CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 220530003634104217

Job options:

ID        	=	 220530003634104217
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   29-MAY-22 1MOD    1       17:36
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.93
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.87
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-05-20
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2022-05-25
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.96
REMARK   3  SIM     0.59
REMARK   3  SID     88.52
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTED
REMARK   3  ALN A TRG TIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDV
REMARK   3  ALN A TRG NDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEK
REMARK   3  ALN A TRG ERKQEEGES
REMARK   3  ALN A TPL QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTED
REMARK   3  ALN A TPL TIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYL
REMARK   3  ALN A TPL DDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEK
REMARK   3  ALN A TPL ERKQEEGES
REMARK   3  ALN A OFF 18
REMARK 970   RasMol::default
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color structure 
REMARK 970   RasMol::script1::GLS G
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color gray 
REMARK 970   select   15:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   38:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   54:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   75:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   85:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   RasMol::script2::GLS S
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color structure 
REMARK 970   select   15:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   38:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   54:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   75:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   85:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
AUTHOR  GlyCon 1.0 (Beta)
REMARK  This file was generated from the Glycon-programm.
REMARK  Molecular: 
ATOM      1  N   GLN A   1      25.953   9.386  -3.281  1.00  0.39           N  
ATOM      2  CA  GLN A   1      24.508   9.784  -3.418  1.00  0.39           C  
ATOM      3  C   GLN A   1      23.773   8.538  -3.852  1.00  0.39           C  
ATOM      4  O   GLN A   1      24.131   7.961  -4.871  1.00  0.39           O  
ATOM      5  CB  GLN A   1      24.353  10.937  -4.458  1.00  0.39           C  
ATOM      6  CG  GLN A   1      22.979  11.670  -4.504  1.00  0.39           C  
ATOM      7  CD  GLN A   1      23.098  12.964  -5.335  1.00  0.39           C  
ATOM      8  OE1 GLN A   1      24.018  13.131  -6.127  1.00  0.39           O  
ATOM      9  NE2 GLN A   1      22.170  13.925  -5.119  1.00  0.39           N  
ATOM     10  N   ILE A   2      22.799   8.037  -3.064  1.00  0.43           N  
ATOM     11  CA  ILE A   2      21.980   6.876  -3.409  1.00  0.43           C  
ATOM     12  C   ILE A   2      21.286   7.160  -4.733  1.00  0.43           C  
ATOM     13  O   ILE A   2      20.671   8.226  -4.811  1.00  0.43           O  
ATOM     14  CB  ILE A   2      20.978   6.654  -2.275  1.00  0.43           C  
ATOM     15  CG1 ILE A   2      21.735   6.145  -1.027  1.00  0.43           C  
ATOM     16  CG2 ILE A   2      19.835   5.695  -2.657  1.00  0.43           C  
ATOM     17  CD1 ILE A   2      20.962   6.282   0.288  1.00  0.43           C  
ATOM     18  N   PRO A   3      21.396   6.357  -5.804  1.00  0.66           N  
ATOM     19  CA  PRO A   3      20.918   6.750  -7.122  1.00  0.66           C  
ATOM     20  C   PRO A   3      19.433   7.015  -7.071  1.00  0.66           C  
ATOM     21  O   PRO A   3      18.738   6.347  -6.308  1.00  0.66           O  
ATOM     22  CB  PRO A   3      21.318   5.593  -8.060  1.00  0.66           C  
ATOM     23  CG  PRO A   3      21.595   4.404  -7.135  1.00  0.66           C  
ATOM     24  CD  PRO A   3      22.068   5.058  -5.836  1.00  0.66           C  
ATOM     25  N   LEU A   4      18.927   7.984  -7.857  1.00  0.66           N  
ATOM     26  CA  LEU A   4      17.572   8.525  -7.770  1.00  0.66           C  
ATOM     27  C   LEU A   4      16.469   7.457  -7.770  1.00  0.66           C  
ATOM     28  O   LEU A   4      15.386   7.621  -7.223  1.00  0.66           O  
ATOM     29  CB  LEU A   4      17.406   9.503  -8.963  1.00  0.66           C  
ATOM     30  CG  LEU A   4      16.147  10.390  -8.968  1.00  0.66           C  
ATOM     31  CD1 LEU A   4      16.180  11.446  -7.855  1.00  0.66           C  
ATOM     32  CD2 LEU A   4      15.976  11.057 -10.344  1.00  0.66           C  
ATOM     33  N   CYS A   5      16.785   6.298  -8.376  1.00  0.81           N  
ATOM     34  CA  CYS A   5      15.935   5.145  -8.557  1.00  0.81           C  
ATOM     35  C   CYS A   5      16.273   3.942  -7.676  1.00  0.81           C  
ATOM     36  O   CYS A   5      15.726   2.861  -7.873  1.00  0.81           O  
ATOM     37  CB  CYS A   5      16.085   4.704 -10.024  1.00  0.81           C  
ATOM     38  SG  CYS A   5      15.619   6.036 -11.172  1.00  0.81           S  
ATOM     39  N   ALA A   6      17.157   4.068  -6.662  1.00  0.81           N  
ATOM     40  CA  ALA A   6      17.583   2.955  -5.818  1.00  0.81           C  
ATOM     41  C   ALA A   6      16.454   2.254  -5.078  1.00  0.81           C  
ATOM     42  O   ALA A   6      16.402   1.032  -4.991  1.00  0.81           O  
ATOM     43  CB  ALA A   6      18.576   3.443  -4.754  1.00  0.81           C  
ATOM     44  N   ASN A   7      15.482   3.046  -4.585  1.00  0.78           N  
ATOM     45  CA  ASN A   7      14.317   2.576  -3.853  1.00  0.78           C  
ATOM     46  C   ASN A   7      13.321   1.829  -4.738  1.00  0.78           C  
ATOM     47  O   ASN A   7      12.338   1.278  -4.253  1.00  0.78           O  
ATOM     48  CB  ASN A   7      13.579   3.757  -3.165  1.00  0.78           C  
ATOM     49  CG  ASN A   7      14.476   4.449  -2.136  1.00  0.78           C  
ATOM     50  OD1 ASN A   7      15.526   3.966  -1.720  1.00  0.78           O  
ATOM     51  ND2 ASN A   7      14.057   5.663  -1.703  1.00  0.78           N  
ATOM     52  N   LEU A   8      13.547   1.815  -6.068  1.00  0.83           N  
ATOM     53  CA  LEU A   8      12.690   1.137  -7.014  1.00  0.83           C  
ATOM     54  C   LEU A   8      13.297  -0.145  -7.546  1.00  0.83           C  
ATOM     55  O   LEU A   8      12.704  -0.812  -8.390  1.00  0.83           O  
ATOM     56  CB  LEU A   8      12.379   2.043  -8.220  1.00  0.83           C  
ATOM     57  CG  LEU A   8      11.661   3.354  -7.870  1.00  0.83           C  
ATOM     58  CD1 LEU A   8      11.247   4.035  -9.167  1.00  0.83           C  
ATOM     59  CD2 LEU A   8      10.409   3.141  -7.020  1.00  0.83           C  
ATOM     60  N   VAL A   9      14.484  -0.554  -7.063  1.00  0.83           N  
ATOM     61  CA  VAL A   9      15.062  -1.836  -7.430  1.00  0.83           C  
ATOM     62  C   VAL A   9      14.350  -2.939  -6.639  1.00  0.83           C  
ATOM     63  O   VAL A   9      14.350  -2.862  -5.409  1.00  0.83           O  
ATOM     64  CB  VAL A   9      16.566  -1.873  -7.170  1.00  0.83           C  
ATOM     65  CG1 VAL A   9      17.163  -3.250  -7.527  1.00  0.83           C  
ATOM     66  CG2 VAL A   9      17.243  -0.764  -8.001  1.00  0.83           C  
ATOM     67  N   PRO A  10      13.716  -3.965  -7.220  1.00  0.90           N  
ATOM     68  CA  PRO A  10      13.045  -5.001  -6.438  1.00  0.90           C  
ATOM     69  C   PRO A  10      14.018  -5.878  -5.667  1.00  0.90           C  
ATOM     70  O   PRO A  10      15.062  -6.237  -6.211  1.00  0.90           O  
ATOM     71  CB  PRO A  10      12.316  -5.845  -7.496  1.00  0.90           C  
ATOM     72  CG  PRO A  10      12.076  -4.876  -8.653  1.00  0.90           C  
ATOM     73  CD  PRO A  10      13.353  -4.039  -8.639  1.00  0.90           C  
ATOM     74  N   VAL A  11      13.701  -6.256  -4.415  1.00  0.90           N  
ATOM     75  CA  VAL A  11      14.553  -7.098  -3.597  1.00  0.90           C  
ATOM     76  C   VAL A  11      13.752  -8.345  -3.239  1.00  0.90           C  
ATOM     77  O   VAL A  11      12.540  -8.230  -3.037  1.00  0.90           O  
ATOM     78  CB  VAL A  11      15.083  -6.402  -2.342  1.00  0.90           C  
ATOM     79  CG1 VAL A  11      16.044  -5.284  -2.791  1.00  0.90           C  
ATOM     80  CG2 VAL A  11      13.940  -5.849  -1.468  1.00  0.90           C  
ATOM     81  N   PRO A  12      14.308  -9.555  -3.191  1.00  0.94           N  
ATOM     82  CA  PRO A  12      13.592 -10.753  -2.756  1.00  0.94           C  
ATOM     83  C   PRO A  12      12.887 -10.688  -1.403  1.00  0.94           C  
ATOM     84  O   PRO A  12      13.437 -10.157  -0.438  1.00  0.94           O  
ATOM     85  CB  PRO A  12      14.645 -11.868  -2.811  1.00  0.94           C  
ATOM     86  CG  PRO A  12      15.632 -11.388  -3.877  1.00  0.94           C  
ATOM     87  CD  PRO A  12      15.656  -9.875  -3.666  1.00  0.94           C  
ATOM     88  N   ILE A  13      11.671 -11.259  -1.286  1.00  0.94           N  
ATOM     89  CA  ILE A  13      10.906 -11.250  -0.043  1.00  0.94           C  
ATOM     90  C   ILE A  13      11.326 -12.402   0.873  1.00  0.94           C  
ATOM     91  O   ILE A  13      10.991 -13.574   0.678  1.00  0.94           O  
ATOM     92  CB  ILE A  13       9.395 -11.235  -0.295  1.00  0.94           C  
ATOM     93  CG1 ILE A  13       8.987  -9.911  -0.986  1.00  0.94           C  
ATOM     94  CG2 ILE A  13       8.594 -11.426   1.013  1.00  0.94           C  
ATOM     95  CD1 ILE A  13       7.596  -9.945  -1.626  1.00  0.94           C  
ATOM     96  N   THR A  14      12.080 -12.081   1.944  1.00  0.96           N  
ATOM     97  CA  THR A  14      12.531 -13.026   2.954  1.00  0.96           C  
ATOM     98  C   THR A  14      11.464 -13.189   4.013  1.00  0.96           C  
ATOM     99  O   THR A  14      10.409 -12.560   3.978  1.00  0.96           O  
ATOM    100  CB  THR A  14      13.883 -12.679   3.602  1.00  0.96           C  
ATOM    101  OG1 THR A  14      13.816 -11.563   4.470  1.00  0.96           O  
ATOM    102  CG2 THR A  14      14.890 -12.322   2.509  1.00  0.96           C  
ATOM    103  N   ASN A  15      11.676 -14.078   4.999  1.00  0.94           N  
ATOM    104  CA  ASN A  15      10.841 -14.131   6.191  1.00  0.94           C  
ATOM    105  C   ASN A  15      10.912 -12.868   7.028  1.00  0.94           C  
ATOM    106  O   ASN A  15       9.886 -12.400   7.504  1.00  0.94           O  
ATOM    107  CB  ASN A  15      11.186 -15.367   7.044  1.00  0.94           C  
ATOM    108  CG  ASN A  15      12.654 -15.260   7.448  1.00  0.94           C  
ATOM    109  OD1 ASN A  15      13.456 -14.546   6.847  1.00  0.94           O  
ATOM    110  ND2 ASN A  15      13.045 -16.021   8.492  1.00  0.94           N  
ATOM    111  N   ALA A  16      12.112 -12.263   7.158  1.00  0.99           N  
ATOM    112  CA  ALA A  16      12.296 -10.984   7.813  1.00  0.99           C  
ATOM    113  C   ALA A  16      11.514  -9.867   7.113  1.00  0.99           C  
ATOM    114  O   ALA A  16      10.846  -9.070   7.761  1.00  0.99           O  
ATOM    115  CB  ALA A  16      13.798 -10.633   7.887  1.00  0.99           C  
ATOM    116  N   THR A  17      11.512  -9.840   5.758  1.00  0.93           N  
ATOM    117  CA  THR A  17      10.704  -8.925   4.941  1.00  0.93           C  
ATOM    118  C   THR A  17       9.218  -9.054   5.226  1.00  0.93           C  
ATOM    119  O   THR A  17       8.497  -8.068   5.345  1.00  0.93           O  
ATOM    120  CB  THR A  17      10.860  -9.152   3.429  1.00  0.93           C  
ATOM    121  OG1 THR A  17      12.221  -9.211   3.039  1.00  0.93           O  
ATOM    122  CG2 THR A  17      10.221  -8.029   2.599  1.00  0.93           C  
ATOM    123  N   LEU A  18       8.718 -10.299   5.371  1.00  0.94           N  
ATOM    124  CA  LEU A  18       7.355 -10.557   5.811  1.00  0.94           C  
ATOM    125  C   LEU A  18       7.067 -10.086   7.236  1.00  0.94           C  
ATOM    126  O   LEU A  18       6.059  -9.435   7.479  1.00  0.94           O  
ATOM    127  CB  LEU A  18       6.969 -12.048   5.668  1.00  0.94           C  
ATOM    128  CG  LEU A  18       6.918 -12.562   4.215  1.00  0.94           C  
ATOM    129  CD1 LEU A  18       6.685 -14.077   4.189  1.00  0.94           C  
ATOM    130  CD2 LEU A  18       5.851 -11.853   3.369  1.00  0.94           C  
ATOM    131  N   ASP A  19       7.975 -10.343   8.202  1.00  0.96           N  
ATOM    132  CA  ASP A  19       7.865  -9.854   9.569  1.00  0.96           C  
ATOM    133  C   ASP A  19       7.812  -8.330   9.664  1.00  0.96           C  
ATOM    134  O   ASP A  19       7.042  -7.765  10.435  1.00  0.96           O  
ATOM    135  CB  ASP A  19       9.033 -10.388  10.434  1.00  0.96           C  
ATOM    136  CG  ASP A  19       8.846 -11.852  10.695  1.00  0.96           C  
ATOM    137  OD1 ASP A  19       7.746 -12.246  11.174  1.00  0.96           O  
ATOM    138  OD2 ASP A  19       9.777 -12.662  10.432  1.00  0.96           O  
ATOM    139  N   GLN A  20       8.608  -7.632   8.834  1.00  0.92           N  
ATOM    140  CA  GLN A  20       8.602  -6.185   8.703  1.00  0.92           C  
ATOM    141  C   GLN A  20       7.297  -5.555   8.216  1.00  0.92           C  
ATOM    142  O   GLN A  20       6.992  -4.425   8.588  1.00  0.92           O  
ATOM    143  CB  GLN A  20       9.724  -5.708   7.756  1.00  0.92           C  
ATOM    144  CG  GLN A  20      11.149  -5.828   8.329  1.00  0.92           C  
ATOM    145  CD  GLN A  20      12.180  -5.458   7.261  1.00  0.92           C  
ATOM    146  OE1 GLN A  20      11.956  -5.563   6.057  1.00  0.92           O  
ATOM    147  NE2 GLN A  20      13.375  -5.012   7.719  1.00  0.92           N  
ATOM    148  N   ILE A  21       6.516  -6.240   7.350  1.00  0.95           N  
ATOM    149  CA  ILE A  21       5.249  -5.719   6.849  1.00  0.95           C  
ATOM    150  C   ILE A  21       4.049  -6.241   7.635  1.00  0.95           C  
ATOM    151  O   ILE A  21       2.909  -5.876   7.360  1.00  0.95           O  
ATOM    152  CB  ILE A  21       5.029  -6.006   5.360  1.00  0.95           C  
ATOM    153  CG1 ILE A  21       4.938  -7.518   5.053  1.00  0.95           C  
ATOM    154  CG2 ILE A  21       6.152  -5.311   4.563  1.00  0.95           C  
ATOM    155  CD1 ILE A  21       4.520  -7.839   3.616  1.00  0.95           C  
ATOM    156  N   THR A  22       4.250  -7.106   8.648  1.00  0.97           N  
ATOM    157  CA  THR A  22       3.173  -7.607   9.510  1.00  0.97           C  
ATOM    158  C   THR A  22       2.550  -6.512  10.358  1.00  0.97           C  
ATOM    159  O   THR A  22       3.242  -5.772  11.055  1.00  0.97           O  
ATOM    160  CB  THR A  22       3.626  -8.724  10.455  1.00  0.97           C  
ATOM    161  OG1 THR A  22       4.053  -9.857   9.719  1.00  0.97           O  
ATOM    162  CG2 THR A  22       2.503  -9.244  11.370  1.00  0.97           C  
ATOM    163  N   GLY A  23       1.204  -6.390  10.360  1.00  0.98           N  
ATOM    164  CA  GLY A  23       0.520  -5.393  11.180  1.00  0.98           C  
ATOM    165  C   GLY A  23      -0.388  -4.493  10.391  1.00  0.98           C  
ATOM    166  O   GLY A  23      -0.889  -4.862   9.331  1.00  0.98           O  
ATOM    167  N   LYS A  24      -0.672  -3.296  10.939  1.00  0.94           N  
ATOM    168  CA  LYS A  24      -1.634  -2.354  10.398  1.00  0.94           C  
ATOM    169  C   LYS A  24      -0.944  -1.286   9.573  1.00  0.94           C  
ATOM    170  O   LYS A  24       0.038  -0.693  10.012  1.00  0.94           O  
ATOM    171  CB  LYS A  24      -2.435  -1.654  11.531  1.00  0.94           C  
ATOM    172  CG  LYS A  24      -3.581  -0.747  11.037  1.00  0.94           C  
ATOM    173  CD  LYS A  24      -4.425  -0.139  12.176  1.00  0.94           C  
ATOM    174  CE  LYS A  24      -5.649   0.629  11.652  1.00  0.94           C  
ATOM    175  NZ  LYS A  24      -6.586   1.004  12.721  1.00  0.94           N  
ATOM    176  N   TRP A  25      -1.464  -0.996   8.367  1.00  0.91           N  
ATOM    177  CA  TRP A  25      -0.920   0.018   7.495  1.00  0.91           C  
ATOM    178  C   TRP A  25      -2.034   0.909   7.009  1.00  0.91           C  
ATOM    179  O   TRP A  25      -3.195   0.508   6.914  1.00  0.91           O  
ATOM    180  CB  TRP A  25      -0.245  -0.609   6.253  1.00  0.91           C  
ATOM    181  CG  TRP A  25       0.930  -1.490   6.606  1.00  0.91           C  
ATOM    182  CD1 TRP A  25       0.948  -2.813   6.940  1.00  0.91           C  
ATOM    183  CD2 TRP A  25       2.261  -0.996   6.804  1.00  0.91           C  
ATOM    184  NE1 TRP A  25       2.209  -3.173   7.354  1.00  0.91           N  
ATOM    185  CE2 TRP A  25       3.021  -2.066   7.324  1.00  0.91           C  
ATOM    186  CE3 TRP A  25       2.825   0.255   6.604  1.00  0.91           C  
ATOM    187  CZ2 TRP A  25       4.339  -1.874   7.713  1.00  0.91           C  
ATOM    188  CZ3 TRP A  25       4.157   0.444   6.984  1.00  0.91           C  
ATOM    189  CH2 TRP A  25       4.896  -0.591   7.574  1.00  0.91           C  
ATOM    190  N   PHE A  26      -1.691   2.157   6.672  1.00  0.95           N  
ATOM    191  CA  PHE A  26      -2.609   3.141   6.160  1.00  0.95           C  
ATOM    192  C   PHE A  26      -2.156   3.500   4.772  1.00  0.95           C  
ATOM    193  O   PHE A  26      -0.977   3.751   4.521  1.00  0.95           O  
ATOM    194  CB  PHE A  26      -2.604   4.432   7.002  1.00  0.95           C  
ATOM    195  CG  PHE A  26      -3.130   4.169   8.379  1.00  0.95           C  
ATOM    196  CD1 PHE A  26      -4.451   4.496   8.714  1.00  0.95           C  
ATOM    197  CD2 PHE A  26      -2.294   3.624   9.365  1.00  0.95           C  
ATOM    198  CE1 PHE A  26      -4.918   4.308  10.021  1.00  0.95           C  
ATOM    199  CE2 PHE A  26      -2.761   3.425  10.667  1.00  0.95           C  
ATOM    200  CZ  PHE A  26      -4.067   3.787  11.001  1.00  0.95           C  
ATOM    201  N   TYR A  27      -3.095   3.525   3.817  1.00  0.96           N  
ATOM    202  CA  TYR A  27      -2.855   4.013   2.480  1.00  0.96           C  
ATOM    203  C   TYR A  27      -2.834   5.536   2.534  1.00  0.96           C  
ATOM    204  O   TYR A  27      -3.797   6.165   2.973  1.00  0.96           O  
ATOM    205  CB  TYR A  27      -3.966   3.452   1.556  1.00  0.96           C  
ATOM    206  CG  TYR A  27      -3.964   4.022   0.164  1.00  0.96           C  
ATOM    207  CD1 TYR A  27      -5.106   4.696  -0.287  1.00  0.96           C  
ATOM    208  CD2 TYR A  27      -2.836   3.961  -0.669  1.00  0.96           C  
ATOM    209  CE1 TYR A  27      -5.094   5.385  -1.501  1.00  0.96           C  
ATOM    210  CE2 TYR A  27      -2.836   4.616  -1.912  1.00  0.96           C  
ATOM    211  CZ  TYR A  27      -3.949   5.380  -2.294  1.00  0.96           C  
ATOM    212  OH  TYR A  27      -3.992   6.232  -3.408  1.00  0.96           O  
ATOM    213  N   ILE A  28      -1.704   6.147   2.133  1.00  0.95           N  
ATOM    214  CA  ILE A  28      -1.491   7.582   2.235  1.00  0.95           C  
ATOM    215  C   ILE A  28      -1.711   8.253   0.892  1.00  0.95           C  
ATOM    216  O   ILE A  28      -2.416   9.253   0.789  1.00  0.95           O  
ATOM    217  CB  ILE A  28      -0.080   7.866   2.748  1.00  0.95           C  
ATOM    218  CG1 ILE A  28       0.215   7.132   4.082  1.00  0.95           C  
ATOM    219  CG2 ILE A  28       0.210   9.382   2.847  1.00  0.95           C  
ATOM    220  CD1 ILE A  28      -0.725   7.476   5.238  1.00  0.95           C  
ATOM    221  N   ALA A  29      -1.117   7.716  -0.191  1.00  0.95           N  
ATOM    222  CA  ALA A  29      -1.201   8.381  -1.469  1.00  0.95           C  
ATOM    223  C   ALA A  29      -0.837   7.451  -2.610  1.00  0.95           C  
ATOM    224  O   ALA A  29      -0.314   6.356  -2.401  1.00  0.95           O  
ATOM    225  CB  ALA A  29      -0.266   9.604  -1.515  1.00  0.95           C  
ATOM    226  N   SER A  30      -1.069   7.861  -3.867  1.00  0.95           N  
ATOM    227  CA  SER A  30      -0.516   7.163  -5.011  1.00  0.95           C  
ATOM    228  C   SER A  30      -0.488   8.050  -6.229  1.00  0.95           C  
ATOM    229  O   SER A  30      -1.134   9.094  -6.276  1.00  0.95           O  
ATOM    230  CB  SER A  30      -1.226   5.840  -5.407  1.00  0.95           C  
ATOM    231  OG  SER A  30      -2.581   6.045  -5.777  1.00  0.95           O  
ATOM    232  N   ALA A  31       0.292   7.658  -7.249  1.00  0.97           N  
ATOM    233  CA  ALA A  31       0.233   8.286  -8.545  1.00  0.97           C  
ATOM    234  C   ALA A  31       0.590   7.238  -9.583  1.00  0.97           C  
ATOM    235  O   ALA A  31       1.536   6.467  -9.398  1.00  0.97           O  
ATOM    236  CB  ALA A  31       1.196   9.485  -8.636  1.00  0.97           C  
ATOM    237  N   PHE A  32      -0.158   7.175 -10.699  1.00  0.92           N  
ATOM    238  CA  PHE A  32       0.062   6.196 -11.741  1.00  0.92           C  
ATOM    239  C   PHE A  32       0.006   6.887 -13.076  1.00  0.92           C  
ATOM    240  O   PHE A  32      -0.652   7.911 -13.236  1.00  0.92           O  
ATOM    241  CB  PHE A  32      -1.043   5.109 -11.787  1.00  0.92           C  
ATOM    242  CG  PHE A  32      -1.106   4.328 -10.520  1.00  0.92           C  
ATOM    243  CD1 PHE A  32      -0.365   3.148 -10.410  1.00  0.92           C  
ATOM    244  CD2 PHE A  32      -1.935   4.720  -9.458  1.00  0.92           C  
ATOM    245  CE1 PHE A  32      -0.396   2.405  -9.228  1.00  0.92           C  
ATOM    246  CE2 PHE A  32      -2.010   3.938  -8.303  1.00  0.92           C  
ATOM    247  CZ  PHE A  32      -1.220   2.795  -8.171  1.00  0.92           C  
ATOM    248  N   ARG A  33       0.673   6.318 -14.097  1.00  0.87           N  
ATOM    249  CA  ARG A  33       0.424   6.725 -15.466  1.00  0.87           C  
ATOM    250  C   ARG A  33      -0.710   5.913 -16.069  1.00  0.87           C  
ATOM    251  O   ARG A  33      -1.328   6.303 -17.051  1.00  0.87           O  
ATOM    252  CB  ARG A  33       1.673   6.523 -16.344  1.00  0.87           C  
ATOM    253  CG  ARG A  33       2.786   7.556 -16.104  1.00  0.87           C  
ATOM    254  CD  ARG A  33       3.933   7.355 -17.087  1.00  0.87           C  
ATOM    255  NE  ARG A  33       4.957   8.417 -16.830  1.00  0.87           N  
ATOM    256  CZ  ARG A  33       6.143   8.431 -17.451  1.00  0.87           C  
ATOM    257  NH1 ARG A  33       6.514   7.456 -18.270  1.00  0.87           N  
ATOM    258  NH2 ARG A  33       6.995   9.418 -17.218  1.00  0.87           N  
ATOM    259  N   ASN A  34      -1.046   4.760 -15.461  1.00  0.87           N  
ATOM    260  CA  ASN A  34      -2.224   4.013 -15.836  1.00  0.87           C  
ATOM    261  C   ASN A  34      -3.519   4.724 -15.390  1.00  0.87           C  
ATOM    262  O   ASN A  34      -3.807   4.878 -14.201  1.00  0.87           O  
ATOM    263  CB  ASN A  34      -2.111   2.560 -15.304  1.00  0.87           C  
ATOM    264  CG  ASN A  34      -3.281   1.705 -15.769  1.00  0.87           C  
ATOM    265  OD1 ASN A  34      -4.367   1.806 -15.198  1.00  0.87           O  
ATOM    266  ND2 ASN A  34      -3.101   0.896 -16.830  1.00  0.87           N  
ATOM    267  N   GLU A  35      -4.346   5.137 -16.372  1.00  0.79           N  
ATOM    268  CA  GLU A  35      -5.626   5.805 -16.191  1.00  0.79           C  
ATOM    269  C   GLU A  35      -6.687   5.012 -15.436  1.00  0.79           C  
ATOM    270  O   GLU A  35      -7.479   5.566 -14.673  1.00  0.79           O  
ATOM    271  CB  GLU A  35      -6.181   6.263 -17.566  1.00  0.79           C  
ATOM    272  CG  GLU A  35      -5.316   7.379 -18.202  1.00  0.79           C  
ATOM    273  CD  GLU A  35      -5.375   8.659 -17.364  1.00  0.79           C  
ATOM    274  OE1 GLU A  35      -4.426   9.469 -17.466  1.00  0.79           O  
ATOM    275  OE2 GLU A  35      -6.376   8.827 -16.614  1.00  0.79           O  
ATOM    276  N   GLU A  36      -6.747   3.677 -15.615  1.00  0.79           N  
ATOM    277  CA  GLU A  36      -7.690   2.815 -14.915  1.00  0.79           C  
ATOM    278  C   GLU A  36      -7.443   2.813 -13.410  1.00  0.79           C  
ATOM    279  O   GLU A  36      -8.352   2.973 -12.594  1.00  0.79           O  
ATOM    280  CB  GLU A  36      -7.603   1.384 -15.481  1.00  0.79           C  
ATOM    281  CG  GLU A  36      -8.650   0.395 -14.923  1.00  0.79           C  
ATOM    282  CD  GLU A  36      -8.504  -1.001 -15.540  1.00  0.79           C  
ATOM    283  OE1 GLU A  36      -9.277  -1.897 -15.115  1.00  0.79           O  
ATOM    284  OE2 GLU A  36      -7.630  -1.182 -16.427  1.00  0.79           O  
ATOM    285  N   TYR A  37      -6.156   2.719 -13.022  1.00  0.87           N  
ATOM    286  CA  TYR A  37      -5.714   2.840 -11.646  1.00  0.87           C  
ATOM    287  C   TYR A  37      -5.994   4.206 -11.034  1.00  0.87           C  
ATOM    288  O   TYR A  37      -6.511   4.285  -9.923  1.00  0.87           O  
ATOM    289  CB  TYR A  37      -4.211   2.517 -11.502  1.00  0.87           C  
ATOM    290  CG  TYR A  37      -3.954   1.038 -11.361  1.00  0.87           C  
ATOM    291  CD1 TYR A  37      -3.238   0.585 -10.244  1.00  0.87           C  
ATOM    292  CD2 TYR A  37      -4.362   0.094 -12.320  1.00  0.87           C  
ATOM    293  CE1 TYR A  37      -2.875  -0.758 -10.116  1.00  0.87           C  
ATOM    294  CE2 TYR A  37      -4.011  -1.259 -12.190  1.00  0.87           C  
ATOM    295  CZ  TYR A  37      -3.250  -1.686 -11.095  1.00  0.87           C  
ATOM    296  OH  TYR A  37      -2.853  -3.029 -10.940  1.00  0.87           O  
ATOM    297  N   ASN A  38      -5.718   5.313 -11.761  1.00  0.84           N  
ATOM    298  CA  ASN A  38      -6.028   6.668 -11.308  1.00  0.84           C  
ATOM    299  C   ASN A  38      -7.512   6.890 -11.027  1.00  0.84           C  
ATOM    300  O   ASN A  38      -7.882   7.448  -9.997  1.00  0.84           O  
ATOM    301  CB  ASN A  38      -5.561   7.733 -12.336  1.00  0.84           C  
ATOM    302  CG  ASN A  38      -4.963   8.941 -11.619  1.00  0.84           C  
ATOM    303  OD1 ASN A  38      -5.201   9.183 -10.436  1.00  0.84           O  
ATOM    304  ND2 ASN A  38      -4.174   9.750 -12.362  1.00  0.84           N  
ATOM    305  N   LYS A  39      -8.403   6.406 -11.914  1.00  0.79           N  
ATOM    306  CA  LYS A  39      -9.841   6.436 -11.694  1.00  0.79           C  
ATOM    307  C   LYS A  39     -10.311   5.637 -10.486  1.00  0.79           C  
ATOM    308  O   LYS A  39     -11.112   6.113  -9.690  1.00  0.79           O  
ATOM    309  CB  LYS A  39     -10.577   5.920 -12.950  1.00  0.79           C  
ATOM    310  CG  LYS A  39     -10.510   6.927 -14.105  1.00  0.79           C  
ATOM    311  CD  LYS A  39     -11.115   6.388 -15.408  1.00  0.79           C  
ATOM    312  CE  LYS A  39     -10.970   7.383 -16.560  1.00  0.79           C  
ATOM    313  NZ  LYS A  39     -11.478   6.779 -17.811  1.00  0.79           N  
ATOM    314  N   SER A  40      -9.791   4.405 -10.302  1.00  0.81           N  
ATOM    315  CA  SER A  40     -10.118   3.560  -9.153  1.00  0.81           C  
ATOM    316  C   SER A  40      -9.694   4.173  -7.826  1.00  0.81           C  
ATOM    317  O   SER A  40     -10.440   4.203  -6.849  1.00  0.81           O  
ATOM    318  CB  SER A  40      -9.439   2.171  -9.300  1.00  0.81           C  
ATOM    319  OG  SER A  40      -9.847   1.236  -8.297  1.00  0.81           O  
ATOM    320  N   VAL A  41      -8.468   4.730  -7.793  1.00  0.88           N  
ATOM    321  CA  VAL A  41      -7.917   5.439  -6.652  1.00  0.88           C  
ATOM    322  C   VAL A  41      -8.677   6.703  -6.294  1.00  0.88           C  
ATOM    323  O   VAL A  41      -8.883   6.991  -5.120  1.00  0.88           O  
ATOM    324  CB  VAL A  41      -6.437   5.714  -6.853  1.00  0.88           C  
ATOM    325  CG1 VAL A  41      -5.901   6.679  -5.787  1.00  0.88           C  
ATOM    326  CG2 VAL A  41      -5.701   4.364  -6.763  1.00  0.88           C  
ATOM    327  N   GLN A  42      -9.151   7.482  -7.287  1.00  0.83           N  
ATOM    328  CA  GLN A  42      -9.851   8.744  -7.079  1.00  0.83           C  
ATOM    329  C   GLN A  42     -11.076   8.663  -6.168  1.00  0.83           C  
ATOM    330  O   GLN A  42     -11.412   9.605  -5.452  1.00  0.83           O  
ATOM    331  CB  GLN A  42     -10.247   9.350  -8.447  1.00  0.83           C  
ATOM    332  CG  GLN A  42     -10.794  10.792  -8.363  1.00  0.83           C  
ATOM    333  CD  GLN A  42     -11.097  11.372  -9.745  1.00  0.83           C  
ATOM    334  OE1 GLN A  42     -11.022  10.737 -10.792  1.00  0.83           O  
ATOM    335  NE2 GLN A  42     -11.460  12.679  -9.746  1.00  0.83           N  
ATOM    336  N   GLU A  43     -11.762   7.508  -6.157  1.00  0.84           N  
ATOM    337  CA  GLU A  43     -12.873   7.260  -5.268  1.00  0.84           C  
ATOM    338  C   GLU A  43     -12.484   6.935  -3.824  1.00  0.84           C  
ATOM    339  O   GLU A  43     -13.318   7.009  -2.920  1.00  0.84           O  
ATOM    340  CB  GLU A  43     -13.699   6.085  -5.817  1.00  0.84           C  
ATOM    341  CG  GLU A  43     -14.303   6.336  -7.221  1.00  0.84           C  
ATOM    342  CD  GLU A  43     -15.354   5.282  -7.552  1.00  0.84           C  
ATOM    343  OE1 GLU A  43     -15.980   5.360  -8.633  1.00  0.84           O  
ATOM    344  OE2 GLU A  43     -15.567   4.380  -6.690  1.00  0.84           O  
ATOM    345  N   ILE A  44     -11.214   6.561  -3.557  1.00  0.93           N  
ATOM    346  CA  ILE A  44     -10.745   6.156  -2.238  1.00  0.93           C  
ATOM    347  C   ILE A  44     -10.525   7.371  -1.353  1.00  0.93           C  
ATOM    348  O   ILE A  44      -9.624   8.181  -1.558  1.00  0.93           O  
ATOM    349  CB  ILE A  44      -9.464   5.314  -2.296  1.00  0.93           C  
ATOM    350  CG1 ILE A  44      -9.672   4.048  -3.165  1.00  0.93           C  
ATOM    351  CG2 ILE A  44      -8.997   4.949  -0.868  1.00  0.93           C  
ATOM    352  CD1 ILE A  44      -8.400   3.221  -3.392  1.00  0.93           C  
ATOM    353  N   GLN A  45     -11.356   7.533  -0.308  1.00  0.90           N  
ATOM    354  CA  GLN A  45     -11.239   8.647   0.608  1.00  0.90           C  
ATOM    355  C   GLN A  45     -10.240   8.354   1.715  1.00  0.90           C  
ATOM    356  O   GLN A  45      -9.414   9.192   2.061  1.00  0.90           O  
ATOM    357  CB  GLN A  45     -12.633   8.991   1.175  1.00  0.90           C  
ATOM    358  CG  GLN A  45     -13.635   9.395   0.064  1.00  0.90           C  
ATOM    359  CD  GLN A  45     -15.061   9.483   0.613  1.00  0.90           C  
ATOM    360  OE1 GLN A  45     -15.655   8.457   0.934  1.00  0.90           O  
ATOM    361  NE2 GLN A  45     -15.637  10.704   0.690  1.00  0.90           N  
ATOM    362  N   ALA A  46     -10.273   7.129   2.270  1.00  0.95           N  
ATOM    363  CA  ALA A  46      -9.336   6.685   3.275  1.00  0.95           C  
ATOM    364  C   ALA A  46      -9.283   5.172   3.192  1.00  0.95           C  
ATOM    365  O   ALA A  46     -10.285   4.544   2.871  1.00  0.95           O  
ATOM    366  CB  ALA A  46      -9.780   7.099   4.693  1.00  0.95           C  
ATOM    367  N   THR A  47      -8.132   4.533   3.471  1.00  0.94           N  
ATOM    368  CA  THR A  47      -8.078   3.068   3.507  1.00  0.94           C  
ATOM    369  C   THR A  47      -7.039   2.673   4.522  1.00  0.94           C  
ATOM    370  O   THR A  47      -5.921   3.194   4.517  1.00  0.94           O  
ATOM    371  CB  THR A  47      -7.668   2.378   2.191  1.00  0.94           C  
ATOM    372  OG1 THR A  47      -8.641   2.514   1.172  1.00  0.94           O  
ATOM    373  CG2 THR A  47      -7.467   0.862   2.327  1.00  0.94           C  
ATOM    374  N   PHE A  48      -7.346   1.697   5.386  1.00  0.94           N  
ATOM    375  CA  PHE A  48      -6.362   1.072   6.238  1.00  0.94           C  
ATOM    376  C   PHE A  48      -6.527  -0.421   6.102  1.00  0.94           C  
ATOM    377  O   PHE A  48      -7.557  -0.918   5.646  1.00  0.94           O  
ATOM    378  CB  PHE A  48      -6.420   1.516   7.728  1.00  0.94           C  
ATOM    379  CG  PHE A  48      -7.725   1.215   8.413  1.00  0.94           C  
ATOM    380  CD1 PHE A  48      -8.751   2.169   8.418  1.00  0.94           C  
ATOM    381  CD2 PHE A  48      -7.927   0.000   9.089  1.00  0.94           C  
ATOM    382  CE1 PHE A  48      -9.937   1.943   9.122  1.00  0.94           C  
ATOM    383  CE2 PHE A  48      -9.115  -0.232   9.792  1.00  0.94           C  
ATOM    384  CZ  PHE A  48     -10.119   0.742   9.810  1.00  0.94           C  
ATOM    385  N   PHE A  49      -5.500  -1.188   6.476  1.00  0.93           N  
ATOM    386  CA  PHE A  49      -5.578  -2.616   6.346  1.00  0.93           C  
ATOM    387  C   PHE A  49      -4.605  -3.297   7.271  1.00  0.93           C  
ATOM    388  O   PHE A  49      -3.714  -2.671   7.840  1.00  0.93           O  
ATOM    389  CB  PHE A  49      -5.383  -3.110   4.886  1.00  0.93           C  
ATOM    390  CG  PHE A  49      -4.102  -2.637   4.276  1.00  0.93           C  
ATOM    391  CD1 PHE A  49      -4.094  -1.424   3.576  1.00  0.93           C  
ATOM    392  CD2 PHE A  49      -2.908  -3.362   4.411  1.00  0.93           C  
ATOM    393  CE1 PHE A  49      -2.911  -0.930   3.028  1.00  0.93           C  
ATOM    394  CE2 PHE A  49      -1.721  -2.867   3.859  1.00  0.93           C  
ATOM    395  CZ  PHE A  49      -1.722  -1.656   3.159  1.00  0.93           C  
ATOM    396  N   TYR A  50      -4.783  -4.616   7.443  1.00  0.94           N  
ATOM    397  CA  TYR A  50      -3.927  -5.459   8.239  1.00  0.94           C  
ATOM    398  C   TYR A  50      -3.341  -6.538   7.362  1.00  0.94           C  
ATOM    399  O   TYR A  50      -4.066  -7.194   6.611  1.00  0.94           O  
ATOM    400  CB  TYR A  50      -4.679  -6.214   9.357  1.00  0.94           C  
ATOM    401  CG  TYR A  50      -5.144  -5.291  10.431  1.00  0.94           C  
ATOM    402  CD1 TYR A  50      -4.418  -5.215  11.629  1.00  0.94           C  
ATOM    403  CD2 TYR A  50      -6.303  -4.514  10.274  1.00  0.94           C  
ATOM    404  CE1 TYR A  50      -4.855  -4.394  12.667  1.00  0.94           C  
ATOM    405  CE2 TYR A  50      -6.737  -3.675  11.311  1.00  0.94           C  
ATOM    406  CZ  TYR A  50      -6.006  -3.638  12.509  1.00  0.94           C  
ATOM    407  OH  TYR A  50      -6.350  -2.850  13.606  1.00  0.94           O  
ATOM    408  N   PHE A  51      -2.028  -6.771   7.490  1.00  0.92           N  
ATOM    409  CA  PHE A  51      -1.340  -7.877   6.865  1.00  0.92           C  
ATOM    410  C   PHE A  51      -0.961  -8.898   7.914  1.00  0.92           C  
ATOM    411  O   PHE A  51      -0.316  -8.582   8.915  1.00  0.92           O  
ATOM    412  CB  PHE A  51      -0.011  -7.443   6.197  1.00  0.92           C  
ATOM    413  CG  PHE A  51      -0.160  -6.750   4.875  1.00  0.92           C  
ATOM    414  CD1 PHE A  51      -1.224  -7.000   3.990  1.00  0.92           C  
ATOM    415  CD2 PHE A  51       0.877  -5.899   4.459  1.00  0.92           C  
ATOM    416  CE1 PHE A  51      -1.244  -6.411   2.723  1.00  0.92           C  
ATOM    417  CE2 PHE A  51       0.863  -5.316   3.187  1.00  0.92           C  
ATOM    418  CZ  PHE A  51      -0.202  -5.573   2.317  1.00  0.92           C  
ATOM    419  N   THR A  52      -1.333 -10.167   7.672  1.00  0.94           N  
ATOM    420  CA  THR A  52      -0.932 -11.291   8.507  1.00  0.94           C  
ATOM    421  C   THR A  52      -0.293 -12.344   7.596  1.00  0.94           C  
ATOM    422  O   THR A  52      -1.021 -13.099   6.945  1.00  0.94           O  
ATOM    423  CB  THR A  52      -2.123 -11.951   9.209  1.00  0.94           C  
ATOM    424  OG1 THR A  52      -2.870 -11.065  10.032  1.00  0.94           O  
ATOM    425  CG2 THR A  52      -1.681 -13.055  10.172  1.00  0.94           C  
ATOM    426  N   PRO A  53       1.030 -12.449   7.475  1.00  0.97           N  
ATOM    427  CA  PRO A  53       1.659 -13.379   6.533  1.00  0.97           C  
ATOM    428  C   PRO A  53       1.708 -14.832   6.964  1.00  0.97           C  
ATOM    429  O   PRO A  53       2.021 -15.120   8.116  1.00  0.97           O  
ATOM    430  CB  PRO A  53       3.101 -12.865   6.393  1.00  0.97           C  
ATOM    431  CG  PRO A  53       3.010 -11.382   6.737  1.00  0.97           C  
ATOM    432  CD  PRO A  53       1.951 -11.369   7.834  1.00  0.97           C  
ATOM    433  N   ASN A  54       1.494 -15.775   6.030  1.00  0.92           N  
ATOM    434  CA  ASN A  54       1.773 -17.177   6.235  1.00  0.92           C  
ATOM    435  C   ASN A  54       3.075 -17.420   5.482  1.00  0.92           C  
ATOM    436  O   ASN A  54       3.135 -17.360   4.257  1.00  0.92           O  
ATOM    437  CB  ASN A  54       0.603 -18.067   5.722  1.00  0.92           C  
ATOM    438  CG  ASN A  54      -0.725 -17.777   6.427  1.00  0.92           C  
ATOM    439  OD1 ASN A  54      -0.927 -16.716   7.022  1.00  0.92           O  
ATOM    440  ND2 ASN A  54      -1.657 -18.752   6.380  1.00  0.92           N  
ATOM    441  N   LYS A  55       4.170 -17.677   6.224  1.00  0.89           N  
ATOM    442  CA  LYS A  55       5.503 -17.844   5.677  1.00  0.89           C  
ATOM    443  C   LYS A  55       5.729 -19.210   5.051  1.00  0.89           C  
ATOM    444  O   LYS A  55       6.715 -19.415   4.353  1.00  0.89           O  
ATOM    445  CB  LYS A  55       6.557 -17.665   6.802  1.00  0.89           C  
ATOM    446  CG  LYS A  55       6.502 -16.293   7.491  1.00  0.89           C  
ATOM    447  CD  LYS A  55       7.478 -16.168   8.677  1.00  0.89           C  
ATOM    448  CE  LYS A  55       7.293 -14.850   9.436  1.00  0.89           C  
ATOM    449  NZ  LYS A  55       8.188 -14.732  10.598  1.00  0.89           N  
ATOM    450  N   THR A  56       4.831 -20.174   5.329  1.00  0.87           N  
ATOM    451  CA  THR A  56       4.903 -21.539   4.813  1.00  0.87           C  
ATOM    452  C   THR A  56       4.243 -21.651   3.457  1.00  0.87           C  
ATOM    453  O   THR A  56       4.692 -22.382   2.580  1.00  0.87           O  
ATOM    454  CB  THR A  56       4.226 -22.534   5.749  1.00  0.87           C  
ATOM    455  OG1 THR A  56       4.818 -22.476   7.041  1.00  0.87           O  
ATOM    456  CG2 THR A  56       4.395 -23.982   5.272  1.00  0.87           C  
ATOM    457  N   GLU A  57       3.133 -20.918   3.255  1.00  0.85           N  
ATOM    458  CA  GLU A  57       2.346 -21.008   2.038  1.00  0.85           C  
ATOM    459  C   GLU A  57       2.627 -19.869   1.080  1.00  0.85           C  
ATOM    460  O   GLU A  57       2.064 -19.808  -0.010  1.00  0.85           O  
ATOM    461  CB  GLU A  57       0.847 -20.957   2.403  1.00  0.85           C  
ATOM    462  CG  GLU A  57       0.360 -22.226   3.138  1.00  0.85           C  
ATOM    463  CD  GLU A  57      -1.044 -22.069   3.718  1.00  0.85           C  
ATOM    464  OE1 GLU A  57      -1.434 -22.973   4.498  1.00  0.85           O  
ATOM    465  OE2 GLU A  57      -1.691 -21.013   3.482  1.00  0.85           O  
ATOM    466  N   ASP A  58       3.507 -18.931   1.480  1.00  0.92           N  
ATOM    467  CA  ASP A  58       3.819 -17.718   0.751  1.00  0.92           C  
ATOM    468  C   ASP A  58       2.588 -16.873   0.420  1.00  0.92           C  
ATOM    469  O   ASP A  58       2.384 -16.393  -0.696  1.00  0.92           O  
ATOM    470  CB  ASP A  58       4.773 -18.004  -0.435  1.00  0.92           C  
ATOM    471  CG  ASP A  58       6.167 -18.336   0.063  1.00  0.92           C  
ATOM    472  OD1 ASP A  58       6.419 -18.312   1.299  1.00  0.92           O  
ATOM    473  OD2 ASP A  58       7.076 -18.503  -0.789  1.00  0.92           O  
ATOM    474  N   THR A  59       1.739 -16.643   1.443  1.00  0.93           N  
ATOM    475  CA  THR A  59       0.513 -15.873   1.321  1.00  0.93           C  
ATOM    476  C   THR A  59       0.473 -14.822   2.394  1.00  0.93           C  
ATOM    477  O   THR A  59       1.112 -14.926   3.439  1.00  0.93           O  
ATOM    478  CB  THR A  59      -0.805 -16.660   1.405  1.00  0.93           C  
ATOM    479  OG1 THR A  59      -0.954 -17.368   2.630  1.00  0.93           O  
ATOM    480  CG2 THR A  59      -0.863 -17.685   0.277  1.00  0.93           C  
ATOM    481  N   ILE A  60      -0.290 -13.744   2.168  1.00  0.95           N  
ATOM    482  CA  ILE A  60      -0.547 -12.743   3.183  1.00  0.95           C  
ATOM    483  C   ILE A  60      -2.040 -12.625   3.314  1.00  0.95           C  
ATOM    484  O   ILE A  60      -2.741 -12.290   2.360  1.00  0.95           O  
ATOM    485  CB  ILE A  60       0.059 -11.378   2.866  1.00  0.95           C  
ATOM    486  CG1 ILE A  60       1.589 -11.468   2.676  1.00  0.95           C  
ATOM    487  CG2 ILE A  60      -0.287 -10.371   3.984  1.00  0.95           C  
ATOM    488  CD1 ILE A  60       2.190 -10.228   2.007  1.00  0.95           C  
ATOM    489  N   PHE A  61      -2.589 -12.894   4.512  1.00  0.94           N  
ATOM    490  CA  PHE A  61      -3.990 -12.647   4.781  1.00  0.94           C  
ATOM    491  C   PHE A  61      -4.184 -11.147   4.961  1.00  0.94           C  
ATOM    492  O   PHE A  61      -3.605 -10.528   5.854  1.00  0.94           O  
ATOM    493  CB  PHE A  61      -4.473 -13.444   6.022  1.00  0.94           C  
ATOM    494  CG  PHE A  61      -5.935 -13.252   6.339  1.00  0.94           C  
ATOM    495  CD1 PHE A  61      -6.342 -12.844   7.623  1.00  0.94           C  
ATOM    496  CD2 PHE A  61      -6.913 -13.527   5.371  1.00  0.94           C  
ATOM    497  CE1 PHE A  61      -7.704 -12.728   7.934  1.00  0.94           C  
ATOM    498  CE2 PHE A  61      -8.272 -13.399   5.677  1.00  0.94           C  
