CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 220530003627104198

Job options:

ID        	=	 220530003627104198
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   29-MAY-22 1MOD    1       17:36
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.93
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.87
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-05-20
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2022-05-25
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.96
REMARK   3  SIM     0.59
REMARK   3  SID     88.52
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTED
REMARK   3  ALN A TRG TIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDV
REMARK   3  ALN A TRG NDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEK
REMARK   3  ALN A TRG ERKQEEGES
REMARK   3  ALN A TPL QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTED
REMARK   3  ALN A TPL TIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYL
REMARK   3  ALN A TPL DDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEK
REMARK   3  ALN A TPL ERKQEEGES
REMARK   3  ALN A OFF 18
REMARK 970   RasMol::default
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color structure 
REMARK 970   RasMol::script1::GLS G
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color gray 
REMARK 970   select   15:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   38:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   54:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   75:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   85:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   RasMol::script2::GLS S
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color structure 
REMARK 970   select   15:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   38:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   54:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   75:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   85:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
AUTHOR  GlyCon 1.0 (Beta)
REMARK  This file was generated from the Glycon-programm.
REMARK  Molecular: 
ATOM      1  N   GLN A   1      25.953   9.386  -3.281  1.00  0.39           N  
ATOM      2  CA  GLN A   1      24.508   9.784  -3.418  1.00  0.39           C  
ATOM      3  C   GLN A   1      23.773   8.538  -3.852  1.00  0.39           C  
ATOM      4  O   GLN A   1      24.131   7.961  -4.871  1.00  0.39           O  
ATOM      5  CB  GLN A   1      24.353  10.937  -4.458  1.00  0.39           C  
ATOM      6  CG  GLN A   1      22.979  11.670  -4.504  1.00  0.39           C  
ATOM      7  CD  GLN A   1      23.098  12.964  -5.335  1.00  0.39           C  
ATOM      8  OE1 GLN A   1      24.018  13.131  -6.127  1.00  0.39           O  
ATOM      9  NE2 GLN A   1      22.170  13.925  -5.119  1.00  0.39           N  
ATOM     10  N   ILE A   2      22.799   8.037  -3.064  1.00  0.43           N  
ATOM     11  CA  ILE A   2      21.980   6.876  -3.409  1.00  0.43           C  
ATOM     12  C   ILE A   2      21.286   7.160  -4.733  1.00  0.43           C  
ATOM     13  O   ILE A   2      20.671   8.226  -4.811  1.00  0.43           O  
ATOM     14  CB  ILE A   2      20.978   6.654  -2.275  1.00  0.43           C  
ATOM     15  CG1 ILE A   2      21.735   6.145  -1.027  1.00  0.43           C  
ATOM     16  CG2 ILE A   2      19.835   5.695  -2.657  1.00  0.43           C  
ATOM     17  CD1 ILE A   2      20.962   6.282   0.288  1.00  0.43           C  
ATOM     18  N   PRO A   3      21.396   6.357  -5.804  1.00  0.66           N  
ATOM     19  CA  PRO A   3      20.918   6.750  -7.122  1.00  0.66           C  
ATOM     20  C   PRO A   3      19.433   7.015  -7.071  1.00  0.66           C  
ATOM     21  O   PRO A   3      18.738   6.347  -6.308  1.00  0.66           O  
ATOM     22  CB  PRO A   3      21.318   5.593  -8.060  1.00  0.66           C  
ATOM     23  CG  PRO A   3      21.595   4.404  -7.135  1.00  0.66           C  
ATOM     24  CD  PRO A   3      22.068   5.058  -5.836  1.00  0.66           C  
ATOM     25  N   LEU A   4      18.927   7.984  -7.857  1.00  0.66           N  
ATOM     26  CA  LEU A   4      17.572   8.525  -7.770  1.00  0.66           C  
ATOM     27  C   LEU A   4      16.469   7.457  -7.770  1.00  0.66           C  
ATOM     28  O   LEU A   4      15.386   7.621  -7.223  1.00  0.66           O  
ATOM     29  CB  LEU A   4      17.406   9.503  -8.963  1.00  0.66           C  
ATOM     30  CG  LEU A   4      16.147  10.390  -8.968  1.00  0.66           C  
ATOM     31  CD1 LEU A   4      16.180  11.446  -7.855  1.00  0.66           C  
ATOM     32  CD2 LEU A   4      15.976  11.057 -10.344  1.00  0.66           C  
ATOM     33  N   CYS A   5      16.785   6.298  -8.376  1.00  0.81           N  
ATOM     34  CA  CYS A   5      15.935   5.145  -8.557  1.00  0.81           C  
ATOM     35  C   CYS A   5      16.273   3.942  -7.676  1.00  0.81           C  
ATOM     36  O   CYS A   5      15.726   2.861  -7.873  1.00  0.81           O  
ATOM     37  CB  CYS A   5      16.085   4.704 -10.024  1.00  0.81           C  
ATOM     38  SG  CYS A   5      15.619   6.036 -11.172  1.00  0.81           S  
ATOM     39  N   ALA A   6      17.157   4.068  -6.662  1.00  0.81           N  
ATOM     40  CA  ALA A   6      17.583   2.955  -5.818  1.00  0.81           C  
ATOM     41  C   ALA A   6      16.454   2.254  -5.078  1.00  0.81           C  
ATOM     42  O   ALA A   6      16.402   1.032  -4.991  1.00  0.81           O  
ATOM     43  CB  ALA A   6      18.576   3.443  -4.754  1.00  0.81           C  
ATOM     44  N   ASN A   7      15.482   3.046  -4.585  1.00  0.78           N  
ATOM     45  CA  ASN A   7      14.317   2.576  -3.853  1.00  0.78           C  
ATOM     46  C   ASN A   7      13.321   1.829  -4.738  1.00  0.78           C  
ATOM     47  O   ASN A   7      12.338   1.278  -4.253  1.00  0.78           O  
ATOM     48  CB  ASN A   7      13.579   3.757  -3.165  1.00  0.78           C  
ATOM     49  CG  ASN A   7      14.476   4.449  -2.136  1.00  0.78           C  
ATOM     50  OD1 ASN A   7      15.526   3.966  -1.720  1.00  0.78           O  
ATOM     51  ND2 ASN A   7      14.057   5.663  -1.703  1.00  0.78           N  
ATOM     52  N   LEU A   8      13.547   1.815  -6.068  1.00  0.83           N  
ATOM     53  CA  LEU A   8      12.690   1.137  -7.014  1.00  0.83           C  
ATOM     54  C   LEU A   8      13.297  -0.145  -7.546  1.00  0.83           C  
ATOM     55  O   LEU A   8      12.704  -0.812  -8.390  1.00  0.83           O  
ATOM     56  CB  LEU A   8      12.379   2.043  -8.220  1.00  0.83           C  
ATOM     57  CG  LEU A   8      11.661   3.354  -7.870  1.00  0.83           C  
ATOM     58  CD1 LEU A   8      11.247   4.035  -9.167  1.00  0.83           C  
ATOM     59  CD2 LEU A   8      10.409   3.141  -7.020  1.00  0.83           C  
ATOM     60  N   VAL A   9      14.484  -0.554  -7.063  1.00  0.83           N  
ATOM     61  CA  VAL A   9      15.062  -1.836  -7.430  1.00  0.83           C  
ATOM     62  C   VAL A   9      14.350  -2.939  -6.639  1.00  0.83           C  
ATOM     63  O   VAL A   9      14.350  -2.862  -5.409  1.00  0.83           O  
ATOM     64  CB  VAL A   9      16.566  -1.873  -7.170  1.00  0.83           C  
ATOM     65  CG1 VAL A   9      17.163  -3.250  -7.527  1.00  0.83           C  
ATOM     66  CG2 VAL A   9      17.243  -0.764  -8.001  1.00  0.83           C  
ATOM     67  N   PRO A  10      13.716  -3.965  -7.220  1.00  0.90           N  
ATOM     68  CA  PRO A  10      13.045  -5.001  -6.438  1.00  0.90           C  
ATOM     69  C   PRO A  10      14.018  -5.878  -5.667  1.00  0.90           C  
ATOM     70  O   PRO A  10      15.062  -6.237  -6.211  1.00  0.90           O  
ATOM     71  CB  PRO A  10      12.316  -5.845  -7.496  1.00  0.90           C  
ATOM     72  CG  PRO A  10      12.076  -4.876  -8.653  1.00  0.90           C  
ATOM     73  CD  PRO A  10      13.353  -4.039  -8.639  1.00  0.90           C  
ATOM     74  N   VAL A  11      13.701  -6.256  -4.415  1.00  0.90           N  
ATOM     75  CA  VAL A  11      14.553  -7.098  -3.597  1.00  0.90           C  
ATOM     76  C   VAL A  11      13.752  -8.345  -3.239  1.00  0.90           C  
ATOM     77  O   VAL A  11      12.540  -8.230  -3.037  1.00  0.90           O  
ATOM     78  CB  VAL A  11      15.083  -6.402  -2.342  1.00  0.90           C  
ATOM     79  CG1 VAL A  11      16.044  -5.284  -2.791  1.00  0.90           C  
ATOM     80  CG2 VAL A  11      13.940  -5.849  -1.468  1.00  0.90           C  
ATOM     81  N   PRO A  12      14.308  -9.555  -3.191  1.00  0.94           N  
ATOM     82  CA  PRO A  12      13.592 -10.753  -2.756  1.00  0.94           C  
ATOM     83  C   PRO A  12      12.887 -10.688  -1.403  1.00  0.94           C  
ATOM     84  O   PRO A  12      13.437 -10.157  -0.438  1.00  0.94           O  
ATOM     85  CB  PRO A  12      14.645 -11.868  -2.811  1.00  0.94           C  
ATOM     86  CG  PRO A  12      15.632 -11.388  -3.877  1.00  0.94           C  
ATOM     87  CD  PRO A  12      15.656  -9.875  -3.666  1.00  0.94           C  
ATOM     88  N   ILE A  13      11.671 -11.259  -1.286  1.00  0.94           N  
ATOM     89  CA  ILE A  13      10.906 -11.250  -0.043  1.00  0.94           C  
ATOM     90  C   ILE A  13      11.326 -12.402   0.873  1.00  0.94           C  
ATOM     91  O   ILE A  13      10.991 -13.574   0.678  1.00  0.94           O  
ATOM     92  CB  ILE A  13       9.395 -11.235  -0.295  1.00  0.94           C  
ATOM     93  CG1 ILE A  13       8.987  -9.911  -0.986  1.00  0.94           C  
ATOM     94  CG2 ILE A  13       8.594 -11.426   1.013  1.00  0.94           C  
ATOM     95  CD1 ILE A  13       7.596  -9.945  -1.626  1.00  0.94           C  
ATOM     96  N   THR A  14      12.080 -12.081   1.944  1.00  0.96           N  
ATOM     97  CA  THR A  14      12.531 -13.026   2.954  1.00  0.96           C  
ATOM     98  C   THR A  14      11.464 -13.189   4.013  1.00  0.96           C  
ATOM     99  O   THR A  14      10.409 -12.560   3.978  1.00  0.96           O  
ATOM    100  CB  THR A  14      13.883 -12.679   3.602  1.00  0.96           C  
ATOM    101  OG1 THR A  14      13.816 -11.563   4.470  1.00  0.96           O  
ATOM    102  CG2 THR A  14      14.890 -12.322   2.509  1.00  0.96           C  
ATOM    103  N   ASN A  15      11.676 -14.078   4.999  1.00  0.94           N  
ATOM    104  CA  ASN A  15      10.841 -14.131   6.191  1.00  0.94           C  
ATOM    105  C   ASN A  15      10.912 -12.868   7.028  1.00  0.94           C  
ATOM    106  O   ASN A  15       9.886 -12.400   7.504  1.00  0.94           O  
ATOM    107  CB  ASN A  15      11.186 -15.367   7.044  1.00  0.94           C  
ATOM    108  CG  ASN A  15      12.654 -15.260   7.448  1.00  0.94           C  
ATOM    109  OD1 ASN A  15      13.456 -14.546   6.847  1.00  0.94           O  
ATOM    110  ND2 ASN A  15      13.045 -16.021   8.492  1.00  0.94           N  
ATOM    111  N   ALA A  16      12.112 -12.263   7.158  1.00  0.99           N  
ATOM    112  CA  ALA A  16      12.296 -10.984   7.813  1.00  0.99           C  
ATOM    113  C   ALA A  16      11.514  -9.867   7.113  1.00  0.99           C  
ATOM    114  O   ALA A  16      10.846  -9.070   7.761  1.00  0.99           O  
ATOM    115  CB  ALA A  16      13.798 -10.633   7.887  1.00  0.99           C  
ATOM    116  N   THR A  17      11.512  -9.840   5.758  1.00  0.93           N  
ATOM    117  CA  THR A  17      10.704  -8.925   4.941  1.00  0.93           C  
ATOM    118  C   THR A  17       9.218  -9.054   5.226  1.00  0.93           C  
ATOM    119  O   THR A  17       8.497  -8.068   5.345  1.00  0.93           O  
ATOM    120  CB  THR A  17      10.860  -9.152   3.429  1.00  0.93           C  
ATOM    121  OG1 THR A  17      12.221  -9.211   3.039  1.00  0.93           O  
ATOM    122  CG2 THR A  17      10.221  -8.029   2.599  1.00  0.93           C  
ATOM    123  N   LEU A  18       8.718 -10.299   5.371  1.00  0.94           N  
ATOM    124  CA  LEU A  18       7.355 -10.557   5.811  1.00  0.94           C  
ATOM    125  C   LEU A  18       7.067 -10.086   7.236  1.00  0.94           C  
ATOM    126  O   LEU A  18       6.059  -9.435   7.479  1.00  0.94           O  
ATOM    127  CB  LEU A  18       6.969 -12.048   5.668  1.00  0.94           C  
ATOM    128  CG  LEU A  18       6.918 -12.562   4.215  1.00  0.94           C  
ATOM    129  CD1 LEU A  18       6.685 -14.077   4.189  1.00  0.94           C  
ATOM    130  CD2 LEU A  18       5.851 -11.853   3.369  1.00  0.94           C  
ATOM    131  N   ASP A  19       7.975 -10.343   8.202  1.00  0.96           N  
ATOM    132  CA  ASP A  19       7.865  -9.854   9.569  1.00  0.96           C  
ATOM    133  C   ASP A  19       7.812  -8.330   9.664  1.00  0.96           C  
ATOM    134  O   ASP A  19       7.042  -7.765  10.435  1.00  0.96           O  
ATOM    135  CB  ASP A  19       9.033 -10.388  10.434  1.00  0.96           C  
ATOM    136  CG  ASP A  19       8.846 -11.852  10.695  1.00  0.96           C  
ATOM    137  OD1 ASP A  19       7.746 -12.246  11.174  1.00  0.96           O  
ATOM    138  OD2 ASP A  19       9.777 -12.662  10.432  1.00  0.96           O  
ATOM    139  N   GLN A  20       8.608  -7.632   8.834  1.00  0.92           N  
ATOM    140  CA  GLN A  20       8.602  -6.185   8.703  1.00  0.92           C  
ATOM    141  C   GLN A  20       7.297  -5.555   8.216  1.00  0.92           C  
ATOM    142  O   GLN A  20       6.992  -4.425   8.588  1.00  0.92           O  
ATOM    143  CB  GLN A  20       9.724  -5.708   7.756  1.00  0.92           C  
ATOM    144  CG  GLN A  20      11.149  -5.828   8.329  1.00  0.92           C  
ATOM    145  CD  GLN A  20      12.180  -5.458   7.261  1.00  0.92           C  
ATOM    146  OE1 GLN A  20      11.956  -5.563   6.057  1.00  0.92           O  
ATOM    147  NE2 GLN A  20      13.375  -5.012   7.719  1.00  0.92           N  
ATOM    148  N   ILE A  21       6.516  -6.240   7.350  1.00  0.95           N  
ATOM    149  CA  ILE A  21       5.249  -5.719   6.849  1.00  0.95           C  
ATOM    150  C   ILE A  21       4.049  -6.241   7.635  1.00  0.95           C  
ATOM    151  O   ILE A  21       2.909  -5.876   7.360  1.00  0.95           O  
ATOM    152  CB  ILE A  21       5.029  -6.006   5.360  1.00  0.95           C  
ATOM    153  CG1 ILE A  21       4.938  -7.518   5.053  1.00  0.95           C  
ATOM    154  CG2 ILE A  21       6.152  -5.311   4.563  1.00  0.95           C  
ATOM    155  CD1 ILE A  21       4.520  -7.839   3.616  1.00  0.95           C  
ATOM    156  N   THR A  22       4.250  -7.106   8.648  1.00  0.97           N  
ATOM    157  CA  THR A  22       3.173  -7.607   9.510  1.00  0.97           C  
ATOM    158  C   THR A  22       2.550  -6.512  10.358  1.00  0.97           C  
ATOM    159  O   THR A  22       3.242  -5.772  11.055  1.00  0.97           O  
ATOM    160  CB  THR A  22       3.626  -8.724  10.455  1.00  0.97           C  
ATOM    161  OG1 THR A  22       4.053  -9.857   9.719  1.00  0.97           O  
ATOM    162  CG2 THR A  22       2.503  -9.244  11.370  1.00  0.97           C  
ATOM    163  N   GLY A  23       1.204  -6.390  10.360  1.00  0.98           N  
ATOM    164  CA  GLY A  23       0.520  -5.393  11.180  1.00  0.98           C  
ATOM    165  C   GLY A  23      -0.388  -4.493  10.391  1.00  0.98           C  
ATOM    166  O   GLY A  23      -0.889  -4.862   9.331  1.00  0.98           O  
ATOM    167  N   LYS A  24      -0.672  -3.296  10.939  1.00  0.94           N  
ATOM    168  CA  LYS A  24      -1.634  -2.354  10.398  1.00  0.94           C  
ATOM    169  C   LYS A  24      -0.944  -1.286   9.573  1.00  0.94           C  
ATOM    170  O   LYS A  24       0.038  -0.693  10.012  1.00  0.94           O  
ATOM    171  CB  LYS A  24      -2.435  -1.654  11.531  1.00  0.94           C  
ATOM    172  CG  LYS A  24      -3.581  -0.747  11.037  1.00  0.94           C  
ATOM    173  CD  LYS A  24      -4.425  -0.139  12.176  1.00  0.94           C  
ATOM    174  CE  LYS A  24      -5.649   0.629  11.652  1.00  0.94           C  
ATOM    175  NZ  LYS A  24      -6.586   1.004  12.721  1.00  0.94           N  
ATOM    176  N   TRP A  25      -1.464  -0.996   8.367  1.00  0.91           N  
ATOM    177  CA  TRP A  25      -0.920   0.018   7.495  1.00  0.91           C  
ATOM    178  C   TRP A  25      -2.034   0.909   7.009  1.00  0.91           C  
ATOM    179  O   TRP A  25      -3.195   0.508   6.914  1.00  0.91           O  
ATOM    180  CB  TRP A  25      -0.245  -0.609   6.253  1.00  0.91           C  
ATOM    181  CG  TRP A  25       0.930  -1.490   6.606  1.00  0.91           C  
ATOM    182  CD1 TRP A  25       0.948  -2.813   6.940  1.00  0.91           C  
ATOM    183  CD2 TRP A  25       2.261  -0.996   6.804  1.00  0.91           C  
ATOM    184  NE1 TRP A  25       2.209  -3.173   7.354  1.00  0.91           N  
ATOM    185  CE2 TRP A  25       3.021  -2.066   7.324  1.00  0.91           C  
ATOM    186  CE3 TRP A  25       2.825   0.255   6.604  1.00  0.91           C  
ATOM    187  CZ2 TRP A  25       4.339  -1.874   7.713  1.00  0.91           C  
ATOM    188  CZ3 TRP A  25       4.157   0.444   6.984  1.00  0.91           C  
ATOM    189  CH2 TRP A  25       4.896  -0.591   7.574  1.00  0.91           C  
ATOM    190  N   PHE A  26      -1.691   2.157   6.672  1.00  0.95           N  
ATOM    191  CA  PHE A  26      -2.609   3.141   6.160  1.00  0.95           C  
ATOM    192  C   PHE A  26      -2.156   3.500   4.772  1.00  0.95           C  
ATOM    193  O   PHE A  26      -0.977   3.751   4.521  1.00  0.95           O  
ATOM    194  CB  PHE A  26      -2.604   4.432   7.002  1.00  0.95           C  
ATOM    195  CG  PHE A  26      -3.130   4.169   8.379  1.00  0.95           C  
ATOM    196  CD1 PHE A  26      -4.451   4.496   8.714  1.00  0.95           C  
ATOM    197  CD2 PHE A  26      -2.294   3.624   9.365  1.00  0.95           C  
ATOM    198  CE1 PHE A  26      -4.918   4.308  10.021  1.00  0.95           C  
ATOM    199  CE2 PHE A  26      -2.761   3.425  10.667  1.00  0.95           C  
ATOM    200  CZ  PHE A  26      -4.067   3.787  11.001  1.00  0.95           C  
ATOM    201  N   TYR A  27      -3.095   3.525   3.817  1.00  0.96           N  
ATOM    202  CA  TYR A  27      -2.855   4.013   2.480  1.00  0.96           C  
ATOM    203  C   TYR A  27      -2.834   5.536   2.534  1.00  0.96           C  
ATOM    204  O   TYR A  27      -3.797   6.165   2.973  1.00  0.96           O  
ATOM    205  CB  TYR A  27      -3.966   3.452   1.556  1.00  0.96           C  
ATOM    206  CG  TYR A  27      -3.964   4.022   0.164  1.00  0.96           C  
ATOM    207  CD1 TYR A  27      -5.106   4.696  -0.287  1.00  0.96           C  
ATOM    208  CD2 TYR A  27      -2.836   3.961  -0.669  1.00  0.96           C  
ATOM    209  CE1 TYR A  27      -5.094   5.385  -1.501  1.00  0.96           C  
ATOM    210  CE2 TYR A  27      -2.836   4.616  -1.912  1.00  0.96           C  
ATOM    211  CZ  TYR A  27      -3.949   5.380  -2.294  1.00  0.96           C  
ATOM    212  OH  TYR A  27      -3.992   6.232  -3.408  1.00  0.96           O  
ATOM    213  N   ILE A  28      -1.704   6.147   2.133  1.00  0.95           N  
ATOM    214  CA  ILE A  28      -1.491   7.582   2.235  1.00  0.95           C  
ATOM    215  C   ILE A  28      -1.711   8.253   0.892  1.00  0.95           C  
ATOM    216  O   ILE A  28      -2.416   9.253   0.789  1.00  0.95           O  
ATOM    217  CB  ILE A  28      -0.080   7.866   2.748  1.00  0.95           C  
ATOM    218  CG1 ILE A  28       0.215   7.132   4.082  1.00  0.95           C  
ATOM    219  CG2 ILE A  28       0.210   9.382   2.847  1.00  0.95           C  
ATOM    220  CD1 ILE A  28      -0.725   7.476   5.238  1.00  0.95           C  
ATOM    221  N   ALA A  29      -1.117   7.716  -0.191  1.00  0.95           N  
ATOM    222  CA  ALA A  29      -1.201   8.381  -1.469  1.00  0.95           C  
ATOM    223  C   ALA A  29      -0.837   7.451  -2.610  1.00  0.95           C  
ATOM    224  O   ALA A  29      -0.314   6.356  -2.401  1.00  0.95           O  
ATOM    225  CB  ALA A  29      -0.266   9.604  -1.515  1.00  0.95           C  
ATOM    226  N   SER A  30      -1.069   7.861  -3.867  1.00  0.95           N  
ATOM    227  CA  SER A  30      -0.516   7.163  -5.011  1.00  0.95           C  
ATOM    228  C   SER A  30      -0.488   8.050  -6.229  1.00  0.95           C  
ATOM    229  O   SER A  30      -1.134   9.094  -6.276  1.00  0.95           O  
ATOM    230  CB  SER A  30      -1.226   5.840  -5.407  1.00  0.95           C  
ATOM    231  OG  SER A  30      -2.581   6.045  -5.777  1.00  0.95           O  
ATOM    232  N   ALA A  31       0.292   7.658  -7.249  1.00  0.97           N  
ATOM    233  CA  ALA A  31       0.233   8.286  -8.545  1.00  0.97           C  
ATOM    234  C   ALA A  31       0.590   7.238  -9.583  1.00  0.97           C  
ATOM    235  O   ALA A  31       1.536   6.467  -9.398  1.00  0.97           O  
ATOM    236  CB  ALA A  31       1.196   9.485  -8.636  1.00  0.97           C  
ATOM    237  N   PHE A  32      -0.158   7.175 -10.699  1.00  0.92           N  
ATOM    238  CA  PHE A  32       0.062   6.196 -11.741  1.00  0.92           C  
ATOM    239  C   PHE A  32       0.006   6.887 -13.076  1.00  0.92           C  
ATOM    240  O   PHE A  32      -0.652   7.911 -13.236  1.00  0.92           O  
ATOM    241  CB  PHE A  32      -1.043   5.109 -11.787  1.00  0.92           C  
ATOM    242  CG  PHE A  32      -1.106   4.328 -10.520  1.00  0.92           C  
ATOM    243  CD1 PHE A  32      -0.365   3.148 -10.410  1.00  0.92           C  
ATOM    244  CD2 PHE A  32      -1.935   4.720  -9.458  1.00  0.92           C  
ATOM    245  CE1 PHE A  32      -0.396   2.405  -9.228  1.00  0.92           C  
ATOM    246  CE2 PHE A  32      -2.010   3.938  -8.303  1.00  0.92           C  
ATOM    247  CZ  PHE A  32      -1.220   2.795  -8.171  1.00  0.92           C  
ATOM    248  N   ARG A  33       0.673   6.318 -14.097  1.00  0.87           N  
ATOM    249  CA  ARG A  33       0.424   6.725 -15.466  1.00  0.87           C  
ATOM    250  C   ARG A  33      -0.710   5.913 -16.069  1.00  0.87           C  
ATOM    251  O   ARG A  33      -1.328   6.303 -17.051  1.00  0.87           O  
ATOM    252  CB  ARG A  33       1.673   6.523 -16.344  1.00  0.87           C  
ATOM    253  CG  ARG A  33       2.786   7.556 -16.104  1.00  0.87           C  
ATOM    254  CD  ARG A  33       3.933   7.355 -17.087  1.00  0.87           C  
ATOM    255  NE  ARG A  33       4.957   8.417 -16.830  1.00  0.87           N  
ATOM    256  CZ  ARG A  33       6.143   8.431 -17.451  1.00  0.87           C  
ATOM    257  NH1 ARG A  33       6.514   7.456 -18.270  1.00  0.87           N  
ATOM    258  NH2 ARG A  33       6.995   9.418 -17.218  1.00  0.87           N  
ATOM    259  N   ASN A  34      -1.046   4.760 -15.461  1.00  0.87           N  
ATOM    260  CA  ASN A  34      -2.224   4.013 -15.836  1.00  0.87           C  
ATOM    261  C   ASN A  34      -3.519   4.724 -15.390  1.00  0.87           C  
ATOM    262  O   ASN A  34      -3.807   4.878 -14.201  1.00  0.87           O  
ATOM    263  CB  ASN A  34      -2.111   2.560 -15.304  1.00  0.87           C  
ATOM    264  CG  ASN A  34      -3.281   1.705 -15.769  1.00  0.87           C  
ATOM    265  OD1 ASN A  34      -4.367   1.806 -15.198  1.00  0.87           O  
ATOM    266  ND2 ASN A  34      -3.101   0.896 -16.830  1.00  0.87           N  
ATOM    267  N   GLU A  35      -4.346   5.137 -16.372  1.00  0.79           N  
ATOM    268  CA  GLU A  35      -5.626   5.805 -16.191  1.00  0.79           C  
ATOM    269  C   GLU A  35      -6.687   5.012 -15.436  1.00  0.79           C  
ATOM    270  O   GLU A  35      -7.479   5.566 -14.673  1.00  0.79           O  
ATOM    271  CB  GLU A  35      -6.181   6.263 -17.566  1.00  0.79           C  
ATOM    272  CG  GLU A  35      -5.316   7.379 -18.202  1.00  0.79           C  
ATOM    273  CD  GLU A  35      -5.375   8.659 -17.364  1.00  0.79           C  
ATOM    274  OE1 GLU A  35      -4.426   9.469 -17.466  1.00  0.79           O  
ATOM    275  OE2 GLU A  35      -6.376   8.827 -16.614  1.00  0.79           O  
ATOM    276  N   GLU A  36      -6.747   3.677 -15.615  1.00  0.79           N  
ATOM    277  CA  GLU A  36      -7.690   2.815 -14.915  1.00  0.79           C  
ATOM    278  C   GLU A  36      -7.443   2.813 -13.410  1.00  0.79           C  
ATOM    279  O   GLU A  36      -8.352   2.973 -12.594  1.00  0.79           O  
ATOM    280  CB  GLU A  36      -7.603   1.384 -15.481  1.00  0.79           C  
ATOM    281  CG  GLU A  36      -8.650   0.395 -14.923  1.00  0.79           C  
ATOM    282  CD  GLU A  36      -8.504  -1.001 -15.540  1.00  0.79           C  
ATOM    283  OE1 GLU A  36      -9.277  -1.897 -15.115  1.00  0.79           O  
ATOM    284  OE2 GLU A  36      -7.630  -1.182 -16.427  1.00  0.79           O  
ATOM    285  N   TYR A  37      -6.156   2.719 -13.022  1.00  0.87           N  
ATOM    286  CA  TYR A  37      -5.714   2.840 -11.646  1.00  0.87           C  
ATOM    287  C   TYR A  37      -5.994   4.206 -11.034  1.00  0.87           C  
ATOM    288  O   TYR A  37      -6.511   4.285  -9.923  1.00  0.87           O  
ATOM    289  CB  TYR A  37      -4.211   2.517 -11.502  1.00  0.87           C  
ATOM    290  CG  TYR A  37      -3.954   1.038 -11.361  1.00  0.87           C  
ATOM    291  CD1 TYR A  37      -3.238   0.585 -10.244  1.00  0.87           C  
ATOM    292  CD2 TYR A  37      -4.362   0.094 -12.320  1.00  0.87           C  
ATOM    293  CE1 TYR A  37      -2.875  -0.758 -10.116  1.00  0.87           C  
ATOM    294  CE2 TYR A  37      -4.011  -1.259 -12.190  1.00  0.87           C  
ATOM    295  CZ  TYR A  37      -3.250  -1.686 -11.095  1.00  0.87           C  
ATOM    296  OH  TYR A  37      -2.853  -3.029 -10.940  1.00  0.87           O  
ATOM    297  N   ASN A  38      -5.718   5.313 -11.761  1.00  0.84           N  
ATOM    298  CA  ASN A  38      -6.028   6.668 -11.308  1.00  0.84           C  
ATOM    299  C   ASN A  38      -7.512   6.890 -11.027  1.00  0.84           C  
ATOM    300  O   ASN A  38      -7.882   7.448  -9.997  1.00  0.84           O  
ATOM    301  CB  ASN A  38      -5.561   7.733 -12.336  1.00  0.84           C  
ATOM    302  CG  ASN A  38      -4.963   8.941 -11.619  1.00  0.84           C  
ATOM    303  OD1 ASN A  38      -5.201   9.183 -10.435  1.00  0.84           O  
ATOM    304  ND2 ASN A  38      -4.174   9.750 -12.362  1.00  0.84           N  
ATOM    305  N   LYS A  39      -8.403   6.406 -11.914  1.00  0.79           N  
ATOM    306  CA  LYS A  39      -9.841   6.436 -11.694  1.00  0.79           C  
ATOM    307  C   LYS A  39     -10.311   5.637 -10.486  1.00  0.79           C  
ATOM    308  O   LYS A  39     -11.112   6.113  -9.690  1.00  0.79           O  
ATOM    309  CB  LYS A  39     -10.577   5.920 -12.950  1.00  0.79           C  
ATOM    310  CG  LYS A  39     -10.510   6.927 -14.105  1.00  0.79           C  
ATOM    311  CD  LYS A  39     -11.115   6.388 -15.408  1.00  0.79           C  
ATOM    312  CE  LYS A  39     -10.970   7.383 -16.560  1.00  0.79           C  
ATOM    313  NZ  LYS A  39     -11.478   6.779 -17.811  1.00  0.79           N  
ATOM    314  N   SER A  40      -9.791   4.405 -10.302  1.00  0.81           N  
ATOM    315  CA  SER A  40     -10.118   3.560  -9.153  1.00  0.81           C  
ATOM    316  C   SER A  40      -9.694   4.173  -7.826  1.00  0.81           C  
ATOM    317  O   SER A  40     -10.440   4.203  -6.849  1.00  0.81           O  
ATOM    318  CB  SER A  40      -9.439   2.171  -9.300  1.00  0.81           C  
ATOM    319  OG  SER A  40      -9.847   1.236  -8.297  1.00  0.81           O  
ATOM    320  N   VAL A  41      -8.468   4.730  -7.793  1.00  0.88           N  
ATOM    321  CA  VAL A  41      -7.917   5.439  -6.652  1.00  0.88           C  
ATOM    322  C   VAL A  41      -8.677   6.703  -6.294  1.00  0.88           C  
ATOM    323  O   VAL A  41      -8.883   6.991  -5.120  1.00  0.88           O  
ATOM    324  CB  VAL A  41      -6.437   5.714  -6.853  1.00  0.88           C  
ATOM    325  CG1 VAL A  41      -5.901   6.679  -5.787  1.00  0.88           C  
ATOM    326  CG2 VAL A  41      -5.701   4.364  -6.763  1.00  0.88           C  
ATOM    327  N   GLN A  42      -9.151   7.482  -7.287  1.00  0.83           N  
ATOM    328  CA  GLN A  42      -9.851   8.744  -7.079  1.00  0.83           C  
ATOM    329  C   GLN A  42     -11.076   8.663  -6.168  1.00  0.83           C  
ATOM    330  O   GLN A  42     -11.412   9.605  -5.452  1.00  0.83           O  
ATOM    331  CB  GLN A  42     -10.247   9.350  -8.447  1.00  0.83           C  
ATOM    332  CG  GLN A  42     -10.794  10.792  -8.363  1.00  0.83           C  
ATOM    333  CD  GLN A  42     -11.097  11.372  -9.745  1.00  0.83           C  
ATOM    334  OE1 GLN A  42     -11.022  10.737 -10.792  1.00  0.83           O  
ATOM    335  NE2 GLN A  42     -11.460  12.679  -9.746  1.00  0.83           N  
ATOM    336  N   GLU A  43     -11.762   7.508  -6.157  1.00  0.84           N  
ATOM    337  CA  GLU A  43     -12.873   7.260  -5.268  1.00  0.84           C  
ATOM    338  C   GLU A  43     -12.484   6.935  -3.824  1.00  0.84           C  
ATOM    339  O   GLU A  43     -13.318   7.009  -2.920  1.00  0.84           O  
ATOM    340  CB  GLU A  43     -13.699   6.085  -5.817  1.00  0.84           C  
ATOM    341  CG  GLU A  43     -14.303   6.336  -7.221  1.00  0.84           C  
ATOM    342  CD  GLU A  43     -15.354   5.282  -7.552  1.00  0.84           C  
ATOM    343  OE1 GLU A  43     -15.980   5.360  -8.633  1.00  0.84           O  
ATOM    344  OE2 GLU A  43     -15.567   4.380  -6.690  1.00  0.84           O  
ATOM    345  N   ILE A  44     -11.214   6.561  -3.557  1.00  0.93           N  
ATOM    346  CA  ILE A  44     -10.745   6.156  -2.238  1.00  0.93           C  
ATOM    347  C   ILE A  44     -10.525   7.371  -1.353  1.00  0.93           C  
ATOM    348  O   ILE A  44      -9.624   8.181  -1.558  1.00  0.93           O  
ATOM    349  CB  ILE A  44      -9.464   5.314  -2.296  1.00  0.93           C  
ATOM    350  CG1 ILE A  44      -9.672   4.048  -3.165  1.00  0.93           C  
ATOM    351  CG2 ILE A  44      -8.997   4.949  -0.868  1.00  0.93           C  
ATOM    352  CD1 ILE A  44      -8.400   3.221  -3.392  1.00  0.93           C  
ATOM    353  N   GLN A  45     -11.356   7.533  -0.308  1.00  0.90           N  
ATOM    354  CA  GLN A  45     -11.239   8.647   0.608  1.00  0.90           C  
ATOM    355  C   GLN A  45     -10.240   8.354   1.715  1.00  0.90           C  
ATOM    356  O   GLN A  45      -9.414   9.192   2.061  1.00  0.90           O  
ATOM    357  CB  GLN A  45     -12.633   8.991   1.175  1.00  0.90           C  
ATOM    358  CG  GLN A  45     -13.635   9.395   0.064  1.00  0.90           C  
ATOM    359  CD  GLN A  45     -15.061   9.483   0.613  1.00  0.90           C  
ATOM    360  OE1 GLN A  45     -15.655   8.457   0.934  1.00  0.90           O  
ATOM    361  NE2 GLN A  45     -15.637  10.704   0.690  1.00  0.90           N  
ATOM    362  N   ALA A  46     -10.273   7.129   2.270  1.00  0.95           N  
ATOM    363  CA  ALA A  46      -9.336   6.685   3.275  1.00  0.95           C  
ATOM    364  C   ALA A  46      -9.283   5.172   3.192  1.00  0.95           C  
ATOM    365  O   ALA A  46     -10.285   4.544   2.871  1.00  0.95           O  
ATOM    366  CB  ALA A  46      -9.780   7.099   4.693  1.00  0.95           C  
ATOM    367  N   THR A  47      -8.132   4.533   3.471  1.00  0.94           N  
ATOM    368  CA  THR A  47      -8.078   3.068   3.507  1.00  0.94           C  
ATOM    369  C   THR A  47      -7.039   2.673   4.522  1.00  0.94           C  
ATOM    370  O   THR A  47      -5.921   3.194   4.517  1.00  0.94           O  
ATOM    371  CB  THR A  47      -7.668   2.378   2.191  1.00  0.94           C  
ATOM    372  OG1 THR A  47      -8.641   2.514   1.172  1.00  0.94           O  
ATOM    373  CG2 THR A  47      -7.467   0.862   2.327  1.00  0.94           C  
ATOM    374  N   PHE A  48      -7.346   1.697   5.386  1.00  0.94           N  
ATOM    375  CA  PHE A  48      -6.362   1.072   6.238  1.00  0.94           C  
ATOM    376  C   PHE A  48      -6.527  -0.421   6.102  1.00  0.94           C  
ATOM    377  O   PHE A  48      -7.557  -0.918   5.646  1.00  0.94           O  
ATOM    378  CB  PHE A  48      -6.420   1.516   7.728  1.00  0.94           C  
ATOM    379  CG  PHE A  48      -7.725   1.215   8.413  1.00  0.94           C  
ATOM    380  CD1 PHE A  48      -8.751   2.169   8.418  1.00  0.94           C  
ATOM    381  CD2 PHE A  48      -7.927  -0.000   9.089  1.00  0.94           C  
ATOM    382  CE1 PHE A  48      -9.937   1.943   9.122  1.00  0.94           C  
ATOM    383  CE2 PHE A  48      -9.115  -0.232   9.792  1.00  0.94           C  
ATOM    384  CZ  PHE A  48     -10.119   0.742   9.810  1.00  0.94           C  
ATOM    385  N   PHE A  49      -5.500  -1.188   6.476  1.00  0.93           N  
ATOM    386  CA  PHE A  49      -5.578  -2.616   6.346  1.00  0.93           C  
ATOM    387  C   PHE A  49      -4.605  -3.297   7.271  1.00  0.93           C  
ATOM    388  O   PHE A  49      -3.714  -2.671   7.840  1.00  0.93           O  
ATOM    389  CB  PHE A  49      -5.383  -3.110   4.886  1.00  0.93           C  
ATOM    390  CG  PHE A  49      -4.102  -2.637   4.276  1.00  0.93           C  
ATOM    391  CD1 PHE A  49      -4.094  -1.424   3.576  1.00  0.93           C  
ATOM    392  CD2 PHE A  49      -2.908  -3.362   4.411  1.00  0.93           C  
ATOM    393  CE1 PHE A  49      -2.911  -0.930   3.028  1.00  0.93           C  
ATOM    394  CE2 PHE A  49      -1.721  -2.867   3.859  1.00  0.93           C  
ATOM    395  CZ  PHE A  49      -1.722  -1.656   3.159  1.00  0.93           C  
ATOM    396  N   TYR A  50      -4.783  -4.616   7.443  1.00  0.94           N  
ATOM    397  CA  TYR A  50      -3.927  -5.459   8.239  1.00  0.94           C  
ATOM    398  C   TYR A  50      -3.341  -6.538   7.362  1.00  0.94           C  
ATOM    399  O   TYR A  50      -4.066  -7.194   6.611  1.00  0.94           O  
ATOM    400  CB  TYR A  50      -4.679  -6.214   9.357  1.00  0.94           C  
ATOM    401  CG  TYR A  50      -5.144  -5.291  10.431  1.00  0.94           C  
ATOM    402  CD1 TYR A  50      -4.418  -5.215  11.629  1.00  0.94           C  
ATOM    403  CD2 TYR A  50      -6.303  -4.514  10.274  1.00  0.94           C  
ATOM    404  CE1 TYR A  50      -4.855  -4.394  12.667  1.00  0.94           C  
ATOM    405  CE2 TYR A  50      -6.737  -3.675  11.311  1.00  0.94           C  
ATOM    406  CZ  TYR A  50      -6.006  -3.638  12.509  1.00  0.94           C  
ATOM    407  OH  TYR A  50      -6.350  -2.850  13.606  1.00  0.94           O  
ATOM    408  N   PHE A  51      -2.028  -6.771   7.490  1.00  0.92           N  
ATOM    409  CA  PHE A  51      -1.340  -7.877   6.865  1.00  0.92           C  
ATOM    410  C   PHE A  51      -0.961  -8.898   7.914  1.00  0.92           C  
ATOM    411  O   PHE A  51      -0.316  -8.582   8.915  1.00  0.92           O  
ATOM    412  CB  PHE A  51      -0.011  -7.443   6.197  1.00  0.92           C  
ATOM    413  CG  PHE A  51      -0.160  -6.750   4.875  1.00  0.92           C  
ATOM    414  CD1 PHE A  51      -1.224  -7.000   3.990  1.00  0.92           C  
ATOM    415  CD2 PHE A  51       0.877  -5.899   4.459  1.00  0.92           C  
ATOM    416  CE1 PHE A  51      -1.244  -6.411   2.723  1.00  0.92           C  
ATOM    417  CE2 PHE A  51       0.863  -5.316   3.187  1.00  0.92           C  
ATOM    418  CZ  PHE A  51      -0.202  -5.573   2.317  1.00  0.92           C  
ATOM    419  N   THR A  52      -1.333 -10.167   7.672  1.00  0.94           N  
ATOM    420  CA  THR A  52      -0.932 -11.291   8.507  1.00  0.94           C  
ATOM    421  C   THR A  52      -0.293 -12.344   7.596  1.00  0.94           C  
ATOM    422  O   THR A  52      -1.021 -13.099   6.945  1.00  0.94           O  
ATOM    423  CB  THR A  52      -2.123 -11.951   9.209  1.00  0.94           C  
ATOM    424  OG1 THR A  52      -2.870 -11.065  10.032  1.00  0.94           O  
ATOM    425  CG2 THR A  52      -1.681 -13.055  10.172  1.00  0.94           C  
ATOM    426  N   PRO A  53       1.030 -12.449   7.475  1.00  0.97           N  
ATOM    427  CA  PRO A  53       1.659 -13.379   6.533  1.00  0.97           C  
ATOM    428  C   PRO A  53       1.708 -14.832   6.964  1.00  0.97           C  
ATOM    429  O   PRO A  53       2.021 -15.120   8.116  1.00  0.97           O  
ATOM    430  CB  PRO A  53       3.101 -12.865   6.393  1.00  0.97           C  
ATOM    431  CG  PRO A  53       3.010 -11.382   6.737  1.00  0.97           C  
ATOM    432  CD  PRO A  53       1.951 -11.369   7.834  1.00  0.97           C  
ATOM    433  N   ASN A  54       1.494 -15.775   6.030  1.00  0.92           N  
ATOM    434  CA  ASN A  54       1.773 -17.177   6.235  1.00  0.92           C  
ATOM    435  C   ASN A  54       3.075 -17.420   5.482  1.00  0.92           C  
ATOM    436  O   ASN A  54       3.135 -17.360   4.257  1.00  0.92           O  
ATOM    437  CB  ASN A  54       0.603 -18.067   5.722  1.00  0.92           C  
ATOM    438  CG  ASN A  54      -0.725 -17.777   6.427  1.00  0.92           C  
ATOM    439  OD1 ASN A  54      -0.927 -16.716   7.022  1.00  0.92           O  
ATOM    440  ND2 ASN A  54      -1.657 -18.752   6.380  1.00  0.92           N  
ATOM    441  N   LYS A  55       4.170 -17.677   6.224  1.00  0.89           N  
ATOM    442  CA  LYS A  55       5.503 -17.844   5.677  1.00  0.89           C  
ATOM    443  C   LYS A  55       5.729 -19.210   5.051  1.00  0.89           C  
ATOM    444  O   LYS A  55       6.715 -19.415   4.353  1.00  0.89           O  
ATOM    445  CB  LYS A  55       6.557 -17.665   6.802  1.00  0.89           C  
ATOM    446  CG  LYS A  55       6.502 -16.293   7.491  1.00  0.89           C  
ATOM    447  CD  LYS A  55       7.478 -16.168   8.677  1.00  0.89           C  
ATOM    448  CE  LYS A  55       7.293 -14.850   9.436  1.00  0.89           C  
ATOM    449  NZ  LYS A  55       8.188 -14.732  10.598  1.00  0.89           N  
ATOM    450  N   THR A  56       4.831 -20.174   5.329  1.00  0.87           N  
ATOM    451  CA  THR A  56       4.903 -21.539   4.813  1.00  0.87           C  
ATOM    452  C   THR A  56       4.243 -21.651   3.457  1.00  0.87           C  
ATOM    453  O   THR A  56       4.692 -22.382   2.580  1.00  0.87           O  
ATOM    454  CB  THR A  56       4.226 -22.534   5.749  1.00  0.87           C  
ATOM    455  OG1 THR A  56       4.818 -22.476   7.041  1.00  0.87           O  
ATOM    456  CG2 THR A  56       4.395 -23.982   5.272  1.00  0.87           C  
ATOM    457  N   GLU A  57       3.133 -20.918   3.255  1.00  0.85           N  
ATOM    458  CA  GLU A  57       2.346 -21.008   2.038  1.00  0.85           C  
ATOM    459  C   GLU A  57       2.627 -19.869   1.080  1.00  0.85           C  
ATOM    460  O   GLU A  57       2.064 -19.808  -0.010  1.00  0.85           O  
ATOM    461  CB  GLU A  57       0.847 -20.957   2.403  1.00  0.85           C  
ATOM    462  CG  GLU A  57       0.360 -22.226   3.138  1.00  0.85           C  
ATOM    463  CD  GLU A  57      -1.044 -22.069   3.718  1.00  0.85           C  
