.332  93.798  1.00  0.24           N  
ATOM   2817  CA  GLN B 385     149.198 118.136  94.464  1.00  0.24           C  
ATOM   2818  C   GLN B 385     148.915 117.892  95.939  1.00  0.24           C  
ATOM   2819  O   GLN B 385     148.992 116.769  96.425  1.00  0.24           O  
ATOM   2820  CB  GLN B 385     150.110 119.384  94.287  1.00  0.24           C  
ATOM   2821  CG  GLN B 385     150.483 119.729  92.825  1.00  0.24           C  
ATOM   2822  CD  GLN B 385     151.317 118.616  92.199  1.00  0.24           C  
ATOM   2823  OE1 GLN B 385     152.303 118.157  92.777  1.00  0.24           O  
ATOM   2824  NE2 GLN B 385     150.932 118.170  90.982  1.00  0.24           N  
ATOM   2825  N   HIS B 386     148.525 118.950  96.673  1.00  0.24           N  
ATOM   2826  CA  HIS B 386     148.207 118.894  98.086  1.00  0.24           C  
ATOM   2827  C   HIS B 386     146.964 119.737  98.289  1.00  0.24           C  
ATOM   2828  O   HIS B 386     146.527 120.435  97.376  1.00  0.24           O  
ATOM   2829  CB  HIS B 386     149.344 119.450  98.973  1.00  0.24           C  
ATOM   2830  CG  HIS B 386     150.612 118.675  98.855  1.00  0.24           C  
ATOM   2831  ND1 HIS B 386     150.703 117.468  99.506  1.00  0.24           N  
ATOM   2832  CD2 HIS B 386     151.758 118.933  98.166  1.00  0.24           C  
ATOM   2833  CE1 HIS B 386     151.897 117.004  99.201  1.00  0.24           C  
ATOM   2834  NE2 HIS B 386     152.578 117.851  98.396  1.00  0.24           N  
ATOM   2835  N   ILE B 387     146.338 119.662  99.481  1.00  0.29           N  
ATOM   2836  CA  ILE B 387     145.200 120.494  99.853  1.00  0.29           C  
ATOM   2837  C   ILE B 387     145.683 121.897 100.236  1.00  0.29           C  
ATOM   2838  O   ILE B 387     146.879 122.134 100.359  1.00  0.29           O  
ATOM   2839  CB  ILE B 387     144.366 119.860 100.981  1.00  0.29           C  
ATOM   2840  CG1 ILE B 387     145.182 119.717 102.279  1.00  0.29           C  
ATOM   2841  CG2 ILE B 387     143.811 118.494 100.529  1.00  0.29           C  
ATOM   2842  CD1 ILE B 387     144.402 119.269 103.522  1.00  0.29           C  
ATOM   2843  N   GLU B 388     144.769 122.883 100.416  1.00  0.27           N  
ATOM   2844  CA  GLU B 388     145.127 124.213 100.905  1.00  0.27           C  
ATOM   2845  C   GLU B 388     145.668 124.233 102.324  1.00  0.27           C  
ATOM   2846  O   GLU B 388     146.652 124.894 102.654  1.00  0.27           O  
ATOM   2847  CB  GLU B 388     143.882 125.116 100.872  1.00  0.27           C  
ATOM   2848  CG  GLU B 388     144.162 126.591 101.250  1.00  0.27           C  
ATOM   2849  CD  GLU B 388     142.903 127.454 101.183  1.00  0.27           C  
ATOM   2850  OE1 GLU B 388     141.818 126.887 100.903  1.00  0.27           O  
ATOM   2851  OE2 GLU B 388     143.030 128.682 101.424  1.00  0.27           O  
ATOM   2852  N   SER B 389     145.008 123.477 103.219  1.00  0.35           N  
ATOM   2853  CA  SER B 389     145.459 123.294 104.589  1.00  0.35           C  
ATOM   2854  C   SER B 389     146.761 122.538 104.673  1.00  0.35           C  
ATOM   2855  O   SER B 389     146.899 121.439 104.166  1.00  0.35           O  
ATOM   2856  CB  SER B 389     144.407 122.546 105.443  1.00  0.35           C  
ATOM   2857  OG  SER B 389     144.794 122.369 106.810  1.00  0.35           O  
ATOM   2858  N   SER B 390     147.770 123.066 105.375  1.00  0.27           N  
ATOM   2859  CA  SER B 390     149.055 122.401 105.443  1.00  0.27           C  