ATOM    499  CZ  PHE A  61      -8.669 -12.995   6.956  1.00  0.94           C  
ATOM    500  N   LEU A  62      -4.985 -10.539   4.075  1.00  0.93           N  
ATOM    501  CA  LEU A  62      -5.240  -9.121   4.027  1.00  0.93           C  
ATOM    502  C   LEU A  62      -6.610  -8.878   4.616  1.00  0.93           C  
ATOM    503  O   LEU A  62      -7.592  -9.501   4.215  1.00  0.93           O  
ATOM    504  CB  LEU A  62      -5.203  -8.624   2.553  1.00  0.93           C  
ATOM    505  CG  LEU A  62      -5.762  -7.213   2.262  1.00  0.93           C  
ATOM    506  CD1 LEU A  62      -5.034  -6.118   3.038  1.00  0.93           C  
ATOM    507  CD2 LEU A  62      -5.715  -6.885   0.761  1.00  0.93           C  
ATOM    508  N   ARG A  63      -6.717  -7.949   5.585  1.00  0.86           N  
ATOM    509  CA  ARG A  63      -8.000  -7.450   6.037  1.00  0.86           C  
ATOM    510  C   ARG A  63      -8.062  -5.970   5.734  1.00  0.86           C  
ATOM    511  O   ARG A  63      -7.352  -5.187   6.360  1.00  0.86           O  
ATOM    512  CB  ARG A  63      -8.235  -7.659   7.561  1.00  0.86           C  
ATOM    513  CG  ARG A  63      -8.123  -9.116   8.054  1.00  0.86           C  
ATOM    514  CD  ARG A  63      -8.526  -9.334   9.520  1.00  0.86           C  
ATOM    515  NE  ARG A  63      -7.483  -8.674  10.378  1.00  0.86           N  
ATOM    516  CZ  ARG A  63      -6.414  -9.300  10.892  1.00  0.86           C  
ATOM    517  NH1 ARG A  63      -6.188 -10.586  10.665  1.00  0.86           N  
ATOM    518  NH2 ARG A  63      -5.535  -8.615  11.618  1.00  0.86           N  
ATOM    519  N   GLU A  64      -8.908  -5.557   4.779  1.00  0.88           N  
ATOM    520  CA  GLU A  64      -8.903  -4.230   4.204  1.00  0.88           C  
ATOM    521  C   GLU A  64     -10.167  -3.501   4.570  1.00  0.88           C  
ATOM    522  O   GLU A  64     -11.274  -4.035   4.487  1.00  0.88           O  
ATOM    523  CB  GLU A  64      -8.800  -4.337   2.667  1.00  0.88           C  
ATOM    524  CG  GLU A  64      -8.723  -3.004   1.884  1.00  0.88           C  
ATOM    525  CD  GLU A  64      -8.556  -3.302   0.415  1.00  0.88           C  
ATOM    526  OE1 GLU A  64      -9.502  -3.895  -0.163  1.00  0.88           O  
ATOM    527  OE2 GLU A  64      -7.490  -3.003  -0.180  1.00  0.88           O  
ATOM    528  N   TYR A  65     -10.010  -2.254   5.027  1.00  0.92           N  
ATOM    529  CA  TYR A  65     -11.093  -1.400   5.423  1.00  0.92           C  
ATOM    530  C   TYR A  65     -10.957  -0.159   4.570  1.00  0.92           C  
ATOM    531  O   TYR A  65     -10.028   0.633   4.737  1.00  0.92           O  
ATOM    532  CB  TYR A  65     -10.927  -1.000   6.896  1.00  0.92           C  
ATOM    533  CG  TYR A  65     -11.101  -2.158   7.829  1.00  0.92           C  
ATOM    534  CD1 TYR A  65     -12.298  -2.367   8.538  1.00  0.92           C  
ATOM    535  CD2 TYR A  65     -10.008  -3.003   8.064  1.00  0.92           C  
ATOM    536  CE1 TYR A  65     -12.377  -3.384   9.505  1.00  0.92           C  
ATOM    537  CE2 TYR A  65     -10.086  -4.020   9.012  1.00  0.92           C  
ATOM    538  CZ  TYR A  65     -11.252  -4.186   9.757  1.00  0.92           C  
ATOM    539  OH  TYR A  65     -11.219  -5.176  10.750  1.00  0.92           O  
ATOM    540  N   GLN A  66     -11.866   0.033   3.607  1.00  0.90           N  
ATOM    541  CA  GLN A  66     -11.740   1.067   2.607  1.00  0.90           C  
ATOM    542  C   GLN A  66     -12.948   1.977   2.630  1.00  0.90           C  
ATOM    543  O   GLN A  66     -14.088   1.536   2.493  1.00  0.90           O  
ATOM    544  CB  GLN A  66     -11.600   0.402   1.217  1.00  0.90           C  
ATOM    545  CG  GLN A  66     -11.642   1.365   0.012  1.00  0.90           C  
ATOM    546  CD  GLN A  66     -11.198   0.661  -1.270  1.00  0.90           C  
ATOM    547  OE1 GLN A  66     -11.987   0.264  -2.129  1.00  0.90           O  
ATOM    548  NE2 GLN A  66      -9.861   0.537  -1.424  1.00  0.90           N  
ATOM    549  N   THR A  67     -12.730   3.292   2.787  1.00  0.91           N  
ATOM    550  CA  THR A  67     -13.791   4.285   2.792  1.00  0.91           C  
ATOM    551  C   THR A  67     -13.937   4.841   1.387  1.00  0.91           C  
ATOM    552  O   THR A  67     -13.012   5.434   0.822  1.00  0.91           O  
ATOM    553  CB  THR A  67     -13.542   5.449   3.765  1.00  0.91           C  
ATOM    554  OG1 THR A  67     -13.487   4.991   5.107  1.00  0.91           O  
ATOM    555  CG2 THR A  67     -14.697   6.467   3.668  1.00  0.91           C  
ATOM    556  N   ARG A  68     -15.117   4.647   0.777  1.00  0.83           N  
ATOM    557  CA  ARG A  68     -15.451   5.120  -0.551  1.00  0.83           C  
ATOM    558  C   ARG A  68     -16.889   5.549  -0.509  1.00  0.83           C  
ATOM    559  O   ARG A  68     -17.716   4.908   0.132  1.00  0.83           O  
ATOM    560  CB  ARG A  68     -15.353   4.025  -1.647  1.00  0.83           C  
ATOM    561  CG  ARG A  68     -13.918   3.776  -2.124  1.00  0.83           C  
ATOM    562  CD  ARG A  68     -13.706   2.539  -2.995  1.00  0.83           C  
ATOM    563  NE  ARG A  68     -14.357   2.682  -4.333  1.00  0.83           N  
ATOM    564  CZ  ARG A  68     -14.286   1.709  -5.251  1.00  0.83           C  
ATOM    565  NH1 ARG A  68     -13.722   0.539  -4.964  1.00  0.83           N  
ATOM    566  NH2 ARG A  68     -14.754   1.935  -6.469  1.00  0.83           N  
ATOM    567  N   GLN A  69     -17.207   6.668  -1.184  1.00  0.79           N  
ATOM    568  CA  GLN A  69     -18.554   7.211  -1.289  1.00  0.79           C  
ATOM    569  C   GLN A  69     -19.225   7.490   0.062  1.00  0.79           C  
ATOM    570  O   GLN A  69     -20.421   7.285   0.249  1.00  0.79           O  
ATOM    571  CB  GLN A  69     -19.441   6.332  -2.213  1.00  0.79           C  
ATOM    572  CG  GLN A  69     -18.880   6.160  -3.648  1.00  0.79           C  
ATOM    573  CD  GLN A  69     -19.748   5.220  -4.495  1.00  0.79           C  
ATOM    574  OE1 GLN A  69     -20.761   4.675  -4.069  1.00  0.79           O  
ATOM    575  NE2 GLN A  69     -19.333   5.017  -5.769  1.00  0.79           N  
ATOM    576  N   ASP A  70     -18.421   7.956   1.040  1.00  0.83           N  
ATOM    577  CA  ASP A  70     -18.795   8.195   2.420  1.00  0.83           C  
ATOM    578  C   ASP A  70     -19.317   6.958   3.165  1.00  0.83           C  
ATOM    579  O   ASP A  70     -20.047   7.059   4.154  1.00  0.83           O  
ATOM    580  CB  ASP A  70     -19.682   9.460   2.588  1.00  0.83           C  
ATOM    581  CG  ASP A  70     -18.922  10.703   2.150  1.00  0.83           C  
ATOM    582  OD1 ASP A  70     -17.719  10.822   2.512  1.00  0.83           O  
ATOM    583  OD2 ASP A  70     -19.525  11.569   1.473  1.00  0.83           O  
ATOM    584  N   GLN A  71     -18.870   5.745   2.764  1.00  0.78           N  
ATOM    585  CA  GLN A  71     -19.259   4.497   3.388  1.00  0.78           C  
ATOM    586  C   GLN A  71     -18.059   3.584   3.562  1.00  0.78           C  
ATOM    587  O   GLN A  71     -17.065   3.674   2.844  1.00  0.78           O  
ATOM    588  CB  GLN A  71     -20.306   3.750   2.528  1.00  0.78           C  
ATOM    589  CG  GLN A  71     -21.651   4.502   2.424  1.00  0.78           C  
ATOM    590  CD  GLN A  71     -22.691   3.703   1.640  1.00  0.78           C  
ATOM    591  OE1 GLN A  71     -22.422   2.732   0.939  1.00  0.78           O  
ATOM    592  NE2 GLN A  71     -23.970   4.125   1.787  1.00  0.78           N  
ATOM    593  N   CYS A  72     -18.119   2.659   4.545  1.00  0.90           N  
ATOM    594  CA  CYS A  72     -17.050   1.705   4.777  1.00  0.90           C  
ATOM    595  C   CYS A  72     -17.290   0.428   3.995  1.00  0.90           C  
ATOM    596  O   CYS A  72     -18.340  -0.203   4.102  1.00  0.90           O  
ATOM    597  CB  CYS A  72     -16.891   1.327   6.275  1.00  0.90           C  
ATOM    598  SG  CYS A  72     -15.473   0.218   6.596  1.00  0.90           S  
ATOM    599  N   ILE A  73     -16.280   0.001   3.225  1.00  0.87           N  
ATOM    600  CA  ILE A  73     -16.260  -1.256   2.513  1.00  0.87           C  
ATOM    601  C   ILE A  73     -15.197  -2.115   3.175  1.00  0.87           C  
ATOM    602  O   ILE A  73     -14.016  -1.771   3.207  1.00  0.87           O  
ATOM    603  CB  ILE A  73     -15.944  -1.056   1.034  1.00  0.87           C  
ATOM    604  CG1 ILE A  73     -17.074  -0.236   0.368  1.00  0.87           C  
ATOM    605  CG2 ILE A  73     -15.738  -2.420   0.339  1.00  0.87           C  
ATOM    606  CD1 ILE A  73     -16.763   0.205  -1.066  1.00  0.87           C  
ATOM    607  N   TYR A  74     -15.593  -3.271   3.738  1.00  0.89           N  
ATOM    608  CA  TYR A  74     -14.675  -4.218   4.341  1.00  0.89           C  
ATOM    609  C   TYR A  74     -14.495  -5.396   3.396  1.00  0.89           C  
ATOM    610  O   TYR A  74     -15.458  -5.868   2.793  1.00  0.89           O  
ATOM    611  CB  TYR A  74     -15.215  -4.678   5.723  1.00  0.89           C  
ATOM    612  CG  TYR A  74     -14.465  -5.829   6.341  1.00  0.89           C  
ATOM    613  CD1 TYR A  74     -15.048  -7.106   6.403  1.00  0.89           C  
ATOM    614  CD2 TYR A  74     -13.176  -5.643   6.855  1.00  0.89           C  
ATOM    615  CE1 TYR A  74     -14.387  -8.158   7.050  1.00  0.89           C  
ATOM    616  CE2 TYR A  74     -12.510  -6.695   7.499  1.00  0.89           C  
ATOM    617  CZ  TYR A  74     -13.129  -7.944   7.619  1.00  0.89           C  
ATOM    618  OH  TYR A  74     -12.460  -8.995   8.272  1.00  0.89           O  
ATOM    619  N   ASN A  75     -13.253  -5.897   3.244  1.00  0.87           N  
ATOM    620  CA  ASN A  75     -12.975  -7.058   2.424  1.00  0.87           C  
ATOM    621  C   ASN A  75     -11.784  -7.820   3.010  1.00  0.87           C  
ATOM    622  O   ASN A  75     -10.838  -7.230   3.538  1.00  0.87           O  
ATOM    623  CB  ASN A  75     -12.701  -6.602   0.963  1.00  0.87           C  
ATOM    624  CG  ASN A  75     -12.793  -7.754  -0.031  1.00  0.87           C  
ATOM    625  OD1 ASN A  75     -12.866  -8.930   0.299  1.00  0.87           O  
ATOM    626  ND2 ASN A  75     -12.822  -7.413  -1.341  1.00  0.87           N  
ATOM    627  N   THR A  76     -11.801  -9.164   2.938  1.00  0.89           N  
ATOM    628  CA  THR A  76     -10.695 -10.022   3.327  1.00  0.89           C  
ATOM    629  C   THR A  76     -10.303 -10.905   2.192  1.00  0.89           C  
ATOM    630  O   THR A  76     -11.132 -11.437   1.461  1.00  0.89           O  
ATOM    631  CB  THR A  76     -10.905 -10.914   4.542  1.00  0.89           C  
ATOM    632  OG1 THR A  76     -12.146 -11.606   4.558  1.00  0.89           O  
ATOM    633  CG2 THR A  76     -10.898  -9.983   5.737  1.00  0.89           C  
ATOM    634  N   THR A  77      -8.990 -11.088   1.996  1.00  0.89           N  
ATOM    635  CA  THR A  77      -8.526 -11.912   0.897  1.00  0.89           C  
ATOM    636  C   THR A  77      -7.128 -12.379   1.204  1.00  0.89           C  
ATOM    637  O   THR A  77      -6.474 -11.878   2.118  1.00  0.89           O  
ATOM    638  CB  THR A  77      -8.575 -11.218  -0.471  1.00  0.89           C  
ATOM    639  OG1 THR A  77      -8.296 -12.114  -1.545  1.00  0.89           O  
ATOM    640  CG2 THR A  77      -7.579 -10.053  -0.541  1.00  0.89           C  
ATOM    641  N   TYR A  78      -6.629 -13.357   0.440  1.00  0.90           N  
ATOM    642  CA  TYR A  78      -5.268 -13.831   0.530  1.00  0.90           C  
ATOM    643  C   TYR A  78      -4.504 -13.246  -0.630  1.00  0.90           C  
ATOM    644  O   TYR A  78      -4.907 -13.356  -1.787  1.00  0.90           O  
ATOM    645  CB  TYR A  78      -5.127 -15.368   0.443  1.00  0.90           C  
ATOM    646  CG  TYR A  78      -5.601 -15.995   1.712  1.00  0.90           C  
ATOM    647  CD1 TYR A  78      -4.709 -16.185   2.778  1.00  0.90           C  
ATOM    648  CD2 TYR A  78      -6.940 -16.384   1.857  1.00  0.90           C  
ATOM    649  CE1 TYR A  78      -5.153 -16.754   3.978  1.00  0.90           C  
ATOM    650  CE2 TYR A  78      -7.388 -16.950   3.059  1.00  0.90           C  
ATOM    651  CZ  TYR A  78      -6.491 -17.131   4.120  1.00  0.90           C  
ATOM    652  OH  TYR A  78      -6.923 -17.689   5.337  1.00  0.90           O  
ATOM    653  N   LEU A  79      -3.369 -12.600  -0.341  1.00  0.91           N  
ATOM    654  CA  LEU A  79      -2.447 -12.143  -1.352  1.00  0.91           C  
ATOM    655  C   LEU A  79      -1.387 -13.205  -1.537  1.00  0.91           C  
ATOM    656  O   LEU A  79      -0.960 -13.815  -0.559  1.00  0.91           O  
ATOM    657  CB  LEU A  79      -1.730 -10.834  -0.943  1.00  0.91           C  
ATOM    658  CG  LEU A  79      -2.647  -9.680  -0.503  1.00  0.91           C  
ATOM    659  CD1 LEU A  79      -1.821  -8.444  -0.125  1.00  0.91           C  
ATOM    660  CD2 LEU A  79      -3.645  -9.317  -1.600  1.00  0.91           C  
ATOM    661  N   ASN A  80      -0.919 -13.455  -2.770  1.00  0.91           N  
ATOM    662  CA  ASN A  80       0.158 -14.400  -3.007  1.00  0.91           C  
ATOM    663  C   ASN A  80       1.481 -13.648  -2.982  1.00  0.91           C  
ATOM    664  O   ASN A  80       1.544 -12.481  -3.366  1.00  0.91           O  
ATOM    665  CB  ASN A  80       0.022 -15.120  -4.370  1.00  0.91           C  
ATOM    666  CG  ASN A  80      -1.278 -15.913  -4.433  1.00  0.91           C  
ATOM    667  OD1 ASN A  80      -1.636 -16.637  -3.507  1.00  0.91           O  
ATOM    668  ND2 ASN A  80      -2.002 -15.813  -5.574  1.00  0.91           N  
ATOM    669  N   VAL A  81       2.572 -14.287  -2.528  1.00  0.95           N  
ATOM    670  CA  VAL A  81       3.890 -13.676  -2.450  1.00  0.95           C  
ATOM    671  C   VAL A  81       4.830 -14.398  -3.393  1.00  0.95           C  
ATOM    672  O   VAL A  81       5.074 -15.596  -3.268  1.00  0.95           O  
ATOM    673  CB  VAL A  81       4.472 -13.792  -1.044  1.00  0.95           C  
ATOM    674  CG1 VAL A  81       5.888 -13.189  -0.957  1.00  0.95           C  
ATOM    675  CG2 VAL A  81       3.527 -13.100  -0.049  1.00  0.95           C  
ATOM    676  N   GLN A  82       5.425 -13.699  -4.374  1.00  0.90           N  
ATOM    677  CA  GLN A  82       6.400 -14.307  -5.253  1.00  0.90           C  
ATOM    678  C   GLN A  82       7.757 -13.840  -4.787  1.00  0.90           C  
ATOM    679  O   GLN A  82       8.239 -12.762  -5.139  1.00  0.90           O  
ATOM    680  CB  GLN A  82       6.175 -13.962  -6.742  1.00  0.90           C  
ATOM    681  CG  GLN A  82       4.787 -14.379  -7.288  1.00  0.90           C  
ATOM    682  CD  GLN A  82       3.661 -13.456  -6.800  1.00  0.90           C  
ATOM    683  OE1 GLN A  82       3.797 -12.237  -6.775  1.00  0.90           O  
ATOM    684  NE2 GLN A  82       2.492 -14.052  -6.474  1.00  0.90           N  
ATOM    685  N   ARG A  83       8.408 -14.657  -3.939  1.00  0.89           N  
ATOM    686  CA  ARG A  83       9.566 -14.228  -3.185  1.00  0.89           C  
ATOM    687  C   ARG A  83      10.764 -13.763  -3.988  1.00  0.89           C  
ATOM    688  O   ARG A  83      11.300 -12.698  -3.715  1.00  0.89           O  
ATOM    689  CB  ARG A  83      10.063 -15.359  -2.270  1.00  0.89           C  
ATOM    690  CG  ARG A  83       9.109 -15.713  -1.126  1.00  0.89           C  
ATOM    691  CD  ARG A  83       9.726 -16.766  -0.216  1.00  0.89           C  
ATOM    692  NE  ARG A  83       8.754 -16.961   0.871  1.00  0.89           N  
ATOM    693  CZ  ARG A  83       8.818 -16.463   2.102  1.00  0.89           C  
ATOM    694  NH1 ARG A  83       9.672 -15.504   2.434  1.00  0.89           N  
ATOM    695  NH2 ARG A  83       7.963 -16.922   3.002  1.00  0.89           N  
ATOM    696  N   GLU A  84      11.184 -14.523  -5.014  1.00  0.89           N  
ATOM    697  CA  GLU A  84      12.326 -14.216  -5.858  1.00  0.89           C  
ATOM    698  C   GLU A  84      12.170 -12.920  -6.640  1.00  0.89           C  
ATOM    699  O   GLU A  84      13.110 -12.149  -6.806  1.00  0.89           O  
ATOM    700  CB  GLU A  84      12.579 -15.411  -6.796  1.00  0.89           C  
ATOM    701  CG  GLU A  84      12.911 -16.707  -6.014  1.00  0.89           C  
ATOM    702  CD  GLU A  84      13.226 -17.901  -6.918  1.00  0.89           C  
ATOM    703  OE1 GLU A  84      13.663 -18.934  -6.350  1.00  0.89           O  
ATOM    704  OE2 GLU A  84      13.023 -17.797  -8.152  1.00  0.89           O  
ATOM    705  N   ASN A  85      10.932 -12.632  -7.088  1.00  0.90           N  
ATOM    706  CA  ASN A  85      10.611 -11.466  -7.891  1.00  0.90           C  
ATOM    707  C   ASN A  85      10.387 -10.207  -7.065  1.00  0.90           C  
ATOM    708  O   ASN A  85      10.318  -9.104  -7.602  1.00  0.90           O  
ATOM    709  CB  ASN A  85       9.309 -11.706  -8.696  1.00  0.90           C  
ATOM    710  CG  ASN A  85       9.471 -12.902  -9.624  1.00  0.90           C  
ATOM    711  OD1 ASN A  85      10.559 -13.341  -9.971  1.00  0.90           O  
ATOM    712  ND2 ASN A  85       8.325 -13.459 -10.084  1.00  0.90           N  
ATOM    713  N   GLY A  86      10.245 -10.348  -5.731  1.00  0.94           N  
ATOM    714  CA  GLY A  86       9.956  -9.233  -4.836  1.00  0.94           C  
ATOM    715  C   GLY A  86       8.544  -8.707  -4.923  1.00  0.94           C  
ATOM    716  O   GLY A  86       8.281  -7.544  -4.627  1.00  0.94           O  
ATOM    717  N   THR A  87       7.590  -9.551  -5.359  1.00  0.94           N  
ATOM    718  CA  THR A  87       6.249  -9.122  -5.722  1.00  0.94           C  
ATOM    719  C   THR A  87       5.174  -9.753  -4.858  1.00  0.94           C  
ATOM    720  O   THR A  87       5.327 -10.835  -4.291  1.00  0.94           O  
ATOM    721  CB  THR A  87       5.885  -9.326  -7.203  1.00  0.94           C  
ATOM    722  OG1 THR A  87       6.137 -10.641  -7.665  1.00  0.94           O  
ATOM    723  CG2 THR A  87       6.738  -8.412  -8.089  1.00  0.94           C  
ATOM    724  N   ILE A  88       4.051  -9.024  -4.704  1.00  0.93           N  
ATOM    725  CA  ILE A  88       2.842  -9.449  -4.018  1.00  0.93           C  
ATOM    726  C   ILE A  88       1.716  -9.347  -5.035  1.00  0.93           C  
ATOM    727  O   ILE A  88       1.669  -8.395  -5.820  1.00  0.93           O  
ATOM    728  CB  ILE A  88       2.526  -8.591  -2.789  1.00  0.93           C  
ATOM    729  CG1 ILE A  88       3.576  -8.822  -1.682  1.00  0.93           C  
ATOM    730  CG2 ILE A  88       1.126  -8.932  -2.242  1.00  0.93           C  
ATOM    731  CD1 ILE A  88       3.431  -7.871  -0.488  1.00  0.93           C  
ATOM    732  N   SER A  89       0.779 -10.320  -5.070  1.00  0.90           N  
ATOM    733  CA  SER A  89      -0.351 -10.276  -5.989  1.00  0.90           C  
ATOM    734  C   SER A  89      -1.724 -10.447  -5.367  1.00  0.90           C  
ATOM    735  O   SER A  89      -1.911 -11.136  -4.366  1.00  0.90           O  
ATOM    736  CB  SER A  89      -0.216 -11.246  -7.181  1.00  0.90           C  
ATOM    737  OG  SER A  89      -0.269 -12.605  -6.763  1.00  0.90           O  
ATOM    738  N   ARG A  90      -2.739  -9.764  -5.949  1.00  0.82           N  
ATOM    739  CA  ARG A  90      -4.121  -9.781  -5.495  1.00  0.82           C  
ATOM    740  C   ARG A  90      -5.053 -10.101  -6.652  1.00  0.82           C  
ATOM    741  O   ARG A  90      -4.960  -9.500  -7.721  1.00  0.82           O  
ATOM    742  CB  ARG A  90      -4.532  -8.392  -4.932  1.00  0.82           C  
ATOM    743  CG  ARG A  90      -5.906  -8.326  -4.220  1.00  0.82           C  
ATOM    744  CD  ARG A  90      -6.209  -6.921  -3.683  1.00  0.82           C  
ATOM    745  NE  ARG A  90      -7.574  -6.897  -3.062  1.00  0.82           N  
ATOM    746  CZ  ARG A  90      -7.990  -5.868  -2.310  1.00  0.82           C  
ATOM    747  NH1 ARG A  90      -7.173  -4.879  -1.977  1.00  0.82           N  
ATOM    748  NH2 ARG A  90      -9.243  -5.809  -1.874  1.00  0.82           N  
ATOM    749  N   TYR A  91      -6.006 -11.032  -6.465  1.00  0.84           N  
ATOM    750  CA  TYR A  91      -7.049 -11.301  -7.442  1.00  0.84           C  
ATOM    751  C   TYR A  91      -8.232 -10.368  -7.205  1.00  0.84           C  
ATOM    752  O   TYR A  91      -8.811 -10.344  -6.119  1.00  0.84           O  
ATOM    753  CB  TYR A  91      -7.527 -12.771  -7.374  1.00  0.84           C  
ATOM    754  CG  TYR A  91      -6.586 -13.657  -8.139  1.00  0.84           C  
ATOM    755  CD1 TYR A  91      -6.937 -14.120  -9.418  1.00  0.84           C  
ATOM    756  CD2 TYR A  91      -5.353 -14.032  -7.591  1.00  0.84           C  
ATOM    757  CE1 TYR A  91      -6.086 -14.983 -10.125  1.00  0.84           C  
ATOM    758  CE2 TYR A  91      -4.509 -14.901  -8.284  1.00  0.84           C  
ATOM    759  CZ  TYR A  91      -4.858 -15.374  -9.550  1.00  0.84           C  
ATOM    760  OH  TYR A  91      -3.944 -16.136 -10.284  1.00  0.84           O  
ATOM    761  N   VAL A  92      -8.602  -9.557  -8.220  1.00  0.80           N  
ATOM    762  CA  VAL A  92      -9.705  -8.600  -8.166  1.00  0.80           C  
ATOM    763  C   VAL A  92     -10.372  -8.603  -9.523  1.00  0.80           C  
ATOM    764  O   VAL A  92      -9.720  -8.478 -10.556  1.00  0.80           O  
ATOM    765  CB  VAL A  92      -9.258  -7.171  -7.836  1.00  0.80           C  
ATOM    766  CG1 VAL A  92     -10.331  -6.095  -8.118  1.00  0.80           C  
ATOM    767  CG2 VAL A  92      -8.893  -7.112  -6.347  1.00  0.80           C  
ATOM    768  N   GLY A  93     -11.712  -8.768  -9.577  1.00  0.80           N  
ATOM    769  CA  GLY A  93     -12.471  -8.707 -10.832  1.00  0.80           C  
ATOM    770  C   GLY A  93     -12.172  -9.782 -11.847  1.00  0.80           C  
ATOM    771  O   GLY A  93     -12.388  -9.609 -13.038  1.00  0.80           O  
ATOM    772  N   GLY A  94     -11.647 -10.935 -11.388  1.00  0.81           N  
ATOM    773  CA  GLY A  94     -11.213 -12.013 -12.270  1.00  0.81           C  
ATOM    774  C   GLY A  94      -9.839 -11.807 -12.854  1.00  0.81           C  
ATOM    775  O   GLY A  94      -9.395 -12.596 -13.677  1.00  0.81           O  
ATOM    776  N   GLN A  95      -9.124 -10.746 -12.441  1.00  0.75           N  
ATOM    777  CA  GLN A  95      -7.803 -10.434 -12.944  1.00  0.75           C  
ATOM    778  C   GLN A  95      -6.818 -10.447 -11.797  1.00  0.75           C  
ATOM    779  O   GLN A  95      -7.135 -10.033 -10.680  1.00  0.75           O  
ATOM    780  CB  GLN A  95      -7.767  -9.028 -13.588  1.00  0.75           C  
ATOM    781  CG  GLN A  95      -8.687  -8.868 -14.819  1.00  0.75           C  
ATOM    782  CD  GLN A  95      -8.187  -9.718 -15.987  1.00  0.75           C  
ATOM    783  OE1 GLN A  95      -6.992  -9.792 -16.267  1.00  0.75           O  
ATOM    784  NE2 GLN A  95      -9.123 -10.383 -16.702  1.00  0.75           N  
ATOM    785  N   GLU A  96      -5.589 -10.934 -12.034  1.00  0.77           N  
ATOM    786  CA  GLU A  96      -4.539 -10.882 -11.035  1.00  0.77           C  
ATOM    787  C   GLU A  96      -3.728  -9.608 -11.192  1.00  0.77           C  
ATOM    788  O   GLU A  96      -3.225  -9.296 -12.269  1.00  0.77           O  
ATOM    789  CB  GLU A  96      -3.610 -12.116 -11.106  1.00  0.77           C  
ATOM    790  CG  GLU A  96      -2.667 -12.253  -9.888  1.00  0.77           C  
ATOM    791  CD  GLU A  96      -1.999 -13.623  -9.736  1.00  0.77           C  
ATOM    792  OE1 GLU A  96      -1.476 -13.850  -8.614  1.00  0.77           O  
ATOM    793  OE2 GLU A  96      -2.033 -14.470 -10.661  1.00  0.77           O  
ATOM    794  N   HIS A  97      -3.596  -8.821 -10.110  1.00  0.82           N  
ATOM    795  CA  HIS A  97      -2.890  -7.557 -10.109  1.00  0.82           C  
ATOM    796  C   HIS A  97      -1.625  -7.736  -9.295  1.00  0.82           C  
ATOM    797  O   HIS A  97      -1.686  -8.143  -8.134  1.00  0.82           O  
ATOM    798  CB  HIS A  97      -3.746  -6.454  -9.453  1.00  0.82           C  
ATOM    799  CG  HIS A  97      -4.987  -6.145 -10.230  1.00  0.82           C  
ATOM    800  ND1 HIS A  97      -5.011  -5.000 -11.005  1.00  0.82           N  
ATOM    801  CD2 HIS A  97      -6.162  -6.813 -10.340  1.00  0.82           C  
ATOM    802  CE1 HIS A  97      -6.199  -4.995 -11.572  1.00  0.82           C  
ATOM    803  NE2 HIS A  97      -6.942  -6.072 -11.205  1.00  0.82           N  
ATOM    804  N   PHE A  98      -0.448  -7.447  -9.884  1.00  0.88           N  
ATOM    805  CA  PHE A  98       0.852  -7.719  -9.292  1.00  0.88           C  
ATOM    806  C   PHE A  98       1.554  -6.420  -8.967  1.00  0.88           C  
ATOM    807  O   PHE A  98       1.582  -5.498  -9.780  1.00  0.88           O  
ATOM    808  CB  PHE A  98       1.814  -8.425 -10.287  1.00  0.88           C  
ATOM    809  CG  PHE A  98       1.554  -9.899 -10.411  1.00  0.88           C  
ATOM    810  CD1 PHE A  98       2.277 -10.799  -9.612  1.00  0.88           C  
ATOM    811  CD2 PHE A  98       0.642 -10.413 -11.345  1.00  0.88           C  
ATOM    812  CE1 PHE A  98       2.060 -12.178  -9.703  1.00  0.88           C  
ATOM    813  CE2 PHE A  98       0.457 -11.797 -11.467  1.00  0.88           C  
ATOM    814  CZ  PHE A  98       1.150 -12.679 -10.633  1.00  0.88           C  
ATOM    815  N   ALA A  99       2.193  -6.338  -7.789  1.00  0.93           N  
ATOM    816  CA  ALA A  99       2.976  -5.182  -7.435  1.00  0.93           C  
ATOM    817  C   ALA A  99       4.260  -5.576  -6.748  1.00  0.93           C  
ATOM    818  O   ALA A  99       4.301  -6.478  -5.911  1.00  0.93           O  
ATOM    819  CB  ALA A  99       2.217  -4.277  -6.458  1.00  0.93           C  
ATOM    820  N   HIS A 100       5.360  -4.891  -7.089  1.00  0.92           N  
ATOM    821  CA  HIS A 100       6.622  -4.996  -6.392  1.00  0.92           C  
ATOM    822  C   HIS A 100       6.579  -4.347  -5.033  1.00  0.92           C  
ATOM    823  O   HIS A 100       6.177  -3.191  -4.898  1.00  0.92           O  
ATOM    824  CB  HIS A 100       7.771  -4.359  -7.185  1.00  0.92           C  
ATOM    825  CG  HIS A 100       8.076  -5.103  -8.437  1.00  0.92           C  
ATOM    826  ND1 HIS A 100       7.455  -4.738  -9.615  1.00  0.92           N  
ATOM    827  CD2 HIS A 100       8.905  -6.152  -8.647  1.00  0.92           C  
ATOM    828  CE1 HIS A 100       7.924  -5.569 -10.516  1.00  0.92           C  
ATOM    829  NE2 HIS A 100       8.811  -6.450  -9.989  1.00  0.92           N  
ATOM    830  N   LEU A 101       7.013  -5.073  -3.990  1.00  0.94           N  
ATOM    831  CA  LEU A 101       7.071  -4.556  -2.640  1.00  0.94           C  
ATOM    832  C   LEU A 101       8.378  -3.806  -2.468  1.00  0.94           C  
ATOM    833  O   LEU A 101       9.462  -4.374  -2.592  1.00  0.94           O  
ATOM    834  CB  LEU A 101       6.953  -5.706  -1.607  1.00  0.94           C  
ATOM    835  CG  LEU A 101       7.090  -5.321  -0.116  1.00  0.94           C  
ATOM    836  CD1 LEU A 101       6.041  -4.296   0.337  1.00  0.94           C  
ATOM    837  CD2 LEU A 101       7.041  -6.582   0.763  1.00  0.94           C  
ATOM    838  N   LEU A 102       8.305  -2.491  -2.205  1.00  0.93           N  
ATOM    839  CA  LEU A 102       9.470  -1.636  -2.175  1.00  0.93           C  
ATOM    840  C   LEU A 102       9.645  -0.990  -0.819  1.00  0.93           C  
ATOM    841  O   LEU A 102       8.703  -0.499  -0.193  1.00  0.93           O  
ATOM    842  CB  LEU A 102       9.348  -0.516  -3.216  1.00  0.93           C  
ATOM    843  CG  LEU A 102       9.221  -0.979  -4.678  1.00  0.93           C  
ATOM    844  CD1 LEU A 102       9.053   0.278  -5.527  1.00  0.93           C  
ATOM    845  CD2 LEU A 102      10.426  -1.781  -5.186  1.00  0.93           C  
ATOM    846  N   ILE A 103      10.897  -0.981  -0.340  1.00  0.86           N  
ATOM    847  CA  ILE A 103      11.253  -0.569   0.998  1.00  0.86           C  
ATOM    848  C   ILE A 103      11.876   0.815   0.977  1.00  0.86           C  
ATOM    849  O   ILE A 103      12.755   1.115   0.170  1.00  0.86           O  
ATOM    850  CB  ILE A 103      12.176  -1.589   1.661  1.00  0.86           C  
ATOM    851  CG1 ILE A 103      11.518  -2.994   1.648  1.00  0.86           C  
ATOM    852  CG2 ILE A 103      12.556  -1.061   3.061  1.00  0.86           C  
ATOM    853  CD1 ILE A 103      12.306  -4.084   2.380  1.00  0.86           C  
ATOM    854  N   LEU A 104      11.402   1.702   1.870  1.00  0.83           N  
ATOM    855  CA  LEU A 104      11.948   3.019   2.113  1.00  0.83           C  
ATOM    856  C   LEU A 104      12.857   2.968   3.325  1.00  0.83           C  
ATOM    857  O   LEU A 104      12.956   1.945   3.997  1.00  0.83           O  
ATOM    858  CB  LEU A 104      10.803   4.026   2.329  1.00  0.83           C  
ATOM    859  CG  LEU A 104       9.982   4.313   1.059  1.00  0.83           C  
ATOM    860  CD1 LEU A 104       8.849   5.310   1.338  1.00  0.83           C  
ATOM    861  CD2 LEU A 104      10.901   4.843  -0.043  1.00  0.83           C  
ATOM    862  N   ARG A 105      13.623   4.043   3.605  1.00  0.77           N  
ATOM    863  CA  ARG A 105      14.596   4.028   4.683  1.00  0.77           C  
ATOM    864  C   ARG A 105      13.953   3.969   6.059  1.00  0.77           C  
ATOM    865  O   ARG A 105      14.439   3.292   6.962  1.00  0.77           O  
ATOM    866  CB  ARG A 105      15.528   5.258   4.635  1.00  0.77           C  
ATOM    867  CG  ARG A 105      16.320   5.445   3.324  1.00  0.77           C  
ATOM    868  CD  ARG A 105      17.114   6.749   3.359  1.00  0.77           C  
ATOM    869  NE  ARG A 105      17.737   6.955   2.009  1.00  0.77           N  
ATOM    870  CZ  ARG A 105      18.043   8.170   1.537  1.00  0.77           C  
ATOM    871  NH1 ARG A 105      18.092   9.222   2.343  1.00  0.77           N  
ATOM    872  NH2 ARG A 105      18.236   8.359   0.235  1.00  0.77           N  
ATOM    873  N   ASP A 106      12.832   4.697   6.234  1.00  0.85           N  
ATOM    874  CA  ASP A 106      11.963   4.530   7.375  1.00  0.85           C  
ATOM    875  C   ASP A 106      11.251   3.168   7.307  1.00  0.85           C  
ATOM    876  O   ASP A 106      10.630   2.797   6.315  1.00  0.85           O  
ATOM    877  CB  ASP A 106      10.992   5.739   7.492  1.00  0.85           C  
ATOM    878  CG  ASP A 106      10.273   5.805   8.832  1.00  0.85           C  
ATOM    879  OD1 ASP A 106      10.407   4.870   9.662  1.00  0.85           O  
ATOM    880  OD2 ASP A 106       9.547   6.807   9.045  1.00  0.85           O  
ATOM    881  N   THR A 107      11.320   2.386   8.401  1.00  0.87           N  
ATOM    882  CA  THR A 107      10.705   1.074   8.546  1.00  0.87           C  
ATOM    883  C   THR A 107       9.218   1.182   8.773  1.00  0.87           C  
ATOM    884  O   THR A 107       8.489   0.193   8.732  1.00  0.87           O  
ATOM    885  CB  THR A 107      11.296   0.261   9.692  1.00  0.87           C  
ATOM    886  OG1 THR A 107      11.325   1.001  10.909  1.00  0.87           O  
ATOM    887  CG2 THR A 107      12.751  -0.095   9.361  1.00  0.87           C  
ATOM    888  N   LYS A 108       8.734   2.413   9.003  1.00  0.89           N  
ATOM    889  CA  LYS A 108       7.337   2.708   9.182  1.00  0.89           C  
ATOM    890  C   LYS A 108       6.645   3.073   7.889  1.00  0.89           C  
ATOM    891  O   LYS A 108       5.467   3.424   7.891  1.00  0.89           O  
ATOM    892  CB  LYS A 108       7.207   3.903  10.133  1.00  0.89           C  
ATOM    893  CG  LYS A 108       7.738   3.559  11.523  1.00  0.89           C  
ATOM    894  CD  LYS A 108       7.665   4.746  12.476  1.00  0.89           C  
ATOM    895  CE  LYS A 108       8.135   4.332  13.858  1.00  0.89           C  
ATOM    896  NZ  LYS A 108       8.091   5.516  14.726  1.00  0.89           N  
ATOM    897  N   THR A 109       7.337   2.982   6.737  1.00  0.92           N  
ATOM    898  CA  THR A 109       6.758   3.287   5.441  1.00  0.92           C  
ATOM    899  C   THR A 109       7.130   2.216   4.439  1.00  0.92           C  
ATOM    900  O   THR A 109       8.176   1.582   4.514  1.00  0.92           O  
ATOM    901  CB  THR A 109       7.160   4.646   4.864  1.00  0.92           C  
ATOM    902  OG1 THR A 109       8.566   4.782   4.731  1.00  0.92           O  
ATOM    903  CG2 THR A 109       6.713   5.771   5.797  1.00  0.92           C  
ATOM    904  N   TYR A 110       6.262   1.979   3.438  1.00  0.93           N  
ATOM    905  CA  TYR A 110       6.544   1.035   2.373  1.00  0.93           C  
ATOM    906  C   TYR A 110       5.824   1.532   1.147  1.00  0.93           C  
ATOM    907  O   TYR A 110       4.890   2.334   1.232  1.00  0.93           O  
ATOM    908  CB  TYR A 110       6.046  -0.424   2.629  1.00  0.93           C  
ATOM    909  CG  TYR A 110       6.930  -1.138   3.604  1.00  0.93           C  
ATOM    910  CD1 TYR A 110       8.256  -1.410   3.260  1.00  0.93           C  
ATOM    911  CD2 TYR A 110       6.481  -1.523   4.873  1.00  0.93           C  
ATOM    912  CE1 TYR A 110       9.150  -1.883   4.226  1.00  0.93           C  
ATOM    913  CE2 TYR A 110       7.377  -2.006   5.839  1.00  0.93           C  
ATOM    914  CZ  TYR A 110       8.731  -2.126   5.532  1.00  0.93           C  
ATOM    915  OH  TYR A 110       9.671  -2.493   6.515  1.00  0.93           O  
ATOM    916  N   MET A 111       6.243   1.060  -0.037  1.00  0.93           N  
ATOM    917  CA  MET A 111       5.582   1.386  -1.278  1.00  0.93           C  
ATOM    918  C   MET A 111       5.269   0.122  -2.050  1.00  0.93           C  
ATOM    919  O   MET A 111       5.914  -0.915  -1.893  1.00  0.93           O  
ATOM    920  CB  MET A 111       6.458   2.261  -2.205  1.00  0.93           C  
ATOM    921  CG  MET A 111       6.723   3.683  -1.698  1.00  0.93           C  
ATOM    922  SD  MET A 111       7.698   4.690  -2.862  1.00  0.93           S  
ATOM    923  CE  MET A 111       9.183   3.651  -2.992  1.00  0.93           C  
ATOM    924  N   LEU A 112       4.268   0.201  -2.941  1.00  0.94           N  
ATOM    925  CA  LEU A 112       3.950  -0.854  -3.880  1.00  0.94           C  
ATOM    926  C   LEU A 112       4.081  -0.273  -5.267  1.00  0.94           C  
ATOM    927  O   LEU A 112       3.432   0.725  -5.589  1.00  0.94           O  
ATOM    928  CB  LEU A 112       2.515  -1.422  -3.724  1.00  0.94           C  
ATOM    929  CG  LEU A 112       2.236  -2.167  -2.404  1.00  0.94           C  
ATOM    930  CD1 LEU A 112       0.763  -2.598  -2.328  1.00  0.94           C  
ATOM    931  CD2 LEU A 112       3.150  -3.385  -2.218  1.00  0.94           C  
ATOM    932  N   ALA A 113       4.932  -0.878  -6.115  1.00  0.94           N  
ATOM    933  CA  ALA A 113       5.121  -0.436  -7.478  1.00  0.94           C  
ATOM    934  C   ALA A 113       4.410  -1.354  -8.442  1.00  0.94           C  
ATOM    935  O   ALA A 113       4.627  -2.562  -8.475  1.00  0.94           O  
ATOM    936  CB  ALA A 113       6.608  -0.341  -7.879  1.00  0.94           C  
ATOM    937  N   PHE A 114       3.538  -0.766  -9.265  1.00  0.90           N  
ATOM    938  CA  PHE A 114       2.758  -1.455 -10.258  1.00  0.90           C  
ATOM    939  C   PHE A 114       3.384  -1.110 -11.583  1.00  0.90           C  
ATOM    940  O   PHE A 114       3.879   0.002 -11.778  1.00  0.90           O  
ATOM    941  CB  PHE A 114       1.287  -1.001 -10.246  1.00  0.90           C  
ATOM    942  CG  PHE A 114       0.614  -1.461  -8.981  1.00  0.90           C  
ATOM    943  CD1 PHE A 114      -0.114  -2.657  -9.005  1.00  0.90           C  
ATOM    944  CD2 PHE A 114       0.656  -0.721  -7.784  1.00  0.90           C  
ATOM    945  CE1 PHE A 114      -0.855  -3.067  -7.893  1.00  0.90           C  
ATOM    946  CE2 PHE A 114      -0.078  -1.129  -6.663  1.00  0.90           C  
ATOM    947  CZ  PHE A 114      -0.845  -2.298  -6.723  1.00  0.90           C  
ATOM    948  N   ASP A 115       3.441  -2.097 -12.491  1.00  0.83           N  
ATOM    949  CA  ASP A 115       3.936  -1.965 -13.845  1.00  0.83           C  
ATOM    950  C   ASP A 115       5.316  -1.339 -14.007  1.00  0.83           C  
ATOM    951  O   ASP A 115       5.572  -0.581 -14.933  1.00  0.83           O  
ATOM    952  CB  ASP A 115       2.865  -1.297 -14.736  1.00  0.83           C  
ATOM    953  CG  ASP A 115       1.627  -2.175 -14.771  1.00  0.83           C  
ATOM    954  OD1 ASP A 115       1.792  -3.421 -14.696  1.00  0.83           O  
ATOM    955  OD2 ASP A 115       0.512  -1.607 -14.857  1.00  0.83           O  
ATOM    956  N   VAL A 116       6.301  -1.700 -13.153  1.00  0.81           N  
ATOM    957  CA  VAL A 116       7.606  -1.036 -13.135  1.00  0.81           C  
ATOM    958  C   VAL A 116       8.421  -1.215 -14.416  1.00  0.81           C  
ATOM    959  O   VAL A 116       9.274  -0.405 -14.757  1.00  0.81           O  
ATOM    960  CB  VAL A 116       8.414  -1.421 -11.892  1.00  0.81           C  
ATOM    961  CG1 VAL A 116       9.150  -2.766 -12.054  1.00  0.81           C  
ATOM    962  CG2 VAL A 116       9.378  -0.277 -11.517  1.00  0.81           C  
ATOM    963  N   ASN A 117       8.099  -2.279 -15.184  1.00  0.79           N  
ATOM    964  CA  ASN A 117       8.723  -2.609 -16.450  1.00  0.79           C  
ATOM    965  C   ASN A 117       7.962  -2.031 -17.639  1.00  0.79           C  
ATOM    966  O   ASN A 117       8.365  -2.229 -18.781  1.00  0.79           O  
ATOM    967  CB  ASN A 117       8.759  -4.147 -16.646  1.00  0.79           C  
ATOM    968  CG  ASN A 117       9.681  -4.789 -15.617  1.00  0.79           C  
ATOM    969  OD1 ASN A 117      10.721  -4.256 -15.246  1.00  0.79           O  
ATOM    970  ND2 ASN A 117       9.319  -6.008 -15.148  1.00  0.79           N  
ATOM    971  N   ASP A 118       6.856  -1.296 -17.408  1.00  0.82           N  
ATOM    972  CA  ASP A 118       6.146  -0.605 -18.458  1.00  0.82           C  
ATOM    973  C   ASP A 118       6.089   0.874 -18.086  1.00  0.82           C  
ATOM    974  O   ASP A 118       5.363   1.314 -17.196  1.00  0.82           O  
ATOM    975  CB  ASP A 118       4.741  -1.231 -18.692  1.00  0.82           C  
ATOM    976  CG  ASP A 118       3.957  -0.558 -19.814  1.00  0.82           C  
ATOM    977  OD1 ASP A 118       4.434   0.456 -20.391  1.00  0.82           O  
ATOM    978  OD2 ASP A 118       2.825  -1.026 -20.085  1.00  0.82           O  
ATOM    979  N   GLU A 119       6.831   1.715 -18.825  1.00  0.79           N  
ATOM    980  CA  GLU A 119       6.857   3.145 -18.630  1.00  0.79           C  
ATOM    981  C   GLU A 119       5.556   3.860 -18.957  1.00  0.79           C  
ATOM    982  O   GLU A 119       5.356   5.010 -18.571  1.00  0.79           O  
ATOM    983  CB  GLU A 119       7.936   3.781 -19.521  1.00  0.79           C  
ATOM    984  CG  GLU A 119       9.361   3.223 -19.325  1.00  0.79           C  
ATOM    985  CD  GLU A 119      10.376   4.067 -20.097  1.00  0.79           C  
ATOM    986  OE1 GLU A 119      11.592   3.789 -19.950  1.00  0.79           O  
ATOM    987  OE2 GLU A 119       9.945   5.004 -20.821  1.00  0.79           O  
ATOM    988  N   LYS A 120       4.620   3.227 -19.687  1.00  0.86           N  
ATOM    989  CA  LYS A 120       3.358   3.859 -20.005  1.00  0.86           C  
ATOM    990  C   LYS A 120       2.331   3.656 -18.917  1.00  0.86           C  
ATOM    991  O   LYS A 120       1.400   4.444 -18.788  1.00  0.86           O  
ATOM    992  CB  LYS A 120       2.800   3.290 -21.324  1.00  0.86           C  
ATOM    993  CG  LYS A 120       3.708   3.618 -22.517  1.00  0.86           C  
ATOM    994  CD  LYS A 120       3.162   3.071 -23.842  1.00  0.86           C  
ATOM    995  CE  LYS A 120       4.093   3.358 -25.019  1.00  0.86           C  
ATOM    996  NZ  LYS A 120       3.555   2.727 -26.243  1.00  0.86           N  
ATOM    997  N   ASN A 121       2.504   2.612 -18.087  1.00  0.88           N  
ATOM    998  CA  ASN A 121       1.504   2.233 -17.115  1.00  0.88           C  
ATOM    999  C   ASN A 121       1.991   2.315 -15.678  1.00  0.88           C  
ATOM   1000  O   ASN A 121       1.182   2.312 -14.753  1.00  0.88           O  
ATOM   1001  CB  ASN A 121       1.013   0.808 -17.447  1.00  0.88           C  
ATOM   1002  CG  ASN A 121       0.096   0.896 -18.661  1.00  0.88           C  
ATOM   1003  OD1 ASN A 121      -0.977   1.504 -18.593  1.00  0.88           O  
ATOM   1004  ND2 ASN A 121       0.485   0.299 -19.804  1.00  0.88           N  
ATOM   1005  N   TRP A 122       3.312   2.466 -15.448  1.00  0.88           N  
ATOM   1006  CA  TRP A 122       3.912   2.459 -14.123  1.00  0.88           C  
ATOM   1007  C   TRP A 122       3.303   3.369 -13.058  1.00  0.88           C  
ATOM   1008  O   TRP A 122       2.705   4.415 -13.332  1.00  0.88           O  
ATOM   1009  CB  TRP A 122       5.462   2.631 -14.168  1.00  0.88           C  
ATOM   1010  CG  TRP A 122       6.061   3.953 -14.643  1.00  0.88           C  
ATOM   1011  CD1 TRP A 122       5.496   5.194 -14.708  1.00  0.88           C  
ATOM   1012  CD2 TRP A 122       7.419   4.112 -15.101  1.00  0.88           C  
ATOM   1013  NE1 TRP A 122       6.408   6.107 -15.172  1.00  0.88           N  
ATOM   1014  CE2 TRP A 122       7.579   5.471 -15.447  1.00  0.88           C  
ATOM   1015  CE3 TRP A 122       8.482   3.220 -15.237  1.00  0.88           C  
ATOM   1016  CZ2 TRP A 122       8.778   5.951 -15.947  1.00  0.88           C  
ATOM   1017  CZ3 TRP A 122       9.710   3.724 -15.697  1.00  0.88           C  
ATOM   1018  CH2 TRP A 122       9.857   5.070 -16.058  1.00  0.88           C  
ATOM   1019  N   GLY A 123       3.453   2.999 -11.778  1.00  0.94           N  
ATOM   1020  CA  GLY A 123       3.061   3.910 -10.725  1.00  0.94           C  
ATOM   1021  C   GLY A 123       3.322   3.357  -9.368  1.00  0.94           C  
ATOM   1022  O   GLY A 123       3.663   2.187  -9.194  1.00  0.94           O  
ATOM   1023  N   LEU A 124       3.174   4.219  -8.355  1.00  0.94           N  