ATOM    464  OE1 GLU A  57      -1.434 -22.973   4.498  1.00  0.85           O  
ATOM    465  OE2 GLU A  57      -1.691 -21.013   3.482  1.00  0.85           O  
ATOM    466  N   ASP A  58       3.507 -18.931   1.480  1.00  0.92           N  
ATOM    467  CA  ASP A  58       3.819 -17.718   0.751  1.00  0.92           C  
ATOM    468  C   ASP A  58       2.588 -16.873   0.420  1.00  0.92           C  
ATOM    469  O   ASP A  58       2.384 -16.393  -0.696  1.00  0.92           O  
ATOM    470  CB  ASP A  58       4.773 -18.004  -0.435  1.00  0.92           C  
ATOM    471  CG  ASP A  58       6.167 -18.336   0.063  1.00  0.92           C  
ATOM    472  OD1 ASP A  58       6.419 -18.312   1.299  1.00  0.92           O  
ATOM    473  OD2 ASP A  58       7.076 -18.503  -0.789  1.00  0.92           O  
ATOM    474  N   THR A  59       1.739 -16.643   1.443  1.00  0.93           N  
ATOM    475  CA  THR A  59       0.513 -15.873   1.321  1.00  0.93           C  
ATOM    476  C   THR A  59       0.473 -14.822   2.394  1.00  0.93           C  
ATOM    477  O   THR A  59       1.112 -14.926   3.439  1.00  0.93           O  
ATOM    478  CB  THR A  59      -0.805 -16.660   1.405  1.00  0.93           C  
ATOM    479  OG1 THR A  59      -0.954 -17.368   2.630  1.00  0.93           O  
ATOM    480  CG2 THR A  59      -0.863 -17.685   0.277  1.00  0.93           C  
ATOM    481  N   ILE A  60      -0.290 -13.744   2.168  1.00  0.95           N  
ATOM    482  CA  ILE A  60      -0.547 -12.743   3.183  1.00  0.95           C  
ATOM    483  C   ILE A  60      -2.040 -12.625   3.314  1.00  0.95           C  
ATOM    484  O   ILE A  60      -2.741 -12.290   2.360  1.00  0.95           O  
ATOM    485  CB  ILE A  60       0.059 -11.378   2.866  1.00  0.95           C  
ATOM    486  CG1 ILE A  60       1.589 -11.468   2.676  1.00  0.95           C  
ATOM    487  CG2 ILE A  60      -0.287 -10.371   3.984  1.00  0.95           C  
ATOM    488  CD1 ILE A  60       2.190 -10.228   2.007  1.00  0.95           C  
ATOM    489  N   PHE A  61      -2.589 -12.894   4.512  1.00  0.94           N  
ATOM    490  CA  PHE A  61      -3.990 -12.647   4.781  1.00  0.94           C  
ATOM    491  C   PHE A  61      -4.184 -11.147   4.961  1.00  0.94           C  
ATOM    492  O   PHE A  61      -3.605 -10.528   5.854  1.00  0.94           O  
ATOM    493  CB  PHE A  61      -4.473 -13.444   6.022  1.00  0.94           C  
ATOM    494  CG  PHE A  61      -5.935 -13.252   6.339  1.00  0.94           C  
ATOM    495  CD1 PHE A  61      -6.342 -12.844   7.623  1.00  0.94           C  
ATOM    496  CD2 PHE A  61      -6.913 -13.527   5.371  1.00  0.94           C  
ATOM    497  CE1 PHE A  61      -7.704 -12.728   7.934  1.00  0.94           C  
ATOM    498  CE2 PHE A  61      -8.272 -13.399   5.677  1.00  0.94           C  
ATOM    499  CZ  PHE A  61      -8.669 -12.995   6.956  1.00  0.94           C  
ATOM    500  N   LEU A  62      -4.985 -10.539   4.075  1.00  0.93           N  
ATOM    501  CA  LEU A  62      -5.240  -9.121   4.027  1.00  0.93           C  
ATOM    502  C   LEU A  62      -6.610  -8.878   4.616  1.00  0.93           C  
ATOM    503  O   LEU A  62      -7.592  -9.501   4.215  1.00  0.93           O  
ATOM    504  CB  LEU A  62      -5.203  -8.624   2.553  1.00  0.93           C  
ATOM    505  CG  LEU A  62      -5.762  -7.213   2.262  1.00  0.93           C  
ATOM    506  CD1 LEU A  62      -5.034  -6.118   3.038  1.00  0.93           C  
ATOM    507  CD2 LEU A  62      -5.715  -6.885   0.761  1.00  0.93           C  
ATOM    508  N   ARG A  63      -6.717  -7.949   5.585  1.00  0.86           N  
ATOM    509  CA  ARG A  63      -8.000  -7.450   6.037  1.00  0.86           C  
ATOM    510  C   ARG A  63      -8.062  -5.970   5.734  1.00  0.86           C  
ATOM    511  O   ARG A  63      -7.352  -5.187   6.360  1.00  0.86           O  
ATOM    512  CB  ARG A  63      -8.235  -7.659   7.561  1.00  0.86           C  
ATOM    513  CG  ARG A  63      -8.123  -9.116   8.054  1.00  0.86           C  
ATOM    514  CD  ARG A  63      -8.526  -9.334   9.520  1.00  0.86           C  
ATOM    515  NE  ARG A  63      -7.483  -8.674  10.378  1.00  0.86           N  
ATOM    516  CZ  ARG A  63      -6.414  -9.300  10.892  1.00  0.86           C  
ATOM    517  NH1 ARG A  63      -6.188 -10.586  10.665  1.00  0.86           N  
ATOM    518  NH2 ARG A  63      -5.535  -8.615  11.618  1.00  0.86           N  
ATOM    519  N   GLU A  64      -8.908  -5.557   4.779  1.00  0.88           N  
ATOM    520  CA  GLU A  64      -8.903  -4.230   4.204  1.00  0.88           C  
ATOM    521  C   GLU A  64     -10.167  -3.501   4.570  1.00  0.88           C  
ATOM    522  O   GLU A  64     -11.274  -4.035   4.487  1.00  0.88           O  
ATOM    523  CB  GLU A  64      -8.800  -4.337   2.667  1.00  0.88           C  
ATOM    524  CG  GLU A  64      -8.723  -3.004   1.884  1.00  0.88           C  
ATOM    525  CD  GLU A  64      -8.556  -3.302   0.415  1.00  0.88           C  
ATOM    526  OE1 GLU A  64      -9.502  -3.895  -0.163  1.00  0.88           O  
ATOM    527  OE2 GLU A  64      -7.490  -3.003  -0.180  1.00  0.88           O  
ATOM    528  N   TYR A  65     -10.010  -2.254   5.027  1.00  0.92           N  
ATOM    529  CA  TYR A  65     -11.093  -1.400   5.423  1.00  0.92           C  
ATOM    530  C   TYR A  65     -10.957  -0.159   4.570  1.00  0.92           C  
ATOM    531  O   TYR A  65     -10.028   0.633   4.737  1.00  0.92           O  
ATOM    532  CB  TYR A  65     -10.927  -1.000   6.896  1.00  0.92           C  
ATOM    533  CG  TYR A  65     -11.101  -2.158   7.829  1.00  0.92           C  
ATOM    534  CD1 TYR A  65     -12.298  -2.367   8.538  1.00  0.92           C  
ATOM    535  CD2 TYR A  65     -10.008  -3.003   8.064  1.00  0.92           C  
ATOM    536  CE1 TYR A  65     -12.377  -3.384   9.505  1.00  0.92           C  
ATOM    537  CE2 TYR A  65     -10.086  -4.020   9.012  1.00  0.92           C  
ATOM    538  CZ  TYR A  65     -11.252  -4.186   9.757  1.00  0.92           C  
ATOM    539  OH  TYR A  65     -11.219  -5.176  10.750  1.00  0.92           O  
ATOM    540  N   GLN A  66     -11.866   0.033   3.607  1.00  0.90           N  
ATOM    541  CA  GLN A  66     -11.740   1.067   2.607  1.00  0.90           C  
ATOM    542  C   GLN A  66     -12.948   1.977   2.630  1.00  0.90           C  
ATOM    543  O   GLN A  66     -14.088   1.536   2.493  1.00  0.90           O  
ATOM    544  CB  GLN A  66     -11.600   0.402   1.217  1.00  0.90           C  
ATOM    545  CG  GLN A  66     -11.642   1.365   0.012  1.00  0.90           C  
ATOM    546  CD  GLN A  66     -11.198   0.661  -1.270  1.00  0.90           C  
ATOM    547  OE1 GLN A  66     -11.987   0.264  -2.129  1.00  0.90           O  
ATOM    548  NE2 GLN A  66      -9.861   0.537  -1.424  1.00  0.90           N  
ATOM    549  N   THR A  67     -12.730   3.292   2.787  1.00  0.91           N  
ATOM    550  CA  THR A  67     -13.791   4.285   2.792  1.00  0.91           C  
ATOM    551  C   THR A  67     -13.937   4.841   1.387  1.00  0.91           C  
ATOM    552  O   THR A  67     -13.012   5.434   0.822  1.00  0.91           O  
ATOM    553  CB  THR A  67     -13.542   5.449   3.765  1.00  0.91           C  
ATOM    554  OG1 THR A  67     -13.487   4.991   5.107  1.00  0.91           O  
ATOM    555  CG2 THR A  67     -14.697   6.467   3.668  1.00  0.91           C  
ATOM    556  N   ARG A  68     -15.117   4.647   0.777  1.00  0.83           N  
ATOM    557  CA  ARG A  68     -15.451   5.120  -0.551  1.00  0.83           C  
ATOM    558  C   ARG A  68     -16.889   5.549  -0.509  1.00  0.83           C  
ATOM    559  O   ARG A  68     -17.716   4.908   0.132  1.00  0.83           O  
ATOM    560  CB  ARG A  68     -15.353   4.025  -1.647  1.00  0.83           C  
ATOM    561  CG  ARG A  68     -13.918   3.776  -2.124  1.00  0.83           C  
ATOM    562  CD  ARG A  68     -13.706   2.539  -2.995  1.00  0.83           C  
ATOM    563  NE  ARG A  68     -14.357   2.682  -4.333  1.00  0.83           N  
ATOM    564  CZ  ARG A  68     -14.286   1.709  -5.251  1.00  0.83           C  
ATOM    565  NH1 ARG A  68     -13.722   0.539  -4.964  1.00  0.83           N  
ATOM    566  NH2 ARG A  68     -14.754   1.935  -6.469  1.00  0.83           N  
ATOM    567  N   GLN A  69     -17.207   6.668  -1.184  1.00  0.79           N  
ATOM    568  CA  GLN A  69     -18.554   7.211  -1.289  1.00  0.79           C  
ATOM    569  C   GLN A  69     -19.225   7.490   0.062  1.00  0.79           C  
ATOM    570  O   GLN A  69     -20.421   7.285   0.249  1.00  0.79           O  
ATOM    571  CB  GLN A  69     -19.441   6.332  -2.213  1.00  0.79           C  
ATOM    572  CG  GLN A  69     -18.880   6.160  -3.648  1.00  0.79           C  
ATOM    573  CD  GLN A  69     -19.748   5.220  -4.495  1.00  0.79           C  
ATOM    574  OE1 GLN A  69     -20.761   4.675  -4.069  1.00  0.79           O  
ATOM    575  NE2 GLN A  69     -19.333   5.017  -5.769  1.00  0.79           N  
ATOM    576  N   ASP A  70     -18.421   7.956   1.040  1.00  0.83           N  
ATOM    577  CA  ASP A  70     -18.795   8.195   2.420  1.00  0.83           C  
ATOM    578  C   ASP A  70     -19.317   6.958   3.165  1.00  0.83           C  
ATOM    579  O   ASP A  70     -20.047   7.059   4.154  1.00  0.83           O  
ATOM    580  CB  ASP A  70     -19.682   9.460   2.588  1.00  0.83           C  
ATOM    581  CG  ASP A  70     -18.922  10.703   2.150  1.00  0.83           C  
ATOM    582  OD1 ASP A  70     -17.719  10.822   2.512  1.00  0.83           O  
ATOM    583  OD2 ASP A  70     -19.525  11.569   1.473  1.00  0.83           O  
ATOM    584  N   GLN A  71     -18.870   5.745   2.764  1.00  0.78           N  
ATOM    585  CA  GLN A  71     -19.259   4.497   3.388  1.00  0.78           C  
ATOM    586  C   GLN A  71     -18.059   3.584   3.562  1.00  0.78           C  
ATOM    587  O   GLN A  71     -17.065   3.674   2.844  1.00  0.78           O  
ATOM    588  CB  GLN A  71     -20.306   3.750   2.528  1.00  0.78           C  
ATOM    589  CG  GLN A  71     -21.651   4.502   2.424  1.00  0.78           C  
ATOM    590  CD  GLN A  71     -22.691   3.703   1.640  1.00  0.78           C  
ATOM    591  OE1 GLN A  71     -22.422   2.732   0.939  1.00  0.78           O  
ATOM    592  NE2 GLN A  71     -23.970   4.125   1.787  1.00  0.78           N  
ATOM    593  N   CYS A  72     -18.119   2.659   4.545  1.00  0.90           N  
ATOM    594  CA  CYS A  72     -17.050   1.705   4.777  1.00  0.90           C  
ATOM    595  C   CYS A  72     -17.290   0.428   3.995  1.00  0.90           C  
ATOM    596  O   CYS A  72     -18.340  -0.203   4.102  1.00  0.90           O  
ATOM    597  CB  CYS A  72     -16.891   1.327   6.275  1.00  0.90           C  
ATOM    598  SG  CYS A  72     -15.473   0.218   6.596  1.00  0.90           S  
ATOM    599  N   ILE A  73     -16.280   0.001   3.225  1.00  0.87           N  
ATOM    600  CA  ILE A  73     -16.260  -1.256   2.513  1.00  0.87           C  
ATOM    601  C   ILE A  73     -15.197  -2.115   3.175  1.00  0.87           C  
ATOM    602  O   ILE A  73     -14.016  -1.771   3.207  1.00  0.87           O  
ATOM    603  CB  ILE A  73     -15.944  -1.056   1.034  1.00  0.87           C  
ATOM    604  CG1 ILE A  73     -17.074  -0.236   0.368  1.00  0.87           C  
ATOM    605  CG2 ILE A  73     -15.738  -2.420   0.339  1.00  0.87           C  
ATOM    606  CD1 ILE A  73     -16.763   0.205  -1.066  1.00  0.87           C  
ATOM    607  N   TYR A  74     -15.593  -3.271   3.738  1.00  0.89           N  
ATOM    608  CA  TYR A  74     -14.675  -4.218   4.341  1.00  0.89           C  
ATOM    609  C   TYR A  74     -14.495  -5.396   3.396  1.00  0.89           C  
ATOM    610  O   TYR A  74     -15.458  -5.868   2.793  1.00  0.89           O  
ATOM    611  CB  TYR A  74     -15.215  -4.678   5.723  1.00  0.89           C  
ATOM    612  CG  TYR A  74     -14.465  -5.829   6.341  1.00  0.89           C  
ATOM    613  CD1 TYR A  74     -15.048  -7.106   6.403  1.00  0.89           C  
ATOM    614  CD2 TYR A  74     -13.176  -5.643   6.855  1.00  0.89           C  
ATOM    615  CE1 TYR A  74     -14.387  -8.158   7.050  1.00  0.89           C  
ATOM    616  CE2 TYR A  74     -12.510  -6.695   7.499  1.00  0.89           C  
ATOM    617  CZ  TYR A  74     -13.129  -7.944   7.619  1.00  0.89           C  
ATOM    618  OH  TYR A  74     -12.460  -8.995   8.272  1.00  0.89           O  
ATOM    619  N   ASN A  75     -13.253  -5.897   3.244  1.00  0.87           N  
ATOM    620  CA  ASN A  75     -12.975  -7.058   2.424  1.00  0.87           C  
ATOM    621  C   ASN A  75     -11.784  -7.820   3.010  1.00  0.87           C  
ATOM    622  O   ASN A  75     -10.838  -7.230   3.538  1.00  0.87           O  
ATOM    623  CB  ASN A  75     -12.701  -6.602   0.963  1.00  0.87           C  
ATOM    624  CG  ASN A  75     -13.888  -5.865   0.353  1.00  0.87           C  
ATOM    625  OD1 ASN A  75     -14.778  -5.348   1.015  1.00  0.87           O  
ATOM    626  ND2 ASN A  75     -13.906  -5.774  -0.998  1.00  0.87           N  
ATOM    627  N   THR A  76     -11.801  -9.164   2.938  1.00  0.89           N  
ATOM    628  CA  THR A  76     -10.695 -10.022   3.327  1.00  0.89           C  
ATOM    629  C   THR A  76     -10.303 -10.905   2.192  1.00  0.89           C  
ATOM    630  O   THR A  76     -11.132 -11.437   1.461  1.00  0.89           O  
ATOM    631  CB  THR A  76     -10.905 -10.914   4.542  1.00  0.89           C  
ATOM    632  OG1 THR A  76     -12.146 -11.606   4.558  1.00  0.89           O  
ATOM    633  CG2 THR A  76     -10.898  -9.983   5.737  1.00  0.89           C  
ATOM    634  N   THR A  77      -8.990 -11.088   1.996  1.00  0.89           N  
ATOM    635  CA  THR A  77      -8.526 -11.912   0.897  1.00  0.89           C  
ATOM    636  C   THR A  77      -7.128 -12.379   1.204  1.00  0.89           C  
ATOM    637  O   THR A  77      -6.474 -11.878   2.118  1.00  0.89           O  
ATOM    638  CB  THR A  77      -8.575 -11.218  -0.471  1.00  0.89           C  
ATOM    639  OG1 THR A  77      -8.296 -12.114  -1.545  1.00  0.89           O  
ATOM    640  CG2 THR A  77      -7.579 -10.053  -0.541  1.00  0.89           C  
ATOM    641  N   TYR A  78      -6.629 -13.357   0.440  1.00  0.90           N  
ATOM    642  CA  TYR A  78      -5.268 -13.831   0.530  1.00  0.90           C  
ATOM    643  C   TYR A  78      -4.504 -13.246  -0.630  1.00  0.90           C  
ATOM    644  O   TYR A  78      -4.907 -13.356  -1.787  1.00  0.90           O  
ATOM    645  CB  TYR A  78      -5.127 -15.368   0.443  1.00  0.90           C  
ATOM    646  CG  TYR A  78      -5.601 -15.995   1.712  1.00  0.90           C  
ATOM    647  CD1 TYR A  78      -4.709 -16.185   2.778  1.00  0.90           C  
ATOM    648  CD2 TYR A  78      -6.940 -16.384   1.857  1.00  0.90           C  
ATOM    649  CE1 TYR A  78      -5.153 -16.754   3.978  1.00  0.90           C  
ATOM    650  CE2 TYR A  78      -7.388 -16.950   3.059  1.00  0.90           C  
ATOM    651  CZ  TYR A  78      -6.491 -17.131   4.120  1.00  0.90           C  
ATOM    652  OH  TYR A  78      -6.923 -17.689   5.337  1.00  0.90           O  
ATOM    653  N   LEU A  79      -3.369 -12.600  -0.341  1.00  0.91           N  
ATOM    654  CA  LEU A  79      -2.447 -12.143  -1.352  1.00  0.91           C  
ATOM    655  C   LEU A  79      -1.387 -13.205  -1.537  1.00  0.91           C  
ATOM    656  O   LEU A  79      -0.960 -13.815  -0.559  1.00  0.91           O  
ATOM    657  CB  LEU A  79      -1.730 -10.834  -0.943  1.00  0.91           C  
ATOM    658  CG  LEU A  79      -2.647  -9.680  -0.503  1.00  0.91           C  
ATOM    659  CD1 LEU A  79      -1.821  -8.444  -0.125  1.00  0.91           C  
ATOM    660  CD2 LEU A  79      -3.645  -9.317  -1.600  1.00  0.91           C  
ATOM    661  N   ASN A  80      -0.919 -13.455  -2.770  1.00  0.91           N  
ATOM    662  CA  ASN A  80       0.158 -14.400  -3.007  1.00  0.91           C  
ATOM    663  C   ASN A  80       1.481 -13.648  -2.982  1.00  0.91           C  
ATOM    664  O   ASN A  80       1.544 -12.481  -3.366  1.00  0.91           O  
ATOM    665  CB  ASN A  80       0.022 -15.120  -4.370  1.00  0.91           C  
ATOM    666  CG  ASN A  80      -1.278 -15.913  -4.433  1.00  0.91           C  
ATOM    667  OD1 ASN A  80      -1.636 -16.637  -3.507  1.00  0.91           O  
ATOM    668  ND2 ASN A  80      -2.002 -15.813  -5.574  1.00  0.91           N  
ATOM    669  N   VAL A  81       2.572 -14.287  -2.528  1.00  0.95           N  
ATOM    670  CA  VAL A  81       3.890 -13.676  -2.450  1.00  0.95           C  
ATOM    671  C   VAL A  81       4.830 -14.398  -3.393  1.00  0.95           C  
ATOM    672  O   VAL A  81       5.074 -15.596  -3.268  1.00  0.95           O  
ATOM    673  CB  VAL A  81       4.472 -13.792  -1.044  1.00  0.95           C  
ATOM    674  CG1 VAL A  81       5.888 -13.189  -0.957  1.00  0.95           C  
ATOM    675  CG2 VAL A  81       3.527 -13.100  -0.049  1.00  0.95           C  
ATOM    676  N   GLN A  82       5.425 -13.699  -4.374  1.00  0.90           N  
ATOM    677  CA  GLN A  82       6.400 -14.307  -5.253  1.00  0.90           C  
ATOM    678  C   GLN A  82       7.757 -13.840  -4.787  1.00  0.90           C  
ATOM    679  O   GLN A  82       8.239 -12.762  -5.139  1.00  0.90           O  
ATOM    680  CB  GLN A  82       6.175 -13.962  -6.742  1.00  0.90           C  
ATOM    681  CG  GLN A  82       4.787 -14.379  -7.288  1.00  0.90           C  
ATOM    682  CD  GLN A  82       3.661 -13.456  -6.800  1.00  0.90           C  
ATOM    683  OE1 GLN A  82       3.797 -12.237  -6.775  1.00  0.90           O  
ATOM    684  NE2 GLN A  82       2.492 -14.052  -6.474  1.00  0.90           N  
ATOM    685  N   ARG A  83       8.408 -14.657  -3.939  1.00  0.89           N  
ATOM    686  CA  ARG A  83       9.566 -14.228  -3.185  1.00  0.89           C  
ATOM    687  C   ARG A  83      10.764 -13.763  -3.988  1.00  0.89           C  
ATOM    688  O   ARG A  83      11.300 -12.698  -3.715  1.00  0.89           O  
ATOM    689  CB  ARG A  83      10.063 -15.359  -2.270  1.00  0.89           C  
ATOM    690  CG  ARG A  83       9.109 -15.713  -1.126  1.00  0.89           C  
ATOM    691  CD  ARG A  83       9.726 -16.766  -0.216  1.00  0.89           C  
ATOM    692  NE  ARG A  83       8.754 -16.961   0.871  1.00  0.89           N  
ATOM    693  CZ  ARG A  83       8.818 -16.463   2.102  1.00  0.89           C  
ATOM    694  NH1 ARG A  83       9.672 -15.504   2.434  1.00  0.89           N  
ATOM    695  NH2 ARG A  83       7.963 -16.922   3.002  1.00  0.89           N  
ATOM    696  N   GLU A  84      11.184 -14.523  -5.014  1.00  0.89           N  
ATOM    697  CA  GLU A  84      12.326 -14.216  -5.858  1.00  0.89           C  
ATOM    698  C   GLU A  84      12.170 -12.920  -6.640  1.00  0.89           C  
ATOM    699  O   GLU A  84      13.110 -12.149  -6.806  1.00  0.89           O  
ATOM    700  CB  GLU A  84      12.579 -15.411  -6.796  1.00  0.89           C  
ATOM    701  CG  GLU A  84      12.911 -16.707  -6.014  1.00  0.89           C  
ATOM    702  CD  GLU A  84      13.226 -17.901  -6.918  1.00  0.89           C  
ATOM    703  OE1 GLU A  84      13.663 -18.934  -6.350  1.00  0.89           O  
ATOM    704  OE2 GLU A  84      13.023 -17.797  -8.152  1.00  0.89           O  
ATOM    705  N   ASN A  85      10.932 -12.632  -7.088  1.00  0.90           N  
ATOM    706  CA  ASN A  85      10.611 -11.466  -7.891  1.00  0.90           C  
ATOM    707  C   ASN A  85      10.387 -10.207  -7.065  1.00  0.90           C  
ATOM    708  O   ASN A  85      10.318  -9.104  -7.602  1.00  0.90           O  
ATOM    709  CB  ASN A  85       9.309 -11.706  -8.696  1.00  0.90           C  
ATOM    710  CG  ASN A  85       9.471 -12.902  -9.624  1.00  0.90           C  
ATOM    711  OD1 ASN A  85      10.559 -13.341  -9.971  1.00  0.90           O  
ATOM    712  ND2 ASN A  85       8.325 -13.459 -10.084  1.00  0.90           N  
ATOM    713  N   GLY A  86      10.245 -10.348  -5.731  1.00  0.94           N  
ATOM    714  CA  GLY A  86       9.956  -9.233  -4.836  1.00  0.94           C  
ATOM    715  C   GLY A  86       8.544  -8.707  -4.923  1.00  0.94           C  
ATOM    716  O   GLY A  86       8.281  -7.544  -4.627  1.00  0.94           O  
ATOM    717  N   THR A  87       7.590  -9.551  -5.359  1.00  0.94           N  
ATOM    718  CA  THR A  87       6.249  -9.122  -5.722  1.00  0.94           C  
ATOM    719  C   THR A  87       5.174  -9.753  -4.858  1.00  0.94           C  
ATOM    720  O   THR A  87       5.327 -10.835  -4.291  1.00  0.94           O  
ATOM    721  CB  THR A  87       5.885  -9.326  -7.203  1.00  0.94           C  
ATOM    722  OG1 THR A  87       6.137 -10.641  -7.665  1.00  0.94           O  
ATOM    723  CG2 THR A  87       6.738  -8.412  -8.089  1.00  0.94           C  
ATOM    724  N   ILE A  88       4.051  -9.024  -4.704  1.00  0.93           N  
ATOM    725  CA  ILE A  88       2.842  -9.449  -4.018  1.00  0.93           C  
ATOM    726  C   ILE A  88       1.716  -9.347  -5.035  1.00  0.93           C  
ATOM    727  O   ILE A  88       1.669  -8.395  -5.820  1.00  0.93           O  
ATOM    728  CB  ILE A  88       2.526  -8.591  -2.789  1.00  0.93           C  
ATOM    729  CG1 ILE A  88       3.576  -8.822  -1.682  1.00  0.93           C  
ATOM    730  CG2 ILE A  88       1.126  -8.932  -2.242  1.00  0.93           C  
ATOM    731  CD1 ILE A  88       3.431  -7.871  -0.488  1.00  0.93           C  
ATOM    732  N   SER A  89       0.779 -10.320  -5.070  1.00  0.90           N  
ATOM    733  CA  SER A  89      -0.351 -10.276  -5.989  1.00  0.90           C  
ATOM    734  C   SER A  89      -1.724 -10.447  -5.367  1.00  0.90           C  
ATOM    735  O   SER A  89      -1.911 -11.136  -4.366  1.00  0.90           O  
ATOM    736  CB  SER A  89      -0.216 -11.246  -7.181  1.00  0.90           C  
ATOM    737  OG  SER A  89      -0.269 -12.605  -6.763  1.00  0.90           O  
ATOM    738  N   ARG A  90      -2.739  -9.764  -5.949  1.00  0.82           N  
ATOM    739  CA  ARG A  90      -4.121  -9.781  -5.495  1.00  0.82           C  
ATOM    740  C   ARG A  90      -5.053 -10.101  -6.652  1.00  0.82           C  
ATOM    741  O   ARG A  90      -4.960  -9.500  -7.721  1.00  0.82           O  
ATOM    742  CB  ARG A  90      -4.532  -8.392  -4.932  1.00  0.82           C  
ATOM    743  CG  ARG A  90      -5.906  -8.326  -4.220  1.00  0.82           C  
ATOM    744  CD  ARG A  90      -6.209  -6.921  -3.683  1.00  0.82           C  
ATOM    745  NE  ARG A  90      -7.574  -6.897  -3.062  1.00  0.82           N  
ATOM    746  CZ  ARG A  90      -7.990  -5.868  -2.310  1.00  0.82           C  
ATOM    747  NH1 ARG A  90      -7.173  -4.879  -1.977  1.00  0.82           N  
ATOM    748  NH2 ARG A  90      -9.243  -5.809  -1.874  1.00  0.82           N  
ATOM    749  N   TYR A  91      -6.006 -11.032  -6.465  1.00  0.84           N  
ATOM    750  CA  TYR A  91      -7.049 -11.301  -7.442  1.00  0.84           C  
ATOM    751  C   TYR A  91      -8.232 -10.368  -7.205  1.00  0.84           C  
ATOM    752  O   TYR A  91      -8.811 -10.344  -6.119  1.00  0.84           O  
ATOM    753  CB  TYR A  91      -7.527 -12.771  -7.374  1.00  0.84           C  
ATOM    754  CG  TYR A  91      -6.586 -13.657  -8.139  1.00  0.84           C  
ATOM    755  CD1 TYR A  91      -6.937 -14.120  -9.418  1.00  0.84           C  
ATOM    756  CD2 TYR A  91      -5.353 -14.032  -7.591  1.00  0.84           C  
ATOM    757  CE1 TYR A  91      -6.086 -14.983 -10.125  1.00  0.84           C  
ATOM    758  CE2 TYR A  91      -4.509 -14.901  -8.284  1.00  0.84           C  
ATOM    759  CZ  TYR A  91      -4.858 -15.374  -9.550  1.00  0.84           C  
ATOM    760  OH  TYR A  91      -3.944 -16.136 -10.284  1.00  0.84           O  
ATOM    761  N   VAL A  92      -8.602  -9.557  -8.220  1.00  0.80           N  
ATOM    762  CA  VAL A  92      -9.705  -8.600  -8.166  1.00  0.80           C  
ATOM    763  C   VAL A  92     -10.372  -8.603  -9.523  1.00  0.80           C  
ATOM    764  O   VAL A  92      -9.720  -8.478 -10.556  1.00  0.80           O  
ATOM    765  CB  VAL A  92      -9.258  -7.171  -7.836  1.00  0.80           C  
ATOM    766  CG1 VAL A  92     -10.331  -6.095  -8.118  1.00  0.80           C  
ATOM    767  CG2 VAL A  92      -8.893  -7.112  -6.347  1.00  0.80           C  
ATOM    768  N   GLY A  93     -11.712  -8.768  -9.577  1.00  0.80           N  
ATOM    769  CA  GLY A  93     -12.471  -8.707 -10.832  1.00  0.80           C  
ATOM    770  C   GLY A  93     -12.172  -9.782 -11.847  1.00  0.80           C  
ATOM    771  O   GLY A  93     -12.388  -9.609 -13.038  1.00  0.80           O  
ATOM    772  N   GLY A  94     -11.647 -10.935 -11.388  1.00  0.81           N  
ATOM    773  CA  GLY A  94     -11.213 -12.013 -12.270  1.00  0.81           C  
ATOM    774  C   GLY A  94      -9.839 -11.807 -12.854  1.00  0.81           C  
ATOM    775  O   GLY A  94      -9.395 -12.596 -13.677  1.00  0.81           O  
ATOM    776  N   GLN A  95      -9.124 -10.746 -12.441  1.00  0.75           N  
ATOM    777  CA  GLN A  95      -7.803 -10.434 -12.944  1.00  0.75           C  
ATOM    778  C   GLN A  95      -6.818 -10.447 -11.797  1.00  0.75           C  
ATOM    779  O   GLN A  95      -7.135 -10.033 -10.680  1.00  0.75           O  
ATOM    780  CB  GLN A  95      -7.767  -9.028 -13.588  1.00  0.75           C  
ATOM    781  CG  GLN A  95      -8.687  -8.868 -14.819  1.00  0.75           C  
ATOM    782  CD  GLN A  95      -8.187  -9.718 -15.987  1.00  0.75           C  
ATOM    783  OE1 GLN A  95      -6.992  -9.792 -16.267  1.00  0.75           O  
ATOM    784  NE2 GLN A  95      -9.123 -10.383 -16.702  1.00  0.75           N  
ATOM    785  N   GLU A  96      -5.589 -10.934 -12.034  1.00  0.77           N  
ATOM    786  CA  GLU A  96      -4.539 -10.882 -11.035  1.00  0.77           C  
ATOM    787  C   GLU A  96      -3.728  -9.608 -11.192  1.00  0.77           C  
ATOM    788  O   GLU A  96      -3.225  -9.296 -12.269  1.00  0.77           O  
ATOM    789  CB  GLU A  96      -3.610 -12.116 -11.106  1.00  0.77           C  
ATOM    790  CG  GLU A  96      -2.667 -12.253  -9.888  1.00  0.77           C  
ATOM    791  CD  GLU A  96      -1.999 -13.623  -9.736  1.00  0.77           C  
ATOM    792  OE1 GLU A  96      -1.476 -13.850  -8.614  1.00  0.77           O  
ATOM    793  OE2 GLU A  96      -2.033 -14.470 -10.661  1.00  0.77           O  
ATOM    794  N   HIS A  97      -3.596  -8.821 -10.110  1.00  0.82           N  
ATOM    795  CA  HIS A  97      -2.890  -7.557 -10.109  1.00  0.82           C  
ATOM    796  C   HIS A  97      -1.625  -7.736  -9.295  1.00  0.82           C  
ATOM    797  O   HIS A  97      -1.686  -8.143  -8.134  1.00  0.82           O  
ATOM    798  CB  HIS A  97      -3.746  -6.454  -9.453  1.00  0.82           C  
ATOM    799  CG  HIS A  97      -4.987  -6.145 -10.230  1.00  0.82           C  
ATOM    800  ND1 HIS A  97      -5.011  -5.000 -11.005  1.00  0.82           N  
ATOM    801  CD2 HIS A  97      -6.162  -6.813 -10.340  1.00  0.82           C  
ATOM    802  CE1 HIS A  97      -6.199  -4.995 -11.572  1.00  0.82           C  
ATOM    803  NE2 HIS A  97      -6.942  -6.072 -11.205  1.00  0.82           N  
ATOM    804  N   PHE A  98      -0.448  -7.447  -9.884  1.00  0.88           N  
ATOM    805  CA  PHE A  98       0.852  -7.719  -9.292  1.00  0.88           C  
ATOM    806  C   PHE A  98       1.554  -6.420  -8.967  1.00  0.88           C  
ATOM    807  O   PHE A  98       1.582  -5.498  -9.780  1.00  0.88           O  
ATOM    808  CB  PHE A  98       1.814  -8.425 -10.287  1.00  0.88           C  
ATOM    809  CG  PHE A  98       1.554  -9.899 -10.411  1.00  0.88           C  
ATOM    810  CD1 PHE A  98       2.277 -10.799  -9.612  1.00  0.88           C  
ATOM    811  CD2 PHE A  98       0.642 -10.413 -11.345  1.00  0.88           C  
ATOM    812  CE1 PHE A  98       2.060 -12.178  -9.703  1.00  0.88           C  
ATOM    813  CE2 PHE A  98       0.457 -11.797 -11.467  1.00  0.88           C  
ATOM    814  CZ  PHE A  98       1.150 -12.679 -10.633  1.00  0.88           C  
ATOM    815  N   ALA A  99       2.193  -6.338  -7.789  1.00  0.93           N  
ATOM    816  CA  ALA A  99       2.976  -5.182  -7.435  1.00  0.93           C  
ATOM    817  C   ALA A  99       4.260  -5.576  -6.748  1.00  0.93           C  
ATOM    818  O   ALA A  99       4.301  -6.478  -5.911  1.00  0.93           O  
ATOM    819  CB  ALA A  99       2.217  -4.277  -6.458  1.00  0.93           C  
ATOM    820  N   HIS A 100       5.360  -4.891  -7.089  1.00  0.92           N  
ATOM    821  CA  HIS A 100       6.622  -4.996  -6.392  1.00  0.92           C  
ATOM    822  C   HIS A 100       6.579  -4.347  -5.033  1.00  0.92           C  
ATOM    823  O   HIS A 100       6.177  -3.191  -4.898  1.00  0.92           O  
ATOM    824  CB  HIS A 100       7.771  -4.359  -7.185  1.00  0.92           C  
ATOM    825  CG  HIS A 100       8.076  -5.103  -8.437  1.00  0.92           C  
ATOM    826  ND1 HIS A 100       7.455  -4.738  -9.615  1.00  0.92           N  
ATOM    827  CD2 HIS A 100       8.905  -6.152  -8.647  1.00  0.92           C  
ATOM    828  CE1 HIS A 100       7.924  -5.569 -10.516  1.00  0.92           C  
ATOM    829  NE2 HIS A 100       8.811  -6.450  -9.989  1.00  0.92           N  
ATOM    830  N   LEU A 101       7.013  -5.073  -3.990  1.00  0.94           N  
ATOM    831  CA  LEU A 101       7.071  -4.556  -2.640  1.00  0.94           C  
ATOM    832  C   LEU A 101       8.378  -3.806  -2.468  1.00  0.94           C  
ATOM    833  O   LEU A 101       9.462  -4.374  -2.592  1.00  0.94           O  
ATOM    834  CB  LEU A 101       6.953  -5.706  -1.607  1.00  0.94           C  
ATOM    835  CG  LEU A 101       7.090  -5.321  -0.116  1.00  0.94           C  
ATOM    836  CD1 LEU A 101       6.041  -4.296   0.337  1.00  0.94           C  
ATOM    837  CD2 LEU A 101       7.041  -6.582   0.763  1.00  0.94           C  
ATOM    838  N   LEU A 102       8.305  -2.491  -2.205  1.00  0.93           N  
ATOM    839  CA  LEU A 102       9.470  -1.636  -2.175  1.00  0.93           C  
ATOM    840  C   LEU A 102       9.645  -0.990  -0.819  1.00  0.93           C  
ATOM    841  O   LEU A 102       8.703  -0.499  -0.193  1.00  0.93           O  
ATOM    842  CB  LEU A 102       9.348  -0.516  -3.216  1.00  0.93           C  
ATOM    843  CG  LEU A 102       9.221  -0.979  -4.678  1.00  0.93           C  
ATOM    844  CD1 LEU A 102       9.053   0.278  -5.527  1.00  0.93           C  
ATOM    845  CD2 LEU A 102      10.426  -1.781  -5.186  1.00  0.93           C  
ATOM    846  N   ILE A 103      10.897  -0.981  -0.340  1.00  0.86           N  
ATOM    847  CA  ILE A 103      11.253  -0.569   0.998  1.00  0.86           C  
ATOM    848  C   ILE A 103      11.876   0.815   0.977  1.00  0.86           C  
ATOM    849  O   ILE A 103      12.755   1.115   0.170  1.00  0.86           O  
ATOM    850  CB  ILE A 103      12.176  -1.589   1.661  1.00  0.86           C  
ATOM    851  CG1 ILE A 103      11.518  -2.994   1.648  1.00  0.86           C  
ATOM    852  CG2 ILE A 103      12.556  -1.061   3.061  1.00  0.86           C  
ATOM    853  CD1 ILE A 103      12.306  -4.084   2.380  1.00  0.86           C  
ATOM    854  N   LEU A 104      11.402   1.702   1.870  1.00  0.83           N  
ATOM    855  CA  LEU A 104      11.948   3.019   2.113  1.00  0.83           C  
ATOM    856  C   LEU A 104      12.857   2.968   3.325  1.00  0.83           C  
ATOM    857  O   LEU A 104      12.956   1.945   3.997  1.00  0.83           O  
ATOM    858  CB  LEU A 104      10.803   4.026   2.329  1.00  0.83           C  
ATOM    859  CG  LEU A 104       9.982   4.313   1.059  1.00  0.83           C  
ATOM    860  CD1 LEU A 104       8.849   5.310   1.338  1.00  0.83           C  
ATOM    861  CD2 LEU A 104      10.901   4.843  -0.043  1.00  0.83           C  
ATOM    862  N   ARG A 105      13.623   4.043   3.605  1.00  0.77           N  
ATOM    863  CA  ARG A 105      14.596   4.028   4.683  1.00  0.77           C  
ATOM    864  C   ARG A 105      13.953   3.969   6.059  1.00  0.77           C  
ATOM    865  O   ARG A 105      14.439   3.292   6.962  1.00  0.77           O  
ATOM    866  CB  ARG A 105      15.528   5.258   4.635  1.00  0.77           C  
ATOM    867  CG  ARG A 105      16.320   5.445   3.324  1.00  0.77           C  
ATOM    868  CD  ARG A 105      17.114   6.749   3.359  1.00  0.77           C  
ATOM    869  NE  ARG A 105      17.737   6.955   2.009  1.00  0.77           N  
ATOM    870  CZ  ARG A 105      18.043   8.170   1.537  1.00  0.77           C  
ATOM    871  NH1 ARG A 105      18.092   9.222   2.343  1.00  0.77           N  
ATOM    872  NH2 ARG A 105      18.236   8.359   0.235  1.00  0.77           N  
ATOM    873  N   ASP A 106      12.832   4.697   6.234  1.00  0.85           N  
ATOM    874  CA  ASP A 106      11.963   4.530   7.375  1.00  0.85           C  
ATOM    875  C   ASP A 106      11.251   3.168   7.307  1.00  0.85           C  
ATOM    876  O   ASP A 106      10.630   2.797   6.315  1.00  0.85           O  
ATOM    877  CB  ASP A 106      10.992   5.739   7.492  1.00  0.85           C  
ATOM    878  CG  ASP A 106      10.273   5.805   8.832  1.00  0.85           C  
ATOM    879  OD1 ASP A 106      10.407   4.870   9.662  1.00  0.85           O  
ATOM    880  OD2 ASP A 106       9.547   6.807   9.045  1.00  0.85           O  
ATOM    881  N   THR A 107      11.320   2.386   8.401  1.00  0.87           N  
ATOM    882  CA  THR A 107      10.705   1.074   8.546  1.00  0.87           C  
ATOM    883  C   THR A 107       9.218   1.182   8.773  1.00  0.87           C  
ATOM    884  O   THR A 107       8.489   0.193   8.732  1.00  0.87           O  
ATOM    885  CB  THR A 107      11.296   0.261   9.692  1.00  0.87           C  
ATOM    886  OG1 THR A 107      11.325   1.001  10.909  1.00  0.87           O  
ATOM    887  CG2 THR A 107      12.751  -0.095   9.361  1.00  0.87           C  
ATOM    888  N   LYS A 108       8.734   2.413   9.003  1.00  0.89           N  
ATOM    889  CA  LYS A 108       7.337   2.708   9.182  1.00  0.89           C  
ATOM    890  C   LYS A 108       6.645   3.073   7.889  1.00  0.89           C  
ATOM    891  O   LYS A 108       5.467   3.424   7.891  1.00  0.89           O  
ATOM    892  CB  LYS A 108       7.207   3.903  10.133  1.00  0.89           C  
ATOM    893  CG  LYS A 108       7.738   3.559  11.523  1.00  0.89           C  
ATOM    894  CD  LYS A 108       7.665   4.746  12.476  1.00  0.89           C  
ATOM    895  CE  LYS A 108       8.135   4.332  13.858  1.00  0.89           C  
ATOM    896  NZ  LYS A 108       8.091   5.516  14.726  1.00  0.89           N  
ATOM    897  N   THR A 109       7.337   2.982   6.737  1.00  0.92           N  
ATOM    898  CA  THR A 109       6.758   3.287   5.441  1.00  0.92           C  
ATOM    899  C   THR A 109       7.130   2.216   4.439  1.00  0.92           C  
ATOM    900  O   THR A 109       8.176   1.582   4.514  1.00  0.92           O  
ATOM    901  CB  THR A 109       7.160   4.646   4.864  1.00  0.92           C  
ATOM    902  OG1 THR A 109       8.566   4.782   4.731  1.00  0.92           O  
ATOM    903  CG2 THR A 109       6.713   5.771   5.797  1.00  0.92           C  
ATOM    904  N   TYR A 110       6.262   1.979   3.438  1.00  0.93           N  
ATOM    905  CA  TYR A 110       6.544   1.035   2.373  1.00  0.93           C  
ATOM    906  C   TYR A 110       5.824   1.532   1.147  1.00  0.93           C  
ATOM    907  O   TYR A 110       4.890   2.334   1.232  1.00  0.93           O  
ATOM    908  CB  TYR A 110       6.046  -0.424   2.629  1.00  0.93           C  
ATOM    909  CG  TYR A 110       6.930  -1.138   3.604  1.00  0.93           C  
ATOM    910  CD1 TYR A 110       8.256  -1.410   3.260  1.00  0.93           C  
ATOM    911  CD2 TYR A 110       6.481  -1.523   4.873  1.00  0.93           C  
ATOM    912  CE1 TYR A 110       9.150  -1.883   4.226  1.00  0.93           C  
ATOM    913  CE2 TYR A 110       7.377  -2.006   5.839  1.00  0.93           C  
ATOM    914  CZ  TYR A 110       8.731  -2.126   5.532  1.00  0.93           C  
ATOM    915  OH  TYR A 110       9.671  -2.493   6.515  1.00  0.93           O  
ATOM    916  N   MET A 111       6.243   1.060  -0.037  1.00  0.93           N  
ATOM    917  CA  MET A 111       5.582   1.386  -1.278  1.00  0.93           C  
ATOM    918  C   MET A 111       5.269   0.122  -2.050  1.00  0.93           C  
ATOM    919  O   MET A 111       5.914  -0.915  -1.893  1.00  0.93           O  
ATOM    920  CB  MET A 111       6.458   2.261  -2.205  1.00  0.93           C  
ATOM    921  CG  MET A 111       6.723   3.683  -1.698  1.00  0.93           C  
ATOM    922  SD  MET A 111       7.698   4.690  -2.862  1.00  0.93           S  
ATOM    923  CE  MET A 111       9.183   3.651  -2.992  1.00  0.93           C  
ATOM    924  N   LEU A 112       4.268   0.201  -2.941  1.00  0.94           N  
ATOM    925  CA  LEU A 112       3.950  -0.854  -3.880  1.00  0.94           C  
ATOM    926  C   LEU A 112       4.081  -0.273  -5.267  1.00  0.94           C  
ATOM    927  O   LEU A 112       3.432   0.725  -5.589  1.00  0.94           O  
ATOM    928  CB  LEU A 112       2.515  -1.422  -3.724  1.00  0.94           C  
ATOM    929  CG  LEU A 112       2.236  -2.167  -2.404  1.00  0.94           C  
ATOM    930  CD1 LEU A 112       0.763  -2.598  -2.328  1.00  0.94           C  
ATOM    931  CD2 LEU A 112       3.150  -3.385  -2.218  1.00  0.94           C  
ATOM    932  N   ALA A 113       4.932  -0.878  -6.115  1.00  0.94           N  
ATOM    933  CA  ALA A 113       5.121  -0.436  -7.478  1.00  0.94           C  
ATOM    934  C   ALA A 113       4.410  -1.354  -8.442  1.00  0.94           C  
ATOM    935  O   ALA A 113       4.627  -2.562  -8.475  1.00  0.94           O  
ATOM    936  CB  ALA A 113       6.608  -0.341  -7.879  1.00  0.94           C  
ATOM    937  N   PHE A 114       3.538  -0.766  -9.265  1.00  0.90           N  
ATOM    938  CA  PHE A 114       2.758  -1.455 -10.258  1.00  0.90           C  
ATOM    939  C   PHE A 114       3.384  -1.110 -11.583  1.00  0.90           C  
ATOM    940  O   PHE A 114       3.879   0.002 -11.778  1.00  0.90           O  
ATOM    941  CB  PHE A 114       1.287  -1.001 -10.246  1.00  0.90           C  
ATOM    942  CG  PHE A 114       0.614  -1.461  -8.981  1.00  0.90           C  
ATOM    943  CD1 PHE A 114      -0.114  -2.657  -9.005  1.00  0.90           C  
ATOM    944  CD2 PHE A 114       0.656  -0.721  -7.784  1.00  0.90           C  
ATOM    945  CE1 PHE A 114      -0.855  -3.067  -7.893  1.00  0.90           C  
ATOM    946  CE2 PHE A 114      -0.078  -1.129  -6.663  1.00  0.90           C  
ATOM    947  CZ  PHE A 114      -0.845  -2.298  -6.723  1.00  0.90           C  
ATOM    948  N   ASP A 115       3.441  -2.097 -12.491  1.00  0.83           N  
ATOM    949  CA  ASP A 115       3.936  -1.965 -13.845  1.00  0.83           C  
ATOM    950  C   ASP A 115       5.316  -1.339 -14.007  1.00  0.83           C  
ATOM    951  O   ASP A 115       5.572  -0.581 -14.933  1.00  0.83           O  
ATOM    952  CB  ASP A 115       2.865  -1.297 -14.736  1.00  0.83           C  