ATOM   2860  C   SER B 390     149.121 121.450 106.618  1.00  0.27           C  
ATOM   2861  O   SER B 390     150.208 121.016 106.983  1.00  0.27           O  
ATOM   2862  CB  SER B 390     150.222 123.416 105.506  1.00  0.27           C  
ATOM   2863  OG  SER B 390     150.102 124.323 106.613  1.00  0.27           O  
ATOM   2864  N   ASN B 391     147.956 121.122 107.236  1.00  0.27           N  
ATOM   2865  CA  ASN B 391     147.758 120.199 108.351  1.00  0.27           C  
ATOM   2866  C   ASN B 391     148.685 118.987 108.338  1.00  0.27           C  
ATOM   2867  O   ASN B 391     148.592 118.120 107.495  1.00  0.27           O  
ATOM   2868  CB  ASN B 391     146.268 119.759 108.424  1.00  0.27           C  
ATOM   2869  CG  ASN B 391     145.877 119.006 109.695  1.00  0.27           C  
ATOM   2870  OD1 ASN B 391     145.700 117.793 109.689  1.00  0.27           O  
ATOM   2871  ND2 ASN B 391     145.676 119.745 110.809  1.00  0.27           N  
ATOM   2872  N   ILE B 392     149.604 118.962 109.332  1.00  0.30           N  
ATOM   2873  CA  ILE B 392     150.673 117.985 109.376  1.00  0.30           C  
ATOM   2874  C   ILE B 392     150.216 116.911 110.338  1.00  0.30           C  
ATOM   2875  O   ILE B 392     149.942 115.773 109.958  1.00  0.30           O  
ATOM   2876  CB  ILE B 392     151.986 118.637 109.837  1.00  0.30           C  
ATOM   2877  CG1 ILE B 392     152.474 119.715 108.836  1.00  0.30           C  
ATOM   2878  CG2 ILE B 392     153.051 117.545 110.053  1.00  0.30           C  
ATOM   2879  CD1 ILE B 392     153.698 120.514 109.304  1.00  0.30           C  
ATOM   2880  N   ASP B 393     150.078 117.301 111.613  1.00  0.29           N  
ATOM   2881  CA  ASP B 393     149.604 116.493 112.705  1.00  0.29           C  
ATOM   2882  C   ASP B 393     148.096 116.668 112.872  1.00  0.29           C  
ATOM   2883  O   ASP B 393     147.561 117.709 112.505  1.00  0.29           O  
ATOM   2884  CB  ASP B 393     150.292 116.975 114.002  1.00  0.29           C  
ATOM   2885  CG  ASP B 393     151.792 116.736 113.958  1.00  0.29           C  
ATOM   2886  OD1 ASP B 393     152.208 115.690 113.404  1.00  0.29           O  
ATOM   2887  OD2 ASP B 393     152.523 117.604 114.496  1.00  0.29           O  
ATOM   2888  N   PRO B 394     147.375 115.696 113.460  1.00  0.26           N  
ATOM   2889  CA  PRO B 394     145.936 115.811 113.650  1.00  0.26           C  
ATOM   2890  C   PRO B 394     145.584 116.912 114.627  1.00  0.26           C  
ATOM   2891  O   PRO B 394     144.694 117.712 114.378  1.00  0.26           O  
ATOM   2892  CB  PRO B 394     145.510 114.421 114.150  1.00  0.26           C  
ATOM   2893  CG  PRO B 394     146.756 113.833 114.820  1.00  0.26           C  
ATOM   2894  CD  PRO B 394     147.920 114.476 114.063  1.00  0.26           C  
ATOM   2895  N   SER B 395     146.341 116.984 115.729  1.00  0.38           N  
ATOM   2896  CA  SER B 395     146.142 117.944 116.790  1.00  0.38           C  
ATOM   2897  C   SER B 395     147.143 119.050 116.624  1.00  0.38           C  
ATOM   2898  O   SER B 395     147.973 119.314 117.485  1.00  0.38           O  
ATOM   2899  CB  SER B 395     146.306 117.346 118.204  1.00  0.38           C  
ATOM   2900  OG  SER B 395     145.334 116.323 118.428  1.00  0.38           O  
ATOM   2901  N   SER B 396     147.061 119.760 115.485  1.00  0.41           N  
ATOM   2902  CA  SER B 396     147.953 120.863 115.160  1.00  0.41           C  