ATOM   1024  CA  LEU A 124       3.565   3.920  -6.997  1.00  0.94           C  
ATOM   1025  C   LEU A 124       2.453   4.253  -6.036  1.00  0.94           C  
ATOM   1026  O   LEU A 124       1.877   5.340  -6.080  1.00  0.94           O  
ATOM   1027  CB  LEU A 124       4.780   4.763  -6.542  1.00  0.94           C  
ATOM   1028  CG  LEU A 124       6.104   4.451  -7.248  1.00  0.94           C  
ATOM   1029  CD1 LEU A 124       7.149   5.528  -6.937  1.00  0.94           C  
ATOM   1030  CD2 LEU A 124       6.624   3.070  -6.852  1.00  0.94           C  
ATOM   1031  N   SER A 125       2.171   3.337  -5.098  1.00  0.95           N  
ATOM   1032  CA  SER A 125       1.263   3.586  -3.991  1.00  0.95           C  
ATOM   1033  C   SER A 125       2.077   3.590  -2.726  1.00  0.95           C  
ATOM   1034  O   SER A 125       2.942   2.735  -2.548  1.00  0.95           O  
ATOM   1035  CB  SER A 125       0.168   2.507  -3.796  1.00  0.95           C  
ATOM   1036  OG  SER A 125      -0.836   2.558  -4.806  1.00  0.95           O  
ATOM   1037  N   VAL A 126       1.831   4.547  -1.815  1.00  0.95           N  
ATOM   1038  CA  VAL A 126       2.650   4.759  -0.627  1.00  0.95           C  
ATOM   1039  C   VAL A 126       1.831   4.534   0.636  1.00  0.95           C  
ATOM   1040  O   VAL A 126       0.643   4.870   0.707  1.00  0.95           O  
ATOM   1041  CB  VAL A 126       3.315   6.136  -0.653  1.00  0.95           C  
ATOM   1042  CG1 VAL A 126       2.316   7.278  -0.457  1.00  0.95           C  
ATOM   1043  CG2 VAL A 126       4.439   6.308   0.382  1.00  0.95           C  
ATOM   1044  N   TYR A 127       2.443   3.908   1.663  1.00  0.95           N  
ATOM   1045  CA  TYR A 127       1.749   3.436   2.845  1.00  0.95           C  
ATOM   1046  C   TYR A 127       2.596   3.720   4.076  1.00  0.95           C  
ATOM   1047  O   TYR A 127       3.825   3.756   3.996  1.00  0.95           O  
ATOM   1048  CB  TYR A 127       1.512   1.900   2.804  1.00  0.95           C  
ATOM   1049  CG  TYR A 127       0.760   1.475   1.576  1.00  0.95           C  
ATOM   1050  CD1 TYR A 127      -0.628   1.303   1.622  1.00  0.95           C  
ATOM   1051  CD2 TYR A 127       1.436   1.228   0.370  1.00  0.95           C  
ATOM   1052  CE1 TYR A 127      -1.337   0.923   0.474  1.00  0.95           C  
ATOM   1053  CE2 TYR A 127       0.732   0.839  -0.775  1.00  0.95           C  
ATOM   1054  CZ  TYR A 127      -0.659   0.703  -0.726  1.00  0.95           C  
ATOM   1055  OH  TYR A 127      -1.386   0.349  -1.876  1.00  0.95           O  
ATOM   1056  N   ALA A 128       1.959   3.918   5.248  1.00  0.96           N  
ATOM   1057  CA  ALA A 128       2.650   4.199   6.493  1.00  0.96           C  
ATOM   1058  C   ALA A 128       1.973   3.507   7.670  1.00  0.96           C  
ATOM   1059  O   ALA A 128       0.860   2.994   7.533  1.00  0.96           O  
ATOM   1060  CB  ALA A 128       2.719   5.718   6.744  1.00  0.96           C  
ATOM   1061  N   ASP A 129       2.635   3.476   8.853  1.00  0.92           N  
ATOM   1062  CA  ASP A 129       2.131   2.898  10.093  1.00  0.92           C  
ATOM   1063  C   ASP A 129       1.042   3.761  10.734  1.00  0.92           C  
ATOM   1064  O   ASP A 129       0.297   3.325  11.609  1.00  0.92           O  
ATOM   1065  CB  ASP A 129       3.300   2.577  11.094  1.00  0.92           C  
ATOM   1066  CG  ASP A 129       3.965   3.768  11.792  1.00  0.92           C  
ATOM   1067  OD1 ASP A 129       3.963   4.890  11.225  1.00  0.92           O  
ATOM   1068  OD2 ASP A 129       4.509   3.582  12.917  1.00  0.92           O  
ATOM   1069  N   LYS A 130       0.912   5.017  10.268  1.00  0.91           N  
ATOM   1070  CA  LYS A 130      -0.004   6.010  10.770  1.00  0.91           C  
ATOM   1071  C   LYS A 130      -0.737   6.653   9.614  1.00  0.91           C  
ATOM   1072  O   LYS A 130      -0.277   6.549   8.477  1.00  0.91           O  
ATOM   1073  CB  LYS A 130       0.783   7.109  11.507  1.00  0.91           C  
ATOM   1074  CG  LYS A 130       1.344   6.583  12.827  1.00  0.91           C  
ATOM   1075  CD  LYS A 130       2.147   7.649  13.565  1.00  0.91           C  
ATOM   1076  CE  LYS A 130       2.777   7.095  14.833  1.00  0.91           C  
ATOM   1077  NZ  LYS A 130       3.416   8.214  15.549  1.00  0.91           N  
ATOM   1078  N   PRO A 131      -1.871   7.314   9.842  1.00  0.93           N  
ATOM   1079  CA  PRO A 131      -2.632   7.935   8.769  1.00  0.93           C  
ATOM   1080  C   PRO A 131      -2.014   9.245   8.318  1.00  0.93           C  
ATOM   1081  O   PRO A 131      -2.260   9.654   7.184  1.00  0.93           O  
ATOM   1082  CB  PRO A 131      -4.038   8.111   9.350  1.00  0.93           C  
ATOM   1083  CG  PRO A 131      -3.867   8.102  10.869  1.00  0.93           C  
ATOM   1084  CD  PRO A 131      -2.629   7.247  11.095  1.00  0.93           C  
ATOM   1085  N   GLU A 132      -1.214   9.910   9.166  1.00  0.84           N  
ATOM   1086  CA  GLU A 132      -0.486  11.111   8.821  1.00  0.84           C  
ATOM   1087  C   GLU A 132       1.004  10.820   8.767  1.00  0.84           C  
ATOM   1088  O   GLU A 132       1.578  10.147   9.625  1.00  0.84           O  
ATOM   1089  CB  GLU A 132      -0.732  12.272   9.818  1.00  0.84           C  
ATOM   1090  CG  GLU A 132      -2.228  12.639   9.990  1.00  0.84           C  
ATOM   1091  CD  GLU A 132      -2.981  11.798  11.026  1.00  0.84           C  
ATOM   1092  OE1 GLU A 132      -4.230  11.952  11.079  1.00  0.84           O  
ATOM   1093  OE2 GLU A 132      -2.334  11.011  11.769  1.00  0.84           O  
ATOM   1094  N   THR A 133       1.676  11.329   7.720  1.00  0.87           N  
ATOM   1095  CA  THR A 133       3.093  11.124   7.481  1.00  0.87           C  
ATOM   1096  C   THR A 133       3.888  12.377   7.769  1.00  0.87           C  
ATOM   1097  O   THR A 133       3.377  13.497   7.766  1.00  0.87           O  
ATOM   1098  CB  THR A 133       3.410  10.688   6.051  1.00  0.87           C  
ATOM   1099  OG1 THR A 133       2.835  11.554   5.078  1.00  0.87           O  
ATOM   1100  CG2 THR A 133       2.806   9.301   5.819  1.00  0.87           C  
ATOM   1101  N   THR A 134       5.199  12.209   8.035  1.00  0.82           N  
ATOM   1102  CA  THR A 134       6.138  13.311   8.159  1.00  0.82           C  
ATOM   1103  C   THR A 134       6.569  13.810   6.793  1.00  0.82           C  
ATOM   1104  O   THR A 134       6.356  13.158   5.768  1.00  0.82           O  
ATOM   1105  CB  THR A 134       7.382  13.036   9.017  1.00  0.82           C  
ATOM   1106  OG1 THR A 134       8.359  12.233   8.367  1.00  0.82           O  
ATOM   1107  CG2 THR A 134       6.972  12.372  10.346  1.00  0.82           C  
ATOM   1108  N   LYS A 135       7.208  15.000   6.729  1.00  0.78           N  
ATOM   1109  CA  LYS A 135       7.733  15.545   5.488  1.00  0.78           C  
ATOM   1110  C   LYS A 135       8.828  14.674   4.901  1.00  0.78           C  
ATOM   1111  O   LYS A 135       8.886  14.444   3.698  1.00  0.78           O  
ATOM   1112  CB  LYS A 135       8.261  16.987   5.676  1.00  0.78           C  
ATOM   1113  CG  LYS A 135       7.142  18.012   5.932  1.00  0.78           C  
ATOM   1114  CD  LYS A 135       7.674  19.455   6.008  1.00  0.78           C  
ATOM   1115  CE  LYS A 135       6.578  20.495   6.256  1.00  0.78           C  
ATOM   1116  NZ  LYS A 135       7.173  21.849   6.324  1.00  0.78           N  
ATOM   1117  N   GLU A 136       9.700  14.139   5.761  1.00  0.77           N  
ATOM   1118  CA  GLU A 136      10.795  13.257   5.431  1.00  0.77           C  
ATOM   1119  C   GLU A 136      10.322  11.948   4.810  1.00  0.77           C  
ATOM   1120  O   GLU A 136      10.802  11.529   3.760  1.00  0.77           O  
ATOM   1121  CB  GLU A 136      11.628  12.968   6.709  1.00  0.77           C  
ATOM   1122  CG  GLU A 136      12.188  14.228   7.436  1.00  0.77           C  
ATOM   1123  CD  GLU A 136      11.114  15.099   8.095  1.00  0.77           C  
ATOM   1124  OE1 GLU A 136      11.265  16.342   8.106  1.00  0.77           O  
ATOM   1125  OE2 GLU A 136      10.062  14.520   8.488  1.00  0.77           O  
ATOM   1126  N   GLN A 137       9.286  11.318   5.408  1.00  0.82           N  
ATOM   1127  CA  GLN A 137       8.648  10.113   4.901  1.00  0.82           C  
ATOM   1128  C   GLN A 137       8.005  10.310   3.541  1.00  0.82           C  
ATOM   1129  O   GLN A 137       8.101   9.477   2.641  1.00  0.82           O  
ATOM   1130  CB  GLN A 137       7.528   9.677   5.873  1.00  0.82           C  
ATOM   1131  CG  GLN A 137       8.044   9.078   7.197  1.00  0.82           C  
ATOM   1132  CD  GLN A 137       6.875   8.763   8.138  1.00  0.82           C  
ATOM   1133  OE1 GLN A 137       5.830   9.418   8.129  1.00  0.82           O  
ATOM   1134  NE2 GLN A 137       7.045   7.717   8.970  1.00  0.82           N  
ATOM   1135  N   LEU A 138       7.314  11.448   3.363  1.00  0.87           N  
ATOM   1136  CA  LEU A 138       6.723  11.824   2.098  1.00  0.87           C  
ATOM   1137  C   LEU A 138       7.759  12.210   1.038  1.00  0.87           C  
ATOM   1138  O   LEU A 138       7.582  11.946  -0.148  1.00  0.87           O  
ATOM   1139  CB  LEU A 138       5.666  12.921   2.342  1.00  0.87           C  
ATOM   1140  CG  LEU A 138       4.680  13.169   1.184  1.00  0.87           C  
ATOM   1141  CD1 LEU A 138       3.859  11.927   0.802  1.00  0.87           C  
ATOM   1142  CD2 LEU A 138       3.744  14.332   1.541  1.00  0.87           C  
ATOM   1143  N   GLY A 139       8.899  12.813   1.447  1.00  0.87           N  
ATOM   1144  CA  GLY A 139      10.047  13.117   0.590  1.00  0.87           C  
ATOM   1145  C   GLY A 139      10.630  11.929  -0.127  1.00  0.87           C  
ATOM   1146  O   GLY A 139      10.884  11.983  -1.325  1.00  0.87           O  
ATOM   1147  N   GLU A 140      10.797  10.800   0.585  1.00  0.79           N  
ATOM   1148  CA  GLU A 140      11.263   9.545   0.014  1.00  0.79           C  
ATOM   1149  C   GLU A 140      10.338   8.984  -1.076  1.00  0.79           C  
ATOM   1150  O   GLU A 140      10.780   8.454  -2.095  1.00  0.79           O  
ATOM   1151  CB  GLU A 140      11.505   8.485   1.118  1.00  0.79           C  
ATOM   1152  CG  GLU A 140      12.644   8.855   2.104  1.00  0.79           C  
ATOM   1153  CD  GLU A 140      13.107   7.692   2.983  1.00  0.79           C  
ATOM   1154  OE1 GLU A 140      13.470   7.946   4.159  1.00  0.79           O  
ATOM   1155  OE2 GLU A 140      13.174   6.537   2.481  1.00  0.79           O  
ATOM   1156  N   PHE A 141       9.004   9.124  -0.897  1.00  0.87           N  
ATOM   1157  CA  PHE A 141       8.006   8.848  -1.924  1.00  0.87           C  
ATOM   1158  C   PHE A 141       8.139   9.758  -3.143  1.00  0.87           C  
ATOM   1159  O   PHE A 141       8.089   9.294  -4.281  1.00  0.87           O  
ATOM   1160  CB  PHE A 141       6.587   8.959  -1.302  1.00  0.87           C  
ATOM   1161  CG  PHE A 141       5.442   8.807  -2.281  1.00  0.87           C  
ATOM   1162  CD1 PHE A 141       4.483   9.827  -2.413  1.00  0.87           C  
ATOM   1163  CD2 PHE A 141       5.318   7.662  -3.082  1.00  0.87           C  
ATOM   1164  CE1 PHE A 141       3.406   9.684  -3.295  1.00  0.87           C  
ATOM   1165  CE2 PHE A 141       4.238   7.515  -3.961  1.00  0.87           C  
ATOM   1166  CZ  PHE A 141       3.276   8.523  -4.063  1.00  0.87           C  
ATOM   1167  N   TYR A 142       8.342  11.075  -2.936  1.00  0.87           N  
ATOM   1168  CA  TYR A 142       8.568  12.013  -4.024  1.00  0.87           C  
ATOM   1169  C   TYR A 142       9.812  11.695  -4.842  1.00  0.87           C  
ATOM   1170  O   TYR A 142       9.732  11.628  -6.061  1.00  0.87           O  
ATOM   1171  CB  TYR A 142       8.627  13.477  -3.526  1.00  0.87           C  
ATOM   1172  CG  TYR A 142       7.334  13.967  -2.920  1.00  0.87           C  
ATOM   1173  CD1 TYR A 142       6.064  13.604  -3.410  1.00  0.87           C  
ATOM   1174  CD2 TYR A 142       7.408  14.913  -1.885  1.00  0.87           C  
ATOM   1175  CE1 TYR A 142       4.907  14.224  -2.921  1.00  0.87           C  
ATOM   1176  CE2 TYR A 142       6.255  15.528  -1.388  1.00  0.87           C  
ATOM   1177  CZ  TYR A 142       5.012  15.213  -1.936  1.00  0.87           C  
ATOM   1178  OH  TYR A 142       3.885  15.933  -1.515  1.00  0.87           O  
ATOM   1179  N   GLU A 143      10.954  11.366  -4.197  1.00  0.79           N  
ATOM   1180  CA  GLU A 143      12.179  10.948  -4.873  1.00  0.79           C  
ATOM   1181  C   GLU A 143      11.962   9.738  -5.793  1.00  0.79           C  
ATOM   1182  O   GLU A 143      12.427   9.680  -6.932  1.00  0.79           O  
ATOM   1183  CB  GLU A 143      13.275  10.587  -3.830  1.00  0.79           C  
ATOM   1184  CG  GLU A 143      13.885  11.786  -3.053  1.00  0.79           C  
ATOM   1185  CD  GLU A 143      14.967  11.384  -2.036  1.00  0.79           C  
ATOM   1186  OE1 GLU A 143      15.520  12.310  -1.385  1.00  0.79           O  
ATOM   1187  OE2 GLU A 143      15.280  10.170  -1.894  1.00  0.79           O  
ATOM   1188  N   ALA A 144      11.171   8.753  -5.321  1.00  0.88           N  
ATOM   1189  CA  ALA A 144      10.714   7.628  -6.108  1.00  0.88           C  
ATOM   1190  C   ALA A 144       9.824   8.000  -7.313  1.00  0.88           C  
ATOM   1191  O   ALA A 144      10.000   7.473  -8.410  1.00  0.88           O  
ATOM   1192  CB  ALA A 144      10.013   6.641  -5.156  1.00  0.88           C  
ATOM   1193  N   LEU A 145       8.867   8.942  -7.156  1.00  0.88           N  
ATOM   1194  CA  LEU A 145       8.084   9.512  -8.253  1.00  0.88           C  
ATOM   1195  C   LEU A 145       8.901  10.309  -9.274  1.00  0.88           C  
ATOM   1196  O   LEU A 145       8.703  10.171 -10.481  1.00  0.88           O  
ATOM   1197  CB  LEU A 145       6.936  10.416  -7.746  1.00  0.88           C  
ATOM   1198  CG  LEU A 145       5.791   9.696  -7.010  1.00  0.88           C  
ATOM   1199  CD1 LEU A 145       4.846  10.755  -6.435  1.00  0.88           C  
ATOM   1200  CD2 LEU A 145       5.008   8.733  -7.916  1.00  0.88           C  
ATOM   1201  N   ASP A 146       9.867  11.131  -8.819  1.00  0.86           N  
ATOM   1202  CA  ASP A 146      10.804  11.880  -9.645  1.00  0.86           C  
ATOM   1203  C   ASP A 146      11.665  10.981 -10.525  1.00  0.86           C  
ATOM   1204  O   ASP A 146      11.914  11.266 -11.704  1.00  0.86           O  
ATOM   1205  CB  ASP A 146      11.714  12.766  -8.764  1.00  0.86           C  
ATOM   1206  CG  ASP A 146      10.926  13.919  -8.145  1.00  0.86           C  
ATOM   1207  OD1 ASP A 146       9.817  14.238  -8.647  1.00  0.86           O  
ATOM   1208  OD2 ASP A 146      11.455  14.527  -7.181  1.00  0.86           O  
ATOM   1209  N   CYS A 147      12.092   9.813  -9.993  1.00  0.86           N  
ATOM   1210  CA  CYS A 147      12.702   8.747 -10.783  1.00  0.86           C  
ATOM   1211  C   CYS A 147      11.786   8.275 -11.912  1.00  0.86           C  
ATOM   1212  O   CYS A 147      12.216   8.198 -13.059  1.00  0.86           O  
ATOM   1213  CB  CYS A 147      13.136   7.520  -9.925  1.00  0.86           C  
ATOM   1214  SG  CYS A 147      13.616   6.045 -10.916  1.00  0.86           S  
ATOM   1215  N   LEU A 148      10.484   8.042 -11.639  1.00  0.88           N  
ATOM   1216  CA  LEU A 148       9.560   7.516 -12.634  1.00  0.88           C  
ATOM   1217  C   LEU A 148       8.992   8.616 -13.515  1.00  0.88           C  
ATOM   1218  O   LEU A 148       8.143   8.398 -14.376  1.00  0.88           O  
ATOM   1219  CB  LEU A 148       8.351   6.817 -11.961  1.00  0.88           C  
ATOM   1220  CG  LEU A 148       8.668   5.529 -11.184  1.00  0.88           C  
ATOM   1221  CD1 LEU A 148       7.373   4.889 -10.669  1.00  0.88           C  
ATOM   1222  CD2 LEU A 148       9.428   4.523 -12.050  1.00  0.88           C  
ATOM   1223  N   ARG A 149       9.457   9.865 -13.320  1.00  0.82           N  
ATOM   1224  CA  ARG A 149       9.021  11.026 -14.063  1.00  0.82           C  
ATOM   1225  C   ARG A 149       7.503  11.169 -14.018  1.00  0.82           C  
ATOM   1226  O   ARG A 149       6.836  11.303 -15.047  1.00  0.82           O  
ATOM   1227  CB  ARG A 149       9.564  11.024 -15.518  1.00  0.82           C  
ATOM   1228  CG  ARG A 149      11.100  10.991 -15.659  1.00  0.82           C  
ATOM   1229  CD  ARG A 149      11.803  12.243 -15.130  1.00  0.82           C  
ATOM   1230  NE  ARG A 149      13.245  12.150 -15.540  1.00  0.82           N  
ATOM   1231  CZ  ARG A 149      14.213  11.579 -14.810  1.00  0.82           C  
ATOM   1232  NH1 ARG A 149      15.448  11.526 -15.315  1.00  0.82           N  
ATOM   1233  NH2 ARG A 149      14.006  11.070 -13.601  1.00  0.82           N  
ATOM   1234  N   ILE A 150       6.940  11.077 -12.800  1.00  0.90           N  
ATOM   1235  CA  ILE A 150       5.525  11.223 -12.538  1.00  0.90           C  
ATOM   1236  C   ILE A 150       5.427  12.529 -11.778  1.00  0.90           C  
ATOM   1237  O   ILE A 150       5.965  12.601 -10.672  1.00  0.90           O  
ATOM   1238  CB  ILE A 150       4.931  10.087 -11.706  1.00  0.90           C  
ATOM   1239  CG1 ILE A 150       4.943   8.773 -12.521  1.00  0.90           C  
ATOM   1240  CG2 ILE A 150       3.494  10.452 -11.272  1.00  0.90           C  
ATOM   1241  CD1 ILE A 150       4.443   7.537 -11.762  1.00  0.90           C  
ATOM   1242  N   PRO A 151       4.833  13.593 -12.302  1.00  0.92           N  
ATOM   1243  CA  PRO A 151       4.592  14.828 -11.563  1.00  0.92           C  
ATOM   1244  C   PRO A 151       3.995  14.678 -10.164  1.00  0.92           C  
ATOM   1245  O   PRO A 151       3.070  13.897  -9.953  1.00  0.92           O  
ATOM   1246  CB  PRO A 151       3.690  15.653 -12.502  1.00  0.92           C  
ATOM   1247  CG  PRO A 151       3.941  15.084 -13.902  1.00  0.92           C  
ATOM   1248  CD  PRO A 151       4.170  13.609 -13.608  1.00  0.92           C  
ATOM   1249  N   LYS A 152       4.453  15.480  -9.181  1.00  0.89           N  
ATOM   1250  CA  LYS A 152       3.884  15.500  -7.841  1.00  0.89           C  
ATOM   1251  C   LYS A 152       2.462  16.072  -7.776  1.00  0.89           C  
ATOM   1252  O   LYS A 152       1.769  15.935  -6.771  1.00  0.89           O  
ATOM   1253  CB  LYS A 152       4.801  16.300  -6.885  1.00  0.89           C  
ATOM   1254  CG  LYS A 152       4.867  17.803  -7.196  1.00  0.89           C  
ATOM   1255  CD  LYS A 152       5.821  18.549  -6.254  1.00  0.89           C  
ATOM   1256  CE  LYS A 152       5.867  20.051  -6.532  1.00  0.89           C  
ATOM   1257  NZ  LYS A 152       6.839  20.707  -5.632  1.00  0.89           N  
ATOM   1258  N   SER A 153       2.011  16.735  -8.866  1.00  0.87           N  
ATOM   1259  CA  SER A 153       0.679  17.259  -9.074  1.00  0.87           C  
ATOM   1260  C   SER A 153      -0.326  16.164  -9.349  1.00  0.87           C  
ATOM   1261  O   SER A 153      -1.512  16.337  -9.088  1.00  0.87           O  
ATOM   1262  CB  SER A 153       0.629  18.317 -10.234  1.00  0.87           C  
ATOM   1263  OG  SER A 153       1.501  17.973 -11.283  1.00  0.87           O  
ATOM   1264  N   ASP A 154       0.140  14.983  -9.795  1.00  0.90           N  
ATOM   1265  CA  ASP A 154      -0.722  13.878 -10.166  1.00  0.90           C  
ATOM   1266  C   ASP A 154      -0.941  12.924  -8.986  1.00  0.90           C  
ATOM   1267  O   ASP A 154      -1.626  11.907  -9.091  1.00  0.90           O  
ATOM   1268  CB  ASP A 154      -0.076  13.092 -11.338  1.00  0.90           C  
ATOM   1269  CG  ASP A 154       0.180  13.933 -12.589  1.00  0.90           C  
ATOM   1270  OD1 ASP A 154      -0.222  15.123 -12.654  1.00  0.90           O  
ATOM   1271  OD2 ASP A 154       0.844  13.375 -13.501  1.00  0.90           O  
ATOM   1272  N   VAL A 155      -0.365  13.238  -7.806  1.00  0.91           N  
ATOM   1273  CA  VAL A 155      -0.525  12.451  -6.592  1.00  0.91           C  
ATOM   1274  C   VAL A 155      -1.898  12.610  -5.955  1.00  0.91           C  
ATOM   1275  O   VAL A 155      -2.313  13.692  -5.539  1.00  0.91           O  
ATOM   1276  CB  VAL A 155       0.550  12.730  -5.546  1.00  0.91           C  
ATOM   1277  CG1 VAL A 155       0.382  11.790  -4.339  1.00  0.91           C  
ATOM   1278  CG2 VAL A 155       1.943  12.515  -6.153  1.00  0.91           C  
ATOM   1279  N   VAL A 156      -2.626  11.489  -5.817  1.00  0.91           N  
ATOM   1280  CA  VAL A 156      -3.899  11.427  -5.127  1.00  0.91           C  
ATOM   1281  C   VAL A 156      -3.609  11.067  -3.678  1.00  0.91           C  
ATOM   1282  O   VAL A 156      -2.874  10.119  -3.411  1.00  0.91           O  
ATOM   1283  CB  VAL A 156      -4.846  10.416  -5.768  1.00  0.91           C  
ATOM   1284  CG1 VAL A 156      -6.175  10.343  -4.989  1.00  0.91           C  
ATOM   1285  CG2 VAL A 156      -5.096  10.836  -7.231  1.00  0.91           C  
ATOM   1286  N   TYR A 157      -4.155  11.828  -2.707  1.00  0.92           N  
ATOM   1287  CA  TYR A 157      -3.944  11.621  -1.283  1.00  0.92           C  
ATOM   1288  C   TYR A 157      -5.238  11.205  -0.625  1.00  0.92           C  
ATOM   1289  O   TYR A 157      -6.320  11.665  -0.995  1.00  0.92           O  
ATOM   1290  CB  TYR A 157      -3.532  12.908  -0.521  1.00  0.92           C  
ATOM   1291  CG  TYR A 157      -2.190  13.371  -0.963  1.00  0.92           C  
ATOM   1292  CD1 TYR A 157      -1.043  12.914  -0.301  1.00  0.92           C  
ATOM   1293  CD2 TYR A 157      -2.058  14.215  -2.075  1.00  0.92           C  
ATOM   1294  CE1 TYR A 157       0.227  13.257  -0.775  1.00  0.92           C  
ATOM   1295  CE2 TYR A 157      -0.790  14.565  -2.549  1.00  0.92           C  
ATOM   1296  CZ  TYR A 157       0.347  14.071  -1.903  1.00  0.92           C  
ATOM   1297  OH  TYR A 157       1.616  14.327  -2.430  1.00  0.92           O  
ATOM   1298  N   THR A 158      -5.148  10.344   0.403  1.00  0.93           N  
ATOM   1299  CA  THR A 158      -6.248  10.075   1.312  1.00  0.93           C  
ATOM   1300  C   THR A 158      -6.476  11.226   2.260  1.00  0.93           C  
ATOM   1301  O   THR A 158      -5.586  12.028   2.539  1.00  0.93           O  
ATOM   1302  CB  THR A 158      -6.101   8.797   2.135  1.00  0.93           C  
ATOM   1303  OG1 THR A 158      -4.878   8.737   2.847  1.00  0.93           O  
ATOM   1304  CG2 THR A 158      -6.115   7.607   1.182  1.00  0.93           C  
ATOM   1305  N   ASP A 159      -7.705  11.342   2.779  1.00  0.91           N  
ATOM   1306  CA  ASP A 159      -8.023  12.266   3.836  1.00  0.91           C  
ATOM   1307  C   ASP A 159      -8.539  11.387   4.962  1.00  0.91           C  
ATOM   1308  O   ASP A 159      -9.592  10.756   4.862  1.00  0.91           O  
ATOM   1309  CB  ASP A 159      -9.044  13.323   3.334  1.00  0.91           C  
ATOM   1310  CG  ASP A 159      -9.441  14.352   4.383  1.00  0.91           C  
ATOM   1311  OD1 ASP A 159      -8.955  14.283   5.542  1.00  0.91           O  
ATOM   1312  OD2 ASP A 159     -10.290  15.210   4.022  1.00  0.91           O  
ATOM   1313  N   TRP A 160      -7.791  11.310   6.079  1.00  0.87           N  
ATOM   1314  CA  TRP A 160      -8.147  10.505   7.233  1.00  0.87           C  
ATOM   1315  C   TRP A 160      -9.392  11.019   7.955  1.00  0.87           C  
ATOM   1316  O   TRP A 160     -10.118  10.260   8.590  1.00  0.87           O  
ATOM   1317  CB  TRP A 160      -6.931  10.369   8.192  1.00  0.87           C  
ATOM   1318  CG  TRP A 160      -7.137   9.447   9.390  1.00  0.87           C  
ATOM   1319  CD1 TRP A 160      -7.103   9.748  10.725  1.00  0.87           C  
ATOM   1320  CD2 TRP A 160      -7.489   8.054   9.300  1.00  0.87           C  
ATOM   1321  NE1 TRP A 160      -7.476   8.646  11.469  1.00  0.87           N  
ATOM   1322  CE2 TRP A 160      -7.730   7.604  10.615  1.00  0.87           C  
ATOM   1323  CE3 TRP A 160      -7.638   7.197   8.213  1.00  0.87           C  
ATOM   1324  CZ2 TRP A 160      -8.161   6.309  10.860  1.00  0.87           C  
ATOM   1325  CZ3 TRP A 160      -8.075   5.890   8.461  1.00  0.87           C  
ATOM   1326  CH2 TRP A 160      -8.351   5.455   9.765  1.00  0.87           C  
ATOM   1327  N   LYS A 161      -9.740  12.315   7.797  1.00  0.86           N  
ATOM   1328  CA  LYS A 161     -10.921  12.904   8.410  1.00  0.86           C  
ATOM   1329  C   LYS A 161     -12.208  12.425   7.764  1.00  0.86           C  
ATOM   1330  O   LYS A 161     -13.303  12.589   8.297  1.00  0.86           O  
ATOM   1331  CB  LYS A 161     -10.875  14.441   8.289  1.00  0.86           C  
ATOM   1332  CG  LYS A 161      -9.671  15.071   9.002  1.00  0.86           C  
ATOM   1333  CD  LYS A 161      -9.589  16.584   8.751  1.00  0.86           C  
ATOM   1334  CE  LYS A 161      -8.375  17.225   9.418  1.00  0.86           C  
ATOM   1335  NZ  LYS A 161      -8.280  18.642   9.008  1.00  0.86           N  
ATOM   1336  N   LYS A 162     -12.088  11.793   6.585  1.00  0.86           N  
ATOM   1337  CA  LYS A 162     -13.213  11.232   5.892  1.00  0.86           C  
ATOM   1338  C   LYS A 162     -13.422   9.766   6.196  1.00  0.86           C  
ATOM   1339  O   LYS A 162     -14.357   9.186   5.655  1.00  0.86           O  
ATOM   1340  CB  LYS A 162     -13.050  11.401   4.368  1.00  0.86           C  
ATOM   1341  CG  LYS A 162     -13.094  12.874   3.954  1.00  0.86           C  
ATOM   1342  CD  LYS A 162     -12.987  13.073   2.438  1.00  0.86           C  
ATOM   1343  CE  LYS A 162     -12.993  14.558   2.079  1.00  0.86           C  
ATOM   1344  NZ  LYS A 162     -12.620  14.734   0.662  1.00  0.86           N  
ATOM   1345  N   ASP A 163     -12.611   9.126   7.074  1.00  0.88           N  
ATOM   1346  CA  ASP A 163     -12.794   7.721   7.398  1.00  0.88           C  
ATOM   1347  C   ASP A 163     -14.191   7.380   7.953  1.00  0.88           C  
ATOM   1348  O   ASP A 163     -14.856   8.162   8.637  1.00  0.88           O  
ATOM   1349  CB  ASP A 163     -11.658   7.168   8.307  1.00  0.88           C  
ATOM   1350  CG  ASP A 163     -11.797   5.657   8.393  1.00  0.88           C  
ATOM   1351  OD1 ASP A 163     -11.713   5.017   7.311  1.00  0.88           O  
ATOM   1352  OD2 ASP A 163     -12.147   5.129   9.478  1.00  0.88           O  
ATOM   1353  N   LYS A 164     -14.681   6.178   7.593  1.00  0.85           N  
ATOM   1354  CA  LYS A 164     -15.942   5.643   8.041  1.00  0.85           C  
ATOM   1355  C   LYS A 164     -15.762   4.234   8.557  1.00  0.85           C  
ATOM   1356  O   LYS A 164     -16.730   3.566   8.920  1.00  0.85           O  
ATOM   1357  CB  LYS A 164     -16.937   5.604   6.854  1.00  0.85           C  
ATOM   1358  CG  LYS A 164     -17.241   6.980   6.240  1.00  0.85           C  
ATOM   1359  CD  LYS A 164     -17.906   7.964   7.210  1.00  0.85           C  
ATOM   1360  CE  LYS A 164     -18.040   9.365   6.616  1.00  0.85           C  
ATOM   1361  NZ  LYS A 164     -18.291  10.321   7.714  1.00  0.85           N  
ATOM   1362  N   CYS A 165     -14.516   3.735   8.619  1.00  0.92           N  
ATOM   1363  CA  CYS A 165     -14.266   2.336   8.881  1.00  0.92           C  
ATOM   1364  C   CYS A 165     -13.749   2.077  10.277  1.00  0.92           C  
ATOM   1365  O   CYS A 165     -13.813   0.944  10.757  1.00  0.92           O  
ATOM   1366  CB  CYS A 165     -13.241   1.769   7.886  1.00  0.92           C  
ATOM   1367  SG  CYS A 165     -13.890   1.420   6.226  1.00  0.92           S  
ATOM   1368  N   GLU A 166     -13.314   3.117  11.005  1.00  0.84           N  
ATOM   1369  CA  GLU A 166     -12.978   3.015  12.419  1.00  0.84           C  
ATOM   1370  C   GLU A 166     -14.090   2.433  13.324  1.00  0.84           C  
ATOM   1371  O   GLU A 166     -13.762   1.597  14.171  1.00  0.84           O  
ATOM   1372  CB  GLU A 166     -12.482   4.377  12.980  1.00  0.84           C  
ATOM   1373  CG  GLU A 166     -11.637   4.246  14.274  1.00  0.84           C  
ATOM   1374  CD  GLU A 166     -11.501   5.539  15.080  1.00  0.84           C  
ATOM   1375  OE1 GLU A 166     -10.966   5.442  16.222  1.00  0.84           O  
ATOM   1376  OE2 GLU A 166     -12.017   6.597  14.658  1.00  0.84           O  
ATOM   1377  N   PRO A 167     -15.402   2.735  13.227  1.00  0.87           N  
ATOM   1378  CA  PRO A 167     -16.442   2.027  13.976  1.00  0.87           C  
ATOM   1379  C   PRO A 167     -16.521   0.535  13.696  1.00  0.87           C  
ATOM   1380  O   PRO A 167     -16.725  -0.236  14.632  1.00  0.87           O  
ATOM   1381  CB  PRO A 167     -17.752   2.736  13.579  1.00  0.87           C  
ATOM   1382  CG  PRO A 167     -17.310   4.125  13.114  1.00  0.87           C  
ATOM   1383  CD  PRO A 167     -15.973   3.832  12.442  1.00  0.87           C  
ATOM   1384  N   LEU A 168     -16.387   0.116  12.420  1.00  0.86           N  
ATOM   1385  CA  LEU A 168     -16.436  -1.280  12.002  1.00  0.86           C  
ATOM   1386  C   LEU A 168     -15.229  -2.074  12.491  1.00  0.86           C  
ATOM   1387  O   LEU A 168     -15.354  -3.197  12.975  1.00  0.86           O  
ATOM   1388  CB  LEU A 168     -16.597  -1.390  10.465  1.00  0.86           C  
ATOM   1389  CG  LEU A 168     -16.778  -2.822   9.909  1.00  0.86           C  
ATOM   1390  CD1 LEU A 168     -18.008  -3.538  10.485  1.00  0.86           C  
ATOM   1391  CD2 LEU A 168     -16.851  -2.792   8.376  1.00  0.86           C  
ATOM   1392  N   GLU A 169     -14.021  -1.467  12.436  1.00  0.86           N  
ATOM   1393  CA  GLU A 169     -12.799  -2.039  12.988  1.00  0.86           C  
ATOM   1394  C   GLU A 169     -12.907  -2.319  14.478  1.00  0.86           C  
ATOM   1395  O   GLU A 169     -12.607  -3.419  14.940  1.00  0.86           O  
ATOM   1396  CB  GLU A 169     -11.601  -1.094  12.727  1.00  0.86           C  
ATOM   1397  CG  GLU A 169     -10.297  -1.464  13.478  1.00  0.86           C  
ATOM   1398  CD  GLU A 169      -9.123  -0.588  13.093  1.00  0.86           C  
ATOM   1399  OE1 GLU A 169      -8.069  -1.159  12.694  1.00  0.86           O  
ATOM   1400  OE2 GLU A 169      -9.189   0.664  13.186  1.00  0.86           O  
ATOM   1401  N   LYS A 170     -13.442  -1.348  15.248  1.00  0.82           N  
ATOM   1402  CA  LYS A 170     -13.734  -1.490  16.664  1.00  0.82           C  
ATOM   1403  C   LYS A 170     -14.729  -2.593  16.980  1.00  0.82           C  
ATOM   1404  O   LYS A 170     -14.611  -3.280  17.994  1.00  0.82           O  
ATOM   1405  CB  LYS A 170     -14.250  -0.156  17.252  1.00  0.82           C  
ATOM   1406  CG  LYS A 170     -13.115   0.864  17.397  1.00  0.82           C  
ATOM   1407  CD  LYS A 170     -13.593   2.274  17.777  1.00  0.82           C  
ATOM   1408  CE  LYS A 170     -12.417   3.246  17.884  1.00  0.82           C  
ATOM   1409  NZ  LYS A 170     -12.864   4.652  17.792  1.00  0.82           N  
ATOM   1410  N   GLN A 171     -15.753  -2.794  16.128  1.00  0.79           N  
ATOM   1411  CA  GLN A 171     -16.641  -3.933  16.253  1.00  0.79           C  
ATOM   1412  C   GLN A 171     -15.934  -5.268  16.030  1.00  0.79           C  
ATOM   1413  O   GLN A 171     -15.997  -6.162  16.871  1.00  0.79           O  
ATOM   1414  CB  GLN A 171     -17.828  -3.799  15.277  1.00  0.79           C  
ATOM   1415  CG  GLN A 171     -18.805  -4.987  15.368  1.00  0.79           C  
ATOM   1416  CD  GLN A 171     -19.998  -4.853  14.424  1.00  0.79           C  
ATOM   1417  OE1 GLN A 171     -20.352  -3.786  13.919  1.00  0.79           O  
ATOM   1418  NE2 GLN A 171     -20.662  -6.007  14.193  1.00  0.79           N  
ATOM   1419  N   HIS A 172     -15.158  -5.391  14.933  1.00  0.81           N  
ATOM   1420  CA  HIS A 172     -14.396  -6.591  14.619  1.00  0.81           C  
ATOM   1421  C   HIS A 172     -13.323  -6.933  15.647  1.00  0.81           C  
ATOM   1422  O   HIS A 172     -13.036  -8.096  15.918  1.00  0.81           O  
ATOM   1423  CB  HIS A 172     -13.746  -6.503  13.229  1.00  0.81           C  
ATOM   1424  CG  HIS A 172     -14.715  -6.512  12.098  1.00  0.81           C  
ATOM   1425  ND1 HIS A 172     -14.218  -6.154  10.863  1.00  0.81           N  
ATOM   1426  CD2 HIS A 172     -16.006  -6.908  11.991  1.00  0.81           C  
ATOM   1427  CE1 HIS A 172     -15.218  -6.326  10.030  1.00  0.81           C  
ATOM   1428  NE2 HIS A 172     -16.329  -6.787  10.656  1.00  0.81           N  
ATOM   1429  N   GLU A 173     -12.680  -5.921  16.259  1.00  0.78           N  
ATOM   1430  CA  GLU A 173     -11.810  -6.094  17.408  1.00  0.78           C  
ATOM   1431  C   GLU A 173     -12.492  -6.689  18.630  1.00  0.78           C  
ATOM   1432  O   GLU A 173     -11.937  -7.561  19.296  1.00  0.78           O  
ATOM   1433  CB  GLU A 173     -11.170  -4.757  17.822  1.00  0.78           C  
ATOM   1434  CG  GLU A 173     -10.006  -4.323  16.909  1.00  0.78           C  
ATOM   1435  CD  GLU A 173      -9.238  -3.138  17.491  1.00  0.78           C  
ATOM   1436  OE1 GLU A 173      -8.218  -2.773  16.862  1.00  0.78           O  
ATOM   1437  OE2 GLU A 173      -9.613  -2.659  18.595  1.00  0.78           O  
ATOM   1438  N   LYS A 174     -13.721  -6.244  18.957  1.00  0.81           N  
ATOM   1439  CA  LYS A 174     -14.503  -6.827  20.032  1.00  0.81           C  
ATOM   1440  C   LYS A 174     -14.885  -8.271  19.776  1.00  0.81           C  
ATOM   1441  O   LYS A 174     -14.729  -9.114  20.655  1.00  0.81           O  
ATOM   1442  CB  LYS A 174     -15.781  -6.008  20.298  1.00  0.81           C  
ATOM   1443  CG  LYS A 174     -15.490  -4.641  20.931  1.00  0.81           C  
ATOM   1444  CD  LYS A 174     -16.749  -3.765  20.995  1.00  0.81           C  
ATOM   1445  CE  LYS A 174     -16.489  -2.377  21.579  1.00  0.81           C  
ATOM   1446  NZ  LYS A 174     -17.750  -1.604  21.592  1.00  0.81           N  
ATOM   1447  N   GLU A 175     -15.340  -8.586  18.549  1.00  0.81           N  
ATOM   1448  CA  GLU A 175     -15.704  -9.931  18.142  1.00  0.81           C  
ATOM   1449  C   GLU A 175     -14.538 -10.912  18.234  1.00  0.81           C  
ATOM   1450  O   GLU A 175     -14.657 -11.963  18.856  1.00  0.81           O  
ATOM   1451  CB  GLU A 175     -16.281  -9.879  16.708  1.00  0.81           C  
ATOM   1452  CG  GLU A 175     -17.654  -9.154  16.635  1.00  0.81           C  
ATOM   1453  CD  GLU A 175     -18.092  -8.740  15.227  1.00  0.81           C  
ATOM   1454  OE1 GLU A 175     -19.224  -8.193  15.112  1.00  0.81           O  
ATOM   1455  OE2 GLU A 175     -17.305  -8.913  14.265  1.00  0.81           O  
ATOM   1456  N   ARG A 176     -13.339 -10.531  17.732  1.00  0.76           N  
ATOM   1457  CA  ARG A 176     -12.126 -11.331  17.880  1.00  0.76           C  
ATOM   1458  C   ARG A 176     -11.729 -11.576  19.336  1.00  0.76           C  
ATOM   1459  O   ARG A 176     -11.442 -12.699  19.733  1.00  0.76           O  
ATOM   1460  CB  ARG A 176     -10.923 -10.677  17.141  1.00  0.76           C  
ATOM   1461  CG  ARG A 176     -11.034 -10.759  15.603  1.00  0.76           C  
ATOM   1462  CD  ARG A 176      -9.745 -10.425  14.836  1.00  0.76           C  
ATOM   1463  NE  ARG A 176      -9.354  -8.990  15.091  1.00  0.76           N  
ATOM   1464  CZ  ARG A 176      -9.673  -7.925  14.341  1.00  0.76           C  
ATOM   1465  NH1 ARG A 176     -10.456  -8.032  13.279  1.00  0.76           N  
ATOM   1466  NH2 ARG A 176      -9.249  -6.715  14.694  1.00  0.76           N  
ATOM   1467  N   LYS A 177     -11.766 -10.540  20.198  1.00  0.78           N  
ATOM   1468  CA  LYS A 177     -11.472 -10.684  21.617  1.00  0.78           C  
ATOM   1469  C   LYS A 177     -12.453 -11.573  22.364  1.00  0.78           C  
ATOM   1470  O   LYS A 177     -12.089 -12.263  23.312  1.00  0.78           O  
ATOM   1471  CB  LYS A 177     -11.378  -9.302  22.304  1.00  0.78           C  
ATOM   1472  CG  LYS A 177     -10.083  -8.567  21.923  1.00  0.78           C  
ATOM   1473  CD  LYS A 177     -10.010  -7.139  22.488  1.00  0.78           C  
ATOM   1474  CE  LYS A 177      -8.719  -6.410  22.097  1.00  0.78           C  
ATOM   1475  NZ  LYS A 177      -8.769  -4.991  22.523  1.00  0.78           N  
ATOM   1476  N   GLN A 178     -13.736 -11.579  21.962  1.00  0.75           N  
ATOM   1477  CA  GLN A 178     -14.703 -12.526  22.480  1.00  0.75           C  
ATOM   1478  C   GLN A 178     -14.390 -13.956  22.061  1.00  0.75           C  
ATOM   1479  O   GLN A 178     -14.315 -14.844  22.902  1.00  0.75           O  
ATOM   1480  CB  GLN A 178     -16.128 -12.100  22.075  1.00  0.75           C  
ATOM   1481  CG  GLN A 178     -16.574 -10.833  22.840  1.00  0.75           C  
ATOM   1482  CD  GLN A 178     -17.888 -10.260  22.310  1.00  0.75           C  
ATOM   1483  OE1 GLN A 178     -18.477 -10.663  21.314  1.00  0.75           O  
ATOM   1484  NE2 GLN A 178     -18.386  -9.226  23.033  1.00  0.75           N  
ATOM   1485  N   GLU A 179     -14.079 -14.187  20.771  1.00  0.73           N  
ATOM   1486  CA  GLU A 179     -13.662 -15.484  20.258  1.00  0.73           C  
ATOM   1487  C   GLU A 179     -12.385 -16.031  20.896  1.00  0.73           C  
ATOM   1488  O   GLU A 179     -12.307 -17.207  21.238  1.00  0.73           O  
ATOM   1489  CB  GLU A 179     -13.472 -15.404  18.729  1.00  0.73           C  
ATOM   1490  CG  GLU A 179     -14.784 -15.172  17.940  1.00  0.73           C  
ATOM   1491  CD  GLU A 179     -14.542 -14.943  16.445  1.00  0.73           C  
ATOM   1492  OE1 GLU A 179     -15.553 -14.912  15.699  1.00  0.73           O  
ATOM   1493  OE2 GLU A 179     -13.361 -14.803  16.030  1.00  0.73           O  
ATOM   1494  N   GLU A 180     -11.369 -15.172  21.118  1.00  0.71           N  
ATOM   1495  CA  GLU A 180     -10.143 -15.500  21.834  1.00  0.71           C  
ATOM   1496  C   GLU A 180     -10.315 -15.631  23.348  1.00  0.71           C  
ATOM   1497  O   GLU A 180      -9.448 -16.161  24.034  1.00  0.71           O  
ATOM   1498  CB  GLU A 180      -9.076 -14.404  21.584  1.00  0.71           C  
ATOM   1499  CG  GLU A 180      -8.536 -14.342  20.133  1.00  0.71           C  
ATOM   1500  CD  GLU A 180      -7.677 -13.099  19.862  1.00  0.71           C  
ATOM   1501  OE1 GLU A 180      -7.229 -12.952  18.693  1.00  0.71           O  
ATOM   1502  OE2 GLU A 180      -7.471 -12.277  20.794  1.00  0.71           O  
ATOM   1503  N   GLY A 181     -11.430 -15.132  23.926  1.00  0.74           N  
ATOM   1504  CA  GLY A 181     -11.697 -15.247  25.359  1.00  0.74           C  
ATOM   1505  C   GLY A 181     -12.639 -16.357  25.731  1.00  0.74           C  
ATOM   1506  O   GLY A 181     -12.813 -16.652  26.909  1.00  0.74           O  
ATOM   1507  N   GLU A 182     -13.278 -16.993  24.735  1.00  0.66           N  
ATOM   1508  CA  GLU A 182     -14.139 -18.142  24.937  1.00  0.66           C  
ATOM   1509  C   GLU A 182     -13.429 -19.435  24.560  1.00  0.66           C  
ATOM   1510  O   GLU A 182     -14.001 -20.520  24.658  1.00  0.66           O  
ATOM   1511  CB  GLU A 182     -15.423 -17.987  24.088  1.00  0.66           C  
ATOM   1512  CG  GLU A 182     -16.423 -16.968  24.692  1.00  0.66           C  
ATOM   1513  CD  GLU A 182     -17.724 -16.826  23.899  1.00  0.66           C  
ATOM   1514  OE1 GLU A 182     -18.620 -16.104  24.412  1.00  0.66           O  
ATOM   1515  OE2 GLU A 182     -17.852 -17.429  22.803  1.00  0.66           O  
ATOM   1516  N   SER A 183     -12.159 -19.341  24.128  1.00  0.68           N  
ATOM   1517  CA  SER A 183     -11.315 -20.473  23.791  1.00  0.68           C  
ATOM   1518  C   SER A 183     -10.288 -20.849  24.893  1.00  0.68           C  
ATOM   1519  O   SER A 183     -10.250 -20.188  25.963  1.00  0.68           O  
ATOM   1520  CB  SER A 183     -10.562 -20.257  22.447  1.00  0.68           C  
ATOM   1521  OG  SER A 183      -9.873 -19.007  22.385  1.00  0.68           O  
ATOM   1522  OXT SER A 183      -9.541 -21.846  24.668  1.00  0.68           O  
ATOM   1523  C1  NAG A   1      14.421 -16.320   8.676  0.00  0.00              
ATOM   1524  C2  NAG A   1      14.606 -17.406   9.784  0.00  0.00              
ATOM   1525  C3  NAG A   1      16.082 -17.911   9.784  0.00  0.00              
ATOM   1526  C4  NAG A   1      16.528 -18.367   8.378  0.00  0.00              
ATOM   1527  C5  NAG A   1      16.289 -17.244   7.334  0.00  0.00              
ATOM   1528  C6  NAG A   1      16.622 -17.688   5.897  0.00  0.00              
ATOM   1529  C7  NAG A   1      13.513 -17.521  12.001  0.00  0.00              
ATOM   1530  C8  NAG A   1      13.339 -16.855  13.351  0.00  0.00              
ATOM   1531  O3h NAG A   1      16.271 -19.013  10.674  0.00  0.00              
ATOM   1532  OR  NAG A   1      17.904 -18.723   8.453  0.00  0.00              
ATOM   1533  OR  NAG A   1      14.896 -16.804   7.390  0.00  0.00              
ATOM   1534  OW  NAG A   1      17.622 -16.856   5.303  0.00  0.00              
ATOM   1535  OM  NAG A   1      13.023 -18.624  11.790  0.00  0.00              
ATOM   1536  N15 NAG A   1      14.261 -16.856  11.125  0.00  0.00              
ATOM   1537  H2  NAG A   1      13.950 -18.259   9.513  0.00  0.00              
ATOM   1538  H3  NAG A   1      16.746 -17.083  10.103  0.00  0.00              
ATOM   1539  H4  NAG A   1      15.934 -19.256   8.084  0.00  0.00              
ATOM   1540  H5  NAG A   1      16.948 -16.387   7.580  0.00  0.00              
ATOM   1541  H6  NAG A   1      16.961 -18.740   5.904  0.00  0.00              
ATOM   1542  H22 NAG A   1      15.700 -17.665   5.284  0.00  0.00              
ATOM   1543  H8  NAG A   1      12.311 -17.014  13.718  0.00  0.00              
ATOM   1544  H24 NAG A   1      13.526 -15.767  13.339  0.00  0.00              
ATOM   1545  H25 NAG A   1      14.026 -17.318  14.080  0.00  0.00              
ATOM   1546  H3o NAG A   1      16.116 -18.676  11.562  0.00  0.00              
ATOM   1547  H29 NAG A   1      14.463 -15.894  11.402  0.00  0.00              
ATOM   1548  H1  NAG A   1      14.961 -15.390   8.942  0.00  0.00              