ATOM    953  CG  ASP A 115       1.627  -2.175 -14.771  1.00  0.83           C  
ATOM    954  OD1 ASP A 115       1.792  -3.421 -14.696  1.00  0.83           O  
ATOM    955  OD2 ASP A 115       0.512  -1.607 -14.857  1.00  0.83           O  
ATOM    956  N   VAL A 116       6.301  -1.700 -13.153  1.00  0.81           N  
ATOM    957  CA  VAL A 116       7.606  -1.036 -13.135  1.00  0.81           C  
ATOM    958  C   VAL A 116       8.421  -1.215 -14.416  1.00  0.81           C  
ATOM    959  O   VAL A 116       9.274  -0.405 -14.757  1.00  0.81           O  
ATOM    960  CB  VAL A 116       8.414  -1.421 -11.892  1.00  0.81           C  
ATOM    961  CG1 VAL A 116       9.150  -2.766 -12.054  1.00  0.81           C  
ATOM    962  CG2 VAL A 116       9.378  -0.277 -11.517  1.00  0.81           C  
ATOM    963  N   ASN A 117       8.099  -2.279 -15.184  1.00  0.79           N  
ATOM    964  CA  ASN A 117       8.723  -2.609 -16.450  1.00  0.79           C  
ATOM    965  C   ASN A 117       7.962  -2.031 -17.639  1.00  0.79           C  
ATOM    966  O   ASN A 117       8.365  -2.229 -18.781  1.00  0.79           O  
ATOM    967  CB  ASN A 117       8.759  -4.147 -16.646  1.00  0.79           C  
ATOM    968  CG  ASN A 117       9.681  -4.789 -15.617  1.00  0.79           C  
ATOM    969  OD1 ASN A 117      10.721  -4.256 -15.246  1.00  0.79           O  
ATOM    970  ND2 ASN A 117       9.319  -6.008 -15.148  1.00  0.79           N  
ATOM    971  N   ASP A 118       6.856  -1.296 -17.408  1.00  0.82           N  
ATOM    972  CA  ASP A 118       6.146  -0.605 -18.458  1.00  0.82           C  
ATOM    973  C   ASP A 118       6.089   0.874 -18.086  1.00  0.82           C  
ATOM    974  O   ASP A 118       5.363   1.314 -17.196  1.00  0.82           O  
ATOM    975  CB  ASP A 118       4.741  -1.231 -18.692  1.00  0.82           C  
ATOM    976  CG  ASP A 118       3.957  -0.558 -19.814  1.00  0.82           C  
ATOM    977  OD1 ASP A 118       4.434   0.456 -20.391  1.00  0.82           O  
ATOM    978  OD2 ASP A 118       2.825  -1.026 -20.085  1.00  0.82           O  
ATOM    979  N   GLU A 119       6.831   1.715 -18.825  1.00  0.79           N  
ATOM    980  CA  GLU A 119       6.857   3.145 -18.630  1.00  0.79           C  
ATOM    981  C   GLU A 119       5.556   3.860 -18.957  1.00  0.79           C  
ATOM    982  O   GLU A 119       5.356   5.010 -18.571  1.00  0.79           O  
ATOM    983  CB  GLU A 119       7.936   3.781 -19.521  1.00  0.79           C  
ATOM    984  CG  GLU A 119       9.361   3.223 -19.325  1.00  0.79           C  
ATOM    985  CD  GLU A 119      10.376   4.067 -20.097  1.00  0.79           C  
ATOM    986  OE1 GLU A 119      11.592   3.789 -19.950  1.00  0.79           O  
ATOM    987  OE2 GLU A 119       9.945   5.004 -20.821  1.00  0.79           O  
ATOM    988  N   LYS A 120       4.620   3.227 -19.687  1.00  0.86           N  
ATOM    989  CA  LYS A 120       3.358   3.859 -20.005  1.00  0.86           C  
ATOM    990  C   LYS A 120       2.331   3.656 -18.917  1.00  0.86           C  
ATOM    991  O   LYS A 120       1.400   4.444 -18.788  1.00  0.86           O  
ATOM    992  CB  LYS A 120       2.800   3.290 -21.324  1.00  0.86           C  
ATOM    993  CG  LYS A 120       3.708   3.618 -22.517  1.00  0.86           C  
ATOM    994  CD  LYS A 120       3.162   3.071 -23.842  1.00  0.86           C  
ATOM    995  CE  LYS A 120       4.093   3.358 -25.019  1.00  0.86           C  
ATOM    996  NZ  LYS A 120       3.555   2.727 -26.243  1.00  0.86           N  
ATOM    997  N   ASN A 121       2.504   2.612 -18.087  1.00  0.88           N  
ATOM    998  CA  ASN A 121       1.504   2.233 -17.115  1.00  0.88           C  
ATOM    999  C   ASN A 121       1.991   2.315 -15.678  1.00  0.88           C  
ATOM   1000  O   ASN A 121       1.182   2.312 -14.753  1.00  0.88           O  
ATOM   1001  CB  ASN A 121       1.013   0.808 -17.447  1.00  0.88           C  
ATOM   1002  CG  ASN A 121       0.096   0.896 -18.661  1.00  0.88           C  
ATOM   1003  OD1 ASN A 121      -0.977   1.504 -18.593  1.00  0.88           O  
ATOM   1004  ND2 ASN A 121       0.485   0.299 -19.804  1.00  0.88           N  
ATOM   1005  N   TRP A 122       3.312   2.466 -15.448  1.00  0.88           N  
ATOM   1006  CA  TRP A 122       3.912   2.459 -14.123  1.00  0.88           C  
ATOM   1007  C   TRP A 122       3.303   3.369 -13.058  1.00  0.88           C  
ATOM   1008  O   TRP A 122       2.705   4.415 -13.332  1.00  0.88           O  
ATOM   1009  CB  TRP A 122       5.462   2.631 -14.168  1.00  0.88           C  
ATOM   1010  CG  TRP A 122       6.061   3.953 -14.643  1.00  0.88           C  
ATOM   1011  CD1 TRP A 122       5.496   5.194 -14.708  1.00  0.88           C  
ATOM   1012  CD2 TRP A 122       7.419   4.112 -15.101  1.00  0.88           C  
ATOM   1013  NE1 TRP A 122       6.408   6.107 -15.172  1.00  0.88           N  
ATOM   1014  CE2 TRP A 122       7.579   5.471 -15.447  1.00  0.88           C  
ATOM   1015  CE3 TRP A 122       8.482   3.220 -15.237  1.00  0.88           C  
ATOM   1016  CZ2 TRP A 122       8.778   5.951 -15.947  1.00  0.88           C  
ATOM   1017  CZ3 TRP A 122       9.710   3.724 -15.697  1.00  0.88           C  
ATOM   1018  CH2 TRP A 122       9.857   5.070 -16.058  1.00  0.88           C  
ATOM   1019  N   GLY A 123       3.453   2.999 -11.778  1.00  0.94           N  
ATOM   1020  CA  GLY A 123       3.061   3.910 -10.725  1.00  0.94           C  
ATOM   1021  C   GLY A 123       3.322   3.357  -9.368  1.00  0.94           C  
ATOM   1022  O   GLY A 123       3.663   2.187  -9.194  1.00  0.94           O  
ATOM   1023  N   LEU A 124       3.174   4.219  -8.355  1.00  0.94           N  
ATOM   1024  CA  LEU A 124       3.565   3.920  -6.997  1.00  0.94           C  
ATOM   1025  C   LEU A 124       2.453   4.253  -6.036  1.00  0.94           C  
ATOM   1026  O   LEU A 124       1.877   5.340  -6.080  1.00  0.94           O  
ATOM   1027  CB  LEU A 124       4.780   4.763  -6.542  1.00  0.94           C  
ATOM   1028  CG  LEU A 124       6.104   4.451  -7.248  1.00  0.94           C  
ATOM   1029  CD1 LEU A 124       7.149   5.528  -6.937  1.00  0.94           C  
ATOM   1030  CD2 LEU A 124       6.624   3.070  -6.852  1.00  0.94           C  
ATOM   1031  N   SER A 125       2.171   3.337  -5.098  1.00  0.95           N  
ATOM   1032  CA  SER A 125       1.263   3.586  -3.991  1.00  0.95           C  
ATOM   1033  C   SER A 125       2.077   3.590  -2.726  1.00  0.95           C  
ATOM   1034  O   SER A 125       2.942   2.735  -2.548  1.00  0.95           O  
ATOM   1035  CB  SER A 125       0.168   2.507  -3.796  1.00  0.95           C  
ATOM   1036  OG  SER A 125      -0.836   2.558  -4.806  1.00  0.95           O  
ATOM   1037  N   VAL A 126       1.831   4.547  -1.815  1.00  0.95           N  
ATOM   1038  CA  VAL A 126       2.650   4.759  -0.627  1.00  0.95           C  
ATOM   1039  C   VAL A 126       1.831   4.534   0.636  1.00  0.95           C  
ATOM   1040  O   VAL A 126       0.643   4.870   0.707  1.00  0.95           O  
ATOM   1041  CB  VAL A 126       3.315   6.136  -0.653  1.00  0.95           C  
ATOM   1042  CG1 VAL A 126       2.316   7.278  -0.457  1.00  0.95           C  
ATOM   1043  CG2 VAL A 126       4.439   6.308   0.382  1.00  0.95           C  
ATOM   1044  N   TYR A 127       2.443   3.908   1.663  1.00  0.95           N  
ATOM   1045  CA  TYR A 127       1.749   3.436   2.845  1.00  0.95           C  
ATOM   1046  C   TYR A 127       2.596   3.720   4.076  1.00  0.95           C  
ATOM   1047  O   TYR A 127       3.825   3.756   3.996  1.00  0.95           O  
ATOM   1048  CB  TYR A 127       1.512   1.900   2.804  1.00  0.95           C  
ATOM   1049  CG  TYR A 127       0.760   1.475   1.576  1.00  0.95           C  
ATOM   1050  CD1 TYR A 127      -0.628   1.303   1.622  1.00  0.95           C  
ATOM   1051  CD2 TYR A 127       1.436   1.228   0.370  1.00  0.95           C  
ATOM   1052  CE1 TYR A 127      -1.337   0.923   0.474  1.00  0.95           C  
ATOM   1053  CE2 TYR A 127       0.732   0.839  -0.775  1.00  0.95           C  
ATOM   1054  CZ  TYR A 127      -0.659   0.703  -0.726  1.00  0.95           C  
ATOM   1055  OH  TYR A 127      -1.386   0.349  -1.876  1.00  0.95           O  
ATOM   1056  N   ALA A 128       1.959   3.918   5.248  1.00  0.96           N  
ATOM   1057  CA  ALA A 128       2.650   4.199   6.493  1.00  0.96           C  
ATOM   1058  C   ALA A 128       1.973   3.507   7.670  1.00  0.96           C  
ATOM   1059  O   ALA A 128       0.860   2.994   7.533  1.00  0.96           O  
ATOM   1060  CB  ALA A 128       2.719   5.718   6.744  1.00  0.96           C  
ATOM   1061  N   ASP A 129       2.635   3.476   8.853  1.00  0.92           N  
ATOM   1062  CA  ASP A 129       2.131   2.898  10.093  1.00  0.92           C  
ATOM   1063  C   ASP A 129       1.042   3.761  10.734  1.00  0.92           C  
ATOM   1064  O   ASP A 129       0.297   3.325  11.609  1.00  0.92           O  
ATOM   1065  CB  ASP A 129       3.300   2.577  11.094  1.00  0.92           C  
ATOM   1066  CG  ASP A 129       3.965   3.768  11.792  1.00  0.92           C  
ATOM   1067  OD1 ASP A 129       3.963   4.890  11.225  1.00  0.92           O  
ATOM   1068  OD2 ASP A 129       4.509   3.582  12.917  1.00  0.92           O  
ATOM   1069  N   LYS A 130       0.912   5.017  10.268  1.00  0.91           N  
ATOM   1070  CA  LYS A 130      -0.004   6.010  10.770  1.00  0.91           C  
ATOM   1071  C   LYS A 130      -0.737   6.653   9.614  1.00  0.91           C  
ATOM   1072  O   LYS A 130      -0.277   6.549   8.477  1.00  0.91           O  
ATOM   1073  CB  LYS A 130       0.783   7.109  11.507  1.00  0.91           C  
ATOM   1074  CG  LYS A 130       1.344   6.583  12.827  1.00  0.91           C  
ATOM   1075  CD  LYS A 130       2.147   7.649  13.565  1.00  0.91           C  
ATOM   1076  CE  LYS A 130       2.777   7.095  14.833  1.00  0.91           C  
ATOM   1077  NZ  LYS A 130       3.416   8.214  15.549  1.00  0.91           N  
ATOM   1078  N   PRO A 131      -1.871   7.314   9.842  1.00  0.93           N  
ATOM   1079  CA  PRO A 131      -2.632   7.935   8.769  1.00  0.93           C  
ATOM   1080  C   PRO A 131      -2.014   9.245   8.318  1.00  0.93           C  
ATOM   1081  O   PRO A 131      -2.260   9.654   7.184  1.00  0.93           O  
ATOM   1082  CB  PRO A 131      -4.038   8.111   9.350  1.00  0.93           C  
ATOM   1083  CG  PRO A 131      -3.867   8.102  10.869  1.00  0.93           C  
ATOM   1084  CD  PRO A 131      -2.629   7.247  11.095  1.00  0.93           C  
ATOM   1085  N   GLU A 132      -1.214   9.910   9.166  1.00  0.84           N  
ATOM   1086  CA  GLU A 132      -0.486  11.111   8.821  1.00  0.84           C  
ATOM   1087  C   GLU A 132       1.004  10.820   8.767  1.00  0.84           C  
ATOM   1088  O   GLU A 132       1.578  10.147   9.625  1.00  0.84           O  
ATOM   1089  CB  GLU A 132      -0.732  12.272   9.818  1.00  0.84           C  
ATOM   1090  CG  GLU A 132      -2.228  12.639   9.990  1.00  0.84           C  
ATOM   1091  CD  GLU A 132      -2.981  11.798  11.026  1.00  0.84           C  
ATOM   1092  OE1 GLU A 132      -4.230  11.952  11.079  1.00  0.84           O  
ATOM   1093  OE2 GLU A 132      -2.334  11.011  11.769  1.00  0.84           O  
ATOM   1094  N   THR A 133       1.676  11.329   7.720  1.00  0.87           N  
ATOM   1095  CA  THR A 133       3.093  11.124   7.481  1.00  0.87           C  
ATOM   1096  C   THR A 133       3.888  12.377   7.769  1.00  0.87           C  
ATOM   1097  O   THR A 133       3.377  13.497   7.766  1.00  0.87           O  
ATOM   1098  CB  THR A 133       3.410  10.688   6.051  1.00  0.87           C  
ATOM   1099  OG1 THR A 133       2.835  11.554   5.078  1.00  0.87           O  
ATOM   1100  CG2 THR A 133       2.806   9.301   5.819  1.00  0.87           C  
ATOM   1101  N   THR A 134       5.199  12.209   8.035  1.00  0.82           N  
ATOM   1102  CA  THR A 134       6.138  13.311   8.159  1.00  0.82           C  
ATOM   1103  C   THR A 134       6.569  13.810   6.793  1.00  0.82           C  
ATOM   1104  O   THR A 134       6.356  13.158   5.768  1.00  0.82           O  
ATOM   1105  CB  THR A 134       7.382  13.036   9.017  1.00  0.82           C  
ATOM   1106  OG1 THR A 134       8.359  12.233   8.367  1.00  0.82           O  
ATOM   1107  CG2 THR A 134       6.972  12.372  10.346  1.00  0.82           C  
ATOM   1108  N   LYS A 135       7.208  15.000   6.729  1.00  0.78           N  
ATOM   1109  CA  LYS A 135       7.733  15.545   5.488  1.00  0.78           C  
ATOM   1110  C   LYS A 135       8.828  14.674   4.901  1.00  0.78           C  
ATOM   1111  O   LYS A 135       8.886  14.444   3.698  1.00  0.78           O  
ATOM   1112  CB  LYS A 135       8.261  16.987   5.676  1.00  0.78           C  
ATOM   1113  CG  LYS A 135       7.142  18.012   5.932  1.00  0.78           C  
ATOM   1114  CD  LYS A 135       7.674  19.455   6.008  1.00  0.78           C  
ATOM   1115  CE  LYS A 135       6.578  20.495   6.256  1.00  0.78           C  
ATOM   1116  NZ  LYS A 135       7.173  21.849   6.324  1.00  0.78           N  
ATOM   1117  N   GLU A 136       9.700  14.139   5.761  1.00  0.77           N  
ATOM   1118  CA  GLU A 136      10.795  13.257   5.431  1.00  0.77           C  
ATOM   1119  C   GLU A 136      10.322  11.948   4.810  1.00  0.77           C  
ATOM   1120  O   GLU A 136      10.802  11.529   3.760  1.00  0.77           O  
ATOM   1121  CB  GLU A 136      11.628  12.968   6.709  1.00  0.77           C  
ATOM   1122  CG  GLU A 136      12.188  14.228   7.436  1.00  0.77           C  
ATOM   1123  CD  GLU A 136      11.114  15.099   8.095  1.00  0.77           C  
ATOM   1124  OE1 GLU A 136      11.265  16.342   8.106  1.00  0.77           O  
ATOM   1125  OE2 GLU A 136      10.062  14.520   8.488  1.00  0.77           O  
ATOM   1126  N   GLN A 137       9.286  11.318   5.408  1.00  0.82           N  
ATOM   1127  CA  GLN A 137       8.648  10.113   4.901  1.00  0.82           C  
ATOM   1128  C   GLN A 137       8.005  10.310   3.541  1.00  0.82           C  
ATOM   1129  O   GLN A 137       8.101   9.477   2.641  1.00  0.82           O  
ATOM   1130  CB  GLN A 137       7.528   9.677   5.873  1.00  0.82           C  
ATOM   1131  CG  GLN A 137       8.044   9.078   7.197  1.00  0.82           C  
ATOM   1132  CD  GLN A 137       6.875   8.763   8.138  1.00  0.82           C  
ATOM   1133  OE1 GLN A 137       5.830   9.418   8.129  1.00  0.82           O  
ATOM   1134  NE2 GLN A 137       7.045   7.717   8.970  1.00  0.82           N  
ATOM   1135  N   LEU A 138       7.314  11.448   3.363  1.00  0.87           N  
ATOM   1136  CA  LEU A 138       6.723  11.824   2.098  1.00  0.87           C  
ATOM   1137  C   LEU A 138       7.759  12.210   1.038  1.00  0.87           C  
ATOM   1138  O   LEU A 138       7.582  11.946  -0.148  1.00  0.87           O  
ATOM   1139  CB  LEU A 138       5.666  12.921   2.342  1.00  0.87           C  
ATOM   1140  CG  LEU A 138       4.680  13.169   1.184  1.00  0.87           C  
ATOM   1141  CD1 LEU A 138       3.859  11.927   0.802  1.00  0.87           C  
ATOM   1142  CD2 LEU A 138       3.744  14.332   1.541  1.00  0.87           C  
ATOM   1143  N   GLY A 139       8.899  12.813   1.447  1.00  0.87           N  
ATOM   1144  CA  GLY A 139      10.047  13.117   0.590  1.00  0.87           C  
ATOM   1145  C   GLY A 139      10.630  11.929  -0.127  1.00  0.87           C  
ATOM   1146  O   GLY A 139      10.884  11.983  -1.325  1.00  0.87           O  
ATOM   1147  N   GLU A 140      10.797  10.800   0.585  1.00  0.79           N  
ATOM   1148  CA  GLU A 140      11.263   9.545   0.014  1.00  0.79           C  
ATOM   1149  C   GLU A 140      10.338   8.984  -1.076  1.00  0.79           C  
ATOM   1150  O   GLU A 140      10.780   8.454  -2.095  1.00  0.79           O  
ATOM   1151  CB  GLU A 140      11.505   8.485   1.118  1.00  0.79           C  
ATOM   1152  CG  GLU A 140      12.644   8.855   2.104  1.00  0.79           C  
ATOM   1153  CD  GLU A 140      13.107   7.692   2.983  1.00  0.79           C  
ATOM   1154  OE1 GLU A 140      13.470   7.946   4.159  1.00  0.79           O  
ATOM   1155  OE2 GLU A 140      13.174   6.537   2.481  1.00  0.79           O  
ATOM   1156  N   PHE A 141       9.004   9.124  -0.897  1.00  0.87           N  
ATOM   1157  CA  PHE A 141       8.006   8.848  -1.924  1.00  0.87           C  
ATOM   1158  C   PHE A 141       8.139   9.758  -3.143  1.00  0.87           C  
ATOM   1159  O   PHE A 141       8.089   9.294  -4.281  1.00  0.87           O  
ATOM   1160  CB  PHE A 141       6.587   8.959  -1.302  1.00  0.87           C  
ATOM   1161  CG  PHE A 141       5.442   8.807  -2.281  1.00  0.87           C  
ATOM   1162  CD1 PHE A 141       4.483   9.827  -2.413  1.00  0.87           C  
ATOM   1163  CD2 PHE A 141       5.318   7.662  -3.082  1.00  0.87           C  
ATOM   1164  CE1 PHE A 141       3.406   9.684  -3.295  1.00  0.87           C  
ATOM   1165  CE2 PHE A 141       4.238   7.515  -3.961  1.00  0.87           C  
ATOM   1166  CZ  PHE A 141       3.276   8.523  -4.063  1.00  0.87           C  
ATOM   1167  N   TYR A 142       8.342  11.075  -2.936  1.00  0.87           N  
ATOM   1168  CA  TYR A 142       8.568  12.013  -4.024  1.00  0.87           C  
ATOM   1169  C   TYR A 142       9.812  11.695  -4.842  1.00  0.87           C  
ATOM   1170  O   TYR A 142       9.732  11.628  -6.061  1.00  0.87           O  
ATOM   1171  CB  TYR A 142       8.627  13.477  -3.526  1.00  0.87           C  
ATOM   1172  CG  TYR A 142       7.334  13.967  -2.920  1.00  0.87           C  
ATOM   1173  CD1 TYR A 142       6.064  13.604  -3.410  1.00  0.87           C  
ATOM   1174  CD2 TYR A 142       7.408  14.913  -1.885  1.00  0.87           C  
ATOM   1175  CE1 TYR A 142       4.907  14.224  -2.921  1.00  0.87           C  
ATOM   1176  CE2 TYR A 142       6.255  15.528  -1.388  1.00  0.87           C  
ATOM   1177  CZ  TYR A 142       5.012  15.213  -1.936  1.00  0.87           C  
ATOM   1178  OH  TYR A 142       3.885  15.933  -1.515  1.00  0.87           O  
ATOM   1179  N   GLU A 143      10.954  11.366  -4.197  1.00  0.79           N  
ATOM   1180  CA  GLU A 143      12.179  10.948  -4.873  1.00  0.79           C  
ATOM   1181  C   GLU A 143      11.962   9.738  -5.793  1.00  0.79           C  
ATOM   1182  O   GLU A 143      12.427   9.680  -6.932  1.00  0.79           O  
ATOM   1183  CB  GLU A 143      13.275  10.587  -3.830  1.00  0.79           C  
ATOM   1184  CG  GLU A 143      13.885  11.786  -3.053  1.00  0.79           C  
ATOM   1185  CD  GLU A 143      14.967  11.384  -2.036  1.00  0.79           C  
ATOM   1186  OE1 GLU A 143      15.520  12.310  -1.385  1.00  0.79           O  
ATOM   1187  OE2 GLU A 143      15.280  10.170  -1.894  1.00  0.79           O  
ATOM   1188  N   ALA A 144      11.171   8.753  -5.321  1.00  0.88           N  
ATOM   1189  CA  ALA A 144      10.714   7.628  -6.108  1.00  0.88           C  
ATOM   1190  C   ALA A 144       9.824   8.000  -7.313  1.00  0.88           C  
ATOM   1191  O   ALA A 144      10.000   7.473  -8.410  1.00  0.88           O  
ATOM   1192  CB  ALA A 144      10.013   6.641  -5.156  1.00  0.88           C  
ATOM   1193  N   LEU A 145       8.867   8.942  -7.156  1.00  0.88           N  
ATOM   1194  CA  LEU A 145       8.084   9.512  -8.253  1.00  0.88           C  
ATOM   1195  C   LEU A 145       8.901  10.309  -9.274  1.00  0.88           C  
ATOM   1196  O   LEU A 145       8.703  10.171 -10.481  1.00  0.88           O  
ATOM   1197  CB  LEU A 145       6.936  10.416  -7.746  1.00  0.88           C  
ATOM   1198  CG  LEU A 145       5.791   9.696  -7.010  1.00  0.88           C  
ATOM   1199  CD1 LEU A 145       4.846  10.755  -6.435  1.00  0.88           C  
ATOM   1200  CD2 LEU A 145       5.008   8.733  -7.916  1.00  0.88           C  
ATOM   1201  N   ASP A 146       9.867  11.131  -8.819  1.00  0.86           N  
ATOM   1202  CA  ASP A 146      10.804  11.880  -9.645  1.00  0.86           C  
ATOM   1203  C   ASP A 146      11.665  10.981 -10.525  1.00  0.86           C  
ATOM   1204  O   ASP A 146      11.914  11.266 -11.704  1.00  0.86           O  
ATOM   1205  CB  ASP A 146      11.714  12.766  -8.764  1.00  0.86           C  
ATOM   1206  CG  ASP A 146      10.926  13.919  -8.145  1.00  0.86           C  
ATOM   1207  OD1 ASP A 146       9.817  14.238  -8.647  1.00  0.86           O  
ATOM   1208  OD2 ASP A 146      11.455  14.527  -7.181  1.00  0.86           O  
ATOM   1209  N   CYS A 147      12.092   9.813  -9.993  1.00  0.86           N  
ATOM   1210  CA  CYS A 147      12.702   8.747 -10.783  1.00  0.86           C  
ATOM   1211  C   CYS A 147      11.786   8.275 -11.912  1.00  0.86           C  
ATOM   1212  O   CYS A 147      12.216   8.198 -13.059  1.00  0.86           O  
ATOM   1213  CB  CYS A 147      13.136   7.520  -9.925  1.00  0.86           C  
ATOM   1214  SG  CYS A 147      13.616   6.045 -10.916  1.00  0.86           S  
ATOM   1215  N   LEU A 148      10.484   8.042 -11.639  1.00  0.88           N  
ATOM   1216  CA  LEU A 148       9.560   7.516 -12.634  1.00  0.88           C  
ATOM   1217  C   LEU A 148       8.992   8.616 -13.515  1.00  0.88           C  
ATOM   1218  O   LEU A 148       8.143   8.398 -14.376  1.00  0.88           O  
ATOM   1219  CB  LEU A 148       8.351   6.817 -11.961  1.00  0.88           C  
ATOM   1220  CG  LEU A 148       8.668   5.529 -11.184  1.00  0.88           C  
ATOM   1221  CD1 LEU A 148       7.373   4.889 -10.669  1.00  0.88           C  
ATOM   1222  CD2 LEU A 148       9.428   4.523 -12.050  1.00  0.88           C  
ATOM   1223  N   ARG A 149       9.457   9.865 -13.320  1.00  0.82           N  
ATOM   1224  CA  ARG A 149       9.021  11.026 -14.063  1.00  0.82           C  
ATOM   1225  C   ARG A 149       7.503  11.169 -14.018  1.00  0.82           C  
ATOM   1226  O   ARG A 149       6.836  11.303 -15.047  1.00  0.82           O  
ATOM   1227  CB  ARG A 149       9.564  11.024 -15.518  1.00  0.82           C  
ATOM   1228  CG  ARG A 149      11.100  10.991 -15.659  1.00  0.82           C  
ATOM   1229  CD  ARG A 149      11.803  12.243 -15.130  1.00  0.82           C  
ATOM   1230  NE  ARG A 149      13.245  12.150 -15.540  1.00  0.82           N  
ATOM   1231  CZ  ARG A 149      14.213  11.579 -14.810  1.00  0.82           C  
ATOM   1232  NH1 ARG A 149      15.448  11.526 -15.315  1.00  0.82           N  
ATOM   1233  NH2 ARG A 149      14.006  11.070 -13.601  1.00  0.82           N  
ATOM   1234  N   ILE A 150       6.940  11.077 -12.800  1.00  0.90           N  
ATOM   1235  CA  ILE A 150       5.525  11.223 -12.538  1.00  0.90           C  
ATOM   1236  C   ILE A 150       5.427  12.529 -11.778  1.00  0.90           C  
ATOM   1237  O   ILE A 150       5.965  12.601 -10.672  1.00  0.90           O  
ATOM   1238  CB  ILE A 150       4.931  10.087 -11.706  1.00  0.90           C  
ATOM   1239  CG1 ILE A 150       4.943   8.773 -12.521  1.00  0.90           C  
ATOM   1240  CG2 ILE A 150       3.494  10.452 -11.272  1.00  0.90           C  
ATOM   1241  CD1 ILE A 150       4.443   7.537 -11.762  1.00  0.90           C  
ATOM   1242  N   PRO A 151       4.833  13.593 -12.302  1.00  0.92           N  
ATOM   1243  CA  PRO A 151       4.592  14.828 -11.563  1.00  0.92           C  
ATOM   1244  C   PRO A 151       3.995  14.678 -10.164  1.00  0.92           C  
ATOM   1245  O   PRO A 151       3.070  13.897  -9.953  1.00  0.92           O  
ATOM   1246  CB  PRO A 151       3.690  15.653 -12.502  1.00  0.92           C  
ATOM   1247  CG  PRO A 151       3.941  15.084 -13.902  1.00  0.92           C  
ATOM   1248  CD  PRO A 151       4.170  13.609 -13.608  1.00  0.92           C  
ATOM   1249  N   LYS A 152       4.453  15.480  -9.181  1.00  0.89           N  
ATOM   1250  CA  LYS A 152       3.884  15.500  -7.841  1.00  0.89           C  
ATOM   1251  C   LYS A 152       2.462  16.072  -7.776  1.00  0.89           C  
ATOM   1252  O   LYS A 152       1.769  15.935  -6.771  1.00  0.89           O  
ATOM   1253  CB  LYS A 152       4.801  16.300  -6.885  1.00  0.89           C  
ATOM   1254  CG  LYS A 152       4.867  17.803  -7.196  1.00  0.89           C  
ATOM   1255  CD  LYS A 152       5.821  18.549  -6.254  1.00  0.89           C  
ATOM   1256  CE  LYS A 152       5.867  20.051  -6.532  1.00  0.89           C  
ATOM   1257  NZ  LYS A 152       6.839  20.707  -5.632  1.00  0.89           N  
ATOM   1258  N   SER A 153       2.011  16.735  -8.866  1.00  0.87           N  
ATOM   1259  CA  SER A 153       0.679  17.259  -9.074  1.00  0.87           C  
ATOM   1260  C   SER A 153      -0.326  16.164  -9.349  1.00  0.87           C  
ATOM   1261  O   SER A 153      -1.512  16.337  -9.088  1.00  0.87           O  
ATOM   1262  CB  SER A 153       0.629  18.317 -10.234  1.00  0.87           C  
ATOM   1263  OG  SER A 153       1.501  17.973 -11.283  1.00  0.87           O  
ATOM   1264  N   ASP A 154       0.140  14.983  -9.795  1.00  0.90           N  
ATOM   1265  CA  ASP A 154      -0.722  13.878 -10.166  1.00  0.90           C  
ATOM   1266  C   ASP A 154      -0.941  12.924  -8.986  1.00  0.90           C  
ATOM   1267  O   ASP A 154      -1.626  11.907  -9.091  1.00  0.90           O  
ATOM   1268  CB  ASP A 154      -0.076  13.092 -11.338  1.00  0.90           C  
ATOM   1269  CG  ASP A 154       0.180  13.933 -12.589  1.00  0.90           C  
ATOM   1270  OD1 ASP A 154      -0.222  15.123 -12.654  1.00  0.90           O  
ATOM   1271  OD2 ASP A 154       0.844  13.375 -13.501  1.00  0.90           O  
ATOM   1272  N   VAL A 155      -0.365  13.238  -7.806  1.00  0.91           N  
ATOM   1273  CA  VAL A 155      -0.525  12.451  -6.592  1.00  0.91           C  
ATOM   1274  C   VAL A 155      -1.898  12.610  -5.955  1.00  0.91           C  
ATOM   1275  O   VAL A 155      -2.313  13.692  -5.539  1.00  0.91           O  
ATOM   1276  CB  VAL A 155       0.550  12.730  -5.546  1.00  0.91           C  
ATOM   1277  CG1 VAL A 155       0.382  11.790  -4.339  1.00  0.91           C  
ATOM   1278  CG2 VAL A 155       1.943  12.515  -6.153  1.00  0.91           C  
ATOM   1279  N   VAL A 156      -2.626  11.489  -5.817  1.00  0.91           N  
ATOM   1280  CA  VAL A 156      -3.899  11.427  -5.127  1.00  0.91           C  
ATOM   1281  C   VAL A 156      -3.609  11.067  -3.678  1.00  0.91           C  
ATOM   1282  O   VAL A 156      -2.874  10.119  -3.411  1.00  0.91           O  
ATOM   1283  CB  VAL A 156      -4.846  10.416  -5.768  1.00  0.91           C  
ATOM   1284  CG1 VAL A 156      -6.175  10.343  -4.989  1.00  0.91           C  
ATOM   1285  CG2 VAL A 156      -5.096  10.836  -7.231  1.00  0.91           C  
ATOM   1286  N   TYR A 157      -4.155  11.828  -2.707  1.00  0.92           N  
ATOM   1287  CA  TYR A 157      -3.944  11.621  -1.283  1.00  0.92           C  
ATOM   1288  C   TYR A 157      -5.238  11.205  -0.625  1.00  0.92           C  
ATOM   1289  O   TYR A 157      -6.320  11.665  -0.995  1.00  0.92           O  
ATOM   1290  CB  TYR A 157      -3.532  12.908  -0.521  1.00  0.92           C  
ATOM   1291  CG  TYR A 157      -2.190  13.371  -0.963  1.00  0.92           C  
ATOM   1292  CD1 TYR A 157      -1.043  12.914  -0.301  1.00  0.92           C  
ATOM   1293  CD2 TYR A 157      -2.058  14.215  -2.075  1.00  0.92           C  
ATOM   1294  CE1 TYR A 157       0.227  13.257  -0.775  1.00  0.92           C  
ATOM   1295  CE2 TYR A 157      -0.790  14.565  -2.549  1.00  0.92           C  
ATOM   1296  CZ  TYR A 157       0.347  14.071  -1.903  1.00  0.92           C  
ATOM   1297  OH  TYR A 157       1.616  14.327  -2.430  1.00  0.92           O  
ATOM   1298  N   THR A 158      -5.148  10.344   0.403  1.00  0.93           N  
ATOM   1299  CA  THR A 158      -6.248  10.075   1.312  1.00  0.93           C  
ATOM   1300  C   THR A 158      -6.476  11.226   2.260  1.00  0.93           C  
ATOM   1301  O   THR A 158      -5.586  12.028   2.539  1.00  0.93           O  
ATOM   1302  CB  THR A 158      -6.101   8.797   2.135  1.00  0.93           C  
ATOM   1303  OG1 THR A 158      -4.878   8.737   2.847  1.00  0.93           O  
ATOM   1304  CG2 THR A 158      -6.115   7.607   1.182  1.00  0.93           C  
ATOM   1305  N   ASP A 159      -7.705  11.342   2.779  1.00  0.91           N  
ATOM   1306  CA  ASP A 159      -8.023  12.266   3.836  1.00  0.91           C  
ATOM   1307  C   ASP A 159      -8.539  11.387   4.962  1.00  0.91           C  
ATOM   1308  O   ASP A 159      -9.592  10.756   4.862  1.00  0.91           O  
ATOM   1309  CB  ASP A 159      -9.044  13.323   3.334  1.00  0.91           C  
ATOM   1310  CG  ASP A 159      -9.441  14.352   4.383  1.00  0.91           C  
ATOM   1311  OD1 ASP A 159      -8.955  14.283   5.542  1.00  0.91           O  
ATOM   1312  OD2 ASP A 159     -10.290  15.210   4.022  1.00  0.91           O  
ATOM   1313  N   TRP A 160      -7.791  11.310   6.079  1.00  0.87           N  
ATOM   1314  CA  TRP A 160      -8.147  10.505   7.233  1.00  0.87           C  
ATOM   1315  C   TRP A 160      -9.392  11.019   7.955  1.00  0.87           C  
ATOM   1316  O   TRP A 160     -10.118  10.260   8.590  1.00  0.87           O  
ATOM   1317  CB  TRP A 160      -6.931  10.369   8.192  1.00  0.87           C  
ATOM   1318  CG  TRP A 160      -7.137   9.447   9.390  1.00  0.87           C  
ATOM   1319  CD1 TRP A 160      -7.103   9.748  10.725  1.00  0.87           C  
ATOM   1320  CD2 TRP A 160      -7.489   8.054   9.300  1.00  0.87           C  
ATOM   1321  NE1 TRP A 160      -7.476   8.646  11.469  1.00  0.87           N  
ATOM   1322  CE2 TRP A 160      -7.730   7.604  10.615  1.00  0.87           C  
ATOM   1323  CE3 TRP A 160      -7.638   7.197   8.213  1.00  0.87           C  
ATOM   1324  CZ2 TRP A 160      -8.161   6.309  10.860  1.00  0.87           C  
ATOM   1325  CZ3 TRP A 160      -8.075   5.890   8.461  1.00  0.87           C  
ATOM   1326  CH2 TRP A 160      -8.351   5.455   9.765  1.00  0.87           C  
ATOM   1327  N   LYS A 161      -9.740  12.315   7.797  1.00  0.86           N  
ATOM   1328  CA  LYS A 161     -10.921  12.904   8.410  1.00  0.86           C  
ATOM   1329  C   LYS A 161     -12.208  12.425   7.764  1.00  0.86           C  
ATOM   1330  O   LYS A 161     -13.303  12.589   8.297  1.00  0.86           O  
ATOM   1331  CB  LYS A 161     -10.875  14.441   8.289  1.00  0.86           C  
ATOM   1332  CG  LYS A 161      -9.671  15.071   9.002  1.00  0.86           C  
ATOM   1333  CD  LYS A 161      -9.589  16.584   8.751  1.00  0.86           C  
ATOM   1334  CE  LYS A 161      -8.375  17.225   9.418  1.00  0.86           C  
ATOM   1335  NZ  LYS A 161      -8.280  18.642   9.008  1.00  0.86           N  
ATOM   1336  N   LYS A 162     -12.088  11.793   6.585  1.00  0.86           N  
ATOM   1337  CA  LYS A 162     -13.213  11.232   5.892  1.00  0.86           C  
ATOM   1338  C   LYS A 162     -13.422   9.766   6.196  1.00  0.86           C  
ATOM   1339  O   LYS A 162     -14.357   9.186   5.655  1.00  0.86           O  
ATOM   1340  CB  LYS A 162     -13.050  11.401   4.368  1.00  0.86           C  
ATOM   1341  CG  LYS A 162     -13.094  12.874   3.954  1.00  0.86           C  
ATOM   1342  CD  LYS A 162     -12.987  13.073   2.438  1.00  0.86           C  
ATOM   1343  CE  LYS A 162     -12.993  14.558   2.079  1.00  0.86           C  
ATOM   1344  NZ  LYS A 162     -12.620  14.734   0.662  1.00  0.86           N  
ATOM   1345  N   ASP A 163     -12.611   9.126   7.074  1.00  0.88           N  
ATOM   1346  CA  ASP A 163     -12.794   7.721   7.398  1.00  0.88           C  
ATOM   1347  C   ASP A 163     -14.191   7.380   7.953  1.00  0.88           C  
ATOM   1348  O   ASP A 163     -14.856   8.162   8.637  1.00  0.88           O  
ATOM   1349  CB  ASP A 163     -11.658   7.168   8.307  1.00  0.88           C  
ATOM   1350  CG  ASP A 163     -11.797   5.657   8.393  1.00  0.88           C  
ATOM   1351  OD1 ASP A 163     -11.713   5.017   7.311  1.00  0.88           O  
ATOM   1352  OD2 ASP A 163     -12.147   5.129   9.478  1.00  0.88           O  
ATOM   1353  N   LYS A 164     -14.681   6.178   7.593  1.00  0.85           N  
ATOM   1354  CA  LYS A 164     -15.942   5.643   8.041  1.00  0.85           C  
ATOM   1355  C   LYS A 164     -15.762   4.234   8.557  1.00  0.85           C  
ATOM   1356  O   LYS A 164     -16.730   3.566   8.920  1.00  0.85           O  
ATOM   1357  CB  LYS A 164     -16.937   5.604   6.854  1.00  0.85           C  
ATOM   1358  CG  LYS A 164     -17.241   6.980   6.240  1.00  0.85           C  
ATOM   1359  CD  LYS A 164     -17.906   7.964   7.210  1.00  0.85           C  
ATOM   1360  CE  LYS A 164     -18.040   9.365   6.616  1.00  0.85           C  
ATOM   1361  NZ  LYS A 164     -18.291  10.321   7.714  1.00  0.85           N  
ATOM   1362  N   CYS A 165     -14.516   3.735   8.619  1.00  0.92           N  
ATOM   1363  CA  CYS A 165     -14.266   2.336   8.881  1.00  0.92           C  
ATOM   1364  C   CYS A 165     -13.749   2.077  10.277  1.00  0.92           C  
ATOM   1365  O   CYS A 165     -13.813   0.944  10.757  1.00  0.92           O  
ATOM   1366  CB  CYS A 165     -13.241   1.769   7.886  1.00  0.92           C  
ATOM   1367  SG  CYS A 165     -13.890   1.420   6.226  1.00  0.92           S  
ATOM   1368  N   GLU A 166     -13.314   3.117  11.005  1.00  0.84           N  
ATOM   1369  CA  GLU A 166     -12.978   3.015  12.419  1.00  0.84           C  
ATOM   1370  C   GLU A 166     -14.090   2.433  13.324  1.00  0.84           C  
ATOM   1371  O   GLU A 166     -13.762   1.597  14.171  1.00  0.84           O  
ATOM   1372  CB  GLU A 166     -12.482   4.377  12.980  1.00  0.84           C  
ATOM   1373  CG  GLU A 166     -11.637   4.246  14.274  1.00  0.84           C  
ATOM   1374  CD  GLU A 166     -11.501   5.539  15.080  1.00  0.84           C  
ATOM   1375  OE1 GLU A 166     -10.966   5.442  16.222  1.00  0.84           O  
ATOM   1376  OE2 GLU A 166     -12.017   6.597  14.658  1.00  0.84           O  
ATOM   1377  N   PRO A 167     -15.402   2.735  13.227  1.00  0.87           N  
ATOM   1378  CA  PRO A 167     -16.442   2.027  13.976  1.00  0.87           C  
ATOM   1379  C   PRO A 167     -16.521   0.535  13.696  1.00  0.87           C  
ATOM   1380  O   PRO A 167     -16.725  -0.236  14.632  1.00  0.87           O  
ATOM   1381  CB  PRO A 167     -17.752   2.736  13.579  1.00  0.87           C  
ATOM   1382  CG  PRO A 167     -17.310   4.125  13.114  1.00  0.87           C  
ATOM   1383  CD  PRO A 167     -15.973   3.832  12.442  1.00  0.87           C  
ATOM   1384  N   LEU A 168     -16.387   0.116  12.420  1.00  0.86           N  
ATOM   1385  CA  LEU A 168     -16.436  -1.280  12.002  1.00  0.86           C  
ATOM   1386  C   LEU A 168     -15.229  -2.074  12.491  1.00  0.86           C  
ATOM   1387  O   LEU A 168     -15.354  -3.197  12.975  1.00  0.86           O  
ATOM   1388  CB  LEU A 168     -16.597  -1.390  10.465  1.00  0.86           C  
ATOM   1389  CG  LEU A 168     -16.778  -2.822   9.909  1.00  0.86           C  
ATOM   1390  CD1 LEU A 168     -18.008  -3.538  10.485  1.00  0.86           C  
ATOM   1391  CD2 LEU A 168     -16.851  -2.792   8.376  1.00  0.86           C  
ATOM   1392  N   GLU A 169     -14.021  -1.467  12.436  1.00  0.86           N  
ATOM   1393  CA  GLU A 169     -12.799  -2.039  12.988  1.00  0.86           C  
ATOM   1394  C   GLU A 169     -12.907  -2.319  14.478  1.00  0.86           C  
ATOM   1395  O   GLU A 169     -12.607  -3.419  14.940  1.00  0.86           O  
ATOM   1396  CB  GLU A 169     -11.601  -1.094  12.727  1.00  0.86           C  
ATOM   1397  CG  GLU A 169     -10.297  -1.464  13.478  1.00  0.86           C  
ATOM   1398  CD  GLU A 169      -9.123  -0.588  13.093  1.00  0.86           C  
ATOM   1399  OE1 GLU A 169      -8.069  -1.159  12.694  1.00  0.86           O  
ATOM   1400  OE2 GLU A 169      -9.189   0.664  13.186  1.00  0.86           O  
ATOM   1401  N   LYS A 170     -13.442  -1.348  15.248  1.00  0.82           N  
ATOM   1402  CA  LYS A 170     -13.734  -1.490  16.664  1.00  0.82           C  
ATOM   1403  C   LYS A 170     -14.729  -2.593  16.980  1.00  0.82           C  
ATOM   1404  O   LYS A 170     -14.611  -3.280  17.994  1.00  0.82           O  
ATOM   1405  CB  LYS A 170     -14.250  -0.156  17.252  1.00  0.82           C  
ATOM   1406  CG  LYS A 170     -13.115   0.864  17.397  1.00  0.82           C  
ATOM   1407  CD  LYS A 170     -13.593   2.274  17.777  1.00  0.82           C  
ATOM   1408  CE  LYS A 170     -12.417   3.246  17.884  1.00  0.82           C  
ATOM   1409  NZ  LYS A 170     -12.864   4.652  17.792  1.00  0.82           N  
ATOM   1410  N   GLN A 171     -15.753  -2.794  16.128  1.00  0.79           N  
ATOM   1411  CA  GLN A 171     -16.641  -3.933  16.253  1.00  0.79           C  
ATOM   1412  C   GLN A 171     -15.934  -5.268  16.030  1.00  0.79           C  
ATOM   1413  O   GLN A 171     -15.997  -6.162  16.871  1.00  0.79           O  
ATOM   1414  CB  GLN A 171     -17.828  -3.799  15.277  1.00  0.79           C  
ATOM   1415  CG  GLN A 171     -18.805  -4.987  15.368  1.00  0.79           C  
ATOM   1416  CD  GLN A 171     -19.998  -4.853  14.424  1.00  0.79           C  
ATOM   1417  OE1 GLN A 171     -20.352  -3.786  13.919  1.00  0.79           O  
ATOM   1418  NE2 GLN A 171     -20.662  -6.007  14.193  1.00  0.79           N  
ATOM   1419  N   HIS A 172     -15.158  -5.391  14.933  1.00  0.81           N  
ATOM   1420  CA  HIS A 172     -14.396  -6.591  14.619  1.00  0.81           C  
ATOM   1421  C   HIS A 172     -13.323  -6.933  15.647  1.00  0.81           C  
ATOM   1422  O   HIS A 172     -13.036  -8.096  15.918  1.00  0.81           O  
ATOM   1423  CB  HIS A 172     -13.746  -6.503  13.229  1.00  0.81           C  
ATOM   1424  CG  HIS A 172     -14.715  -6.512  12.098  1.00  0.81           C  
ATOM   1425  ND1 HIS A 172     -14.218  -6.154  10.863  1.00  0.81           N  
ATOM   1426  CD2 HIS A 172     -16.006  -6.908  11.991  1.00  0.81           C  
ATOM   1427  CE1 HIS A 172     -15.218  -6.326  10.030  1.00  0.81           C  
ATOM   1428  NE2 HIS A 172     -16.329  -6.787  10.656  1.00  0.81           N  
ATOM   1429  N   GLU A 173     -12.680  -5.921  16.259  1.00  0.78           N  
ATOM   1430  CA  GLU A 173     -11.810  -6.094  17.408  1.00  0.78           C  
ATOM   1431  C   GLU A 173     -12.492  -6.689  18.630  1.00  0.78           C  
ATOM   1432  O   GLU A 173     -11.937  -7.561  19.296  1.00  0.78           O  
ATOM   1433  CB  GLU A 173     -11.170  -4.757  17.822  1.00  0.78           C  
ATOM   1434  CG  GLU A 173     -10.006  -4.323  16.909  1.00  0.78           C  
ATOM   1435  CD  GLU A 173      -9.238  -3.138  17.491  1.00  0.78           C  
ATOM   1436  OE1 GLU A 173      -8.218  -2.773  16.862  1.00  0.78           O  
ATOM   1437  OE2 GLU A 173      -9.613  -2.659  18.595  1.00  0.78           O  
ATOM   1438  N   LYS A 174     -13.721  -6.244  18.957  1.00  0.81           N  
ATOM   1439  CA  LYS A 174     -14.503  -6.827  20.032  1.00  0.81           C  
ATOM   1440  C   LYS A 174     -14.885  -8.271  19.776  1.00  0.81           C  
ATOM   1441  O   LYS A 174     -14.729  -9.114  20.655  1.00  0.81           O  