ATOM   2903  C   SER B 396     147.652 122.121 115.957  1.00  0.41           C  
ATOM   2904  O   SER B 396     148.418 123.079 115.974  1.00  0.41           O  
ATOM   2905  CB  SER B 396     147.871 121.233 113.654  1.00  0.41           C  
ATOM   2906  OG  SER B 396     146.592 121.771 113.292  1.00  0.41           O  
ATOM   2907  N   GLY B 397     146.471 122.123 116.606  1.00  0.46           N  
ATOM   2908  CA  GLY B 397     145.908 123.204 117.403  1.00  0.46           C  
ATOM   2909  C   GLY B 397     144.909 123.999 116.620  1.00  0.46           C  
ATOM   2910  O   GLY B 397     144.176 124.822 117.159  1.00  0.46           O  
ATOM   2911  N   LYS B 398     144.816 123.727 115.309  1.00  0.34           N  
ATOM   2912  CA  LYS B 398     143.835 124.332 114.443  1.00  0.34           C  
ATOM   2913  C   LYS B 398     142.605 123.459 114.408  1.00  0.34           C  
ATOM   2914  O   LYS B 398     142.499 122.517 113.630  1.00  0.34           O  
ATOM   2915  CB  LYS B 398     144.391 124.538 113.018  1.00  0.34           C  
ATOM   2916  CG  LYS B 398     145.620 125.457 113.001  1.00  0.34           C  
ATOM   2917  CD  LYS B 398     146.211 125.602 111.590  1.00  0.34           C  
ATOM   2918  CE  LYS B 398     147.446 126.508 111.545  1.00  0.34           C  
ATOM   2919  NZ  LYS B 398     147.986 126.595 110.168  1.00  0.34           N  
ATOM   2920  N   SER B 399     141.644 123.766 115.300  1.00  0.31           N  
ATOM   2921  CA  SER B 399     140.348 123.113 115.313  1.00  0.31           C  
ATOM   2922  C   SER B 399     139.535 123.461 114.081  1.00  0.31           C  
ATOM   2923  O   SER B 399     139.166 124.609 113.860  1.00  0.31           O  
ATOM   2924  CB  SER B 399     139.525 123.440 116.582  1.00  0.31           C  
ATOM   2925  OG  SER B 399     138.305 122.699 116.629  1.00  0.31           O  
ATOM   2926  N   TRP B 400     139.263 122.442 113.243  1.00  0.29           N  
ATOM   2927  CA  TRP B 400     138.439 122.592 112.062  1.00  0.29           C  
ATOM   2928  C   TRP B 400     136.978 122.366 112.393  1.00  0.29           C  
ATOM   2929  O   TRP B 400     136.089 123.096 111.941  1.00  0.29           O  
ATOM   2930  CB  TRP B 400     138.917 121.633 110.948  1.00  0.29           C  
ATOM   2931  CG  TRP B 400     140.336 121.895 110.434  1.00  0.29           C  
ATOM   2932  CD1 TRP B 400     141.367 121.000 110.367  1.00  0.29           C  
ATOM   2933  CD2 TRP B 400     140.846 123.141 109.924  1.00  0.29           C  
ATOM   2934  NE1 TRP B 400     142.493 121.599 109.853  1.00  0.29           N  
ATOM   2935  CE2 TRP B 400     142.206 122.917 109.576  1.00  0.29           C  
ATOM   2936  CE3 TRP B 400     140.270 124.393 109.737  1.00  0.29           C  
ATOM   2937  CZ2 TRP B 400     142.974 123.944 109.053  1.00  0.29           C  
ATOM   2938  CZ3 TRP B 400     141.045 125.416 109.185  1.00  0.29           C  
ATOM   2939  CH2 TRP B 400     142.384 125.196 108.847  1.00  0.29           C  
ATOM   2940  N   VAL B 401     136.708 121.348 113.230  1.00  0.30           N  
ATOM   2941  CA  VAL B 401     135.400 120.959 113.689  1.00  0.30           C  
ATOM   2942  C   VAL B 401     135.402 120.696 115.141  1.00  0.30           C  
ATOM   2943  O   VAL B 401     136.452 120.559 115.750  1.00  0.30           O  
ATOM   2944  CB  VAL B 401     134.779 119.739 113.032  1.00  0.30           C  
ATOM   2945  CG1 VAL B 401     134.607 120.021 111.551  1.00  0.30           C  
ATOM   2946  CG2 VAL B 401     135.629 118.473 113.217  1.00  0.30           C  