ATOM   1549  C1  NAG A   2      18.256 -20.031   8.028  0.00  0.00              
ATOM   1550  C2  NAG A   2      19.795 -20.139   7.788  0.00  0.00              
ATOM   1551  C3  NAG A   2      20.193 -21.634   7.585  0.00  0.00              
ATOM   1552  C4  NAG A   2      19.674 -22.523   8.734  0.00  0.00              
ATOM   1553  C5  NAG A   2      18.144 -22.340   8.923  0.00  0.00              
ATOM   1554  C6  NAG A   2      17.596 -23.128  10.128  0.00  0.00              
ATOM   1555  C7  NAG A   2      21.266 -18.545   6.597  0.00  0.00              
ATOM   1556  C8  NAG A   2      21.587 -17.882   5.273  0.00  0.00              
ATOM   1557  O3h NAG A   2      21.611 -21.805   7.514  0.00  0.00              
ATOM   1558  OR  NAG A   2      20.002 -23.872   8.421  0.00  0.00              
ATOM   1559  OR  NAG A   2      17.832 -20.922   9.097  0.00  0.00              
ATOM   1560  O6h NAG A   2      18.194 -22.704  11.356  0.00  0.00              
ATOM   1561  OM  NAG A   2      21.997 -18.371   7.564  0.00  0.00              
ATOM   1562  N15 NAG A   2      20.202 -19.343   6.597  0.00  0.00              
ATOM   1563  H2  NAG A   2      20.292 -19.773   8.711  0.00  0.00              
ATOM   1564  H3  NAG A   2      19.746 -21.999   6.638  0.00  0.00              
ATOM   1565  H4  NAG A   2      20.184 -22.229   9.674  0.00  0.00              
ATOM   1566  H5  NAG A   2      17.629 -22.713   8.016  0.00  0.00              
ATOM   1567  H6S NAG A   2      16.498 -23.007  10.182  0.00  0.00              
ATOM   1568  H6R NAG A   2      17.780 -24.209   9.973  0.00  0.00              
ATOM   1569  H8  NAG A   2      21.938 -16.850   5.445  0.00  0.00              
ATOM   1570  H24 NAG A   2      20.729 -17.833   4.578  0.00  0.00              
ATOM   1571  H25 NAG A   2      22.404 -18.431   4.775  0.00  0.00              
ATOM   1572  H3o NAG A   2      21.901 -21.353   6.715  0.00  0.00              
ATOM   1573  H6o NAG A   2      18.015 -23.382  12.013  0.00  0.00              
ATOM   1574  H29 NAG A   2      19.623 -19.257   5.760  0.00  0.00              
ATOM   1575  H1  NAG A   2      17.695 -20.273   7.103  0.00  0.00              
ATOM   1576  C1  BMA A   3      20.741 -24.572   9.359  0.00  0.00              
ATOM   1577  C2  BMA A   3      20.736 -26.047   8.965  0.00  0.00              
ATOM   1578  C3  BMA A   3      21.727 -26.858   9.782  0.00  0.00              
ATOM   1579  C4  BMA A   3      23.089 -26.205   9.763  0.00  0.00              
ATOM   1580  C5  BMA A   3      22.970 -24.745  10.202  0.00  0.00              
ATOM   1581  C6  BMA A   3      24.271 -23.972  10.203  0.00  0.00              
ATOM   1582  OW  BMA A   3      21.827 -28.169   9.212  0.00  0.00              
ATOM   1583  O4h BMA A   3      23.983 -26.863  10.648  0.00  0.00              
ATOM   1584  OR  BMA A   3      22.087 -24.085   9.282  0.00  0.00              
ATOM   1585  OW  BMA A   3      24.556 -23.417  11.477  0.00  0.00              
ATOM   1586  H4o BMA A   3      24.579 -27.588  10.094  0.00  0.00              
ATOM   1587  O2h BMA A   3      21.059 -26.150   7.585  0.00  0.00              
ATOM   1588  H2o BMA A   3      22.066 -25.768   7.417  0.00  0.00              
ATOM   1589  H5  BMA A   3      22.607 -24.705  11.192  0.00  0.00              
ATOM   1590  H6  BMA A   3      25.171 -24.210   9.843  0.00  0.00              
ATOM   1591  H20 BMA A   3      24.190 -23.176   9.520  0.00  0.00              
ATOM   1592  H2  BMA A   3      19.727 -26.423   9.137  0.00  0.00              
ATOM   1593  H3  BMA A   3      21.367 -26.922  10.809  0.00  0.00              
ATOM   1594  H1  BMA A   3      20.333 -24.463  10.363  0.00  0.00              
ATOM   1595  H4  BMA A   3      23.474 -26.268   8.745  0.00  0.00              
ATOM   1596  C1  MAN A   4      21.630 -29.272  10.088  0.00  0.00              
ATOM   1597  C2  MAN A   4      22.024 -30.632   9.522  0.00  0.00              
ATOM   1598  C3  MAN A   4      21.111 -31.064   8.386  0.00  0.00              
ATOM   1599  C4  MAN A   4      19.661 -30.948   8.800  0.00  0.00              
ATOM   1600  C5  MAN A   4      19.382 -29.538   9.321  0.00  0.00              
ATOM   1601  C6  MAN A   4      17.964 -29.300   9.791  0.00  0.00              
ATOM   1602  O3h MAN A   4      21.398 -32.429   8.061  0.00  0.00              
ATOM   1603  OR  MAN A   4      18.797 -31.195   7.702  0.00  0.00              
ATOM   1604  OR  MAN A   4      20.244 -29.312  10.449  0.00  0.00              
ATOM   1605  O6h MAN A   4      17.597 -30.183  10.840  0.00  0.00              
ATOM   1606  H3o MAN A   4      21.874 -32.353   7.082  0.00  0.00              
ATOM   1607  H6o MAN A   4      17.223 -29.936  11.833  0.00  0.00              
ATOM   1608  OW  MAN A   4      21.970 -31.594  10.568  0.00  0.00              
ATOM   1609  H5  MAN A   4      19.554 -28.838   8.550  0.00  0.00              
ATOM   1610  H6S MAN A   4      17.486 -28.454  10.018  0.00  0.00              
ATOM   1611  H6R MAN A   4      17.309 -29.473   8.986  0.00  0.00              
ATOM   1612  H1  MAN A   4      22.258 -29.040  10.949  0.00  0.00              
ATOM   1613  H2  MAN A   4      23.046 -30.545   9.153  0.00  0.00              
ATOM   1614  H3  MAN A   4      21.295 -30.424   7.524  0.00  0.00              
ATOM   1615  H4  MAN A   4      19.479 -31.687   9.581  0.00  0.00              
ATOM   1616  C1  NAG A   5      23.129 -31.732  11.376  0.00  0.00              
ATOM   1617  C2  NAG A   5      22.735 -31.977  12.869  0.00  0.00              
ATOM   1618  C3  NAG A   5      23.999 -32.389  13.686  0.00  0.00              
ATOM   1619  C4  NAG A   5      24.740 -33.573  13.030  0.00  0.00              
ATOM   1620  C5  NAG A   5      25.072 -33.261  11.545  0.00  0.00              
ATOM   1621  C6  NAG A   5      25.720 -34.454  10.818  0.00  0.00              
ATOM   1622  C7  NAG A   5      21.026 -30.789  14.207  0.00  0.00              
ATOM   1623  C8  NAG A   5      20.599 -29.467  14.809  0.00  0.00              
ATOM   1624  O3h NAG A   5      23.669 -32.774  15.023  0.00  0.00              
ATOM   1625  OR  NAG A   5      25.920 -33.821  13.786  0.00  0.00              
ATOM   1626  OR  NAG A   5      23.855 -32.870  10.837  0.00  0.00              
ATOM   1627  O6h NAG A   5      24.854 -35.592  10.791  0.00  0.00              
ATOM   1628  OM  NAG A   5      20.398 -31.812  14.459  0.00  0.00              
ATOM   1629  N15 NAG A   5      22.127 -30.753  13.462  0.00  0.00              
ATOM   1630  H2  NAG A   5      22.024 -32.831  12.878  0.00  0.00              
ATOM   1631  H3  NAG A   5      24.696 -31.529  13.728  0.00  0.00              
ATOM   1632  H4  NAG A   5      24.086 -34.470  13.064  0.00  0.00              
ATOM   1633  H5  NAG A   5      25.793 -32.419  11.516  0.00  0.00              
ATOM   1634  H6S NAG A   5      25.986 -34.158   9.785  0.00  0.00              
ATOM   1635  H6R NAG A   5      26.673 -34.715  11.320  0.00  0.00              
ATOM   1636  H8  NAG A   5      19.498 -29.384  14.792  0.00  0.00              
ATOM   1637  H24 NAG A   5      21.008 -28.585  14.284  0.00  0.00              
ATOM   1638  H25 NAG A   5      20.918 -29.422  15.864  0.00  0.00              
ATOM   1639  H3o NAG A   5      23.330 -31.986  15.458  0.00  0.00              
ATOM   1640  H6o NAG A   5      25.391 -36.357  10.565  0.00  0.00              
ATOM   1641  H29 NAG A   5      22.437 -29.809  13.230  0.00  0.00              
ATOM   1642  H1  NAG A   5      23.749 -30.818  11.278  0.00  0.00              
ATOM   1643  C1  GLB A   6      26.091 -35.100  14.283  0.00  0.00              
ATOM   1644  C2  GLB A   6      27.519 -35.222  14.805  0.00  0.00              
ATOM   1645  C3  GLB A   6      27.729 -36.499  15.601  0.00  0.00              
ATOM   1646  C4  GLB A   6      26.657 -36.649  16.656  0.00  0.00              
ATOM   1647  C5  GLB A   6      25.275 -36.538  16.010  0.00  0.00              
ATOM   1648  C6  GLB A   6      24.112 -36.648  16.972  0.00  0.00              
ATOM   1649  O2h GLB A   6      28.408 -35.195  13.696  0.00  0.00              
ATOM   1650  OW  GLB A   6      29.010 -36.438  16.238  0.00  0.00              
ATOM   1651  OR  GLB A   6      25.188 -35.245  15.389  0.00  0.00              
ATOM   1652  O6h GLB A   6      24.156 -35.644  17.974  0.00  0.00              
ATOM   1653  H2o GLB A   6      28.856 -34.282  13.524  0.00  0.00              
ATOM   1654  H6o GLB A   6      23.392 -34.911  18.232  0.00  0.00              
ATOM   1655  O4h GLB A   6      26.909 -35.620  17.605  0.00  0.00              
ATOM   1656  H4o GLB A   6      27.907 -35.746  18.023  0.00  0.00              
ATOM   1657  H5  GLB A   6      25.151 -37.318  15.313  0.00  0.00              
ATOM   1658  H6S GLB A   6      23.136 -36.767  16.802  0.00  0.00              
ATOM   1659  H6R GLB A   6      24.160 -37.581  17.452  0.00  0.00              
ATOM   1660  H1  GLB A   6      25.916 -35.860  13.522  0.00  0.00              
ATOM   1661  H2  GLB A   6      27.704 -34.360  15.446  0.00  0.00              
ATOM   1662  H3  GLB A   6      27.689 -37.349  14.919  0.00  0.00              
ATOM   1663  H4  GLB A   6      26.677 -37.616  17.155  0.00  0.00              
ATOM   1664  C1  NAN A   7      30.088 -37.732  14.483  0.00  0.00              
ATOM   1665  C2  NAN A   7      29.888 -37.530  16.027  0.00  0.00              
ATOM   1666  C3  NAN A   7      29.269 -38.738  16.784  0.00  0.00              
ATOM   1667  C4  NAN A   7      30.297 -39.870  17.005  0.00  0.00              
ATOM   1668  C5  NAN A   7      31.576 -39.341  17.688  0.00  0.00              
ATOM   1669  C6  NAN A   7      32.162 -38.126  16.913  0.00  0.00              
ATOM   1670  C7  NAN A   7      33.364 -37.456  17.628  0.00  0.00              
ATOM   1671  C8  NAN A   7      34.096 -36.411  16.749  0.00  0.00              
ATOM   1672  C9  NAN A   7      35.301 -35.761  17.440  0.00  0.00              
ATOM   1673  OW  NAN A   7      31.109 -37.118  16.714  0.00  0.00              
ATOM   1674  OM  NAN A   7      29.763 -38.738  13.854  0.00  0.00              
ATOM   1675  O1h NAN A   7      30.674 -36.653  13.885  0.00  0.00              
ATOM   1676  O4h NAN A   7      29.705 -40.870  17.821  0.00  0.00              
ATOM   1677  O7h NAN A   7      32.880 -36.816  18.807  0.00  0.00              
ATOM   1678  O8h NAN A   7      34.605 -37.031  15.577  0.00  0.00              
ATOM   1679  O9h NAN A   7      35.959 -34.868  16.540  0.00  0.00              
ATOM   1680  H6  NAN A   7      32.511 -38.492  15.926  0.00  0.00              
ATOM   1681  H3  NAN A   7      28.902 -38.393  17.769  0.00  0.00              
ATOM   1682  H21 NAN A   7      28.376 -39.109  16.248  0.00  0.00              
ATOM   1683  H4  NAN A   7      30.568 -40.314  16.023  0.00  0.00              
ATOM   1684  H7o NAN A   7      32.018 -36.477  18.549  0.00  0.00              
ATOM   1685  H8o NAN A   7      35.327 -36.451  15.314  0.00  0.00              
ATOM   1686  H4o NAN A   7      28.836 -41.038  17.446  0.00  0.00              
ATOM   1687  H9o NAN A   7      36.623 -34.392  17.049  0.00  0.00              
ATOM   1688  H9R NAN A   7      36.009 -36.539  17.791  0.00  0.00              
ATOM   1689  H9S NAN A   7      34.969 -35.216  18.346  0.00  0.00              
ATOM   1690  H8  NAN A   7      33.382 -35.616  16.453  0.00  0.00              
ATOM   1691  H7  NAN A   7      34.093 -38.241  17.912  0.00  0.00              
ATOM   1692  H1o NAN A   7      30.786 -36.860  12.957  0.00  0.00              
ATOM   1693  H5  NAN A   7      31.327 -39.023  18.720  0.00  0.00              
ATOM   1694  N33 NAN A   7      32.528 -40.428  17.743  0.00  0.00              
ATOM   1695  C34 NAN A   7      32.608 -41.214  18.863  0.00  0.00              
ATOM   1696  C35 NAN A   7      33.656 -42.308  18.777  0.00  0.00              
ATOM   1697  OM  NAN A   7      31.916 -41.069  19.853  0.00  0.00              
ATOM   1698  H37 NAN A   7      33.148 -40.609  16.940  0.00  0.00              
ATOM   1699  H35 NAN A   7      33.670 -42.919  19.708  0.00  0.00              
ATOM   1700  H39 NAN A   7      34.668 -41.861  18.643  0.00  0.00              
ATOM   1701  H40 NAN A   7      33.440 -42.986  17.921  0.00  0.00              
ATOM   1702  C1  NAG A   8      17.847 -32.239   7.851  0.00  0.00              
ATOM   1703  C2  NAG A   8      16.731 -32.132   6.763  0.00  0.00              
ATOM   1704  C3  NAG A   8      15.858 -33.425   6.775  0.00  0.00              
ATOM   1705  C4  NAG A   8      16.723 -34.697   6.664  0.00  0.00              
ATOM   1706  C5  NAG A   8      17.820 -34.716   7.763  0.00  0.00              
ATOM   1707  C6  NAG A   8      18.775 -35.917   7.628  0.00  0.00              
ATOM   1708  C7  NAG A   8      15.509 -30.109   6.029  0.00  0.00              
ATOM   1709  C8  NAG A   8      14.557 -29.003   6.434  0.00  0.00              
ATOM   1710  O3h NAG A   8      14.919 -33.446   5.698  0.00  0.00              
ATOM   1711  OR  NAG A   8      15.858 -35.823   6.774  0.00  0.00              
ATOM   1712  OR  NAG A   8      18.595 -33.478   7.709  0.00  0.00              
ATOM   1713  O6h NAG A   8      19.474 -35.901   6.382  0.00  0.00              
ATOM   1714  OM  NAG A   8      15.857 -30.226   4.860  0.00  0.00              
ATOM   1715  N15 NAG A   8      15.872 -30.940   7.003  0.00  0.00              
ATOM   1716  H2  NAG A   8      17.246 -32.072   5.780  0.00  0.00              
ATOM   1717  H3  NAG A   8      15.299 -33.472   7.732  0.00  0.00              
ATOM   1718  H4  NAG A   8      17.218 -34.711   5.671  0.00  0.00              
ATOM   1719  H5  NAG A   8      17.326 -34.790   8.752  0.00  0.00              
ATOM   1720  H6S NAG A   8      19.498 -35.911   8.466  0.00  0.00              
ATOM   1721  H6R NAG A   8      18.198 -36.857   7.726  0.00  0.00              
ATOM   1722  H8  NAG A   8      14.817 -28.071   5.902  0.00  0.00              
ATOM   1723  H24 NAG A   8      14.561 -28.783   7.516  0.00  0.00              
ATOM   1724  H25 NAG A   8      13.529 -29.276   6.139  0.00  0.00              
ATOM   1725  H3o NAG A   8      14.306 -32.721   5.856  0.00  0.00              
ATOM   1726  H6o NAG A   8      19.844 -36.778   6.246  0.00  0.00              
ATOM   1727  H29 NAG A   8      15.618 -30.615   7.937  0.00  0.00              
ATOM   1728  H1  NAG A   8      17.410 -32.187   8.869  0.00  0.00              
ATOM   1729  C1  GLB A   9      15.890 -36.743   5.742  0.00  0.00              
ATOM   1730  C2  GLB A   9      15.118 -37.983   6.185  0.00  0.00              
ATOM   1731  C3  GLB A   9      14.877 -38.946   5.035  0.00  0.00              
ATOM   1732  C4  GLB A   9      14.279 -38.220   3.852  0.00  0.00              
ATOM   1733  C5  GLB A   9      15.153 -37.020   3.485  0.00  0.00              
ATOM   1734  C6  GLB A   9      14.646 -36.193   2.325  0.00  0.00              
ATOM   1735  O2h GLB A   9      15.859 -38.633   7.211  0.00  0.00              
ATOM   1736  OW  GLB A   9      13.966 -39.962   5.471  0.00  0.00              
ATOM   1737  OR  GLB A   9      15.204 -36.153   4.631  0.00  0.00              
ATOM   1738  O6h GLB A   9      13.349 -35.671   2.572  0.00  0.00              
ATOM   1739  H2o GLB A   9      15.531 -38.440   8.168  0.00  0.00              
ATOM   1740  H6o GLB A   9      13.021 -34.631   2.546  0.00  0.00              
ATOM   1741  O4h GLB A   9      12.968 -37.847   4.255  0.00  0.00              
ATOM   1742  H4o GLB A   9      12.398 -38.741   4.511  0.00  0.00              
ATOM   1743  H5  GLB A   9      16.112 -37.356   3.205  0.00  0.00              
ATOM   1744  H6S GLB A   9      15.090 -35.475   1.793  0.00  0.00              
ATOM   1745  H6R GLB A   9      14.584 -36.807   1.474  0.00  0.00              
ATOM   1746  H1  GLB A   9      16.910 -37.024   5.480  0.00  0.00              
ATOM   1747  H2  GLB A   9      14.161 -37.644   6.582  0.00  0.00              
ATOM   1748  H3  GLB A   9      15.828 -39.393   4.746  0.00  0.00              
ATOM   1749  H4  GLB A   9      14.224 -38.835   2.954  0.00  0.00              
ATOM   1750  C1  NAN A  10      15.759 -41.525   5.985  0.00  0.00              
ATOM   1751  C2  NAN A  10      14.368 -41.309   5.288  0.00  0.00              
ATOM   1752  C3  NAN A  10      14.344 -41.565   3.755  0.00  0.00              
ATOM   1753  C4  NAN A  10      14.344 -43.074   3.421  0.00  0.00              
ATOM   1754  C5  NAN A  10      13.206 -43.812   4.159  0.00  0.00              
ATOM   1755  C6  NAN A  10      13.253 -43.524   5.687  0.00  0.00              
ATOM   1756  C7  NAN A  10      12.051 -44.117   6.468  0.00  0.00              
ATOM   1757  C8  NAN A  10      12.220 -44.044   8.005  0.00  0.00              
ATOM   1758  C9  NAN A  10      11.045 -44.651   8.783  0.00  0.00              
ATOM   1759  OW  NAN A  10      13.290 -42.070   5.912  0.00  0.00              
ATOM   1760  OM  NAN A  10      16.799 -41.839   5.407  0.00  0.00              
ATOM   1761  O1h NAN A  10      15.703 -41.326   7.335  0.00  0.00              
ATOM   1762  O4h NAN A  10      14.177 -43.230   2.019  0.00  0.00              
ATOM   1763  O7h NAN A  10      10.878 -43.397   6.091  0.00  0.00              
ATOM   1764  O8h NAN A  10      13.372 -44.773   8.404  0.00  0.00              
ATOM   1765  O9h NAN A  10      11.313 -44.607  10.186  0.00  0.00              
ATOM   1766  H6  NAN A  10      14.180 -43.981   6.088  0.00  0.00              
ATOM   1767  H3  NAN A  10      13.431 -41.106   3.330  0.00  0.00              
ATOM   1768  H21 NAN A  10      15.190 -41.048   3.267  0.00  0.00              
ATOM   1769  H4  NAN A  10      15.317 -43.514   3.722  0.00  0.00              
ATOM   1770  H7o NAN A  10      11.187 -42.492   5.982  0.00  0.00              
ATOM   1771  H8o NAN A  10      13.186 -44.994   9.322  0.00  0.00              
ATOM   1772  H4o NAN A  10      14.794 -42.617   1.609  0.00  0.00              
ATOM   1773  H9o NAN A  10      10.505 -44.877  10.636  0.00  0.00              
ATOM   1774  H9R NAN A  10      10.870 -45.696   8.461  0.00  0.00              
ATOM   1775  H9S NAN A  10      10.113 -44.097   8.554  0.00  0.00              
ATOM   1776  H8  NAN A  10      12.342 -42.986   8.309  0.00  0.00              
ATOM   1777  H7  NAN A  10      11.931 -45.181   6.181  0.00  0.00              
ATOM   1778  H1o NAN A  10      16.575 -41.502   7.690  0.00  0.00              
ATOM   1779  H5  NAN A  10      12.234 -43.465   3.757  0.00  0.00              
ATOM   1780  N33 NAN A  10      13.353 -45.226   3.894  0.00  0.00              
ATOM   1781  C34 NAN A  10      12.663 -45.805   2.861  0.00  0.00              
ATOM   1782  C35 NAN A  10      12.911 -47.293   2.710  0.00  0.00              
ATOM   1783  OM  NAN A  10      11.908 -45.205   2.119  0.00  0.00              
ATOM   1784  H37 NAN A  10      13.975 -45.797   4.482  0.00  0.00              
ATOM   1785  H35 NAN A  10      12.334 -47.708   1.851  0.00  0.00              
ATOM   1786  H39 NAN A  10      12.594 -47.833   3.631  0.00  0.00              
ATOM   1787  H40 NAN A  10      13.992 -47.489   2.526  0.00  0.00              
ATOM   1788  C1  MAN A  11      25.478 -22.335  11.518  0.00  0.00              
ATOM   1789  C2  MAN A  11      26.949 -22.727  11.412  0.00  0.00              
ATOM   1790  C3  MAN A  11      27.424 -23.493  12.636  0.00  0.00              
ATOM   1791  C4  MAN A  11      27.058 -22.749  13.900  0.00  0.00              
ATOM   1792  C5  MAN A  11      25.561 -22.437  13.905  0.00  0.00              
ATOM   1793  C6  MAN A  11      25.074 -21.671  15.114  0.00  0.00              
ATOM   1794  O3h MAN A  11      28.848 -23.630  12.567  0.00  0.00              
ATOM   1795  O4h MAN A  11      27.354 -23.525  15.051  0.00  0.00              
ATOM   1796  OR  MAN A  11      25.283 -21.628  12.750  0.00  0.00              
ATOM   1797  OW  MAN A  11      24.040 -22.361  15.797  0.00  0.00              
ATOM   1798  H3o MAN A  11      28.984 -24.694  12.374  0.00  0.00              
ATOM   1799  H4o MAN A  11      28.330 -23.242  15.443  0.00  0.00              
ATOM   1800  OW  MAN A  11      27.726 -21.546  11.258  0.00  0.00              
ATOM   1801  H5  MAN A  11      25.016 -23.340  13.892  0.00  0.00              
ATOM   1802  H6  MAN A  11      25.579 -21.219  15.846  0.00  0.00              
ATOM   1803  H20 MAN A  11      24.683 -20.749  14.793  0.00  0.00              
ATOM   1804  H1  MAN A  11      25.203 -21.720  10.661  0.00  0.00              
ATOM   1805  H2  MAN A  11      27.051 -23.356  10.528  0.00  0.00              
ATOM   1806  H3  MAN A  11      26.951 -24.475  12.642  0.00  0.00              
ATOM   1807  H4  MAN A  11      27.641 -21.829  13.924  0.00  0.00              
ATOM   1808  C1  NAG A  12      27.890 -21.052   9.937  0.00  0.00              
ATOM   1809  C2  NAG A  12      27.853 -19.489   9.925  0.00  0.00              
ATOM   1810  C3  NAG A  12      28.299 -18.964   8.525  0.00  0.00              
ATOM   1811  C4  NAG A  12      29.654 -19.563   8.097  0.00  0.00              
ATOM   1812  C5  NAG A  12      29.616 -21.114   8.160  0.00  0.00              
ATOM   1813  C6  NAG A  12      30.979 -21.756   7.841  0.00  0.00              
ATOM   1814  C7  NAG A  12      26.264 -17.994  11.093  0.00  0.00              
ATOM   1815  C8  NAG A  12      24.822 -17.553  11.224  0.00  0.00              
ATOM   1816  O3h NAG A  12      28.430 -17.541   8.505  0.00  0.00              
ATOM   1817  OR  NAG A  12      29.936 -19.103   6.779  0.00  0.00              
ATOM   1818  OR  NAG A  12      29.181 -21.545   9.487  0.00  0.00              
ATOM   1819  O6h NAG A  12      31.985 -21.353   8.774  0.00  0.00              
ATOM   1820  OM  NAG A  12      27.146 -17.410  11.712  0.00  0.00              
ATOM   1821  N15 NAG A  12      26.485 -18.991  10.239  0.00  0.00              
ATOM   1822  H2  NAG A  12      28.595 -19.144  10.676  0.00  0.00              
ATOM   1823  H3  NAG A  12      27.539 -19.258   7.772  0.00  0.00              
ATOM   1824  H4  NAG A  12      30.442 -19.201   8.789  0.00  0.00              
ATOM   1825  H5  NAG A  12      28.889 -21.479   7.406  0.00  0.00              
ATOM   1826  H6S NAG A  12      30.880 -22.858   7.845  0.00  0.00              
ATOM   1827  H6R NAG A  12      31.284 -21.477   6.814  0.00  0.00              
ATOM   1828  H8  NAG A  12      24.600 -17.300  12.275  0.00  0.00              
ATOM   1829  H24 NAG A  12      24.090 -18.315  10.901  0.00  0.00              
ATOM   1830  H25 NAG A  12      24.660 -16.641  10.624  0.00  0.00              
ATOM   1831  H3o NAG A  12      27.547 -17.183   8.644  0.00  0.00              
ATOM   1832  H6o NAG A  12      32.839 -21.567   8.388  0.00  0.00              
ATOM   1833  H29 NAG A  12      25.635 -19.461   9.927  0.00  0.00              
ATOM   1834  H1  NAG A  12      27.090 -21.469   9.294  0.00  0.00              
ATOM   1835  C1  GLB A  13      31.137 -18.443   6.587  0.00  0.00              
ATOM   1836  C2  GLB A  13      31.364 -18.293   5.086  0.00  0.00              
ATOM   1837  C3  GLB A  13      32.522 -17.361   4.775  0.00  0.00              
ATOM   1838  C4  GLB A  13      32.369 -16.057   5.524  0.00  0.00              
ATOM   1839  C5  GLB A  13      32.178 -16.335   7.015  0.00  0.00              
ATOM   1840  C6  GLB A  13      31.989 -15.104   7.875  0.00  0.00              
ATOM   1841  O2h GLB A  13      31.620 -19.579   4.538  0.00  0.00              
ATOM   1842  OW  GLB A  13      32.532 -17.094   3.367  0.00  0.00              
ATOM   1843  OR  GLB A  13      30.994 -17.137   7.160  0.00  0.00              
ATOM   1844  O6h GLB A  13      30.859 -14.344   7.472  0.00  0.00              
ATOM   1845  H2o GLB A  13      30.810 -20.022   4.080  0.00  0.00              
ATOM   1846  H6o GLB A  13      30.003 -14.036   8.071  0.00  0.00              
ATOM   1847  O4h GLB A  13      31.250 -15.406   4.935  0.00  0.00              
ATOM   1848  H4o GLB A  13      31.441 -15.243   3.874  0.00  0.00              
ATOM   1849  H5  GLB A  13      33.032 -16.825   7.392  0.00  0.00              
ATOM   1850  H6S GLB A  13      32.005 -14.994   8.866  0.00  0.00              
ATOM   1851  H6R GLB A  13      32.837 -14.491   7.776  0.00  0.00              
ATOM   1852  H1  GLB A  13      31.973 -18.985   7.030  0.00  0.00              
ATOM   1853  H2  GLB A  13      30.446 -17.888   4.659  0.00  0.00              
ATOM   1854  H3  GLB A  13      33.452 -17.844   5.074  0.00  0.00              
ATOM   1855  H4  GLB A  13      33.245 -15.413   5.449  0.00  0.00              
ATOM   1856  C1  NAN A  14      34.206 -18.805   2.929  0.00  0.00              
ATOM   1857  C2  NAN A  14      33.749 -17.324   2.678  0.00  0.00              
ATOM   1858  C3  NAN A  14      34.738 -16.228   3.166  0.00  0.00              
ATOM   1859  C4  NAN A  14      35.948 -16.078   2.216  0.00  0.00              
ATOM   1860  C5  NAN A  14      35.494 -15.853   0.757  0.00  0.00              
ATOM   1861  C6  NAN A  14      34.496 -16.959   0.307  0.00  0.00              
ATOM   1862  C7  NAN A  14      33.887 -16.711  -1.098  0.00  0.00              
ATOM   1863  C8  NAN A  14      33.092 -17.922  -1.646  0.00  0.00              
ATOM   1864  C9  NAN A  14      32.508 -17.692  -3.046  0.00  0.00              
ATOM   1865  OW  NAN A  14      33.400 -17.059   1.284  0.00  0.00              
ATOM   1866  OM  NAN A  14      35.245 -19.138   3.498  0.00  0.00              
ATOM   1867  O1h NAN A  14      33.316 -19.717   2.440  0.00  0.00              
ATOM   1868  O4h NAN A  14      36.727 -14.971   2.644  0.00  0.00              
ATOM   1869  O7h NAN A  14      33.020 -15.582  -1.013  0.00  0.00              
ATOM   1870  O8h NAN A  14      33.943 -19.053  -1.758  0.00  0.00              
ATOM   1871  O9h NAN A  14      31.854 -18.877  -3.503  0.00  0.00              
ATOM   1872  H6  NAN A  14      35.049 -17.920   0.276  0.00  0.00              
ATOM   1873  H3  NAN A  14      34.202 -15.261   3.216  0.00  0.00              
ATOM   1874  H21 NAN A  14      35.065 -16.441   4.199  0.00  0.00              
ATOM   1875  H4  NAN A  14      36.566 -16.999   2.265  0.00  0.00              
ATOM   1876  H7o NAN A  14      32.614 -15.666  -0.146  0.00  0.00              
ATOM   1877  H8o NAN A  14      33.508 -19.592  -2.426  0.00  0.00              
ATOM   1878  H4o NAN A  14      36.835 -15.073   3.594  0.00  0.00              
ATOM   1879  H9o NAN A  14      31.398 -18.650  -4.320  0.00  0.00              
ATOM   1880  H9R NAN A  14      33.309 -17.401  -3.754  0.00  0.00              
ATOM   1881  H9S NAN A  14      31.794 -16.846  -3.022  0.00  0.00              
ATOM   1882  H8  NAN A  14      32.265 -18.162  -0.948  0.00  0.00              
ATOM   1883  H7  NAN A  14      34.709 -16.485  -1.807  0.00  0.00              
ATOM   1884  H1o NAN A  14      33.675 -20.591   2.605  0.00  0.00              
ATOM   1885  H5  NAN A  14      34.993 -14.867   0.686  0.00  0.00              
ATOM   1886  N33 NAN A  14      36.673 -15.849  -0.077  0.00  0.00              
ATOM   1887  C34 NAN A  14      37.286 -14.664  -0.394  0.00  0.00              
ATOM   1888  C35 NAN A  14      38.506 -14.817  -1.282  0.00  0.00              
ATOM   1889  OM  NAN A  14      36.903 -13.573  -0.016  0.00  0.00              
ATOM   1890  H37 NAN A  14      37.054 -16.738  -0.433  0.00  0.00              
ATOM   1891  H35 NAN A  14      38.967 -13.827  -1.498  0.00  0.00              
ATOM   1892  H39 NAN A  14      38.221 -15.285  -2.251  0.00  0.00              
ATOM   1893  H40 NAN A  14      39.272 -15.452  -0.781  0.00  0.00              
ATOM   1894  C1  NAG A  15      23.209 -21.594  16.656  0.00  0.00              
ATOM   1895  C2  NAG A  15      21.938 -22.405  17.065  0.00  0.00              
ATOM   1896  C3  NAG A  15      21.182 -21.657  18.208  0.00  0.00              
ATOM   1897  C4  NAG A  15      22.119 -21.323  19.386  0.00  0.00              
ATOM   1898  C5  NAG A  15      23.367 -20.540  18.894  0.00  0.00              
ATOM   1899  C6  NAG A  15      24.384 -20.273  20.020  0.00  0.00              
ATOM   1900  C7  NAG A  15      20.462 -23.758  15.612  0.00  0.00              
ATOM   1901  C8  NAG A  15      19.497 -23.746  14.445  0.00  0.00              
ATOM   1902  O3h NAG A  15      20.095 -22.429  18.725  0.00  0.00              
ATOM   1903  OR  NAG A  15      21.372 -20.567  20.334  0.00  0.00              
ATOM   1904  OR  NAG A  15      24.024 -21.281  17.819  0.00  0.00              
ATOM   1905  O6h NAG A  15      24.883 -21.490  20.581  0.00  0.00              
ATOM   1906  OM  NAG A  15      20.638 -24.786  16.255  0.00  0.00              
ATOM   1907  N15 NAG A  15      21.032 -22.590  15.898  0.00  0.00              
ATOM   1908  H2  NAG A  15      22.292 -23.378  17.465  0.00  0.00              
ATOM   1909  H3  NAG A  15      20.779 -20.704  17.808  0.00  0.00              
ATOM   1910  H4  NAG A  15      22.459 -22.268  19.856  0.00  0.00              
ATOM   1911  H5  NAG A  15      23.035 -19.557  18.503  0.00  0.00              
ATOM   1912  H6S NAG A  15      25.221 -19.667  19.627  0.00  0.00              
ATOM   1913  H6R NAG A  15      23.904 -19.663  20.809  0.00  0.00              
ATOM   1914  H8  NAG A  15      19.598 -24.678  13.864  0.00  0.00              
ATOM   1915  H24 NAG A  15      19.646 -22.900  13.750  0.00  0.00              
ATOM   1916  H25 NAG A  15      18.461 -23.704  14.824  0.00  0.00              
ATOM   1917  H3o NAG A  15      19.458 -22.515  18.010  0.00  0.00              
ATOM   1918  H6o NAG A  15      25.298 -21.271  21.420  0.00  0.00              
ATOM   1919  H29 NAG A  15      20.897 -21.879  15.178  0.00  0.00              
ATOM   1920  H1  NAG A  15      22.928 -20.654  16.141  0.00  0.00              
ATOM   1921  C1  GLB A  16      21.322 -21.055  21.628  0.00  0.00              
ATOM   1922  C2  GLB A  16      20.727 -19.972  22.523  0.00  0.00              
ATOM   1923  C3  GLB A  16      20.393 -20.498  23.909  0.00  0.00              
ATOM   1924  C4  GLB A  16      19.569 -21.761  23.812  0.00  0.00              
ATOM   1925  C5  GLB A  16      20.278 -22.777  22.916  0.00  0.00              
ATOM   1926  C6  GLB A  16      19.538 -24.081  22.719  0.00  0.00              
ATOM   1927  O2h GLB A  16      21.663 -18.907  22.625  0.00  0.00              
ATOM   1928  OW  GLB A  16      19.643 -19.500  24.610  0.00  0.00              
ATOM   1929  OR  GLB A  16      20.432 -22.179  21.618  0.00  0.00              
ATOM   1930  O6h GLB A  16      18.257 -23.882  22.144  0.00  0.00              
ATOM   1931  H2o GLB A  16      21.469 -18.101  22.011  0.00  0.00              
ATOM   1932  H6o GLB A  16      17.847 -24.322  21.235  0.00  0.00              
ATOM   1933  O4h GLB A  16      18.307 -21.355  23.296  0.00  0.00              
ATOM   1934  H4o GLB A  16      17.855 -20.629  23.972  0.00  0.00              
ATOM   1935  H5  GLB A  16      21.208 -23.031  23.342  0.00  0.00              
ATOM   1936  H6S GLB A  16      19.839 -24.948  22.328  0.00  0.00              
ATOM   1937  H6R GLB A  16      19.399 -24.534  23.658  0.00  0.00              
ATOM   1938  H1  GLB A  16      22.311 -21.330  21.997  0.00  0.00              
ATOM   1939  H2  GLB A  16      19.817 -19.617  22.040  0.00  0.00              
ATOM   1940  H3  GLB A  16      21.323 -20.711  24.437  0.00  0.00              
ATOM   1941  H4  GLB A  16      19.427 -22.256  24.773  0.00  0.00              
ATOM   1942  C1  NAG A  17      19.780 -19.464  26.023  0.00  0.00              
ATOM   1943  C2  NAG A  17      20.808 -18.367  26.450  0.00  0.00              
ATOM   1944  C3  NAG A  17      20.745 -18.162  27.996  0.00  0.00              
ATOM   1945  C4  NAG A  17      19.305 -17.892  28.476  0.00  0.00              
ATOM   1946  C5  NAG A  17      18.344 -19.011  27.992  0.00  0.00              
ATOM   1947  C6  NAG A  17      16.874 -18.733  28.359  0.00  0.00              
ATOM   1948  C7  NAG A  17      23.031 -17.900  25.470  0.00  0.00              
ATOM   1949  C8  NAG A  17      24.426 -18.431  25.212  0.00  0.00              
ATOM   1950  O3h NAG A  17      21.555 -17.063  28.422  0.00  0.00              
ATOM   1951  OR  NAG A  17      19.331 -17.808  29.898  0.00  0.00              
ATOM   1952  OR  NAG A  17      18.455 -19.165  26.542  0.00  0.00              
ATOM   1953  O6h NAG A  17      16.398 -17.525  27.760  0.00  0.00              
ATOM   1954  OM  NAG A  17      22.755 -16.738  25.196  0.00  0.00              
ATOM   1955  N15 NAG A  17      22.189 -18.753  26.047  0.00  0.00              
ATOM   1956  H2  NAG A  17      20.491 -17.422  25.963  0.00  0.00              
ATOM   1957  H3  NAG A  17      21.109 -19.082  28.495  0.00  0.00              
ATOM   1958  H4  NAG A  17      18.961 -16.925  28.057  0.00  0.00              
ATOM   1959  H5  NAG A  17      18.637 -19.962  28.478  0.00  0.00              
ATOM   1960  H6S NAG A  17      16.244 -19.585  28.040  0.00  0.00              
ATOM   1961  H6R NAG A  17      16.777 -18.672  29.460  0.00  0.00              
ATOM   1962  H8  NAG A  17      24.801 -18.051  24.246  0.00  0.00              
ATOM   1963  H24 NAG A  17      24.485 -19.534  25.184  0.00  0.00              
ATOM   1964  H25 NAG A  17      25.110 -18.067  25.998  0.00  0.00              
ATOM   1965  H3o NAG A  17      22.467 -17.306  28.232  0.00  0.00              
ATOM   1966  H6o NAG A  17      15.590 -17.275  28.218  0.00  0.00              
ATOM   1967  H29 NAG A  17      22.528 -19.716  26.067  0.00  0.00              
ATOM   1968  H1  NAG A  17      20.100 -20.463  26.380  0.00  0.00              
ATOM   1969  C1  GLB A  18      18.823 -16.654  30.468  0.00  0.00              
ATOM   1970  C2  GLB A  18      18.685 -16.885  31.969  0.00  0.00              
ATOM   1971  C3  GLB A  18      18.380 -15.599  32.719  0.00  0.00              
ATOM   1972  C4  GLB A  18      19.363 -14.516  32.335  0.00  0.00              
ATOM   1973  C5  GLB A  18      19.392 -14.358  30.814  0.00  0.00              
ATOM   1974  C6  GLB A  18      20.361 -13.316  30.300  0.00  0.00              
ATOM   1975  O2h GLB A  18      17.642 -17.826  32.186  0.00  0.00              
ATOM   1976  OW  GLB A  18      18.486 -15.851  34.125  0.00  0.00              
ATOM   1977  OR  GLB A  18      19.793 -15.619  30.253  0.00  0.00              
ATOM   1978  O6h GLB A  18      21.696 -13.595  30.689  0.00  0.00              
ATOM   1979  H2o GLB A  18      17.961 -18.792  32.359  0.00  0.00              
ATOM   1980  H6o GLB A  18      22.576 -13.712  30.055  0.00  0.00              
ATOM   1981  O4h GLB A  18      20.614 -14.928  32.872  0.00  0.00              
ATOM   1982  H4o GLB A  18      20.528 -15.031  33.954  0.00  0.00              
ATOM   1983  H5  GLB A  18      18.439 -14.063  30.475  0.00  0.00              
ATOM   1984  H6S GLB A  18      20.459 -12.910  29.394  0.00  0.00              
ATOM   1985  H6R GLB A  18      20.099 -12.383  30.708  0.00  0.00              
ATOM   1986  H1  GLB A  18      17.853 -16.386  30.050  0.00  0.00              
ATOM   1987  H2  GLB A  18      19.631 -17.297  32.322  0.00  0.00              
ATOM   1988  H3  GLB A  18      17.369 -15.278  32.469  0.00  0.00              
ATOM   1989  H4  GLB A  18      19.100 -13.536  32.733  0.00  0.00              
ATOM   1990  C1  NAN A  19      16.088 -16.187  34.372  0.00  0.00              
ATOM   1991  C2  NAN A  19      17.378 -15.485  34.929  0.00  0.00              
ATOM   1992  C3  NAN A  19      17.340 -13.931  34.937  0.00  0.00              
ATOM   1993  C4  NAN A  19      16.470 -13.380  36.088  0.00  0.00              
ATOM   1994  C5  NAN A  19      16.904 -13.963  37.450  0.00  0.00              
ATOM   1995  C6  NAN A  19      16.942 -15.519  37.404  0.00  0.00              
ATOM   1996  C7  NAN A  19      17.510 -16.164  38.694  0.00  0.00              
ATOM   1997  C8  NAN A  19      17.323 -17.700  38.746  0.00  0.00              
ATOM   1998  C9  NAN A  19      17.862 -18.343  40.031  0.00  0.00              
ATOM   1999  OW  NAN A  19      17.758 -15.955  36.259  0.00  0.00              
ATOM   2000  OM  NAN A  19      15.102 -15.603  33.925  0.00  0.00              
ATOM   2001  O1h NAN A  19      16.167 -17.549  34.432  0.00  0.00              
ATOM   2002  O4h NAN A  19      16.599 -11.965  36.119  0.00  0.00              
ATOM   2003  O7h NAN A  19      18.903 -15.860  38.767  0.00  0.00              
ATOM   2004  O8h NAN A  19      15.941 -18.024  38.696  0.00  0.00              
ATOM   2005  O9h NAN A  19      17.585 -19.744  40.030  0.00  0.00              
ATOM   2006  H6  NAN A  19      15.901 -15.877  37.271  0.00  0.00              
ATOM   2007  H3  NAN A  19      18.373 -13.550  35.056  0.00  0.00              
ATOM   2008  H21 NAN A  19      16.995 -13.552  33.958  0.00  0.00              
ATOM   2009  H4  NAN A  19      15.409 -13.644  35.902  0.00  0.00              
ATOM   2010  H7o NAN A  19      19.195 -15.895  37.851  0.00  0.00              
ATOM   2011  H8o NAN A  19      15.902 -18.894  39.108  0.00  0.00              
ATOM   2012  H4o NAN A  19      16.490 -11.669  35.211  0.00  0.00              
ATOM   2013  H9o NAN A  19      18.047 -20.124  40.785  0.00  0.00              
ATOM   2014  H9R NAN A  19      17.404 -17.865  40.921  0.00  0.00              
ATOM   2015  H9S NAN A  19      18.952 -18.167  40.113  0.00  0.00              
ATOM   2016  H8  NAN A  19      17.832 -18.161  37.876  0.00  0.00              
ATOM   2017  H7  NAN A  19      16.996 -15.721  39.569  0.00  0.00              
ATOM   2018  H1o NAN A  19      15.340 -17.903  34.103  0.00  0.00              
ATOM   2019  H5  NAN A  19      17.916 -13.586  37.697  0.00  0.00              
ATOM   2020  N33 NAN A  19      15.967 -13.499  38.448  0.00  0.00              
ATOM   2021  C34 NAN A  19      16.243 -12.370  39.175  0.00  0.00              
ATOM   2022  C35 NAN A  19      15.173 -12.010  40.188  0.00  0.00              
ATOM   2023  OM  NAN A  19      17.250 -11.701  39.045  0.00  0.00              
ATOM   2024  H37 NAN A  19      15.092 -14.017  38.613  0.00  0.00              
ATOM   2025  H35 NAN A  19      15.445 -11.082  40.741  0.00  0.00              
ATOM   2026  H39 NAN A  19      15.052 -12.832  40.930  0.00  0.00              
ATOM   2027  H40 NAN A  19      14.200 -11.834  39.677  0.00  0.00              
ATOM   2028  C1  AFL A  20      17.711 -16.864   3.880  0.00  0.00              
ATOM   2029  C2  AFL A  20      18.817 -15.955   3.314  0.00  0.00              
ATOM   2030  C3  AFL A  20      20.204 -16.543   3.612  0.00  0.00              
ATOM   2031  C4  AFL A  20      20.259 -17.997   3.116  0.00  0.00              
ATOM   2032  C5  AFL A  20      19.095 -18.796   3.723  0.00  0.00              
ATOM   2033  C6  AFL A  20      19.038 -20.255   3.250  0.00  0.00              
ATOM   2034  OR  AFL A  20      17.832 -18.205   3.397  0.00  0.00              
ATOM   2035  O2h AFL A  20      18.617 -14.643   3.834  0.00  0.00              
ATOM   2036  O3h AFL A  20      21.204 -15.710   3.032  0.00  0.00              
ATOM   2037  O4h AFL A  20      20.160 -18.076   1.694  0.00  0.00              
ATOM   2038  H5  AFL A  20      19.227 -18.816   4.822  0.00  0.00              
ATOM   2039  H1  AFL A  20      16.732 -16.515   3.527  0.00  0.00              
ATOM   2040  H2  AFL A  20      18.691 -15.920   2.215  0.00  0.00              
ATOM   2041  H2o AFL A  20      19.228 -14.065   3.358  0.00  0.00              
ATOM   2042  H3  AFL A  20      20.345 -16.542   4.710  0.00  0.00              
ATOM   2043  H3o AFL A  20      22.048 -15.997   3.404  0.00  0.00              
ATOM   2044  H4  AFL A  20      21.212 -18.467   3.426  0.00  0.00              
ATOM   2045  H4o AFL A  20      20.956 -17.656   1.340  0.00  0.00              
ATOM   2046  H6  AFL A  20      19.982 -20.789   3.446  0.00  0.00              
ATOM   2047  H22 AFL A  20      18.229 -20.788   3.772  0.00  0.00              
ATOM   2048  H23 AFL A  20      18.830 -20.307   2.170  0.00  0.00              
ATOM   2049  C1  NAG B   1      -3.924  11.082 -11.939  0.00  0.00              
ATOM   2050  C2  NAG B   1      -3.207  11.893 -13.066  0.00  0.00              
ATOM   2051  C3  NAG B   1      -3.182  13.408 -12.690  0.00  0.00              
ATOM   2052  C4  NAG B   1      -4.591  13.930 -12.341  0.00  0.00              
ATOM   2053  C5  NAG B   1      -5.244  13.057 -11.234  0.00  0.00              
ATOM   2054  C6  NAG B   1      -6.693  13.477 -10.924  0.00  0.00              
ATOM   2055  C7  NAG B   1      -1.299  11.185 -14.474  0.00  0.00              
ATOM   2056  C8  NAG B   1       0.158  10.776 -14.499  0.00  0.00              
ATOM   2057  O3h NAG B   1      -2.675  14.215 -13.755  0.00  0.00              
ATOM   2058  OR  NAG B   1      -4.461  15.286 -11.926  0.00  0.00              
ATOM   2059  OR  NAG B   1      -5.225  11.652 -11.637  0.00  0.00              
ATOM   2060  O6h NAG B   1      -7.539  13.347 -12.070  0.00  0.00              
ATOM   2061  OM  NAG B   1      -1.911  11.346 -15.524  0.00  0.00              
ATOM   2062  N15 NAG B   1      -1.816  11.401 -13.267  0.00  0.00              
ATOM   2063  H2  NAG B   1      -3.817  11.776 -13.986  0.00  0.00              
ATOM   2064  H3  NAG B   1      -2.533  13.547 -11.802  0.00  0.00              
ATOM   2065  H4  NAG B   1      -5.228  13.884 -13.248  0.00  0.00              
ATOM   2066  H5  NAG B   1      -4.655  13.173 -10.302  0.00  0.00              
ATOM   2067  H6S NAG B   1      -7.088  12.861 -10.093  0.00  0.00              
ATOM   2068  H6R NAG B   1      -6.703  14.523 -10.563  0.00  0.00              
ATOM   2069  H8  NAG B   1       0.324  10.018 -15.284  0.00  0.00              
ATOM   2070  H24 NAG B   1       0.520  10.352 -13.544  0.00  0.00              
ATOM   2071  H25 NAG B   1       0.783  11.651 -14.747  0.00  0.00              
ATOM   2072  H3o NAG B   1      -1.753  13.966 -13.871  0.00  0.00              