ATOM   1442  CB  LYS A 174     -15.781  -6.008  20.298  1.00  0.81           C  
ATOM   1443  CG  LYS A 174     -15.490  -4.641  20.931  1.00  0.81           C  
ATOM   1444  CD  LYS A 174     -16.749  -3.765  20.995  1.00  0.81           C  
ATOM   1445  CE  LYS A 174     -16.489  -2.377  21.579  1.00  0.81           C  
ATOM   1446  NZ  LYS A 174     -17.750  -1.604  21.592  1.00  0.81           N  
ATOM   1447  N   GLU A 175     -15.340  -8.586  18.549  1.00  0.81           N  
ATOM   1448  CA  GLU A 175     -15.704  -9.931  18.142  1.00  0.81           C  
ATOM   1449  C   GLU A 175     -14.538 -10.912  18.234  1.00  0.81           C  
ATOM   1450  O   GLU A 175     -14.657 -11.963  18.856  1.00  0.81           O  
ATOM   1451  CB  GLU A 175     -16.281  -9.879  16.708  1.00  0.81           C  
ATOM   1452  CG  GLU A 175     -17.654  -9.154  16.635  1.00  0.81           C  
ATOM   1453  CD  GLU A 175     -18.092  -8.740  15.227  1.00  0.81           C  
ATOM   1454  OE1 GLU A 175     -19.224  -8.193  15.112  1.00  0.81           O  
ATOM   1455  OE2 GLU A 175     -17.305  -8.913  14.265  1.00  0.81           O  
ATOM   1456  N   ARG A 176     -13.339 -10.531  17.732  1.00  0.76           N  
ATOM   1457  CA  ARG A 176     -12.126 -11.331  17.880  1.00  0.76           C  
ATOM   1458  C   ARG A 176     -11.729 -11.576  19.336  1.00  0.76           C  
ATOM   1459  O   ARG A 176     -11.442 -12.699  19.733  1.00  0.76           O  
ATOM   1460  CB  ARG A 176     -10.923 -10.677  17.141  1.00  0.76           C  
ATOM   1461  CG  ARG A 176     -11.034 -10.759  15.603  1.00  0.76           C  
ATOM   1462  CD  ARG A 176      -9.745 -10.425  14.836  1.00  0.76           C  
ATOM   1463  NE  ARG A 176      -9.354  -8.990  15.091  1.00  0.76           N  
ATOM   1464  CZ  ARG A 176      -9.673  -7.925  14.341  1.00  0.76           C  
ATOM   1465  NH1 ARG A 176     -10.456  -8.032  13.279  1.00  0.76           N  
ATOM   1466  NH2 ARG A 176      -9.249  -6.715  14.694  1.00  0.76           N  
ATOM   1467  N   LYS A 177     -11.766 -10.540  20.198  1.00  0.78           N  
ATOM   1468  CA  LYS A 177     -11.472 -10.684  21.617  1.00  0.78           C  
ATOM   1469  C   LYS A 177     -12.453 -11.573  22.364  1.00  0.78           C  
ATOM   1470  O   LYS A 177     -12.089 -12.263  23.312  1.00  0.78           O  
ATOM   1471  CB  LYS A 177     -11.378  -9.302  22.304  1.00  0.78           C  
ATOM   1472  CG  LYS A 177     -10.083  -8.567  21.923  1.00  0.78           C  
ATOM   1473  CD  LYS A 177     -10.010  -7.139  22.488  1.00  0.78           C  
ATOM   1474  CE  LYS A 177      -8.719  -6.410  22.097  1.00  0.78           C  
ATOM   1475  NZ  LYS A 177      -8.769  -4.991  22.523  1.00  0.78           N  
ATOM   1476  N   GLN A 178     -13.736 -11.579  21.962  1.00  0.75           N  
ATOM   1477  CA  GLN A 178     -14.703 -12.526  22.480  1.00  0.75           C  
ATOM   1478  C   GLN A 178     -14.390 -13.956  22.061  1.00  0.75           C  
ATOM   1479  O   GLN A 178     -14.315 -14.844  22.902  1.00  0.75           O  
ATOM   1480  CB  GLN A 178     -16.128 -12.100  22.075  1.00  0.75           C  
ATOM   1481  CG  GLN A 178     -16.574 -10.833  22.840  1.00  0.75           C  
ATOM   1482  CD  GLN A 178     -17.888 -10.260  22.310  1.00  0.75           C  
ATOM   1483  OE1 GLN A 178     -18.477 -10.663  21.314  1.00  0.75           O  
ATOM   1484  NE2 GLN A 178     -18.386  -9.226  23.033  1.00  0.75           N  
ATOM   1485  N   GLU A 179     -14.079 -14.187  20.771  1.00  0.73           N  
ATOM   1486  CA  GLU A 179     -13.662 -15.484  20.258  1.00  0.73           C  
ATOM   1487  C   GLU A 179     -12.385 -16.031  20.896  1.00  0.73           C  
ATOM   1488  O   GLU A 179     -12.307 -17.207  21.238  1.00  0.73           O  
ATOM   1489  CB  GLU A 179     -13.472 -15.404  18.729  1.00  0.73           C  
ATOM   1490  CG  GLU A 179     -14.784 -15.172  17.940  1.00  0.73           C  
ATOM   1491  CD  GLU A 179     -14.542 -14.943  16.445  1.00  0.73           C  
ATOM   1492  OE1 GLU A 179     -15.553 -14.912  15.699  1.00  0.73           O  
ATOM   1493  OE2 GLU A 179     -13.361 -14.803  16.030  1.00  0.73           O  
ATOM   1494  N   GLU A 180     -11.369 -15.172  21.118  1.00  0.71           N  
ATOM   1495  CA  GLU A 180     -10.143 -15.500  21.834  1.00  0.71           C  
ATOM   1496  C   GLU A 180     -10.315 -15.631  23.348  1.00  0.71           C  
ATOM   1497  O   GLU A 180      -9.448 -16.161  24.034  1.00  0.71           O  
ATOM   1498  CB  GLU A 180      -9.076 -14.404  21.584  1.00  0.71           C  
ATOM   1499  CG  GLU A 180      -8.536 -14.342  20.133  1.00  0.71           C  
ATOM   1500  CD  GLU A 180      -7.677 -13.099  19.862  1.00  0.71           C  
ATOM   1501  OE1 GLU A 180      -7.229 -12.952  18.693  1.00  0.71           O  
ATOM   1502  OE2 GLU A 180      -7.471 -12.277  20.794  1.00  0.71           O  
ATOM   1503  N   GLY A 181     -11.430 -15.132  23.926  1.00  0.74           N  
ATOM   1504  CA  GLY A 181     -11.697 -15.247  25.359  1.00  0.74           C  
ATOM   1505  C   GLY A 181     -12.639 -16.357  25.731  1.00  0.74           C  
ATOM   1506  O   GLY A 181     -12.813 -16.652  26.909  1.00  0.74           O  
ATOM   1507  N   GLU A 182     -13.278 -16.993  24.735  1.00  0.66           N  
ATOM   1508  CA  GLU A 182     -14.139 -18.142  24.937  1.00  0.66           C  
ATOM   1509  C   GLU A 182     -13.429 -19.435  24.560  1.00  0.66           C  
ATOM   1510  O   GLU A 182     -14.001 -20.520  24.658  1.00  0.66           O  
ATOM   1511  CB  GLU A 182     -15.423 -17.987  24.088  1.00  0.66           C  
ATOM   1512  CG  GLU A 182     -16.423 -16.968  24.692  1.00  0.66           C  
ATOM   1513  CD  GLU A 182     -17.724 -16.826  23.899  1.00  0.66           C  
ATOM   1514  OE1 GLU A 182     -18.620 -16.104  24.412  1.00  0.66           O  
ATOM   1515  OE2 GLU A 182     -17.852 -17.429  22.803  1.00  0.66           O  
ATOM   1516  N   SER A 183     -12.159 -19.341  24.128  1.00  0.68           N  
ATOM   1517  CA  SER A 183     -11.315 -20.473  23.791  1.00  0.68           C  
ATOM   1518  C   SER A 183     -10.288 -20.849  24.893  1.00  0.68           C  
ATOM   1519  O   SER A 183     -10.250 -20.188  25.963  1.00  0.68           O  
ATOM   1520  CB  SER A 183     -10.562 -20.257  22.447  1.00  0.68           C  
ATOM   1521  OG  SER A 183      -9.873 -19.007  22.385  1.00  0.68           O  
ATOM   1522  OXT SER A 183      -9.541 -21.846  24.668  1.00  0.68           O  
ATOM   1523  C1  NAG A   1      14.421 -16.320   8.676  0.00  0.00              
ATOM   1524  C2  NAG A   1      14.606 -17.406   9.784  0.00  0.00              
ATOM   1525  C3  NAG A   1      16.082 -17.911   9.784  0.00  0.00              
ATOM   1526  C4  NAG A   1      16.528 -18.367   8.378  0.00  0.00              
ATOM   1527  C5  NAG A   1      16.289 -17.244   7.334  0.00  0.00              
ATOM   1528  C6  NAG A   1      16.622 -17.688   5.897  0.00  0.00              
ATOM   1529  C7  NAG A   1      13.513 -17.521  12.001  0.00  0.00              
ATOM   1530  C8  NAG A   1      13.339 -16.855  13.351  0.00  0.00              
ATOM   1531  O3h NAG A   1      16.271 -19.013  10.674  0.00  0.00              
ATOM   1532  OR  NAG A   1      17.904 -18.723   8.453  0.00  0.00              
ATOM   1533  OR  NAG A   1      14.896 -16.804   7.390  0.00  0.00              
ATOM   1534  OW  NAG A   1      17.622 -16.856   5.303  0.00  0.00              
ATOM   1535  OM  NAG A   1      13.023 -18.624  11.790  0.00  0.00              
ATOM   1536  N15 NAG A   1      14.261 -16.856  11.125  0.00  0.00              
ATOM   1537  H2  NAG A   1      13.950 -18.259   9.513  0.00  0.00              
ATOM   1538  H3  NAG A   1      16.746 -17.083  10.103  0.00  0.00              
ATOM   1539  H4  NAG A   1      15.934 -19.256   8.084  0.00  0.00              
ATOM   1540  H5  NAG A   1      16.948 -16.387   7.580  0.00  0.00              
ATOM   1541  H6  NAG A   1      16.961 -18.740   5.904  0.00  0.00              
ATOM   1542  H22 NAG A   1      15.700 -17.665   5.284  0.00  0.00              
ATOM   1543  H8  NAG A   1      12.311 -17.014  13.718  0.00  0.00              
ATOM   1544  H24 NAG A   1      13.526 -15.767  13.339  0.00  0.00              
ATOM   1545  H25 NAG A   1      14.026 -17.318  14.080  0.00  0.00              
ATOM   1546  H3o NAG A   1      16.116 -18.676  11.562  0.00  0.00              
ATOM   1547  H29 NAG A   1      14.463 -15.894  11.402  0.00  0.00              
ATOM   1548  H1  NAG A   1      14.961 -15.390   8.942  0.00  0.00              
ATOM   1549  C1  NAG A   2      18.256 -20.031   8.028  0.00  0.00              
ATOM   1550  C2  NAG A   2      19.795 -20.139   7.788  0.00  0.00              
ATOM   1551  C3  NAG A   2      20.193 -21.634   7.585  0.00  0.00              
ATOM   1552  C4  NAG A   2      19.674 -22.523   8.734  0.00  0.00              
ATOM   1553  C5  NAG A   2      18.144 -22.340   8.923  0.00  0.00              
ATOM   1554  C6  NAG A   2      17.596 -23.128  10.128  0.00  0.00              
ATOM   1555  C7  NAG A   2      21.266 -18.545   6.597  0.00  0.00              
ATOM   1556  C8  NAG A   2      21.587 -17.882   5.273  0.00  0.00              
ATOM   1557  O3h NAG A   2      21.611 -21.805   7.514  0.00  0.00              
ATOM   1558  OR  NAG A   2      20.002 -23.872   8.421  0.00  0.00              
ATOM   1559  OR  NAG A   2      17.832 -20.922   9.097  0.00  0.00              
ATOM   1560  O6h NAG A   2      18.194 -22.704  11.356  0.00  0.00              
ATOM   1561  OM  NAG A   2      21.997 -18.371   7.564  0.00  0.00              
ATOM   1562  N15 NAG A   2      20.202 -19.343   6.597  0.00  0.00              
ATOM   1563  H2  NAG A   2      20.292 -19.773   8.711  0.00  0.00              
ATOM   1564  H3  NAG A   2      19.746 -21.999   6.638  0.00  0.00              
ATOM   1565  H4  NAG A   2      20.184 -22.229   9.674  0.00  0.00              
ATOM   1566  H5  NAG A   2      17.629 -22.713   8.016  0.00  0.00              
ATOM   1567  H6S NAG A   2      16.498 -23.007  10.182  0.00  0.00              
ATOM   1568  H6R NAG A   2      17.780 -24.209   9.973  0.00  0.00              
ATOM   1569  H8  NAG A   2      21.938 -16.850   5.445  0.00  0.00              
ATOM   1570  H24 NAG A   2      20.729 -17.833   4.578  0.00  0.00              
ATOM   1571  H25 NAG A   2      22.404 -18.431   4.775  0.00  0.00              
ATOM   1572  H3o NAG A   2      21.901 -21.353   6.715  0.00  0.00              
ATOM   1573  H6o NAG A   2      18.015 -23.382  12.013  0.00  0.00              
ATOM   1574  H29 NAG A   2      19.623 -19.257   5.760  0.00  0.00              
ATOM   1575  H1  NAG A   2      17.695 -20.273   7.103  0.00  0.00              
ATOM   1576  C1  BMA A   3      20.741 -24.572   9.359  0.00  0.00              
ATOM   1577  C2  BMA A   3      20.736 -26.047   8.965  0.00  0.00              
ATOM   1578  C3  BMA A   3      21.727 -26.858   9.782  0.00  0.00              
ATOM   1579  C4  BMA A   3      23.089 -26.205   9.763  0.00  0.00              
ATOM   1580  C5  BMA A   3      22.970 -24.745  10.202  0.00  0.00              
ATOM   1581  C6  BMA A   3      24.271 -23.972  10.203  0.00  0.00              
ATOM   1582  OW  BMA A   3      21.827 -28.169   9.212  0.00  0.00              
ATOM   1583  O4h BMA A   3      23.983 -26.863  10.648  0.00  0.00              
ATOM   1584  OR  BMA A   3      22.087 -24.085   9.282  0.00  0.00              
ATOM   1585  OW  BMA A   3      24.556 -23.417  11.477  0.00  0.00              
ATOM   1586  H4o BMA A   3      24.579 -27.588  10.094  0.00  0.00              
ATOM   1587  O2h BMA A   3      21.059 -26.150   7.585  0.00  0.00              
ATOM   1588  H2o BMA A   3      22.066 -25.768   7.417  0.00  0.00              
ATOM   1589  H5  BMA A   3      22.607 -24.705  11.192  0.00  0.00              
ATOM   1590  H6  BMA A   3      25.171 -24.210   9.843  0.00  0.00              
ATOM   1591  H20 BMA A   3      24.190 -23.176   9.520  0.00  0.00              
ATOM   1592  H2  BMA A   3      19.727 -26.423   9.137  0.00  0.00              
ATOM   1593  H3  BMA A   3      21.367 -26.922  10.808  0.00  0.00              
ATOM   1594  H1  BMA A   3      20.333 -24.463  10.363  0.00  0.00              
ATOM   1595  H4  BMA A   3      23.473 -26.268   8.745  0.00  0.00              
ATOM   1596  C1  MAN A   4      21.630 -29.272  10.088  0.00  0.00              
ATOM   1597  C2  MAN A   4      22.024 -30.632   9.522  0.00  0.00              
ATOM   1598  C3  MAN A   4      21.111 -31.064   8.386  0.00  0.00              
ATOM   1599  C4  MAN A   4      19.661 -30.948   8.800  0.00  0.00              
ATOM   1600  C5  MAN A   4      19.382 -29.538   9.321  0.00  0.00              
ATOM   1601  C6  MAN A   4      17.964 -29.300   9.791  0.00  0.00              
ATOM   1602  O3h MAN A   4      21.398 -32.429   8.061  0.00  0.00              
ATOM   1603  OR  MAN A   4      18.797 -31.195   7.702  0.00  0.00              
ATOM   1604  OR  MAN A   4      20.244 -29.312  10.449  0.00  0.00              
ATOM   1605  O6h MAN A   4      17.597 -30.183  10.840  0.00  0.00              
ATOM   1606  H3o MAN A   4      21.874 -32.353   7.082  0.00  0.00              
ATOM   1607  H6o MAN A   4      17.223 -29.936  11.833  0.00  0.00              
ATOM   1608  OW  MAN A   4      21.970 -31.594  10.568  0.00  0.00              
ATOM   1609  H5  MAN A   4      19.554 -28.838   8.550  0.00  0.00              
ATOM   1610  H6S MAN A   4      17.486 -28.454  10.018  0.00  0.00              
ATOM   1611  H6R MAN A   4      17.309 -29.473   8.986  0.00  0.00              
ATOM   1612  H1  MAN A   4      22.258 -29.040  10.949  0.00  0.00              
ATOM   1613  H2  MAN A   4      23.046 -30.545   9.153  0.00  0.00              
ATOM   1614  H3  MAN A   4      21.295 -30.424   7.524  0.00  0.00              
ATOM   1615  H4  MAN A   4      19.479 -31.687   9.581  0.00  0.00              
ATOM   1616  C1  NAG A   5      23.129 -31.732  11.376  0.00  0.00              
ATOM   1617  C2  NAG A   5      22.735 -31.977  12.869  0.00  0.00              
ATOM   1618  C3  NAG A   5      23.999 -32.389  13.686  0.00  0.00              
ATOM   1619  C4  NAG A   5      24.740 -33.573  13.030  0.00  0.00              
ATOM   1620  C5  NAG A   5      25.072 -33.261  11.545  0.00  0.00              
ATOM   1621  C6  NAG A   5      25.720 -34.454  10.818  0.00  0.00              
ATOM   1622  C7  NAG A   5      21.026 -30.789  14.207  0.00  0.00              
ATOM   1623  C8  NAG A   5      20.599 -29.467  14.809  0.00  0.00              
ATOM   1624  O3h NAG A   5      23.669 -32.774  15.023  0.00  0.00              
ATOM   1625  OR  NAG A   5      25.920 -33.821  13.786  0.00  0.00              
ATOM   1626  OR  NAG A   5      23.855 -32.870  10.837  0.00  0.00              
ATOM   1627  O6h NAG A   5      24.854 -35.592  10.791  0.00  0.00              
ATOM   1628  OM  NAG A   5      20.398 -31.812  14.459  0.00  0.00              
ATOM   1629  N15 NAG A   5      22.127 -30.753  13.462  0.00  0.00              
ATOM   1630  H2  NAG A   5      22.024 -32.831  12.878  0.00  0.00              
ATOM   1631  H3  NAG A   5      24.696 -31.529  13.728  0.00  0.00              
ATOM   1632  H4  NAG A   5      24.086 -34.470  13.064  0.00  0.00              
ATOM   1633  H5  NAG A   5      25.793 -32.419  11.516  0.00  0.00              
ATOM   1634  H6S NAG A   5      25.986 -34.158   9.785  0.00  0.00              
ATOM   1635  H6R NAG A   5      26.673 -34.715  11.320  0.00  0.00              
ATOM   1636  H8  NAG A   5      19.498 -29.384  14.792  0.00  0.00              
ATOM   1637  H24 NAG A   5      21.008 -28.585  14.284  0.00  0.00              
ATOM   1638  H25 NAG A   5      20.918 -29.422  15.864  0.00  0.00              
ATOM   1639  H3o NAG A   5      23.330 -31.986  15.458  0.00  0.00              
ATOM   1640  H6o NAG A   5      25.391 -36.357  10.565  0.00  0.00              
ATOM   1641  H29 NAG A   5      22.437 -29.809  13.230  0.00  0.00              
ATOM   1642  H1  NAG A   5      23.749 -30.818  11.278  0.00  0.00              
ATOM   1643  C1  GLB A   6      26.091 -35.100  14.283  0.00  0.00              
ATOM   1644  C2  GLB A   6      27.519 -35.222  14.805  0.00  0.00              
ATOM   1645  C3  GLB A   6      27.729 -36.499  15.601  0.00  0.00              
ATOM   1646  C4  GLB A   6      26.657 -36.649  16.656  0.00  0.00              
ATOM   1647  C5  GLB A   6      25.275 -36.538  16.010  0.00  0.00              
ATOM   1648  C6  GLB A   6      24.112 -36.648  16.971  0.00  0.00              
ATOM   1649  O2h GLB A   6      28.408 -35.195  13.696  0.00  0.00              
ATOM   1650  OW  GLB A   6      29.010 -36.438  16.238  0.00  0.00              
ATOM   1651  OR  GLB A   6      25.188 -35.245  15.389  0.00  0.00              
ATOM   1652  O6h GLB A   6      24.156 -35.644  17.974  0.00  0.00              
ATOM   1653  H2o GLB A   6      28.856 -34.282  13.524  0.00  0.00              
ATOM   1654  H6o GLB A   6      23.392 -34.911  18.232  0.00  0.00              
ATOM   1655  O4h GLB A   6      26.909 -35.620  17.605  0.00  0.00              
ATOM   1656  H4o GLB A   6      27.907 -35.746  18.023  0.00  0.00              
ATOM   1657  H5  GLB A   6      25.151 -37.318  15.313  0.00  0.00              
ATOM   1658  H6S GLB A   6      23.136 -36.767  16.802  0.00  0.00              
ATOM   1659  H6R GLB A   6      24.160 -37.581  17.452  0.00  0.00              
ATOM   1660  H1  GLB A   6      25.916 -35.860  13.522  0.00  0.00              
ATOM   1661  H2  GLB A   6      27.704 -34.360  15.446  0.00  0.00              
ATOM   1662  H3  GLB A   6      27.689 -37.349  14.919  0.00  0.00              
ATOM   1663  H4  GLB A   6      26.677 -37.616  17.155  0.00  0.00              
ATOM   1664  C1  NAN A   7      30.088 -37.732  14.483  0.00  0.00              
ATOM   1665  C2  NAN A   7      29.888 -37.530  16.027  0.00  0.00              
ATOM   1666  C3  NAN A   7      29.269 -38.738  16.784  0.00  0.00              
ATOM   1667  C4  NAN A   7      30.297 -39.870  17.005  0.00  0.00              
ATOM   1668  C5  NAN A   7      31.576 -39.341  17.688  0.00  0.00              
ATOM   1669  C6  NAN A   7      32.162 -38.126  16.913  0.00  0.00              
ATOM   1670  C7  NAN A   7      33.364 -37.456  17.628  0.00  0.00              
ATOM   1671  C8  NAN A   7      34.096 -36.411  16.749  0.00  0.00              
ATOM   1672  C9  NAN A   7      35.301 -35.761  17.440  0.00  0.00              
ATOM   1673  OW  NAN A   7      31.109 -37.118  16.714  0.00  0.00              
ATOM   1674  OM  NAN A   7      29.763 -38.738  13.854  0.00  0.00              
ATOM   1675  O1h NAN A   7      30.674 -36.653  13.885  0.00  0.00              
ATOM   1676  O4h NAN A   7      29.705 -40.870  17.821  0.00  0.00              
ATOM   1677  O7h NAN A   7      32.880 -36.816  18.807  0.00  0.00              
ATOM   1678  O8h NAN A   7      34.605 -37.031  15.577  0.00  0.00              
ATOM   1679  O9h NAN A   7      35.959 -34.868  16.540  0.00  0.00              
ATOM   1680  H6  NAN A   7      32.511 -38.492  15.926  0.00  0.00              
ATOM   1681  H3  NAN A   7      28.902 -38.393  17.769  0.00  0.00              
ATOM   1682  H21 NAN A   7      28.376 -39.109  16.248  0.00  0.00              
ATOM   1683  H4  NAN A   7      30.568 -40.314  16.023  0.00  0.00              
ATOM   1684  H7o NAN A   7      32.018 -36.477  18.549  0.00  0.00              
ATOM   1685  H8o NAN A   7      35.327 -36.451  15.314  0.00  0.00              
ATOM   1686  H4o NAN A   7      28.836 -41.038  17.446  0.00  0.00              
ATOM   1687  H9o NAN A   7      36.623 -34.392  17.049  0.00  0.00              
ATOM   1688  H9R NAN A   7      36.009 -36.539  17.791  0.00  0.00              
ATOM   1689  H9S NAN A   7      34.969 -35.216  18.346  0.00  0.00              
ATOM   1690  H8  NAN A   7      33.382 -35.616  16.453  0.00  0.00              
ATOM   1691  H7  NAN A   7      34.093 -38.241  17.912  0.00  0.00              
ATOM   1692  H1o NAN A   7      30.786 -36.860  12.957  0.00  0.00              
ATOM   1693  H5  NAN A   7      31.327 -39.023  18.720  0.00  0.00              
ATOM   1694  N33 NAN A   7      32.528 -40.428  17.743  0.00  0.00              
ATOM   1695  C34 NAN A   7      32.608 -41.214  18.863  0.00  0.00              
ATOM   1696  C35 NAN A   7      33.656 -42.308  18.777  0.00  0.00              
ATOM   1697  OM  NAN A   7      31.916 -41.069  19.853  0.00  0.00              
ATOM   1698  H37 NAN A   7      33.148 -40.609  16.940  0.00  0.00              
ATOM   1699  H35 NAN A   7      33.670 -42.919  19.708  0.00  0.00              
ATOM   1700  H39 NAN A   7      34.668 -41.861  18.643  0.00  0.00              
ATOM   1701  H40 NAN A   7      33.440 -42.986  17.921  0.00  0.00              
ATOM   1702  C1  NAG A   8      17.847 -32.239   7.851  0.00  0.00              
ATOM   1703  C2  NAG A   8      16.731 -32.132   6.763  0.00  0.00              
ATOM   1704  C3  NAG A   8      15.858 -33.425   6.775  0.00  0.00              
ATOM   1705  C4  NAG A   8      16.723 -34.697   6.664  0.00  0.00              
ATOM   1706  C5  NAG A   8      17.820 -34.716   7.763  0.00  0.00              
ATOM   1707  C6  NAG A   8      18.775 -35.917   7.628  0.00  0.00              
ATOM   1708  C7  NAG A   8      15.509 -30.109   6.029  0.00  0.00              
ATOM   1709  C8  NAG A   8      14.557 -29.003   6.434  0.00  0.00              
ATOM   1710  O3h NAG A   8      14.919 -33.446   5.698  0.00  0.00              
ATOM   1711  OR  NAG A   8      15.858 -35.823   6.774  0.00  0.00              
ATOM   1712  OR  NAG A   8      18.595 -33.478   7.709  0.00  0.00              
ATOM   1713  O6h NAG A   8      19.474 -35.901   6.382  0.00  0.00              
ATOM   1714  OM  NAG A   8      15.857 -30.226   4.860  0.00  0.00              
ATOM   1715  N15 NAG A   8      15.872 -30.940   7.003  0.00  0.00              
ATOM   1716  H2  NAG A   8      17.246 -32.072   5.780  0.00  0.00              
ATOM   1717  H3  NAG A   8      15.299 -33.472   7.732  0.00  0.00              
ATOM   1718  H4  NAG A   8      17.218 -34.711   5.671  0.00  0.00              
ATOM   1719  H5  NAG A   8      17.326 -34.790   8.752  0.00  0.00              
ATOM   1720  H6S NAG A   8      19.498 -35.911   8.466  0.00  0.00              
ATOM   1721  H6R NAG A   8      18.198 -36.857   7.726  0.00  0.00              
ATOM   1722  H8  NAG A   8      14.817 -28.071   5.902  0.00  0.00              
ATOM   1723  H24 NAG A   8      14.561 -28.783   7.516  0.00  0.00              
ATOM   1724  H25 NAG A   8      13.529 -29.276   6.139  0.00  0.00              
ATOM   1725  H3o NAG A   8      14.306 -32.721   5.856  0.00  0.00              
ATOM   1726  H6o NAG A   8      19.844 -36.778   6.246  0.00  0.00              
ATOM   1727  H29 NAG A   8      15.618 -30.615   7.937  0.00  0.00              
ATOM   1728  H1  NAG A   8      17.410 -32.187   8.869  0.00  0.00              
ATOM   1729  C1  GLB A   9      15.890 -36.743   5.742  0.00  0.00              
ATOM   1730  C2  GLB A   9      15.118 -37.983   6.185  0.00  0.00              
ATOM   1731  C3  GLB A   9      14.877 -38.946   5.035  0.00  0.00              
ATOM   1732  C4  GLB A   9      14.279 -38.220   3.852  0.00  0.00              
ATOM   1733  C5  GLB A   9      15.153 -37.020   3.485  0.00  0.00              
ATOM   1734  C6  GLB A   9      14.646 -36.193   2.325  0.00  0.00              
ATOM   1735  O2h GLB A   9      15.859 -38.633   7.211  0.00  0.00              
ATOM   1736  OW  GLB A   9      13.966 -39.962   5.471  0.00  0.00              
ATOM   1737  OR  GLB A   9      15.204 -36.153   4.631  0.00  0.00              
ATOM   1738  O6h GLB A   9      13.349 -35.671   2.572  0.00  0.00              
ATOM   1739  H2o GLB A   9      15.531 -38.440   8.168  0.00  0.00              
ATOM   1740  H6o GLB A   9      13.021 -34.631   2.546  0.00  0.00              
ATOM   1741  O4h GLB A   9      12.968 -37.847   4.255  0.00  0.00              
ATOM   1742  H4o GLB A   9      12.398 -38.741   4.511  0.00  0.00              
ATOM   1743  H5  GLB A   9      16.112 -37.356   3.205  0.00  0.00              
ATOM   1744  H6S GLB A   9      15.090 -35.475   1.793  0.00  0.00              
ATOM   1745  H6R GLB A   9      14.584 -36.807   1.474  0.00  0.00              
ATOM   1746  H1  GLB A   9      16.910 -37.024   5.480  0.00  0.00              
ATOM   1747  H2  GLB A   9      14.161 -37.644   6.582  0.00  0.00              
ATOM   1748  H3  GLB A   9      15.828 -39.393   4.746  0.00  0.00              
ATOM   1749  H4  GLB A   9      14.224 -38.835   2.954  0.00  0.00              
ATOM   1750  C1  NAN A  10      15.759 -41.525   5.985  0.00  0.00              
ATOM   1751  C2  NAN A  10      14.368 -41.309   5.288  0.00  0.00              
ATOM   1752  C3  NAN A  10      14.344 -41.565   3.755  0.00  0.00              
ATOM   1753  C4  NAN A  10      14.344 -43.074   3.421  0.00  0.00              
ATOM   1754  C5  NAN A  10      13.206 -43.812   4.159  0.00  0.00              
ATOM   1755  C6  NAN A  10      13.253 -43.524   5.687  0.00  0.00              
ATOM   1756  C7  NAN A  10      12.051 -44.117   6.468  0.00  0.00              
ATOM   1757  C8  NAN A  10      12.220 -44.044   8.005  0.00  0.00              
ATOM   1758  C9  NAN A  10      11.045 -44.651   8.783  0.00  0.00              
ATOM   1759  OW  NAN A  10      13.290 -42.070   5.912  0.00  0.00              
ATOM   1760  OM  NAN A  10      16.799 -41.839   5.407  0.00  0.00              
ATOM   1761  O1h NAN A  10      15.703 -41.326   7.335  0.00  0.00              
ATOM   1762  O4h NAN A  10      14.177 -43.230   2.019  0.00  0.00              
ATOM   1763  O7h NAN A  10      10.878 -43.397   6.091  0.00  0.00              
ATOM   1764  O8h NAN A  10      13.372 -44.773   8.404  0.00  0.00              
ATOM   1765  O9h NAN A  10      11.312 -44.607  10.186  0.00  0.00              
ATOM   1766  H6  NAN A  10      14.180 -43.981   6.088  0.00  0.00              
ATOM   1767  H3  NAN A  10      13.431 -41.106   3.330  0.00  0.00              
ATOM   1768  H21 NAN A  10      15.190 -41.048   3.267  0.00  0.00              
ATOM   1769  H4  NAN A  10      15.317 -43.514   3.722  0.00  0.00              
ATOM   1770  H7o NAN A  10      11.187 -42.492   5.981  0.00  0.00              
ATOM   1771  H8o NAN A  10      13.186 -44.994   9.322  0.00  0.00              
ATOM   1772  H4o NAN A  10      14.794 -42.617   1.609  0.00  0.00              
ATOM   1773  H9o NAN A  10      10.505 -44.877  10.636  0.00  0.00              
ATOM   1774  H9R NAN A  10      10.870 -45.696   8.461  0.00  0.00              
ATOM   1775  H9S NAN A  10      10.113 -44.097   8.554  0.00  0.00              
ATOM   1776  H8  NAN A  10      12.342 -42.986   8.309  0.00  0.00              
ATOM   1777  H7  NAN A  10      11.931 -45.181   6.181  0.00  0.00              
ATOM   1778  H1o NAN A  10      16.575 -41.502   7.690  0.00  0.00              
ATOM   1779  H5  NAN A  10      12.234 -43.465   3.757  0.00  0.00              
ATOM   1780  N33 NAN A  10      13.353 -45.226   3.894  0.00  0.00              
ATOM   1781  C34 NAN A  10      12.663 -45.805   2.861  0.00  0.00              
ATOM   1782  C35 NAN A  10      12.911 -47.293   2.710  0.00  0.00              
ATOM   1783  OM  NAN A  10      11.908 -45.205   2.119  0.00  0.00              
ATOM   1784  H37 NAN A  10      13.975 -45.797   4.482  0.00  0.00              
ATOM   1785  H35 NAN A  10      12.334 -47.708   1.851  0.00  0.00              
ATOM   1786  H39 NAN A  10      12.594 -47.833   3.631  0.00  0.00              
ATOM   1787  H40 NAN A  10      13.992 -47.489   2.526  0.00  0.00              
ATOM   1788  C1  MAN A  11      25.478 -22.335  11.518  0.00  0.00              
ATOM   1789  C2  MAN A  11      26.949 -22.727  11.412  0.00  0.00              
ATOM   1790  C3  MAN A  11      27.424 -23.493  12.636  0.00  0.00              
ATOM   1791  C4  MAN A  11      27.058 -22.749  13.900  0.00  0.00              
ATOM   1792  C5  MAN A  11      25.561 -22.437  13.905  0.00  0.00              
ATOM   1793  C6  MAN A  11      25.074 -21.671  15.114  0.00  0.00              
ATOM   1794  O3h MAN A  11      28.848 -23.630  12.567  0.00  0.00              
ATOM   1795  O4h MAN A  11      27.354 -23.525  15.051  0.00  0.00              
ATOM   1796  OR  MAN A  11      25.283 -21.628  12.750  0.00  0.00              
ATOM   1797  OW  MAN A  11      24.040 -22.361  15.797  0.00  0.00              
ATOM   1798  H3o MAN A  11      28.984 -24.694  12.374  0.00  0.00              
ATOM   1799  H4o MAN A  11      28.330 -23.242  15.443  0.00  0.00              
ATOM   1800  OW  MAN A  11      27.726 -21.546  11.258  0.00  0.00              
ATOM   1801  H5  MAN A  11      25.016 -23.340  13.892  0.00  0.00              
ATOM   1802  H6  MAN A  11      25.579 -21.219  15.846  0.00  0.00              
ATOM   1803  H20 MAN A  11      24.683 -20.749  14.793  0.00  0.00              
ATOM   1804  H1  MAN A  11      25.203 -21.720  10.661  0.00  0.00              
ATOM   1805  H2  MAN A  11      27.051 -23.356  10.528  0.00  0.00              
ATOM   1806  H3  MAN A  11      26.951 -24.475  12.642  0.00  0.00              
ATOM   1807  H4  MAN A  11      27.641 -21.829  13.923  0.00  0.00              
ATOM   1808  C1  NAG A  12      27.890 -21.052   9.937  0.00  0.00              
ATOM   1809  C2  NAG A  12      27.853 -19.489   9.925  0.00  0.00              
ATOM   1810  C3  NAG A  12      28.299 -18.964   8.525  0.00  0.00              
ATOM   1811  C4  NAG A  12      29.654 -19.563   8.097  0.00  0.00              
ATOM   1812  C5  NAG A  12      29.616 -21.114   8.160  0.00  0.00              
ATOM   1813  C6  NAG A  12      30.979 -21.756   7.841  0.00  0.00              
ATOM   1814  C7  NAG A  12      26.264 -17.994  11.093  0.00  0.00              
ATOM   1815  C8  NAG A  12      24.822 -17.553  11.224  0.00  0.00              
ATOM   1816  O3h NAG A  12      28.430 -17.541   8.505  0.00  0.00              
ATOM   1817  OR  NAG A  12      29.936 -19.103   6.779  0.00  0.00              
ATOM   1818  OR  NAG A  12      29.181 -21.545   9.487  0.00  0.00              
ATOM   1819  O6h NAG A  12      31.985 -21.353   8.774  0.00  0.00              
ATOM   1820  OM  NAG A  12      27.146 -17.410  11.712  0.00  0.00              
ATOM   1821  N15 NAG A  12      26.485 -18.991  10.239  0.00  0.00              
ATOM   1822  H2  NAG A  12      28.595 -19.144  10.676  0.00  0.00              
ATOM   1823  H3  NAG A  12      27.539 -19.258   7.772  0.00  0.00              
ATOM   1824  H4  NAG A  12      30.442 -19.201   8.789  0.00  0.00              
ATOM   1825  H5  NAG A  12      28.889 -21.479   7.406  0.00  0.00              
ATOM   1826  H6S NAG A  12      30.880 -22.858   7.845  0.00  0.00              
ATOM   1827  H6R NAG A  12      31.284 -21.477   6.814  0.00  0.00              
ATOM   1828  H8  NAG A  12      24.600 -17.300  12.275  0.00  0.00              
ATOM   1829  H24 NAG A  12      24.090 -18.315  10.901  0.00  0.00              
ATOM   1830  H25 NAG A  12      24.660 -16.641  10.624  0.00  0.00              
ATOM   1831  H3o NAG A  12      27.547 -17.183   8.644  0.00  0.00              
ATOM   1832  H6o NAG A  12      32.839 -21.567   8.388  0.00  0.00              
ATOM   1833  H29 NAG A  12      25.635 -19.461   9.927  0.00  0.00              
ATOM   1834  H1  NAG A  12      27.090 -21.469   9.294  0.00  0.00              
ATOM   1835  C1  GLB A  13      31.137 -18.443   6.587  0.00  0.00              
ATOM   1836  C2  GLB A  13      31.364 -18.293   5.086  0.00  0.00              
ATOM   1837  C3  GLB A  13      32.522 -17.361   4.775  0.00  0.00              
ATOM   1838  C4  GLB A  13      32.369 -16.057   5.524  0.00  0.00              
ATOM   1839  C5  GLB A  13      32.178 -16.335   7.015  0.00  0.00              
ATOM   1840  C6  GLB A  13      31.989 -15.104   7.875  0.00  0.00              
ATOM   1841  O2h GLB A  13      31.620 -19.579   4.538  0.00  0.00              
ATOM   1842  OW  GLB A  13      32.532 -17.094   3.367  0.00  0.00              
ATOM   1843  OR  GLB A  13      30.994 -17.137   7.160  0.00  0.00              
ATOM   1844  O6h GLB A  13      30.859 -14.344   7.472  0.00  0.00              
ATOM   1845  H2o GLB A  13      30.810 -20.022   4.080  0.00  0.00              
ATOM   1846  H6o GLB A  13      30.003 -14.036   8.071  0.00  0.00              
ATOM   1847  O4h GLB A  13      31.250 -15.406   4.935  0.00  0.00              
ATOM   1848  H4o GLB A  13      31.441 -15.243   3.874  0.00  0.00              
ATOM   1849  H5  GLB A  13      33.032 -16.825   7.392  0.00  0.00              
ATOM   1850  H6S GLB A  13      32.005 -14.994   8.866  0.00  0.00              
ATOM   1851  H6R GLB A  13      32.836 -14.491   7.776  0.00  0.00              
ATOM   1852  H1  GLB A  13      31.973 -18.985   7.030  0.00  0.00              
ATOM   1853  H2  GLB A  13      30.446 -17.888   4.659  0.00  0.00              
ATOM   1854  H3  GLB A  13      33.452 -17.844   5.074  0.00  0.00              
ATOM   1855  H4  GLB A  13      33.245 -15.413   5.449  0.00  0.00              
ATOM   1856  C1  NAN A  14      34.206 -18.805   2.929  0.00  0.00              
ATOM   1857  C2  NAN A  14      33.749 -17.324   2.678  0.00  0.00              
ATOM   1858  C3  NAN A  14      34.738 -16.228   3.166  0.00  0.00              
ATOM   1859  C4  NAN A  14      35.948 -16.078   2.216  0.00  0.00              
ATOM   1860  C5  NAN A  14      35.494 -15.853   0.757  0.00  0.00              
ATOM   1861  C6  NAN A  14      34.496 -16.959   0.307  0.00  0.00              
ATOM   1862  C7  NAN A  14      33.887 -16.711  -1.098  0.00  0.00              
ATOM   1863  C8  NAN A  14      33.092 -17.922  -1.646  0.00  0.00              
ATOM   1864  C9  NAN A  14      32.508 -17.692  -3.046  0.00  0.00              
ATOM   1865  OW  NAN A  14      33.400 -17.059   1.284  0.00  0.00              
ATOM   1866  OM  NAN A  14      35.245 -19.138   3.498  0.00  0.00              
ATOM   1867  O1h NAN A  14      33.316 -19.717   2.440  0.00  0.00              
ATOM   1868  O4h NAN A  14      36.727 -14.971   2.644  0.00  0.00              
ATOM   1869  O7h NAN A  14      33.020 -15.582  -1.013  0.00  0.00              
ATOM   1870  O8h NAN A  14      33.943 -19.053  -1.758  0.00  0.00              
ATOM   1871  O9h NAN A  14      31.854 -18.877  -3.503  0.00  0.00              
ATOM   1872  H6  NAN A  14      35.049 -17.920   0.276  0.00  0.00              
ATOM   1873  H3  NAN A  14      34.202 -15.261   3.216  0.00  0.00              
ATOM   1874  H21 NAN A  14      35.065 -16.441   4.199  0.00  0.00              
ATOM   1875  H4  NAN A  14      36.566 -16.999   2.265  0.00  0.00              
ATOM   1876  H7o NAN A  14      32.614 -15.666  -0.146  0.00  0.00              
ATOM   1877  H8o NAN A  14      33.508 -19.592  -2.426  0.00  0.00              
ATOM   1878  H4o NAN A  14      36.835 -15.073   3.594  0.00  0.00              
ATOM   1879  H9o NAN A  14      31.398 -18.650  -4.320  0.00  0.00              
ATOM   1880  H9R NAN A  14      33.309 -17.401  -3.754  0.00  0.00              
ATOM   1881  H9S NAN A  14      31.794 -16.846  -3.022  0.00  0.00              
ATOM   1882  H8  NAN A  14      32.265 -18.162  -0.948  0.00  0.00              
ATOM   1883  H7  NAN A  14      34.709 -16.485  -1.807  0.00  0.00              
ATOM   1884  H1o NAN A  14      33.675 -20.591   2.605  0.00  0.00              
ATOM   1885  H5  NAN A  14      34.993 -14.867   0.686  0.00  0.00              
ATOM   1886  N33 NAN A  14      36.673 -15.849  -0.077  0.00  0.00              
ATOM   1887  C34 NAN A  14      37.286 -14.664  -0.394  0.00  0.00              
ATOM   1888  C35 NAN A  14      38.506 -14.817  -1.282  0.00  0.00              
ATOM   1889  OM  NAN A  14      36.903 -13.573  -0.016  0.00  0.00              
ATOM   1890  H37 NAN A  14      37.054 -16.738  -0.433  0.00  0.00              
ATOM   1891  H35 NAN A  14      38.967 -13.827  -1.498  0.00  0.00              
ATOM   1892  H39 NAN A  14      38.221 -15.285  -2.251  0.00  0.00              
ATOM   1893  H40 NAN A  14      39.272 -15.452  -0.781  0.00  0.00              
ATOM   1894  C1  NAG A  15      23.209 -21.594  16.656  0.00  0.00              
ATOM   1895  C2  NAG A  15      21.938 -22.405  17.065  0.00  0.00              
ATOM   1896  C3  NAG A  15      21.182 -21.657  18.208  0.00  0.00              
ATOM   1897  C4  NAG A  15      22.119 -21.323  19.386  0.00  0.00              
ATOM   1898  C5  NAG A  15      23.367 -20.540  18.894  0.00  0.00              
ATOM   1899  C6  NAG A  15      24.384 -20.273  20.020  0.00  0.00              
ATOM   1900  C7  NAG A  15      20.462 -23.758  15.612  0.00  0.00              
ATOM   1901  C8  NAG A  15      19.497 -23.746  14.445  0.00  0.00              
ATOM   1902  O3h NAG A  15      20.095 -22.429  18.724  0.00  0.00              
ATOM   1903  OR  NAG A  15      21.372 -20.567  20.334  0.00  0.00              
ATOM   1904  OR  NAG A  15      24.024 -21.281  17.819  0.00  0.00              
ATOM   1905  O6h NAG A  15      24.883 -21.490  20.581  0.00  0.00              
ATOM   1906  OM  NAG A  15      20.638 -24.786  16.255  0.00  0.00              
ATOM   1907  N15 NAG A  15      21.032 -22.590  15.898  0.00  0.00              
ATOM   1908  H2  NAG A  15      22.292 -23.378  17.465  0.00  0.00              
ATOM   1909  H3  NAG A  15      20.779 -20.704  17.808  0.00  0.00              
ATOM   1910  H4  NAG A  15      22.459 -22.268  19.856  0.00  0.00              
ATOM   1911  H5  NAG A  15      23.035 -19.557  18.503  0.00  0.00              
ATOM   1912  H6S NAG A  15      25.221 -19.667  19.627  0.00  0.00              
ATOM   1913  H6R NAG A  15      23.904 -19.663  20.809  0.00  0.00              
ATOM   1914  H8  NAG A  15      19.598 -24.678  13.864  0.00  0.00              
ATOM   1915  H24 NAG A  15      19.646 -22.900  13.750  0.00  0.00              
ATOM   1916  H25 NAG A  15      18.461 -23.704  14.824  0.00  0.00              
ATOM   1917  H3o NAG A  15      19.457 -22.515  18.010  0.00  0.00              
ATOM   1918  H6o NAG A  15      25.298 -21.271  21.420  0.00  0.00              
ATOM   1919  H29 NAG A  15      20.897 -21.879  15.178  0.00  0.00              
ATOM   1920  H1  NAG A  15      22.928 -20.654  16.141  0.00  0.00              
ATOM   1921  C1  GLB A  16      21.322 -21.055  21.628  0.00  0.00              
ATOM   1922  C2  GLB A  16      20.727 -19.972  22.523  0.00  0.00              
ATOM   1923  C3  GLB A  16      20.393 -20.498  23.909  0.00  0.00              
ATOM   1924  C4  GLB A  16      19.569 -21.761  23.812  0.00  0.00              
ATOM   1925  C5  GLB A  16      20.278 -22.777  22.916  0.00  0.00              
ATOM   1926  C6  GLB A  16      19.538 -24.081  22.719  0.00  0.00              
ATOM   1927  O2h GLB A  16      21.663 -18.907  22.625  0.00  0.00              
ATOM   1928  OW  GLB A  16      19.643 -19.500  24.610  0.00  0.00              
ATOM   1929  OR  GLB A  16      20.432 -22.179  21.618  0.00  0.00              
ATOM   1930  O6h GLB A  16      18.257 -23.882  22.144  0.00  0.00              