ATOM   2947  N   SER B 402     134.196 120.629 115.727  1.00  0.30           N  
ATOM   2948  CA  SER B 402     134.028 120.414 117.142  1.00  0.30           C  
ATOM   2949  C   SER B 402     133.265 119.108 117.259  1.00  0.30           C  
ATOM   2950  O   SER B 402     132.345 118.904 116.470  1.00  0.30           O  
ATOM   2951  CB  SER B 402     133.240 121.574 117.773  1.00  0.30           C  
ATOM   2952  OG  SER B 402     133.229 121.517 119.203  1.00  0.30           O  
ATOM   2953  N   PRO B 403     133.639 118.179 118.132  1.00  0.30           N  
ATOM   2954  CA  PRO B 403     132.920 116.941 118.310  1.00  0.30           C  
ATOM   2955  C   PRO B 403     131.655 117.125 119.085  1.00  0.30           C  
ATOM   2956  O   PRO B 403     131.426 118.149 119.727  1.00  0.30           O  
ATOM   2957  CB  PRO B 403     133.911 116.063 119.082  1.00  0.30           C  
ATOM   2958  CG  PRO B 403     134.705 117.046 119.946  1.00  0.30           C  
ATOM   2959  CD  PRO B 403     134.639 118.368 119.177  1.00  0.30           C  
ATOM   2960  N   ALA B 404     130.829 116.081 119.040  1.00  0.33           N  
ATOM   2961  CA  ALA B 404     129.609 116.065 119.743  1.00  0.33           C  
ATOM   2962  C   ALA B 404     129.632 114.863 120.604  1.00  0.33           C  
ATOM   2963  O   ALA B 404     130.270 113.845 120.361  1.00  0.33           O  
ATOM   2964  CB  ALA B 404     128.429 115.924 118.797  1.00  0.33           C  
ATOM   2965  N   GLU B 405     128.908 115.039 121.680  1.00  0.31           N  
ATOM   2966  CA  GLU B 405     128.599 114.058 122.656  1.00  0.31           C  
ATOM   2967  C   GLU B 405     127.541 113.043 122.172  1.00  0.31           C  
ATOM   2968  O   GLU B 405     126.532 113.440 121.604  1.00  0.31           O  
ATOM   2969  CB  GLU B 405     127.997 114.949 123.744  1.00  0.31           C  
ATOM   2970  CG  GLU B 405     128.940 115.671 124.742  1.00  0.31           C  
ATOM   2971  CD  GLU B 405     130.039 114.789 125.316  1.00  0.31           C  
ATOM   2972  OE1 GLU B 405     129.867 113.541 125.307  1.00  0.31           O  
ATOM   2973  OE2 GLU B 405     131.071 115.363 125.740  1.00  0.31           O  
ATOM   2974  N   ARG B 406     127.749 111.708 122.382  1.00  0.61           N  
ATOM   2975  CA  ARG B 406     126.874 110.607 121.926  1.00  0.61           C  
ATOM   2976  C   ARG B 406     125.366 110.749 122.160  1.00  0.61           C  
ATOM   2977  O   ARG B 406     124.614 111.091 121.275  1.00  0.61           O  
ATOM   2978  CB  ARG B 406     127.276 109.248 122.568  1.00  0.61           C  
ATOM   2979  CG  ARG B 406     128.631 108.665 122.140  1.00  0.61           C  
ATOM   2980  CD  ARG B 406     128.930 107.356 122.881  1.00  0.61           C  
ATOM   2981  NE  ARG B 406     130.260 106.878 122.388  1.00  0.61           N  
ATOM   2982  CZ  ARG B 406     130.927 105.832 122.899  1.00  0.61           C  
ATOM   2983  NH1 ARG B 406     132.113 105.499 122.392  1.00  0.61           N  
ATOM   2984  NH2 ARG B 406     130.441 105.115 123.908  1.00  0.61           N  
ATOM   2985  N   TYR B 407     124.897 110.434 123.390  1.00  0.51           N  
ATOM   2986  CA  TYR B 407     123.538 110.677 123.780  1.00  0.51           C  
ATOM   2987  C   TYR B 407     123.559 110.523 125.292  1.00  0.51           C  
ATOM   2988  O   TYR B 407     124.306 109.699 125.808  1.00  0.51           O  
ATOM   2989  CB  TYR B 407     122.565 109.658 123.132  1.00  0.51           C  