ATOM   2073  H6o NAG B   1      -8.339  13.852 -11.897  0.00  0.00              
ATOM   2074  H29 NAG B   1      -1.222  11.078 -12.502  0.00  0.00              
ATOM   2075  H1  NAG B   1      -3.308  11.060 -11.019  0.00  0.00              
ATOM   2076  C1  NAG B   2      -5.235  16.250 -12.623  0.00  0.00              
ATOM   2077  C2  NAG B   2      -5.301  17.589 -11.822  0.00  0.00              
ATOM   2078  C3  NAG B   2      -5.920  18.708 -12.717  0.00  0.00              
ATOM   2079  C4  NAG B   2      -5.191  18.824 -14.070  0.00  0.00              
ATOM   2080  C5  NAG B   2      -5.147  17.449 -14.791  0.00  0.00              
ATOM   2081  C6  NAG B   2      -4.337  17.489 -16.101  0.00  0.00              
ATOM   2082  C7  NAG B   2      -5.725  17.898  -9.403  0.00  0.00              
ATOM   2083  C8  NAG B   2      -6.716  17.724  -8.271  0.00  0.00              
ATOM   2084  O3h NAG B   2      -5.864  19.990 -12.086  0.00  0.00              
ATOM   2085  OR  NAG B   2      -5.875  19.798 -14.851  0.00  0.00              
ATOM   2086  OR  NAG B   2      -4.570  16.442 -13.902  0.00  0.00              
ATOM   2087  O6h NAG B   2      -2.973  17.852 -15.869  0.00  0.00              
ATOM   2088  OM  NAG B   2      -4.668  18.487  -9.211  0.00  0.00              
ATOM   2089  N15 NAG B   2      -6.114  17.425 -10.584  0.00  0.00              
ATOM   2090  H2  NAG B   2      -4.255  17.876 -11.585  0.00  0.00              
ATOM   2091  H3  NAG B   2      -6.982  18.460 -12.917  0.00  0.00              
ATOM   2092  H4  NAG B   2      -4.149  19.161 -13.891  0.00  0.00              
ATOM   2093  H5  NAG B   2      -6.184  17.151 -15.047  0.00  0.00              
ATOM   2094  H6S NAG B   2      -4.387  16.503 -16.599  0.00  0.00              
ATOM   2095  H6R NAG B   2      -4.806  18.210 -16.799  0.00  0.00              
ATOM   2096  H8  NAG B   2      -6.181  17.482  -7.337  0.00  0.00              
ATOM   2097  H24 NAG B   2      -7.460  16.927  -8.446  0.00  0.00              
ATOM   2098  H25 NAG B   2      -7.255  18.672  -8.105  0.00  0.00              
ATOM   2099  H3o NAG B   2      -6.433  19.938 -11.311  0.00  0.00              
ATOM   2100  H6o NAG B   2      -2.595  18.107 -16.715  0.00  0.00              
ATOM   2101  H29 NAG B   2      -6.945  16.834 -10.538  0.00  0.00              
ATOM   2102  H1  NAG B   2      -6.252  15.843 -12.794  0.00  0.00              
ATOM   2103  C1  BMA B   3      -5.125  20.858 -15.328  0.00  0.00              
ATOM   2104  C2  BMA B   3      -5.967  21.613 -16.353  0.00  0.00              
ATOM   2105  C3  BMA B   3      -5.335  22.938 -16.746  0.00  0.00              
ATOM   2106  C4  BMA B   3      -4.971  23.737 -15.516  0.00  0.00              
ATOM   2107  C5  BMA B   3      -4.108  22.888 -14.582  0.00  0.00              
ATOM   2108  C6  BMA B   3      -3.696  23.572 -13.297  0.00  0.00              
ATOM   2109  OW  BMA B   3      -6.277  23.682 -17.528  0.00  0.00              
ATOM   2110  O4h BMA B   3      -4.239  24.902 -15.863  0.00  0.00              
ATOM   2111  OR  BMA B   3      -4.873  21.728 -14.217  0.00  0.00              
ATOM   2112  OW  BMA B   3      -2.286  23.604 -13.143  0.00  0.00              
ATOM   2113  H4o BMA B   3      -4.916  25.754 -15.931  0.00  0.00              
ATOM   2114  O2h BMA B   3      -7.256  21.847 -15.800  0.00  0.00              
ATOM   2115  H2o BMA B   3      -7.164  22.481 -14.918  0.00  0.00              
ATOM   2116  H5  BMA B   3      -3.211  22.629 -15.074  0.00  0.00              
ATOM   2117  H6  BMA B   3      -3.996  24.433 -12.893  0.00  0.00              
ATOM   2118  H20 BMA B   3      -4.093  23.032 -12.487  0.00  0.00              
ATOM   2119  H2  BMA B   3      -6.052  20.976 -17.233  0.00  0.00              
ATOM   2120  H3  BMA B   3      -4.436  22.739 -17.330  0.00  0.00              
ATOM   2121  H1  BMA B   3      -4.199  20.524 -15.795  0.00  0.00              
ATOM   2122  H4  BMA B   3      -5.900  24.025 -15.022  0.00  0.00              
ATOM   2123  C1  MAN B   4      -5.831  24.164 -18.790  0.00  0.00              
ATOM   2124  C2  MAN B   4      -6.749  25.183 -19.459  0.00  0.00              
ATOM   2125  C3  MAN B   4      -8.068  24.565 -19.891  0.00  0.00              
ATOM   2126  C4  MAN B   4      -7.824  23.310 -20.697  0.00  0.00              
ATOM   2127  C5  MAN B   4      -6.920  22.358 -19.914  0.00  0.00              
ATOM   2128  C6  MAN B   4      -6.582  21.068 -20.629  0.00  0.00              
ATOM   2129  O3h MAN B   4      -8.774  25.513 -20.701  0.00  0.00              
ATOM   2130  O4h MAN B   4      -9.044  22.637 -20.973  0.00  0.00              
ATOM   2131  OR  MAN B   4      -5.680  23.041 -19.668  0.00  0.00              
ATOM   2132  O6h MAN B   4      -5.925  21.301 -21.865  0.00  0.00              
ATOM   2133  H3o MAN B   4      -9.609  25.808 -20.063  0.00  0.00              
ATOM   2134  H4o MAN B   4      -9.404  22.923 -21.961  0.00  0.00              
ATOM   2135  H6o MAN B   4      -4.961  20.922 -22.202  0.00  0.00              
ATOM   2136  OW  MAN B   4      -6.080  25.722 -20.592  0.00  0.00              
ATOM   2137  H5  MAN B   4      -7.398  22.077 -19.018  0.00  0.00              
ATOM   2138  H6S MAN B   4      -6.158  20.229 -20.292  0.00  0.00              
ATOM   2139  H6R MAN B   4      -7.475  20.553 -20.835  0.00  0.00              
ATOM   2140  H1  MAN B   4      -4.870  24.629 -18.571  0.00  0.00              
ATOM   2141  H2  MAN B   4      -6.938  25.973 -18.732  0.00  0.00              
ATOM   2142  H3  MAN B   4      -8.649  24.321 -19.003  0.00  0.00              
ATOM   2143  H4  MAN B   4      -7.352  23.603 -21.634  0.00  0.00              
ATOM   2144  C1  NAG B   5      -5.219  26.828 -20.367  0.00  0.00              
ATOM   2145  C2  NAG B   5      -3.947  26.729 -21.267  0.00  0.00              
ATOM   2146  C3  NAG B   5      -3.151  28.071 -21.205  0.00  0.00              
ATOM   2147  C4  NAG B   5      -4.053  29.282 -21.524  0.00  0.00              
ATOM   2148  C5  NAG B   5      -5.305  29.294 -20.605  0.00  0.00              
ATOM   2149  C6  NAG B   5      -6.288  30.427 -20.956  0.00  0.00              
ATOM   2150  C7  NAG B   5      -2.524  24.747 -21.682  0.00  0.00              
ATOM   2151  C8  NAG B   5      -1.591  23.722 -21.071  0.00  0.00              
ATOM   2152  O3h NAG B   5      -2.061  28.090 -22.129  0.00  0.00              
ATOM   2153  OR  NAG B   5      -3.272  30.460 -21.355  0.00  0.00              
ATOM   2154  OR  NAG B   5      -5.998  28.010 -20.697  0.00  0.00              
ATOM   2155  O6h NAG B   5      -6.786  30.302 -22.290  0.00  0.00              
ATOM   2156  OM  NAG B   5      -2.694  24.779 -22.895  0.00  0.00              
ATOM   2157  N15 NAG B   5      -3.074  25.605 -20.827  0.00  0.00              
ATOM   2158  H2  NAG B   5      -4.299  26.585 -22.311  0.00  0.00              
ATOM   2159  H3  NAG B   5      -2.748  28.202 -20.180  0.00  0.00              
ATOM   2160  H4  NAG B   5      -4.390  29.211 -22.579  0.00  0.00              
ATOM   2161  H5  NAG B   5      -4.972  29.450 -19.559  0.00  0.00              
ATOM   2162  H6S NAG B   5      -7.130  30.422 -20.237  0.00  0.00              
ATOM   2163  H6R NAG B   5      -5.781  31.403 -20.832  0.00  0.00              
ATOM   2164  H8  NAG B   5      -1.718  22.749 -21.577  0.00  0.00              
ATOM   2165  H24 NAG B   5      -1.749  23.562 -19.991  0.00  0.00              
ATOM   2166  H25 NAG B   5      -0.545  24.040 -21.225  0.00  0.00              
ATOM   2167  H3o NAG B   5      -1.443  27.413 -21.835  0.00  0.00              
ATOM   2168  H6o NAG B   5      -7.175  31.146 -22.532  0.00  0.00              
ATOM   2169  H29 NAG B   5      -2.951  25.346 -19.847  0.00  0.00              
ATOM   2170  H1  NAG B   5      -4.941  26.858 -19.294  0.00  0.00              
ATOM   2171  C1  GLB B   6      -3.193  31.321 -22.436  0.00  0.00              
ATOM   2172  C2  GLB B   6      -2.563  32.626 -21.961  0.00  0.00              
ATOM   2173  C3  GLB B   6      -2.197  33.538 -23.119  0.00  0.00              
ATOM   2174  C4  GLB B   6      -1.389  32.787 -24.151  0.00  0.00              
ATOM   2175  C5  GLB B   6      -2.134  31.519 -24.570  0.00  0.00              
ATOM   2176  C6  GLB B   6      -1.413  30.662 -25.587  0.00  0.00              
ATOM   2177  O2h GLB B   6      -3.484  33.286 -21.101  0.00  0.00              
ATOM   2178  O3h GLB B   6      -1.418  34.630 -22.616  0.00  0.00              
ATOM   2179  OR  GLB B   6      -2.316  30.713 -23.393  0.00  0.00              
ATOM   2180  OW  GLB B   6      -2.311  30.077 -26.518  0.00  0.00              
ATOM   2181  H2o GLB B   6      -3.297  33.164 -20.094  0.00  0.00              
ATOM   2182  H3o GLB B   6      -2.092  35.480 -22.712  0.00  0.00              
ATOM   2183  O4h GLB B   6      -0.138  32.516 -23.533  0.00  0.00              
ATOM   2184  H4o GLB B   6       0.340  33.454 -23.252  0.00  0.00              
ATOM   2185  H5  GLB B   6      -3.055  31.782 -25.011  0.00  0.00              
ATOM   2186  H6  GLB B   6      -0.598  30.844 -26.131  0.00  0.00              
ATOM   2187  H20 GLB B   6      -0.924  29.881 -25.083  0.00  0.00              
ATOM   2188  H1  GLB B   6      -4.175  31.527 -22.865  0.00  0.00              
ATOM   2189  H2  GLB B   6      -1.662  32.367 -21.403  0.00  0.00              
ATOM   2190  H3  GLB B   6      -3.115  33.911 -23.576  0.00  0.00              
ATOM   2191  H4  GLB B   6      -1.228  33.355 -25.067  0.00  0.00              
ATOM   2192  C1  NAN B   7      -1.435  27.831 -26.201  0.00  0.00              
ATOM   2193  C2  NAN B   7      -1.851  28.942 -27.229  0.00  0.00              
ATOM   2194  C3  NAN B   7      -0.715  29.446 -28.165  0.00  0.00              
ATOM   2195  C4  NAN B   7      -0.404  28.435 -29.291  0.00  0.00              
ATOM   2196  C5  NAN B   7      -1.681  28.052 -30.072  0.00  0.00              
ATOM   2197  C6  NAN B   7      -2.800  27.566 -29.105  0.00  0.00              
ATOM   2198  C7  NAN B   7      -4.158  27.306 -29.809  0.00  0.00              
ATOM   2199  C8  NAN B   7      -5.192  26.593 -28.903  0.00  0.00              
ATOM   2200  C9  NAN B   7      -6.529  26.310 -29.600  0.00  0.00              
ATOM   2201  OW  NAN B   7      -3.002  28.566 -28.045  0.00  0.00              
ATOM   2202  OM  NAN B   7      -0.298  27.375 -26.072  0.00  0.00              
ATOM   2203  O1h NAN B   7      -2.485  27.401 -25.441  0.00  0.00              
ATOM   2204  O4h NAN B   7       0.534  29.022 -30.183  0.00  0.00              
ATOM   2205  O7h NAN B   7      -4.688  28.561 -30.229  0.00  0.00              
ATOM   2206  O8h NAN B   7      -4.691  25.331 -28.491  0.00  0.00              
ATOM   2207  O9h NAN B   7      -7.396  25.592 -28.722  0.00  0.00              
ATOM   2208  H6  NAN B   7      -2.461  26.613 -28.650  0.00  0.00              
ATOM   2209  H3  NAN B   7      -1.027  30.404 -28.621  0.00  0.00              
ATOM   2210  H21 NAN B   7       0.191  29.677 -27.575  0.00  0.00              
ATOM   2211  H4  NAN B   7       0.038  27.519 -28.849  0.00  0.00              
ATOM   2212  H7o NAN B   7      -4.438  29.166 -29.522  0.00  0.00              
ATOM   2213  H8o NAN B   7      -5.488  24.831 -28.287  0.00  0.00              
ATOM   2214  H4o NAN B   7       1.224  29.396 -29.630  0.00  0.00              
ATOM   2215  H9o NAN B   7      -8.258  25.549 -29.149  0.00  0.00              
ATOM   2216  H9R NAN B   7      -6.363  25.732 -30.530  0.00  0.00              
ATOM   2217  H9S NAN B   7      -7.003  27.263 -29.911  0.00  0.00              
ATOM   2218  H8  NAN B   7      -5.382  27.215 -28.005  0.00  0.00              
ATOM   2219  H7  NAN B   7      -3.980  26.671 -30.699  0.00  0.00              
ATOM   2220  H1o NAN B   7      -2.161  26.711 -24.862  0.00  0.00              
ATOM   2221  H5  NAN B   7      -2.045  28.942 -30.623  0.00  0.00              
ATOM   2222  N33 NAN B   7      -1.328  27.018 -31.017  0.00  0.00              
ATOM   2223  C34 NAN B   7      -0.994  27.351 -32.304  0.00  0.00              
ATOM   2224  C35 NAN B   7      -0.655  26.161 -33.181  0.00  0.00              
ATOM   2225  OM  NAN B   7      -0.971  28.488 -32.733  0.00  0.00              
ATOM   2226  H37 NAN B   7      -1.327  26.031 -30.723  0.00  0.00              
ATOM   2227  H35 NAN B   7      -0.383  26.490 -34.211  0.00  0.00              
ATOM   2228  H39 NAN B   7      -1.530  25.477 -33.258  0.00  0.00              
ATOM   2229  H40 NAN B   7       0.211  25.602 -32.759  0.00  0.00              
ATOM   2230  C1  MAN B   8      -1.785  23.807 -11.828  0.00  0.00              
ATOM   2231  C2  MAN B   8      -1.825  25.250 -11.331  0.00  0.00              
ATOM   2232  C3  MAN B   8      -0.860  26.142 -12.094  0.00  0.00              
ATOM   2233  C4  MAN B   8       0.518  25.524 -12.129  0.00  0.00              
ATOM   2234  C5  MAN B   8       0.434  24.096 -12.668  0.00  0.00              
ATOM   2235  C6  MAN B   8       1.753  23.358 -12.730  0.00  0.00              
ATOM   2236  O3h MAN B   8      -0.789  27.412 -11.433  0.00  0.00              
ATOM   2237  O4h MAN B   8       1.389  26.266 -12.970  0.00  0.00              
ATOM   2238  OR  MAN B   8      -0.427  23.350 -11.791  0.00  0.00              
ATOM   2239  OW  MAN B   8       2.044  22.902 -14.042  0.00  0.00              
ATOM   2240  H3o MAN B   8      -1.294  28.080 -12.131  0.00  0.00              
ATOM   2241  H4o MAN B   8       1.970  26.965 -12.369  0.00  0.00              
ATOM   2242  OW  MAN B   8      -1.494  25.264  -9.947  0.00  0.00              
ATOM   2243  H5  MAN B   8       0.065  24.117 -13.656  0.00  0.00              
ATOM   2244  H6  MAN B   8       2.649  23.594 -12.360  0.00  0.00              
ATOM   2245  H20 MAN B   8       1.697  22.515 -12.105  0.00  0.00              
ATOM   2246  H1  MAN B   8      -2.428  23.189 -11.201  0.00  0.00              
ATOM   2247  H2  MAN B   8      -2.844  25.611 -11.471  0.00  0.00              
ATOM   2248  H3  MAN B   8      -1.228  26.268 -13.112  0.00  0.00              
ATOM   2249  H4  MAN B   8       0.908  25.526 -11.111  0.00  0.00              
ATOM   2250  C1  NAG B   9      -2.555  25.048  -9.030  0.00  0.00              
ATOM   2251  C2  NAG B   9      -2.072  24.183  -7.821  0.00  0.00              
ATOM   2252  C3  NAG B   9      -3.163  24.183  -6.705  0.00  0.00              
ATOM   2253  C4  NAG B   9      -3.585  25.616  -6.321  0.00  0.00              
ATOM   2254  C5  NAG B   9      -4.027  26.415  -7.577  0.00  0.00              
ATOM   2255  C6  NAG B   9      -4.360  27.885  -7.260  0.00  0.00              
ATOM   2256  C7  NAG B   9      -0.697  22.127  -7.874  0.00  0.00              
ATOM   2257  C8  NAG B   9      -0.615  20.684  -8.327  0.00  0.00              
ATOM   2258  O3h NAG B   9      -2.709  23.533  -5.515  0.00  0.00              
ATOM   2259  OR  NAG B   9      -4.639  25.518  -5.369  0.00  0.00              
ATOM   2260  OR  NAG B   9      -2.973  26.369  -8.589  0.00  0.00              
ATOM   2261  O6h NAG B   9      -3.228  28.583  -6.733  0.00  0.00              
ATOM   2262  OM  NAG B   9       0.183  22.600  -7.164  0.00  0.00              
ATOM   2263  N15 NAG B   9      -1.789  22.786  -8.252  0.00  0.00              
ATOM   2264  H2  NAG B   9      -1.163  24.676  -7.416  0.00  0.00              
ATOM   2265  H3  NAG B   9      -4.059  23.648  -7.079  0.00  0.00              
ATOM   2266  H4  NAG B   9      -2.720  26.135  -5.859  0.00  0.00              
ATOM   2267  H5  NAG B   9      -4.942  25.945  -7.989  0.00  0.00              
ATOM   2268  H6S NAG B   9      -4.721  28.389  -8.176  0.00  0.00              
ATOM   2269  H6R NAG B   9      -5.197  27.923  -6.536  0.00  0.00              
ATOM   2270  H8  NAG B   9       0.426  20.434  -8.598  0.00  0.00              
ATOM   2271  H24 NAG B   9      -1.254  20.451  -9.197  0.00  0.00              
ATOM   2272  H25 NAG B   9      -0.907  20.019  -7.495  0.00  0.00              
ATOM   2273  H3o NAG B   9      -2.576  22.608  -5.743  0.00  0.00              
ATOM   2274  H6o NAG B   9      -3.552  29.390  -6.325  0.00  0.00              
ATOM   2275  H29 NAG B   9      -2.340  22.298  -8.959  0.00  0.00              
ATOM   2276  H1  NAG B   9      -3.394  24.552  -9.557  0.00  0.00              
ATOM   2277  C1  GLB B  10      -4.457  26.166  -4.161  0.00  0.00              
ATOM   2278  C2  GLB B  10      -5.791  26.174  -3.419  0.00  0.00              
ATOM   2279  C3  GLB B  10      -5.639  26.632  -1.979  0.00  0.00              
ATOM   2280  C4  GLB B  10      -4.538  25.859  -1.290  0.00  0.00              
ATOM   2281  C5  GLB B  10      -3.250  25.948  -2.110  0.00  0.00              
ATOM   2282  C6  GLB B  10      -2.074  25.192  -1.534  0.00  0.00              
ATOM   2283  O2h GLB B  10      -6.685  27.039  -4.108  0.00  0.00              
ATOM   2284  OW  GLB B  10      -6.875  26.403  -1.291  0.00  0.00              
ATOM   2285  OR  GLB B  10      -3.520  25.388  -3.406  0.00  0.00              
ATOM   2286  O6h GLB B  10      -2.352  23.807  -1.394  0.00  0.00              
ATOM   2287  H2o GLB B  10      -7.360  26.561  -4.724  0.00  0.00              
ATOM   2288  H6o GLB B  10      -1.799  22.960  -1.801  0.00  0.00              
ATOM   2289  O4h GLB B  10      -5.024  24.528  -1.166  0.00  0.00              
ATOM   2290  H4o GLB B  10      -5.944  24.530  -0.581  0.00  0.00              
ATOM   2291  H5  GLB B  10      -2.945  26.955  -2.174  0.00  0.00              
ATOM   2292  H6S GLB B  10      -1.105  25.214  -1.773  0.00  0.00              
ATOM   2293  H6R GLB B  10      -1.864  25.572  -0.577  0.00  0.00              
ATOM   2294  H1  GLB B  10      -4.111  27.190  -4.297  0.00  0.00              
ATOM   2295  H2  GLB B  10      -6.178  25.154  -3.437  0.00  0.00              
ATOM   2296  H3  GLB B  10      -5.396  27.695  -1.971  0.00  0.00              
ATOM   2297  H4  GLB B  10      -4.292  26.249  -0.302  0.00  0.00              
ATOM   2298  C1  NAN B  11      -7.622  28.696  -1.608  0.00  0.00              
ATOM   2299  C2  NAN B  11      -7.441  27.503  -0.602  0.00  0.00              
ATOM   2300  C3  NAN B  11      -6.509  27.786   0.609  0.00  0.00              
ATOM   2301  C4  NAN B  11      -7.200  28.661   1.678  0.00  0.00              
ATOM   2302  C5  NAN B  11      -8.555  28.058   2.109  0.00  0.00              
ATOM   2303  C6  NAN B  11      -9.458  27.776   0.872  0.00  0.00              
ATOM   2304  C7  NAN B  11     -10.774  27.034   1.222  0.00  0.00              
ATOM   2305  C8  NAN B  11     -11.776  26.972   0.043  0.00  0.00              
ATOM   2306  C9  NAN B  11     -13.091  26.261   0.389  0.00  0.00              
ATOM   2307  OW  NAN B  11      -8.710  26.973  -0.108  0.00  0.00              
ATOM   2308  OM  NAN B  11      -7.063  29.788  -1.517  0.00  0.00              
ATOM   2309  O1h NAN B  11      -8.486  28.398  -2.623  0.00  0.00              
ATOM   2310  O4h NAN B  11      -6.346  28.756   2.809  0.00  0.00              
ATOM   2311  O7h NAN B  11     -10.443  25.707   1.625  0.00  0.00              
ATOM   2312  O8h NAN B  11     -12.135  28.285  -0.360  0.00  0.00              
ATOM   2313  O9h NAN B  11     -13.981  26.311  -0.726  0.00  0.00              
ATOM   2314  H6  NAN B  11      -9.724  28.753   0.420  0.00  0.00              
ATOM   2315  H3  NAN B  11      -6.219  26.823   1.069  0.00  0.00              
ATOM   2316  H21 NAN B  11      -5.565  28.247   0.264  0.00  0.00              
ATOM   2317  H4  NAN B  11      -7.371  29.677   1.264  0.00  0.00              
ATOM   2318  H7o NAN B  11      -9.705  25.468   1.053  0.00  0.00              
ATOM   2319  H8o NAN B  11     -12.991  28.160  -0.785  0.00  0.00              
ATOM   2320  H4o NAN B  11      -5.474  28.967   2.465  0.00  0.00              
ATOM   2321  H9o NAN B  11     -14.734  25.749  -0.513  0.00  0.00              
ATOM   2322  H9R NAN B  11     -13.562  26.733   1.275  0.00  0.00              
ATOM   2323  H9S NAN B  11     -12.889  25.209   0.672  0.00  0.00              
ATOM   2324  H8  NAN B  11     -11.302  26.451  -0.814  0.00  0.00              
ATOM   2325  H7  NAN B  11     -11.265  27.558   2.067  0.00  0.00              
ATOM   2326  H1o NAN B  11      -8.564  29.177  -3.175  0.00  0.00              
ATOM   2327  H5  NAN B  11      -8.370  27.105   2.643  0.00  0.00              
ATOM   2328  N33 NAN B  11      -9.189  28.994   3.009  0.00  0.00              
ATOM   2329  C34 NAN B  11      -9.031  28.857   4.363  0.00  0.00              
ATOM   2330  C35 NAN B  11      -9.758  29.906   5.181  0.00  0.00              
ATOM   2331  OM  NAN B  11      -8.375  27.978   4.891  0.00  0.00              
ATOM   2332  H37 NAN B  11      -9.760  29.765   2.633  0.00  0.00              
ATOM   2333  H35 NAN B  11      -9.588  29.752   6.271  0.00  0.00              
ATOM   2334  H39 NAN B  11     -10.855  29.849   4.993  0.00  0.00              
ATOM   2335  H40 NAN B  11      -9.396  30.926   4.915  0.00  0.00              
ATOM   2336  C1  NAG B  12       2.991  21.852 -14.164  0.00  0.00              
ATOM   2337  C2  NAG B  12       2.956  21.240 -15.601  0.00  0.00              
ATOM   2338  C3  NAG B  12       4.172  20.282 -15.795  0.00  0.00              
ATOM   2339  C4  NAG B  12       5.505  20.975 -15.441  0.00  0.00              
ATOM   2340  C5  NAG B  12       5.449  21.575 -14.010  0.00  0.00              
ATOM   2341  C6  NAG B  12       6.721  22.367 -13.648  0.00  0.00              
ATOM   2342  C7  NAG B  12       0.972  20.617 -16.942  0.00  0.00              
ATOM   2343  C8  NAG B  12      -0.242  19.717 -17.045  0.00  0.00              
ATOM   2344  O3h NAG B  12       4.274  19.813 -17.142  0.00  0.00              
ATOM   2345  OR  NAG B  12       6.542  20.006 -15.559  0.00  0.00              
ATOM   2346  OR  NAG B  12       4.286  22.451 -13.885  0.00  0.00              
ATOM   2347  O6h NAG B  12       6.921  23.476 -14.529  0.00  0.00              
ATOM   2348  OM  NAG B  12       1.269  21.358 -17.872  0.00  0.00              
ATOM   2349  N15 NAG B  12       1.686  20.495 -15.826  0.00  0.00              
ATOM   2350  H2  NAG B  12       3.064  22.084 -16.313  0.00  0.00              
ATOM   2351  H3  NAG B  12       4.051  19.407 -15.126  0.00  0.00              
ATOM   2352  H4  NAG B  12       5.685  21.797 -16.162  0.00  0.00              
ATOM   2353  H5  NAG B  12       5.354  20.745 -13.282  0.00  0.00              
ATOM   2354  H6S NAG B  12       6.651  22.724 -12.604  0.00  0.00              
ATOM   2355  H6R NAG B  12       7.596  21.692 -13.687  0.00  0.00              
ATOM   2356  H8  NAG B  12      -1.073  20.260 -17.526  0.00  0.00              
ATOM   2357  H24 NAG B  12      -0.605  19.344 -16.071  0.00  0.00              
ATOM   2358  H25 NAG B  12      -0.003  18.848 -17.681  0.00  0.00              
ATOM   2359  H3o NAG B  12       3.495  19.273 -17.303  0.00  0.00              
ATOM   2360  H6o NAG B  12       7.831  23.767 -14.424  0.00  0.00              
ATOM   2361  H29 NAG B  12       1.220  19.953 -15.098  0.00  0.00              
ATOM   2362  H1  NAG B  12       2.772  21.077 -13.401  0.00  0.00              
ATOM   2363  C1  GLB B  13       7.594  20.313 -16.402  0.00  0.00              
ATOM   2364  C2  GLB B  13       8.706  19.295 -16.167  0.00  0.00              
ATOM   2365  C3  GLB B  13       9.798  19.389 -17.221  0.00  0.00              
ATOM   2366  C4  GLB B  13       9.198  19.361 -18.608  0.00  0.00              
ATOM   2367  C5  GLB B  13       8.121  20.440 -18.730  0.00  0.00              
ATOM   2368  C6  GLB B  13       7.426  20.498 -20.073  0.00  0.00              
ATOM   2369  O2h GLB B  13       9.261  19.523 -14.878  0.00  0.00              
ATOM   2370  O3h GLB B  13      10.681  18.272 -17.068  0.00  0.00              
ATOM   2371  OR  GLB B  13       7.114  20.162 -17.744  0.00  0.00              
ATOM   2372  OW  GLB B  13       7.136  21.831 -20.462  0.00  0.00              
ATOM   2373  H2o GLB B  13       8.918  18.888 -14.142  0.00  0.00              
ATOM   2374  H3o GLB B  13      11.595  18.731 -16.690  0.00  0.00              
ATOM   2375  O4h GLB B  13       8.686  18.045 -18.776  0.00  0.00              
ATOM   2376  H4o GLB B  13       9.495  17.323 -18.671  0.00  0.00              
ATOM   2377  H5  GLB B  13       8.559  21.389 -18.588  0.00  0.00              
ATOM   2378  H6  GLB B  13       7.637  20.042 -20.935  0.00  0.00              
ATOM   2379  H20 GLB B  13       6.514  19.980 -20.003  0.00  0.00              
ATOM   2380  H1  GLB B  13       7.978  21.318 -16.226  0.00  0.00              
ATOM   2381  H2  GLB B  13       8.252  18.305 -16.202  0.00  0.00              
ATOM   2382  H3  GLB B  13      10.344  20.323 -17.079  0.00  0.00              
ATOM   2383  H4  GLB B  13       9.924  19.572 -19.394  0.00  0.00              
ATOM   2384  C1  NAN B  14       4.797  21.356 -20.936  0.00  0.00              
ATOM   2385  C2  NAN B  14       6.131  22.010 -21.445  0.00  0.00              
ATOM   2386  C3  NAN B  14       6.703  21.418 -22.764  0.00  0.00              
ATOM   2387  C4  NAN B  14       5.921  21.905 -24.003  0.00  0.00              
ATOM   2388  C5  NAN B  14       5.833  23.447 -24.041  0.00  0.00              
ATOM   2389  C6  NAN B  14       5.268  24.006 -22.702  0.00  0.00              
ATOM   2390  C7  NAN B  14       5.292  25.554 -22.618  0.00  0.00              
ATOM   2391  C8  NAN B  14       4.513  26.116 -21.403  0.00  0.00              
ATOM   2392  C9  NAN B  14       4.511  27.648 -21.327  0.00  0.00              
ATOM   2393  OW  NAN B  14       6.046  23.462 -21.577  0.00  0.00              
ATOM   2394  OM  NAN B  14       4.217  20.416 -21.478  0.00  0.00              
ATOM   2395  O1h NAN B  14       4.326  21.949 -19.799  0.00  0.00              
ATOM   2396  O4h NAN B  14       6.583  21.443 -25.171  0.00  0.00              
ATOM   2397  O7h NAN B  14       6.653  25.975 -22.537  0.00  0.00              
ATOM   2398  O8h NAN B  14       3.150  25.725 -21.476  0.00  0.00              
ATOM   2399  O9h NAN B  14       3.715  28.082 -20.224  0.00  0.00              
ATOM   2400  H6  NAN B  14       4.215  23.674 -22.616  0.00  0.00              
ATOM   2401  H3  NAN B  14       7.761  21.727 -22.865  0.00  0.00              
ATOM   2402  H21 NAN B  14       6.719  20.314 -22.712  0.00  0.00              
ATOM   2403  H4  NAN B  14       4.894  21.485 -23.976  0.00  0.00              
ATOM   2404  H7o NAN B  14       7.072  25.299 -21.996  0.00  0.00              
ATOM   2405  H8o NAN B  14       2.699  26.395 -20.951  0.00  0.00              
ATOM   2406  H4o NAN B  14       6.768  20.512 -25.020  0.00  0.00              
ATOM   2407  H9o NAN B  14       3.844  29.032 -20.138  0.00  0.00              
ATOM   2408  H9R NAN B  14       4.121  28.080 -22.271  0.00  0.00              
ATOM   2409  H9S NAN B  14       5.548  28.022 -21.222  0.00  0.00              
ATOM   2410  H8  NAN B  14       4.952  25.712 -20.469  0.00  0.00              
ATOM   2411  H7  NAN B  14       4.839  25.968 -23.542  0.00  0.00              
ATOM   2412  H1o NAN B  14       3.502  21.518 -19.567  0.00  0.00              
ATOM   2413  H5  NAN B  14       6.848  23.861 -24.204  0.00  0.00              
ATOM   2414  N33 NAN B  14       4.985  23.814 -25.152  0.00  0.00              
ATOM   2415  C34 NAN B  14       5.541  24.108 -26.370  0.00  0.00              
ATOM   2416  C35 NAN B  14       4.529  24.483 -27.438  0.00  0.00              
ATOM   2417  OM  NAN B  14       6.734  24.087 -26.602  0.00  0.00              
ATOM   2418  H37 NAN B  14       3.963  23.854 -25.030  0.00  0.00              
ATOM   2419  H35 NAN B  14       5.035  24.701 -28.405  0.00  0.00              
ATOM   2420  H39 NAN B  14       3.963  25.391 -27.130  0.00  0.00              
ATOM   2421  H40 NAN B  14       3.814  23.645 -27.603  0.00  0.00              
ATOM   2422  C1  NAG C   1      -2.716 -18.767   7.326  0.00  0.00              
ATOM   2423  C2  NAG C   1      -3.516 -20.106   7.238  0.00  0.00              
ATOM   2424  C3  NAG C   1      -4.492 -20.217   8.450  0.00  0.00              
ATOM   2425  C4  NAG C   1      -3.761 -20.009   9.792  0.00  0.00              
ATOM   2426  C5  NAG C   1      -2.973 -18.670   9.789  0.00  0.00              
ATOM   2427  C6  NAG C   1      -2.142 -18.467  11.070  0.00  0.00              
ATOM   2428  C7  NAG C   1      -4.308 -21.277   5.208  0.00  0.00              
ATOM   2429  C8  NAG C   1      -5.212 -21.212   3.994  0.00  0.00              
ATOM   2430  O3h NAG C   1      -5.137 -21.492   8.503  0.00  0.00              
ATOM   2431  OR  NAG C   1      -4.737 -20.035  10.827  0.00  0.00              
ATOM   2432  OR  NAG C   1      -2.087 -18.621   8.628  0.00  0.00              
ATOM   2433  O6h NAG C   1      -1.162 -19.495  11.233  0.00  0.00              
ATOM   2434  OM  NAG C   1      -3.700 -22.309   5.467  0.00  0.00              
ATOM   2435  N15 NAG C   1      -4.281 -20.184   5.964  0.00  0.00              
ATOM   2436  H2  NAG C   1      -2.774 -20.930   7.318  0.00  0.00              
ATOM   2437  H3  NAG C   1      -5.269 -19.432   8.356  0.00  0.00              
ATOM   2438  H4  NAG C   1      -3.042 -20.841   9.943  0.00  0.00              
ATOM   2439  H5  NAG C   1      -3.699 -17.835   9.724  0.00  0.00              
ATOM   2440  H6S NAG C   1      -1.649 -17.477  11.038  0.00  0.00              
ATOM   2441  H6R NAG C   1      -2.818 -18.447  11.947  0.00  0.00              
ATOM   2442  H8  NAG C   1      -4.737 -21.730   3.144  0.00  0.00              
ATOM   2443  H24 NAG C   1      -5.451 -20.184   3.670  0.00  0.00              
ATOM   2444  H25 NAG C   1      -6.159 -21.735   4.212  0.00  0.00              
ATOM   2445  H3o NAG C   1      -5.693 -21.548   7.720  0.00  0.00              
ATOM   2446  H6o NAG C   1      -0.861 -19.464  12.146  0.00  0.00              
ATOM   2447  H29 NAG C   1      -4.720 -19.371   5.527  0.00  0.00              
ATOM   2448  H1  NAG C   1      -3.381 -17.900   7.137  0.00  0.00              
ATOM   2449  C1  NAG C   2      -4.543 -20.975  11.873  0.00  0.00              
ATOM   2450  C2  NAG C   2      -5.437 -20.625  13.105  0.00  0.00              
ATOM   2451  C3  NAG C   2      -5.412 -21.804  14.126  0.00  0.00              
ATOM   2452  C4  NAG C   2      -5.769 -23.146  13.456  0.00  0.00              
ATOM   2453  C5  NAG C   2      -4.854 -23.409  12.229  0.00  0.00              
ATOM   2454  C6  NAG C   2      -5.240 -24.688  11.463  0.00  0.00              
ATOM   2455  C7  NAG C   2      -5.790 -18.408  14.149  0.00  0.00              
ATOM   2456  C8  NAG C   2      -5.148 -17.252  14.886  0.00  0.00              
ATOM   2457  O3h NAG C   2      -6.334 -21.601  15.201  0.00  0.00              
ATOM   2458  OR  NAG C   2      -5.633 -24.171  14.435  0.00  0.00              
ATOM   2459  OR  NAG C   2      -4.909 -22.268  11.317  0.00  0.00              
ATOM   2460  O6h NAG C   2      -6.571 -24.615  10.946  0.00  0.00              
ATOM   2461  OM  NAG C   2      -7.004 -18.435  13.984  0.00  0.00              
ATOM   2462  N15 NAG C   2      -4.962 -19.376  13.764  0.00  0.00              
ATOM   2463  H2  NAG C   2      -6.476 -20.516  12.729  0.00  0.00              
ATOM   2464  H3  NAG C   2      -4.391 -21.891  14.550  0.00  0.00              
ATOM   2465  H4  NAG C   2      -6.821 -23.106  13.108  0.00  0.00              
ATOM   2466  H5  NAG C   2      -3.812 -23.533  12.587  0.00  0.00              
ATOM   2467  H6S NAG C   2      -4.523 -24.856  10.636  0.00  0.00              
ATOM   2468  H6R NAG C   2      -5.144 -25.562  12.136  0.00  0.00              
ATOM   2469  H8  NAG C   2      -5.624 -16.304  14.586  0.00  0.00              
ATOM   2470  H24 NAG C   2      -4.062 -17.155  14.705  0.00  0.00              
ATOM   2471  H25 NAG C   2      -5.308 -17.373  15.971  0.00  0.00              
ATOM   2472  H3o NAG C   2      -6.020 -20.833  15.689  0.00  0.00              
ATOM   2473  H6o NAG C   2      -6.839 -25.508  10.714  0.00  0.00              
ATOM   2474  H29 NAG C   2      -3.975 -19.127  13.843  0.00  0.00              
ATOM   2475  H1  NAG C   2      -3.471 -20.986  12.155  0.00  0.00              
ATOM   2476  C1  BMA C   3      -6.738 -24.971  14.663  0.00  0.00              
ATOM   2477  C2  BMA C   3      -6.300 -26.156  15.518  0.00  0.00              
ATOM   2478  C3  BMA C   3      -7.484 -26.955  16.037  0.00  0.00              
ATOM   2479  C4  BMA C   3      -8.492 -26.041  16.694  0.00  0.00              
ATOM   2480  C5  BMA C   3      -8.874 -24.914  15.734  0.00  0.00              
ATOM   2481  C6  BMA C   3      -9.865 -23.913  16.287  0.00  0.00              
ATOM   2482  OW  BMA C   3      -7.011 -27.903  17.001  0.00  0.00              
ATOM   2483  O4h BMA C   3      -9.673 -26.748  17.041  0.00  0.00              
ATOM   2484  OR  BMA C   3      -7.675 -24.189  15.414  0.00  0.00              
ATOM   2485  OW  BMA C   3     -11.026 -23.813  15.476  0.00  0.00              
ATOM   2486  H4o BMA C   3      -9.620 -27.058  18.085  0.00  0.00              
ATOM   2487  O2h BMA C   3      -5.538 -25.669  16.616  0.00  0.00              
ATOM   2488  H2o BMA C   3      -6.163 -25.028  17.236  0.00  0.00              
ATOM   2489  H5  BMA C   3      -9.326 -25.326  14.873  0.00  0.00              
ATOM   2490  H6  BMA C   3     -10.214 -23.785  17.213  0.00  0.00              
ATOM   2491  H20 BMA C   3      -9.410 -22.966  16.310  0.00  0.00              
ATOM   2492  H2  BMA C   3      -5.678 -26.794  14.890  0.00  0.00              
ATOM   2493  H3  BMA C   3      -7.954 -27.471  15.199  0.00  0.00              
ATOM   2494  H1  BMA C   3      -7.176 -25.336  13.733  0.00  0.00              
ATOM   2495  H4  BMA C   3      -8.032 -25.635  17.596  0.00  0.00              
ATOM   2496  C1  MAN C   4      -7.377 -29.263  16.803  0.00  0.00              
ATOM   2497  C2  MAN C   4      -7.107 -30.189  17.984  0.00  0.00              
ATOM   2498  C3  MAN C   4      -5.620 -30.376  18.234  0.00  0.00              
ATOM   2499  C4  MAN C   4      -4.913 -30.762  16.956  0.00  0.00              
ATOM   2500  C5  MAN C   4      -5.237 -29.748  15.857  0.00  0.00              
ATOM   2501  C6  MAN C   4      -4.603 -30.038  14.514  0.00  0.00              
ATOM   2502  O3h MAN C   4      -5.445 -31.419  19.200  0.00  0.00              
ATOM   2503  OR  MAN C   4      -3.506 -30.785  17.138  0.00  0.00              
ATOM   2504  OR  MAN C   4      -6.660 -29.756  15.663  0.00  0.00              
ATOM   2505  O6h MAN C   4      -4.995 -31.302  14.005  0.00  0.00              
ATOM   2506  H3o MAN C   4      -5.094 -30.883  20.081  0.00  0.00              
ATOM   2507  H6o MAN C   4      -5.463 -31.531  13.047  0.00  0.00              
ATOM   2508  OW  MAN C   4      -7.708 -31.451  17.720  0.00  0.00              
ATOM   2509  H5  MAN C   4      -4.885 -28.796  16.145  0.00  0.00              
ATOM   2510  H6S MAN C   4      -4.519 -29.471  13.698  0.00  0.00              
ATOM   2511  H6R MAN C   4      -3.558 -30.051  14.631  0.00  0.00              
ATOM   2512  H1  MAN C   4      -8.450 -29.223  16.609  0.00  0.00              
ATOM   2513  H2  MAN C   4      -7.569 -29.736  18.861  0.00  0.00              
ATOM   2514  H3  MAN C   4      -5.206 -29.441  18.611  0.00  0.00              
ATOM   2515  H4  MAN C   4      -5.259 -31.756  16.671  0.00  0.00              
ATOM   2516  C1  NAG C   5      -9.074 -31.600  18.073  0.00  0.00              
ATOM   2517  C2  NAG C   5      -9.829 -32.459  17.009  0.00  0.00              
ATOM   2518  C3  NAG C   5     -11.247 -32.834  17.544  0.00  0.00              
ATOM   2519  C4  NAG C   5     -11.174 -33.487  18.939  0.00  0.00              
ATOM   2520  C5  NAG C   5     -10.390 -32.584  19.930  0.00  0.00              
ATOM   2521  C6  NAG C   5     -10.201 -33.242  21.310  0.00  0.00              
ATOM   2522  C7  NAG C   5      -9.709 -32.280  14.544  0.00  0.00              
ATOM   2523  C8  NAG C   5      -9.977 -31.408  13.335  0.00  0.00              
ATOM   2524  O3h NAG C   5     -11.922 -33.747  16.675  0.00  0.00              
ATOM   2525  OR  NAG C   5     -12.508 -33.710  19.384  0.00  0.00              
ATOM   2526  OR  NAG C   5      -9.080 -32.258  19.370  0.00  0.00              
ATOM   2527  O6h NAG C   5      -9.456 -34.459  21.220  0.00  0.00              
ATOM   2528  OM  NAG C   5      -9.340 -33.439  14.396  0.00  0.00              
ATOM   2529  N15 NAG C   5      -9.956 -31.717  15.724  0.00  0.00              
ATOM   2530  H2  NAG C   5      -9.250 -33.398  16.882  0.00  0.00              
ATOM   2531  H3  NAG C   5     -11.855 -31.911  17.626  0.00  0.00              
ATOM   2532  H4  NAG C   5     -10.648 -34.460  18.855  0.00  0.00              
ATOM   2533  H5  NAG C   5     -10.961 -31.647  20.079  0.00  0.00              
ATOM   2534  H6S NAG C   5      -9.687 -32.535  21.990  0.00  0.00              
ATOM   2535  H6R NAG C   5     -11.192 -33.438  21.761  0.00  0.00              
ATOM   2536  H8  NAG C   5      -9.206 -31.585  12.565  0.00  0.00              
ATOM   2537  H24 NAG C   5      -9.986 -30.326  13.557  0.00  0.00              
ATOM   2538  H25 NAG C   5     -10.952 -31.679  12.894  0.00  0.00              
ATOM   2539  H3o NAG C   5     -12.077 -33.275  15.851  0.00  0.00              
ATOM   2540  H6o NAG C   5      -9.589 -34.939  22.041  0.00  0.00              
ATOM   2541  H29 NAG C   5     -10.108 -30.708  15.675  0.00  0.00              
ATOM   2542  H1  NAG C   5      -9.536 -30.597  18.168  0.00  0.00              
ATOM   2543  C1  GLB C   6     -12.844 -35.005  19.739  0.00  0.00              
ATOM   2544  C2  GLB C   6     -14.198 -34.972  20.440  0.00  0.00              
ATOM   2545  C3  GLB C   6     -14.772 -36.364  20.640  0.00  0.00              
ATOM   2546  C4  GLB C   6     -14.754 -37.135  19.339  0.00  0.00              
ATOM   2547  C5  GLB C   6     -13.344 -37.122  18.749  0.00  0.00              
ATOM   2548  C6  GLB C   6     -13.200 -37.845  17.427  0.00  0.00              
ATOM   2549  O2h GLB C   6     -14.036 -34.333  21.701  0.00  0.00              
ATOM   2550  OW  GLB C   6     -16.125 -36.242  21.095  0.00  0.00              
ATOM   2551  OR  GLB C   6     -12.980 -35.751  18.522  0.00  0.00              
ATOM   2552  O6h GLB C   6     -14.046 -37.298  16.429  0.00  0.00              
ATOM   2553  H2o GLB C   6     -14.324 -33.343  21.723  0.00  0.00              
ATOM   2554  H6o GLB C   6     -13.773 -36.911  15.447  0.00  0.00              
ATOM   2555  O4h GLB C   6     -15.711 -36.497  18.503  0.00  0.00              
ATOM   2556  H4o GLB C   6     -16.690 -36.530  18.980  0.00  0.00              
ATOM   2557  H5  GLB C   6     -12.680 -37.599  19.415  0.00  0.00              
ATOM   2558  H6S GLB C   6     -12.385 -38.119  16.921  0.00  0.00              
ATOM   2559  H6R GLB C   6     -13.475 -38.851  17.562  0.00  0.00              
ATOM   2560  H1  GLB C   6     -12.101 -35.451  20.401  0.00  0.00              
ATOM   2561  H2  GLB C   6     -14.873 -34.386  19.816  0.00  0.00              
ATOM   2562  H3  GLB C   6     -14.171 -36.889  21.383  0.00  0.00              
ATOM   2563  H4  GLB C   6     -15.019 -38.186  19.460  0.00  0.00              
ATOM   2564  C1  GLA C   7     -16.587 -37.220  22.018  0.00  0.00              
ATOM   2565  C2  GLA C   7     -18.101 -37.296  22.183  0.00  0.00              
ATOM   2566  C3  GLA C   7     -18.665 -36.053  22.852  0.00  0.00              
ATOM   2567  C4  GLA C   7     -17.905 -35.744  24.121  0.00  0.00              
ATOM   2568  C5  GLA C   7     -16.408 -35.666  23.824  0.00  0.00              
ATOM   2569  C6  GLA C   7     -15.533 -35.382  25.025  0.00  0.00              
ATOM   2570  O2h GLA C   7     -18.687 -37.459  20.899  0.00  0.00              
ATOM   2571  OW  GLA C   7     -20.041 -36.289  23.173  0.00  0.00              
ATOM   2572  OR  GLA C   7     -16.001 -36.938  23.296  0.00  0.00              
ATOM   2573  O6h GLA C   7     -15.678 -36.372  26.032  0.00  0.00              
ATOM   2574  H2o GLA C   7     -18.970 -38.483  20.653  0.00  0.00              
ATOM   2575  H6o GLA C   7     -14.907 -36.988  26.494  0.00  0.00              
ATOM   2576  O4h GLA C   7     -18.235 -36.788  25.028  0.00  0.00              
ATOM   2577  H4o GLA C   7     -19.313 -36.800  25.194  0.00  0.00              
ATOM   2578  H5  GLA C   7     -16.226 -34.882  23.141  0.00  0.00              
ATOM   2579  H6S GLA C   7     -14.569 -35.129  25.084  0.00  0.00              
ATOM   2580  H6R GLA C   7     -15.819 -34.460  25.441  0.00  0.00              
ATOM   2581  H1  GLA C   7     -16.217 -38.162  21.612  0.00  0.00              
ATOM   2582  H2  GLA C   7     -18.316 -38.169  22.799  0.00  0.00              
ATOM   2583  H3  GLA C   7     -18.578 -35.213  22.162  0.00  0.00              
ATOM   2584  H4  GLA C   7     -18.175 -34.783  24.560  0.00  0.00              
ATOM   2585  C1  NGA C   8     -20.863 -35.179  23.264  0.00  0.00              
ATOM   2586  C2  NGA C   8     -21.784 -35.167  22.048  0.00  0.00              
ATOM   2587  C3  NGA C   8     -22.893 -34.138  22.182  0.00  0.00              
ATOM   2588  C4  NGA C   8     -23.601 -34.293  23.508  0.00  0.00              
ATOM   2589  C5  NGA C   8     -22.583 -34.261  24.647  0.00  0.00              
ATOM   2590  C6  NGA C   8     -23.168 -34.431  26.032  0.00  0.00              
ATOM   2591  OW  NGA C   8     -23.835 -34.336  21.120  0.00  0.00              
ATOM   2592  OR  NGA C   8     -21.664 -35.348  24.440  0.00  0.00              
ATOM   2593  O6h NGA C   8     -23.864 -35.660  26.166  0.00  0.00              
ATOM   2594  H6o NGA C   8     -23.706 -36.451  26.899  0.00  0.00              
ATOM   2595  O4h NGA C   8     -24.302 -35.527  23.426  0.00  0.00              
ATOM   2596  H4o NGA C   8     -25.005 -35.493  22.594  0.00  0.00              
ATOM   2597  H5  NGA C   8     -22.090 -33.327  24.652  0.00  0.00              