ATOM   1931  H2o GLB A  16      21.469 -18.101  22.011  0.00  0.00              
ATOM   1932  H6o GLB A  16      17.847 -24.322  21.235  0.00  0.00              
ATOM   1933  O4h GLB A  16      18.307 -21.355  23.296  0.00  0.00              
ATOM   1934  H4o GLB A  16      17.855 -20.629  23.972  0.00  0.00              
ATOM   1935  H5  GLB A  16      21.208 -23.031  23.342  0.00  0.00              
ATOM   1936  H6S GLB A  16      19.839 -24.948  22.328  0.00  0.00              
ATOM   1937  H6R GLB A  16      19.399 -24.534  23.658  0.00  0.00              
ATOM   1938  H1  GLB A  16      22.311 -21.330  21.997  0.00  0.00              
ATOM   1939  H2  GLB A  16      19.817 -19.617  22.040  0.00  0.00              
ATOM   1940  H3  GLB A  16      21.323 -20.711  24.437  0.00  0.00              
ATOM   1941  H4  GLB A  16      19.427 -22.256  24.773  0.00  0.00              
ATOM   1942  C1  NAG A  17      19.780 -19.464  26.023  0.00  0.00              
ATOM   1943  C2  NAG A  17      20.807 -18.367  26.450  0.00  0.00              
ATOM   1944  C3  NAG A  17      20.745 -18.162  27.996  0.00  0.00              
ATOM   1945  C4  NAG A  17      19.305 -17.892  28.476  0.00  0.00              
ATOM   1946  C5  NAG A  17      18.344 -19.011  27.992  0.00  0.00              
ATOM   1947  C6  NAG A  17      16.874 -18.733  28.359  0.00  0.00              
ATOM   1948  C7  NAG A  17      23.031 -17.900  25.470  0.00  0.00              
ATOM   1949  C8  NAG A  17      24.426 -18.431  25.212  0.00  0.00              
ATOM   1950  O3h NAG A  17      21.555 -17.063  28.422  0.00  0.00              
ATOM   1951  OR  NAG A  17      19.331 -17.808  29.898  0.00  0.00              
ATOM   1952  OR  NAG A  17      18.455 -19.165  26.542  0.00  0.00              
ATOM   1953  O6h NAG A  17      16.398 -17.525  27.760  0.00  0.00              
ATOM   1954  OM  NAG A  17      22.755 -16.738  25.196  0.00  0.00              
ATOM   1955  N15 NAG A  17      22.189 -18.753  26.047  0.00  0.00              
ATOM   1956  H2  NAG A  17      20.491 -17.422  25.963  0.00  0.00              
ATOM   1957  H3  NAG A  17      21.109 -19.082  28.495  0.00  0.00              
ATOM   1958  H4  NAG A  17      18.961 -16.925  28.057  0.00  0.00              
ATOM   1959  H5  NAG A  17      18.637 -19.962  28.478  0.00  0.00              
ATOM   1960  H6S NAG A  17      16.244 -19.585  28.040  0.00  0.00              
ATOM   1961  H6R NAG A  17      16.777 -18.672  29.460  0.00  0.00              
ATOM   1962  H8  NAG A  17      24.801 -18.051  24.246  0.00  0.00              
ATOM   1963  H24 NAG A  17      24.485 -19.534  25.184  0.00  0.00              
ATOM   1964  H25 NAG A  17      25.110 -18.067  25.998  0.00  0.00              
ATOM   1965  H3o NAG A  17      22.467 -17.306  28.232  0.00  0.00              
ATOM   1966  H6o NAG A  17      15.590 -17.275  28.218  0.00  0.00              
ATOM   1967  H29 NAG A  17      22.528 -19.716  26.067  0.00  0.00              
ATOM   1968  H1  NAG A  17      20.100 -20.463  26.380  0.00  0.00              
ATOM   1969  C1  GLB A  18      18.823 -16.654  30.468  0.00  0.00              
ATOM   1970  C2  GLB A  18      18.685 -16.885  31.969  0.00  0.00              
ATOM   1971  C3  GLB A  18      18.380 -15.599  32.719  0.00  0.00              
ATOM   1972  C4  GLB A  18      19.363 -14.516  32.335  0.00  0.00              
ATOM   1973  C5  GLB A  18      19.392 -14.358  30.814  0.00  0.00              
ATOM   1974  C6  GLB A  18      20.361 -13.316  30.300  0.00  0.00              
ATOM   1975  O2h GLB A  18      17.642 -17.826  32.186  0.00  0.00              
ATOM   1976  OW  GLB A  18      18.486 -15.851  34.125  0.00  0.00              
ATOM   1977  OR  GLB A  18      19.793 -15.619  30.253  0.00  0.00              
ATOM   1978  O6h GLB A  18      21.696 -13.595  30.689  0.00  0.00              
ATOM   1979  H2o GLB A  18      17.961 -18.792  32.359  0.00  0.00              
ATOM   1980  H6o GLB A  18      22.576 -13.712  30.055  0.00  0.00              
ATOM   1981  O4h GLB A  18      20.614 -14.928  32.872  0.00  0.00              
ATOM   1982  H4o GLB A  18      20.528 -15.031  33.954  0.00  0.00              
ATOM   1983  H5  GLB A  18      18.439 -14.063  30.475  0.00  0.00              
ATOM   1984  H6S GLB A  18      20.459 -12.910  29.394  0.00  0.00              
ATOM   1985  H6R GLB A  18      20.099 -12.383  30.708  0.00  0.00              
ATOM   1986  H1  GLB A  18      17.853 -16.386  30.050  0.00  0.00              
ATOM   1987  H2  GLB A  18      19.631 -17.297  32.322  0.00  0.00              
ATOM   1988  H3  GLB A  18      17.369 -15.278  32.469  0.00  0.00              
ATOM   1989  H4  GLB A  18      19.100 -13.536  32.733  0.00  0.00              
ATOM   1990  C1  NAN A  19      16.088 -16.187  34.372  0.00  0.00              
ATOM   1991  C2  NAN A  19      17.378 -15.485  34.929  0.00  0.00              
ATOM   1992  C3  NAN A  19      17.340 -13.931  34.937  0.00  0.00              
ATOM   1993  C4  NAN A  19      16.470 -13.380  36.088  0.00  0.00              
ATOM   1994  C5  NAN A  19      16.904 -13.963  37.450  0.00  0.00              
ATOM   1995  C6  NAN A  19      16.942 -15.519  37.404  0.00  0.00              
ATOM   1996  C7  NAN A  19      17.510 -16.164  38.694  0.00  0.00              
ATOM   1997  C8  NAN A  19      17.323 -17.700  38.746  0.00  0.00              
ATOM   1998  C9  NAN A  19      17.862 -18.343  40.031  0.00  0.00              
ATOM   1999  OW  NAN A  19      17.758 -15.955  36.259  0.00  0.00              
ATOM   2000  OM  NAN A  19      15.102 -15.603  33.925  0.00  0.00              
ATOM   2001  O1h NAN A  19      16.167 -17.549  34.432  0.00  0.00              
ATOM   2002  O4h NAN A  19      16.599 -11.965  36.119  0.00  0.00              
ATOM   2003  O7h NAN A  19      18.903 -15.860  38.767  0.00  0.00              
ATOM   2004  O8h NAN A  19      15.941 -18.024  38.696  0.00  0.00              
ATOM   2005  O9h NAN A  19      17.585 -19.744  40.030  0.00  0.00              
ATOM   2006  H6  NAN A  19      15.901 -15.877  37.271  0.00  0.00              
ATOM   2007  H3  NAN A  19      18.373 -13.550  35.056  0.00  0.00              
ATOM   2008  H21 NAN A  19      16.995 -13.552  33.958  0.00  0.00              
ATOM   2009  H4  NAN A  19      15.409 -13.644  35.902  0.00  0.00              
ATOM   2010  H7o NAN A  19      19.195 -15.895  37.851  0.00  0.00              
ATOM   2011  H8o NAN A  19      15.902 -18.894  39.108  0.00  0.00              
ATOM   2012  H4o NAN A  19      16.490 -11.669  35.211  0.00  0.00              
ATOM   2013  H9o NAN A  19      18.047 -20.124  40.785  0.00  0.00              
ATOM   2014  H9R NAN A  19      17.404 -17.865  40.921  0.00  0.00              
ATOM   2015  H9S NAN A  19      18.952 -18.167  40.113  0.00  0.00              
ATOM   2016  H8  NAN A  19      17.832 -18.161  37.876  0.00  0.00              
ATOM   2017  H7  NAN A  19      16.996 -15.721  39.569  0.00  0.00              
ATOM   2018  H1o NAN A  19      15.340 -17.903  34.103  0.00  0.00              
ATOM   2019  H5  NAN A  19      17.916 -13.586  37.697  0.00  0.00              
ATOM   2020  N33 NAN A  19      15.967 -13.499  38.448  0.00  0.00              
ATOM   2021  C34 NAN A  19      16.243 -12.370  39.175  0.00  0.00              
ATOM   2022  C35 NAN A  19      15.173 -12.010  40.188  0.00  0.00              
ATOM   2023  OM  NAN A  19      17.250 -11.701  39.045  0.00  0.00              
ATOM   2024  H37 NAN A  19      15.092 -14.017  38.613  0.00  0.00              
ATOM   2025  H35 NAN A  19      15.445 -11.082  40.741  0.00  0.00              
ATOM   2026  H39 NAN A  19      15.052 -12.832  40.930  0.00  0.00              
ATOM   2027  H40 NAN A  19      14.200 -11.834  39.677  0.00  0.00              
ATOM   2028  C1  AFL A  20      17.711 -16.864   3.880  0.00  0.00              
ATOM   2029  C2  AFL A  20      18.817 -15.955   3.314  0.00  0.00              
ATOM   2030  C3  AFL A  20      20.204 -16.543   3.612  0.00  0.00              
ATOM   2031  C4  AFL A  20      20.259 -17.997   3.116  0.00  0.00              
ATOM   2032  C5  AFL A  20      19.095 -18.796   3.723  0.00  0.00              
ATOM   2033  C6  AFL A  20      19.038 -20.255   3.250  0.00  0.00              
ATOM   2034  OR  AFL A  20      17.832 -18.205   3.397  0.00  0.00              
ATOM   2035  O2h AFL A  20      18.617 -14.643   3.834  0.00  0.00              
ATOM   2036  O3h AFL A  20      21.204 -15.710   3.032  0.00  0.00              
ATOM   2037  O4h AFL A  20      20.160 -18.076   1.694  0.00  0.00              
ATOM   2038  H5  AFL A  20      19.227 -18.816   4.822  0.00  0.00              
ATOM   2039  H1  AFL A  20      16.732 -16.515   3.527  0.00  0.00              
ATOM   2040  H2  AFL A  20      18.691 -15.920   2.215  0.00  0.00              
ATOM   2041  H2o AFL A  20      19.228 -14.065   3.358  0.00  0.00              
ATOM   2042  H3  AFL A  20      20.345 -16.542   4.710  0.00  0.00              
ATOM   2043  H3o AFL A  20      22.048 -15.997   3.404  0.00  0.00              
ATOM   2044  H4  AFL A  20      21.212 -18.467   3.426  0.00  0.00              
ATOM   2045  H4o AFL A  20      20.956 -17.656   1.340  0.00  0.00              
ATOM   2046  H6  AFL A  20      19.982 -20.789   3.446  0.00  0.00              
ATOM   2047  H22 AFL A  20      18.229 -20.788   3.772  0.00  0.00              
ATOM   2048  H23 AFL A  20      18.830 -20.307   2.170  0.00  0.00              
ATOM   2049  C1  NAG B   1      -3.924  11.082 -11.939  0.00  0.00              
ATOM   2050  C2  NAG B   1      -3.206  11.892 -13.065  0.00  0.00              
ATOM   2051  C3  NAG B   1      -3.182  13.407 -12.689  0.00  0.00              
ATOM   2052  C4  NAG B   1      -4.590  13.930 -12.342  0.00  0.00              
ATOM   2053  C5  NAG B   1      -5.245  13.058 -11.235  0.00  0.00              
ATOM   2054  C6  NAG B   1      -6.695  13.477 -10.927  0.00  0.00              
ATOM   2055  C7  NAG B   1      -1.297  11.183 -14.471  0.00  0.00              
ATOM   2056  C8  NAG B   1       0.160  10.774 -14.493  0.00  0.00              
ATOM   2057  O3h NAG B   1      -2.672  14.214 -13.753  0.00  0.00              
ATOM   2058  OR  NAG B   1      -4.461  15.285 -11.926  0.00  0.00              
ATOM   2059  OR  NAG B   1      -5.227  11.653 -11.638  0.00  0.00              
ATOM   2060  O6h NAG B   1      -7.539  13.348 -12.075  0.00  0.00              
ATOM   2061  OM  NAG B   1      -1.907  11.344 -15.521  0.00  0.00              
ATOM   2062  N15 NAG B   1      -1.814  11.400 -13.265  0.00  0.00              
ATOM   2063  H2  NAG B   1      -3.815  11.776 -13.985  0.00  0.00              
ATOM   2064  H3  NAG B   1      -2.534  13.547 -11.800  0.00  0.00              
ATOM   2065  H4  NAG B   1      -5.226  13.883 -13.250  0.00  0.00              
ATOM   2066  H5  NAG B   1      -4.657  13.173 -10.303  0.00  0.00              
ATOM   2067  H6S NAG B   1      -7.090  12.862 -10.097  0.00  0.00              
ATOM   2068  H6R NAG B   1      -6.704  14.525 -10.568  0.00  0.00              
ATOM   2069  H8  NAG B   1       0.326  10.016 -15.279  0.00  0.00              
ATOM   2070  H24 NAG B   1       0.521  10.350 -13.538  0.00  0.00              
ATOM   2071  H25 NAG B   1       0.786  11.648 -14.741  0.00  0.00              
ATOM   2072  H3o NAG B   1      -1.751  13.965 -13.868  0.00  0.00              
ATOM   2073  H6o NAG B   1      -8.338  13.852 -11.902  0.00  0.00              
ATOM   2074  H29 NAG B   1      -1.222  11.077 -12.498  0.00  0.00              
ATOM   2075  H1  NAG B   1      -3.309  11.059 -11.018  0.00  0.00              
ATOM   2076  C1  NAG B   2      -5.233  16.250 -12.625  0.00  0.00              
ATOM   2077  C2  NAG B   2      -5.299  17.590 -11.823  0.00  0.00              
ATOM   2078  C3  NAG B   2      -5.917  18.709 -12.719  0.00  0.00              
ATOM   2079  C4  NAG B   2      -5.185  18.824 -14.072  0.00  0.00              
ATOM   2080  C5  NAG B   2      -5.141  17.449 -14.793  0.00  0.00              
ATOM   2081  C6  NAG B   2      -4.330  17.489 -16.101  0.00  0.00              
ATOM   2082  C7  NAG B   2      -5.727  17.899  -9.406  0.00  0.00              
ATOM   2083  C8  NAG B   2      -6.719  17.725  -8.274  0.00  0.00              
ATOM   2084  O3h NAG B   2      -5.861  19.991 -12.088  0.00  0.00              
ATOM   2085  OR  NAG B   2      -5.868  19.799 -14.853  0.00  0.00              
ATOM   2086  OR  NAG B   2      -4.567  16.442 -13.903  0.00  0.00              
ATOM   2087  O6h NAG B   2      -2.966  17.850 -15.868  0.00  0.00              
ATOM   2088  OM  NAG B   2      -4.670  18.487  -9.213  0.00  0.00              
ATOM   2089  N15 NAG B   2      -6.115  17.426 -10.588  0.00  0.00              
ATOM   2090  H2  NAG B   2      -4.254  17.876 -11.587  0.00  0.00              
ATOM   2091  H3  NAG B   2      -6.979  18.462 -12.921  0.00  0.00              
ATOM   2092  H4  NAG B   2      -4.145  19.161 -13.891  0.00  0.00              
ATOM   2093  H5  NAG B   2      -6.178  17.152 -15.050  0.00  0.00              
ATOM   2094  H6S NAG B   2      -4.379  16.503 -16.598  0.00  0.00              
ATOM   2095  H6R NAG B   2      -4.798  18.211 -16.800  0.00  0.00              
ATOM   2096  H8  NAG B   2      -6.184  17.483  -7.339  0.00  0.00              
ATOM   2097  H24 NAG B   2      -7.464  16.928  -8.451  0.00  0.00              
ATOM   2098  H25 NAG B   2      -7.259  18.673  -8.110  0.00  0.00              
ATOM   2099  H3o NAG B   2      -6.430  19.939 -11.314  0.00  0.00              
ATOM   2100  H6o NAG B   2      -2.587  18.106 -16.714  0.00  0.00              
ATOM   2101  H29 NAG B   2      -6.946  16.836 -10.541  0.00  0.00              
ATOM   2102  H1  NAG B   2      -6.250  15.844 -12.796  0.00  0.00              
ATOM   2103  C1  BMA B   3      -5.118  20.859 -15.330  0.00  0.00              
ATOM   2104  C2  BMA B   3      -5.958  21.614 -16.356  0.00  0.00              
ATOM   2105  C3  BMA B   3      -5.325  22.939 -16.748  0.00  0.00              
ATOM   2106  C4  BMA B   3      -4.963  23.737 -15.517  0.00  0.00              
ATOM   2107  C5  BMA B   3      -4.101  22.888 -14.583  0.00  0.00              
ATOM   2108  C6  BMA B   3      -3.690  23.572 -13.297  0.00  0.00              
ATOM   2109  OW  BMA B   3      -6.265  23.683 -17.531  0.00  0.00              
ATOM   2110  O4h BMA B   3      -4.228  24.902 -15.863  0.00  0.00              
ATOM   2111  OR  BMA B   3      -4.866  21.728 -14.218  0.00  0.00              
ATOM   2112  OW  BMA B   3      -2.280  23.603 -13.141  0.00  0.00              
ATOM   2113  H4o BMA B   3      -4.906  25.754 -15.932  0.00  0.00              
ATOM   2114  O2h BMA B   3      -7.248  21.848 -15.805  0.00  0.00              
ATOM   2115  H2o BMA B   3      -7.156  22.481 -14.922  0.00  0.00              
ATOM   2116  H5  BMA B   3      -3.203  22.628 -15.073  0.00  0.00              
ATOM   2117  H6  BMA B   3      -3.990  24.433 -12.893  0.00  0.00              
ATOM   2118  H20 BMA B   3      -4.089  23.032 -12.487  0.00  0.00              
ATOM   2119  H2  BMA B   3      -6.043  20.977 -17.236  0.00  0.00              
ATOM   2120  H3  BMA B   3      -4.426  22.739 -17.330  0.00  0.00              
ATOM   2121  H1  BMA B   3      -4.191  20.524 -15.795  0.00  0.00              
ATOM   2122  H4  BMA B   3      -5.892  24.025 -15.025  0.00  0.00              
ATOM   2123  C1  MAN B   4      -5.818  24.164 -18.792  0.00  0.00              
ATOM   2124  C2  MAN B   4      -6.734  25.184 -19.463  0.00  0.00              
ATOM   2125  C3  MAN B   4      -8.053  24.567 -19.897  0.00  0.00              
ATOM   2126  C4  MAN B   4      -7.809  23.311 -20.702  0.00  0.00              
ATOM   2127  C5  MAN B   4      -6.906  22.359 -19.918  0.00  0.00              
ATOM   2128  C6  MAN B   4      -6.567  21.069 -20.633  0.00  0.00              
ATOM   2129  O3h MAN B   4      -8.758  25.515 -20.708  0.00  0.00              
ATOM   2130  O4h MAN B   4      -9.028  22.639 -20.979  0.00  0.00              
ATOM   2131  OR  MAN B   4      -5.666  23.042 -19.670  0.00  0.00              
ATOM   2132  OW  MAN B   4      -6.946  19.930 -19.875  0.00  0.00              
ATOM   2133  H3o MAN B   4      -9.593  25.809 -20.071  0.00  0.00              
ATOM   2134  H4o MAN B   4      -9.387  22.925 -21.968  0.00  0.00              
ATOM   2135  OW  MAN B   4      -6.065  25.722 -20.595  0.00  0.00              
ATOM   2136  H5  MAN B   4      -7.386  22.078 -19.023  0.00  0.00              
ATOM   2137  H6  MAN B   4      -6.724  20.786 -21.576  0.00  0.00              
ATOM   2138  H20 MAN B   4      -5.527  21.025 -20.774  0.00  0.00              
ATOM   2139  H1  MAN B   4      -4.856  24.629 -18.572  0.00  0.00              
ATOM   2140  H2  MAN B   4      -6.924  25.973 -18.736  0.00  0.00              
ATOM   2141  H3  MAN B   4      -8.636  24.322 -19.009  0.00  0.00              
ATOM   2142  H4  MAN B   4      -7.335  23.604 -21.639  0.00  0.00              
ATOM   2143  C1  NAG B   5      -5.203  26.828 -20.369  0.00  0.00              
ATOM   2144  C2  NAG B   5      -3.929  26.729 -21.267  0.00  0.00              
ATOM   2145  C3  NAG B   5      -3.134  28.070 -21.204  0.00  0.00              
ATOM   2146  C4  NAG B   5      -4.034  29.281 -21.524  0.00  0.00              
ATOM   2147  C5  NAG B   5      -5.287  29.294 -20.607  0.00  0.00              
ATOM   2148  C6  NAG B   5      -6.270  30.427 -20.959  0.00  0.00              
ATOM   2149  C7  NAG B   5      -2.507  24.745 -21.680  0.00  0.00              
ATOM   2150  C8  NAG B   5      -1.575  23.721 -21.069  0.00  0.00              
ATOM   2151  O3h NAG B   5      -2.042  28.088 -22.126  0.00  0.00              
ATOM   2152  OR  NAG B   5      -3.253  30.459 -21.355  0.00  0.00              
ATOM   2153  OR  NAG B   5      -5.981  28.011 -20.700  0.00  0.00              
ATOM   2154  O6h NAG B   5      -6.767  30.302 -22.295  0.00  0.00              
ATOM   2155  OM  NAG B   5      -2.675  24.779 -22.894  0.00  0.00              
ATOM   2156  N15 NAG B   5      -3.058  25.604 -20.826  0.00  0.00              
ATOM   2157  H2  NAG B   5      -4.281  26.585 -22.311  0.00  0.00              
ATOM   2158  H3  NAG B   5      -2.732  28.201 -20.179  0.00  0.00              
ATOM   2159  H4  NAG B   5      -4.369  29.211 -22.580  0.00  0.00              
ATOM   2160  H5  NAG B   5      -4.957  29.451 -19.561  0.00  0.00              
ATOM   2161  H6S NAG B   5      -7.112  30.423 -20.242  0.00  0.00              
ATOM   2162  H6R NAG B   5      -5.762  31.404 -20.835  0.00  0.00              
ATOM   2163  H8  NAG B   5      -1.702  22.748 -21.575  0.00  0.00              
ATOM   2164  H24 NAG B   5      -1.735  23.560 -19.987  0.00  0.00              
ATOM   2165  H25 NAG B   5      -0.529  24.038 -21.221  0.00  0.00              
ATOM   2166  H3o NAG B   5      -1.425  27.412 -21.832  0.00  0.00              
ATOM   2167  H6o NAG B   5      -7.154  31.147 -22.538  0.00  0.00              
ATOM   2168  H29 NAG B   5      -2.935  25.345 -19.847  0.00  0.00              
ATOM   2169  H1  NAG B   5      -4.927  26.857 -19.296  0.00  0.00              
ATOM   2170  C1  GLB B   6      -3.172  31.321 -22.435  0.00  0.00              
ATOM   2171  C2  GLB B   6      -2.542  32.625 -21.959  0.00  0.00              
ATOM   2172  C3  GLB B   6      -2.175  33.537 -23.117  0.00  0.00              
ATOM   2173  C4  GLB B   6      -1.366  32.785 -24.149  0.00  0.00              
ATOM   2174  C5  GLB B   6      -2.111  31.517 -24.567  0.00  0.00              
ATOM   2175  C6  GLB B   6      -1.389  30.660 -25.584  0.00  0.00              
ATOM   2176  O2h GLB B   6      -3.464  33.285 -21.101  0.00  0.00              
ATOM   2177  O3h GLB B   6      -1.394  34.629 -22.613  0.00  0.00              
ATOM   2178  OR  GLB B   6      -2.295  30.712 -23.392  0.00  0.00              
ATOM   2179  OW  GLB B   6      -2.286  30.076 -26.516  0.00  0.00              
ATOM   2180  H2o GLB B   6      -3.279  33.163 -20.094  0.00  0.00              
ATOM   2181  H3o GLB B   6      -2.069  35.479 -22.711  0.00  0.00              
ATOM   2182  O4h GLB B   6      -0.115  32.513 -23.529  0.00  0.00              
ATOM   2183  H4o GLB B   6       0.363  33.451 -23.247  0.00  0.00              
ATOM   2184  H5  GLB B   6      -3.031  31.781 -25.011  0.00  0.00              
ATOM   2185  H6  GLB B   6      -0.572  30.843 -26.127  0.00  0.00              
ATOM   2186  H20 GLB B   6      -0.900  29.879 -25.080  0.00  0.00              
ATOM   2187  H1  GLB B   6      -4.153  31.526 -22.866  0.00  0.00              
ATOM   2188  H2  GLB B   6      -1.642  32.366 -21.401  0.00  0.00              
ATOM   2189  H3  GLB B   6      -3.091  33.910 -23.575  0.00  0.00              
ATOM   2190  H4  GLB B   6      -1.202  33.353 -25.065  0.00  0.00              
ATOM   2191  C1  NAN B   7      -1.411  27.829 -26.198  0.00  0.00              
ATOM   2192  C2  NAN B   7      -1.824  28.940 -27.227  0.00  0.00              
ATOM   2193  C3  NAN B   7      -0.688  29.443 -28.161  0.00  0.00              
ATOM   2194  C4  NAN B   7      -0.376  28.433 -29.288  0.00  0.00              
ATOM   2195  C5  NAN B   7      -1.652  28.051 -30.069  0.00  0.00              
ATOM   2196  C6  NAN B   7      -2.773  27.564 -29.104  0.00  0.00              
ATOM   2197  C7  NAN B   7      -4.129  27.304 -29.809  0.00  0.00              
ATOM   2198  C8  NAN B   7      -5.165  26.594 -28.904  0.00  0.00              
ATOM   2199  C9  NAN B   7      -6.501  26.311 -29.604  0.00  0.00              
ATOM   2200  OW  NAN B   7      -2.975  28.566 -28.044  0.00  0.00              
ATOM   2201  OM  NAN B   7      -0.274  27.374 -26.068  0.00  0.00              
ATOM   2202  O1h NAN B   7      -2.461  27.400 -25.440  0.00  0.00              
ATOM   2203  O4h NAN B   7       0.564  29.019 -30.177  0.00  0.00              
ATOM   2204  O7h NAN B   7      -4.659  28.560 -30.230  0.00  0.00              
ATOM   2205  O8h NAN B   7      -4.665  25.331 -28.491  0.00  0.00              
ATOM   2206  O9h NAN B   7      -7.370  25.593 -28.726  0.00  0.00              
ATOM   2207  H6  NAN B   7      -2.435  26.611 -28.648  0.00  0.00              
ATOM   2208  H3  NAN B   7      -0.998  30.402 -28.617  0.00  0.00              
ATOM   2209  H21 NAN B   7       0.218  29.675 -27.570  0.00  0.00              
ATOM   2210  H4  NAN B   7       0.065  27.516 -28.844  0.00  0.00              
ATOM   2211  H7o NAN B   7      -4.409  29.165 -29.524  0.00  0.00              
ATOM   2212  H8o NAN B   7      -5.463  24.832 -28.290  0.00  0.00              
ATOM   2213  H4o NAN B   7       1.254  29.394 -29.623  0.00  0.00              
ATOM   2214  H9o NAN B   7      -8.231  25.550 -29.155  0.00  0.00              
ATOM   2215  H9R NAN B   7      -6.334  25.732 -30.533  0.00  0.00              
ATOM   2216  H9S NAN B   7      -6.973  27.263 -29.915  0.00  0.00              
ATOM   2217  H8  NAN B   7      -5.356  27.215 -28.007  0.00  0.00              
ATOM   2218  H7  NAN B   7      -3.951  26.669 -30.699  0.00  0.00              
ATOM   2219  H1o NAN B   7      -2.138  26.709 -24.860  0.00  0.00              
ATOM   2220  H5  NAN B   7      -2.014  28.940 -30.621  0.00  0.00              
ATOM   2221  N33 NAN B   7      -1.298  27.017 -31.014  0.00  0.00              
ATOM   2222  C34 NAN B   7      -0.963  27.348 -32.301  0.00  0.00              
ATOM   2223  C35 NAN B   7      -0.622  26.159 -33.178  0.00  0.00              
ATOM   2224  OM  NAN B   7      -0.938  28.486 -32.730  0.00  0.00              
ATOM   2225  H37 NAN B   7      -1.298  26.030 -30.720  0.00  0.00              
ATOM   2226  H35 NAN B   7      -0.349  26.488 -34.206  0.00  0.00              
ATOM   2227  H39 NAN B   7      -1.497  25.475 -33.255  0.00  0.00              
ATOM   2228  H40 NAN B   7       0.242  25.599 -32.753  0.00  0.00              
ATOM   2229  C1  NAG B   8      -6.316  18.701 -20.201  0.00  0.00              
ATOM   2230  C2  NAG B   8      -6.575  17.634 -19.088  0.00  0.00              
ATOM   2231  C3  NAG B   8      -6.108  16.231 -19.585  0.00  0.00              
ATOM   2232  C4  NAG B   8      -6.728  15.875 -20.951  0.00  0.00              
ATOM   2233  C5  NAG B   8      -6.447  16.992 -21.992  0.00  0.00              
ATOM   2234  C6  NAG B   8      -7.136  16.732 -23.345  0.00  0.00              
ATOM   2235  C7  NAG B   8      -6.425  17.926 -16.635  0.00  0.00              
ATOM   2236  C8  NAG B   8      -5.519  18.236 -15.461  0.00  0.00              
ATOM   2237  O3h NAG B   8      -6.462  15.193 -18.666  0.00  0.00              
ATOM   2238  OR  NAG B   8      -6.180  14.627 -21.365  0.00  0.00              
ATOM   2239  OR  NAG B   8      -6.894  18.281 -21.467  0.00  0.00              
ATOM   2240  O6h NAG B   8      -8.559  16.671 -23.213  0.00  0.00              
ATOM   2241  OM  NAG B   8      -7.587  17.590 -16.444  0.00  0.00              
ATOM   2242  N15 NAG B   8      -5.854  17.993 -17.836  0.00  0.00              
ATOM   2243  H2  NAG B   8      -7.673  17.596 -18.929  0.00  0.00              
ATOM   2244  H3  NAG B   8      -5.005  16.239 -19.699  0.00  0.00              
ATOM   2245  H4  NAG B   8      -7.826  15.771 -20.832  0.00  0.00              
ATOM   2246  H5  NAG B   8      -5.355  17.037 -22.175  0.00  0.00              
ATOM   2247  H6S NAG B   8      -6.856  17.526 -24.062  0.00  0.00              
ATOM   2248  H6R NAG B   8      -6.756  15.783 -23.772  0.00  0.00              
ATOM   2249  H8  NAG B   8      -6.076  18.804 -14.697  0.00  0.00              
ATOM   2250  H24 NAG B   8      -4.624  18.824 -15.731  0.00  0.00              
ATOM   2251  H25 NAG B   8      -5.185  17.293 -14.995  0.00  0.00              
ATOM   2252  H3o NAG B   8      -5.962  15.360 -17.862  0.00  0.00              
ATOM   2253  H6o NAG B   8      -8.905  16.262 -24.010  0.00  0.00              
ATOM   2254  H29 NAG B   8      -4.932  18.431 -17.829  0.00  0.00              
ATOM   2255  H1  NAG B   8      -5.229  18.876 -20.331  0.00  0.00              
ATOM   2256  C1  GLB B   9      -7.075  13.614 -21.657  0.00  0.00              
ATOM   2257  C2  GLB B   9      -6.309  12.484 -22.340  0.00  0.00              
ATOM   2258  C3  GLB B   9      -7.147  11.224 -22.470  0.00  0.00              
ATOM   2259  C4  GLB B   9      -7.760  10.857 -21.137  0.00  0.00              
ATOM   2260  C5  GLB B   9      -8.521  12.054 -20.568  0.00  0.00              
ATOM   2261  C6  GLB B   9      -9.164  11.819 -19.219  0.00  0.00              
ATOM   2262  O2h GLB B   9      -5.905  12.928 -23.629  0.00  0.00              
ATOM   2263  O3h GLB B   9      -6.303  10.153 -22.909  0.00  0.00              
ATOM   2264  OR  GLB B   9      -7.583  13.130 -20.408  0.00  0.00              
ATOM   2265  OW  GLB B   9     -10.420  12.470 -19.110  0.00  0.00              
ATOM   2266  H2o GLB B   9      -4.925  13.241 -23.691  0.00  0.00              
ATOM   2267  H3o GLB B   9      -6.642   9.975 -23.929  0.00  0.00              
ATOM   2268  O4h GLB B   9      -6.672  10.450 -20.315  0.00  0.00              
ATOM   2269  H4o GLB B   9      -6.166   9.602 -20.775  0.00  0.00              
ATOM   2270  H5  GLB B   9      -9.306  12.313 -21.223  0.00  0.00              
ATOM   2271  H6  GLB B   9      -9.288  10.980 -18.695  0.00  0.00              
ATOM   2272  H20 GLB B   9      -8.536  12.212 -18.473  0.00  0.00              
ATOM   2273  H1  GLB B   9      -7.878  13.956 -22.310  0.00  0.00              
ATOM   2274  H2  GLB B   9      -5.429  12.275 -21.731  0.00  0.00              
ATOM   2275  H3  GLB B   9      -7.939  11.401 -23.197  0.00  0.00              
ATOM   2276  H4  GLB B   9      -8.485  10.045 -21.207  0.00  0.00              
ATOM   2277  C1  NAN B  10      -9.863  13.548 -17.001  0.00  0.00              
ATOM   2278  C2  NAN B  10     -10.914  12.700 -17.802  0.00  0.00              
ATOM   2279  C3  NAN B  10     -11.235  11.300 -17.207  0.00  0.00              
ATOM   2280  C4  NAN B  10     -12.162  11.395 -15.974  0.00  0.00              
ATOM   2281  C5  NAN B  10     -13.438  12.206 -16.292  0.00  0.00              
ATOM   2282  C6  NAN B  10     -13.080  13.595 -16.896  0.00  0.00              
ATOM   2283  C7  NAN B  10     -14.316  14.400 -17.374  0.00  0.00              
ATOM   2284  C8  NAN B  10     -13.988  15.867 -17.745  0.00  0.00              
ATOM   2285  C9  NAN B  10     -15.210  16.677 -18.195  0.00  0.00              
ATOM   2286  OW  NAN B  10     -12.167  13.412 -18.036  0.00  0.00              
ATOM   2287  OM  NAN B  10      -9.274  13.171 -15.988  0.00  0.00              
ATOM   2288  O1h NAN B  10      -9.657  14.781 -17.550  0.00  0.00              
ATOM   2289  O4h NAN B  10     -12.526  10.081 -15.575  0.00  0.00              
ATOM   2290  O7h NAN B  10     -14.864  13.740 -18.513  0.00  0.00              
ATOM   2291  O8h NAN B  10     -13.459  16.549 -16.617  0.00  0.00              
ATOM   2292  O9h NAN B  10     -14.834  18.031 -18.449  0.00  0.00              
ATOM   2293  H6  NAN B  10     -12.570  14.184 -16.108  0.00  0.00              
ATOM   2294  H3  NAN B  10     -11.735  10.689 -17.982  0.00  0.00              
ATOM   2295  H21 NAN B  10     -10.300  10.765 -16.962  0.00  0.00              
ATOM   2296  H4  NAN B  10     -11.616  11.889 -15.144  0.00  0.00              
ATOM   2297  H7o NAN B  10     -14.091  13.413 -18.985  0.00  0.00              
ATOM   2298  H8o NAN B  10     -13.649  17.474 -16.809  0.00  0.00              
ATOM   2299  H4o NAN B  10     -11.710   9.574 -15.561  0.00  0.00              
ATOM   2300  H9o NAN B  10     -15.594  18.466 -18.847  0.00  0.00              
ATOM   2301  H9R NAN B  10     -16.002  16.641 -17.420  0.00  0.00              
ATOM   2302  H9S NAN B  10     -15.649  16.224 -19.106  0.00  0.00              
ATOM   2303  H8  NAN B  10     -13.233  15.878 -18.558  0.00  0.00              
ATOM   2304  H7  NAN B  10     -15.071  14.408 -16.561  0.00  0.00              
ATOM   2305  H1o NAN B  10      -9.029  15.245 -16.996  0.00  0.00              
ATOM   2306  H5  NAN B  10     -14.049  11.642 -17.023  0.00  0.00              
ATOM   2307  N33 NAN B  10     -14.184  12.355 -15.063  0.00  0.00              
ATOM   2308  C34 NAN B  10     -15.180  11.464 -14.754  0.00  0.00              
ATOM   2309  C35 NAN B  10     -15.878  11.750 -13.438  0.00  0.00              
ATOM   2310  OM  NAN B  10     -15.500  10.523 -15.455  0.00  0.00              
ATOM   2311  H37 NAN B  10     -13.967  13.128 -14.419  0.00  0.00              
ATOM   2312  H35 NAN B  10     -16.669  10.993 -13.234  0.00  0.00              
ATOM   2313  H39 NAN B  10     -16.362  12.754 -13.468  0.00  0.00              
ATOM   2314  H40 NAN B  10     -15.148  11.721 -12.597  0.00  0.00              
ATOM   2315  C1  MAN B  11      -1.780  23.807 -11.825  0.00  0.00              
ATOM   2316  C2  MAN B  11      -1.821  25.248 -11.328  0.00  0.00              
ATOM   2317  C3  MAN B  11      -0.856  26.141 -12.090  0.00  0.00              
ATOM   2318  C4  MAN B  11       0.524  25.522 -12.123  0.00  0.00              
ATOM   2319  C5  MAN B  11       0.439  24.094 -12.662  0.00  0.00              
ATOM   2320  C6  MAN B  11       1.758  23.356 -12.723  0.00  0.00              
ATOM   2321  O3h MAN B  11      -0.784  27.410 -11.430  0.00  0.00              
ATOM   2322  O4h MAN B  11       1.395  26.263 -12.963  0.00  0.00              
ATOM   2323  OR  MAN B  11      -0.423  23.349 -11.787  0.00  0.00              
ATOM   2324  O6h MAN B  11       2.368  23.254 -11.446  0.00  0.00              
ATOM   2325  H3o MAN B  11      -1.289  28.079 -12.127  0.00  0.00              
ATOM   2326  H4o MAN B  11       1.976  26.962 -12.361  0.00  0.00              
ATOM   2327  H6o MAN B  11       2.689  22.356 -10.919  0.00  0.00              
ATOM   2328  OW  MAN B  11      -1.492  25.263  -9.945  0.00  0.00              
ATOM   2329  H5  MAN B  11       0.072  24.115 -13.650  0.00  0.00              
ATOM   2330  H6S MAN B  11       2.004  22.498 -13.170  0.00  0.00              
ATOM   2331  H6R MAN B  11       2.414  23.889 -13.347  0.00  0.00              
ATOM   2332  H1  MAN B  11      -2.424  23.188 -11.199  0.00  0.00              
ATOM   2333  H2  MAN B  11      -2.839  25.611 -11.470  0.00  0.00              
ATOM   2334  H3  MAN B  11      -1.222  26.267 -13.109  0.00  0.00              
ATOM   2335  H4  MAN B  11       0.912  25.523 -11.104  0.00  0.00              
ATOM   2336  C1  NAG B  12      -2.554  25.047  -9.028  0.00  0.00              
ATOM   2337  C2  NAG B  12      -2.072  24.183  -7.819  0.00  0.00              
ATOM   2338  C3  NAG B  12      -3.165  24.182  -6.704  0.00  0.00              
ATOM   2339  C4  NAG B  12      -3.588  25.615  -6.321  0.00  0.00              
ATOM   2340  C5  NAG B  12      -4.028  26.415  -7.577  0.00  0.00              
ATOM   2341  C6  NAG B  12      -4.361  27.885  -7.261  0.00  0.00              
ATOM   2342  C7  NAG B  12      -0.699  22.125  -7.869  0.00  0.00              
ATOM   2343  C8  NAG B  12      -0.617  20.683  -8.322  0.00  0.00              
ATOM   2344  O3h NAG B  12      -2.714  23.532  -5.513  0.00  0.00              
ATOM   2345  OR  NAG B  12      -4.643  25.518  -5.371  0.00  0.00              
ATOM   2346  OR  NAG B  12      -2.972  26.368  -8.588  0.00  0.00              
ATOM   2347  O6h NAG B  12      -3.229  28.582  -6.732  0.00  0.00              
ATOM   2348  OM  NAG B  12       0.180  22.598  -7.158  0.00  0.00              
ATOM   2349  N15 NAG B  12      -1.790  22.785  -8.248  0.00  0.00              
ATOM   2350  H2  NAG B  12      -1.165  24.675  -7.412  0.00  0.00              
ATOM   2351  H3  NAG B  12      -4.061  23.648  -7.079  0.00  0.00              
ATOM   2352  H4  NAG B  12      -2.723  26.134  -5.858  0.00  0.00              
ATOM   2353  H5  NAG B  12      -4.942  25.946  -7.991  0.00  0.00              
ATOM   2354  H6S NAG B  12      -4.721  28.389  -8.178  0.00  0.00              
ATOM   2355  H6R NAG B  12      -5.199  27.923  -6.538  0.00  0.00              
ATOM   2356  H8  NAG B  12       0.423  20.432  -8.593  0.00  0.00              
ATOM   2357  H24 NAG B  12      -1.255  20.450  -9.194  0.00  0.00              
ATOM   2358  H25 NAG B  12      -0.911  20.018  -7.491  0.00  0.00              
ATOM   2359  H3o NAG B  12      -2.580  22.607  -5.742  0.00  0.00              
ATOM   2360  H6o NAG B  12      -3.553  29.390  -6.324  0.00  0.00              
ATOM   2361  H29 NAG B  12      -2.341  22.297  -8.957  0.00  0.00              
ATOM   2362  H1  NAG B  12      -3.393  24.553  -9.557  0.00  0.00              
ATOM   2363  C1  GLB B  13      -4.463  26.166  -4.162  0.00  0.00              
ATOM   2364  C2  GLB B  13      -5.797  26.175  -3.421  0.00  0.00              
ATOM   2365  C3  GLB B  13      -5.647  26.634  -1.981  0.00  0.00              
ATOM   2366  C4  GLB B  13      -4.547  25.859  -1.291  0.00  0.00              
ATOM   2367  C5  GLB B  13      -3.259  25.948  -2.109  0.00  0.00              
ATOM   2368  C6  GLB B  13      -2.083  25.190  -1.532  0.00  0.00              
ATOM   2369  O2h GLB B  13      -6.689  27.040  -4.111  0.00  0.00              
ATOM   2370  OW  GLB B  13      -6.884  26.404  -1.295  0.00  0.00              
ATOM   2371  OR  GLB B  13      -3.527  25.388  -3.405  0.00  0.00              
ATOM   2372  O6h GLB B  13      -2.361  23.806  -1.392  0.00  0.00              
ATOM   2373  H2o GLB B  13      -7.364  26.562  -4.729  0.00  0.00              
ATOM   2374  H6o GLB B  13      -1.808  22.959  -1.799  0.00  0.00              
ATOM   2375  O4h GLB B  13      -5.034  24.528  -1.169  0.00  0.00              
ATOM   2376  H4o GLB B  13      -5.954  24.531  -0.584  0.00  0.00              
ATOM   2377  H5  GLB B  13      -2.952  26.956  -2.173  0.00  0.00              
ATOM   2378  H6S GLB B  13      -1.114  25.212  -1.769  0.00  0.00              
ATOM   2379  H6R GLB B  13      -1.874  25.572  -0.575  0.00  0.00              
ATOM   2380  H1  GLB B  13      -4.116  27.190  -4.298  0.00  0.00              
ATOM   2381  H2  GLB B  13      -6.185  25.156  -3.441  0.00  0.00              
ATOM   2382  H3  GLB B  13      -5.404  27.696  -1.974  0.00  0.00              
ATOM   2383  H4  GLB B  13      -4.302  26.249  -0.303  0.00  0.00              
ATOM   2384  C1  NAN B  14      -7.630  28.698  -1.613  0.00  0.00              
ATOM   2385  C2  NAN B  14      -7.451  27.504  -0.607  0.00  0.00              
ATOM   2386  C3  NAN B  14      -6.521  27.787   0.605  0.00  0.00              
ATOM   2387  C4  NAN B  14      -7.212  28.663   1.673  0.00  0.00              
ATOM   2388  C5  NAN B  14      -8.567  28.060   2.102  0.00  0.00              
ATOM   2389  C6  NAN B  14      -9.469  27.778   0.864  0.00  0.00              
ATOM   2390  C7  NAN B  14     -10.786  27.037   1.213  0.00  0.00              
ATOM   2391  C8  NAN B  14     -11.786  26.975   0.032  0.00  0.00              
ATOM   2392  C9  NAN B  14     -13.102  26.265   0.377  0.00  0.00              
ATOM   2393  OW  NAN B  14      -8.721  26.975  -0.115  0.00  0.00              
ATOM   2394  OM  NAN B  14      -7.071  29.790  -1.522  0.00  0.00              
ATOM   2395  O1h NAN B  14      -8.492  28.401  -2.629  0.00  0.00              
ATOM   2396  O4h NAN B  14      -6.360  28.758   2.806  0.00  0.00              
ATOM   2397  O7h NAN B  14     -10.456  25.709   1.616  0.00  0.00              
ATOM   2398  O8h NAN B  14     -12.145  28.288  -0.372  0.00  0.00              
ATOM   2399  O9h NAN B  14     -13.991  26.315  -0.740  0.00  0.00              
ATOM   2400  H6  NAN B  14      -9.735  28.755   0.412  0.00  0.00              
ATOM   2401  H3  NAN B  14      -6.231  26.824   1.066  0.00  0.00              
ATOM   2402  H21 NAN B  14      -5.576  28.248   0.263  0.00  0.00              
ATOM   2403  H4  NAN B  14      -7.381  29.679   1.259  0.00  0.00              
ATOM   2404  H7o NAN B  14      -9.718  25.471   1.046  0.00  0.00              
ATOM   2405  H8o NAN B  14     -12.999  28.163  -0.797  0.00  0.00              
ATOM   2406  H4o NAN B  14      -5.487  28.968   2.463  0.00  0.00              
ATOM   2407  H9o NAN B  14     -14.743  25.754  -0.527  0.00  0.00              
ATOM   2408  H9R NAN B  14     -13.574  26.737   1.261  0.00  0.00              
ATOM   2409  H9S NAN B  14     -12.900  25.213   0.659  0.00  0.00              
ATOM   2410  H8  NAN B  14     -11.312  26.454  -0.823  0.00  0.00              
ATOM   2411  H7  NAN B  14     -11.277  27.562   2.057  0.00  0.00              
ATOM   2412  H1o NAN B  14      -8.569  29.179  -3.181  0.00  0.00              
ATOM   2413  H5  NAN B  14      -8.384  27.107   2.638  0.00  0.00              
ATOM   2414  N33 NAN B  14      -9.202  28.996   3.001  0.00  0.00              
ATOM   2415  C34 NAN B  14      -9.045  28.859   4.357  0.00  0.00              
ATOM   2416  C35 NAN B  14      -9.774  29.909   5.172  0.00  0.00              
ATOM   2417  OM  NAN B  14      -8.391  27.980   4.885  0.00  0.00              
ATOM   2418  H37 NAN B  14      -9.772  29.767   2.624  0.00  0.00              
ATOM   2419  H35 NAN B  14      -9.605  29.755   6.263  0.00  0.00              