ATOM   2990  CG  TYR B 407     121.144 109.991 123.442  1.00  0.51           C  
ATOM   2991  CD1 TYR B 407     120.461 110.936 122.671  1.00  0.51           C  
ATOM   2992  CD2 TYR B 407     120.491 109.392 124.526  1.00  0.51           C  
ATOM   2993  CE1 TYR B 407     119.138 111.275 122.976  1.00  0.51           C  
ATOM   2994  CE2 TYR B 407     119.172 109.743 124.842  1.00  0.51           C  
ATOM   2995  CZ  TYR B 407     118.492 110.679 124.059  1.00  0.51           C  
ATOM   2996  OH  TYR B 407     117.159 111.023 124.347  1.00  0.51           O  
ATOM   2997  N   ALA B 408     122.743 111.322 126.017  1.00  0.39           N  
ATOM   2998  CA  ALA B 408     122.566 111.267 127.463  1.00  0.39           C  
ATOM   2999  C   ALA B 408     123.811 111.407 128.307  1.00  0.39           C  
ATOM   3000  O   ALA B 408     123.932 110.863 129.399  1.00  0.39           O  
ATOM   3001  CB  ALA B 408     121.824 109.999 127.902  1.00  0.39           C  
ATOM   3002  N   VAL B 409     124.750 112.216 127.832  1.00  0.35           N  
ATOM   3003  CA  VAL B 409     125.999 112.416 128.484  1.00  0.35           C  
ATOM   3004  C   VAL B 409     125.891 113.798 129.055  1.00  0.35           C  
ATOM   3005  O   VAL B 409     125.294 114.710 128.500  1.00  0.35           O  
ATOM   3006  CB  VAL B 409     127.156 112.320 127.517  1.00  0.35           C  
ATOM   3007  CG1 VAL B 409     127.370 110.933 126.886  1.00  0.35           C  
ATOM   3008  CG2 VAL B 409     126.829 113.182 126.315  1.00  0.35           C  
ATOM   3009  N   VAL B 410     126.417 113.946 130.269  1.00  0.29           N  
ATOM   3010  CA  VAL B 410     126.336 115.184 130.991  1.00  0.29           C  
ATOM   3011  C   VAL B 410     127.511 116.047 130.545  1.00  0.29           C  
ATOM   3012  O   VAL B 410     128.628 115.547 130.624  1.00  0.29           O  
ATOM   3013  CB  VAL B 410     126.375 114.858 132.470  1.00  0.29           C  
ATOM   3014  CG1 VAL B 410     126.309 116.143 133.304  1.00  0.29           C  
ATOM   3015  CG2 VAL B 410     125.174 113.939 132.784  1.00  0.29           C  
ATOM   3016  N   PRO B 411     127.370 117.272 130.032  1.00  0.40           N  
ATOM   3017  CA  PRO B 411     128.476 118.227 129.913  1.00  0.40           C  
ATOM   3018  C   PRO B 411     129.317 118.378 131.181  1.00  0.40           C  
ATOM   3019  O   PRO B 411     128.733 118.368 132.262  1.00  0.40           O  
ATOM   3020  CB  PRO B 411     127.791 119.554 129.522  1.00  0.40           C  
ATOM   3021  CG  PRO B 411     126.440 119.142 128.934  1.00  0.40           C  
ATOM   3022  CD  PRO B 411     126.084 117.901 129.745  1.00  0.40           C  
ATOM   3023  N   ASP B 412     130.648 118.520 131.043  1.00  0.34           N  
ATOM   3024  CA  ASP B 412     131.573 118.771 132.135  1.00  0.34           C  
ATOM   3025  C   ASP B 412     131.401 120.161 132.850  1.00  0.34           C  
ATOM   3026  O   ASP B 412     130.641 121.036 132.352  1.00  0.34           O  
ATOM   3027  CB  ASP B 412     133.026 118.684 131.580  1.00  0.34           C  
ATOM   3028  CG  ASP B 412     133.504 117.300 131.155  1.00  0.34           C  
ATOM   3029  OD1 ASP B 412     132.842 116.279 131.462  1.00  0.34           O  
ATOM   3030  OD2 ASP B 412     134.598 117.261 130.525  1.00  0.34           O  
ATOM   3031  OXT ASP B 412     132.059 120.356 133.916  1.00  0.34           O  
TER    3032      ASP B 412                                                      
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.