ATOM   2598  H6S NGA C   8     -22.761 -34.291  26.932  0.00  0.00              
ATOM   2599  H6R NGA C   8     -23.856 -33.654  26.204  0.00  0.00              
ATOM   2600  H1  NGA C   8     -20.292 -34.252  23.297  0.00  0.00              
ATOM   2601  H2  NGA C   8     -22.220 -36.163  21.962  0.00  0.00              
ATOM   2602  H3  NGA C   8     -22.457 -33.140  22.116  0.00  0.00              
ATOM   2603  H4  NGA C   8     -24.306 -33.487  23.715  0.00  0.00              
ATOM   2604  N23 NGA C   8     -20.989 -34.880  20.875  0.00  0.00              
ATOM   2605  C24 NGA C   8     -21.249 -35.530  19.695  0.00  0.00              
ATOM   2606  C25 NGA C   8     -20.331 -35.131  18.556  0.00  0.00              
ATOM   2607  OM  NGA C   8     -22.125 -36.360  19.549  0.00  0.00              
ATOM   2608  H27 NGA C   8     -20.229 -34.187  20.925  0.00  0.00              
ATOM   2609  H25 NGA C   8     -20.592 -35.681  17.624  0.00  0.00              
ATOM   2610  H29 NGA C   8     -19.273 -35.369  18.812  0.00  0.00              
ATOM   2611  H30 NGA C   8     -20.420 -34.040  18.349  0.00  0.00              
ATOM   2612  C1  AFL C   9     -24.058 -33.237  20.239  0.00  0.00              
ATOM   2613  C2  AFL C   9     -24.912 -33.586  19.006  0.00  0.00              
ATOM   2614  C3  AFL C   9     -26.373 -33.830  19.412  0.00  0.00              
ATOM   2615  C4  AFL C   9     -26.886 -32.627  20.221  0.00  0.00              
ATOM   2616  C5  AFL C   9     -25.943 -32.359  21.405  0.00  0.00              
ATOM   2617  C6  AFL C   9     -26.347 -31.145  22.250  0.00  0.00              
ATOM   2618  OR  AFL C   9     -24.601 -32.127  20.959  0.00  0.00              
ATOM   2619  O2h AFL C   9     -24.299 -34.690  18.344  0.00  0.00              
ATOM   2620  O3h AFL C   9     -27.148 -34.098  18.246  0.00  0.00              
ATOM   2621  O4h AFL C   9     -26.951 -31.443  19.427  0.00  0.00              
ATOM   2622  H5  AFL C   9     -25.968 -33.243  22.071  0.00  0.00              
ATOM   2623  H1  AFL C   9     -23.060 -32.917  19.917  0.00  0.00              
ATOM   2624  H2  AFL C   9     -24.889 -32.713  18.326  0.00  0.00              
ATOM   2625  H2o AFL C   9     -24.766 -34.798  17.505  0.00  0.00              
ATOM   2626  H3  AFL C   9     -26.401 -34.726  20.060  0.00  0.00              
ATOM   2627  H3o AFL C   9     -27.999 -34.435  18.554  0.00  0.00              
ATOM   2628  H4  AFL C   9     -27.898 -32.839  20.615  0.00  0.00              
ATOM   2629  H4o AFL C   9     -27.625 -31.602  18.753  0.00  0.00              
ATOM   2630  H6  AFL C   9     -27.379 -31.229  22.625  0.00  0.00              
ATOM   2631  H22 AFL C   9     -25.674 -31.050  23.118  0.00  0.00              
ATOM   2632  H23 AFL C   9     -26.267 -30.217  21.664  0.00  0.00              
ATOM   2633  C1  NAG C  10      -2.837 -32.003  16.845  0.00  0.00              
ATOM   2634  C2  NAG C  10      -1.299 -31.770  16.703  0.00  0.00              
ATOM   2635  C3  NAG C  10      -0.560 -33.142  16.650  0.00  0.00              
ATOM   2636  C4  NAG C  10      -0.950 -34.046  17.838  0.00  0.00              
ATOM   2637  C5  NAG C  10      -2.492 -34.208  17.924  0.00  0.00              
ATOM   2638  C6  NAG C  10      -2.938 -35.017  19.157  0.00  0.00              
ATOM   2639  C7  NAG C  10      -0.141 -29.965  15.468  0.00  0.00              
ATOM   2640  C8  NAG C  10       0.121 -29.339  14.114  0.00  0.00              
ATOM   2641  O3h NAG C  10       0.861 -32.987  16.675  0.00  0.00              
ATOM   2642  OR  NAG C  10      -0.304 -35.302  17.660  0.00  0.00              
ATOM   2643  OR  NAG C  10      -3.127 -32.892  17.958  0.00  0.00              
ATOM   2644  O6h NAG C  10      -2.544 -34.382  20.377  0.00  0.00              
ATOM   2645  OM  NAG C  10       0.457 -29.561  16.459  0.00  0.00              
ATOM   2646  N15 NAG C  10      -0.995 -30.985  15.475  0.00  0.00              
ATOM   2647  H2  NAG C  10      -0.969 -31.235  17.619  0.00  0.00              
ATOM   2648  H3  NAG C  10      -0.841 -33.665  15.714  0.00  0.00              
ATOM   2649  H4  NAG C  10      -0.592 -33.579  18.778  0.00  0.00              
ATOM   2650  H5  NAG C  10      -2.840 -34.752  17.023  0.00  0.00              
ATOM   2651  H6S NAG C  10      -4.036 -35.149  19.137  0.00  0.00              
ATOM   2652  H6R NAG C  10      -2.504 -36.034  19.103  0.00  0.00              
ATOM   2653  H8  NAG C  10       0.217 -28.244  14.218  0.00  0.00              
ATOM   2654  H24 NAG C  10      -0.671 -29.536  13.370  0.00  0.00              
ATOM   2655  H25 NAG C  10       1.076 -29.717  13.712  0.00  0.00              
ATOM   2656  H3o NAG C  10       1.100 -32.536  15.859  0.00  0.00              
ATOM   2657  H6o NAG C  10      -2.615 -35.037  21.077  0.00  0.00              
ATOM   2658  H29 NAG C  10      -1.514 -31.092  14.602  0.00  0.00              
ATOM   2659  H1  NAG C  10      -3.258 -32.431  15.913  0.00  0.00              
ATOM   2660  C1  GLB C  11       0.501 -35.747  18.694  0.00  0.00              
ATOM   2661  C2  GLB C  11       0.857 -37.205  18.425  0.00  0.00              
ATOM   2662  C3  GLB C  11       1.942 -37.709  19.363  0.00  0.00              
ATOM   2663  C4  GLB C  11       3.120 -36.762  19.368  0.00  0.00              
ATOM   2664  C5  GLB C  11       2.643 -35.342  19.674  0.00  0.00              
ATOM   2665  C6  GLB C  11       3.730 -34.291  19.684  0.00  0.00              
ATOM   2666  O2h GLB C  11      -0.316 -37.993  18.580  0.00  0.00              
ATOM   2667  OW  GLB C  11       2.377 -38.997  18.912  0.00  0.00              
ATOM   2668  OR  GLB C  11       1.704 -34.968  18.653  0.00  0.00              
ATOM   2669  O6h GLB C  11       4.405 -34.214  18.439  0.00  0.00              
ATOM   2670  H2o GLB C  11      -0.786 -38.246  17.699  0.00  0.00              
ATOM   2671  H6o GLB C  11       4.543 -33.345  17.795  0.00  0.00              
ATOM   2672  O4h GLB C  11       3.711 -36.880  18.080  0.00  0.00              
ATOM   2673  H4o GLB C  11       4.023 -37.912  17.917  0.00  0.00              
ATOM   2674  H5  GLB C  11       2.206 -35.318  20.635  0.00  0.00              
ATOM   2675  H6S GLB C  11       3.720 -33.346  20.005  0.00  0.00              
ATOM   2676  H6R GLB C  11       4.440 -34.548  20.416  0.00  0.00              
ATOM   2677  H1  GLB C  11       0.003 -35.665  19.660  0.00  0.00              
ATOM   2678  H2  GLB C  11       1.209 -37.270  17.396  0.00  0.00              
ATOM   2679  H3  GLB C  11       1.530 -37.782  20.369  0.00  0.00              
ATOM   2680  H4  GLB C  11       3.860 -37.000  20.132  0.00  0.00              
ATOM   2681  C1  GLA C  12       2.746 -39.940  19.910  0.00  0.00              
ATOM   2682  C2  GLA C  12       3.553 -41.135  19.411  0.00  0.00              
ATOM   2683  C3  GLA C  12       2.730 -42.045  18.516  0.00  0.00              
ATOM   2684  C4  GLA C  12       1.421 -42.401  19.183  0.00  0.00              
ATOM   2685  C5  GLA C  12       0.694 -41.128  19.612  0.00  0.00              
ATOM   2686  C6  GLA C  12      -0.626 -41.352  20.317  0.00  0.00              
ATOM   2687  O2h GLA C  12       4.682 -40.649  18.695  0.00  0.00              
ATOM   2688  OW  GLA C  12       3.474 -43.244  18.271  0.00  0.00              
ATOM   2689  OR  GLA C  12       1.549 -40.425  20.530  0.00  0.00              
ATOM   2690  O6h GLA C  12      -0.472 -42.128  21.495  0.00  0.00              
ATOM   2691  H2o GLA C  12       5.614 -40.645  19.261  0.00  0.00              
ATOM   2692  H6o GLA C  12      -0.771 -41.880  22.513  0.00  0.00              
ATOM   2693  O4h GLA C  12       1.766 -43.237  20.281  0.00  0.00              
ATOM   2694  H4o GLA C  12       2.288 -44.121  19.915  0.00  0.00              
ATOM   2695  H5  GLA C  12       0.473 -40.546  18.760  0.00  0.00              
ATOM   2696  H6S GLA C  12      -1.357 -40.714  20.550  0.00  0.00              
ATOM   2697  H6R GLA C  12      -1.267 -41.877  19.670  0.00  0.00              
ATOM   2698  H1  GLA C  12       3.348 -39.362  20.611  0.00  0.00              
ATOM   2699  H2  GLA C  12       3.885 -41.690  20.287  0.00  0.00              
ATOM   2700  H3  GLA C  12       2.531 -41.528  17.577  0.00  0.00              
ATOM   2701  H4  GLA C  12       0.733 -42.932  18.524  0.00  0.00              
ATOM   2702  C1  NGA C  13       3.192 -43.931  17.104  0.00  0.00              
ATOM   2703  C2  NGA C  13       4.361 -43.738  16.143  0.00  0.00              
ATOM   2704  C3  NGA C  13       4.267 -44.658  14.937  0.00  0.00              
ATOM   2705  C4  NGA C  13       4.041 -46.086  15.377  0.00  0.00              
ATOM   2706  C5  NGA C  13       2.831 -46.156  16.309  0.00  0.00              
ATOM   2707  C6  NGA C  13       2.514 -47.538  16.839  0.00  0.00              
ATOM   2708  OW  NGA C  13       5.496 -44.582  14.204  0.00  0.00              
ATOM   2709  OR  NGA C  13       3.108 -45.322  17.445  0.00  0.00              
ATOM   2710  O6h NGA C  13       3.600 -48.088  17.568  0.00  0.00              
ATOM   2711  H6o NGA C  13       3.609 -48.462  18.592  0.00  0.00              
ATOM   2712  O4h NGA C  13       5.250 -46.489  16.009  0.00  0.00              
ATOM   2713  H4o NGA C  13       6.075 -46.409  15.299  0.00  0.00              
ATOM   2714  H5  NGA C  13       1.969 -45.840  15.790  0.00  0.00              
ATOM   2715  H6S NGA C  13       1.710 -47.882  17.320  0.00  0.00              
ATOM   2716  H6R NGA C  13       2.320 -48.175  16.026  0.00  0.00              
ATOM   2717  H1  NGA C  13       2.275 -43.578  16.635  0.00  0.00              
ATOM   2718  H2  NGA C  13       5.275 -43.957  16.697  0.00  0.00              
ATOM   2719  H3  NGA C  13       3.435 -44.334  14.312  0.00  0.00              
ATOM   2720  H4  NGA C  13       3.821 -46.761  14.550  0.00  0.00              
ATOM   2721  N23 NGA C  13       4.374 -42.361  15.707  0.00  0.00              
ATOM   2722  C24 NGA C  13       5.565 -41.699  15.557  0.00  0.00              
ATOM   2723  C25 NGA C  13       5.420 -40.260  15.101  0.00  0.00              
ATOM   2724  OM  NGA C  13       6.655 -42.195  15.769  0.00  0.00              
ATOM   2725  H27 NGA C  13       3.487 -41.876  15.509  0.00  0.00              
ATOM   2726  H25 NGA C  13       6.418 -39.776  14.988  0.00  0.00              
ATOM   2727  H29 NGA C  13       4.837 -39.676  15.850  0.00  0.00              
ATOM   2728  H30 NGA C  13       4.900 -40.215  14.117  0.00  0.00              
ATOM   2729  C1  AFL C  14       5.413 -44.161  12.843  0.00  0.00              
ATOM   2730  C2  AFL C  14       6.780 -43.896  12.185  0.00  0.00              
ATOM   2731  C3  AFL C  14       7.530 -45.215  11.950  0.00  0.00              
ATOM   2732  C4  AFL C  14       6.626 -46.186  11.173  0.00  0.00              
ATOM   2733  C5  AFL C  14       5.288 -46.350  11.910  0.00  0.00              
ATOM   2734  C6  AFL C  14       4.297 -47.270  11.187  0.00  0.00              
ATOM   2735  OR  AFL C  14       4.633 -45.088  12.083  0.00  0.00              
ATOM   2736  O2h AFL C  14       7.485 -42.959  12.995  0.00  0.00              
ATOM   2737  O3h AFL C  14       8.764 -44.944  11.292  0.00  0.00              
ATOM   2738  O4h AFL C  14       6.354 -45.717   9.853  0.00  0.00              
ATOM   2739  H5  AFL C  14       5.492 -46.805  12.899  0.00  0.00              
ATOM   2740  H1  AFL C  14       4.828 -43.233  12.862  0.00  0.00              
ATOM   2741  H2  AFL C  14       6.589 -43.432  11.197  0.00  0.00              
ATOM   2742  H2o AFL C  14       8.269 -42.702  12.493  0.00  0.00              
ATOM   2743  H3  AFL C  14       7.754 -45.658  12.939  0.00  0.00              
ATOM   2744  H3o AFL C  14       9.285 -45.756  11.342  0.00  0.00              
ATOM   2745  H4  AFL C  14       7.113 -47.177  11.097  0.00  0.00              
ATOM   2746  H4o AFL C  14       7.198 -45.721   9.381  0.00  0.00              
ATOM   2747  H6  AFL C  14       4.725 -48.266  10.994  0.00  0.00              
ATOM   2748  H22 AFL C  14       3.389 -47.400  11.797  0.00  0.00              
ATOM   2749  H23 AFL C  14       3.990 -46.834  10.223  0.00  0.00              
ATOM   2750  C1  MAN C  15     -11.813 -22.638  15.619  0.00  0.00              
ATOM   2751  C2  MAN C  15     -12.724 -22.609  16.843  0.00  0.00              
ATOM   2752  C3  MAN C  15     -13.840 -23.635  16.747  0.00  0.00              
ATOM   2753  C4  MAN C  15     -14.559 -23.513  15.423  0.00  0.00              
ATOM   2754  C5  MAN C  15     -13.549 -23.584  14.277  0.00  0.00              
ATOM   2755  C6  MAN C  15     -14.146 -23.450  12.893  0.00  0.00              
ATOM   2756  O3h MAN C  15     -14.772 -23.400  17.811  0.00  0.00              
ATOM   2757  OR  MAN C  15     -15.497 -24.564  15.254  0.00  0.00              
ATOM   2758  OR  MAN C  15     -12.624 -22.498  14.445  0.00  0.00              
ATOM   2759  OW  MAN C  15     -13.834 -24.564  12.071  0.00  0.00              
ATOM   2760  H3o MAN C  15     -14.617 -24.255  18.467  0.00  0.00              
ATOM   2761  OW  MAN C  15     -13.282 -21.307  16.965  0.00  0.00              
ATOM   2762  H5  MAN C  15     -13.064 -24.521  14.295  0.00  0.00              
ATOM   2763  H6  MAN C  15     -15.065 -23.194  12.602  0.00  0.00              
ATOM   2764  H20 MAN C  15     -13.743 -22.594  12.434  0.00  0.00              
ATOM   2765  H1  MAN C  15     -11.080 -21.835  15.692  0.00  0.00              
ATOM   2766  H2  MAN C  15     -12.102 -22.827  17.712  0.00  0.00              
ATOM   2767  H3  MAN C  15     -13.411 -24.632  16.838  0.00  0.00              
ATOM   2768  H4  MAN C  15     -15.080 -22.556  15.415  0.00  0.00              
ATOM   2769  C1  NAG C  16     -12.515 -20.340  17.665  0.00  0.00              
ATOM   2770  C2  NAG C  16     -12.647 -18.936  16.990  0.00  0.00              
ATOM   2771  C3  NAG C  16     -12.022 -17.847  17.916  0.00  0.00              
ATOM   2772  C4  NAG C  16     -12.603 -17.912  19.344  0.00  0.00              
ATOM   2773  C5  NAG C  16     -12.456 -19.342  19.933  0.00  0.00              
ATOM   2774  C6  NAG C  16     -13.115 -19.484  21.318  0.00  0.00              
ATOM   2775  C7  NAG C  16     -12.521 -18.388  14.581  0.00  0.00              
ATOM   2776  C8  NAG C  16     -11.653 -18.376  13.339  0.00  0.00              
ATOM   2777  O3h NAG C  16     -12.251 -16.526  17.418  0.00  0.00              
ATOM   2778  OR  NAG C  16     -11.916 -16.950  20.137  0.00  0.00              
ATOM   2779  OR  NAG C  16     -13.046 -20.317  19.018  0.00  0.00              
ATOM   2780  O6h NAG C  16     -14.520 -19.227  21.265  0.00  0.00              
ATOM   2781  OM  NAG C  16     -13.637 -17.882  14.555  0.00  0.00              
ATOM   2782  N15 NAG C  16     -11.967 -18.923  15.665  0.00  0.00              
ATOM   2783  H2  NAG C  16     -13.732 -18.726  16.893  0.00  0.00              
ATOM   2784  H3  NAG C  16     -10.928 -18.013  17.981  0.00  0.00              
ATOM   2785  H4  NAG C  16     -13.681 -17.655  19.307  0.00  0.00              
ATOM   2786  H5  NAG C  16     -11.377 -19.565  20.050  0.00  0.00              
ATOM   2787  H6S NAG C  16     -12.931 -20.501  21.713  0.00  0.00              
ATOM   2788  H6R NAG C  16     -12.630 -18.785  22.028  0.00  0.00              
ATOM   2789  H8  NAG C  16     -12.269 -18.586  12.448  0.00  0.00              
ATOM   2790  H24 NAG C  16     -10.833 -19.116  13.361  0.00  0.00              
ATOM   2791  H25 NAG C  16     -11.212 -17.373  13.209  0.00  0.00              
ATOM   2792  H3o NAG C  16     -11.771 -16.462  16.586  0.00  0.00              
ATOM   2793  H6o NAG C  16     -14.820 -19.080  22.166  0.00  0.00              
ATOM   2794  H29 NAG C  16     -11.101 -19.430  15.477  0.00  0.00              
ATOM   2795  H1  NAG C  16     -11.456 -20.667  17.690  0.00  0.00              
ATOM   2796  C1  GLB C  17     -12.689 -16.004  20.787  0.00  0.00              
ATOM   2797  C2  GLB C  17     -11.801 -15.267  21.785  0.00  0.00              
ATOM   2798  C3  GLB C  17     -12.489 -14.042  22.364  0.00  0.00              
ATOM   2799  C4  GLB C  17     -13.050 -13.177  21.259  0.00  0.00              
ATOM   2800  C5  GLB C  17     -13.943 -14.019  20.345  0.00  0.00              
ATOM   2801  C6  GLB C  17     -14.549 -13.268  19.180  0.00  0.00              
ATOM   2802  O2h GLB C  17     -11.456 -16.165  22.831  0.00  0.00              
ATOM   2803  OW  GLB C  17     -11.527 -13.284  23.109  0.00  0.00              
ATOM   2804  OR  GLB C  17     -13.133 -15.071  19.795  0.00  0.00              
ATOM   2805  O6h GLB C  17     -13.556 -12.700  18.339  0.00  0.00              
ATOM   2806  H2o GLB C  17     -10.518 -16.586  22.748  0.00  0.00              
ATOM   2807  H6o GLB C  17     -13.413 -12.843  17.268  0.00  0.00              
ATOM   2808  O4h GLB C  17     -11.921 -12.638  20.584  0.00  0.00              
ATOM   2809  H4o GLB C  17     -11.321 -12.058  21.286  0.00  0.00              
ATOM   2810  H5  GLB C  17     -14.754 -14.398  20.901  0.00  0.00              
ATOM   2811  H6S GLB C  17     -15.274 -13.528  18.544  0.00  0.00              
ATOM   2812  H6R GLB C  17     -15.137 -12.481  19.555  0.00  0.00              
ATOM   2813  H1  GLB C  17     -13.528 -16.459  21.314  0.00  0.00              
ATOM   2814  H2  GLB C  17     -10.901 -14.961  21.252  0.00  0.00              
ATOM   2815  H3  GLB C  17     -13.298 -14.369  23.016  0.00  0.00              
ATOM   2816  H4  GLB C  17     -13.678 -12.365  21.625  0.00  0.00              
ATOM   2817  C1  GLA C  18     -11.994 -12.620  24.277  0.00  0.00              
ATOM   2818  C2  GLA C  18     -11.070 -11.536  24.822  0.00  0.00              
ATOM   2819  C3  GLA C  18      -9.778 -12.114  25.376  0.00  0.00              
ATOM   2820  C4  GLA C  18     -10.073 -13.237  26.344  0.00  0.00              
ATOM   2821  C5  GLA C  18     -10.980 -14.271  25.676  0.00  0.00              
ATOM   2822  C6  GLA C  18     -11.368 -15.441  26.555  0.00  0.00              
ATOM   2823  O2h GLA C  18     -10.777 -10.623  23.772  0.00  0.00              
ATOM   2824  OW  GLA C  18      -9.069 -11.076  26.064  0.00  0.00              
ATOM   2825  OR  GLA C  18     -12.196 -13.605  25.299  0.00  0.00              
ATOM   2826  O6h GLA C  18     -12.050 -15.021  27.726  0.00  0.00              
ATOM   2827  H2o GLA C  18     -11.363  -9.705  23.789  0.00  0.00              
ATOM   2828  H6o GLA C  18     -13.033 -15.328  28.084  0.00  0.00              
ATOM   2829  O4h GLA C  18     -10.674 -12.620  27.475  0.00  0.00              
ATOM   2830  H4o GLA C  18      -9.985 -11.891  27.900  0.00  0.00              
ATOM   2831  H5  GLA C  18     -10.485 -14.686  24.842  0.00  0.00              
ATOM   2832  H6S GLA C  18     -11.804 -16.309  26.328  0.00  0.00              
ATOM   2833  H6R GLA C  18     -10.493 -15.939  26.858  0.00  0.00              
ATOM   2834  H1  GLA C  18     -12.937 -12.172  23.967  0.00  0.00              
ATOM   2835  H2  GLA C  18     -11.609 -11.022  25.617  0.00  0.00              
ATOM   2836  H3  GLA C  18      -9.179 -12.493  24.549  0.00  0.00              
ATOM   2837  H4  GLA C  18      -9.180 -13.779  26.657  0.00  0.00              
ATOM   2838  C1  NGA C  19      -7.696 -11.209  26.157  0.00  0.00              
ATOM   2839  C2  NGA C  19      -7.054 -10.186  25.223  0.00  0.00              
ATOM   2840  C3  NGA C  19      -5.554 -10.076  25.441  0.00  0.00              
ATOM   2841  C4  NGA C  19      -5.246  -9.873  26.908  0.00  0.00              
ATOM   2842  C5  NGA C  19      -5.916 -10.970  27.735  0.00  0.00              
ATOM   2843  C6  NGA C  19      -5.702 -10.863  29.229  0.00  0.00              
ATOM   2844  OW  NGA C  19      -5.064  -8.954  24.699  0.00  0.00              
ATOM   2845  OR  NGA C  19      -7.333 -10.884  27.505  0.00  0.00              
ATOM   2846  O6h NGA C  19      -6.185  -9.633  29.747  0.00  0.00              
ATOM   2847  H6o NGA C  19      -6.906  -9.472  30.547  0.00  0.00              
ATOM   2848  O4h NGA C  19      -5.724  -8.571  27.221  0.00  0.00              
ATOM   2849  H4o NGA C  19      -5.219  -7.836  26.596  0.00  0.00              
ATOM   2850  H5  NGA C  19      -5.529 -11.908  27.452  0.00  0.00              
ATOM   2851  H6S NGA C  19      -5.886 -11.515  29.962  0.00  0.00              
ATOM   2852  H6R NGA C  19      -4.670 -10.908  29.425  0.00  0.00              
ATOM   2853  H1  NGA C  19      -7.364 -12.209  25.883  0.00  0.00              
ATOM   2854  H2  NGA C  19      -7.523  -9.223  25.425  0.00  0.00              
ATOM   2855  H3  NGA C  19      -5.080 -10.995  25.094  0.00  0.00              
ATOM   2856  H4  NGA C  19      -4.182  -9.934  27.135  0.00  0.00              
ATOM   2857  N23 NGA C  19      -7.321 -10.581  23.859  0.00  0.00              
ATOM   2858  C24 NGA C  19      -7.613  -9.630  22.915  0.00  0.00              
ATOM   2859  C25 NGA C  19      -7.878 -10.193  21.532  0.00  0.00              
ATOM   2860  OM  NGA C  19      -7.669  -8.436  23.139  0.00  0.00              
ATOM   2861  H27 NGA C  19      -7.292 -11.576  23.595  0.00  0.00              
ATOM   2862  H25 NGA C  19      -8.100  -9.378  20.806  0.00  0.00              
ATOM   2863  H29 NGA C  19      -8.754 -10.881  21.556  0.00  0.00              
ATOM   2864  H30 NGA C  19      -6.986 -10.750  21.163  0.00  0.00              
ATOM   2865  C1  AFL C  20      -4.059  -9.216  23.719  0.00  0.00              
ATOM   2866  C2  AFL C  20      -3.736  -8.009  22.817  0.00  0.00              
ATOM   2867  C3  AFL C  20      -2.980  -6.932  23.607  0.00  0.00              
ATOM   2868  C4  AFL C  20      -1.755  -7.564  24.290  0.00  0.00              
ATOM   2869  C5  AFL C  20      -2.199  -8.766  25.138  0.00  0.00              
ATOM   2870  C6  AFL C  20      -1.037  -9.494  25.827  0.00  0.00              
ATOM   2871  OR  AFL C  20      -2.883  -9.741  24.340  0.00  0.00              
ATOM   2872  O2h AFL C  20      -4.954  -7.558  22.232  0.00  0.00              
ATOM   2873  O3h AFL C  20      -2.647  -5.855  22.736  0.00  0.00              
ATOM   2874  O4h AFL C  20      -0.793  -8.018  23.339  0.00  0.00              
ATOM   2875  H5  AFL C  20      -2.871  -8.397  25.935  0.00  0.00              
ATOM   2876  H1  AFL C  20      -4.457 -10.035  23.108  0.00  0.00              
ATOM   2877  H2  AFL C  20      -3.070  -8.369  22.008  0.00  0.00              
ATOM   2878  H2o AFL C  20      -4.709  -6.901  21.566  0.00  0.00              
ATOM   2879  H3  AFL C  20      -3.660  -6.547  24.390  0.00  0.00              
ATOM   2880  H3o AFL C  20      -2.358  -5.126  23.299  0.00  0.00              
ATOM   2881  H4  AFL C  20      -1.268  -6.823  24.953  0.00  0.00              
ATOM   2882  H4o AFL C  20      -0.457  -7.229  22.892  0.00  0.00              
ATOM   2883  H6  AFL C  20      -0.439  -8.815  26.454  0.00  0.00              
ATOM   2884  H22 AFL C  20      -1.427 -10.299  26.471  0.00  0.00              
ATOM   2885  H23 AFL C  20      -0.368  -9.955  25.083  0.00  0.00              
ATOM   2886  C1  NAG C  21     -16.848 -24.192  15.027  0.00  0.00              
ATOM   2887  C2  NAG C  21     -17.669 -25.400  14.470  0.00  0.00              
ATOM   2888  C3  NAG C  21     -19.190 -25.052  14.481  0.00  0.00              
ATOM   2889  C4  NAG C  21     -19.653 -24.566  15.870  0.00  0.00              
ATOM   2890  C5  NAG C  21     -18.775 -23.384  16.361  0.00  0.00              
ATOM   2891  C6  NAG C  21     -19.133 -22.931  17.789  0.00  0.00              
ATOM   2892  C7  NAG C  21     -17.021 -26.988  12.687  0.00  0.00              
ATOM   2893  C8  NAG C  21     -16.680 -27.157  11.222  0.00  0.00              
ATOM   2894  O3h NAG C  21     -19.998 -26.177  14.126  0.00  0.00              
ATOM   2895  OR  NAG C  21     -21.022 -24.189  15.764  0.00  0.00              
ATOM   2896  OR  NAG C  21     -17.364 -23.764  16.317  0.00  0.00              
ATOM   2897  O6h NAG C  21     -18.939 -23.980  18.742  0.00  0.00              
ATOM   2898  OM  NAG C  21     -17.130 -27.970  13.411  0.00  0.00              
ATOM   2899  N15 NAG C  21     -17.238 -25.737  13.086  0.00  0.00              
ATOM   2900  H2  NAG C  21     -17.504 -26.249  15.167  0.00  0.00              
ATOM   2901  H3  NAG C  21     -19.378 -24.239  13.752  0.00  0.00              
ATOM   2902  H4  NAG C  21     -19.558 -25.401  16.594  0.00  0.00              
ATOM   2903  H5  NAG C  21     -18.937 -22.520  15.686  0.00  0.00              
ATOM   2904  H6S NAG C  21     -18.517 -22.054  18.065  0.00  0.00              
ATOM   2905  H6R NAG C  21     -20.184 -22.589  17.813  0.00  0.00              
ATOM   2906  H8  NAG C  21     -15.915 -27.944  11.102  0.00  0.00              
ATOM   2907  H24 NAG C  21     -16.293 -26.240  10.743  0.00  0.00              
ATOM   2908  H25 NAG C  21     -17.577 -27.484  10.669  0.00  0.00              
ATOM   2909  H3o NAG C  21     -19.789 -26.385  13.210  0.00  0.00              
ATOM   2910  H6o NAG C  21     -19.409 -23.732  19.543  0.00  0.00              
ATOM   2911  H29 NAG C  21     -16.958 -25.033  12.401  0.00  0.00              
ATOM   2912  H1  NAG C  21     -16.874 -23.340  14.318  0.00  0.00              
ATOM   2913  C1  GLB C  22     -21.911 -24.801  16.629  0.00  0.00              
ATOM   2914  C2  GLB C  22     -23.243 -24.061  16.545  0.00  0.00              
ATOM   2915  C3  GLB C  22     -24.356 -24.808  17.260  0.00  0.00              
ATOM   2916  C4  GLB C  22     -24.404 -26.249  16.805  0.00  0.00              
ATOM   2917  C5  GLB C  22     -23.025 -26.889  16.964  0.00  0.00              
ATOM   2918  C6  GLB C  22     -22.937 -28.332  16.517  0.00  0.00              
ATOM   2919  O2h GLB C  22     -23.081 -22.772  17.123  0.00  0.00              
ATOM   2920  OW  GLB C  22     -25.605 -24.177  16.952  0.00  0.00              
ATOM   2921  OR  GLB C  22     -22.102 -26.140  16.154  0.00  0.00              
ATOM   2922  O6h GLB C  22     -23.284 -28.487  15.151  0.00  0.00              
ATOM   2923  H2o GLB C  22     -22.943 -22.009  16.445  0.00  0.00              
ATOM   2924  H6o GLB C  22     -22.697 -28.935  14.349  0.00  0.00              
ATOM   2925  O4h GLB C  22     -24.845 -26.209  15.454  0.00  0.00              
ATOM   2926  H4o GLB C  22     -25.826 -25.736  15.405  0.00  0.00              
ATOM   2927  H5  GLB C  22     -22.749 -26.882  17.981  0.00  0.00              
ATOM   2928  H6S GLB C  22     -22.222 -29.014  16.657  0.00  0.00              
ATOM   2929  H6R GLB C  22     -23.614 -28.902  17.085  0.00  0.00              
ATOM   2930  H1  GLB C  22     -21.552 -24.787  17.658  0.00  0.00              
ATOM   2931  H2  GLB C  22     -23.493 -23.961  15.489  0.00  0.00              
ATOM   2932  H3  GLB C  22     -24.171 -24.772  18.334  0.00  0.00              
ATOM   2933  H4  GLB C  22     -25.088 -26.863  17.393  0.00  0.00              
ATOM   2934  C1  GLA C  23     -26.587 -24.153  17.980  0.00  0.00              
ATOM   2935  C2  GLA C  23     -28.005 -23.832  17.517  0.00  0.00              
ATOM   2936  C3  GLA C  23     -28.135 -22.399  17.030  0.00  0.00              
ATOM   2937  C4  GLA C  23     -27.572 -21.438  18.053  0.00  0.00              
ATOM   2938  C5  GLA C  23     -26.143 -21.845  18.414  0.00  0.00              
ATOM   2939  C6  GLA C  23     -25.474 -20.971  19.451  0.00  0.00              
ATOM   2940  O2h GLA C  23     -28.352 -24.729  16.471  0.00  0.00              
ATOM   2941  OW  GLA C  23     -29.523 -22.107  16.827  0.00  0.00              
ATOM   2942  OR  GLA C  23     -26.193 -23.176  18.952  0.00  0.00              
ATOM   2943  O6h GLA C  23     -26.194 -20.952  20.673  0.00  0.00              
ATOM   2944  H2o GLA C  23     -28.972 -25.573  16.779  0.00  0.00              
ATOM   2945  H6o GLA C  23     -25.839 -21.202  21.673  0.00  0.00              
ATOM   2946  O4h GLA C  23     -28.461 -21.495  19.161  0.00  0.00              
ATOM   2947  H4o GLA C  23     -29.461 -21.203  18.841  0.00  0.00              
ATOM   2948  H5  GLA C  23     -25.536 -21.793  17.553  0.00  0.00              
ATOM   2949  H6S GLA C  23     -24.520 -20.917  19.739  0.00  0.00              
ATOM   2950  H6R GLA C  23     -25.437 -19.985  19.088  0.00  0.00              
ATOM   2951  H1  GLA C  23     -26.560 -25.160  18.396  0.00  0.00              
ATOM   2952  H2  GLA C  23     -28.667 -23.988  18.370  0.00  0.00              
ATOM   2953  H3  GLA C  23     -27.588 -22.295  16.093  0.00  0.00              
ATOM   2954  H4  GLA C  23     -27.508 -20.412  17.689  0.00  0.00              
ATOM   2955  C1  NGA C  24     -29.829 -21.121  15.907  0.00  0.00              
ATOM   2956  C2  NGA C  24     -30.418 -21.790  14.668  0.00  0.00              
ATOM   2957  C3  NGA C  24     -31.021 -20.780  13.707  0.00  0.00              
ATOM   2958  C4  NGA C  24     -31.970 -19.856  14.436  0.00  0.00              
ATOM   2959  C5  NGA C  24     -31.261 -19.225  15.635  0.00  0.00              
ATOM   2960  C6  NGA C  24     -32.116 -18.292  16.464  0.00  0.00              
ATOM   2961  OW  NGA C  24     -31.743 -21.487  12.692  0.00  0.00              
ATOM   2962  OR  NGA C  24     -30.838 -20.292  16.500  0.00  0.00              
ATOM   2963  O6h NGA C  24     -33.260 -18.948  16.988  0.00  0.00              
ATOM   2964  H6o NGA C  24     -33.577 -19.030  18.028  0.00  0.00              
ATOM   2965  O4h NGA C  24     -33.079 -20.663  14.810  0.00  0.00              
ATOM   2966  H4o NGA C  24     -33.536 -21.090  13.917  0.00  0.00              
ATOM   2967  H5  NGA C  24     -30.445 -18.648  15.296  0.00  0.00              
ATOM   2968  H6S NGA C  24     -31.867 -17.646  17.181  0.00  0.00              
ATOM   2969  H6R NGA C  24     -32.452 -17.508  15.849  0.00  0.00              
ATOM   2970  H1  NGA C  24     -28.950 -20.541  15.624  0.00  0.00              
ATOM   2971  H2  NGA C  24     -31.194 -22.476  15.009  0.00  0.00              
ATOM   2972  H3  NGA C  24     -30.217 -20.196  13.260  0.00  0.00              
ATOM   2973  H4  NGA C  24     -32.316 -19.025  13.821  0.00  0.00              
ATOM   2974  N23 NGA C  24     -29.369 -22.529  14.006  0.00  0.00              
ATOM   2975  C24 NGA C  24     -29.640 -23.754  13.451  0.00  0.00              
ATOM   2976  C25 NGA C  24     -28.441 -24.414  12.796  0.00  0.00              
ATOM   2977  OM  NGA C  24     -30.731 -24.290  13.472  0.00  0.00              
ATOM   2978  H27 NGA C  24     -28.418 -22.138  13.949  0.00  0.00              
ATOM   2979  H25 NGA C  24     -28.719 -25.399  12.356  0.00  0.00              
ATOM   2980  H29 NGA C  24     -27.637 -24.588  13.549  0.00  0.00              
ATOM   2981  H30 NGA C  24     -28.042 -23.770  11.979  0.00  0.00              
ATOM   2982  C1  AFL C  25     -31.333 -21.279  11.341  0.00  0.00              
ATOM   2983  C2  AFL C  25     -32.005 -22.226  10.329  0.00  0.00              
ATOM   2984  C3  AFL C  25     -33.488 -21.868  10.155  0.00  0.00              
ATOM   2985  C4  AFL C  25     -33.615 -20.373   9.810  0.00  0.00              
ATOM   2986  C5  AFL C  25     -32.887 -19.535  10.873  0.00  0.00              
ATOM   2987  C6  AFL C  25     -32.920 -18.026  10.591  0.00  0.00              
ATOM   2988  OR  AFL C  25     -31.508 -19.907  10.975  0.00  0.00              
ATOM   2989  O2h AFL C  25     -31.776 -23.566  10.760  0.00  0.00              
ATOM   2990  O3h AFL C  25     -34.067 -22.724   9.175  0.00  0.00              
ATOM   2991  O4h AFL C  25     -33.046 -20.073   8.537  0.00  0.00              
ATOM   2992  H5  AFL C  25     -33.393 -19.695  11.844  0.00  0.00              
ATOM   2993  H1  AFL C  25     -30.249 -21.446  11.338  0.00  0.00              
ATOM   2994  H2  AFL C  25     -31.502 -22.081   9.353  0.00  0.00              
ATOM   2995  H2o AFL C  25     -32.077 -24.138  10.042  0.00  0.00              
ATOM   2996  H3  AFL C  25     -33.997 -22.049  11.120  0.00  0.00              
ATOM   2997  H3o AFL C  25     -35.024 -22.604   9.239  0.00  0.00              
ATOM   2998  H4  AFL C  25     -34.681 -20.080   9.794  0.00  0.00              
ATOM   2999  H4o AFL C  25     -33.586 -20.533   7.880  0.00  0.00              
ATOM   3000  H6  AFL C  25     -33.949 -17.651  10.479  0.00  0.00              
ATOM   3001  H22 AFL C  25     -32.445 -17.479  11.421  0.00  0.00              
ATOM   3002  H23 AFL C  25     -32.364 -17.788   9.671  0.00  0.00              
ATOM   3003  C1  NAG C  26     -13.944 -24.381  10.668  0.00  0.00              
ATOM   3004  C2  NAG C  26     -13.258 -25.558   9.902  0.00  0.00              
ATOM   3005  C3  NAG C  26     -13.618 -25.479   8.386  0.00  0.00              
ATOM   3006  C4  NAG C  26     -15.143 -25.391   8.166  0.00  0.00              
ATOM   3007  C5  NAG C  26     -15.748 -24.213   8.978  0.00  0.00              
ATOM   3008  C6  NAG C  26     -17.284 -24.148   8.873  0.00  0.00              
ATOM   3009  C7  NAG C  26     -11.055 -26.590  10.352  0.00  0.00              
ATOM   3010  C8  NAG C  26      -9.557 -26.379  10.400  0.00  0.00              
ATOM   3011  O3h NAG C  26     -13.145 -26.618   7.664  0.00  0.00              
ATOM   3012  OR  NAG C  26     -15.372 -25.231   6.770  0.00  0.00              
ATOM   3013  OR  NAG C  26     -15.368 -24.335  10.383  0.00  0.00              
ATOM   3014  O6h NAG C  26     -17.901 -25.332   9.385  0.00  0.00              
ATOM   3015  OM  NAG C  26     -11.524 -27.712  10.516  0.00  0.00              
ATOM   3016  N15 NAG C  26     -11.780 -25.510  10.073  0.00  0.00              
ATOM   3017  H2  NAG C  26     -13.685 -26.499  10.309  0.00  0.00              
ATOM   3018  H3  NAG C  26     -13.154 -24.570   7.954  0.00  0.00              
ATOM   3019  H4  NAG C  26     -15.612 -26.335   8.510  0.00  0.00              
ATOM   3020  H5  NAG C  26     -15.344 -23.263   8.576  0.00  0.00              
ATOM   3021  H6S NAG C  26     -17.656 -23.262   9.422  0.00  0.00              
ATOM   3022  H6R NAG C  26     -17.573 -23.999   7.814  0.00  0.00              
ATOM   3023  H8  NAG C  26      -9.117 -26.983  11.213  0.00  0.00              
ATOM   3024  H24 NAG C  26      -9.258 -25.328  10.564  0.00  0.00              
ATOM   3025  H25 NAG C  26      -9.106 -26.722   9.453  0.00  0.00              
ATOM   3026  H3o NAG C  26     -12.183 -26.584   7.701  0.00  0.00              
ATOM   3027  H6o NAG C  26     -18.807 -25.345   9.065  0.00  0.00              
ATOM   3028  H29 NAG C  26     -11.251 -24.638  10.118  0.00  0.00              
ATOM   3029  H1  NAG C  26     -13.481 -23.411  10.394  0.00  0.00              
ATOM   3030  C1  GLB C  27     -16.201 -26.157   6.159  0.00  0.00              
ATOM   3031  C2  GLB C  27     -16.533 -25.649   4.761  0.00  0.00              
ATOM   3032  C3  GLB C  27     -17.226 -26.707   3.919  0.00  0.00              
ATOM   3033  C4  GLB C  27     -16.447 -28.002   3.951  0.00  0.00              
ATOM   3034  C5  GLB C  27     -16.201 -28.422   5.401  0.00  0.00              
ATOM   3035  C6  GLB C  27     -15.406 -29.699   5.568  0.00  0.00              
ATOM   3036  O2h GLB C  27     -17.373 -24.507   4.883  0.00  0.00              
ATOM   3037  OW  GLB C  27     -17.304 -26.240   2.567  0.00  0.00              
ATOM   3038  OR  GLB C  27     -15.453 -27.373   6.037  0.00  0.00              
ATOM   3039  O6h GLB C  27     -14.124 -29.609   4.965  0.00  0.00              
ATOM   3040  H2o GLB C  27     -16.889 -23.602   4.783  0.00  0.00              
ATOM   3041  H6o GLB C  27     -13.148 -29.769   5.423  0.00  0.00              
ATOM   3042  O4h GLB C  27     -15.244 -27.743   3.238  0.00  0.00              
ATOM   3043  H4o GLB C  27     -15.483 -27.440   2.219  0.00  0.00              
ATOM   3044  H5  GLB C  27     -17.125 -28.591   5.879  0.00  0.00              
ATOM   3045  H6S GLB C  27     -15.247 -30.266   6.374  0.00  0.00              
ATOM   3046  H6R GLB C  27     -15.925 -30.483   5.098  0.00  0.00              
ATOM   3047  H1  GLB C  27     -17.123 -26.308   6.721  0.00  0.00              
ATOM   3048  H2  GLB C  27     -15.594 -25.364   4.287  0.00  0.00              
ATOM   3049  H3  GLB C  27     -18.226 -26.874   4.317  0.00  0.00              
ATOM   3050  H4  GLB C  27     -16.975 -28.833   3.484  0.00  0.00              
ATOM   3051  C1  GLA C  28     -18.459 -26.604   1.824  0.00  0.00              
ATOM   3052  C2  GLA C  28     -18.344 -26.430   0.312  0.00  0.00              
ATOM   3053  C3  GLA C  28     -18.253 -24.967  -0.088  0.00  0.00              
ATOM   3054  C4  GLA C  28     -19.367 -24.172   0.555  0.00  0.00              
ATOM   3055  C5  GLA C  28     -19.363 -24.404   2.066  0.00  0.00              
ATOM   3056  C6  GLA C  28     -20.451 -23.677   2.825  0.00  0.00              
ATOM   3057  O2h GLA C  28     -17.185 -27.123  -0.134  0.00  0.00              
ATOM   3058  OW  GLA C  28     -18.372 -24.873  -1.514  0.00  0.00              
ATOM   3059  OR  GLA C  28     -19.558 -25.810   2.290  0.00  0.00              
ATOM   3060  O6h GLA C  28     -21.746 -24.044   2.378  0.00  0.00              
ATOM   3061  H2o GLA C  28     -17.379 -28.104  -0.568  0.00  0.00              
ATOM   3062  H6o GLA C  28     -22.576 -24.442   2.960  0.00  0.00              
ATOM   3063  O4h GLA C  28     -20.564 -24.615  -0.070  0.00  0.00              
ATOM   3064  H4o GLA C  28     -20.504 -24.431  -1.142  0.00  0.00              
ATOM   3065  H5  GLA C  28     -18.449 -24.066   2.470  0.00  0.00              
ATOM   3066  H6S GLA C  28     -20.573 -23.529   3.804  0.00  0.00              
ATOM   3067  H6R GLA C  28     -20.339 -22.643   2.666  0.00  0.00              
ATOM   3068  H1  GLA C  28     -18.604 -27.658   2.058  0.00  0.00              
ATOM   3069  H2  GLA C  28     -19.233 -26.874  -0.134  0.00  0.00              
ATOM   3070  H3  GLA C  28     -17.290 -24.573   0.235  0.00  0.00              
ATOM   3071  H4  GLA C  28     -19.261 -23.096   0.417  0.00  0.00              
ATOM   3072  C1  NGA C  29     -17.790 -23.774  -2.121  0.00  0.00              
ATOM   3073  C2  NGA C  29     -16.547 -24.247  -2.869  0.00  0.00              
ATOM   3074  C3  NGA C  29     -15.981 -23.167  -3.776  0.00  0.00              
ATOM   3075  C4  NGA C  29     -17.069 -22.594  -4.657  0.00  0.00              
ATOM   3076  C5  NGA C  29     -18.243 -22.130  -3.795  0.00  0.00              
ATOM   3077  C6  NGA C  29     -19.412 -21.556  -4.566  0.00  0.00              
ATOM   3078  OW  NGA C  29     -14.965 -23.747  -4.602  0.00  0.00              
ATOM   3079  OR  NGA C  29     -18.734 -23.275  -3.077  0.00  0.00              
ATOM   3080  O6h NGA C  29     -19.949 -22.490  -5.489  0.00  0.00              
ATOM   3081  H6o NGA C  29     -20.976 -22.847  -5.571  0.00  0.00              
ATOM   3082  O4h NGA C  29     -17.420 -23.636  -5.558  0.00  0.00              
ATOM   3083  H4o NGA C  29     -16.543 -23.929  -6.137  0.00  0.00              
ATOM   3084  H5  NGA C  29     -17.921 -21.367  -3.144  0.00  0.00              
ATOM   3085  H6S NGA C  29     -20.212 -21.048  -4.253  0.00  0.00              
ATOM   3086  H6R NGA C  29     -19.076 -20.723  -5.114  0.00  0.00              
ATOM   3087  H1  NGA C  29     -17.509 -23.010  -1.397  0.00  0.00              
ATOM   3088  H2  NGA C  29     -16.837 -25.110  -3.467  0.00  0.00              
ATOM   3089  H3  NGA C  29     -15.558 -22.376  -3.158  0.00  0.00              
ATOM   3090  H4  NGA C  29     -16.746 -21.718  -5.221  0.00  0.00              
ATOM   3091  N23 NGA C  29     -15.550 -24.641  -1.899  0.00  0.00              
ATOM   3092  C24 NGA C  29     -14.768 -25.743  -2.129  0.00  0.00              
ATOM   3093  C25 NGA C  29     -13.773 -26.037  -1.021  0.00  0.00              
ATOM   3094  OM  NGA C  29     -14.845 -26.444  -3.119  0.00  0.00              
ATOM   3095  H27 NGA C  29     -15.428 -24.093  -1.035  0.00  0.00              
ATOM   3096  H25 NGA C  29     -13.160 -26.934  -1.265  0.00  0.00              
ATOM   3097  H29 NGA C  29     -14.309 -26.233  -0.064  0.00  0.00              
ATOM   3098  H30 NGA C  29     -13.083 -25.174  -0.882  0.00  0.00              
ATOM   3099  C1  AFL C  30     -13.657 -23.185  -4.510  0.00  0.00              
ATOM   3100  C2  AFL C  30     -12.576 -23.988  -5.257  0.00  0.00              
ATOM   3101  C3  AFL C  30     -12.755 -23.852  -6.777  0.00  0.00              
ATOM   3102  C4  AFL C  30     -12.815 -22.361  -7.152  0.00  0.00              
ATOM   3103  C5  AFL C  30     -13.908 -21.663  -6.327  0.00  0.00              
ATOM   3104  C6  AFL C  30     -14.016 -20.158  -6.598  0.00  0.00              
ATOM   3105  OR  AFL C  30     -13.675 -21.816  -4.922  0.00  0.00              
ATOM   3106  O2h AFL C  30     -12.618 -25.332  -4.783  0.00  0.00              
ATOM   3107  O3h AFL C  30     -11.711 -24.559  -7.440  0.00  0.00              
ATOM   3108  O4h AFL C  30     -11.576 -21.701  -6.900  0.00  0.00              
ATOM   3109  H5  AFL C  30     -14.883 -22.113  -6.596  0.00  0.00              
ATOM   3110  H1  AFL C  30     -13.425 -23.165  -3.438  0.00  0.00              
ATOM   3111  H2  AFL C  30     -11.594 -23.553  -4.990  0.00  0.00              
ATOM   3112  H2o AFL C  30     -11.846 -25.777  -5.156  0.00  0.00              
ATOM   3113  H3  AFL C  30     -13.720 -24.321  -7.048  0.00  0.00              
ATOM   3114  H3o AFL C  30     -11.968 -24.616  -8.370  0.00  0.00              
ATOM   3115  H4  AFL C  30     -13.057 -22.252  -8.226  0.00  0.00              
ATOM   3116  H4o AFL C  30     -10.930 -22.090  -7.506  0.00  0.00              
ATOM   3117  H6  AFL C  30     -14.180 -19.943  -7.667  0.00  0.00              
ATOM   3118  H22 AFL C  30     -14.859 -19.733  -6.031  0.00  0.00              
ATOM   3119  H23 AFL C  30     -13.101 -19.637  -6.278  0.00  0.00              
ATOM   3120  C1  NAG D   1       8.348 -14.271 -11.250  0.00  0.00              
ATOM   3121  C2  NAG D   1       6.896 -14.591 -11.729  0.00  0.00              
ATOM   3122  C3  NAG D   1       6.941 -15.249 -13.143  0.00  0.00              