ATOM   2420  H39 NAN B  14     -10.871  29.852   4.983  0.00  0.00              
ATOM   2421  H40 NAN B  14      -9.411  30.928   4.908  0.00  0.00              
ATOM   2422  C1  NAG C   1      -2.716 -18.767   7.325  0.00  0.00              
ATOM   2423  C2  NAG C   1      -3.515 -20.106   7.238  0.00  0.00              
ATOM   2424  C3  NAG C   1      -4.493 -20.215   8.449  0.00  0.00              
ATOM   2425  C4  NAG C   1      -3.762 -20.008   9.792  0.00  0.00              
ATOM   2426  C5  NAG C   1      -2.974 -18.670   9.788  0.00  0.00              
ATOM   2427  C6  NAG C   1      -2.142 -18.466  11.070  0.00  0.00              
ATOM   2428  C7  NAG C   1      -4.309 -21.277   5.207  0.00  0.00              
ATOM   2429  C8  NAG C   1      -5.212 -21.212   3.994  0.00  0.00              
ATOM   2430  O3h NAG C   1      -5.139 -21.490   8.503  0.00  0.00              
ATOM   2431  OR  NAG C   1      -4.739 -20.034  10.827  0.00  0.00              
ATOM   2432  OR  NAG C   1      -2.086 -18.622   8.628  0.00  0.00              
ATOM   2433  OW  NAG C   1      -2.509 -17.266  11.754  0.00  0.00              
ATOM   2434  OM  NAG C   1      -3.702 -22.309   5.467  0.00  0.00              
ATOM   2435  N15 NAG C   1      -4.281 -20.182   5.963  0.00  0.00              
ATOM   2436  H2  NAG C   1      -2.774 -20.930   7.317  0.00  0.00              
ATOM   2437  H3  NAG C   1      -5.270 -19.431   8.355  0.00  0.00              
ATOM   2438  H4  NAG C   1      -3.044 -20.840   9.943  0.00  0.00              
ATOM   2439  H5  NAG C   1      -3.699 -17.834   9.724  0.00  0.00              
ATOM   2440  H6  NAG C   1      -2.273 -19.338  11.739  0.00  0.00              
ATOM   2441  H22 NAG C   1      -1.067 -18.439  10.807  0.00  0.00              
ATOM   2442  H8  NAG C   1      -4.737 -21.730   3.143  0.00  0.00              
ATOM   2443  H24 NAG C   1      -5.450 -20.183   3.668  0.00  0.00              
ATOM   2444  H25 NAG C   1      -6.160 -21.733   4.212  0.00  0.00              
ATOM   2445  H3o NAG C   1      -5.694 -21.547   7.719  0.00  0.00              
ATOM   2446  H29 NAG C   1      -4.720 -19.370   5.527  0.00  0.00              
ATOM   2447  H1  NAG C   1      -3.380 -17.899   7.138  0.00  0.00              
ATOM   2448  C1  NAG C   2      -4.545 -20.974  11.873  0.00  0.00              
ATOM   2449  C2  NAG C   2      -5.440 -20.622  13.104  0.00  0.00              
ATOM   2450  C3  NAG C   2      -5.416 -21.801  14.126  0.00  0.00              
ATOM   2451  C4  NAG C   2      -5.773 -23.144  13.455  0.00  0.00              
ATOM   2452  C5  NAG C   2      -4.857 -23.407  12.228  0.00  0.00              
ATOM   2453  C6  NAG C   2      -5.244 -24.686  11.462  0.00  0.00              
ATOM   2454  C7  NAG C   2      -5.792 -18.406  14.148  0.00  0.00              
ATOM   2455  C8  NAG C   2      -5.148 -17.250  14.885  0.00  0.00              
ATOM   2456  O3h NAG C   2      -6.337 -21.598  15.200  0.00  0.00              
ATOM   2457  OR  NAG C   2      -5.638 -24.169  14.434  0.00  0.00              
ATOM   2458  OR  NAG C   2      -4.912 -22.267  11.316  0.00  0.00              
ATOM   2459  O6h NAG C   2      -6.575 -24.612  10.946  0.00  0.00              
ATOM   2460  OM  NAG C   2      -7.005 -18.432  13.983  0.00  0.00              
ATOM   2461  N15 NAG C   2      -4.963 -19.374  13.764  0.00  0.00              
ATOM   2462  H2  NAG C   2      -6.478 -20.513  12.728  0.00  0.00              
ATOM   2463  H3  NAG C   2      -4.394 -21.889  14.550  0.00  0.00              
ATOM   2464  H4  NAG C   2      -6.825 -23.104  13.107  0.00  0.00              
ATOM   2465  H5  NAG C   2      -3.816 -23.532  12.586  0.00  0.00              
ATOM   2466  H6S NAG C   2      -4.527 -24.855  10.636  0.00  0.00              
ATOM   2467  H6R NAG C   2      -5.148 -25.560  12.136  0.00  0.00              
ATOM   2468  H8  NAG C   2      -5.624 -16.301  14.585  0.00  0.00              
ATOM   2469  H24 NAG C   2      -4.063 -17.152  14.704  0.00  0.00              
ATOM   2470  H25 NAG C   2      -5.309 -17.371  15.970  0.00  0.00              
ATOM   2471  H3o NAG C   2      -6.023 -20.830  15.688  0.00  0.00              
ATOM   2472  H6o NAG C   2      -6.844 -25.505  10.712  0.00  0.00              
ATOM   2473  H29 NAG C   2      -3.976 -19.126  13.842  0.00  0.00              
ATOM   2474  H1  NAG C   2      -3.473 -20.985  12.155  0.00  0.00              
ATOM   2475  C1  BMA C   3      -6.744 -24.969  14.662  0.00  0.00              
ATOM   2476  C2  BMA C   3      -6.306 -26.153  15.518  0.00  0.00              
ATOM   2477  C3  BMA C   3      -7.491 -26.951  16.036  0.00  0.00              
ATOM   2478  C4  BMA C   3      -8.498 -26.036  16.693  0.00  0.00              
ATOM   2479  C5  BMA C   3      -8.880 -24.909  15.733  0.00  0.00              
ATOM   2480  C6  BMA C   3      -9.870 -23.908  16.285  0.00  0.00              
ATOM   2481  OW  BMA C   3      -7.019 -27.900  17.000  0.00  0.00              
ATOM   2482  O4h BMA C   3      -9.679 -26.744  17.040  0.00  0.00              
ATOM   2483  OR  BMA C   3      -7.680 -24.186  15.413  0.00  0.00              
ATOM   2484  OW  BMA C   3     -11.030 -23.807  15.474  0.00  0.00              
ATOM   2485  H4o BMA C   3      -9.627 -27.053  18.083  0.00  0.00              
ATOM   2486  O2h BMA C   3      -5.544 -25.666  16.615  0.00  0.00              
ATOM   2487  H2o BMA C   3      -6.169 -25.024  17.236  0.00  0.00              
ATOM   2488  H5  BMA C   3      -9.331 -25.321  14.872  0.00  0.00              
ATOM   2489  H6  BMA C   3     -10.219 -23.781  17.211  0.00  0.00              
ATOM   2490  H20 BMA C   3      -9.414 -22.961  16.308  0.00  0.00              
ATOM   2491  H2  BMA C   3      -5.684 -26.792  14.890  0.00  0.00              
ATOM   2492  H3  BMA C   3      -7.960 -27.468  15.198  0.00  0.00              
ATOM   2493  H1  BMA C   3      -7.181 -25.333  13.732  0.00  0.00              
ATOM   2494  H4  BMA C   3      -8.039 -25.631  17.595  0.00  0.00              
ATOM   2495  C1  MAN C   4      -7.386 -29.260  16.802  0.00  0.00              
ATOM   2496  C2  MAN C   4      -7.116 -30.186  17.984  0.00  0.00              
ATOM   2497  C3  MAN C   4      -5.630 -30.373  18.235  0.00  0.00              
ATOM   2498  C4  MAN C   4      -4.921 -30.760  16.956  0.00  0.00              
ATOM   2499  C5  MAN C   4      -5.244 -29.746  15.858  0.00  0.00              
ATOM   2500  C6  MAN C   4      -4.611 -30.036  14.515  0.00  0.00              
ATOM   2501  O3h MAN C   4      -5.455 -31.416  19.200  0.00  0.00              
ATOM   2502  OR  MAN C   4      -3.515 -30.784  17.139  0.00  0.00              
ATOM   2503  OR  MAN C   4      -6.668 -29.753  15.664  0.00  0.00              
ATOM   2504  O6h MAN C   4      -5.004 -31.300  14.006  0.00  0.00              
ATOM   2505  H3o MAN C   4      -5.104 -30.879  20.081  0.00  0.00              
ATOM   2506  H6o MAN C   4      -5.472 -31.529  13.047  0.00  0.00              
ATOM   2507  OW  MAN C   4      -7.718 -31.447  17.720  0.00  0.00              
ATOM   2508  H5  MAN C   4      -4.893 -28.794  16.146  0.00  0.00              
ATOM   2509  H6S MAN C   4      -4.527 -29.469  13.698  0.00  0.00              
ATOM   2510  H6R MAN C   4      -3.566 -30.051  14.631  0.00  0.00              
ATOM   2511  H1  MAN C   4      -8.457 -29.219  16.608  0.00  0.00              
ATOM   2512  H2  MAN C   4      -7.578 -29.732  18.860  0.00  0.00              
ATOM   2513  H3  MAN C   4      -5.216 -29.438  18.611  0.00  0.00              
ATOM   2514  H4  MAN C   4      -5.269 -31.753  16.672  0.00  0.00              
ATOM   2515  C1  NAG C   5      -9.084 -31.596  18.072  0.00  0.00              
ATOM   2516  C2  NAG C   5      -9.840 -32.455  17.008  0.00  0.00              
ATOM   2517  C3  NAG C   5     -11.258 -32.828  17.543  0.00  0.00              
ATOM   2518  C4  NAG C   5     -11.186 -33.481  18.938  0.00  0.00              
ATOM   2519  C5  NAG C   5     -10.401 -32.579  19.929  0.00  0.00              
ATOM   2520  C6  NAG C   5     -10.212 -33.235  21.310  0.00  0.00              
ATOM   2521  C7  NAG C   5      -9.719 -32.275  14.543  0.00  0.00              
ATOM   2522  C8  NAG C   5      -9.986 -31.402  13.334  0.00  0.00              
ATOM   2523  O3h NAG C   5     -11.933 -33.740  16.674  0.00  0.00              
ATOM   2524  OR  NAG C   5     -12.519 -33.703  19.383  0.00  0.00              
ATOM   2525  OR  NAG C   5      -9.091 -32.253  19.369  0.00  0.00              
ATOM   2526  O6h NAG C   5      -9.469 -34.454  21.219  0.00  0.00              
ATOM   2527  OM  NAG C   5      -9.351 -33.434  14.396  0.00  0.00              
ATOM   2528  N15 NAG C   5      -9.965 -31.712  15.723  0.00  0.00              
ATOM   2529  H2  NAG C   5      -9.261 -33.393  16.881  0.00  0.00              
ATOM   2530  H3  NAG C   5     -11.865 -31.904  17.625  0.00  0.00              
ATOM   2531  H4  NAG C   5     -10.659 -34.454  18.854  0.00  0.00              
ATOM   2532  H5  NAG C   5     -10.972 -31.640  20.079  0.00  0.00              
ATOM   2533  H6S NAG C   5      -9.699 -32.529  21.989  0.00  0.00              
ATOM   2534  H6R NAG C   5     -11.205 -33.431  21.760  0.00  0.00              
ATOM   2535  H8  NAG C   5      -9.214 -31.581  12.564  0.00  0.00              
ATOM   2536  H24 NAG C   5      -9.994 -30.321  13.555  0.00  0.00              
ATOM   2537  H25 NAG C   5     -10.961 -31.673  12.893  0.00  0.00              
ATOM   2538  H3o NAG C   5     -12.087 -33.269  15.850  0.00  0.00              
ATOM   2539  H6o NAG C   5      -9.603 -34.934  22.041  0.00  0.00              
ATOM   2540  H29 NAG C   5     -10.116 -30.704  15.674  0.00  0.00              
ATOM   2541  H1  NAG C   5      -9.545 -30.591  18.167  0.00  0.00              
ATOM   2542  C1  GLB C   6     -12.856 -34.998  19.737  0.00  0.00              
ATOM   2543  C2  GLB C   6     -14.211 -34.964  20.439  0.00  0.00              
ATOM   2544  C3  GLB C   6     -14.785 -36.356  20.638  0.00  0.00              
ATOM   2545  C4  GLB C   6     -14.767 -37.127  19.338  0.00  0.00              
ATOM   2546  C5  GLB C   6     -13.357 -37.115  18.748  0.00  0.00              
ATOM   2547  C6  GLB C   6     -13.214 -37.838  17.427  0.00  0.00              
ATOM   2548  O2h GLB C   6     -14.049 -34.325  21.699  0.00  0.00              
ATOM   2549  OW  GLB C   6     -16.138 -36.233  21.092  0.00  0.00              
ATOM   2550  OR  GLB C   6     -12.992 -35.743  18.520  0.00  0.00              
ATOM   2551  O6h GLB C   6     -14.058 -37.291  16.428  0.00  0.00              
ATOM   2552  H2o GLB C   6     -14.336 -33.334  21.721  0.00  0.00              
ATOM   2553  H6o GLB C   6     -13.785 -36.903  15.445  0.00  0.00              
ATOM   2554  O4h GLB C   6     -15.723 -36.488  18.501  0.00  0.00              
ATOM   2555  H4o GLB C   6     -16.703 -36.521  18.977  0.00  0.00              
ATOM   2556  H5  GLB C   6     -12.693 -37.592  19.414  0.00  0.00              
ATOM   2557  H6S GLB C   6     -12.398 -38.113  16.921  0.00  0.00              
ATOM   2558  H6R GLB C   6     -13.489 -38.843  17.561  0.00  0.00              
ATOM   2559  H1  GLB C   6     -12.114 -35.444  20.400  0.00  0.00              
ATOM   2560  H2  GLB C   6     -14.884 -34.377  19.814  0.00  0.00              
ATOM   2561  H3  GLB C   6     -14.185 -36.881  21.380  0.00  0.00              
ATOM   2562  H4  GLB C   6     -15.033 -38.177  19.458  0.00  0.00              
ATOM   2563  C1  NAN C   7     -15.511 -36.504  23.427  0.00  0.00              
ATOM   2564  C2  NAN C   7     -16.487 -36.933  22.274  0.00  0.00              
ATOM   2565  C3  NAN C   7     -16.462 -38.444  21.908  0.00  0.00              
ATOM   2566  C4  NAN C   7     -17.216 -39.303  22.946  0.00  0.00              
ATOM   2567  C5  NAN C   7     -18.651 -38.777  23.175  0.00  0.00              
ATOM   2568  C6  NAN C   7     -18.639 -37.261  23.528  0.00  0.00              
ATOM   2569  C7  NAN C   7     -20.055 -36.637  23.626  0.00  0.00              
ATOM   2570  C8  NAN C   7     -20.054 -35.203  24.212  0.00  0.00              
ATOM   2571  C9  NAN C   7     -21.455 -34.588  24.335  0.00  0.00              
ATOM   2572  OW  NAN C   7     -17.870 -36.527  22.511  0.00  0.00              
ATOM   2573  OM  NAN C   7     -14.733 -37.256  24.013  0.00  0.00              
ATOM   2574  O1h NAN C   7     -15.612 -35.176  23.731  0.00  0.00              
ATOM   2575  O4h NAN C   7     -17.276 -40.642  22.473  0.00  0.00              
ATOM   2576  O7h NAN C   7     -20.619 -36.606  22.317  0.00  0.00              
ATOM   2577  O8h NAN C   7     -19.515 -35.214  25.526  0.00  0.00              
ATOM   2578  O9h NAN C   7     -21.371 -33.300  24.947  0.00  0.00              
ATOM   2579  H6  NAN C   7     -18.146 -37.148  24.514  0.00  0.00              
ATOM   2580  H3  NAN C   7     -16.939 -38.578  20.918  0.00  0.00              
ATOM   2581  H21 NAN C   7     -15.420 -38.790  21.784  0.00  0.00              
ATOM   2582  H4  NAN C   7     -16.665 -39.281  23.909  0.00  0.00              
ATOM   2583  H7o NAN C   7     -19.871 -36.408  21.746  0.00  0.00              
ATOM   2584  H8o NAN C   7     -19.895 -34.426  25.928  0.00  0.00              
ATOM   2585  H4o NAN C   7     -16.385 -40.859  22.183  0.00  0.00              
ATOM   2586  H9o NAN C   7     -22.245 -32.902  24.889  0.00  0.00              
ATOM   2587  H9R NAN C   7     -22.115 -35.250  24.930  0.00  0.00              
ATOM   2588  H9S NAN C   7     -21.921 -34.506  23.334  0.00  0.00              
ATOM   2589  H8  NAN C   7     -19.430 -34.547  23.573  0.00  0.00              
ATOM   2590  H7  NAN C   7     -20.682 -37.277  24.277  0.00  0.00              
ATOM   2591  H1o NAN C   7     -15.012 -34.997  24.455  0.00  0.00              
ATOM   2592  H5  NAN C   7     -19.240 -38.926  22.249  0.00  0.00              
ATOM   2593  N33 NAN C   7     -19.240 -39.551  24.243  0.00  0.00              
ATOM   2594  C34 NAN C   7     -20.005 -40.652  23.951  0.00  0.00              
ATOM   2595  C35 NAN C   7     -20.561 -41.359  25.172  0.00  0.00              
ATOM   2596  OM  NAN C   7     -20.237 -41.044  22.824  0.00  0.00              
ATOM   2597  H37 NAN C   7     -19.085 -39.277  25.224  0.00  0.00              
ATOM   2598  H35 NAN C   7     -21.164 -42.248  24.877  0.00  0.00              
ATOM   2599  H39 NAN C   7     -21.220 -40.672  25.750  0.00  0.00              
ATOM   2600  H40 NAN C   7     -19.732 -41.708  25.830  0.00  0.00              
ATOM   2601  C1  NAG C   8      -2.847 -32.002  16.846  0.00  0.00              
ATOM   2602  C2  NAG C   8      -1.309 -31.769  16.706  0.00  0.00              
ATOM   2603  C3  NAG C   8      -0.571 -33.143  16.652  0.00  0.00              
ATOM   2604  C4  NAG C   8      -0.962 -34.045  17.840  0.00  0.00              
ATOM   2605  C5  NAG C   8      -2.504 -34.207  17.925  0.00  0.00              
ATOM   2606  C6  NAG C   8      -2.950 -35.016  19.158  0.00  0.00              
ATOM   2607  C7  NAG C   8      -0.149 -29.965  15.470  0.00  0.00              
ATOM   2608  C8  NAG C   8       0.113 -29.339  14.116  0.00  0.00              
ATOM   2609  O3h NAG C   8       0.850 -32.988  16.676  0.00  0.00              
ATOM   2610  OR  NAG C   8      -0.317 -35.302  17.661  0.00  0.00              
ATOM   2611  OR  NAG C   8      -3.138 -32.890  17.960  0.00  0.00              
ATOM   2612  O6h NAG C   8      -2.557 -34.382  20.378  0.00  0.00              
ATOM   2613  OM  NAG C   8       0.448 -29.561  16.461  0.00  0.00              
ATOM   2614  N15 NAG C   8      -1.004 -30.985  15.477  0.00  0.00              
ATOM   2615  H2  NAG C   8      -0.978 -31.235  17.621  0.00  0.00              
ATOM   2616  H3  NAG C   8      -0.852 -33.666  15.715  0.00  0.00              
ATOM   2617  H4  NAG C   8      -0.604 -33.579  18.780  0.00  0.00              
ATOM   2618  H5  NAG C   8      -2.851 -34.751  17.024  0.00  0.00              
ATOM   2619  H6S NAG C   8      -4.048 -35.147  19.138  0.00  0.00              
ATOM   2620  H6R NAG C   8      -2.516 -36.033  19.105  0.00  0.00              
ATOM   2621  H8  NAG C   8       0.210 -28.245  14.221  0.00  0.00              
ATOM   2622  H24 NAG C   8      -0.678 -29.537  13.372  0.00  0.00              
ATOM   2623  H25 NAG C   8       1.068 -29.719  13.714  0.00  0.00              
ATOM   2624  H3o NAG C   8       1.090 -32.538  15.861  0.00  0.00              
ATOM   2625  H6o NAG C   8      -2.629 -35.035  21.079  0.00  0.00              
ATOM   2626  H29 NAG C   8      -1.523 -31.091  14.604  0.00  0.00              
ATOM   2627  H1  NAG C   8      -3.267 -32.429  15.914  0.00  0.00              
ATOM   2628  C1  GLB C   9       0.488 -35.747  18.696  0.00  0.00              
ATOM   2629  C2  GLB C   9       0.845 -37.206  18.428  0.00  0.00              
ATOM   2630  C3  GLB C   9       1.928 -37.710  19.366  0.00  0.00              
ATOM   2631  C4  GLB C   9       3.106 -36.763  19.372  0.00  0.00              
ATOM   2632  C5  GLB C   9       2.629 -35.344  19.678  0.00  0.00              
ATOM   2633  C6  GLB C   9       3.718 -34.293  19.688  0.00  0.00              
ATOM   2634  O2h GLB C   9      -0.330 -37.993  18.583  0.00  0.00              
ATOM   2635  OW  GLB C   9       2.363 -38.999  18.915  0.00  0.00              
ATOM   2636  OR  GLB C   9       1.692 -34.969  18.655  0.00  0.00              
ATOM   2637  O6h GLB C   9       4.393 -34.217  18.442  0.00  0.00              
ATOM   2638  H2o GLB C   9      -0.799 -38.246  17.701  0.00  0.00              
ATOM   2639  H6o GLB C   9       4.532 -33.348  17.799  0.00  0.00              
ATOM   2640  O4h GLB C   9       3.698 -36.882  18.084  0.00  0.00              
ATOM   2641  H4o GLB C   9       4.009 -37.914  17.920  0.00  0.00              
ATOM   2642  H5  GLB C   9       2.193 -35.319  20.638  0.00  0.00              
ATOM   2643  H6S GLB C   9       3.708 -33.348  20.008  0.00  0.00              
ATOM   2644  H6R GLB C   9       4.428 -34.550  20.420  0.00  0.00              
ATOM   2645  H1  GLB C   9      -0.009 -35.665  19.662  0.00  0.00              
ATOM   2646  H2  GLB C   9       1.196 -37.271  17.399  0.00  0.00              
ATOM   2647  H3  GLB C   9       1.516 -37.783  20.372  0.00  0.00              
ATOM   2648  H4  GLB C   9       3.846 -37.002  20.136  0.00  0.00              
ATOM   2649  C1  NAN C  10       0.912 -40.174  20.474  0.00  0.00              
ATOM   2650  C2  NAN C  10       2.353 -40.050  19.866  0.00  0.00              
ATOM   2651  C3  NAN C  10       3.483 -39.726  20.883  0.00  0.00              
ATOM   2652  C4  NAN C  10       3.878 -40.962  21.720  0.00  0.00              
ATOM   2653  C5  NAN C  10       4.230 -42.164  20.816  0.00  0.00              
ATOM   2654  C6  NAN C  10       3.084 -42.453  19.803  0.00  0.00              
ATOM   2655  C7  NAN C  10       3.434 -43.554  18.768  0.00  0.00              
ATOM   2656  C8  NAN C  10       2.220 -44.011  17.922  0.00  0.00              
ATOM   2657  C9  NAN C  10       2.554 -45.117  16.913  0.00  0.00              
ATOM   2658  OW  NAN C  10       2.747 -41.216  19.079  0.00  0.00              
ATOM   2659  OM  NAN C  10       0.627 -40.001  21.660  0.00  0.00              
ATOM   2660  O1h NAN C  10      -0.026 -40.501  19.537  0.00  0.00              
ATOM   2661  O4h NAN C  10       5.004 -40.630  22.520  0.00  0.00              
ATOM   2662  O7h NAN C  10       4.444 -43.043  17.900  0.00  0.00              
ATOM   2663  O8h NAN C  10       1.210 -44.543  18.768  0.00  0.00              
ATOM   2664  O9h NAN C  10       1.370 -45.527  16.229  0.00  0.00              
ATOM   2665  H6  NAN C  10       2.200 -42.793  20.379  0.00  0.00              
ATOM   2666  H3  NAN C  10       4.372 -39.371  20.329  0.00  0.00              
ATOM   2667  H21 NAN C  10       3.182 -38.884  21.533  0.00  0.00              
ATOM   2668  H4  NAN C  10       3.032 -41.242  22.382  0.00  0.00              
ATOM   2669  H7o NAN C  10       4.210 -42.115  17.793  0.00  0.00              
ATOM   2670  H8o NAN C  10       0.713 -45.121  18.180  0.00  0.00              
ATOM   2671  H4o NAN C  10       4.799 -39.784  22.927  0.00  0.00              
ATOM   2672  H9o NAN C  10       1.643 -46.124  15.525  0.00  0.00              
ATOM   2673  H9R NAN C  10       3.015 -45.982  17.430  0.00  0.00              
ATOM   2674  H9S NAN C  10       3.309 -44.753  16.189  0.00  0.00              
ATOM   2675  H8  NAN C  10       1.807 -43.140  17.375  0.00  0.00              
ATOM   2676  H7  NAN C  10       3.832 -44.436  19.308  0.00  0.00              
ATOM   2677  H1o NAN C  10      -0.868 -40.585  19.987  0.00  0.00              
ATOM   2678  H5  NAN C  10       5.156 -41.933  20.255  0.00  0.00              
ATOM   2679  N33 NAN C  10       4.463 -43.306  21.671  0.00  0.00              
ATOM   2680  C34 NAN C  10       5.737 -43.612  22.073  0.00  0.00              
ATOM   2681  C35 NAN C  10       5.827 -44.840  22.960  0.00  0.00              
ATOM   2682  OM  NAN C  10       6.726 -42.978  21.759  0.00  0.00              
ATOM   2683  H37 NAN C  10       3.671 -43.891  21.978  0.00  0.00              
ATOM   2684  H35 NAN C  10       6.881 -45.035  23.263  0.00  0.00              
ATOM   2685  H39 NAN C  10       5.453 -45.736  22.415  0.00  0.00              
ATOM   2686  H40 NAN C  10       5.223 -44.696  23.884  0.00  0.00              
ATOM   2687  C1  MAN C  11     -11.817 -22.631  15.617  0.00  0.00              
ATOM   2688  C2  MAN C  11     -12.728 -22.602  16.841  0.00  0.00              
ATOM   2689  C3  MAN C  11     -13.845 -23.627  16.745  0.00  0.00              
ATOM   2690  C4  MAN C  11     -14.564 -23.506  15.420  0.00  0.00              
ATOM   2691  C5  MAN C  11     -13.554 -23.577  14.274  0.00  0.00              
ATOM   2692  C6  MAN C  11     -14.150 -23.443  12.890  0.00  0.00              
ATOM   2693  O3h MAN C  11     -14.776 -23.392  17.807  0.00  0.00              
ATOM   2694  O4h MAN C  11     -15.503 -24.556  15.251  0.00  0.00              
ATOM   2695  OR  MAN C  11     -12.627 -22.491  14.442  0.00  0.00              
ATOM   2696  OW  MAN C  11     -13.838 -24.557  12.069  0.00  0.00              
ATOM   2697  H3o MAN C  11     -14.623 -24.248  18.464  0.00  0.00              
ATOM   2698  H4o MAN C  11     -16.493 -24.214  15.555  0.00  0.00              
ATOM   2699  OW  MAN C  11     -13.286 -21.300  16.962  0.00  0.00              
ATOM   2700  H5  MAN C  11     -13.069 -24.514  14.293  0.00  0.00              
ATOM   2701  H6  MAN C  11     -15.069 -23.186  12.598  0.00  0.00              
ATOM   2702  H20 MAN C  11     -13.747 -22.587  12.431  0.00  0.00              
ATOM   2703  H1  MAN C  11     -11.083 -21.829  15.690  0.00  0.00              
ATOM   2704  H2  MAN C  11     -12.108 -22.821  17.710  0.00  0.00              
ATOM   2705  H3  MAN C  11     -13.416 -24.625  16.835  0.00  0.00              
ATOM   2706  H4  MAN C  11     -15.084 -22.548  15.412  0.00  0.00              
ATOM   2707  C1  NAG C  12     -12.519 -20.333  17.662  0.00  0.00              
ATOM   2708  C2  NAG C  12     -12.649 -18.930  16.987  0.00  0.00              
ATOM   2709  C3  NAG C  12     -12.024 -17.840  17.912  0.00  0.00              
ATOM   2710  C4  NAG C  12     -12.606 -17.905  19.340  0.00  0.00              
ATOM   2711  C5  NAG C  12     -12.459 -19.334  19.930  0.00  0.00              
ATOM   2712  C6  NAG C  12     -13.118 -19.476  21.315  0.00  0.00              
ATOM   2713  C7  NAG C  12     -12.523 -18.381  14.577  0.00  0.00              
ATOM   2714  C8  NAG C  12     -11.654 -18.371  13.336  0.00  0.00              
ATOM   2715  O3h NAG C  12     -12.253 -16.520  17.415  0.00  0.00              
ATOM   2716  OR  NAG C  12     -11.918 -16.943  20.133  0.00  0.00              
ATOM   2717  OR  NAG C  12     -13.050 -20.309  19.015  0.00  0.00              
ATOM   2718  O6h NAG C  12     -14.524 -19.219  21.262  0.00  0.00              
ATOM   2719  OM  NAG C  12     -13.638 -17.875  14.552  0.00  0.00              
ATOM   2720  N15 NAG C  12     -11.968 -18.916  15.662  0.00  0.00              
ATOM   2721  H2  NAG C  12     -13.735 -18.718  16.890  0.00  0.00              
ATOM   2722  H3  NAG C  12     -10.931 -18.008  17.978  0.00  0.00              
ATOM   2723  H4  NAG C  12     -13.683 -17.648  19.302  0.00  0.00              
ATOM   2724  H5  NAG C  12     -11.380 -19.558  20.048  0.00  0.00              
ATOM   2725  H6S NAG C  12     -12.936 -20.494  21.710  0.00  0.00              
ATOM   2726  H6R NAG C  12     -12.633 -18.778  22.025  0.00  0.00              
ATOM   2727  H8  NAG C  12     -12.270 -18.580  12.444  0.00  0.00              
ATOM   2728  H24 NAG C  12     -10.835 -19.110  13.358  0.00  0.00              
ATOM   2729  H25 NAG C  12     -11.213 -17.368  13.205  0.00  0.00              
ATOM   2730  H3o NAG C  12     -11.772 -16.455  16.583  0.00  0.00              
ATOM   2731  H6o NAG C  12     -14.824 -19.070  22.162  0.00  0.00              
ATOM   2732  H29 NAG C  12     -11.103 -19.424  15.474  0.00  0.00              
ATOM   2733  H1  NAG C  12     -11.460 -20.661  17.687  0.00  0.00              
ATOM   2734  C1  GLB C  13     -12.690 -15.997  20.784  0.00  0.00              
ATOM   2735  C2  GLB C  13     -11.802 -15.260  21.781  0.00  0.00              
ATOM   2736  C3  GLB C  13     -12.490 -14.034  22.360  0.00  0.00              
ATOM   2737  C4  GLB C  13     -13.050 -13.170  21.255  0.00  0.00              
ATOM   2738  C5  GLB C  13     -13.942 -14.010  20.341  0.00  0.00              
ATOM   2739  C6  GLB C  13     -14.549 -13.259  19.176  0.00  0.00              
ATOM   2740  O2h GLB C  13     -11.458 -16.158  22.829  0.00  0.00              
ATOM   2741  OW  GLB C  13     -11.528 -13.278  23.106  0.00  0.00              
ATOM   2742  OR  GLB C  13     -13.134 -15.064  19.791  0.00  0.00              
ATOM   2743  O6h GLB C  13     -13.555 -12.693  18.335  0.00  0.00              
ATOM   2744  H2o GLB C  13     -10.521 -16.580  22.745  0.00  0.00              
ATOM   2745  H6o GLB C  13     -13.413 -12.836  17.264  0.00  0.00              
ATOM   2746  O4h GLB C  13     -11.920 -12.631  20.580  0.00  0.00              
ATOM   2747  H4o GLB C  13     -11.320 -12.051  21.282  0.00  0.00              
ATOM   2748  H5  GLB C  13     -14.755 -14.389  20.897  0.00  0.00              
ATOM   2749  H6S GLB C  13     -15.273 -13.519  18.540  0.00  0.00              
ATOM   2750  H6R GLB C  13     -15.136 -12.473  19.550  0.00  0.00              
ATOM   2751  H1  GLB C  13     -13.530 -16.451  21.310  0.00  0.00              
ATOM   2752  H2  GLB C  13     -10.901 -14.954  21.249  0.00  0.00              
ATOM   2753  H3  GLB C  13     -13.299 -14.361  23.012  0.00  0.00              
ATOM   2754  H4  GLB C  13     -13.677 -12.357  21.621  0.00  0.00              
ATOM   2755  C1  NAG C  14     -12.014 -12.526  24.208  0.00  0.00              
ATOM   2756  C2  NAG C  14     -11.794 -13.302  25.546  0.00  0.00              
ATOM   2757  C3  NAG C  14     -12.084 -12.360  26.754  0.00  0.00              
ATOM   2758  C4  NAG C  14     -11.285 -11.043  26.655  0.00  0.00              
ATOM   2759  C5  NAG C  14     -11.540 -10.348  25.290  0.00  0.00              
ATOM   2760  C6  NAG C  14     -10.683  -9.081  25.100  0.00  0.00              
ATOM   2761  C7  NAG C  14     -12.244 -15.690  26.013  0.00  0.00              
ATOM   2762  C8  NAG C  14     -13.299 -16.772  26.112  0.00  0.00              
ATOM   2763  O3h NAG C  14     -11.751 -12.972  28.003  0.00  0.00              
ATOM   2764  OR  NAG C  14     -11.678 -10.213  27.743  0.00  0.00              
ATOM   2765  OR  NAG C  14     -11.264 -11.281  24.200  0.00  0.00              
ATOM   2766  O6h NAG C  14      -9.285  -9.377  25.132  0.00  0.00              
ATOM   2767  OM  NAG C  14     -11.086 -15.928  26.338  0.00  0.00              
ATOM   2768  N15 NAG C  14     -12.679 -14.498  25.615  0.00  0.00              
ATOM   2769  H2  NAG C  14     -10.721 -13.588  25.581  0.00  0.00              
ATOM   2770  H3  NAG C  14     -13.164 -12.108  26.763  0.00  0.00              
ATOM   2771  H4  NAG C  14     -10.203 -11.272  26.738  0.00  0.00              
ATOM   2772  H5  NAG C  14     -12.604 -10.043  25.243  0.00  0.00              
ATOM   2773  H6S NAG C  14     -10.945  -8.597  24.140  0.00  0.00              
ATOM   2774  H6R NAG C  14     -10.933  -8.349  25.893  0.00  0.00              
ATOM   2775  H8  NAG C  14     -12.881 -17.737  25.775  0.00  0.00              
ATOM   2776  H24 NAG C  14     -14.203 -16.571  25.512  0.00  0.00              
ATOM   2777  H25 NAG C  14     -13.603 -16.894  27.166  0.00  0.00              
ATOM   2778  H3o NAG C  14     -12.351 -13.717  28.110  0.00  0.00              
ATOM   2779  H6o NAG C  14      -8.818  -8.549  25.266  0.00  0.00              
ATOM   2780  H29 NAG C  14     -13.629 -14.511  25.241  0.00  0.00              
ATOM   2781  H1  NAG C  14     -13.089 -12.310  24.052  0.00  0.00              
ATOM   2782  C1  GLB C  15     -10.675  -9.758  28.580  0.00  0.00              
ATOM   2783  C2  GLB C  15     -11.262  -8.681  29.486  0.00  0.00              
ATOM   2784  C3  GLB C  15     -10.313  -8.300  30.609  0.00  0.00              
ATOM   2785  C4  GLB C  15      -9.826  -9.535  31.332  0.00  0.00              
ATOM   2786  C5  GLB C  15      -9.236 -10.525  30.328  0.00  0.00              
ATOM   2787  C6  GLB C  15      -8.732 -11.819  30.928  0.00  0.00              
ATOM   2788  O2h GLB C  15     -11.553  -7.536  28.693  0.00  0.00              
ATOM   2789  OW  GLB C  15     -11.011  -7.459  31.535  0.00  0.00              
ATOM   2790  OR  GLB C  15     -10.273 -10.868  29.394  0.00  0.00              
ATOM   2791  O6h GLB C  15      -9.759 -12.522  31.610  0.00  0.00              
ATOM   2792  H2o GLB C  15     -12.543  -7.440  28.421  0.00  0.00              
ATOM   2793  H6o GLB C  15     -10.100 -13.544  31.452  0.00  0.00              
ATOM   2794  O4h GLB C  15     -10.962 -10.051  32.015  0.00  0.00              
ATOM   2795  H4o GLB C  15     -11.342  -9.300  32.708  0.00  0.00              
ATOM   2796  H5  GLB C  15      -8.406 -10.084  29.848  0.00  0.00              
ATOM   2797  H6S GLB C  15      -8.173 -12.545  30.534  0.00  0.00              
ATOM   2798  H6R GLB C  15      -7.980 -11.596  31.627  0.00  0.00              
ATOM   2799  H1  GLB C  15      -9.835  -9.346  28.022  0.00  0.00              
ATOM   2800  H2  GLB C  15     -12.185  -9.078  29.908  0.00  0.00              
ATOM   2801  H3  GLB C  15      -9.462  -7.767  30.185  0.00  0.00              
ATOM   2802  H4  GLB C  15      -9.033  -9.327  32.050  0.00  0.00              
ATOM   2803  C1  NAN C  16     -10.137  -5.420  30.535  0.00  0.00              
ATOM   2804  C2  NAN C  16     -10.406  -6.220  31.861  0.00  0.00              
ATOM   2805  C3  NAN C  16      -9.146  -6.558  32.703  0.00  0.00              
ATOM   2806  C4  NAN C  16      -8.623  -5.330  33.481  0.00  0.00              
ATOM   2807  C5  NAN C  16      -9.740  -4.684  34.329  0.00  0.00              
ATOM   2808  C6  NAN C  16     -10.990  -4.368  33.456  0.00  0.00              
ATOM   2809  C7  NAN C  16     -12.203  -3.854  34.275  0.00  0.00              
ATOM   2810  C8  NAN C  16     -13.354  -3.313  33.391  0.00  0.00              
ATOM   2811  C9  NAN C  16     -14.548  -2.779  34.195  0.00  0.00              
ATOM   2812  OW  NAN C  16     -11.395  -5.580  32.725  0.00  0.00              
ATOM   2813  OM  NAN C  16      -9.027  -5.089  30.123  0.00  0.00              
ATOM   2814  O1h NAN C  16     -11.286  -5.117  29.865  0.00  0.00              
ATOM   2815  O4h NAN C  16      -7.565  -5.747  34.334  0.00  0.00              
ATOM   2816  O7h NAN C  16     -12.692  -4.931  35.072  0.00  0.00              
ATOM   2817  O8h NAN C  16     -12.894  -2.224  32.605  0.00  0.00              
ATOM   2818  O9h NAN C  16     -15.529  -2.236  33.311  0.00  0.00              
ATOM   2819  H6  NAN C  16     -10.706  -3.580  32.732  0.00  0.00              
ATOM   2820  H3  NAN C  16      -9.403  -7.355  33.427  0.00  0.00              
ATOM   2821  H21 NAN C  16      -8.358  -6.987  32.058  0.00  0.00              
ATOM   2822  H4  NAN C  16      -8.235  -4.579  32.761  0.00  0.00              
ATOM   2823  H7o NAN C  16     -12.581  -5.704  34.509  0.00  0.00              
ATOM   2824  H8o NAN C  16     -13.700  -1.735  32.410  0.00  0.00              
ATOM   2825  H4o NAN C  16      -6.987  -6.290  33.791  0.00  0.00              
ATOM   2826  H9o NAN C  16     -16.306  -2.032  33.841  0.00  0.00              
ATOM   2827  H9R NAN C  16     -14.212  -2.004  34.914  0.00  0.00              
ATOM   2828  H9S NAN C  16     -14.989  -3.593  34.802  0.00  0.00              
ATOM   2829  H8  NAN C  16     -13.709  -4.118  32.718  0.00  0.00              
ATOM   2830  H7  NAN C  16     -11.862  -3.036  34.940  0.00  0.00              
ATOM   2831  H1o NAN C  16     -11.046  -4.610  29.089  0.00  0.00              
ATOM   2832  H5  NAN C  16     -10.031  -5.386  35.134  0.00  0.00              
ATOM   2833  N33 NAN C  16      -9.205  -3.478  34.919  0.00  0.00              
ATOM   2834  C34 NAN C  16      -8.670  -3.512  36.181  0.00  0.00              
ATOM   2835  C35 NAN C  16      -8.155  -2.171  36.670  0.00  0.00              
ATOM   2836  OM  NAN C  16      -8.607  -4.511  36.872  0.00  0.00              
ATOM   2837  H37 NAN C  16      -9.225  -2.594  34.392  0.00  0.00              
ATOM   2838  H35 NAN C  16      -7.725  -2.260  37.694  0.00  0.00              
ATOM   2839  H39 NAN C  16      -8.986  -1.430  36.709  0.00  0.00              
ATOM   2840  H40 NAN C  16      -7.357  -1.792  35.992  0.00  0.00              
ATOM   2841  C1  NAG C  17     -13.947 -24.374  10.665  0.00  0.00              
ATOM   2842  C2  NAG C  17     -13.263 -25.552   9.900  0.00  0.00              
ATOM   2843  C3  NAG C  17     -13.623 -25.473   8.383  0.00  0.00              
ATOM   2844  C4  NAG C  17     -15.147 -25.384   8.163  0.00  0.00              
ATOM   2845  C5  NAG C  17     -15.752 -24.206   8.975  0.00  0.00              
ATOM   2846  C6  NAG C  17     -17.288 -24.139   8.870  0.00  0.00              
ATOM   2847  C7  NAG C  17     -11.060 -26.585  10.350  0.00  0.00              
ATOM   2848  C8  NAG C  17      -9.562 -26.375  10.398  0.00  0.00              
ATOM   2849  O3h NAG C  17     -13.148 -26.613   7.661  0.00  0.00              
ATOM   2850  OR  NAG C  17     -15.376 -25.224   6.766  0.00  0.00              
ATOM   2851  OR  NAG C  17     -15.373 -24.327  10.381  0.00  0.00              
ATOM   2852  O6h NAG C  17     -17.906 -25.323   9.380  0.00  0.00              
ATOM   2853  OM  NAG C  17     -11.530 -27.705  10.514  0.00  0.00              
ATOM   2854  N15 NAG C  17     -11.785 -25.505  10.070  0.00  0.00              
ATOM   2855  H2  NAG C  17     -13.691 -26.492  10.307  0.00  0.00              
ATOM   2856  H3  NAG C  17     -13.158 -24.563   7.951  0.00  0.00              
ATOM   2857  H4  NAG C  17     -15.616 -26.328   8.507  0.00  0.00              
ATOM   2858  H5  NAG C  17     -15.347 -23.256   8.573  0.00  0.00              
ATOM   2859  H6S NAG C  17     -17.659 -23.253   9.418  0.00  0.00              
ATOM   2860  H6R NAG C  17     -17.575 -23.990   7.811  0.00  0.00              
ATOM   2861  H8  NAG C  17      -9.123 -26.979  11.211  0.00  0.00              
ATOM   2862  H24 NAG C  17      -9.263 -25.324  10.563  0.00  0.00              
ATOM   2863  H25 NAG C  17      -9.111 -26.719   9.451  0.00  0.00              
ATOM   2864  H3o NAG C  17     -12.188 -26.579   7.699  0.00  0.00              
ATOM   2865  H6o NAG C  17     -18.812 -25.336   9.062  0.00  0.00              
ATOM   2866  H29 NAG C  17     -11.256 -24.633  10.115  0.00  0.00              
ATOM   2867  H1  NAG C  17     -13.484 -23.405  10.390  0.00  0.00              
ATOM   2868  C1  GLB C  18     -16.204 -26.149   6.157  0.00  0.00              
ATOM   2869  C2  GLB C  18     -16.537 -25.640   4.758  0.00  0.00              
ATOM   2870  C3  GLB C  18     -17.230 -26.699   3.915  0.00  0.00              
ATOM   2871  C4  GLB C  18     -16.451 -27.994   3.948  0.00  0.00              
ATOM   2872  C5  GLB C  18     -16.206 -28.415   5.398  0.00  0.00              
ATOM   2873  C6  GLB C  18     -15.412 -29.692   5.566  0.00  0.00              
ATOM   2874  O2h GLB C  18     -17.376 -24.498   4.879  0.00  0.00              
ATOM   2875  OW  GLB C  18     -17.306 -26.232   2.563  0.00  0.00              
ATOM   2876  OR  GLB C  18     -15.458 -27.366   6.035  0.00  0.00              
ATOM   2877  O6h GLB C  18     -14.130 -29.602   4.963  0.00  0.00              
ATOM   2878  H2o GLB C  18     -16.890 -23.594   4.779  0.00  0.00              
ATOM   2879  H6o GLB C  18     -13.154 -29.763   5.421  0.00  0.00              
ATOM   2880  O4h GLB C  18     -15.248 -27.736   3.236  0.00  0.00              
ATOM   2881  H4o GLB C  18     -15.487 -27.434   2.217  0.00  0.00              
ATOM   2882  H5  GLB C  18     -17.131 -28.583   5.876  0.00  0.00              
ATOM   2883  H6S GLB C  18     -15.254 -30.259   6.371  0.00  0.00              
ATOM   2884  H6R GLB C  18     -15.931 -30.476   5.095  0.00  0.00              
ATOM   2885  H1  GLB C  18     -17.128 -26.300   6.718  0.00  0.00              
ATOM   2886  H2  GLB C  18     -15.597 -25.357   4.284  0.00  0.00              
ATOM   2887  H3  GLB C  18     -18.230 -26.865   4.314  0.00  0.00              
ATOM   2888  H4  GLB C  18     -16.979 -28.825   3.481  0.00  0.00              
ATOM   2889  C1  NAN C  19     -19.582 -25.419   2.841  0.00  0.00              
ATOM   2890  C2  NAN C  19     -18.584 -26.242   1.951  0.00  0.00              
ATOM   2891  C3  NAN C  19     -18.954 -27.737   1.740  0.00  0.00              
ATOM   2892  C4  NAN C  19     -20.100 -27.910   0.720  0.00  0.00              
ATOM   2893  C5  NAN C  19     -19.784 -27.191  -0.610  0.00  0.00              
ATOM   2894  C6  NAN C  19     -19.406 -25.702  -0.361  0.00  0.00              
ATOM   2895  C7  NAN C  19     -18.933 -24.961  -1.639  0.00  0.00              
ATOM   2896  C8  NAN C  19     -18.794 -23.430  -1.445  0.00  0.00              
ATOM   2897  C9  NAN C  19     -18.350 -22.687  -2.712  0.00  0.00              
ATOM   2898  OW  NAN C  19     -18.338 -25.628   0.649  0.00  0.00              
ATOM   2899  OM  NAN C  19     -20.584 -25.878   3.390  0.00  0.00              
ATOM   2900  O1h NAN C  19     -19.226 -24.106   2.951  0.00  0.00              
ATOM   2901  O4h NAN C  19     -20.285 -29.297   0.473  0.00  0.00              
ATOM   2902  O7h NAN C  19     -17.671 -25.500  -2.025  0.00  0.00              
ATOM   2903  O8h NAN C  19     -20.046 -22.869  -1.080  0.00  0.00              
ATOM   2904  O9h NAN C  19     -18.315 -21.280  -2.466  0.00  0.00              
ATOM   2905  H6  NAN C  19     -20.309 -25.185   0.022  0.00  0.00              
ATOM   2906  H3  NAN C  19     -18.062 -28.277   1.371  0.00  0.00              
ATOM   2907  H21 NAN C  19     -19.206 -28.209   2.708  0.00  0.00              
ATOM   2908  H4  NAN C  19     -21.036 -27.489   1.145  0.00  0.00              
ATOM   2909  H7o NAN C  19     -17.230 -25.678  -1.188  0.00  0.00              
ATOM   2910  H8o NAN C  19     -19.965 -21.950  -1.355  0.00  0.00              
ATOM   2911  H4o NAN C  19     -20.302 -29.720   1.336  0.00  0.00              
ATOM   2912  H9o NAN C  19     -17.914 -20.869  -3.239  0.00  0.00              
ATOM   2913  H9R NAN C  19     -19.039 -22.912  -3.550  0.00  0.00              
ATOM   2914  H9S NAN C  19     -17.351 -23.045  -3.030  0.00  0.00              
ATOM   2915  H8  NAN C  19     -18.062 -23.229  -0.638  0.00  0.00              
ATOM   2916  H7  NAN C  19     -19.668 -25.142  -2.448  0.00  0.00              
ATOM   2917  H1o NAN C  19     -19.891 -23.667   3.481  0.00  0.00              
ATOM   2918  H5  NAN C  19     -18.930 -27.701  -1.100  0.00  0.00              
ATOM   2919  N33 NAN C  19     -20.949 -27.294  -1.457  0.00  0.00              
ATOM   2920  C34 NAN C  19     -21.045 -28.313  -2.370  0.00  0.00              
ATOM   2921  C35 NAN C  19     -22.320 -28.287  -3.191  0.00  0.00              
ATOM   2922  OM  NAN C  19     -20.198 -29.169  -2.533  0.00  0.00              
ATOM   2923  H37 NAN C  19     -21.708 -26.603  -1.374  0.00  0.00              
ATOM   2924  H35 NAN C  19     -22.348 -29.140  -3.908  0.00  0.00              
ATOM   2925  H39 NAN C  19     -22.382 -27.342  -3.777  0.00  0.00              
ATOM   2926  H40 NAN C  19     -23.212 -28.365  -2.527  0.00  0.00              
ATOM   2927  C1  AFL C  20      -1.562 -16.732  12.677  0.00  0.00              
ATOM   2928  C2  AFL C  20      -2.031 -15.447  13.385  0.00  0.00              
ATOM   2929  C3  AFL C  20      -3.149 -15.761  14.390  0.00  0.00              
ATOM   2930  C4  AFL C  20      -2.682 -16.877  15.340  0.00  0.00              
ATOM   2931  C5  AFL C  20      -2.215 -18.091  14.522  0.00  0.00              
ATOM   2932  C6  AFL C  20      -1.686 -19.244  15.384  0.00  0.00              
ATOM   2933  OR  AFL C  20      -1.164 -17.735  13.617  0.00  0.00              
ATOM   2934  O2h AFL C  20      -2.397 -14.502  12.383  0.00  0.00              
ATOM   2935  O3h AFL C  20      -3.524 -14.565  15.065  0.00  0.00              
ATOM   2936  O4h AFL C  20      -1.598 -16.450  16.166  0.00  0.00              
ATOM   2937  H5  AFL C  20      -3.083 -18.479  13.956  0.00  0.00              
ATOM   2938  H1  AFL C  20      -0.666 -16.518  12.083  0.00  0.00              
ATOM   2939  H2  AFL C  20      -1.168 -15.043  13.949  0.00  0.00              
ATOM   2940  H2o AFL C  20      -2.548 -13.664  12.840  0.00  0.00              
ATOM   2941  H3  AFL C  20      -4.023 -16.128  13.821  0.00  0.00              
ATOM   2942  H3o AFL C  20      -4.347 -14.761  15.533  0.00  0.00              
ATOM   2943  H4  AFL C  20      -3.517 -17.189  15.996  0.00  0.00              
ATOM   2944  H4o AFL C  20      -1.948 -15.757  16.740  0.00  0.00              
ATOM   2945  H6  AFL C  20      -2.427 -19.577  16.130  0.00  0.00              
ATOM   2946  H22 AFL C  20      -1.435 -20.106  14.746  0.00  0.00              
ATOM   2947  H23 AFL C  20      -0.770 -18.946  15.919  0.00  0.00              
ATOM   2948  C1  NAG D   1     -15.124  -5.504  -1.674  0.00  0.00              
ATOM   2949  C2  NAG D   1     -14.954  -5.693  -3.216  0.00  0.00              
ATOM   2950  C3  NAG D   1     -16.351  -5.656  -3.909  0.00  0.00              
ATOM   2951  C4  NAG D   1     -17.336  -6.650  -3.260  0.00  0.00              
ATOM   2952  C5  NAG D   1     -17.430  -6.411  -1.728  0.00  0.00              
ATOM   2953  C6  NAG D   1     -18.322  -7.448  -1.019  0.00  0.00              
ATOM   2954  C7  NAG D   1     -13.105  -4.893  -4.653  0.00  0.00              
ATOM   2955  C8  NAG D   1     -12.375  -3.685  -5.202  0.00  0.00              
ATOM   2956  O3h NAG D   1     -16.267  -5.978  -5.299  0.00  0.00              
ATOM   2957  OR  NAG D   1     -18.600  -6.484  -3.890  0.00  0.00              
ATOM   2958  OR  NAG D   1     -16.093  -6.446  -1.139  0.00  0.00              
ATOM   2959  O6h NAG D   1     -17.818  -8.776  -1.175  0.00  0.00              
ATOM   2960  OM  NAG D   1     -12.820  -6.017  -5.050  0.00  0.00              
ATOM   2961  N15 NAG D   1     -14.079  -4.632  -3.786  0.00  0.00              
ATOM   2962  H2  NAG D   1     -14.519  -6.704  -3.370  0.00  0.00              
ATOM   2963  H3  NAG D   1     -16.774  -4.636  -3.807  0.00  0.00              
ATOM   2964  H4  NAG D   1     -16.971  -7.684  -3.434  0.00  0.00              
ATOM   2965  H5  NAG D   1     -17.875  -5.412  -1.554  0.00  0.00              
ATOM   2966  H6S NAG D   1     -18.399  -7.197   0.056  0.00  0.00              
ATOM   2967  H6R NAG D   1     -19.351  -7.384  -1.424  0.00  0.00              
ATOM   2968  H8  NAG D   1     -11.300  -3.911  -5.307  0.00  0.00              
ATOM   2969  H24 NAG D   1     -12.468  -2.783  -4.572  0.00  0.00              
ATOM   2970  H25 NAG D   1     -12.762  -3.446  -6.208  0.00  0.00              
ATOM   2971  H3o NAG D   1     -15.758  -5.273  -5.712  0.00  0.00              
ATOM   2972  H6o NAG D   1     -18.527  -9.383  -0.945  0.00  0.00              
ATOM   2973  H29 NAG D   1     -14.083  -3.667  -3.451  0.00  0.00              
ATOM   2974  H1  NAG D   1     -15.446  -4.470  -1.439  0.00  0.00              
ATOM   2975  C1  NAG D   2     -19.189  -7.638  -4.471  0.00  0.00              
ATOM   2976  C2  NAG D   2     -20.706  -7.401  -4.757  0.00  0.00              
ATOM   2977  C3  NAG D   2     -21.265  -8.567  -5.630  0.00  0.00              
ATOM   2978  C4  NAG D   2     -20.416  -8.788  -6.898  0.00  0.00              
ATOM   2979  C5  NAG D   2     -18.921  -8.991  -6.531  0.00  0.00              
ATOM   2980  C6  NAG D   2     -18.016  -9.112  -7.771  0.00  0.00              
ATOM   2981  C7  NAG D   2     -22.393  -6.371  -3.269  0.00  0.00              
ATOM   2982  C8  NAG D   2     -23.145  -6.481  -1.959  0.00  0.00              
ATOM   2983  O3h NAG D   2     -22.611  -8.324  -6.050  0.00  0.00              
ATOM   2984  OR  NAG D   2     -20.942  -9.921  -7.582  0.00  0.00              
ATOM   2985  OR  NAG D   2     -18.458  -7.877  -5.705  0.00  0.00              
ATOM   2986  O6h NAG D   2     -18.061  -7.932  -8.577  0.00  0.00              
ATOM   2987  OM  NAG D   2     -22.680  -5.490  -4.071  0.00  0.00              
ATOM   2988  N15 NAG D   2     -21.475  -7.308  -3.485  0.00  0.00              
ATOM   2989  H2  NAG D   2     -20.780  -6.463  -5.346  0.00  0.00              
ATOM   2990  H3  NAG D   2     -21.245  -9.503  -5.035  0.00  0.00              
ATOM   2991  H4  NAG D   2     -20.501  -7.894  -7.548  0.00  0.00              
ATOM   2992  H5  NAG D   2     -18.825  -9.931  -5.952  0.00  0.00              
ATOM   2993  H6S NAG D   2     -16.975  -9.311  -7.452  0.00  0.00              
ATOM   2994  H6R NAG D   2     -18.328  -9.990  -8.369  0.00  0.00              
ATOM   2995  H8  NAG D   2     -23.323  -5.475  -1.542  0.00  0.00              
ATOM   2996  H24 NAG D   2     -22.619  -7.074  -1.190  0.00  0.00              
ATOM   2997  H25 NAG D   2     -24.131  -6.943  -2.138  0.00  0.00              
ATOM   2998  H3o NAG D   2     -23.149  -8.320  -5.252  0.00  0.00              
ATOM   2999  H6o NAG D   2     -17.696  -8.156  -9.438  0.00  0.00              
ATOM   3000  H29 NAG D   2     -21.258  -7.869  -2.660  0.00  0.00              
ATOM   3001  H1  NAG D   2     -19.047  -8.498  -3.787  0.00  0.00              
ATOM   3002  C1  BMA D   3     -21.316  -9.739  -8.901  0.00  0.00              
ATOM   3003  C2  BMA D   3     -21.577 -11.111  -9.516  0.00  0.00              
ATOM   3004  C3  BMA D   3     -22.238 -11.010 -10.880  0.00  0.00              
ATOM   3005  C4  BMA D   3     -23.448 -10.107 -10.816  0.00  0.00              
ATOM   3006  C5  BMA D   3     -23.058  -8.758 -10.212  0.00  0.00              
ATOM   3007  C6  BMA D   3     -24.193  -7.768 -10.072  0.00  0.00              
ATOM   3008  OW  BMA D   3     -22.651 -12.319 -11.288  0.00  0.00              
ATOM   3009  O4h BMA D   3     -23.982  -9.876 -12.111  0.00  0.00              
ATOM   3010  OR  BMA D   3     -22.546  -9.004  -8.892  0.00  0.00              
ATOM   3011  OW  BMA D   3     -23.924  -6.552 -10.753  0.00  0.00              
ATOM   3012  H4o BMA D   3     -24.799 -10.572 -12.299  0.00  0.00              
ATOM   3013  O2h BMA D   3     -22.413 -11.853  -8.636  0.00  0.00              
ATOM   3014  H2o BMA D   3     -23.374 -11.348  -8.536  0.00  0.00              
ATOM   3015  H5  BMA D   3     -22.340  -8.292 -10.830  0.00  0.00              
ATOM   3016  H6  BMA D   3     -25.177  -7.887 -10.184  0.00  0.00              
ATOM   3017  H20 BMA D   3     -24.319  -7.542  -9.053  0.00  0.00              
ATOM   3018  H2  BMA D   3     -20.612 -11.608  -9.615  0.00  0.00              
ATOM   3019  H3  BMA D   3     -21.518 -10.603 -11.590  0.00  0.00              
ATOM   3020  H1  BMA D   3     -20.546  -9.224  -9.476  0.00  0.00              
ATOM   3021  H4  BMA D   3     -24.197 -10.600 -10.196  0.00  0.00              
ATOM   3022  C1  MAN D   4     -22.218 -12.762 -12.570  0.00  0.00              
ATOM   3023  C2  MAN D   4     -22.903 -14.022 -13.088  0.00  0.00              
ATOM   3024  C3  MAN D   4     -22.532 -15.250 -12.273  0.00  0.00              
ATOM   3025  C4  MAN D   4     -21.032 -15.359 -12.135  0.00  0.00              
ATOM   3026  C5  MAN D   4     -20.465 -14.051 -11.582  0.00  0.00              
ATOM   3027  C6  MAN D   4     -18.961 -14.026 -11.418  0.00  0.00              
ATOM   3028  O3h MAN D   4     -23.027 -16.414 -12.946  0.00  0.00              
ATOM   3029  OR  MAN D   4     -20.677 -16.408 -11.246  0.00  0.00              
ATOM   3030  OR  MAN D   4     -20.806 -13.004 -12.505  0.00  0.00              
ATOM   3031  O6h MAN D   4     -18.290 -14.252 -12.647  0.00  0.00              
ATOM   3032  H3o MAN D   4     -23.835 -16.749 -12.296  0.00  0.00              
ATOM   3033  H6o MAN D   4     -17.544 -13.626 -13.137  0.00  0.00              
ATOM   3034  OW  MAN D   4     -22.526 -14.220 -14.446  0.00  0.00              
ATOM   3035  H5  MAN D   4     -20.865 -13.875 -10.622  0.00  0.00              
ATOM   3036  H6S MAN D   4     -18.369 -13.379 -10.942  0.00  0.00              
ATOM   3037  H6R MAN D   4     -18.682 -14.793 -10.756  0.00  0.00              
ATOM   3038  H1  MAN D   4     -22.447 -11.925 -13.230  0.00  0.00              
ATOM   3039  H2  MAN D   4     -23.978 -13.855 -13.024  0.00  0.00              
ATOM   3040  H3  MAN D   4     -22.984 -15.166 -11.285  0.00  0.00              
ATOM   3041  H4  MAN D   4     -20.621 -15.566 -13.123  0.00  0.00              
ATOM   3042  C1  NAG D   5     -23.292 -13.546 -15.431  0.00  0.00              
ATOM   3043  C2  NAG D   5     -22.377 -13.037 -16.590  0.00  0.00              
ATOM   3044  C3  NAG D   5     -23.258 -12.542 -17.780  0.00  0.00              
ATOM   3045  C4  NAG D   5     -24.283 -13.611 -18.212  0.00  0.00              
ATOM   3046  C5  NAG D   5     -25.135 -14.079 -17.002  0.00  0.00              
ATOM   3047  C6  NAG D   5     -26.102 -15.222 -17.363  0.00  0.00              
ATOM   3048  C7  NAG D   5     -20.198 -11.878 -16.413  0.00  0.00              
ATOM   3049  C8  NAG D   5     -19.472 -10.638 -15.935  0.00  0.00              
ATOM   3050  O3h NAG D   5     -22.471 -12.209 -18.926  0.00  0.00              
ATOM   3051  OR  NAG D   5     -25.097 -13.043 -19.233  0.00  0.00              
ATOM   3052  OR  NAG D   5     -24.256 -14.518 -15.920  0.00  0.00              
ATOM   3053  O6h NAG D   5     -25.404 -16.383 -17.820  0.00  0.00              
ATOM   3054  OM  NAG D   5     -19.602 -12.725 -17.068  0.00  0.00              
ATOM   3055  N15 NAG D   5     -21.495 -11.933 -16.122  0.00  0.00              
ATOM   3056  H2  NAG D   5     -21.785 -13.910 -16.940  0.00  0.00              
ATOM   3057  H3  NAG D   5     -23.815 -11.638 -17.461  0.00  0.00              
ATOM   3058  H4  NAG D   5     -23.738 -14.487 -18.622  0.00  0.00              
ATOM   3059  H5  NAG D   5     -25.743 -13.223 -16.647  0.00  0.00              
ATOM   3060  H6S NAG D   5     -26.721 -15.476 -16.481  0.00  0.00              
ATOM   3061  H6R NAG D   5     -26.806 -14.873 -18.143  0.00  0.00              
ATOM   3062  H8  NAG D   5     -18.459 -10.905 -15.588  0.00  0.00              
ATOM   3063  H24 NAG D   5     -19.981 -10.112 -15.108  0.00  0.00              
ATOM   3064  H25 NAG D   5     -19.357  -9.931 -16.775  0.00  0.00              
ATOM   3065  H3o NAG D   5     -21.931 -11.453 -18.676  0.00  0.00              
ATOM   3066  H6o NAG D   5     -26.043 -16.949 -18.262  0.00  0.00              
ATOM   3067  H29 NAG D   5     -21.795 -11.227 -15.447  0.00  0.00              
ATOM   3068  H1  NAG D   5     -23.830 -12.700 -14.957  0.00  0.00              
ATOM   3069  C1  GLB D   6     -25.163 -13.724 -20.436  0.00  0.00              
ATOM   3070  C2  GLB D   6     -26.286 -13.114 -21.269  0.00  0.00              
ATOM   3071  C3  GLB D   6     -26.273 -13.618 -22.701  0.00  0.00              
ATOM   3072  C4  GLB D   6     -24.892 -13.474 -23.301  0.00  0.00              
ATOM   3073  C5  GLB D   6     -23.861 -14.147 -22.395  0.00  0.00              
ATOM   3074  C6  GLB D   6     -22.430 -14.049 -22.877  0.00  0.00              
ATOM   3075  O2h GLB D   6     -27.528 -13.438 -20.656  0.00  0.00              
ATOM   3076  OW  GLB D   6     -27.202 -12.844 -23.469  0.00  0.00              
ATOM   3077  OR  GLB D   6     -23.919 -13.499 -21.114  0.00  0.00              
ATOM   3078  O6h GLB D   6     -22.008 -12.702 -23.016  0.00  0.00              
ATOM   3079  H2o GLB D   6     -27.935 -12.685 -20.082  0.00  0.00              
ATOM   3080  H6o GLB D   6     -21.148 -12.211 -22.558  0.00  0.00              
ATOM   3081  O4h GLB D   6     -24.680 -12.074 -23.439  0.00  0.00              
ATOM   3082  H4o GLB D   6     -25.449 -11.652 -24.086  0.00  0.00              
ATOM   3083  H5  GLB D   6     -24.074 -15.176 -22.325  0.00  0.00              
ATOM   3084  H6S GLB D   6     -21.607 -14.523 -22.572  0.00  0.00              
ATOM   3085  H6R GLB D   6     -22.361 -14.504 -23.823  0.00  0.00              
ATOM   3086  H1  GLB D   6     -25.353 -14.788 -20.291  0.00  0.00              
ATOM   3087  H2  GLB D   6     -26.144 -12.033 -21.262  0.00  0.00              
ATOM   3088  H3  GLB D   6     -26.563 -14.669 -22.707  0.00  0.00              
ATOM   3089  H4  GLB D   6     -24.795 -13.954 -24.275  0.00  0.00              
ATOM   3090  C1  GLA D   7     -27.908 -13.521 -24.502  0.00  0.00              
ATOM   3091  C2  GLA D   7     -28.582 -12.617 -25.529  0.00  0.00              
ATOM   3092  C3  GLA D   7     -29.735 -11.831 -24.928  0.00  0.00              
ATOM   3093  C4  GLA D   7     -30.674 -12.752 -24.184  0.00  0.00              
ATOM   3094  C5  GLA D   7     -29.890 -13.582 -23.168  0.00  0.00              
ATOM   3095  C6  GLA D   7     -30.719 -14.565 -22.370  0.00  0.00              
ATOM   3096  O2h GLA D   7     -27.609 -11.722 -26.050  0.00  0.00              
ATOM   3097  OW  GLA D   7     -30.452 -11.185 -25.987  0.00  0.00              
ATOM   3098  OR  GLA D   7     -28.910 -14.344 -23.890  0.00  0.00              
ATOM   3099  O6h GLA D   7     -31.382 -15.500 -23.207  0.00  0.00              
ATOM   3100  H2o GLA D   7     -27.200 -12.006 -27.020  0.00  0.00              
ATOM   3101  H6o GLA D   7     -31.335 -16.588 -23.177  0.00  0.00              
ATOM   3102  O4h GLA D   7     -31.300 -13.548 -25.183  0.00  0.00              
ATOM   3103  H4o GLA D   7     -31.834 -12.903 -25.881  0.00  0.00              
ATOM   3104  H5  GLA D   7     -29.443 -12.939 -22.461  0.00  0.00              
ATOM   3105  H6S GLA D   7     -30.494 -15.097 -21.557  0.00  0.00              
ATOM   3106  H6R GLA D   7     -31.455 -14.033 -21.841  0.00  0.00              
ATOM   3107  H1  GLA D   7     -27.144 -14.124 -24.993  0.00  0.00              
ATOM   3108  H2  GLA D   7     -28.957 -13.258 -26.327  0.00  0.00              
ATOM   3109  H3  GLA D   7     -29.332 -11.088 -24.239  0.00  0.00              
ATOM   3110  H4  GLA D   7     -31.436 -12.220 -23.613  0.00  0.00              
ATOM   3111  C1  NGA D   8     -31.148 -10.033 -25.662  0.00  0.00              
ATOM   3112  C2  NGA D   8     -30.407  -8.843 -26.263  0.00  0.00              
ATOM   3113  C3  NGA D   8     -31.222  -7.563 -26.183  0.00  0.00              
ATOM   3114  C4  NGA D   8     -32.611  -7.787 -26.737  0.00  0.00              
ATOM   3115  C5  NGA D   8     -33.261  -8.982 -26.041  0.00  0.00              
ATOM   3116  C6  NGA D   8     -34.653  -9.323 -26.526  0.00  0.00              
ATOM   3117  OW  NGA D   8     -30.566  -6.551 -26.956  0.00  0.00              
ATOM   3118  OR  NGA D   8     -32.434 -10.132 -26.288  0.00  0.00              
ATOM   3119  O6h NGA D   8     -34.673  -9.621 -27.913  0.00  0.00              
ATOM   3120  H6o NGA D   8     -35.039 -10.521 -28.407  0.00  0.00              
ATOM   3121  O4h NGA D   8     -32.439  -7.985 -28.134  0.00  0.00              
ATOM   3122  H4o NGA D   8     -31.966  -7.106 -28.571  0.00  0.00              
ATOM   3123  H5  NGA D   8     -33.354  -8.780 -25.009  0.00  0.00              
ATOM   3124  H6S NGA D   8     -35.344  -9.934 -26.144  0.00  0.00              
ATOM   3125  H6R NGA D   8     -35.277  -8.492 -26.369  0.00  0.00              
ATOM   3126  H1  NGA D   8     -31.236  -9.901 -24.585  0.00  0.00              
ATOM   3127  H2  NGA D   8     -30.204  -9.081 -27.307  0.00  0.00              
ATOM   3128  H3  NGA D   8     -31.292  -7.255 -25.140  0.00  0.00              
ATOM   3129  H4  NGA D   8     -33.281  -6.942 -26.568  0.00  0.00              
ATOM   3130  N23 NGA D   8     -29.161  -8.673 -25.551  0.00  0.00              
ATOM   3131  C24 NGA D   8     -28.022  -8.327 -26.234  0.00  0.00              
ATOM   3132  C25 NGA D   8     -26.793  -8.192 -25.356  0.00  0.00              
ATOM   3133  OM  NGA D   8     -27.973  -8.144 -27.434  0.00  0.00              
ATOM   3134  H27 NGA D   8     -29.127  -8.812 -24.530  0.00  0.00              
ATOM   3135  H25 NGA D   8     -25.904  -7.901 -25.960  0.00  0.00              
ATOM   3136  H29 NGA D   8     -26.568  -9.161 -24.855  0.00  0.00              
ATOM   3137  H30 NGA D   8     -26.954  -7.409 -24.580  0.00  0.00              
ATOM   3138  C1  AFL D   9     -30.179  -5.361 -26.270  0.00  0.00              
ATOM   3139  C2  AFL D   9     -29.296  -4.416 -27.105  0.00  0.00              
ATOM   3140  C3  AFL D   9     -30.116  -3.756 -28.223  0.00  0.00              
ATOM   3141  C4  AFL D   9     -31.363  -3.092 -27.617  0.00  0.00              
ATOM   3142  C5  AFL D   9     -32.148  -4.122 -26.789  0.00  0.00              
ATOM   3143  C6  AFL D   9     -33.392  -3.541 -26.105  0.00  0.00              
ATOM   3144  OR  AFL D   9     -31.332  -4.689 -25.757  0.00  0.00              
ATOM   3145  O2h AFL D   9     -28.170  -5.159 -27.568  0.00  0.00              
ATOM   3146  O3h AFL D   9     -29.286  -2.849 -28.943  0.00  0.00              
ATOM   3147  O4h AFL D   9     -31.022  -2.001 -26.763  0.00  0.00              
ATOM   3148  H5  AFL D   9     -32.495  -4.920 -27.472  0.00  0.00              
ATOM   3149  H1  AFL D   9     -29.623  -5.703 -25.389  0.00  0.00              
ATOM   3150  H2  AFL D   9     -28.934  -3.616 -26.430  0.00  0.00              
ATOM   3151  H2o AFL D   9     -27.564  -4.519 -27.963  0.00  0.00              
ATOM   3152  H3  AFL D   9     -30.444  -4.552 -28.918  0.00  0.00              
ATOM   3153  H3o AFL D   9     -29.772  -2.610 -29.744  0.00  0.00              
ATOM   3154  H4  AFL D   9     -32.019  -2.712 -28.424  0.00  0.00              
ATOM   3155  H4o AFL D   9     -30.623  -1.326 -27.329  0.00  0.00              
ATOM   3156  H6  AFL D   9     -34.075  -3.065 -26.826  0.00  0.00              
ATOM   3157  H22 AFL D   9     -33.944  -4.342 -25.587  0.00  0.00              
ATOM   3158  H23 AFL D   9     -33.108  -2.791 -25.351  0.00  0.00              
ATOM   3159  C1  NAG D  10     -19.826 -17.424 -11.755  0.00  0.00              
ATOM   3160  C2  NAG D  10     -19.209 -18.264 -10.592  0.00  0.00              
ATOM   3161  C3  NAG D  10     -18.501 -19.527 -11.171  0.00  0.00              
ATOM   3162  C4  NAG D  10     -19.438 -20.332 -12.096  0.00  0.00              
ATOM   3163  C5  NAG D  10     -20.027 -19.423 -13.209  0.00  0.00              
ATOM   3164  C6  NAG D  10     -21.051 -20.156 -14.096  0.00  0.00              
ATOM   3165  C7  NAG D  10     -18.209 -17.439  -8.483  0.00  0.00              
ATOM   3166  C8  NAG D  10     -17.093 -16.631  -7.856  0.00  0.00              
ATOM   3167  O3h NAG D  10     -18.052 -20.410 -10.140  0.00  0.00              
ATOM   3168  OR  NAG D  10     -18.687 -21.408 -12.647  0.00  0.00              
ATOM   3169  OR  NAG D  10     -20.664 -18.253 -12.607  0.00  0.00              
ATOM   3170  O6h NAG D  10     -22.171 -20.620 -13.338  0.00  0.00              
ATOM   3171  OM  NAG D  10     -18.987 -18.068  -7.775  0.00  0.00              
ATOM   3172  N15 NAG D  10     -18.234 -17.451  -9.814  0.00  0.00              
ATOM   3173  H2  NAG D  10     -20.054 -18.603  -9.956  0.00  0.00              
ATOM   3174  H3  NAG D  10     -17.623 -19.206 -11.767  0.00  0.00              
ATOM   3175  H4  NAG D  10     -20.275 -20.739 -11.493  0.00  0.00              
ATOM   3176  H5  NAG D  10     -19.198 -19.084 -13.862  0.00  0.00              
ATOM   3177  H6S NAG D  10     -21.393 -19.480 -14.903  0.00  0.00              
ATOM   3178  H6R NAG D  10     -20.555 -21.009 -14.598  0.00  0.00              
ATOM   3179  H8  NAG D  10     -17.463 -16.115  -6.953  0.00  0.00              
ATOM   3180  H24 NAG D  10     -16.664 -15.866  -8.526  0.00  0.00              
ATOM   3181  H25 NAG D  10     -16.281 -17.308  -7.539  0.00  0.00              
ATOM   3182  H3o NAG D  10     -17.371 -19.935  -9.652  0.00  0.00              
ATOM   3183  H6o NAG D  10     -22.631 -21.271 -13.875  0.00  0.00              
ATOM   3184  H29 NAG D  10     -17.617 -16.759 -10.242  0.00  0.00              
ATOM   3185  H1  NAG D  10     -19.029 -16.955 -12.368  0.00  0.00              
ATOM   3186  C1  GLB D  11     -19.184 -22.685 -12.455  0.00  0.00              
ATOM   3187  C2  GLB D  11     -18.399 -23.640 -13.349  0.00  0.00              
ATOM   3188  C3  GLB D  11     -18.694 -25.096 -13.025  0.00  0.00              
ATOM   3189  C4  GLB D  11     -18.542 -25.349 -11.543  0.00  0.00              
ATOM   3190  C5  GLB D  11     -19.393 -24.352 -10.755  0.00  0.00              
ATOM   3191  C6  GLB D  11     -19.308 -24.487  -9.251  0.00  0.00              
ATOM   3192  O2h GLB D  11     -18.737 -23.372 -14.703  0.00  0.00              
ATOM   3193  OW  GLB D  11     -17.768 -25.921 -13.739  0.00  0.00              
ATOM   3194  OR  GLB D  11     -18.934 -23.031 -11.087  0.00  0.00              
ATOM   3195  O6h GLB D  11     -17.981 -24.324  -8.779  0.00  0.00              
ATOM   3196  H2o GLB D  11     -18.053 -22.793 -15.213  0.00  0.00              
ATOM   3197  H6o GLB D  11     -17.608 -23.620  -8.033  0.00  0.00              
ATOM   3198  O4h GLB D  11     -17.152 -25.222 -11.273  0.00  0.00              
ATOM   3199  H4o GLB D  11     -16.598 -25.950 -11.866  0.00  0.00              
ATOM   3200  H5  GLB D  11     -20.410 -24.487 -11.003  0.00  0.00              
ATOM   3201  H6S GLB D  11     -19.866 -24.086  -8.529  0.00  0.00              
ATOM   3202  H6R GLB D  11     -19.626 -25.453  -8.982  0.00  0.00              
ATOM   3203  H1  GLB D  11     -20.245 -22.747 -12.697  0.00  0.00              
ATOM   3204  H2  GLB D  11     -17.340 -23.440 -13.188  0.00  0.00              
ATOM   3205  H3  GLB D  11     -19.715 -25.323 -13.330  0.00  0.00              
ATOM   3206  H4  GLB D  11     -18.883 -26.338 -11.238  0.00  0.00              
ATOM   3207  C1  GLA D  12     -18.249 -27.174 -14.211  0.00  0.00              
ATOM   3208  C2  GLA D  12     -17.172 -28.176 -14.617  0.00  0.00              
ATOM   3209  C3  GLA D  12     -16.417 -27.728 -15.857  0.00  0.00              
ATOM   3210  C4  GLA D  12     -17.381 -27.357 -16.960  0.00  0.00              
ATOM   3211  C5  GLA D  12     -18.389 -26.331 -16.443  0.00  0.00              
ATOM   3212  C6  GLA D  12     -19.429 -25.895 -17.451  0.00  0.00              
ATOM   3213  O2h GLA D  12     -16.266 -28.328 -13.531  0.00  0.00              
ATOM   3214  OW  GLA D  12     -15.586 -28.808 -16.302  0.00  0.00              
ATOM   3215  OR  GLA D  12     -19.094 -26.929 -15.342  0.00  0.00              
ATOM   3216  O6h GLA D  12     -20.196 -26.989 -17.930  0.00  0.00              
ATOM   3217  H2o GLA D  12     -16.431 -29.216 -12.921  0.00  0.00              
ATOM   3218  H6o GLA D  12     -21.278 -27.114 -17.916  0.00  0.00              
ATOM   3219  O4h GLA D  12     -17.991 -28.578 -17.362  0.00  0.00              
ATOM   3220  H4o GLA D  12     -17.224 -29.270 -17.711  0.00  0.00              
ATOM   3221  H5  GLA D  12     -17.880 -25.455 -16.152  0.00  0.00              
ATOM   3222  H6S GLA D  12     -20.083 -25.141 -17.428  0.00  0.00              
ATOM   3223  H6R GLA D  12     -18.938 -25.465 -18.276  0.00  0.00              
ATOM   3224  H1  GLA D  12     -18.818 -27.572 -13.371  0.00  0.00              
ATOM   3225  H2  GLA D  12     -17.670 -29.123 -14.816  0.00  0.00              
ATOM   3226  H3  GLA D  12     -15.804 -26.864 -15.602  0.00  0.00              
ATOM   3227  H4  GLA D  12     -16.894 -26.893 -17.818  0.00  0.00              
ATOM   3228  C1  NGA D  13     -14.457 -28.474 -17.028  0.00  0.00              
ATOM   3229  C2  NGA D  13     -13.236 -28.709 -16.144  0.00  0.00              
ATOM   3230  C3  NGA D  13     -11.938 -28.618 -16.927  0.00  0.00              
ATOM   3231  C4  NGA D  13     -12.001 -29.488 -18.161  0.00  0.00              
ATOM   3232  C5  NGA D  13     -13.246 -29.142 -18.977  0.00  0.00              
ATOM   3233  C6  NGA D  13     -13.436 -29.966 -20.232  0.00  0.00              
ATOM   3234  OW  NGA D  13     -10.864 -29.065 -16.092  0.00  0.00              
ATOM   3235  OR  NGA D  13     -14.392 -29.373 -18.142  0.00  0.00              
ATOM   3236  O6h NGA D  13     -13.532 -31.352 -19.946  0.00  0.00              
ATOM   3237  H6o NGA D  13     -14.330 -32.046 -20.211  0.00  0.00              
ATOM   3238  O4h NGA D  13     -12.008 -30.828 -17.684  0.00  0.00              
ATOM   3239  H4o NGA D  13     -11.102 -31.012 -17.105  0.00  0.00              
ATOM   3240  H5  NGA D  13     -13.189 -28.138 -19.295  0.00  0.00              
ATOM   3241  H6S NGA D  13     -14.056 -29.842 -21.005  0.00  0.00              
ATOM   3242  H6R NGA D  13     -12.603 -29.826 -20.857  0.00  0.00              
ATOM   3243  H1  NGA D  13     -14.475 -27.434 -17.353  0.00  0.00              
ATOM   3244  H2  NGA D  13     -13.333 -29.708 -15.716  0.00  0.00              
ATOM   3245  H3  NGA D  13     -11.778 -27.580 -17.223  0.00  0.00              
ATOM   3246  H4  NGA D  13     -11.154 -29.346 -18.832  0.00  0.00              
ATOM   3247  N23 NGA D  13     -13.239 -27.725 -15.086  0.00  0.00              
ATOM   3248  C24 NGA D  13     -12.863 -28.080 -13.817  0.00  0.00              
ATOM   3249  C25 NGA D  13     -12.923 -26.944 -12.813  0.00  0.00              
ATOM   3250  OM  NGA D  13     -12.514 -29.199 -13.494  0.00  0.00              
ATOM   3251  H27 NGA D  13     -13.523 -26.755 -15.286  0.00  0.00              
ATOM   3252  H25 NGA D  13     -12.599 -27.288 -11.804  0.00  0.00              
ATOM   3253  H29 NGA D  13     -13.965 -26.560 -12.729  0.00  0.00              
ATOM   3254  H30 NGA D  13     -12.251 -26.113 -13.127  0.00  0.00              
ATOM   3255  C1  AFL D  14      -9.807 -28.139 -15.843  0.00  0.00              
ATOM   3256  C2  AFL D  14      -8.803 -28.606 -14.772  0.00  0.00              
ATOM   3257  C3  AFL D  14      -7.945 -29.763 -15.306  0.00  0.00              
ATOM   3258  C4  AFL D  14      -7.306 -29.352 -16.642  0.00  0.00              
ATOM   3259  C5  AFL D  14      -8.399 -28.882 -17.616  0.00  0.00              
ATOM   3260  C6  AFL D  14      -7.854 -28.407 -18.968  0.00  0.00              
ATOM   3261  OR  AFL D  14      -9.151 -27.794 -17.066  0.00  0.00              
ATOM   3262  O2h AFL D  14      -9.534 -28.919 -13.590  0.00  0.00              
ATOM   3263  O3h AFL D  14      -6.992 -30.138 -14.316  0.00  0.00              
ATOM   3264  O4h AFL D  14      -6.369 -28.289 -16.478  0.00  0.00              
ATOM   3265  H5  AFL D  14      -9.071 -29.738 -17.818  0.00  0.00              
ATOM   3266  H1  AFL D  14     -10.301 -27.219 -15.507  0.00  0.00              
ATOM   3267  H2  AFL D  14      -8.129 -27.755 -14.555  0.00  0.00              
ATOM   3268  H2o AFL D  14      -8.878 -29.068 -12.897  0.00  0.00              
ATOM   3269  H3  AFL D  14      -8.615 -30.626 -15.487  0.00  0.00              
ATOM   3270  H3o AFL D  14      -6.615 -30.980 -14.604  0.00  0.00              
ATOM   3271  H4  AFL D  14      -6.779 -30.216 -17.090  0.00  0.00              
ATOM   3272  H4o AFL D  14      -5.643 -28.644 -15.946  0.00  0.00              
ATOM   3273  H6  AFL D  14      -7.242 -29.180 -19.461  0.00  0.00              
ATOM   3274  H22 AFL D  14      -8.687 -28.150 -19.642  0.00  0.00              
ATOM   3275  H23 AFL D  14      -7.235 -27.504 -18.846  0.00  0.00              
ATOM   3276  C1  MAN D  15     -24.672  -5.411 -10.354  0.00  0.00              
ATOM   3277  C2  MAN D  15     -26.097  -5.344 -10.898  0.00  0.00              
ATOM   3278  C3  MAN D  15     -26.122  -5.135 -12.403  0.00  0.00              
ATOM   3279  C4  MAN D  15     -25.243  -3.968 -12.791  0.00  0.00              
ATOM   3280  C5  MAN D  15     -23.841  -4.162 -12.215  0.00  0.00              
ATOM   3281  C6  MAN D  15     -22.868  -3.043 -12.516  0.00  0.00              
ATOM   3282  O3h MAN D  15     -27.471  -4.861 -12.805  0.00  0.00              
ATOM   3283  OR  MAN D  15     -25.133  -3.860 -14.202  0.00  0.00              
ATOM   3284  OR  MAN D  15     -23.965  -4.240 -10.785  0.00  0.00              
ATOM   3285  OW  MAN D  15     -21.707  -3.515 -13.183  0.00  0.00              
ATOM   3286  H3o MAN D  15     -27.752  -5.760 -13.351  0.00  0.00              
ATOM   3287  OW  MAN D  15     -26.779  -4.274 -10.257  0.00  0.00              
ATOM   3288  H5  MAN D  15     -23.413  -5.036 -12.621  0.00  0.00              
ATOM   3289  H6  MAN D  15     -23.016  -2.140 -12.914  0.00  0.00              
ATOM   3290  H20 MAN D  15     -22.560  -2.611 -11.608  0.00  0.00              
ATOM   3291  H1  MAN D  15     -24.700  -5.478  -9.267  0.00  0.00              
ATOM   3292  H2  MAN D  15     -26.580  -6.290 -10.653  0.00  0.00              
ATOM   3293  H3  MAN D  15     -25.762  -6.040 -12.891  0.00  0.00              
ATOM   3294  H4  MAN D  15     -25.700  -3.062 -12.392  0.00  0.00              
ATOM   3295  C1  NAG D  16     -27.399  -4.560  -9.012  0.00  0.00              
ATOM   3296  C2  NAG D  16     -27.249  -3.353  -8.031  0.00  0.00              
ATOM   3297  C3  NAG D  16     -28.156  -3.576  -6.780  0.00  0.00              
ATOM   3298  C4  NAG D  16     -29.614  -3.880  -7.182  0.00  0.00              
ATOM   3299  C5  NAG D  16     -29.674  -5.073  -8.174  0.00  0.00              
ATOM   3300  C6  NAG D  16     -31.101  -5.349  -8.685  0.00  0.00              
ATOM   3301  C7  NAG D  16     -25.224  -2.010  -7.567  0.00  0.00              
ATOM   3302  C8  NAG D  16     -23.811  -2.017  -7.019  0.00  0.00              
ATOM   3303  O3h NAG D  16     -28.174  -2.432  -5.923  0.00  0.00              
ATOM   3304  OR  NAG D  16     -30.344  -4.157  -5.991  0.00  0.00              
ATOM   3305  OR  NAG D  16     -28.798  -4.812  -9.315  0.00  0.00              
ATOM   3306  O6h NAG D  16     -31.637  -4.228  -9.391  0.00  0.00              
ATOM   3307  OM  NAG D  16     -25.750  -0.954  -7.895  0.00  0.00              
ATOM   3308  N15 NAG D  16     -25.831  -3.193  -7.604  0.00  0.00              
ATOM   3309  H2  NAG D  16     -27.616  -2.454  -8.568  0.00  0.00              
ATOM   3310  H3  NAG D  16     -27.769  -4.441  -6.205  0.00  0.00              
ATOM   3311  H4  NAG D  16     -30.045  -2.987  -7.677  0.00  0.00              
ATOM   3312  H5  NAG D  16     -29.323  -5.985  -7.651  0.00  0.00              
ATOM   3313  H6S NAG D  16     -31.094  -6.240  -9.341  0.00  0.00              
ATOM   3314  H6R NAG D  16     -31.754  -5.603  -7.827  0.00  0.00              
ATOM   3315  H8  NAG D  16     -23.184  -1.309  -7.589  0.00  0.00              
ATOM   3316  H24 NAG D  16     -23.321  -3.006  -7.060  0.00  0.00              
ATOM   3317  H25 NAG D  16     -23.822  -1.678  -5.969  0.00  0.00              
ATOM   3318  H3o NAG D  16     -27.281  -2.336  -5.578  0.00  0.00              
ATOM   3319  H6o NAG D  16     -32.587  -4.356  -9.457  0.00  0.00              
ATOM   3320  H29 NAG D  16     -25.205  -3.982  -7.441  0.00  0.00              
ATOM   3321  H1  NAG D  16     -26.943  -5.475  -8.583  0.00  0.00              
ATOM   3322  C1  GLB D  17     -31.471  -3.391  -5.752  0.00  0.00              
ATOM   3323  C2  GLB D  17     -32.245  -4.028  -4.602  0.00  0.00              
ATOM   3324  C3  GLB D  17     -33.358  -3.127  -4.095  0.00  0.00              
ATOM   3325  C4  GLB D  17     -32.828  -1.741  -3.809  0.00  0.00              
ATOM   3326  C5  GLB D  17     -32.101  -1.199  -5.041  0.00  0.00              
ATOM   3327  C6  GLB D  17     -31.502   0.180  -4.873  0.00  0.00              
ATOM   3328  O2h GLB D  17     -32.791  -5.261  -5.053  0.00  0.00              
ATOM   3329  OW  GLB D  17     -33.887  -3.685  -2.886  0.00  0.00              
ATOM   3330  OR  GLB D  17     -31.019  -2.097  -5.337  0.00  0.00              
ATOM   3331  O6h GLB D  17     -30.559   0.223  -3.813  0.00  0.00              
ATOM   3332  H2o GLB D  17     -32.256  -6.098  -4.775  0.00  0.00              
ATOM   3333  H6o GLB D  17     -29.516   0.539  -3.847  0.00  0.00              
ATOM   3334  O4h GLB D  17     -31.975  -1.882  -2.681  0.00  0.00              
ATOM   3335  H4o GLB D  17     -32.546  -2.278  -1.841  0.00  0.00              
ATOM   3336  H5  GLB D  17     -32.780  -1.125  -5.844  0.00  0.00              
ATOM   3337  H6S GLB D  17     -31.127   0.813  -5.546  0.00  0.00              
ATOM   3338  H6R GLB D  17     -32.273   0.856  -4.641  0.00  0.00              
ATOM   3339  H1  GLB D  17     -32.113  -3.329  -6.631  0.00  0.00              
ATOM   3340  H2  GLB D  17     -31.533  -4.215  -3.797  0.00  0.00              
ATOM   3341  H3  GLB D  17     -34.137  -3.069  -4.855  0.00  0.00              
ATOM   3342  H4  GLB D  17     -33.613  -1.019  -3.584  0.00  0.00              
ATOM   3343  C1  GLA D  18     -35.282  -3.527  -2.659  0.00  0.00              
ATOM   3344  C2  GLA D  18     -35.741  -3.780  -1.226  0.00  0.00              
ATOM   3345  C3  GLA D  18     -35.598  -5.241  -0.832  0.00  0.00              
ATOM   3346  C4  GLA D  18     -36.242  -6.134  -1.867  0.00  0.00              
ATOM   3347  C5  GLA D  18     -35.683  -5.807  -3.252  0.00  0.00              
ATOM   3348  C6  GLA D  18     -36.268  -6.623  -4.385  0.00  0.00              
ATOM   3349  O2h GLA D  18     -34.964  -2.969  -0.353  0.00  0.00              
ATOM   3350  OW  GLA D  18     -36.248  -5.441   0.430  0.00  0.00              
ATOM   3351  OR  GLA D  18     -35.980  -4.429  -3.528  0.00  0.00              
ATOM   3352  O6h GLA D  18     -37.674  -6.461  -4.482  0.00  0.00              
ATOM   3353  H2o GLA D  18     -35.455  -2.053  -0.026  0.00  0.00              
ATOM   3354  H6o GLA D  18     -38.261  -6.139  -5.344  0.00  0.00              
ATOM   3355  O4h GLA D  18     -37.639  -5.895  -1.763  0.00  0.00              
ATOM   3356  H4o GLA D  18     -37.976  -6.138  -0.755  0.00  0.00              
ATOM   3357  H5  GLA D  18     -34.645  -5.995  -3.265  0.00  0.00              
ATOM   3358  H6S GLA D  18     -35.977  -6.723  -5.334  0.00  0.00              
ATOM   3359  H6R GLA D  18     -36.077  -7.640  -4.201  0.00  0.00              
ATOM   3360  H1  GLA D  18     -35.477  -2.489  -2.925  0.00  0.00              
ATOM   3361  H2  GLA D  18     -36.788  -3.488  -1.165  0.00  0.00              
ATOM   3362  H3  GLA D  18     -34.538  -5.482  -0.751  0.00  0.00              
ATOM   3363  H4  GLA D  18     -36.041  -7.193  -1.705  0.00  0.00              
ATOM   3364  C1  NGA D  19     -35.794  -6.488   1.211  0.00  0.00              
ATOM   3365  C2  NGA D  19     -35.025  -5.903   2.393  0.00  0.00              
ATOM   3366  C3  NGA D  19     -34.707  -6.954   3.443  0.00  0.00              
ATOM   3367  C4  NGA D  19     -35.954  -7.722   3.819  0.00  0.00              
ATOM   3368  C5  NGA D  19     -36.617  -8.282   2.560  0.00  0.00              
ATOM   3369  C6  NGA D  19     -37.894  -9.055   2.803  0.00  0.00              
ATOM   3370  OW  NGA D  19     -34.191  -6.298   4.606  0.00  0.00              
ATOM   3371  OR  NGA D  19     -36.951  -7.170   1.713  0.00  0.00              
ATOM   3372  O6h NGA D  19     -38.881  -8.261   3.443  0.00  0.00              
ATOM   3373  H6o NGA D  19     -39.898  -8.050   3.115  0.00  0.00              
ATOM   3374  O4h NGA D  19     -36.778  -6.796   4.514  0.00  0.00              
ATOM   3375  H4o NGA D  19     -36.250  -6.427   5.393  0.00  0.00              
ATOM   3376  H5  NGA D  19     -35.957  -8.952   2.085  0.00  0.00              
ATOM   3377  H6S NGA D  19     -38.425  -9.643   2.196  0.00  0.00              
ATOM   3378  H6R NGA D  19     -37.681  -9.869   3.433  0.00  0.00              
ATOM   3379  H1  NGA D  19     -35.144  -7.161   0.652  0.00  0.00              
ATOM   3380  H2  NGA D  19     -35.650  -5.126   2.833  0.00  0.00              
ATOM   3381  H3  NGA D  19     -33.964  -7.642   3.038  0.00  0.00              
ATOM   3382  H4  NGA D  19     -35.752  -8.581   4.458  0.00  0.00              
ATOM   3383  N23 NGA D  19     -33.799  -5.319   1.898  0.00  0.00              
ATOM   3384  C24 NGA D  19     -33.341  -4.140   2.425  0.00  0.00              
ATOM   3385  C25 NGA D  19     -32.049  -3.646   1.802  0.00  0.00              
ATOM   3386  OM  NGA D  19     -33.901  -3.520   3.308  0.00  0.00              
ATOM   3387  H27 NGA D  19     -33.271  -5.789   1.149  0.00  0.00              
ATOM   3388  H25 NGA D  19     -31.718  -2.692   2.274  0.00  0.00              
ATOM   3389  H29 NGA D  19     -32.191  -3.461   0.713  0.00  0.00              
ATOM   3390  H30 NGA D  19     -31.238  -4.398   1.942  0.00  0.00              
ATOM   3391  C1  AFL D  20     -32.883  -6.674   5.036  0.00  0.00              
ATOM   3392  C2  AFL D  20     -32.310  -5.783   6.155  0.00  0.00              
ATOM   3393  C3  AFL D  20     -33.045  -6.039   7.478  0.00  0.00              
ATOM   3394  C4  AFL D  20     -33.026  -7.545   7.790  0.00  0.00              
ATOM   3395  C5  AFL D  20     -33.595  -8.328   6.596  0.00  0.00              
ATOM   3396  C6  AFL D  20     -33.577  -9.849   6.794  0.00  0.00              
ATOM   3397  OR  AFL D  20     -32.857  -8.057   5.398  0.00  0.00              