ATOM   3123  C4  NAG D   1       7.758 -14.401 -14.139  0.00  0.00              
ATOM   3124  C5  NAG D   1       9.177 -14.107 -13.579  0.00  0.00              
ATOM   3125  C6  NAG D   1       9.995 -13.176 -14.493  0.00  0.00              
ATOM   3126  C7  NAG D   1       4.962 -15.303 -10.359  0.00  0.00              
ATOM   3127  C8  NAG D   1       4.391 -16.378  -9.457  0.00  0.00              
ATOM   3128  O3h NAG D   1       5.634 -15.423 -13.694  0.00  0.00              
ATOM   3129  OR  NAG D   1       7.823 -15.117 -15.368  0.00  0.00              
ATOM   3130  OR  NAG D   1       9.069 -13.505 -12.252  0.00  0.00              
ATOM   3131  OW  NAG D   1      11.216 -13.788 -14.916  0.00  0.00              
ATOM   3132  OM  NAG D   1       4.266 -14.356 -10.704  0.00  0.00              
ATOM   3133  N15 NAG D   1       6.212 -15.502 -10.770  0.00  0.00              
ATOM   3134  H2  NAG D   1       6.364 -13.620 -11.817  0.00  0.00              
ATOM   3135  H3  NAG D   1       7.424 -16.244 -13.060  0.00  0.00              
ATOM   3136  H4  NAG D   1       7.236 -13.436 -14.303  0.00  0.00              
ATOM   3137  H5  NAG D   1       9.728 -15.065 -13.496  0.00  0.00              
ATOM   3138  H6  NAG D   1       9.388 -12.894 -15.374  0.00  0.00              
ATOM   3139  H22 NAG D   1      10.212 -12.232 -13.955  0.00  0.00              
ATOM   3140  H8  NAG D   1       3.763 -15.918  -8.675  0.00  0.00              
ATOM   3141  H24 NAG D   1       5.158 -16.993  -8.952  0.00  0.00              
ATOM   3142  H25 NAG D   1       3.744 -17.049 -10.047  0.00  0.00              
ATOM   3143  H3o NAG D   1       5.183 -16.059 -13.131  0.00  0.00              
ATOM   3144  H29 NAG D   1       6.694 -16.252 -10.271  0.00  0.00              
ATOM   3145  H1  NAG D   1       8.904 -15.204 -11.028  0.00  0.00              
ATOM   3146  C1  NAG D   2       7.360 -14.445 -16.530  0.00  0.00              
ATOM   3147  C2  NAG D   2       7.853 -15.173 -17.822  0.00  0.00              
ATOM   3148  C3  NAG D   2       7.121 -14.585 -19.069  0.00  0.00              
ATOM   3149  C4  NAG D   2       5.590 -14.597 -18.889  0.00  0.00              
ATOM   3150  C5  NAG D   2       5.185 -13.877 -17.573  0.00  0.00              
ATOM   3151  C6  NAG D   2       3.671 -13.953 -17.296  0.00  0.00              
ATOM   3152  C7  NAG D   2      10.119 -16.040 -18.310  0.00  0.00              
ATOM   3153  C8  NAG D   2      11.576 -15.691 -18.524  0.00  0.00              
ATOM   3154  O3h NAG D   2       7.422 -15.318 -20.259  0.00  0.00              
ATOM   3155  OR  NAG D   2       5.014 -13.964 -20.026  0.00  0.00              
ATOM   3156  OR  NAG D   2       5.909 -14.462 -16.447  0.00  0.00              
ATOM   3157  O6h NAG D   2       3.225 -15.305 -17.154  0.00  0.00              
ATOM   3158  OM  NAG D   2       9.729 -17.188 -18.489  0.00  0.00              
ATOM   3159  N15 NAG D   2       9.326 -15.023 -17.983  0.00  0.00              
ATOM   3160  H2  NAG D   2       7.561 -16.240 -17.722  0.00  0.00              
ATOM   3161  H3  NAG D   2       7.444 -13.534 -19.212  0.00  0.00              
ATOM   3162  H4  NAG D   2       5.242 -15.648 -18.837  0.00  0.00              
ATOM   3163  H5  NAG D   2       5.456 -12.806 -17.659  0.00  0.00              
ATOM   3164  H6S NAG D   2       3.433 -13.378 -16.382  0.00  0.00              
ATOM   3165  H6R NAG D   2       3.122 -13.460 -18.122  0.00  0.00              
ATOM   3166  H8  NAG D   2      12.218 -16.496 -18.127  0.00  0.00              
ATOM   3167  H24 NAG D   2      11.886 -14.746 -18.041  0.00  0.00              
ATOM   3168  H25 NAG D   2      11.781 -15.608 -19.605  0.00  0.00              
ATOM   3169  H3o NAG D   2       8.360 -15.190 -20.430  0.00  0.00              
ATOM   3170  H6o NAG D   2       2.269 -15.304 -17.240  0.00  0.00              
ATOM   3171  H29 NAG D   2       9.831 -14.173 -17.728  0.00  0.00              
ATOM   3172  H1  NAG D   2       7.719 -13.397 -16.509  0.00  0.00              
ATOM   3173  C1  BMA D   3       4.077 -14.689 -20.741  0.00  0.00              
ATOM   3174  C2  BMA D   3       3.392 -13.744 -21.724  0.00  0.00              
ATOM   3175  C3  BMA D   3       2.531 -14.492 -22.728  0.00  0.00              
ATOM   3176  C4  BMA D   3       3.319 -15.611 -23.372  0.00  0.00              
ATOM   3177  C5  BMA D   3       3.930 -16.502 -22.290  0.00  0.00              
ATOM   3178  C6  BMA D   3       4.766 -17.651 -22.809  0.00  0.00              
ATOM   3179  OW  BMA D   3       2.107 -13.573 -23.743  0.00  0.00              
ATOM   3180  O4h BMA D   3       2.485 -16.414 -24.192  0.00  0.00              
ATOM   3181  OR  BMA D   3       4.793 -15.682 -21.486  0.00  0.00              
ATOM   3182  OW  BMA D   3       4.293 -18.905 -22.341  0.00  0.00              
ATOM   3183  H4o BMA D   3       2.559 -16.081 -25.227  0.00  0.00              
ATOM   3184  O2h BMA D   3       4.391 -13.002 -22.413  0.00  0.00              
ATOM   3185  H2o BMA D   3       5.017 -13.682 -22.991  0.00  0.00              
ATOM   3186  H5  BMA D   3       3.159 -16.939 -21.719  0.00  0.00              
ATOM   3187  H6  BMA D   3       5.096 -17.853 -23.729  0.00  0.00              
ATOM   3188  H20 BMA D   3       5.752 -17.534 -22.463  0.00  0.00              
ATOM   3189  H2  BMA D   3       2.766 -13.069 -21.141  0.00  0.00              
ATOM   3190  H3  BMA D   3       1.667 -14.907 -22.211  0.00  0.00              
ATOM   3191  H1  BMA D   3       3.328 -15.139 -20.089  0.00  0.00              
ATOM   3192  H4  BMA D   3       4.102 -15.157 -23.981  0.00  0.00              
ATOM   3193  C1  MAN D   4       0.712 -13.504 -24.009  0.00  0.00              
ATOM   3194  C2  MAN D   4       0.326 -12.743 -25.273  0.00  0.00              
ATOM   3195  C3  MAN D   4       0.621 -11.258 -25.157  0.00  0.00              
ATOM   3196  C4  MAN D   4       0.032 -10.700 -23.880  0.00  0.00              
ATOM   3197  C5  MAN D   4       0.512 -11.524 -22.686  0.00  0.00              
ATOM   3198  C6  MAN D   4      -0.028 -11.079 -21.345  0.00  0.00              
ATOM   3199  O3h MAN D   4       0.034 -10.583 -26.277  0.00  0.00              
ATOM   3200  OR  MAN D   4       0.434  -9.353 -23.680  0.00  0.00              
ATOM   3201  OR  MAN D   4       0.074 -12.878 -22.887  0.00  0.00              
ATOM   3202  O6h MAN D   4      -1.446 -11.120 -21.304  0.00  0.00              
ATOM   3203  H3o MAN D   4       0.902 -10.277 -26.862  0.00  0.00              
ATOM   3204  H6o MAN D   4      -2.088 -11.649 -20.599  0.00  0.00              
ATOM   3205  OW  MAN D   4      -1.062 -12.936 -25.516  0.00  0.00              
ATOM   3206  H5  MAN D   4       1.562 -11.459 -22.612  0.00  0.00              
ATOM   3207  H6S MAN D   4       0.241 -11.330 -20.417  0.00  0.00              
ATOM   3208  H6R MAN D   4       0.265 -10.083 -21.178  0.00  0.00              
ATOM   3209  H1  MAN D   4       0.408 -14.547 -24.105  0.00  0.00              
ATOM   3210  H2  MAN D   4       0.907 -13.165 -26.093  0.00  0.00              
ATOM   3211  H3  MAN D   4       1.700 -11.113 -25.153  0.00  0.00              
ATOM   3212  H4  MAN D   4      -1.053 -10.747 -23.966  0.00  0.00              
ATOM   3213  C1  NAG D   5      -1.433 -14.094 -26.247  0.00  0.00              
ATOM   3214  C2  NAG D   5      -2.757 -14.703 -25.683  0.00  0.00              
ATOM   3215  C3  NAG D   5      -3.287 -15.803 -26.655  0.00  0.00              
ATOM   3216  C4  NAG D   5      -3.405 -15.276 -28.100  0.00  0.00              
ATOM   3217  C5  NAG D   5      -2.058 -14.668 -28.577  0.00  0.00              
ATOM   3218  C6  NAG D   5      -2.154 -14.034 -29.978  0.00  0.00              
ATOM   3219  C7  NAG D   5      -3.370 -15.084 -23.316  0.00  0.00              
ATOM   3220  C8  NAG D   5      -3.043 -15.830 -22.040  0.00  0.00              
ATOM   3221  O3h NAG D   5      -4.575 -16.286 -26.265  0.00  0.00              
ATOM   3222  OR  NAG D   5      -3.806 -16.364 -28.928  0.00  0.00              
ATOM   3223  OR  NAG D   5      -1.608 -13.656 -27.622  0.00  0.00              
ATOM   3224  O6h NAG D   5      -3.099 -12.962 -30.009  0.00  0.00              
ATOM   3225  OM  NAG D   5      -4.378 -14.389 -23.382  0.00  0.00              
ATOM   3226  N15 NAG D   5      -2.536 -15.288 -24.331  0.00  0.00              
ATOM   3227  H2  NAG D   5      -3.503 -13.880 -25.653  0.00  0.00              
ATOM   3228  H3  NAG D   5      -2.577 -16.655 -26.655  0.00  0.00              
ATOM   3229  H4  NAG D   5      -4.182 -14.485 -28.133  0.00  0.00              
ATOM   3230  H5  NAG D   5      -1.303 -15.478 -28.626  0.00  0.00              
ATOM   3231  H6S NAG D   5      -1.157 -13.668 -30.288  0.00  0.00              
ATOM   3232  H6R NAG D   5      -2.440 -14.812 -30.712  0.00  0.00              
ATOM   3233  H8  NAG D   5      -3.258 -15.192 -21.165  0.00  0.00              
ATOM   3234  H24 NAG D   5      -1.989 -16.153 -21.968  0.00  0.00              
ATOM   3235  H25 NAG D   5      -3.684 -16.725 -21.961  0.00  0.00              
ATOM   3236  H3o NAG D   5      -4.456 -16.728 -25.419  0.00  0.00              
ATOM   3237  H6o NAG D   5      -3.302 -12.784 -30.933  0.00  0.00              
ATOM   3238  H29 NAG D   5      -1.674 -15.767 -24.066  0.00  0.00              
ATOM   3239  H1  NAG D   5      -0.609 -14.833 -26.198  0.00  0.00              
ATOM   3240  C1  GLB D   6      -4.953 -16.191 -29.681  0.00  0.00              
ATOM   3241  C2  GLB D   6      -5.041 -17.336 -30.686  0.00  0.00              
ATOM   3242  C3  GLB D   6      -6.389 -17.379 -31.385  0.00  0.00              
ATOM   3243  C4  GLB D   6      -7.511 -17.339 -30.373  0.00  0.00              
ATOM   3244  C5  GLB D   6      -7.331 -16.139 -29.444  0.00  0.00              
ATOM   3245  C6  GLB D   6      -8.383 -16.001 -28.367  0.00  0.00              
ATOM   3246  O2h GLB D   6      -4.005 -17.172 -31.647  0.00  0.00              
ATOM   3247  O3h GLB D   6      -6.477 -18.595 -32.137  0.00  0.00              
ATOM   3248  OR  GLB D   6      -6.064 -16.287 -28.781  0.00  0.00              
ATOM   3249  OW  GLB D   6      -8.716 -14.644 -28.121  0.00  0.00              
ATOM   3250  H2o GLB D   6      -3.172 -17.757 -31.488  0.00  0.00              
ATOM   3251  H3o GLB D   6      -6.429 -18.250 -33.169  0.00  0.00              
ATOM   3252  O4h GLB D   6      -7.452 -18.584 -29.686  0.00  0.00              
ATOM   3253  H4o GLB D   6      -7.577 -19.399 -30.400  0.00  0.00              
ATOM   3254  H5  GLB D   6      -7.375 -15.249 -30.009  0.00  0.00              
ATOM   3255  H6  GLB D   6      -9.247 -16.482 -28.235  0.00  0.00              
ATOM   3256  H20 GLB D   6      -8.004 -16.403 -27.473  0.00  0.00              
ATOM   3257  H1  GLB D   6      -4.950 -15.239 -30.213  0.00  0.00              
ATOM   3258  H2  GLB D   6      -4.886 -18.263 -30.135  0.00  0.00              
ATOM   3259  H3  GLB D   6      -6.468 -16.518 -32.050  0.00  0.00              
ATOM   3260  H4  GLB D   6      -8.495 -17.222 -30.827  0.00  0.00              
ATOM   3261  C1  NAN D   7      -8.401 -14.832 -25.715  0.00  0.00              
ATOM   3262  C2  NAN D   7      -9.335 -14.349 -26.881  0.00  0.00              
ATOM   3263  C3  NAN D   7     -10.741 -15.011 -26.927  0.00  0.00              
ATOM   3264  C4  NAN D   7     -11.686 -14.435 -25.850  0.00  0.00              
ATOM   3265  C5  NAN D   7     -11.761 -12.895 -25.931  0.00  0.00              
ATOM   3266  C6  NAN D   7     -10.337 -12.266 -25.894  0.00  0.00              
ATOM   3267  C7  NAN D   7     -10.331 -10.731 -26.119  0.00  0.00              
ATOM   3268  C8  NAN D   7      -8.956 -10.076 -25.841  0.00  0.00              
ATOM   3269  C9  NAN D   7      -8.949  -8.553 -26.038  0.00  0.00              
ATOM   3270  OW  NAN D   7      -9.496 -12.897 -26.923  0.00  0.00              
ATOM   3271  OM  NAN D   7      -8.690 -15.697 -24.889  0.00  0.00              
ATOM   3272  O1h NAN D   7      -7.200 -14.182 -25.704  0.00  0.00              
ATOM   3273  O4h NAN D   7     -12.985 -14.979 -26.046  0.00  0.00              
ATOM   3274  O7h NAN D   7     -10.704 -10.480 -27.473  0.00  0.00              
ATOM   3275  O8h NAN D   7      -8.575 -10.297 -24.491  0.00  0.00              
ATOM   3276  O9h NAN D   7      -7.670  -8.022 -25.693  0.00  0.00              
ATOM   3277  H6  NAN D   7      -9.906 -12.467 -24.893  0.00  0.00              
ATOM   3278  H3  NAN D   7     -11.186 -14.833 -27.925  0.00  0.00              
ATOM   3279  H21 NAN D   7     -10.650 -16.109 -26.834  0.00  0.00              
ATOM   3280  H4  NAN D   7     -11.317 -14.728 -24.845  0.00  0.00              
ATOM   3281  H7o NAN D   7     -10.298 -11.201 -27.964  0.00  0.00              
ATOM   3282  H8o NAN D   7      -7.963  -9.576 -24.314  0.00  0.00              
ATOM   3283  H4o NAN D   7     -12.860 -15.926 -26.161  0.00  0.00              
ATOM   3284  H9o NAN D   7      -7.670  -7.094 -25.952  0.00  0.00              
ATOM   3285  H9R NAN D   7      -9.738  -8.082 -25.418  0.00  0.00              
ATOM   3286  H9S NAN D   7      -9.196  -8.308 -27.090  0.00  0.00              
ATOM   3287  H8  NAN D   7      -8.194 -10.526 -26.507  0.00  0.00              
ATOM   3288  H7  NAN D   7     -11.079 -10.270 -25.444  0.00  0.00              
ATOM   3289  H1o NAN D   7      -6.700 -14.509 -24.955  0.00  0.00              
ATOM   3290  H5  NAN D   7     -12.256 -12.608 -26.880  0.00  0.00              
ATOM   3291  N33 NAN D   7     -12.559 -12.432 -24.819  0.00  0.00              
ATOM   3292  C34 NAN D   7     -13.902 -12.212 -24.985  0.00  0.00              
ATOM   3293  C35 NAN D   7     -14.607 -11.722 -23.733  0.00  0.00              
ATOM   3294  OM  NAN D   7     -14.501 -12.381 -26.029  0.00  0.00              
ATOM   3295  H37 NAN D   7     -12.119 -12.268 -23.903  0.00  0.00              
ATOM   3296  H35 NAN D   7     -15.694 -11.569 -23.923  0.00  0.00              
ATOM   3297  H39 NAN D   7     -14.175 -10.750 -23.404  0.00  0.00              
ATOM   3298  H40 NAN D   7     -14.501 -12.467 -22.912  0.00  0.00              
ATOM   3299  C1  NAG D   8      -0.597  -8.387 -23.546  0.00  0.00              
ATOM   3300  C2  NAG D   8      -0.035  -7.059 -22.942  0.00  0.00              
ATOM   3301  C3  NAG D   8      -1.112  -5.935 -23.051  0.00  0.00              
ATOM   3302  C4  NAG D   8      -1.643  -5.793 -24.492  0.00  0.00              
ATOM   3303  C5  NAG D   8      -2.160  -7.157 -25.025  0.00  0.00              
ATOM   3304  C6  NAG D   8      -2.606  -7.089 -26.498  0.00  0.00              
ATOM   3305  C7  NAG D   8       1.498  -6.790 -21.019  0.00  0.00              
ATOM   3306  C8  NAG D   8       1.691  -6.990 -19.531  0.00  0.00              
ATOM   3307  O3h NAG D   8      -0.596  -4.661 -22.654  0.00  0.00              
ATOM   3308  OR  NAG D   8      -2.678  -4.815 -24.479  0.00  0.00              
ATOM   3309  OR  NAG D   8      -1.116  -8.170 -24.886  0.00  0.00              
ATOM   3310  O6h NAG D   8      -1.528  -6.716 -27.361  0.00  0.00              
ATOM   3311  OM  NAG D   8       2.344  -6.192 -21.674  0.00  0.00              
ATOM   3312  N15 NAG D   8       0.354  -7.250 -21.517  0.00  0.00              
ATOM   3313  H2  NAG D   8       0.835  -6.766 -23.565  0.00  0.00              
ATOM   3314  H3  NAG D   8      -1.967  -6.190 -22.392  0.00  0.00              
ATOM   3315  H4  NAG D   8      -0.819  -5.447 -25.147  0.00  0.00              
ATOM   3316  H5  NAG D   8      -3.039  -7.461 -24.422  0.00  0.00              
ATOM   3317  H6S NAG D   8      -3.015  -8.069 -26.807  0.00  0.00              
ATOM   3318  H6R NAG D   8      -3.437  -6.363 -26.596  0.00  0.00              
ATOM   3319  H8  NAG D   8       2.746  -7.240 -19.318  0.00  0.00              
ATOM   3320  H24 NAG D   8       1.064  -7.793 -19.102  0.00  0.00              
ATOM   3321  H25 NAG D   8       1.461  -6.050 -19.000  0.00  0.00              
ATOM   3322  H3o NAG D   8      -0.392  -4.731 -21.716  0.00  0.00              
ATOM   3323  H6o NAG D   8      -1.911  -6.445 -28.199  0.00  0.00              
ATOM   3324  H29 NAG D   8      -0.164  -7.850 -20.873  0.00  0.00              
ATOM   3325  H1  NAG D   8      -1.400  -8.802 -22.903  0.00  0.00              
ATOM   3326  C1  GLB D   9      -2.536  -3.740 -25.339  0.00  0.00              
ATOM   3327  C2  GLB D   9      -3.859  -2.979 -25.371  0.00  0.00              
ATOM   3328  C3  GLB D   9      -3.730  -1.643 -26.083  0.00  0.00              
ATOM   3329  C4  GLB D   9      -2.564  -0.857 -25.527  0.00  0.00              
ATOM   3330  C5  GLB D   9      -1.296  -1.710 -25.572  0.00  0.00              
ATOM   3331  C6  GLB D   9      -0.057  -1.040 -25.019  0.00  0.00              
ATOM   3332  O2h GLB D   9      -4.825  -3.785 -26.034  0.00  0.00              
ATOM   3333  OW  GLB D   9      -4.937  -0.898 -25.881  0.00  0.00              
ATOM   3334  OR  GLB D   9      -1.533  -2.883 -24.777  0.00  0.00              
ATOM   3335  O6h GLB D   9      -0.222  -0.658 -23.663  0.00  0.00              
ATOM   3336  H2o GLB D   9      -5.466  -4.294 -25.406  0.00  0.00              
ATOM   3337  H6o GLB D   9       0.392  -0.928 -22.804  0.00  0.00              
ATOM   3338  O4h GLB D   9      -2.942  -0.495 -24.205  0.00  0.00              
ATOM   3339  H4o GLB D   9      -3.853   0.101 -24.237  0.00  0.00              
ATOM   3340  H5  GLB D   9      -1.073  -1.953 -26.574  0.00  0.00              
ATOM   3341  H6S GLB D   9       0.904  -1.303 -25.075  0.00  0.00              
ATOM   3342  H6R GLB D   9       0.131  -0.169 -25.575  0.00  0.00              
ATOM   3343  H1  GLB D   9      -2.274  -4.058 -26.347  0.00  0.00              
ATOM   3344  H2  GLB D   9      -4.164  -2.814 -24.338  0.00  0.00              
ATOM   3345  H3  GLB D   9      -3.572  -1.824 -27.146  0.00  0.00              
ATOM   3346  H4  GLB D   9      -2.341   0.043 -26.101  0.00  0.00              
ATOM   3347  C1  NAN D  10      -5.868  -1.586 -28.021  0.00  0.00              
ATOM   3348  C2  NAN D  10      -5.584  -0.395 -27.037  0.00  0.00              
ATOM   3349  C3  NAN D  10      -4.665   0.728 -27.597  0.00  0.00              
ATOM   3350  C4  NAN D  10      -5.413   1.646 -28.588  0.00  0.00              
ATOM   3351  C5  NAN D  10      -6.711   2.205 -27.966  0.00  0.00              
ATOM   3352  C6  NAN D  10      -7.600   1.057 -27.406  0.00  0.00              
ATOM   3353  C7  NAN D  10      -8.850   1.560 -26.637  0.00  0.00              
ATOM   3354  C8  NAN D  10      -9.854   0.432 -26.295  0.00  0.00              
ATOM   3355  C9  NAN D  10     -11.106   0.926 -25.555  0.00  0.00              
ATOM   3356  OW  NAN D  10      -6.800   0.212 -26.505  0.00  0.00              
ATOM   3357  OM  NAN D  10      -5.397  -1.697 -29.153  0.00  0.00              
ATOM   3358  O1h NAN D  10      -6.714  -2.514 -27.487  0.00  0.00              
ATOM   3359  O4h NAN D  10      -4.558   2.724 -28.944  0.00  0.00              
ATOM   3360  O7h NAN D  10      -8.410   2.177 -25.428  0.00  0.00              
ATOM   3361  O8h NAN D  10     -10.321  -0.182 -27.486  0.00  0.00              
ATOM   3362  O9h NAN D  10     -12.008  -0.160 -25.342  0.00  0.00              
ATOM   3363  H6  NAN D  10      -7.948   0.450 -28.266  0.00  0.00              
ATOM   3364  H3  NAN D  10      -4.294   1.340 -26.753  0.00  0.00              
ATOM   3365  H21 NAN D  10      -3.764   0.288 -28.062  0.00  0.00              
ATOM   3366  H4  NAN D  10      -5.668   1.069 -29.501  0.00  0.00              
ATOM   3367  H7o NAN D  10      -7.661   1.637 -25.153  0.00  0.00              
ATOM   3368  H8o NAN D  10     -11.169  -0.559 -27.224  0.00  0.00              
ATOM   3369  H4o NAN D  10      -3.709   2.329 -29.157  0.00  0.00              
ATOM   3370  H9o NAN D  10     -12.711   0.164 -24.770  0.00  0.00              
ATOM   3371  H9R NAN D  10     -11.604   1.728 -26.135  0.00  0.00              
ATOM   3372  H9S NAN D  10     -10.817   1.380 -24.587  0.00  0.00              
ATOM   3373  H8  NAN D  10      -9.350  -0.332 -25.671  0.00  0.00              
ATOM   3374  H7  NAN D  10      -9.372   2.313 -27.259  0.00  0.00              
ATOM   3375  H1o NAN D  10      -6.860  -3.190 -28.150  0.00  0.00              
ATOM   3376  H5  NAN D  10      -6.446   2.891 -27.137  0.00  0.00              
ATOM   3377  N33 NAN D  10      -7.409   2.946 -28.992  0.00  0.00              
ATOM   3378  C34 NAN D  10      -7.227   4.300 -29.104  0.00  0.00              
ATOM   3379  C35 NAN D  10      -8.029   4.942 -30.220  0.00  0.00              
ATOM   3380  OM  NAN D  10      -6.498   4.955 -28.383  0.00  0.00              
ATOM   3381  H37 NAN D  10      -8.043   2.457 -29.639  0.00  0.00              
ATOM   3382  H35 NAN D  10      -7.835   6.038 -30.270  0.00  0.00              
ATOM   3383  H39 NAN D  10      -9.119   4.792 -30.046  0.00  0.00              
ATOM   3384  H40 NAN D  10      -7.750   4.497 -31.202  0.00  0.00              
ATOM   3385  C1  MAN D  11       5.207 -19.994 -22.379  0.00  0.00              
ATOM   3386  C2  MAN D  11       5.399 -20.633 -23.752  0.00  0.00              
ATOM   3387  C3  MAN D  11       4.148 -21.353 -24.227  0.00  0.00              
ATOM   3388  C4  MAN D  11       3.639 -22.293 -23.157  0.00  0.00              
ATOM   3389  C5  MAN D  11       3.460 -21.535 -21.843  0.00  0.00              
ATOM   3390  C6  MAN D  11       2.974 -22.377 -20.682  0.00  0.00              
ATOM   3391  O3h MAN D  11       4.470 -22.108 -25.401  0.00  0.00              
ATOM   3392  O4h MAN D  11       2.387 -22.852 -23.523  0.00  0.00              
ATOM   3393  OR  MAN D  11       4.740 -21.000 -21.471  0.00  0.00              
ATOM   3394  OW  MAN D  11       1.773 -21.868 -20.126  0.00  0.00              
ATOM   3395  H3o MAN D  11       3.947 -21.568 -26.191  0.00  0.00              
ATOM   3396  H4o MAN D  11       2.542 -23.828 -23.982  0.00  0.00              
ATOM   3397  OW  MAN D  11       6.478 -21.556 -23.677  0.00  0.00              
ATOM   3398  H5  MAN D  11       2.739 -20.775 -21.973  0.00  0.00              
ATOM   3399  H6  MAN D  11       2.876 -23.365 -20.591  0.00  0.00              
ATOM   3400  H20 MAN D  11       3.707 -22.363 -19.928  0.00  0.00              
ATOM   3401  H1  MAN D  11       6.149 -19.562 -22.043  0.00  0.00              
ATOM   3402  H2  MAN D  11       5.645 -19.833 -24.448  0.00  0.00              
ATOM   3403  H3  MAN D  11       3.381 -20.612 -24.454  0.00  0.00              
ATOM   3404  H4  MAN D  11       4.374 -23.091 -23.042  0.00  0.00              
ATOM   3405  C1  NAG D  12       7.785 -21.036 -23.871  0.00  0.00              
ATOM   3406  C2  NAG D  12       8.806 -21.735 -22.917  0.00  0.00              
ATOM   3407  C3  NAG D  12      10.261 -21.347 -23.327  0.00  0.00              
ATOM   3408  C4  NAG D  12      10.520 -21.613 -24.824  0.00  0.00              
ATOM   3409  C5  NAG D  12       9.451 -20.907 -25.702  0.00  0.00              
ATOM   3410  C6  NAG D  12       9.606 -21.228 -27.201  0.00  0.00              
ATOM   3411  C7  NAG D  12       8.546 -22.222 -20.504  0.00  0.00              
ATOM   3412  C8  NAG D  12       8.375 -21.638 -19.117  0.00  0.00              
ATOM   3413  O3h NAG D  12      11.239 -22.078 -22.583  0.00  0.00              
ATOM   3414  OR  NAG D  12      11.831 -21.149 -25.127  0.00  0.00              
ATOM   3415  OR  NAG D  12       8.113 -21.298 -25.263  0.00  0.00              
ATOM   3416  O6h NAG D  12       9.460 -22.626 -27.460  0.00  0.00              
ATOM   3417  OM  NAG D  12       8.712 -23.428 -20.648  0.00  0.00              
ATOM   3418  N15 NAG D  12       8.560 -21.341 -21.501  0.00  0.00              
ATOM   3419  H2  NAG D  12       8.686 -22.829 -23.062  0.00  0.00              
ATOM   3420  H3  NAG D  12      10.412 -20.265 -23.138  0.00  0.00              
ATOM   3421  H4  NAG D  12      10.464 -22.705 -25.010  0.00  0.00              
ATOM   3422  H5  NAG D  12       9.564 -19.811 -25.580  0.00  0.00              
ATOM   3423  H6S NAG D  12       8.858 -20.656 -27.781  0.00  0.00              
ATOM   3424  H6R NAG D  12      10.598 -20.880 -27.548  0.00  0.00              
ATOM   3425  H8  NAG D  12       7.734 -22.299 -18.508  0.00  0.00              
ATOM   3426  H24 NAG D  12       7.920 -20.632 -19.110  0.00  0.00              
ATOM   3427  H25 NAG D  12       9.357 -21.579 -18.618  0.00  0.00              
ATOM   3428  H3o NAG D  12      11.150 -21.800 -21.667  0.00  0.00              
ATOM   3429  H6o NAG D  12       9.813 -22.795 -28.338  0.00  0.00              
ATOM   3430  H29 NAG D  12       8.259 -20.405 -21.227  0.00  0.00              
ATOM   3431  H1  NAG D  12       7.768 -19.941 -23.695  0.00  0.00              
ATOM   3432  C1  GLB D  13      12.705 -22.061 -25.694  0.00  0.00              
ATOM   3433  C2  GLB D  13      13.930 -21.302 -26.190  0.00  0.00              
ATOM   3434  C3  GLB D  13      15.057 -22.238 -26.594  0.00  0.00              
ATOM   3435  C4  GLB D  13      15.336 -23.236 -25.495  0.00  0.00              
ATOM   3436  C5  GLB D  13      14.043 -23.952 -25.102  0.00  0.00              
ATOM   3437  C6  GLB D  13      14.187 -24.965 -23.989  0.00  0.00              
ATOM   3438  O2h GLB D  13      13.546 -20.503 -27.302  0.00  0.00              
ATOM   3439  O3h GLB D  13      16.237 -21.460 -26.834  0.00  0.00              
ATOM   3440  OR  GLB D  13      13.114 -22.953 -24.648  0.00  0.00              
ATOM   3441  OW  GLB D  13      13.362 -26.101 -24.196  0.00  0.00              
ATOM   3442  H2o GLB D  13      13.377 -19.509 -27.083  0.00  0.00              
ATOM   3443  H3o GLB D  13      16.361 -21.529 -27.914  0.00  0.00              
ATOM   3444  O4h GLB D  13      15.897 -22.482 -24.427  0.00  0.00              
ATOM   3445  H4o GLB D  13      16.807 -21.991 -24.768  0.00  0.00              
ATOM   3446  H5  GLB D  13      13.671 -24.483 -25.934  0.00  0.00              
ATOM   3447  H6  GLB D  13      15.001 -25.342 -23.553  0.00  0.00              
ATOM   3448  H20 GLB D  13      13.891 -24.516 -23.085  0.00  0.00              
ATOM   3449  H1  GLB D  13      12.248 -22.600 -26.524  0.00  0.00              
ATOM   3450  H2  GLB D  13      14.266 -20.659 -25.376  0.00  0.00              
ATOM   3451  H3  GLB D  13      14.764 -22.768 -27.501  0.00  0.00              
ATOM   3452  H4  GLB D  13      16.033 -24.019 -25.793  0.00  0.00              
ATOM   3453  C1  NAN D  14      12.382 -25.999 -21.971  0.00  0.00              
ATOM   3454  C2  NAN D  14      13.067 -26.897 -23.062  0.00  0.00              
ATOM   3455  C3  NAN D  14      14.408 -27.559 -22.635  0.00  0.00              
ATOM   3456  C4  NAN D  14      14.184 -28.765 -21.697  0.00  0.00              
ATOM   3457  C5  NAN D  14      13.197 -29.781 -22.312  0.00  0.00              
ATOM   3458  C6  NAN D  14      11.871 -29.083 -22.738  0.00  0.00              
ATOM   3459  C7  NAN D  14      10.894 -30.019 -23.498  0.00  0.00              
ATOM   3460  C8  NAN D  14       9.490 -29.401 -23.704  0.00  0.00              
ATOM   3461  C9  NAN D  14       8.510 -30.331 -24.433  0.00  0.00              
ATOM   3462  OW  NAN D  14      12.180 -27.927 -23.596  0.00  0.00              
ATOM   3463  OM  NAN D  14      12.843 -25.767 -20.853  0.00  0.00              
ATOM   3464  O1h NAN D  14      11.190 -25.483 -22.392  0.00  0.00              
ATOM   3465  O4h NAN D  14      15.432 -29.402 -21.467  0.00  0.00              
ATOM   3466  O7h NAN D  14      11.465 -30.319 -24.770  0.00  0.00              
ATOM   3467  O8h NAN D  14       8.895 -29.113 -22.447  0.00  0.00              
ATOM   3468  O9h NAN D  14       7.225 -29.715 -24.518  0.00  0.00              
ATOM   3469  H6  NAN D  14      11.365 -28.732 -21.817  0.00  0.00              
ATOM   3470  H3  NAN D  14      14.939 -27.907 -23.542  0.00  0.00              
ATOM   3471  H21 NAN D  14      15.073 -26.809 -22.169  0.00  0.00              
ATOM   3472  H4  NAN D  14      13.775 -28.404 -20.728  0.00  0.00              
ATOM   3473  H7o NAN D  14      11.899 -29.499 -25.028  0.00  0.00              
ATOM   3474  H8o NAN D  14       7.952 -29.114 -22.644  0.00  0.00              
ATOM   3475  H4o NAN D  14      16.053 -28.699 -21.253  0.00  0.00              
ATOM   3476  H9o NAN D  14       6.683 -30.271 -25.088  0.00  0.00              
ATOM   3477  H9R NAN D  14       8.435 -31.301 -23.904  0.00  0.00              
ATOM   3478  H9S NAN D  14       8.892 -30.562 -25.447  0.00  0.00              
ATOM   3479  H8  NAN D  14       9.585 -28.459 -24.280  0.00  0.00              
ATOM   3480  H7  NAN D  14      10.780 -30.957 -22.920  0.00  0.00              
ATOM   3481  H1o NAN D  14      10.823 -24.973 -21.669  0.00  0.00              
ATOM   3482  H5  NAN D  14      13.664 -30.240 -23.205  0.00  0.00              
ATOM   3483  N33 NAN D  14      12.946 -30.807 -21.326  0.00  0.00              
ATOM   3484  C34 NAN D  14      13.684 -31.962 -21.336  0.00  0.00              
ATOM   3485  C35 NAN D  14      13.304 -32.948 -20.246  0.00  0.00              
ATOM   3486  OM  NAN D  14      14.566 -32.205 -22.136  0.00  0.00              
ATOM   3487  H37 NAN D  14      12.212 -30.670 -20.615  0.00  0.00              
ATOM   3488  H35 NAN D  14      13.940 -33.860 -20.297  0.00  0.00              
ATOM   3489  H39 NAN D  14      12.242 -33.261 -20.364  0.00  0.00              
ATOM   3490  H40 NAN D  14      13.441 -32.486 -19.242  0.00  0.00              
ATOM   3491  C1  NAG D  15       1.451 -22.277 -18.805  0.00  0.00              
ATOM   3492  C2  NAG D  15       0.306 -21.392 -18.216  0.00  0.00              
ATOM   3493  C3  NAG D  15      -0.212 -22.019 -16.884  0.00  0.00              
ATOM   3494  C4  NAG D  15      -0.595 -23.502 -17.064  0.00  0.00              
ATOM   3495  C5  NAG D  15       0.585 -24.306 -17.675  0.00  0.00              
ATOM   3496  C6  NAG D  15       0.215 -25.772 -17.971  0.00  0.00              
ATOM   3497  C7  NAG D  15       0.082 -18.929 -18.312  0.00  0.00              
ATOM   3498  C8  NAG D  15       0.674 -17.598 -17.901  0.00  0.00              
ATOM   3499  O3h NAG D  15      -1.362 -21.334 -16.382  0.00  0.00              
ATOM   3500  OR  NAG D  15      -0.967 -24.013 -15.788  0.00  0.00              
ATOM   3501  OR  NAG D  15       1.033 -23.665 -18.910  0.00  0.00              
ATOM   3502  O6h NAG D  15      -0.852 -25.868 -18.917  0.00  0.00              
ATOM   3503  OM  NAG D  15      -1.005 -18.970 -18.879  0.00  0.00              
ATOM   3504  N15 NAG D  15       0.786 -20.004 -17.967  0.00  0.00              
ATOM   3505  H2  NAG D  15      -0.526 -21.409 -18.951  0.00  0.00              
ATOM   3506  H3  NAG D  15       0.593 -21.961 -16.123  0.00  0.00              
ATOM   3507  H4  NAG D  15      -1.461 -23.568 -17.753  0.00  0.00              
ATOM   3508  H5  NAG D  15       1.421 -24.311 -16.947  0.00  0.00              
ATOM   3509  H6S NAG D  15       1.105 -26.309 -18.349  0.00  0.00              
ATOM   3510  H6R NAG D  15      -0.070 -26.275 -17.027  0.00  0.00              
ATOM   3511  H8  NAG D  15       0.505 -16.850 -18.694  0.00  0.00              
ATOM   3512  H24 NAG D  15       1.760 -17.635 -17.702  0.00  0.00              
ATOM   3513  H25 NAG D  15       0.168 -17.235 -16.990  0.00  0.00              
ATOM   3514  H3o NAG D  15      -1.071 -20.446 -16.151  0.00  0.00              
ATOM   3515  H6o NAG D  15      -1.202 -26.762 -18.866  0.00  0.00              
ATOM   3516  H29 NAG D  15       1.729 -19.790 -17.641  0.00  0.00              
ATOM   3517  H1  NAG D  15       2.361 -22.212 -18.175  0.00  0.00              
ATOM   3518  C1  GLB D  16      -2.221 -24.589 -15.683  0.00  0.00              
ATOM   3519  C2  GLB D  16      -2.303 -25.310 -14.341  0.00  0.00              
ATOM   3520  C3  GLB D  16      -3.719 -25.756 -14.019  0.00  0.00              
ATOM   3521  C4  GLB D  16      -4.685 -24.604 -14.177  0.00  0.00              
ATOM   3522  C5  GLB D  16      -4.530 -23.983 -15.565  0.00  0.00              
ATOM   3523  C6  GLB D  16      -5.431 -22.799 -15.838  0.00  0.00              
ATOM   3524  O2h GLB D  16      -1.442 -26.440 -14.383  0.00  0.00              
ATOM   3525  OW  GLB D  16      -3.758 -26.219 -12.664  0.00  0.00              
ATOM   3526  OR  GLB D  16      -3.175 -23.519 -15.684  0.00  0.00              
ATOM   3527  O6h GLB D  16      -5.216 -21.745 -14.914  0.00  0.00              
ATOM   3528  H2o GLB D  16      -0.527 -26.303 -13.927  0.00  0.00              
ATOM   3529  H6o GLB D  16      -4.961 -20.704 -15.119  0.00  0.00              
ATOM   3530  O4h GLB D  16      -4.374 -23.697 -13.127  0.00  0.00              
ATOM   3531  H4o GLB D  16      -4.496 -24.198 -12.166  0.00  0.00              
ATOM   3532  H5  GLB D  16      -4.764 -24.702 -16.299  0.00  0.00              
ATOM   3533  H6S GLB D  16      -5.642 -22.325 -16.691  0.00  0.00              
ATOM   3534  H6R GLB D  16      -6.432 -23.108 -15.744  0.00  0.00              
ATOM   3535  H1  GLB D  16      -2.412 -25.297 -16.489  0.00  0.00              
ATOM   3536  H2  GLB D  16      -1.958 -24.613 -13.577  0.00  0.00              
ATOM   3537  H3  GLB D  16      -3.998 -26.560 -14.699  0.00  0.00              
ATOM   3538  H4  GLB D  16      -5.730 -24.907 -14.099  0.00  0.00              
ATOM   3539  C1  NAN D  17      -3.515 -28.549 -13.320  0.00  0.00              
ATOM   3540  C2  NAN D  17      -4.296 -27.509 -12.440  0.00  0.00              
ATOM   3541  C3  NAN D  17      -5.819 -27.401 -12.730  0.00  0.00              
ATOM   3542  C4  NAN D  17      -6.607 -28.589 -12.134  0.00  0.00              
ATOM   3543  C5  NAN D  17      -6.307 -28.765 -10.630  0.00  0.00              
ATOM   3544  C6  NAN D  17      -4.774 -28.857 -10.373  0.00  0.00              
ATOM   3545  C7  NAN D  17      -4.398 -28.886  -8.869  0.00  0.00              
ATOM   3546  C8  NAN D  17      -2.908 -29.222  -8.616  0.00  0.00              
ATOM   3547  C9  NAN D  17      -2.533 -29.277  -7.129  0.00  0.00              
ATOM   3548  OW  NAN D  17      -4.102 -27.711 -11.006  0.00  0.00              
ATOM   3549  OM  NAN D  17      -4.010 -29.231 -14.217  0.00  0.00              
ATOM   3550  O1h NAN D  17      -2.193 -28.627 -12.987  0.00  0.00              
ATOM   3551  O4h NAN D  17      -7.996 -28.351 -12.313  0.00  0.00              
ATOM   3552  O7h NAN D  17      -4.690 -27.605  -8.313  0.00  0.00              
ATOM   3553  O8h NAN D  17      -2.601 -30.504  -9.144  0.00  0.00              
ATOM   3554  O9h NAN D  17      -1.166 -29.662  -6.984  0.00  0.00              
ATOM   3555  H6  NAN D  17      -4.412 -29.797 -10.836  0.00  0.00              
ATOM   3556  H3  NAN D  17      -6.202 -26.462 -12.288  0.00  0.00              
ATOM   3557  H21 NAN D  17      -5.996 -27.312 -13.818  0.00  0.00              
ATOM   3558  H4  NAN D  17      -6.326 -29.520 -12.670  0.00  0.00              
ATOM   3559  H7o NAN D  17      -4.465 -26.990  -9.018  0.00  0.00              
ATOM   3560  H8o NAN D  17      -1.834 -30.777  -8.630  0.00  0.00              
ATOM   3561  H4o NAN D  17      -8.102 -28.078 -13.228  0.00  0.00              
ATOM   3562  H9o NAN D  17      -0.941 -29.559  -6.053  0.00  0.00              
ATOM   3563  H9R NAN D  17      -3.189 -29.992  -6.593  0.00  0.00              
ATOM   3564  H9S NAN D  17      -2.705 -28.289  -6.659  0.00  0.00              
ATOM   3565  H8  NAN D  17      -2.271 -28.466  -9.118  0.00  0.00              
ATOM   3566  H7  NAN D  17      -5.018 -29.652  -8.362  0.00  0.00              
ATOM   3567  H1o NAN D  17      -1.791 -29.294 -13.543  0.00  0.00              
ATOM   3568  H5  NAN D  17      -6.712 -27.892 -10.079  0.00  0.00              
ATOM   3569  N33 NAN D  17      -6.979 -29.963 -10.182  0.00  0.00              
ATOM   3570  C34 NAN D  17      -8.229 -29.881  -9.623  0.00  0.00              
ATOM   3571  C35 NAN D  17      -8.804 -31.218  -9.195  0.00  0.00              
ATOM   3572  OM  NAN D  17      -8.842 -28.842  -9.467  0.00  0.00              
ATOM   3573  H37 NAN D  17      -6.519 -30.879 -10.282  0.00  0.00              
ATOM   3574  H35 NAN D  17      -9.820 -31.092  -8.758  0.00  0.00              
ATOM   3575  H39 NAN D  17      -8.152 -31.688  -8.423  0.00  0.00              
ATOM   3576  H40 NAN D  17      -8.886 -31.903 -10.070  0.00  0.00              
ATOM   3577  C1  AFL D  18      12.248 -12.919 -15.382  0.00  0.00              
ATOM   3578  C2  AFL D  18      13.527 -13.651 -15.831  0.00  0.00              
ATOM   3579  C3  AFL D  18      13.284 -14.408 -17.144  0.00  0.00              
ATOM   3580  C4  AFL D  18      12.701 -13.442 -18.190  0.00  0.00              
ATOM   3581  C5  AFL D  18      11.450 -12.756 -17.621  0.00  0.00              
ATOM   3582  C6  AFL D  18      10.819 -11.736 -18.577  0.00  0.00              
ATOM   3583  OR  AFL D  18      11.747 -12.056 -16.406  0.00  0.00              
ATOM   3584  O2h AFL D  18      13.963 -14.476 -14.754  0.00  0.00              
ATOM   3585  O3h AFL D  18      14.495 -15.029 -17.562  0.00  0.00              
ATOM   3586  O4h AFL D  18      13.637 -12.429 -18.556  0.00  0.00              
ATOM   3587  H5  AFL D  18      10.688 -13.535 -17.427  0.00  0.00              
ATOM   3588  H1  AFL D  18      12.479 -12.262 -14.534  0.00  0.00              
ATOM   3589  H2  AFL D  18      14.302 -12.881 -16.019  0.00  0.00              
ATOM   3590  H2o AFL D  18      14.835 -14.809 -15.003  0.00  0.00              
ATOM   3591  H3  AFL D  18      12.537 -15.201 -16.945  0.00  0.00              
ATOM   3592  H3o AFL D  18      14.258 -15.646 -18.267  0.00  0.00              
ATOM   3593  H4  AFL D  18      12.416 -14.000 -19.103  0.00  0.00              
ATOM   3594  H4o AFL D  18      14.367 -12.880 -19.003  0.00  0.00              
ATOM   3595  H6  AFL D  18      10.571 -12.184 -19.552  0.00  0.00              
ATOM   3596  H22 AFL D  18       9.892 -11.333 -18.140  0.00  0.00              
ATOM   3597  H23 AFL D  18      11.502 -10.890 -18.752  0.00  0.00              
TER
CONECT 1523 1524 1548 1533  110
CONECT 1524 1523 1525 1537 1536
CONECT 1525 1524 1526 1538 1531
CONECT 1526 1525 1527 1539 1532
CONECT 1527 1526 1528 1540 1533
CONECT 1528 1527 1541 1542 1534
CONECT 1529 1530 1536 1535
CONECT 1530 1529 1543 1544 1545
CONECT 1531 1525 1546
CONECT 1532 1526 1549
CONECT 1533 1523 1527
CONECT 1534 1528 2028
CONECT 1535 1529
CONECT 1536 1524 1529 1547
CONECT 1537 1524
CONECT 1538 1525
CONECT 1539 1526
CONECT 1540 1527
CONECT 1541 1528
CONECT 1542 1528
CONECT 1543 1530
CONECT 1544 1530
CONECT 1545 1530
CONECT 1546 1531
CONECT 1547 1536
CONECT 1548 1523
CONECT 1549 1532 1550 1575 1559
CONECT 1550 1549 1551 1563 1562
CONECT 1551 1550 1552 1564 1557
CONECT 1552 1551 1553 1565 1558
CONECT 1553 1552 1554 1566 1559
CONECT 1554 1553 1567 1568 1560
CONECT 1555 1556 1562 1561
CONECT 1556 1555 1569 1570 1571
CONECT 1557 1551 1572
CONECT 1558 1552 1576
CONECT 1559 1549 1553
CONECT 1560 1554 1573
CONECT 1561 1555
CONECT 1562 1550 1555 1574
CONECT 1563 1550
CONECT 1564 1551
CONECT 1565 1552
CONECT 1566 1553
CONECT 1567 1554
CONECT 1568 1554
CONECT 1569 1556
CONECT 1570 1556
CONECT 1571 1556
CONECT 1572 1557
CONECT 1573 1560
CONECT 1574 1562
CONECT 1575 1549
CONECT 1576 1558 1577 1584 1594
CONECT 1577 1576 1578 1587 1592
CONECT 1578 1577 1579 1582 1593
CONECT 1579 1578 1583 1580 1595
CONECT 1580 1579 1584 1581 1589
CONECT 1581 1580 1590 1591 1585
CONECT 1582 1578 1596
CONECT 1583 1579 1586
CONECT 1584 1576 1580
CONECT 1585 1581 1788
CONECT 1586 1583
CONECT 1587 1577 1588
CONECT 1588 1587
CONECT 1589 1580
CONECT 1590 1581
CONECT 1591 1581
CONECT 1592 1577
CONECT 1593 1578
CONECT 1594 1576
CONECT 1595 1579
CONECT 1596 1582 1597 1604 1612
CONECT 1597 1596 1598 1608 1613
CONECT 1598 1597 1599 1602 1614
CONECT 1599 1598 1603 1600 1615
CONECT 1600 1599 1604 1601 1609
CONECT 1601 1600 1610 1611 1605
CONECT 1602 1598 1606
CONECT 1603 1599 1702
CONECT 1604 1596 1600
CONECT 1605 1601 1607
CONECT 1606 1602
CONECT 1607 1605
CONECT 1608 1597 1616
CONECT 1609 1600
CONECT 1610 1601
CONECT 1611 1601
CONECT 1612 1596
CONECT 1613 1597
CONECT 1614 1598
CONECT 1615 1599
CONECT 1616 1608 1617 1642 1626
CONECT 1617 1616 1618 1630 1629
CONECT 1618 1617 1619 1631 1624
CONECT 1619 1618 1620 1632 1625
CONECT 1620 1619 1621 1633 1626
CONECT 1621 1620 1634 1635 1627
CONECT 1622 1623 1629 1628
CONECT 1623 1622 1636 1637 1638
CONECT 1624 1618 1639
CONECT 1625 1619 1643
CONECT 1626 1616 1620
CONECT 1627 1621 1640
CONECT 1628 1622
CONECT 1629 1617 1622 1641
CONECT 1630 1617
CONECT 1631 1618
CONECT 1632 1619
CONECT 1633 1620
CONECT 1634 1621
CONECT 1635 1621
CONECT 1636 1623
CONECT 1637 1623
CONECT 1638 1623
CONECT 1639 1624
CONECT 1640 1627
CONECT 1641 1629
CONECT 1642 1616
CONECT 1643 1625 1644 1651 1660
CONECT 1644 1643 1645 1649 1661
CONECT 1645 1644 1646 1650 1662
CONECT 1646 1645 1655 1647 1663
CONECT 1647 1646 1651 1648 1657
CONECT 1648 1647 1658 1659 1652
CONECT 1649 1644 1653
CONECT 1650 1645 1665
CONECT 1651 1643 1647
CONECT 1652 1648 1654
CONECT 1653 1649
CONECT 1654 1652
CONECT 1655 1646 1656
CONECT 1656 1655
CONECT 1657 1647
CONECT 1658 1648
CONECT 1659 1648
CONECT 1660 1643
CONECT 1661 1644
CONECT 1662 1645
CONECT 1663 1646
CONECT 1664 1665 1674 1675
CONECT 1665 1650 1664 1666 1673
CONECT 1666 1665 1667 1681 1682
CONECT 1667 1666 1668 1676 1683
CONECT 1668 1667 1669 1693 1694
CONECT 1669 1668 1670 1673 1680
CONECT 1670 1669 1671 1677 1691
CONECT 1671 1670 1672 1678 1690
CONECT 1672 1671 1679 1688 1689
CONECT 1673 1665 1669
CONECT 1674 1664
CONECT 1675 1664 1692
CONECT 1676 1667 1686
CONECT 1677 1670 1684
CONECT 1678 1671 1685
CONECT 1679 1672 1687
CONECT 1680 1669
CONECT 1681 1666
CONECT 1682 1666
CONECT 1683 1667
CONECT 1684 1677
CONECT 1685 1678
CONECT 1686 1676
CONECT 1687 1679
CONECT 1688 1672
CONECT 1689 1672
CONECT 1690 1671
CONECT 1691 1670
CONECT 1692 1675
CONECT 1693 1668
CONECT 1694 1668 1695 1698
CONECT 1695 1694 1696 1697
CONECT 1696 1695 1699 1700 1701
CONECT 1697 1695
CONECT 1698 1694
CONECT 1699 1696
CONECT 1700 1696
CONECT 1701 1696
CONECT 1702 1603 1703 1728 1712
CONECT 1703 1702 1704 1716 1715
CONECT 1704 1703 1705 1717 1710
CONECT 1705 1704 1706 1718 1711
CONECT 1706 1705 1707 1719 1712
CONECT 1707 1706 1720 1721 1713
CONECT 1708 1709 1715 1714
CONECT 1709 1708 1722 1723 1724
CONECT 1710 1704 1725
CONECT 1711 1705 1729
CONECT 1712 1702 1706
CONECT 1713 1707 1726
CONECT 1714 1708
CONECT 1715 1703 1708 1727
CONECT 1716 1703
CONECT 1717 1704
CONECT 1718 1705
CONECT 1719 1706
CONECT 1720 1707
CONECT 1721 1707
CONECT 1722 1709
CONECT 1723 1709
CONECT 1724 1709
CONECT 1725 1710
CONECT 1726 1713
CONECT 1727 1715
CONECT 1728 1702
CONECT 1729 1711 1730 1737 1746
CONECT 1730 1729 1731 1735 1747
CONECT 1731 1730 1732 1736 1748
CONECT 1732 1731 1741 1733 1749
CONECT 1733 1732 1737 1734 1743
CONECT 1734 1733 1744 1745 1738
CONECT 1735 1730 1739
CONECT 1736 1731 1751
CONECT 1737 1729 1733
CONECT 1738 1734 1740
CONECT 1739 1735
CONECT 1740 1738
CONECT 1741 1732 1742
CONECT 1742 1741
CONECT 1743 1733
CONECT 1744 1734
CONECT 1745 1734
CONECT 1746 1729
CONECT 1747 1730
CONECT 1748 1731
CONECT 1749 1732
CONECT 1750 1751 1760 1761
CONECT 1751 1736 1750 1752 1759
CONECT 1752 1751 1753 1767 1768
CONECT 1753 1752 1754 1762 1769
CONECT 1754 1753 1755 1779 1780
CONECT 1755 1754 1756 1759 1766
CONECT 1756 1755 1757 1763 1777
CONECT 1757 1756 1758 1764 1776
CONECT 1758 1757 1765 1774 1775
CONECT 1759 1751 1755
CONECT 1760 1750
CONECT 1761 1750 1778
CONECT 1762 1753 1772
CONECT 1763 1756 1770
CONECT 1764 1757 1771
CONECT 1765 1758 1773
CONECT 1766 1755
CONECT 1767 1752
CONECT 1768 1752
CONECT 1769 1753
CONECT 1770 1763
CONECT 1771 1764
CONECT 1772 1762
CONECT 1773 1765
CONECT 1774 1758
CONECT 1775 1758
CONECT 1776 1757
CONECT 1777 1756
CONECT 1778 1761
CONECT 1779 1754
CONECT 1780 1754 1781 1784
CONECT 1781 1780 1782 1783
CONECT 1782 1781 1785 1786 1787
CONECT 1783 1781
CONECT 1784 1780
CONECT 1785 1782
CONECT 1786 1782
CONECT 1787 1782
CONECT 1788 1585 1789 1796 1804
CONECT 1789 1788 1790 1800 1805
CONECT 1790 1789 1791 1794 1806
CONECT 1791 1790 1795 1792 1807
CONECT 1792 1791 1796 1793 1801
CONECT 1793 1792 1802 1803 1797
CONECT 1794 1790 1798
CONECT 1795 1791 1799
CONECT 1796 1788 1792
CONECT 1797 1793 1894
CONECT 1798 1794
CONECT 1799 1795
CONECT 1800 1789 1808
CONECT 1801 1792
CONECT 1802 1793
CONECT 1803 1793
CONECT 1804 1788
CONECT 1805 1789
CONECT 1806 1790
CONECT 1807 1791
CONECT 1808 1800 1809 1834 1818
CONECT 1809 1808 1810 1822 1821
CONECT 1810 1809 1811 1823 1816
CONECT 1811 1810 1812 1824 1817
CONECT 1812 1811 1813 1825 1818
CONECT 1813 1812 1826 1827 1819
CONECT 1814 1815 1821 1820
CONECT 1815 1814 1828 1829 1830
CONECT 1816 1810 1831
CONECT 1817 1811 1835
CONECT 1818 1808 1812
CONECT 1819 1813 1832
CONECT 1820 1814
CONECT 1821 1809 1814 1833
CONECT 1822 1809
CONECT 1823 1810
CONECT 1824 1811
CONECT 1825 1812
CONECT 1826 1813
CONECT 1827 1813
CONECT 1828 1815
CONECT 1829 1815
CONECT 1830 1815
CONECT 1831 1816
CONECT 1832 1819
CONECT 1833 1821
CONECT 1834 1808
CONECT 1835 1817 1836 1843 1852
CONECT 1836 1835 1837 1841 1853
CONECT 1837 1836 1838 1842 1854
CONECT 1838 1837 1847 1839 1855
CONECT 1839 1838 1843 1840 1849
CONECT 1840 1839 1850 1851 1844
CONECT 1841 1836 1845
CONECT 1842 1837 1857
CONECT 1843 1835 1839
CONECT 1844 1840 1846
CONECT 1845 1841
CONECT 1846 1844
CONECT 1847 1838 1848
CONECT 1848 1847
CONECT 1849 1839
CONECT 1850 1840
CONECT 1851 1840
CONECT 1852 1835
CONECT 1853 1836
CONECT 1854 1837
CONECT 1855 1838
CONECT 1856 1857 1866 1867
CONECT 1857 1842 1856 1858 1865
CONECT 1858 1857 1859 1873 1874
CONECT 1859 1858 1860 1868 1875
CONECT 1860 1859 1861 1885 1886
CONECT 1861 1860 1862 1865 1872
CONECT 1862 1861 1863 1869 1883
CONECT 1863 1862 1864 1870 1882
CONECT 1864 1863 1871 1880 1881
CONECT 1865 1857 1861
CONECT 1866 1856
CONECT 1867 1856 1884
CONECT 1868 1859 1878
CONECT 1869 1862 1876
CONECT 1870 1863 1877
CONECT 1871 1864 1879
CONECT 1872 1861
CONECT 1873 1858
CONECT 1874 1858
CONECT 1875 1859
CONECT 1876 1869
CONECT 1877 1870
CONECT 1878 1868
CONECT 1879 1871
CONECT 1880 1864
CONECT 1881 1864
CONECT 1882 1863
CONECT 1883 1862
CONECT 1884 1867
CONECT 1885 1860
CONECT 1886 1860 1887 1890
CONECT 1887 1886 1888 1889
CONECT 1888 1887 1891 1892 1893
CONECT 1889 1887
CONECT 1890 1886
CONECT 1891 1888
CONECT 1892 1888
CONECT 1893 1888
CONECT 1894 1797 1895 1920 1904
CONECT 1895 1894 1896 1908 1907
CONECT 1896 1895 1897 1909 1902
CONECT 1897 1896 1898 1910 1903
CONECT 1898 1897 1899 1911 1904
CONECT 1899 1898 1912 1913 1905
CONECT 1900 1901 1907 1906
CONECT 1901 1900 1914 1915 1916
CONECT 1902 1896 1917
CONECT 1903 1897 1921
CONECT 1904 1894 1898
CONECT 1905 1899 1918
CONECT 1906 1900
CONECT 1907 1895 1900 1919
CONECT 1908 1895
CONECT 1909 1896
CONECT 1910 1897
CONECT 1911 1898
CONECT 1912 1899
CONECT 1913 1899
CONECT 1914 1901
CONECT 1915 1901
CONECT 1916 1901
CONECT 1917 1902
CONECT 1918 1905
CONECT 1919 1907
CONECT 1920 1894
CONECT 1921 1903 1922 1929 1938
CONECT 1922 1921 1923 1927 1939
CONECT 1923 1922 1924 1928 1940
CONECT 1924 1923 1933 1925 1941
CONECT 1925 1924 1929 1926 1935
CONECT 1926 1925 1936 1937 1930
CONECT 1927 1922 1931
CONECT 1928 1923 1942
CONECT 1929 1921 1925
CONECT 1930 1926 1932
CONECT 1931 1927
CONECT 1932 1930
CONECT 1933 1924 1934
CONECT 1934 1933
CONECT 1935 1925
CONECT 1936 1926
CONECT 1937 1926
CONECT 1938 1921
CONECT 1939 1922
CONECT 1940 1923
CONECT 1941 1924
CONECT 1942 1928 1943 1968 1952
CONECT 1943 1942 1944 1956 1955
CONECT 1944 1943 1945 1957 1950
CONECT 1945 1944 1946 1958 1951
CONECT 1946 1945 1947 1959 1952
CONECT 1947 1946 1960 1961 1953
CONECT 1948 1949 1955 1954
CONECT 1949 1948 1962 1963 1964
CONECT 1950 1944 1965
CONECT 1951 1945 1969
CONECT 1952 1942 1946
CONECT 1953 1947 1966
CONECT 1954 1948
CONECT 1955 1943 1948 1967
CONECT 1956 1943
CONECT 1957 1944
CONECT 1958 1945
CONECT 1959 1946
CONECT 1960 1947
CONECT 1961 1947
CONECT 1962 1949
CONECT 1963 1949
CONECT 1964 1949
CONECT 1965 1950
CONECT 1966 1953
CONECT 1967 1955
CONECT 1968 1942
CONECT 1969 1951 1970 1977 1986
CONECT 1970 1969 1971 1975 1987
CONECT 1971 1970 1972 1976 1988
CONECT 1972 1971 1981 1973 1989
CONECT 1973 1972 1977 1974 1983
CONECT 1974 1973 1984 1985 1978
CONECT 1975 1970 1979
CONECT 1976 1971 1991
CONECT 1977 1969 1973
CONECT 1978 1974 1980
CONECT 1979 1975
CONECT 1980 1978
CONECT 1981 1972 1982
CONECT 1982 1981
CONECT 1983 1973
CONECT 1984 1974
CONECT 1985 1974
CONECT 1986 1969
CONECT 1987 1970
CONECT 1988 1971
CONECT 1989 1972
CONECT 1990 1991 2000 2001
CONECT 1991 1976 1990 1992 1999
CONECT 1992 1991 1993 2007 2008
CONECT 1993 1992 1994 2002 2009
CONECT 1994 1993 1995 2019 2020
CONECT 1995 1994 1996 1999 2006
CONECT 1996 1995 1997 2003 2017
CONECT 1997 1996 1998 2004 2016
CONECT 1998 1997 2005 2014 2015
CONECT 1999 1991 1995
CONECT 2000 1990
CONECT 2001 1990 2018
CONECT 2002 1993 2012
CONECT 2003 1996 2010
CONECT 2004 1997 2011
CONECT 2005 1998 2013
CONECT 2006 1995
CONECT 2007 1992
CONECT 2008 1992
CONECT 2009 1993
CONECT 2010 2003
CONECT 2011 2004
CONECT 2012 2002
CONECT 2013 2005
CONECT 2014 1998
CONECT 2015 1998
CONECT 2016 1997
CONECT 2017 1996
CONECT 2018 2001
CONECT 2019 1994
CONECT 2020 1994 2021 2024
CONECT 2021 2020 2022 2023
CONECT 2022 2021 2025 2026 2027
CONECT 2023 2021
CONECT 2024 2020
CONECT 2025 2022
CONECT 2026 2022
CONECT 2027 2022
CONECT 2028 1534 2029 2034 2039
CONECT 2029 2028 2030 2035 2040
CONECT 2030 2029 2031 2036 2042
CONECT 2031 2030 2032 2037 2044
CONECT 2032 2031 2033 2034 2038
CONECT 2033 2032 2046 2047 2048
CONECT 2034 2028 2032
CONECT 2035 2029 2041
CONECT 2036 2030 2043
CONECT 2037 2031 2045
CONECT 2038 2032
CONECT 2039 2028
CONECT 2040 2029
CONECT 2041 2035
CONECT 2042 2030
CONECT 2043 2036
CONECT 2044 2031
CONECT 2045 2037
CONECT 2046 2033
CONECT 2047 2033
CONECT 2048 2033
CONECT 2049 2050 2075 2059  304
CONECT 2050 2049 2051 2063 2062
CONECT 2051 2050 2052 2064 2057
CONECT 2052 2051 2053 2065 2058
CONECT 2053 2052 2054 2066 2059
CONECT 2054 2053 2067 2068 2060
CONECT 2055 2056 2062 2061
CONECT 2056 2055 2069 2070 2071
CONECT 2057 2051 2072
CONECT 2058 2052 2076
CONECT 2059 2049 2053
CONECT 2060 2054 2073
CONECT 2061 2055
CONECT 2062 2050 2055 2074
CONECT 2063 2050
CONECT 2064 2051
CONECT 2065 2052
CONECT 2066 2053
CONECT 2067 2054
CONECT 2068 2054
CONECT 2069 2056
CONECT 2070 2056
CONECT 2071 2056
CONECT 2072 2057
CONECT 2073 2060
CONECT 2074 2062
CONECT 2075 2049
CONECT 2076 2058 2077 2102 2086
CONECT 2077 2076 2078 2090 2089
CONECT 2078 2077 2079 2091 2084
CONECT 2079 2078 2080 2092 2085
CONECT 2080 2079 2081 2093 2086
CONECT 2081 2080 2094 2095 2087
CONECT 2082 2083 2089 2088
CONECT 2083 2082 2096 2097 2098
CONECT 2084 2078 2099
CONECT 2085 2079 2103
CONECT 2086 2076 2080
CONECT 2087 2081 2100
CONECT 2088 2082
CONECT 2089 2077 2082 2101
CONECT 2090 2077
CONECT 2091 2078
CONECT 2092 2079
CONECT 2093 2080
CONECT 2094 2081
CONECT 2095 2081
CONECT 2096 2083
CONECT 2097 2083
CONECT 2098 2083
CONECT 2099 2084
CONECT 2100 2087
CONECT 2101 2089
CONECT 2102 2076
CONECT 2103 2085 2104 2111 2121
CONECT 2104 2103 2105 2114 2119
CONECT 2105 2104 2106 2109 2120
CONECT 2106 2105 2110 2107 2122
CONECT 2107 2106 2111 2108 2116
CONECT 2108 2107 2117 2118 2112
CONECT 2109 2105 2123
CONECT 2110 2106 2113
CONECT 2111 2103 2107
CONECT 2112 2108 2230
CONECT 2113 2110
CONECT 2114 2104 2115
CONECT 2115 2114
CONECT 2116 2107
CONECT 2117 2108
CONECT 2118 2108
CONECT 2119 2104
CONECT 2120 2105
CONECT 2121 2103
CONECT 2122 2106
CONECT 2123 2109 2124 2131 2140
CONECT 2124 2123 2125 2136 2141
CONECT 2125 2124 2126 2129 2142
CONECT 2126 2125 2130 2127 2143
CONECT 2127 2126 2131 2128 2137
CONECT 2128 2127 2138 2139 2132
CONECT 2129 2125 2133
CONECT 2130 2126 2134
CONECT 2131 2123 2127
CONECT 2132 2128 2135
CONECT 2133 2129
CONECT 2134 2130
CONECT 2135 2132
CONECT 2136 2124 2144
CONECT 2137 2127
CONECT 2138 2128
CONECT 2139 2128
CONECT 2140 2123
CONECT 2141 2124
CONECT 2142 2125
CONECT 2143 2126
CONECT 2144 2136 2145 2170 2154
CONECT 2145 2144 2146 2158 2157
CONECT 2146 2145 2147 2159 2152
CONECT 2147 2146 2148 2160 2153
CONECT 2148 2147 2149 2161 2154
CONECT 2149 2148 2162 2163 2155
CONECT 2150 2151 2157 2156
CONECT 2151 2150 2164 2165 2166
CONECT 2152 2146 2167
CONECT 2153 2147 2171
CONECT 2154 2144 2148
CONECT 2155 2149 2168
CONECT 2156 2150
CONECT 2157 2145 2150 2169
CONECT 2158 2145
CONECT 2159 2146
CONECT 2160 2147
CONECT 2161 2148
CONECT 2162 2149
CONECT 2163 2149
CONECT 2164 2151
CONECT 2165 2151
CONECT 2166 2151
CONECT 2167 2152
CONECT 2168 2155
CONECT 2169 2157
CONECT 2170 2144
CONECT 2171 2153 2172 2179 2188
CONECT 2172 2171 2173 2177 2189
CONECT 2173 2172 2174 2178 2190
CONECT 2174 2173 2183 2175 2191
CONECT 2175 2174 2179 2176 2185
CONECT 2176 2175 2186 2187 2180
CONECT 2177 2172 2181
CONECT 2178 2173 2182
CONECT 2179 2171 2175
CONECT 2180 2176 2193
CONECT 2181 2177
CONECT 2182 2178
CONECT 2183 2174 2184
CONECT 2184 2183
CONECT 2185 2175
CONECT 2186 2176
CONECT 2187 2176
CONECT 2188 2171
CONECT 2189 2172
CONECT 2190 2173
CONECT 2191 2174
CONECT 2192 2193 2202 2203
CONECT 2193 2180 2192 2194 2201
CONECT 2194 2193 2195 2209 2210
CONECT 2195 2194 2196 2204 2211
CONECT 2196 2195 2197 2221 2222
CONECT 2197 2196 2198 2201 2208
CONECT 2198 2197 2199 2205 2219
CONECT 2199 2198 2200 2206 2218
CONECT 2200 2199 2207 2216 2217
CONECT 2201 2193 2197
CONECT 2202 2192
CONECT 2203 2192 2220
CONECT 2204 2195 2214
CONECT 2205 2198 2212
CONECT 2206 2199 2213
CONECT 2207 2200 2215
CONECT 2208 2197
CONECT 2209 2194
CONECT 2210 2194
CONECT 2211 2195
CONECT 2212 2205
CONECT 2213 2206
CONECT 2214 2204
CONECT 2215 2207
CONECT 2216 2200
CONECT 2217 2200
CONECT 2218 2199
CONECT 2219 2198
CONECT 2220 2203
CONECT 2221 2196
CONECT 2222 2196 2223 2226
CONECT 2223 2222 2224 2225
CONECT 2224 2223 2227 2228 2229
CONECT 2225 2223
CONECT 2226 2222
CONECT 2227 2224
CONECT 2228 2224
CONECT 2229 2224
CONECT 2230 2112 2231 2238 2246
CONECT 2231 2230 2232 2242 2247
CONECT 2232 2231 2233 2236 2248
CONECT 2233 2232 2237 2234 2249
CONECT 2234 2233 2238 2235 2243
CONECT 2235 2234 2244 2245 2239
CONECT 2236 2232 2240
CONECT 2237 2233 2241
CONECT 2238 2230 2234
CONECT 2239 2235 2336
CONECT 2240 2236
CONECT 2241 2237
CONECT 2242 2231 2250
CONECT 2243 2234
CONECT 2244 2235
CONECT 2245 2235
CONECT 2246 2230
CONECT 2247 2231
CONECT 2248 2232
CONECT 2249 2233
CONECT 2250 2242 2251 2276 2260
CONECT 2251 2250 2252 2264 2263
CONECT 2252 2251 2253 2265 2258
CONECT 2253 2252 2254 2266 2259
CONECT 2254 2253 2255 2267 2260
CONECT 2255 2254 2268 2269 2261
CONECT 2256 2257 2263 2262
CONECT 2257 2256 2270 2271 2272
CONECT 2258 2252 2273
CONECT 2259 2253 2277
CONECT 2260 2250 2254
CONECT 2261 2255 2274
CONECT 2262 2256
CONECT 2263 2251 2256 2275
CONECT 2264 2251
CONECT 2265 2252
CONECT 2266 2253
CONECT 2267 2254
CONECT 2268 2255
CONECT 2269 2255
CONECT 2270 2257
CONECT 2271 2257
CONECT 2272 2257
CONECT 2273 2258
CONECT 2274 2261
CONECT 2275 2263
CONECT 2276 2250
CONECT 2277 2259 2278 2285 2294
CONECT 2278 2277 2279 2283 2295
CONECT 2279 2278 2280 2284 2296
CONECT 2280 2279 2289 2281 2297
CONECT 2281 2280 2285 2282 2291
CONECT 2282 2281 2292 2293 2286
CONECT 2283 2278 2287
CONECT 2284 2279 2299
CONECT 2285 2277 2281
CONECT 2286 2282 2288
CONECT 2287 2283
CONECT 2288 2286
CONECT 2289 2280 2290
CONECT 2290 2289
CONECT 2291 2281
CONECT 2292 2282
CONECT 2293 2282
CONECT 2294 2277
CONECT 2295 2278
CONECT 2296 2279
CONECT 2297 2280
CONECT 2298 2299 2308 2309
CONECT 2299 2284 2298 2300 2307
CONECT 2300 2299 2301 2315 2316
CONECT 2301 2300 2302 2310 2317
CONECT 2302 2301 2303 2327 2328
CONECT 2303 2302 2304 2307 2314
CONECT 2304 2303 2305 2311 2325
CONECT 2305 2304 2306 2312 2324
CONECT 2306 2305 2313 2322 2323
CONECT 2307 2299 2303
CONECT 2308 2298
CONECT 2309 2298 2326
CONECT 2310 2301 2320
CONECT 2311 2304 2318
CONECT 2312 2305 2319
CONECT 2313 2306 2321
CONECT 2314 2303
CONECT 2315 2300
CONECT 2316 2300
CONECT 2317 2301
CONECT 2318 2311
CONECT 2319 2312
CONECT 2320 2310
CONECT 2321 2313
CONECT 2322 2306
CONECT 2323 2306
CONECT 2324 2305
CONECT 2325 2304
CONECT 2326 2309
CONECT 2327 2302
CONECT 2328 2302 2329 2332
CONECT 2329 2328 2330 2331
CONECT 2330 2329 2333 2334 2335
CONECT 2331 2329
CONECT 2332 2328
CONECT 2333 2330
CONECT 2334 2330
CONECT 2335 2330
CONECT 2336 2239 2337 2362 2346
CONECT 2337 2336 2338 2350 2349
CONECT 2338 2337 2339 2351 2344
CONECT 2339 2338 2340 2352 2345
CONECT 2340 2339 2341 2353 2346
CONECT 2341 2340 2354 2355 2347
CONECT 2342 2343 2349 2348
CONECT 2343 2342 2356 2357 2358
CONECT 2344 2338 2359
CONECT 2345 2339 2363
CONECT 2346 2336 2340
CONECT 2347 2341 2360
CONECT 2348 2342
CONECT 2349 2337 2342 2361
CONECT 2350 2337
CONECT 2351 2338
CONECT 2352 2339
CONECT 2353 2340
CONECT 2354 2341
CONECT 2355 2341
CONECT 2356 2343
CONECT 2357 2343
CONECT 2358 2343
CONECT 2359 2344
CONECT 2360 2347
CONECT 2361 2349
CONECT 2362 2336
CONECT 2363 2345 2364 2371 2380
CONECT 2364 2363 2365 2369 2381
CONECT 2365 2364 2366 2370 2382
CONECT 2366 2365 2375 2367 2383
CONECT 2367 2366 2371 2368 2377
CONECT 2368 2367 2378 2379 2372
CONECT 2369 2364 2373
CONECT 2370 2365 2374
CONECT 2371 2363 2367
CONECT 2372 2368 2385
CONECT 2373 2369
CONECT 2374 2370
CONECT 2375 2366 2376
CONECT 2376 2375
CONECT 2377 2367
CONECT 2378 2368
CONECT 2379 2368
CONECT 2380 2363
CONECT 2381 2364
CONECT 2382 2365
CONECT 2383 2366
CONECT 2384 2385 2394 2395
CONECT 2385 2372 2384 2386 2393
CONECT 2386 2385 2387 2401 2402
CONECT 2387 2386 2388 2396 2403
CONECT 2388 2387 2389 2413 2414
CONECT 2389 2388 2390 2393 2400
CONECT 2390 2389 2391 2397 2411
CONECT 2391 2390 2392 2398 2410
CONECT 2392 2391 2399 2408 2409
CONECT 2393 2385 2389
CONECT 2394 2384
CONECT 2395 2384 2412
CONECT 2396 2387 2406
CONECT 2397 2390 2404
CONECT 2398 2391 2405
CONECT 2399 2392 2407
CONECT 2400 2389
CONECT 2401 2386
CONECT 2402 2386
CONECT 2403 2387
CONECT 2404 2397
CONECT 2405 2398
CONECT 2406 2396
CONECT 2407 2399
CONECT 2408 2392
CONECT 2409 2392
CONECT 2410 2391
CONECT 2411 2390
CONECT 2412 2395
CONECT 2413 2388
CONECT 2414 2388 2415 2418
CONECT 2415 2414 2416 2417
CONECT 2416 2415 2419 2420 2421
CONECT 2417 2415
CONECT 2418 2414
CONECT 2419 2416
CONECT 2420 2416
CONECT 2421 2416
CONECT 2422 2423 2448 2432  440
CONECT 2423 2422 2424 2436 2435
CONECT 2424 2423 2425 2437 2430
CONECT 2425 2424 2426 2438 2431
CONECT 2426 2425 2427 2439 2432
CONECT 2427 2426 2440 2441 2433
CONECT 2428 2429 2435 2434
CONECT 2429 2428 2442 2443 2444
CONECT 2430 2424 2445
CONECT 2431 2425 2449
CONECT 2432 2422 2426
CONECT 2433 2427 2446
CONECT 2434 2428
CONECT 2435 2423 2428 2447
CONECT 2436 2423
CONECT 2437 2424
CONECT 2438 2425
CONECT 2439 2426
CONECT 2440 2427
CONECT 2441 2427
CONECT 2442 2429
CONECT 2443 2429
CONECT 2444 2429
CONECT 2445 2430
CONECT 2446 2433
CONECT 2447 2435
CONECT 2448 2422
CONECT 2449 2431 2450 2475 2459
CONECT 2450 2449 2451 2463 2462
CONECT 2451 2450 2452 2464 2457
CONECT 2452 2451 2453 2465 2458
CONECT 2453 2452 2454 2466 2459
CONECT 2454 2453 2467 2468 2460
CONECT 2455 2456 2462 2461
CONECT 2456 2455 2469 2470 2471
CONECT 2457 2451 2472
CONECT 2458 2452 2476
CONECT 2459 2449 2453
CONECT 2460 2454 2473
CONECT 2461 2455
CONECT 2462 2450 2455 2474
CONECT 2463 2450
CONECT 2464 2451
CONECT 2465 2452
CONECT 2466 2453
CONECT 2467 2454
CONECT 2468 2454
CONECT 2469 2456
CONECT 2470 2456
CONECT 2471 2456
CONECT 2472 2457
CONECT 2473 2460
CONECT 2474 2462
CONECT 2475 2449
CONECT 2476 2458 2477 2484 2494
CONECT 2477 2476 2478 2487 2492
CONECT 2478 2477 2479 2482 2493
CONECT 2479 2478 2483 2480 2495
CONECT 2480 2479 2484 2481 2489
CONECT 2481 2480 2490 2491 2485
CONECT 2482 2478 2496
CONECT 2483 2479 2486
CONECT 2484 2476 2480
CONECT 2485 2481 2750
CONECT 2486 2483
CONECT 2487 2477 2488
CONECT 2488 2487
CONECT 2489 2480
CONECT 2490 2481
CONECT 2491 2481
CONECT 2492 2477
CONECT 2493 2478
CONECT 2494 2476
CONECT 2495 2479
CONECT 2496 2482 2497 2504 2512
CONECT 2497 2496 2498 2508 2513
CONECT 2498 2497 2499 2502 2514
CONECT 2499 2498 2503 2500 2515
CONECT 2500 2499 2504 2501 2509
CONECT 2501 2500 2510 2511 2505
CONECT 2502 2498 2506
CONECT 2503 2499 2633
CONECT 2504 2496 2500
CONECT 2505 2501 2507
CONECT 2506 2502
CONECT 2507 2505
CONECT 2508 2497 2516
CONECT 2509 2500
CONECT 2510 2501
CONECT 2511 2501
CONECT 2512 2496
CONECT 2513 2497
CONECT 2514 2498
CONECT 2515 2499
CONECT 2516 2508 2517 2542 2526
CONECT 2517 2516 2518 2530 2529
CONECT 2518 2517 2519 2531 2524
CONECT 2519 2518 2520 2532 2525
CONECT 2520 2519 2521 2533 2526
CONECT 2521 2520 2534 2535 2527
CONECT 2522 2523 2529 2528
CONECT 2523 2522 2536 2537 2538
CONECT 2524 2518 2539
CONECT 2525 2519 2543
CONECT 2526 2516 2520
CONECT 2527 2521 2540
CONECT 2528 2522
CONECT 2529 2517 2522 2541
CONECT 2530 2517
CONECT 2531 2518
CONECT 2532 2519
CONECT 2533 2520
CONECT 2534 2521
CONECT 2535 2521
CONECT 2536 2523
CONECT 2537 2523
CONECT 2538 2523
CONECT 2539 2524
CONECT 2540 2527
CONECT 2541 2529
CONECT 2542 2516
CONECT 2543 2525 2544 2551 2560
CONECT 2544 2543 2545 2549 2561
CONECT 2545 2544 2546 2550 2562
CONECT 2546 2545 2555 2547 2563
CONECT 2547 2546 2551 2548 2557
CONECT 2548 2547 2558 2559 2552
CONECT 2549 2544 2553
CONECT 2550 2545 2564
CONECT 2551 2543 2547
CONECT 2552 2548 2554
CONECT 2553 2549
CONECT 2554 2552
CONECT 2555 2546 2556
CONECT 2556 2555
CONECT 2557 2547
CONECT 2558 2548
CONECT 2559 2548
CONECT 2560 2543
CONECT 2561 2544
CONECT 2562 2545
CONECT 2563 2546
CONECT 2564 2550 2565 2572 2581
CONECT 2565 2564 2566 2570 2582
CONECT 2566 2565 2567 2571 2583
CONECT 2567 2566 2576 2568 2584
CONECT 2568 2567 2572 2569 2578
CONECT 2569 2568 2579 2580 2573
CONECT 2570 2565 2574
CONECT 2571 2566 2585
CONECT 2572 2564 2568
CONECT 2573 2569 2575
CONECT 2574 2570
CONECT 2575 2573
CONECT 2576 2567 2577
CONECT 2577 2576
CONECT 2578 2568
CONECT 2579 2569
CONECT 2580 2569
CONECT 2581 2564
CONECT 2582 2565
CONECT 2583 2566
CONECT 2584 2567
CONECT 2585 2571 2586 2592 2600
CONECT 2586 2585 2587 2601 2604
CONECT 2587 2586 2588 2591 2602
CONECT 2588 2587 2595 2589 2603
CONECT 2589 2588 2592 2590 2597
CONECT 2590 2589 2598 2599 2593
CONECT 2591 2587 2612
CONECT 2592 2585 2589
CONECT 2593 2590 2594
CONECT 2594 2593
CONECT 2595 2588 2596
CONECT 2596 2595
CONECT 2597 2589
CONECT 2598 2590
CONECT 2599 2590
CONECT 2600 2585
CONECT 2601 2586
CONECT 2602 2587
CONECT 2603 2588
CONECT 2604 2586 2605 2608
CONECT 2605 2604 2606 2607
CONECT 2606 2605 2609 2610 2611
CONECT 2607 2605
CONECT 2608 2604
CONECT 2609 2606
CONECT 2610 2606
CONECT 2611 2606
CONECT 2612 2591 2613 2618 2623
CONECT 2613 2612 2614 2619 2624
CONECT 2614 2613 2615 2620 2626
CONECT 2615 2614 2616 2621 2628
CONECT 2616 2615 2617 2618 2622
CONECT 2617 2616 2630 2631 2632
CONECT 2618 2612 2616
CONECT 2619 2613 2625
CONECT 2620 2614 2627
CONECT 2621 2615 2629
CONECT 2622 2616
CONECT 2623 2612
CONECT 2624 2613
CONECT 2625 2619
CONECT 2626 2614
CONECT 2627 2620
CONECT 2628 2615
CONECT 2629 2621
CONECT 2630 2617
CONECT 2631 2617
CONECT 2632 2617
CONECT 2633 2503 2634 2659 2643
CONECT 2634 2633 2635 2647 2646
CONECT 2635 2634 2636 2648 2641
CONECT 2636 2635 2637 2649 2642
CONECT 2637 2636 2638 2650 2643
CONECT 2638 2637 2651 2652 2644
CONECT 2639 2640 2646 2645
CONECT 2640 2639 2653 2654 2655
CONECT 2641 2635 2656
CONECT 2642 2636 2660
CONECT 2643 2633 2637
CONECT 2644 2638 2657
CONECT 2645 2639
CONECT 2646 2634 2639 2658
CONECT 2647 2634
CONECT 2648 2635
CONECT 2649 2636
CONECT 2650 2637
CONECT 2651 2638
CONECT 2652 2638
CONECT 2653 2640
CONECT 2654 2640
CONECT 2655 2640
CONECT 2656 2641
CONECT 2657 2644
CONECT 2658 2646
CONECT 2659 2633
CONECT 2660 2642 2661 2668 2677
CONECT 2661 2660 2662 2666 2678
CONECT 2662 2661 2663 2667 2679
CONECT 2663 2662 2672 2664 2680
CONECT 2664 2663 2668 2665 2674
CONECT 2665 2664 2675 2676 2669
CONECT 2666 2661 2670
CONECT 2667 2662 2681
CONECT 2668 2660 2664
CONECT 2669 2665 2671
CONECT 2670 2666
CONECT 2671 2669
CONECT 2672 2663 2673
CONECT 2673 2672
CONECT 2674 2664
CONECT 2675 2665
CONECT 2676 2665
CONECT 2677 2660
CONECT 2678 2661
CONECT 2679 2662
CONECT 2680 2663
CONECT 2681 2667 2682 2689 2698
CONECT 2682 2681 2683 2687 2699
CONECT 2683 2682 2684 2688 2700
CONECT 2684 2683 2693 2685 2701
CONECT 2685 2684 2689 2686 2695
CONECT 2686 2685 2696 2697 2690
CONECT 2687 2682 2691
CONECT 2688 2683 2702
CONECT 2689 2681 2685
CONECT 2690 2686 2692
CONECT 2691 2687
CONECT 2692 2690
CONECT 2693 2684 2694
CONECT 2694 2693
CONECT 2695 2685
CONECT 2696 2686
CONECT 2697 2686
CONECT 2698 2681
CONECT 2699 2682
CONECT 2700 2683
CONECT 2701 2684
CONECT 2702 2688 2703 2709 2717
CONECT 2703 2702 2704 2718 2721
CONECT 2704 2703 2705 2708 2719
CONECT 2705 2704 2712 2706 2720
CONECT 2706 2705 2709 2707 2714
CONECT 2707 2706 2715 2716 2710
CONECT 2708 2704 2729
CONECT 2709 2702 2706
CONECT 2710 2707 2711
CONECT 2711 2710
CONECT 2712 2705 2713
CONECT 2713 2712
CONECT 2714 2706
CONECT 2715 2707
CONECT 2716 2707
CONECT 2717 2702
CONECT 2718 2703
CONECT 2719 2704
CONECT 2720 2705
CONECT 2721 2703 2722 2725
CONECT 2722 2721 2723 2724
CONECT 2723 2722 2726 2727 2728
CONECT 2724 2722
CONECT 2725 2721
CONECT 2726 2723
CONECT 2727 2723
CONECT 2728 2723
CONECT 2729 2708 2730 2735 2740
CONECT 2730 2729 2731 2736 2741
CONECT 2731 2730 2732 2737 2743
CONECT 2732 2731 2733 2738 2745
CONECT 2733 2732 2734 2735 2739
CONECT 2734 2733 2747 2748 2749
CONECT 2735 2729 2733
CONECT 2736 2730 2742
CONECT 2737 2731 2744
CONECT 2738 2732 2746
CONECT 2739 2733
CONECT 2740 2729
CONECT 2741 2730
CONECT 2742 2736
CONECT 2743 2731
CONECT 2744 2737
CONECT 2745 2732
CONECT 2746 2738
CONECT 2747 2734
CONECT 2748 2734
CONECT 2749 2734
CONECT 2750 2485 2751 2758 2765
CONECT 2751 2750 2752 2761 2766
CONECT 2752 2751 2753 2756 2767
CONECT 2753 2752 2757 2754 2768
CONECT 2754 2753 2758 2755 2762
CONECT 2755 2754 2763 2764 2759
CONECT 2756 2752 2760
CONECT 2757 2753 2886
CONECT 2758 2750 2754
CONECT 2759 2755 3003
CONECT 2760 2756
CONECT 2761 2751 2769
CONECT 2762 2754
CONECT 2763 2755
CONECT 2764 2755
CONECT 2765 2750
CONECT 2766 2751
CONECT 2767 2752
CONECT 2768 2753
CONECT 2769 2761 2770 2795 2779
CONECT 2770 2769 2771 2783 2782
CONECT 2771 2770 2772 2784 2777
CONECT 2772 2771 2773 2785 2778
CONECT 2773 2772 2774 2786 2779
CONECT 2774 2773 2787 2788 2780
CONECT 2775 2776 2782 2781
CONECT 2776 2775 2789 2790 2791
CONECT 2777 2771 2792
CONECT 2778 2772 2796
CONECT 2779 2769 2773
CONECT 2780 2774 2793
CONECT 2781 2775
CONECT 2782 2770 2775 2794
CONECT 2783 2770
CONECT 2784 2771
CONECT 2785 2772
CONECT 2786 2773
CONECT 2787 2774
CONECT 2788 2774
CONECT 2789 2776
CONECT 2790 2776
CONECT 2791 2776
CONECT 2792 2777
CONECT 2793 2780
CONECT 2794 2782
CONECT 2795 2769
CONECT 2796 2778 2797 2804 2813
CONECT 2797 2796 2798 2802 2814
CONECT 2798 2797 2799 2803 2815
CONECT 2799 2798 2808 2800 2816
CONECT 2800 2799 2804 2801 2810
CONECT 2801 2800 2811 2812 2805
CONECT 2802 2797 2806
CONECT 2803 2798 2817
CONECT 2804 2796 2800
CONECT 2805 2801 2807
CONECT 2806 2802
CONECT 2807 2805
CONECT 2808 2799 2809
CONECT 2809 2808
CONECT 2810 2800
CONECT 2811 2801
CONECT 2812 2801
CONECT 2813 2796
CONECT 2814 2797
CONECT 2815 2798
CONECT 2816 2799
CONECT 2817 2803 2818 2825 2834
CONECT 2818 2817 2819 2823 2835
CONECT 2819 2818 2820 2824 2836
CONECT 2820 2819 2829 2821 2837
CONECT 2821 2820 2825 2822 2831
CONECT 2822 2821 2832 2833 2826
CONECT 2823 2818 2827
CONECT 2824 2819 2838
CONECT 2825 2817 2821
CONECT 2826 2822 2828
CONECT 2827 2823
CONECT 2828 2826
CONECT 2829 2820 2830
CONECT 2830 2829
CONECT 2831 2821
CONECT 2832 2822
CONECT 2833 2822
CONECT 2834 2817
CONECT 2835 2818
CONECT 2836 2819
CONECT 2837 2820
CONECT 2838 2824 2839 2845 2853
CONECT 2839 2838 2840 2854 2857
CONECT 2840 2839 2841 2844 2855
CONECT 2841 2840 2848 2842 2856
CONECT 2842 2841 2845 2843 2850
CONECT 2843 2842 2851 2852 2846
CONECT 2844 2840 2865
CONECT 2845 2838 2842
CONECT 2846 2843 2847
CONECT 2847 2846
CONECT 2848 2841 2849
CONECT 2849 2848
CONECT 2850 2842
CONECT 2851 2843
CONECT 2852 2843
CONECT 2853 2838
CONECT 2854 2839
CONECT 2855 2840
CONECT 2856 2841
CONECT 2857 2839 2858 2861
CONECT 2858 2857 2859 2860
CONECT 2859 2858 2862 2863 2864
CONECT 2860 2858
CONECT 2861 2857
CONECT 2862 2859
CONECT 2863 2859
CONECT 2864 2859
CONECT 2865 2844 2866 2871 2876
CONECT 2866 2865 2867 2872 2877
CONECT 2867 2866 2868 2873 2879
CONECT 2868 2867 2869 2874 2881
CONECT 2869 2868 2870 2871 2875
CONECT 2870 2869 2883 2884 2885
CONECT 2871 2865 2869
CONECT 2872 2866 2878
CONECT 2873 2867 2880
CONECT 2874 2868 2882
CONECT 2875 2869
CONECT 2876 2865
CONECT 2877 2866
CONECT 2878 2872
CONECT 2879 2867
CONECT 2880 2873
CONECT 2881 2868
CONECT 2882 2874
CONECT 2883 2870
CONECT 2884 2870
CONECT 2885 2870
CONECT 2886 2757 2887 2912 2896
CONECT 2887 2886 2888 2900 2899
CONECT 2888 2887 2889 2901 2894
CONECT 2889 2888 2890 2902 2895
CONECT 2890 2889 2891 2903 2896
CONECT 2891 2890 2904 2905 2897
CONECT 2892 2893 2899 2898
CONECT 2893 2892 2906 2907 2908
CONECT 2894 2888 2909
CONECT 2895 2889 2913
CONECT 2896 2886 2890
CONECT 2897 2891 2910
CONECT 2898 2892
CONECT 2899 2887 2892 2911
CONECT 2900 2887
CONECT 2901 2888
CONECT 2902 2889
CONECT 2903 2890
CONECT 2904 2891
CONECT 2905 2891
CONECT 2906 2893
CONECT 2907 2893
CONECT 2908 2893
CONECT 2909 2894
CONECT 2910 2897
CONECT 2911 2899
CONECT 2912 2886
CONECT 2913 2895 2914 2921 2930
CONECT 2914 2913 2915 2919 2931
CONECT 2915 2914 2916 2920 2932
CONECT 2916 2915 2925 2917 2933
CONECT 2917 2916 2921 2918 2927
CONECT 2918 2917 2928 2929 2922
CONECT 2919 2914 2923
CONECT 2920 2915 2934
CONECT 2921 2913 2917
CONECT 2922 2918 2924
CONECT 2923 2919
CONECT 2924 2922
CONECT 2925 2916 2926
CONECT 2926 2925
CONECT 2927 2917
CONECT 2928 2918
CONECT 2929 2918
CONECT 2930 2913
CONECT 2931 2914
CONECT 2932 2915
CONECT 2933 2916
CONECT 2934 2920 2935 2942 2951
CONECT 2935 2934 2936 2940 2952
CONECT 2936 2935 2937 2941 2953
CONECT 2937 2936 2946 2938 2954
CONECT 2938 2937 2942 2939 2948
CONECT 2939 2938 2949 2950 2943
CONECT 2940 2935 2944
CONECT 2941 2936 2955
CONECT 2942 2934 2938
CONECT 2943 2939 2945
CONECT 2944 2940
CONECT 2945 2943
CONECT 2946 2937 2947
CONECT 2947 2946
CONECT 2948 2938
CONECT 2949 2939
CONECT 2950 2939
CONECT 2951 2934
CONECT 2952 2935
CONECT 2953 2936
CONECT 2954 2937
CONECT 2955 2941 2956 2962 2970
CONECT 2956 2955 2957 2971 2974
CONECT 2957 2956 2958 2961 2972
CONECT 2958 2957 2965 2959 2973
CONECT 2959 2958 2962 2960 2967
CONECT 2960 2959 2968 2969 2963
CONECT 2961 2957 2982
CONECT 2962 2955 2959
CONECT 2963 2960 2964
CONECT 2964 2963
CONECT 2965 2958 2966
CONECT 2966 2965
CONECT 2967 2959
CONECT 2968 2960
CONECT 2969 2960
CONECT 2970 2955
CONECT 2971 2956
CONECT 2972 2957
CONECT 2973 2958
CONECT 2974 2956 2975 2978
CONECT 2975 2974 2976 2977
CONECT 2976 2975 2979 2980 2981
CONECT 2977 2975
CONECT 2978 2974
CONECT 2979 2976
CONECT 2980 2976
CONECT 2981 2976
CONECT 2982 2961 2983 2988 2993
CONECT 2983 2982 2984 2989 2994
CONECT 2984 2983 2985 2990 2996
CONECT 2985 2984 2986 2991 2998
CONECT 2986 2985 2987 2988 2992
CONECT 2987 2986 3000 3001 3002
CONECT 2988 2982 2986
CONECT 2989 2983 2995
CONECT 2990 2984 2997
CONECT 2991 2985 2999
CONECT 2992 2986
CONECT 2993 2982
CONECT 2994 2983
CONECT 2995 2989
CONECT 2996 2984
CONECT 2997 2990
CONECT 2998 2985
CONECT 2999 2991
CONECT 3000 2987
CONECT 3001 2987
CONECT 3002 2987
CONECT 3003 2759 3004 3029 3013
CONECT 3004 3003 3005 3017 3016
CONECT 3005 3004 3006 3018 3011
CONECT 3006 3005 3007 3019 3012
CONECT 3007 3006 3008 3020 3013
CONECT 3008 3007 3021 3022 3014
CONECT 3009 3010 3016 3015
CONECT 3010 3009 3023 3024 3025
CONECT 3011 3005 3026
CONECT 3012 3006 3030
CONECT 3013 3003 3007
CONECT 3014 3008 3027
CONECT 3015 3009
CONECT 3016 3004 3009 3028
CONECT 3017 3004
CONECT 3018 3005
CONECT 3019 3006
CONECT 3020 3007
CONECT 3021 3008
CONECT 3022 3008
CONECT 3023 3010
CONECT 3024 3010
CONECT 3025 3010
CONECT 3026 3011
CONECT 3027 3014
CONECT 3028 3016
CONECT 3029 3003
CONECT 3030 3012 3031 3038 3047
CONECT 3031 3030 3032 3036 3048
CONECT 3032 3031 3033 3037 3049
CONECT 3033 3032 3042 3034 3050
CONECT 3034 3033 3038 3035 3044
CONECT 3035 3034 3045 3046 3039
CONECT 3036 3031 3040
CONECT 3037 3032 3051
CONECT 3038 3030 3034
CONECT 3039 3035 3041
CONECT 3040 3036
CONECT 3041 3039
CONECT 3042 3033 3043
CONECT 3043 3042
CONECT 3044 3034
CONECT 3045 3035
CONECT 3046 3035
CONECT 3047 3030
CONECT 3048 3031
CONECT 3049 3032
CONECT 3050 3033
CONECT 3051 3037 3052 3059 3068
CONECT 3052 3051 3053 3057 3069
CONECT 3053 3052 3054 3058 3070
CONECT 3054 3053 3063 3055 3071
CONECT 3055 3054 3059 3056 3065
CONECT 3056 3055 3066 3067 3060
CONECT 3057 3052 3061
CONECT 3058 3053 3072
CONECT 3059 3051 3055
CONECT 3060 3056 3062
CONECT 3061 3057
CONECT 3062 3060
CONECT 3063 3054 3064
CONECT 3064 3063
CONECT 3065 3055
CONECT 3066 3056
CONECT 3067 3056
CONECT 3068 3051
CONECT 3069 3052
CONECT 3070 3053
CONECT 3071 3054
CONECT 3072 3058 3073 3079 3087
CONECT 3073 3072 3074 3088 3091
CONECT 3074 3073 3075 3078 3089
CONECT 3075 3074 3082 3076 3090
CONECT 3076 3075 3079 3077 3084
CONECT 3077 3076 3085 3086 3080
CONECT 3078 3074 3099
CONECT 3079 3072 3076
CONECT 3080 3077 3081
CONECT 3081 3080
CONECT 3082 3075 3083
CONECT 3083 3082
CONECT 3084 3076
CONECT 3085 3077
CONECT 3086 3077
CONECT 3087 3072
CONECT 3088 3073
CONECT 3089 3074
CONECT 3090 3075
CONECT 3091 3073 3092 3095
CONECT 3092 3091 3093 3094
CONECT 3093 3092 3096 3097 3098
CONECT 3094 3092
CONECT 3095 3091
CONECT 3096 3093
CONECT 3097 3093
CONECT 3098 3093
CONECT 3099 3078 3100 3105 3110
CONECT 3100 3099 3101 3106 3111
CONECT 3101 3100 3102 3107 3113
CONECT 3102 3101 3103 3108 3115
CONECT 3103 3102 3104 3105 3109
CONECT 3104 3103 3117 3118 3119
CONECT 3105 3099 3103
CONECT 3106 3100 3112
CONECT 3107 3101 3114
CONECT 3108 3102 3116
CONECT 3109 3103
CONECT 3110 3099
CONECT 3111 3100
CONECT 3112 3106
CONECT 3113 3101
CONECT 3114 3107
CONECT 3115 3102
CONECT 3116 3108
CONECT 3117 3104
CONECT 3118 3104
CONECT 3119 3104
CONECT 3120 3121 3145 3130  712
CONECT 3121 3120 3122 3134 3133
CONECT 3122 3121 3123 3135 3128
CONECT 3123 3122 3124 3136 3129
CONECT 3124 3123 3125 3137 3130
CONECT 3125 3124 3138 3139 3131
CONECT 3126 3127 3133 3132
CONECT 3127 3126 3140 3141 3142
CONECT 3128 3122 3143
CONECT 3129 3123 3146
CONECT 3130 3120 3124
CONECT 3131 3125 3577
CONECT 3132 3126
CONECT 3133 3121 3126 3144
CONECT 3134 3121
CONECT 3135 3122
CONECT 3136 3123
CONECT 3137 3124
CONECT 3138 3125
CONECT 3139 3125
CONECT 3140 3127
CONECT 3141 3127
CONECT 3142 3127
CONECT 3143 3128
CONECT 3144 3133
CONECT 3145 3120
CONECT 3146 3129 3147 3172 3156
CONECT 3147 3146 3148 3160 3159
CONECT 3148 3147 3149 3161 3154
CONECT 3149 3148 3150 3162 3155
CONECT 3150 3149 3151 3163 3156
CONECT 3151 3150 3164 3165 3157
CONECT 3152 3153 3159 3158
CONECT 3153 3152 3166 3167 3168
CONECT 3154 3148 3169
CONECT 3155 3149 3173
CONECT 3156 3146 3150
CONECT 3157 3151 3170
CONECT 3158 3152
CONECT 3159 3147 3152 3171
CONECT 3160 3147
CONECT 3161 3148
CONECT 3162 3149
CONECT 3163 3150
CONECT 3164 3151
CONECT 3165 3151
CONECT 3166 3153
CONECT 3167 3153
CONECT 3168 3153
CONECT 3169 3154
CONECT 3170 3157
CONECT 3171 3159
CONECT 3172 3146
CONECT 3173 3155 3174 3181 3191
CONECT 3174 3173 3175 3184 3189
CONECT 3175 3174 3176 3179 3190
CONECT 3176 3175 3180 3177 3192
CONECT 3177 3176 3181 3178 3186
CONECT 3178 3177 3187 3188 3182
CONECT 3179 3175 3193
CONECT 3180 3176 3183
CONECT 3181 3173 3177
CONECT 3182 3178 3385
CONECT 3183 3180
CONECT 3184 3174 3185
CONECT 3185 3184
CONECT 3186 3177
CONECT 3187 3178
CONECT 3188 3178
CONECT 3189 3174
CONECT 3190 3175
CONECT 3191 3173
CONECT 3192 3176
CONECT 3193 3179 3194 3201 3209
CONECT 3194 3193 3195 3205 3210
CONECT 3195 3194 3196 3199 3211
CONECT 3196 3195 3200 3197 3212
CONECT 3197 3196 3201 3198 3206
CONECT 3198 3197 3207 3208 3202
CONECT 3199 3195 3203
CONECT 3200 3196 3299
CONECT 3201 3193 3197
CONECT 3202 3198 3204
CONECT 3203 3199
CONECT 3204 3202
CONECT 3205 3194 3213
CONECT 3206 3197
CONECT 3207 3198
CONECT 3208 3198
CONECT 3209 3193
CONECT 3210 3194
CONECT 3211 3195
CONECT 3212 3196
CONECT 3213 3205 3214 3239 3223
CONECT 3214 3213 3215 3227 3226
CONECT 3215 3214 3216 3228 3221
CONECT 3216 3215 3217 3229 3222
CONECT 3217 3216 3218 3230 3223
CONECT 3218 3217 3231 3232 3224
CONECT 3219 3220 3226 3225
CONECT 3220 3219 3233 3234 3235
CONECT 3221 3215 3236
CONECT 3222 3216 3240
CONECT 3223 3213 3217
CONECT 3224 3218 3237
CONECT 3225 3219
CONECT 3226 3214 3219 3238
CONECT 3227 3214
CONECT 3228 3215
CONECT 3229 3216
CONECT 3230 3217
CONECT 3231 3218
CONECT 3232 3218
CONECT 3233 3220
CONECT 3234 3220
CONECT 3235 3220
CONECT 3236 3221
CONECT 3237 3224
CONECT 3238 3226
CONECT 3239 3213
CONECT 3240 3222 3241 3248 3257
CONECT 3241 3240 3242 3246 3258
CONECT 3242 3241 3243 3247 3259
CONECT 3243 3242 3252 3244 3260
CONECT 3244 3243 3248 3245 3254
CONECT 3245 3244 3255 3256 3249
CONECT 3246 3241 3250
CONECT 3247 3242 3251
CONECT 3248 3240 3244
CONECT 3249 3245 3262
CONECT 3250 3246
CONECT 3251 3247
CONECT 3252 3243 3253
CONECT 3253 3252
CONECT 3254 3244
CONECT 3255 3245
CONECT 3256 3245
CONECT 3257 3240
CONECT 3258 3241
CONECT 3259 3242
CONECT 3260 3243
CONECT 3261 3262 3271 3272
CONECT 3262 3249 3261 3263 3270
CONECT 3263 3262 3264 3278 3279
CONECT 3264 3263 3265 3273 3280
CONECT 3265 3264 3266 3290 3291
CONECT 3266 3265 3267 3270 3277
CONECT 3267 3266 3268 3274 3288
CONECT 3268 3267 3269 3275 3287
CONECT 3269 3268 3276 3285 3286
CONECT 3270 3262 3266
CONECT 3271 3261
CONECT 3272 3261 3289
CONECT 3273 3264 3283
CONECT 3274 3267 3281
CONECT 3275 3268 3282
CONECT 3276 3269 3284
CONECT 3277 3266
CONECT 3278 3263
CONECT 3279 3263
CONECT 3280 3264
CONECT 3281 3274
CONECT 3282 3275
CONECT 3283 3273
CONECT 3284 3276
CONECT 3285 3269
CONECT 3286 3269
CONECT 3287 3268
CONECT 3288 3267
CONECT 3289 3272
CONECT 3290 3265
CONECT 3291 3265 3292 3295
CONECT 3292 3291 3293 3294
CONECT 3293 3292 3296 3297 3298
CONECT 3294 3292
CONECT 3295 3291
CONECT 3296 3293
CONECT 3297 3293
CONECT 3298 3293
CONECT 3299 3200 3300 3325 3309
CONECT 3300 3299 3301 3313 3312
CONECT 3301 3300 3302 3314 3307
CONECT 3302 3301 3303 3315 3308
CONECT 3303 3302 3304 3316 3309
CONECT 3304 3303 3317 3318 3310
CONECT 3305 3306 3312 3311
CONECT 3306 3305 3319 3320 3321
CONECT 3307 3301 3322
CONECT 3308 3302 3326
CONECT 3309 3299 3303
CONECT 3310 3304 3323
CONECT 3311 3305
CONECT 3312 3300 3305 3324
CONECT 3313 3300
CONECT 3314 3301
CONECT 3315 3302
CONECT 3316 3303
CONECT 3317 3304
CONECT 3318 3304
CONECT 3319 3306
CONECT 3320 3306
CONECT 3321 3306
CONECT 3322 3307
CONECT 3323 3310
CONECT 3324 3312
CONECT 3325 3299
CONECT 3326 3308 3327 3334 3343
CONECT 3327 3326 3328 3332 3344
CONECT 3328 3327 3329 3333 3345
CONECT 3329 3328 3338 3330 3346
CONECT 3330 3329 3334 3331 3340
CONECT 3331 3330 3341 3342 3335
CONECT 3332 3327 3336
CONECT 3333 3328 3348
CONECT 3334 3326 3330
CONECT 3335 3331 3337
CONECT 3336 3332
CONECT 3337 3335
CONECT 3338 3329 3339
CONECT 3339 3338
CONECT 3340 3330
CONECT 3341 3331
CONECT 3342 3331
CONECT 3343 3326
CONECT 3344 3327
CONECT 3345 3328
CONECT 3346 3329
CONECT 3347 3348 3357 3358
CONECT 3348 3333 3347 3349 3356
CONECT 3349 3348 3350 3364 3365
CONECT 3350 3349 3351 3359 3366
CONECT 3351 3350 3352 3376 3377
CONECT 3352 3351 3353 3356 3363
CONECT 3353 3352 3354 3360 3374
CONECT 3354 3353 3355 3361 3373
CONECT 3355 3354 3362 3371 3372
CONECT 3356 3348 3352
CONECT 3357 3347
CONECT 3358 3347 3375
CONECT 3359 3350 3369
CONECT 3360 3353 3367
CONECT 3361 3354 3368
CONECT 3362 3355 3370
CONECT 3363 3352
CONECT 3364 3349
CONECT 3365 3349
CONECT 3366 3350
CONECT 3367 3360
CONECT 3368 3361
CONECT 3369 3359
CONECT 3370 3362
CONECT 3371 3355
CONECT 3372 3355
CONECT 3373 3354
CONECT 3374 3353
CONECT 3375 3358
CONECT 3376 3351
CONECT 3377 3351 3378 3381
CONECT 3378 3377 3379 3380
CONECT 3379 3378 3382 3383 3384
CONECT 3380 3378
CONECT 3381 3377
CONECT 3382 3379
CONECT 3383 3379
CONECT 3384 3379
CONECT 3385 3182 3386 3393 3401
CONECT 3386 3385 3387 3397 3402
CONECT 3387 3386 3388 3391 3403
CONECT 3388 3387 3392 3389 3404
CONECT 3389 3388 3393 3390 3398
CONECT 3390 3389 3399 3400 3394
CONECT 3391 3387 3395
CONECT 3392 3388 3396
CONECT 3393 3385 3389
CONECT 3394 3390 3491
CONECT 3395 3391
CONECT 3396 3392
CONECT 3397 3386 3405
CONECT 3398 3389
CONECT 3399 3390
CONECT 3400 3390
CONECT 3401 3385
CONECT 3402 3386
CONECT 3403 3387
CONECT 3404 3388
CONECT 3405 3397 3406 3431 3415
CONECT 3406 3405 3407 3419 3418
CONECT 3407 3406 3408 3420 3413
CONECT 3408 3407 3409 3421 3414
CONECT 3409 3408 3410 3422 3415
CONECT 3410 3409 3423 3424 3416
CONECT 3411 3412 3418 3417
CONECT 3412 3411 3425 3426 3427
CONECT 3413 3407 3428
CONECT 3414 3408 3432
CONECT 3415 3405 3409
CONECT 3416 3410 3429
CONECT 3417 3411
CONECT 3418 3406 3411 3430
CONECT 3419 3406
CONECT 3420 3407
CONECT 3421 3408
CONECT 3422 3409
CONECT 3423 3410
CONECT 3424 3410
CONECT 3425 3412
CONECT 3426 3412
CONECT 3427 3412
CONECT 3428 3413
CONECT 3429 3416
CONECT 3430 3418
CONECT 3431 3405
CONECT 3432 3414 3433 3440 3449
CONECT 3433 3432 3434 3438 3450
CONECT 3434 3433 3435 3439 3451
CONECT 3435 3434 3444 3436 3452
CONECT 3436 3435 3440 3437 3446
CONECT 3437 3436 3447 3448 3441
CONECT 3438 3433 3442
CONECT 3439 3434 3443
CONECT 3440 3432 3436
CONECT 3441 3437 3454
CONECT 3442 3438
CONECT 3443 3439
CONECT 3444 3435 3445
CONECT 3445 3444
CONECT 3446 3436
CONECT 3447 3437
CONECT 3448 3437
CONECT 3449 3432
CONECT 3450 3433
CONECT 3451 3434
CONECT 3452 3435
CONECT 3453 3454 3463 3464
CONECT 3454 3441 3453 3455 3462
CONECT 3455 3454 3456 3470 3471
CONECT 3456 3455 3457 3465 3472
CONECT 3457 3456 3458 3482 3483
CONECT 3458 3457 3459 3462 3469
CONECT 3459 3458 3460 3466 3480
CONECT 3460 3459 3461 3467 3479
CONECT 3461 3460 3468 3477 3478
CONECT 3462 3454 3458
CONECT 3463 3453
CONECT 3464 3453 3481
CONECT 3465 3456 3475
CONECT 3466 3459 3473
CONECT 3467 3460 3474
CONECT 3468 3461 3476
CONECT 3469 3458
CONECT 3470 3455
CONECT 3471 3455
CONECT 3472 3456
CONECT 3473 3466
CONECT 3474 3467
CONECT 3475 3465
CONECT 3476 3468
CONECT 3477 3461
CONECT 3478 3461
CONECT 3479 3460
CONECT 3480 3459
CONECT 3481 3464
CONECT 3482 3457
CONECT 3483 3457 3484 3487
CONECT 3484 3483 3485 3486
CONECT 3485 3484 3488 3489 3490
CONECT 3486 3484
CONECT 3487 3483
CONECT 3488 3485
CONECT 3489 3485
CONECT 3490 3485
CONECT 3491 3394 3492 3517 3501
CONECT 3492 3491 3493 3505 3504
CONECT 3493 3492 3494 3506 3499
CONECT 3494 3493 3495 3507 3500
CONECT 3495 3494 3496 3508 3501
CONECT 3496 3495 3509 3510 3502
CONECT 3497 3498 3504 3503
CONECT 3498 3497 3511 3512 3513
CONECT 3499 3493 3514
CONECT 3500 3494 3518
CONECT 3501 3491 3495
CONECT 3502 3496 3515
CONECT 3503 3497
CONECT 3504 3492 3497 3516
CONECT 3505 3492
CONECT 3506 3493
CONECT 3507 3494
CONECT 3508 3495
CONECT 3509 3496
CONECT 3510 3496
CONECT 3511 3498
CONECT 3512 3498
CONECT 3513 3498
CONECT 3514 3499
CONECT 3515 3502
CONECT 3516 3504
CONECT 3517 3491
CONECT 3518 3500 3519 3526 3535
CONECT 3519 3518 3520 3524 3536
CONECT 3520 3519 3521 3525 3537
CONECT 3521 3520 3530 3522 3538
CONECT 3522 3521 3526 3523 3532
CONECT 3523 3522 3533 3534 3527
CONECT 3524 3519 3528
CONECT 3525 3520 3540
CONECT 3526 3518 3522
CONECT 3527 3523 3529
CONECT 3528 3524
CONECT 3529 3527
CONECT 3530 3521 3531
CONECT 3531 3530
CONECT 3532 3522
CONECT 3533 3523
CONECT 3534 3523
CONECT 3535 3518
CONECT 3536 3519
CONECT 3537 3520
CONECT 3538 3521
CONECT 3539 3540 3549 3550
CONECT 3540 3525 3539 3541 3548
CONECT 3541 3540 3542 3556 3557
CONECT 3542 3541 3543 3551 3558
CONECT 3543 3542 3544 3568 3569
CONECT 3544 3543 3545 3548 3555
CONECT 3545 3544 3546 3552 3566
CONECT 3546 3545 3547 3553 3565
CONECT 3547 3546 3554 3563 3564
CONECT 3548 3540 3544
CONECT 3549 3539
CONECT 3550 3539 3567
CONECT 3551 3542 3561
CONECT 3552 3545 3559
CONECT 3553 3546 3560
CONECT 3554 3547 3562
CONECT 3555 3544
CONECT 3556 3541
CONECT 3557 3541
CONECT 3558 3542
CONECT 3559 3552
CONECT 3560 3553
CONECT 3561 3551
CONECT 3562 3554
CONECT 3563 3547
CONECT 3564 3547
CONECT 3565 3546
CONECT 3566 3545
CONECT 3567 3550
CONECT 3568 3543
CONECT 3569 3543 3570 3573
CONECT 3570 3569 3571 3572
CONECT 3571 3570 3574 3575 3576
CONECT 3572 3570
CONECT 3573 3569
CONECT 3574 3571
CONECT 3575 3571
CONECT 3576 3571
CONECT 3577 3131 3578 3583 3588
CONECT 3578 3577 3579 3584 3589
CONECT 3579 3578 3580 3585 3591
CONECT 3580 3579 3581 3586 3593
CONECT 3581 3580 3582 3583 3587
CONECT 3582 3581 3595 3596 3597
CONECT 3583 3577 3581
CONECT 3584 3578 3590
CONECT 3585 3579 3592
CONECT 3586 3580 3594
CONECT 3587 3581
CONECT 3588 3577
CONECT 3589 3578
CONECT 3590 3584
CONECT 3591 3579
CONECT 3592 3585
CONECT 3593 3580
CONECT 3594 3586
CONECT 3595 3582
CONECT 3596 3582
CONECT 3597 3582
END



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.