ATOM   3398  O2h AFL D  20     -32.362  -4.430   5.710  0.00  0.00              
ATOM   3399  O3h AFL D  20     -32.460  -5.243   8.504  0.00  0.00              
ATOM   3400  O4h AFL D  20     -31.704  -8.018   8.044  0.00  0.00              
ATOM   3401  H5  AFL D  20     -34.652  -8.030   6.460  0.00  0.00              
ATOM   3402  H1  AFL D  20     -32.252  -6.594   4.143  0.00  0.00              
ATOM   3403  H2  AFL D  20     -31.249  -6.066   6.294  0.00  0.00              
ATOM   3404  H2o AFL D  20     -31.871  -3.911   6.361  0.00  0.00              
ATOM   3405  H3  AFL D  20     -34.097  -5.720   7.349  0.00  0.00              
ATOM   3406  H3o AFL D  20     -33.063  -5.279   9.257  0.00  0.00              
ATOM   3407  H4  AFL D  20     -33.649  -7.754   8.681  0.00  0.00              
ATOM   3408  H4o AFL D  20     -31.411  -7.585   8.858  0.00  0.00              
ATOM   3409  H6  AFL D  20     -34.110 -10.152   7.708  0.00  0.00              
ATOM   3410  H22 AFL D  20     -34.059 -10.346   5.936  0.00  0.00              
ATOM   3411  H23 AFL D  20     -32.543 -10.223   6.859  0.00  0.00              
ATOM   3412  C1  NAG D  21     -25.529  -2.628 -14.787  0.00  0.00              
ATOM   3413  C2  NAG D  21     -24.987  -2.511 -16.248  0.00  0.00              
ATOM   3414  C3  NAG D  21     -25.647  -1.289 -16.958  0.00  0.00              
ATOM   3415  C4  NAG D  21     -27.187  -1.338 -16.862  0.00  0.00              
ATOM   3416  C5  NAG D  21     -27.642  -1.478 -15.384  0.00  0.00              
ATOM   3417  C6  NAG D  21     -29.168  -1.635 -15.244  0.00  0.00              
ATOM   3418  C7  NAG D  21     -22.716  -3.038 -17.077  0.00  0.00              
ATOM   3419  C8  NAG D  21     -21.245  -2.690 -17.010  0.00  0.00              
ATOM   3420  O3h NAG D  21     -25.304  -1.225 -18.344  0.00  0.00              
ATOM   3421  OR  NAG D  21     -27.697  -0.147 -17.452  0.00  0.00              
ATOM   3422  OR  NAG D  21     -26.983  -2.629 -14.770  0.00  0.00              
ATOM   3423  O6h NAG D  21     -29.643  -2.808 -15.910  0.00  0.00              
ATOM   3424  OM  NAG D  21     -23.117  -3.864 -17.889  0.00  0.00              
ATOM   3425  N15 NAG D  21     -23.506  -2.357 -16.251  0.00  0.00              
ATOM   3426  H2  NAG D  21     -25.302  -3.432 -16.783  0.00  0.00              
ATOM   3427  H3  NAG D  21     -25.302  -0.357 -16.466  0.00  0.00              
ATOM   3428  H4  NAG D  21     -27.556  -2.216 -17.430  0.00  0.00              
ATOM   3429  H5  NAG D  21     -27.348  -0.561 -14.836  0.00  0.00              
ATOM   3430  H6S NAG D  21     -29.440  -1.675 -14.173  0.00  0.00              
ATOM   3431  H6R NAG D  21     -29.668  -0.739 -15.657  0.00  0.00              
ATOM   3432  H8  NAG D  21     -20.636  -3.603 -17.124  0.00  0.00              
ATOM   3433  H24 NAG D  21     -20.942  -2.203 -16.066  0.00  0.00              
ATOM   3434  H25 NAG D  21     -20.987  -2.016 -17.845  0.00  0.00              
ATOM   3435  H3o NAG D  21     -24.357  -1.063 -18.384  0.00  0.00              
ATOM   3436  H6o NAG D  21     -30.594  -2.719 -16.009  0.00  0.00              
ATOM   3437  H29 NAG D  21     -22.999  -1.825 -15.543  0.00  0.00              
ATOM   3438  H1  NAG D  21     -25.153  -1.794 -14.161  0.00  0.00              
ATOM   3439  C1  GLB D  22     -28.612  -0.297 -18.479  0.00  0.00              
ATOM   3440  C2  GLB D  22     -29.232   1.067 -18.768  0.00  0.00              
ATOM   3441  C3  GLB D  22     -30.056   1.059 -20.044  0.00  0.00              
ATOM   3442  C4  GLB D  22     -29.258   0.473 -21.187  0.00  0.00              
ATOM   3443  C5  GLB D  22     -28.715  -0.899 -20.789  0.00  0.00              
ATOM   3444  C6  GLB D  22     -27.875  -1.582 -21.846  0.00  0.00              
ATOM   3445  O2h GLB D  22     -30.054   1.431 -17.667  0.00  0.00              
ATOM   3446  OW  GLB D  22     -30.417   2.408 -20.366  0.00  0.00              
ATOM   3447  OR  GLB D  22     -27.877  -0.719 -19.636  0.00  0.00              
ATOM   3448  O6h GLB D  22     -26.744  -0.806 -22.209  0.00  0.00              
ATOM   3449  H2o GLB D  22     -29.621   2.090 -17.003  0.00  0.00              
ATOM   3450  H6o GLB D  22     -25.692  -1.090 -22.187  0.00  0.00              
ATOM   3451  O4h GLB D  22     -28.230   1.418 -21.459  0.00  0.00              
ATOM   3452  H4o GLB D  22     -28.678   2.376 -21.727  0.00  0.00              
ATOM   3453  H5  GLB D  22     -29.520  -1.551 -20.592  0.00  0.00              
ATOM   3454  H6S GLB D  22     -27.544  -2.522 -21.908  0.00  0.00              
ATOM   3455  H6R GLB D  22     -28.460  -1.714 -22.709  0.00  0.00              
ATOM   3456  H1  GLB D  22     -29.398  -1.007 -18.223  0.00  0.00              
ATOM   3457  H2  GLB D  22     -28.414   1.780 -18.868  0.00  0.00              
ATOM   3458  H3  GLB D  22     -30.952   0.459 -19.881  0.00  0.00              
ATOM   3459  H4  GLB D  22     -29.852   0.312 -22.087  0.00  0.00              
ATOM   3460  C1  GLA D  23     -31.691   2.612 -20.963  0.00  0.00              
ATOM   3461  C2  GLA D  23     -31.887   3.967 -21.634  0.00  0.00              
ATOM   3462  C3  GLA D  23     -31.911   5.104 -20.626  0.00  0.00              
ATOM   3463  C4  GLA D  23     -32.889   4.803 -19.512  0.00  0.00              
ATOM   3464  C5  GLA D  23     -32.575   3.438 -18.902  0.00  0.00              
ATOM   3465  C6  GLA D  23     -33.502   3.009 -17.786  0.00  0.00              
ATOM   3466  O2h GLA D  23     -30.828   4.169 -22.560  0.00  0.00              
ATOM   3467  OW  GLA D  23     -32.319   6.303 -21.296  0.00  0.00              
ATOM   3468  OR  GLA D  23     -32.690   2.457 -19.946  0.00  0.00              
ATOM   3469  O6h GLA D  23     -34.853   2.942 -18.215  0.00  0.00              
ATOM   3470  H2o GLA D  23     -31.085   3.961 -23.600  0.00  0.00              
ATOM   3471  H6o GLA D  23     -35.539   2.097 -18.163  0.00  0.00              
ATOM   3472  O4h GLA D  23     -34.179   4.859 -20.110  0.00  0.00              
ATOM   3473  H4o GLA D  23     -34.341   5.850 -20.532  0.00  0.00              
ATOM   3474  H5  GLA D  23     -31.606   3.454 -18.485  0.00  0.00              
ATOM   3475  H6S GLA D  23     -33.427   2.262 -17.128  0.00  0.00              
ATOM   3476  H6R GLA D  23     -33.448   3.718 -17.012  0.00  0.00              
ATOM   3477  H1  GLA D  23     -31.762   1.822 -21.711  0.00  0.00              
ATOM   3478  H2  GLA D  23     -32.838   3.931 -22.165  0.00  0.00              
ATOM   3479  H3  GLA D  23     -30.912   5.226 -20.209  0.00  0.00              
ATOM   3480  H4  GLA D  23     -32.837   5.518 -18.690  0.00  0.00              
ATOM   3481  C1  NGA D  24     -31.896   7.502 -20.750  0.00  0.00              
ATOM   3482  C2  NGA D  24     -30.819   8.087 -21.660  0.00  0.00              
ATOM   3483  C3  NGA D  24     -30.474   9.519 -21.288  0.00  0.00              
ATOM   3484  C4  NGA D  24     -31.729  10.354 -21.177  0.00  0.00              
ATOM   3485  C5  NGA D  24     -32.716   9.684 -20.220  0.00  0.00              
ATOM   3486  C6  NGA D  24     -34.028  10.415 -20.041  0.00  0.00              
ATOM   3487  OW  NGA D  24     -29.633  10.069 -22.308  0.00  0.00              
ATOM   3488  OR  NGA D  24     -33.025   8.385 -20.753  0.00  0.00              
ATOM   3489  O6h NGA D  24     -34.720  10.570 -21.270  0.00  0.00              
ATOM   3490  H6o NGA D  24     -35.734  10.257 -21.520  0.00  0.00              
ATOM   3491  O4h NGA D  24     -32.232  10.467 -22.501  0.00  0.00              
ATOM   3492  H4o NGA D  24     -31.484  10.943 -23.136  0.00  0.00              
ATOM   3493  H5  NGA D  24     -32.284   9.621 -19.259  0.00  0.00              
ATOM   3494  H6S NGA D  24     -34.759  10.287 -19.374  0.00  0.00              
ATOM   3495  H6R NGA D  24     -33.829  11.376 -19.664  0.00  0.00              
ATOM   3496  H1  NGA D  24     -31.492   7.371 -19.746  0.00  0.00              
ATOM   3497  H2  NGA D  24     -31.206   8.059 -22.678  0.00  0.00              
ATOM   3498  H3  NGA D  24     -29.953   9.517 -20.331  0.00  0.00              
ATOM   3499  H4  NGA D  24     -31.547  11.349 -20.771  0.00  0.00              
ATOM   3500  N23 NGA D  24     -29.640   7.259 -21.564  0.00  0.00              
ATOM   3501  C24 NGA D  24     -28.896   6.994 -22.685  0.00  0.00              
ATOM   3502  C25 NGA D  24     -27.691   6.106 -22.432  0.00  0.00              
ATOM   3503  OM  NGA D  24     -29.156   7.414 -23.796  0.00  0.00              
ATOM   3504  H27 NGA D  24     -29.357   6.868 -20.654  0.00  0.00              
ATOM   3505  H25 NGA D  24     -27.120   5.932 -23.372  0.00  0.00              
ATOM   3506  H29 NGA D  24     -28.018   5.116 -22.038  0.00  0.00              
ATOM   3507  H30 NGA D  24     -27.006   6.584 -21.695  0.00  0.00              
ATOM   3508  C1  AFL D  25     -28.346  10.534 -21.907  0.00  0.00              
ATOM   3509  C2  AFL D  25     -27.421  10.911 -23.078  0.00  0.00              
ATOM   3510  C3  AFL D  25     -27.907  12.199 -23.759  0.00  0.00              
ATOM   3511  C4  AFL D  25     -28.075  13.303 -22.700  0.00  0.00              
ATOM   3512  C5  AFL D  25     -28.994  12.803 -21.573  0.00  0.00              
ATOM   3513  C6  AFL D  25     -29.187  13.822 -20.443  0.00  0.00              
ATOM   3514  OR  AFL D  25     -28.477  11.610 -20.972  0.00  0.00              
ATOM   3515  O2h AFL D  25     -27.337   9.787 -23.952  0.00  0.00              
ATOM   3516  O3h AFL D  25     -27.003  12.552 -24.802  0.00  0.00              
ATOM   3517  O4h AFL D  25     -26.825  13.679 -22.123  0.00  0.00              
ATOM   3518  H5  AFL D  25     -29.992  12.604 -22.006  0.00  0.00              
ATOM   3519  H1  AFL D  25     -27.903   9.707 -21.339  0.00  0.00              
ATOM   3520  H2  AFL D  25     -26.414  11.105 -22.660  0.00  0.00              
ATOM   3521  H2o AFL D  25     -26.646   9.993 -24.595  0.00  0.00              
ATOM   3522  H3  AFL D  25     -28.896  11.993 -24.210  0.00  0.00              
ATOM   3523  H3o AFL D  25     -27.441  13.237 -25.323  0.00  0.00              
ATOM   3524  H4  AFL D  25     -28.531  14.200 -23.159  0.00  0.00              
ATOM   3525  H4o AFL D  25     -26.307  14.083 -22.833  0.00  0.00              
ATOM   3526  H6  AFL D  25     -29.568  14.786 -20.817  0.00  0.00              
ATOM   3527  H22 AFL D  25     -29.907  13.433 -19.705  0.00  0.00              
ATOM   3528  H23 AFL D  25     -28.237  14.008 -19.916  0.00  0.00              
ATOM   3529  C1  NAG D  26     -20.555  -2.688 -13.134  0.00  0.00              
ATOM   3530  C2  NAG D  26     -19.290  -3.473 -13.608  0.00  0.00              
ATOM   3531  C3  NAG D  26     -18.099  -2.485 -13.802  0.00  0.00              
ATOM   3532  C4  NAG D  26     -18.482  -1.302 -14.716  0.00  0.00              
ATOM   3533  C5  NAG D  26     -19.759  -0.591 -14.189  0.00  0.00              
ATOM   3534  C6  NAG D  26     -20.241   0.532 -15.127  0.00  0.00              
ATOM   3535  C7  NAG D  26     -18.595  -5.763 -12.979  0.00  0.00              
ATOM   3536  C8  NAG D  26     -18.155  -6.676 -11.855  0.00  0.00              
ATOM   3537  O3h NAG D  26     -16.961  -3.126 -14.382  0.00  0.00              
ATOM   3538  OR  NAG D  26     -17.372  -0.412 -14.762  0.00  0.00              
ATOM   3539  OR  NAG D  26     -20.832  -1.567 -14.017  0.00  0.00              
ATOM   3540  O6h NAG D  26     -20.580   0.033 -16.423  0.00  0.00              
ATOM   3541  OM  NAG D  26     -18.590  -6.167 -14.137  0.00  0.00              
ATOM   3542  N15 NAG D  26     -18.920  -4.524 -12.620  0.00  0.00              
ATOM   3543  H2  NAG D  26     -19.537  -3.914 -14.597  0.00  0.00              
ATOM   3544  H3  NAG D  26     -17.807  -2.077 -12.814  0.00  0.00              
ATOM   3545  H4  NAG D  26     -18.687  -1.687 -15.736  0.00  0.00              
ATOM   3546  H5  NAG D  26     -19.528  -0.133 -13.208  0.00  0.00              
ATOM   3547  H6S NAG D  26     -21.116   1.039 -14.677  0.00  0.00              
ATOM   3548  H6R NAG D  26     -19.449   1.302 -15.214  0.00  0.00              
ATOM   3549  H8  NAG D  26     -18.543  -7.696 -12.023  0.00  0.00              
ATOM   3550  H24 NAG D  26     -18.493  -6.350 -10.855  0.00  0.00              
ATOM   3551  H25 NAG D  26     -17.053  -6.740 -11.842  0.00  0.00              
ATOM   3552  H3o NAG D  26     -16.655  -3.773 -13.738  0.00  0.00              
ATOM   3553  H6o NAG D  26     -20.622   0.784 -17.019  0.00  0.00              
ATOM   3554  H29 NAG D  26     -19.017  -4.400 -11.611  0.00  0.00              
ATOM   3555  H1  NAG D  26     -20.421  -2.316 -12.098  0.00  0.00              
ATOM   3556  C1  GLB D  27     -16.867  -0.102 -16.013  0.00  0.00              
ATOM   3557  C2  GLB D  27     -15.892   1.061 -15.858  0.00  0.00              
ATOM   3558  C3  GLB D  27     -15.094   1.309 -17.127  0.00  0.00              
ATOM   3559  C4  GLB D  27     -14.470   0.023 -17.619  0.00  0.00              
ATOM   3560  C5  GLB D  27     -15.546  -1.054 -17.761  0.00  0.00              
ATOM   3561  C6  GLB D  27     -15.041  -2.402 -18.228  0.00  0.00              
ATOM   3562  O2h GLB D  27     -16.632   2.228 -15.519  0.00  0.00              
ATOM   3563  OW  GLB D  27     -14.056   2.254 -16.839  0.00  0.00              
ATOM   3564  OR  GLB D  27     -16.140  -1.250 -16.468  0.00  0.00              
ATOM   3565  O6h GLB D  27     -14.067  -2.938 -17.345  0.00  0.00              
ATOM   3566  H2o GLB D  27     -16.626   2.467 -14.516  0.00  0.00              
ATOM   3567  H6o GLB D  27     -14.074  -3.901 -16.834  0.00  0.00              
ATOM   3568  O4h GLB D  27     -13.475  -0.312 -16.659  0.00  0.00              
ATOM   3569  H4o GLB D  27     -12.745   0.495 -16.596  0.00  0.00              
ATOM   3570  H5  GLB D  27     -16.257  -0.747 -18.477  0.00  0.00              
ATOM   3571  H6S GLB D  27     -15.536  -3.207 -18.548  0.00  0.00              
ATOM   3572  H6R GLB D  27     -14.588  -2.285 -19.168  0.00  0.00              
ATOM   3573  H1  GLB D  27     -17.657   0.175 -16.712  0.00  0.00              
ATOM   3574  H2  GLB D  27     -15.213   0.808 -15.044  0.00  0.00              
ATOM   3575  H3  GLB D  27     -15.762   1.705 -17.891  0.00  0.00              
ATOM   3576  H4  GLB D  27     -14.009   0.119 -18.602  0.00  0.00              
ATOM   3577  C1  GLA D  28     -13.713   3.169 -17.871  0.00  0.00              
ATOM   3578  C2  GLA D  28     -12.380   3.888 -17.686  0.00  0.00              
ATOM   3579  C3  GLA D  28     -12.410   4.853 -16.512  0.00  0.00              
ATOM   3580  C4  GLA D  28     -13.612   5.766 -16.608  0.00  0.00              
ATOM   3581  C5  GLA D  28     -14.884   4.932 -16.761  0.00  0.00              
ATOM   3582  C6  GLA D  28     -16.160   5.735 -16.890  0.00  0.00              
ATOM   3583  O2h GLA D  28     -11.366   2.914 -17.481  0.00  0.00              
ATOM   3584  OW  GLA D  28     -11.216   5.645 -16.538  0.00  0.00              
ATOM   3585  OR  GLA D  28     -14.752   4.152 -17.961  0.00  0.00              
ATOM   3586  O6h GLA D  28     -16.128   6.605 -18.010  0.00  0.00              
ATOM   3587  H2o GLA D  28     -10.770   2.681 -18.364  0.00  0.00              
ATOM   3588  H6o GLA D  28     -16.832   6.669 -18.839  0.00  0.00              
ATOM   3589  O4h GLA D  28     -13.365   6.608 -17.725  0.00  0.00              
ATOM   3590  H4o GLA D  28     -12.445   7.168 -17.562  0.00  0.00              
ATOM   3591  H5  GLA D  28     -15.008   4.323 -15.909  0.00  0.00              
ATOM   3592  H6S GLA D  28     -17.115   5.450 -16.841  0.00  0.00              
ATOM   3593  H6R GLA D  28     -16.275   6.326 -16.028  0.00  0.00              
ATOM   3594  H1  GLA D  28     -13.672   2.553 -18.769  0.00  0.00              
ATOM   3595  H2  GLA D  28     -12.180   4.440 -18.605  0.00  0.00              
ATOM   3596  H3  GLA D  28     -12.460   4.279 -15.588  0.00  0.00              
ATOM   3597  H4  GLA D  28     -13.759   6.376 -15.717  0.00  0.00              
ATOM   3598  C1  NGA D  29     -10.781   6.164 -15.332  0.00  0.00              
ATOM   3599  C2  NGA D  29      -9.531   5.397 -14.908  0.00  0.00              
ATOM   3600  C3  NGA D  29      -8.830   6.055 -13.731  0.00  0.00              
ATOM   3601  C4  NGA D  29      -8.607   7.526 -14.002  0.00  0.00              
ATOM   3602  C5  NGA D  29      -9.930   8.188 -14.388  0.00  0.00              
ATOM   3603  C6  NGA D  29      -9.835   9.663 -14.709  0.00  0.00              
ATOM   3604  OW  NGA D  29      -7.563   5.416 -13.536  0.00  0.00              
ATOM   3605  OR  NGA D  29     -10.418   7.530 -15.570  0.00  0.00              
ATOM   3606  O6h NGA D  29      -8.944   9.916 -15.784  0.00  0.00              
ATOM   3607  H6o NGA D  29      -9.141  10.442 -16.718  0.00  0.00              
ATOM   3608  O4h NGA D  29      -7.637   7.580 -15.041  0.00  0.00              
ATOM   3609  H4o NGA D  29      -6.722   7.086 -14.711  0.00  0.00              
ATOM   3610  H5  NGA D  29     -10.610   8.108 -13.586  0.00  0.00              
ATOM   3611  H6S NGA D  29     -10.547  10.352 -14.828  0.00  0.00              
ATOM   3612  H6R NGA D  29      -9.465  10.169 -13.864  0.00  0.00              
ATOM   3613  H1  NGA D  29     -11.539   6.079 -14.555  0.00  0.00              
ATOM   3614  H2  NGA D  29      -8.859   5.374 -15.765  0.00  0.00              
ATOM   3615  H3  NGA D  29      -9.451   5.939 -12.843  0.00  0.00              
ATOM   3616  H4  NGA D  29      -8.240   8.071 -13.133  0.00  0.00              
ATOM   3617  N23 NGA D  29      -9.917   4.050 -14.556  0.00  0.00              
ATOM   3618  C24 NGA D  29      -9.114   2.994 -14.902  0.00  0.00              
ATOM   3619  C25 NGA D  29      -9.652   1.642 -14.472  0.00  0.00              
ATOM   3620  OM  NGA D  29      -8.063   3.100 -15.504  0.00  0.00              
ATOM   3621  H27 NGA D  29     -10.796   3.884 -14.044  0.00  0.00              
ATOM   3622  H25 NGA D  29      -8.957   0.824 -14.770  0.00  0.00              
ATOM   3623  H29 NGA D  29     -10.639   1.449 -14.952  0.00  0.00              
ATOM   3624  H30 NGA D  29      -9.772   1.607 -13.365  0.00  0.00              
ATOM   3625  C1  AFL D  30      -7.331   4.813 -12.264  0.00  0.00              
ATOM   3626  C2  AFL D  30      -6.047   3.966 -12.197  0.00  0.00              
ATOM   3627  C3  AFL D  30      -4.803   4.867 -12.231  0.00  0.00              
ATOM   3628  C4  AFL D  30      -4.918   5.937 -11.132  0.00  0.00              
ATOM   3629  C5  AFL D  30      -6.246   6.696 -11.286  0.00  0.00              
ATOM   3630  C6  AFL D  30      -6.475   7.759 -10.205  0.00  0.00              
ATOM   3631  OR  AFL D  30      -7.364   5.802 -11.232  0.00  0.00              
ATOM   3632  O2h AFL D  30      -6.098   3.003 -13.248  0.00  0.00              
ATOM   3633  O3h AFL D  30      -3.634   4.061 -12.113  0.00  0.00              
ATOM   3634  O4h AFL D  30      -4.881   5.363  -9.827  0.00  0.00              
ATOM   3635  H5  AFL D  30      -6.233   7.220 -12.261  0.00  0.00              
ATOM   3636  H1  AFL D  30      -8.203   4.173 -12.084  0.00  0.00              
ATOM   3637  H2  AFL D  30      -6.052   3.429 -11.229  0.00  0.00              
ATOM   3638  H2o AFL D  30      -5.360   2.398 -13.099  0.00  0.00              
ATOM   3639  H3  AFL D  30      -4.778   5.374 -13.214  0.00  0.00              
ATOM   3640  H3o AFL D  30      -2.886   4.631 -12.336  0.00  0.00              
ATOM   3641  H4  AFL D  30      -4.084   6.660 -11.220  0.00  0.00              
ATOM   3642  H4o AFL D  30      -3.998   4.982  -9.720  0.00  0.00              
ATOM   3643  H6  AFL D  30      -5.648   8.487 -10.161  0.00  0.00              
ATOM   3644  H22 AFL D  30      -7.406   8.311 -10.411  0.00  0.00              
ATOM   3645  H23 AFL D  30      -6.576   7.293  -9.213  0.00  0.00              
ATOM   3646  C1  NAG E   1       8.348 -14.271 -11.250  0.00  0.00              
ATOM   3647  C2  NAG E   1       6.896 -14.591 -11.729  0.00  0.00              
ATOM   3648  C3  NAG E   1       6.941 -15.249 -13.143  0.00  0.00              
ATOM   3649  C4  NAG E   1       7.758 -14.401 -14.139  0.00  0.00              
ATOM   3650  C5  NAG E   1       9.177 -14.107 -13.579  0.00  0.00              
ATOM   3651  C6  NAG E   1       9.995 -13.176 -14.493  0.00  0.00              
ATOM   3652  C7  NAG E   1       4.962 -15.303 -10.359  0.00  0.00              
ATOM   3653  C8  NAG E   1       4.391 -16.378  -9.457  0.00  0.00              
ATOM   3654  O3h NAG E   1       5.634 -15.422 -13.694  0.00  0.00              
ATOM   3655  OR  NAG E   1       7.822 -15.117 -15.368  0.00  0.00              
ATOM   3656  OR  NAG E   1       9.069 -13.505 -12.252  0.00  0.00              
ATOM   3657  OW  NAG E   1      11.216 -13.788 -14.916  0.00  0.00              
ATOM   3658  OM  NAG E   1       4.266 -14.356 -10.704  0.00  0.00              
ATOM   3659  N15 NAG E   1       6.212 -15.502 -10.770  0.00  0.00              
ATOM   3660  H2  NAG E   1       6.364 -13.620 -11.817  0.00  0.00              
ATOM   3661  H3  NAG E   1       7.424 -16.244 -13.060  0.00  0.00              
ATOM   3662  H4  NAG E   1       7.236 -13.436 -14.303  0.00  0.00              
ATOM   3663  H5  NAG E   1       9.728 -15.065 -13.496  0.00  0.00              
ATOM   3664  H6  NAG E   1       9.388 -12.894 -15.374  0.00  0.00              
ATOM   3665  H22 NAG E   1      10.212 -12.232 -13.955  0.00  0.00              
ATOM   3666  H8  NAG E   1       3.763 -15.918  -8.675  0.00  0.00              
ATOM   3667  H24 NAG E   1       5.158 -16.993  -8.952  0.00  0.00              
ATOM   3668  H25 NAG E   1       3.744 -17.049 -10.047  0.00  0.00              
ATOM   3669  H3o NAG E   1       5.183 -16.058 -13.131  0.00  0.00              
ATOM   3670  H29 NAG E   1       6.694 -16.252 -10.271  0.00  0.00              
ATOM   3671  H1  NAG E   1       8.904 -15.204 -11.028  0.00  0.00              
ATOM   3672  C1  NAG E   2       7.360 -14.445 -16.530  0.00  0.00              
ATOM   3673  C2  NAG E   2       7.853 -15.173 -17.822  0.00  0.00              
ATOM   3674  C3  NAG E   2       7.121 -14.585 -19.069  0.00  0.00              
ATOM   3675  C4  NAG E   2       5.590 -14.597 -18.889  0.00  0.00              
ATOM   3676  C5  NAG E   2       5.185 -13.877 -17.573  0.00  0.00              
ATOM   3677  C6  NAG E   2       3.671 -13.953 -17.296  0.00  0.00              
ATOM   3678  C7  NAG E   2      10.119 -16.040 -18.310  0.00  0.00              
ATOM   3679  C8  NAG E   2      11.576 -15.691 -18.524  0.00  0.00              
ATOM   3680  O3h NAG E   2       7.421 -15.318 -20.259  0.00  0.00              
ATOM   3681  OR  NAG E   2       5.014 -13.964 -20.026  0.00  0.00              
ATOM   3682  OR  NAG E   2       5.909 -14.462 -16.447  0.00  0.00              
ATOM   3683  O6h NAG E   2       3.225 -15.305 -17.154  0.00  0.00              
ATOM   3684  OM  NAG E   2       9.729 -17.188 -18.489  0.00  0.00              
ATOM   3685  N15 NAG E   2       9.326 -15.023 -17.983  0.00  0.00              
ATOM   3686  H2  NAG E   2       7.561 -16.240 -17.722  0.00  0.00              
ATOM   3687  H3  NAG E   2       7.444 -13.534 -19.212  0.00  0.00              
ATOM   3688  H4  NAG E   2       5.242 -15.648 -18.837  0.00  0.00              
ATOM   3689  H5  NAG E   2       5.456 -12.806 -17.659  0.00  0.00              
ATOM   3690  H6S NAG E   2       3.433 -13.378 -16.382  0.00  0.00              
ATOM   3691  H6R NAG E   2       3.122 -13.460 -18.122  0.00  0.00              
ATOM   3692  H8  NAG E   2      12.218 -16.496 -18.127  0.00  0.00              
ATOM   3693  H24 NAG E   2      11.886 -14.746 -18.041  0.00  0.00              
ATOM   3694  H25 NAG E   2      11.780 -15.608 -19.605  0.00  0.00              
ATOM   3695  H3o NAG E   2       8.360 -15.190 -20.430  0.00  0.00              
ATOM   3696  H6o NAG E   2       2.269 -15.304 -17.240  0.00  0.00              
ATOM   3697  H29 NAG E   2       9.831 -14.173 -17.728  0.00  0.00              
ATOM   3698  H1  NAG E   2       7.719 -13.397 -16.509  0.00  0.00              
ATOM   3699  C1  BMA E   3       4.076 -14.688 -20.741  0.00  0.00              
ATOM   3700  C2  BMA E   3       3.392 -13.744 -21.724  0.00  0.00              
ATOM   3701  C3  BMA E   3       2.531 -14.492 -22.728  0.00  0.00              
ATOM   3702  C4  BMA E   3       3.319 -15.611 -23.371  0.00  0.00              
ATOM   3703  C5  BMA E   3       3.930 -16.502 -22.290  0.00  0.00              
ATOM   3704  C6  BMA E   3       4.766 -17.651 -22.809  0.00  0.00              
ATOM   3705  OW  BMA E   3       2.107 -13.573 -23.743  0.00  0.00              
ATOM   3706  O4h BMA E   3       2.485 -16.414 -24.192  0.00  0.00              
ATOM   3707  OR  BMA E   3       4.793 -15.682 -21.486  0.00  0.00              
ATOM   3708  OW  BMA E   3       4.293 -18.905 -22.341  0.00  0.00              
ATOM   3709  H4o BMA E   3       2.559 -16.081 -25.227  0.00  0.00              
ATOM   3710  O2h BMA E   3       4.391 -13.002 -22.413  0.00  0.00              
ATOM   3711  H2o BMA E   3       5.016 -13.682 -22.991  0.00  0.00              
ATOM   3712  H5  BMA E   3       3.159 -16.939 -21.719  0.00  0.00              
ATOM   3713  H6  BMA E   3       5.096 -17.853 -23.729  0.00  0.00              
ATOM   3714  H20 BMA E   3       5.752 -17.534 -22.463  0.00  0.00              
ATOM   3715  H2  BMA E   3       2.766 -13.069 -21.141  0.00  0.00              
ATOM   3716  H3  BMA E   3       1.667 -14.907 -22.211  0.00  0.00              
ATOM   3717  H1  BMA E   3       3.328 -15.139 -20.089  0.00  0.00              
ATOM   3718  H4  BMA E   3       4.102 -15.157 -23.981  0.00  0.00              
ATOM   3719  C1  MAN E   4       0.712 -13.504 -24.009  0.00  0.00              
ATOM   3720  C2  MAN E   4       0.326 -12.743 -25.273  0.00  0.00              
ATOM   3721  C3  MAN E   4       0.621 -11.258 -25.157  0.00  0.00              
ATOM   3722  C4  MAN E   4       0.032 -10.700 -23.880  0.00  0.00              
ATOM   3723  C5  MAN E   4       0.512 -11.524 -22.686  0.00  0.00              
ATOM   3724  C6  MAN E   4      -0.028 -11.079 -21.345  0.00  0.00              
ATOM   3725  O3h MAN E   4       0.034 -10.583 -26.277  0.00  0.00              
ATOM   3726  OR  MAN E   4       0.434  -9.353 -23.680  0.00  0.00              
ATOM   3727  OR  MAN E   4       0.074 -12.878 -22.887  0.00  0.00              
ATOM   3728  O6h MAN E   4      -1.446 -11.120 -21.304  0.00  0.00              
ATOM   3729  H3o MAN E   4       0.902 -10.277 -26.862  0.00  0.00              
ATOM   3730  H6o MAN E   4      -2.088 -11.649 -20.599  0.00  0.00              
ATOM   3731  OW  MAN E   4      -1.062 -12.936 -25.516  0.00  0.00              
ATOM   3732  H5  MAN E   4       1.562 -11.459 -22.612  0.00  0.00              
ATOM   3733  H6S MAN E   4       0.240 -11.330 -20.417  0.00  0.00              
ATOM   3734  H6R MAN E   4       0.265 -10.083 -21.178  0.00  0.00              
ATOM   3735  H1  MAN E   4       0.408 -14.547 -24.105  0.00  0.00              
ATOM   3736  H2  MAN E   4       0.906 -13.165 -26.093  0.00  0.00              
ATOM   3737  H3  MAN E   4       1.700 -11.113 -25.153  0.00  0.00              
ATOM   3738  H4  MAN E   4      -1.053 -10.747 -23.966  0.00  0.00              
ATOM   3739  C1  NAG E   5      -1.434 -14.094 -26.247  0.00  0.00              
ATOM   3740  C2  NAG E   5      -2.757 -14.703 -25.683  0.00  0.00              
ATOM   3741  C3  NAG E   5      -3.287 -15.803 -26.655  0.00  0.00              
ATOM   3742  C4  NAG E   5      -3.405 -15.276 -28.100  0.00  0.00              
ATOM   3743  C5  NAG E   5      -2.058 -14.667 -28.577  0.00  0.00              
ATOM   3744  C6  NAG E   5      -2.154 -14.034 -29.977  0.00  0.00              
ATOM   3745  C7  NAG E   5      -3.370 -15.084 -23.316  0.00  0.00              
ATOM   3746  C8  NAG E   5      -3.043 -15.830 -22.040  0.00  0.00              
ATOM   3747  O3h NAG E   5      -4.575 -16.286 -26.265  0.00  0.00              
ATOM   3748  OR  NAG E   5      -3.806 -16.364 -28.927  0.00  0.00              
ATOM   3749  OR  NAG E   5      -1.608 -13.656 -27.622  0.00  0.00              
ATOM   3750  O6h NAG E   5      -3.100 -12.962 -30.009  0.00  0.00              
ATOM   3751  OM  NAG E   5      -4.378 -14.389 -23.382  0.00  0.00              
ATOM   3752  N15 NAG E   5      -2.536 -15.288 -24.331  0.00  0.00              
ATOM   3753  H2  NAG E   5      -3.503 -13.880 -25.653  0.00  0.00              
ATOM   3754  H3  NAG E   5      -2.577 -16.655 -26.655  0.00  0.00              
ATOM   3755  H4  NAG E   5      -4.182 -14.485 -28.133  0.00  0.00              
ATOM   3756  H5  NAG E   5      -1.303 -15.478 -28.626  0.00  0.00              
ATOM   3757  H6S NAG E   5      -1.157 -13.668 -30.288  0.00  0.00              
ATOM   3758  H6R NAG E   5      -2.441 -14.812 -30.712  0.00  0.00              
ATOM   3759  H8  NAG E   5      -3.258 -15.192 -21.165  0.00  0.00              
ATOM   3760  H24 NAG E   5      -1.989 -16.152 -21.968  0.00  0.00              
ATOM   3761  H25 NAG E   5      -3.684 -16.725 -21.961  0.00  0.00              
ATOM   3762  H3o NAG E   5      -4.456 -16.728 -25.419  0.00  0.00              
ATOM   3763  H6o NAG E   5      -3.302 -12.784 -30.933  0.00  0.00              
ATOM   3764  H29 NAG E   5      -1.674 -15.767 -24.066  0.00  0.00              
ATOM   3765  H1  NAG E   5      -0.609 -14.833 -26.198  0.00  0.00              
ATOM   3766  C1  GLB E   6      -4.953 -16.190 -29.681  0.00  0.00              
ATOM   3767  C2  GLB E   6      -5.041 -17.335 -30.686  0.00  0.00              
ATOM   3768  C3  GLB E   6      -6.389 -17.379 -31.385  0.00  0.00              
ATOM   3769  C4  GLB E   6      -7.511 -17.339 -30.373  0.00  0.00              
ATOM   3770  C5  GLB E   6      -7.331 -16.138 -29.444  0.00  0.00              
ATOM   3771  C6  GLB E   6      -8.383 -16.001 -28.367  0.00  0.00              
ATOM   3772  O2h GLB E   6      -4.006 -17.172 -31.647  0.00  0.00              
ATOM   3773  O3h GLB E   6      -6.477 -18.595 -32.137  0.00  0.00              
ATOM   3774  OR  GLB E   6      -6.065 -16.287 -28.781  0.00  0.00              
ATOM   3775  OW  GLB E   6      -8.716 -14.644 -28.121  0.00  0.00              
ATOM   3776  H2o GLB E   6      -3.172 -17.757 -31.488  0.00  0.00              
ATOM   3777  H3o GLB E   6      -6.429 -18.249 -33.169  0.00  0.00              
ATOM   3778  O4h GLB E   6      -7.452 -18.584 -29.686  0.00  0.00              
ATOM   3779  H4o GLB E   6      -7.577 -19.399 -30.400  0.00  0.00              
ATOM   3780  H5  GLB E   6      -7.375 -15.249 -30.009  0.00  0.00              
ATOM   3781  H6  GLB E   6      -9.248 -16.482 -28.235  0.00  0.00              
ATOM   3782  H20 GLB E   6      -8.004 -16.403 -27.472  0.00  0.00              
ATOM   3783  H1  GLB E   6      -4.950 -15.239 -30.213  0.00  0.00              
ATOM   3784  H2  GLB E   6      -4.886 -18.262 -30.134  0.00  0.00              
ATOM   3785  H3  GLB E   6      -6.468 -16.518 -32.049  0.00  0.00              
ATOM   3786  H4  GLB E   6      -8.495 -17.222 -30.827  0.00  0.00              
ATOM   3787  C1  NAN E   7      -8.401 -14.832 -25.715  0.00  0.00              
ATOM   3788  C2  NAN E   7      -9.335 -14.349 -26.881  0.00  0.00              
ATOM   3789  C3  NAN E   7     -10.741 -15.010 -26.927  0.00  0.00              
ATOM   3790  C4  NAN E   7     -11.687 -14.435 -25.850  0.00  0.00              
ATOM   3791  C5  NAN E   7     -11.761 -12.895 -25.931  0.00  0.00              
ATOM   3792  C6  NAN E   7     -10.337 -12.266 -25.894  0.00  0.00              
ATOM   3793  C7  NAN E   7     -10.331 -10.731 -26.119  0.00  0.00              
ATOM   3794  C8  NAN E   7      -8.956 -10.076 -25.841  0.00  0.00              
ATOM   3795  C9  NAN E   7      -8.949  -8.553 -26.038  0.00  0.00              
ATOM   3796  OW  NAN E   7      -9.496 -12.897 -26.922  0.00  0.00              
ATOM   3797  OM  NAN E   7      -8.691 -15.697 -24.889  0.00  0.00              
ATOM   3798  O1h NAN E   7      -7.200 -14.181 -25.704  0.00  0.00              
ATOM   3799  O4h NAN E   7     -12.985 -14.979 -26.046  0.00  0.00              
ATOM   3800  O7h NAN E   7     -10.704 -10.480 -27.473  0.00  0.00              
ATOM   3801  O8h NAN E   7      -8.575 -10.296 -24.491  0.00  0.00              
ATOM   3802  O9h NAN E   7      -7.670  -8.022 -25.693  0.00  0.00              
ATOM   3803  H6  NAN E   7      -9.906 -12.467 -24.893  0.00  0.00              
ATOM   3804  H3  NAN E   7     -11.186 -14.833 -27.925  0.00  0.00              
ATOM   3805  H21 NAN E   7     -10.650 -16.108 -26.834  0.00  0.00              
ATOM   3806  H4  NAN E   7     -11.317 -14.728 -24.845  0.00  0.00              
ATOM   3807  H7o NAN E   7     -10.298 -11.201 -27.963  0.00  0.00              
ATOM   3808  H8o NAN E   7      -7.963  -9.576 -24.314  0.00  0.00              
ATOM   3809  H4o NAN E   7     -12.860 -15.926 -26.161  0.00  0.00              
ATOM   3810  H9o NAN E   7      -7.670  -7.094 -25.952  0.00  0.00              
ATOM   3811  H9R NAN E   7      -9.738  -8.082 -25.418  0.00  0.00              
ATOM   3812  H9S NAN E   7      -9.196  -8.307 -27.090  0.00  0.00              
ATOM   3813  H8  NAN E   7      -8.194 -10.526 -26.507  0.00  0.00              
ATOM   3814  H7  NAN E   7     -11.079 -10.270 -25.444  0.00  0.00              
ATOM   3815  H1o NAN E   7      -6.700 -14.509 -24.955  0.00  0.00              
ATOM   3816  H5  NAN E   7     -12.256 -12.608 -26.880  0.00  0.00              
ATOM   3817  N33 NAN E   7     -12.559 -12.432 -24.819  0.00  0.00              
ATOM   3818  C34 NAN E   7     -13.903 -12.212 -24.984  0.00  0.00              
ATOM   3819  C35 NAN E   7     -14.607 -11.722 -23.733  0.00  0.00              
ATOM   3820  OM  NAN E   7     -14.501 -12.380 -26.029  0.00  0.00              
ATOM   3821  H37 NAN E   7     -12.120 -12.267 -23.903  0.00  0.00              
ATOM   3822  H35 NAN E   7     -15.694 -11.569 -23.923  0.00  0.00              
ATOM   3823  H39 NAN E   7     -14.175 -10.750 -23.403  0.00  0.00              
ATOM   3824  H40 NAN E   7     -14.501 -12.467 -22.912  0.00  0.00              
ATOM   3825  C1  NAG E   8      -0.597  -8.387 -23.546  0.00  0.00              
ATOM   3826  C2  NAG E   8      -0.035  -7.059 -22.942  0.00  0.00              
ATOM   3827  C3  NAG E   8      -1.112  -5.935 -23.051  0.00  0.00              
ATOM   3828  C4  NAG E   8      -1.643  -5.793 -24.492  0.00  0.00              
ATOM   3829  C5  NAG E   8      -2.160  -7.157 -25.025  0.00  0.00              
ATOM   3830  C6  NAG E   8      -2.606  -7.089 -26.498  0.00  0.00              
ATOM   3831  C7  NAG E   8       1.498  -6.790 -21.019  0.00  0.00              
ATOM   3832  C8  NAG E   8       1.691  -6.990 -19.531  0.00  0.00              
ATOM   3833  O3h NAG E   8      -0.596  -4.661 -22.654  0.00  0.00              
ATOM   3834  OR  NAG E   8      -2.678  -4.815 -24.479  0.00  0.00              
ATOM   3835  OR  NAG E   8      -1.116  -8.170 -24.886  0.00  0.00              
ATOM   3836  O6h NAG E   8      -1.529  -6.716 -27.361  0.00  0.00              
ATOM   3837  OM  NAG E   8       2.344  -6.192 -21.674  0.00  0.00              
ATOM   3838  N15 NAG E   8       0.354  -7.250 -21.517  0.00  0.00              
ATOM   3839  H2  NAG E   8       0.835  -6.766 -23.565  0.00  0.00              
ATOM   3840  H3  NAG E   8      -1.967  -6.190 -22.392  0.00  0.00              
ATOM   3841  H4  NAG E   8      -0.819  -5.447 -25.147  0.00  0.00              
ATOM   3842  H5  NAG E   8      -3.039  -7.460 -24.422  0.00  0.00              
ATOM   3843  H6S NAG E   8      -3.015  -8.069 -26.807  0.00  0.00              
ATOM   3844  H6R NAG E   8      -3.437  -6.363 -26.596  0.00  0.00              
ATOM   3845  H8  NAG E   8       2.745  -7.240 -19.318  0.00  0.00              
ATOM   3846  H24 NAG E   8       1.064  -7.793 -19.102  0.00  0.00              
ATOM   3847  H25 NAG E   8       1.461  -6.050 -19.000  0.00  0.00              
ATOM   3848  H3o NAG E   8      -0.392  -4.730 -21.716  0.00  0.00              
ATOM   3849  H6o NAG E   8      -1.911  -6.445 -28.199  0.00  0.00              
ATOM   3850  H29 NAG E   8      -0.164  -7.850 -20.873  0.00  0.00              
ATOM   3851  H1  NAG E   8      -1.400  -8.802 -22.902  0.00  0.00              
ATOM   3852  C1  GLB E   9      -2.536  -3.740 -25.339  0.00  0.00              
ATOM   3853  C2  GLB E   9      -3.859  -2.979 -25.371  0.00  0.00              
ATOM   3854  C3  GLB E   9      -3.730  -1.643 -26.083  0.00  0.00              
ATOM   3855  C4  GLB E   9      -2.564  -0.857 -25.527  0.00  0.00              
ATOM   3856  C5  GLB E   9      -1.296  -1.710 -25.572  0.00  0.00              
ATOM   3857  C6  GLB E   9      -0.058  -1.040 -25.019  0.00  0.00              
ATOM   3858  O2h GLB E   9      -4.825  -3.785 -26.034  0.00  0.00              
ATOM   3859  OW  GLB E   9      -4.937  -0.897 -25.881  0.00  0.00              
ATOM   3860  OR  GLB E   9      -1.533  -2.883 -24.777  0.00  0.00              
ATOM   3861  O6h GLB E   9      -0.222  -0.658 -23.663  0.00  0.00              
ATOM   3862  H2o GLB E   9      -5.466  -4.294 -25.406  0.00  0.00              
ATOM   3863  H6o GLB E   9       0.392  -0.928 -22.804  0.00  0.00              
ATOM   3864  O4h GLB E   9      -2.942  -0.495 -24.205  0.00  0.00              
ATOM   3865  H4o GLB E   9      -3.853   0.101 -24.237  0.00  0.00              
ATOM   3866  H5  GLB E   9      -1.073  -1.953 -26.574  0.00  0.00              
ATOM   3867  H6S GLB E   9       0.904  -1.303 -25.074  0.00  0.00              
ATOM   3868  H6R GLB E   9       0.131  -0.169 -25.575  0.00  0.00              
ATOM   3869  H1  GLB E   9      -2.274  -4.058 -26.347  0.00  0.00              
ATOM   3870  H2  GLB E   9      -4.164  -2.814 -24.338  0.00  0.00              
ATOM   3871  H3  GLB E   9      -3.572  -1.824 -27.146  0.00  0.00              
ATOM   3872  H4  GLB E   9      -2.341   0.043 -26.101  0.00  0.00              
ATOM   3873  C1  NAN E  10      -5.868  -1.586 -28.021  0.00  0.00              
ATOM   3874  C2  NAN E  10      -5.584  -0.395 -27.037  0.00  0.00              
ATOM   3875  C3  NAN E  10      -4.665   0.728 -27.597  0.00  0.00              
ATOM   3876  C4  NAN E  10      -5.413   1.646 -28.587  0.00  0.00              
ATOM   3877  C5  NAN E  10      -6.711   2.205 -27.966  0.00  0.00              
ATOM   3878  C6  NAN E  10      -7.600   1.057 -27.406  0.00  0.00              
ATOM   3879  C7  NAN E  10      -8.850   1.560 -26.636  0.00  0.00              
ATOM   3880  C8  NAN E  10      -9.854   0.433 -26.295  0.00  0.00              
ATOM   3881  C9  NAN E  10     -11.106   0.926 -25.555  0.00  0.00              
ATOM   3882  OW  NAN E  10      -6.800   0.213 -26.505  0.00  0.00              
ATOM   3883  OM  NAN E  10      -5.397  -1.697 -29.152  0.00  0.00              
ATOM   3884  O1h NAN E  10      -6.714  -2.514 -27.487  0.00  0.00              
ATOM   3885  O4h NAN E  10      -4.558   2.724 -28.944  0.00  0.00              
ATOM   3886  O7h NAN E  10      -8.410   2.177 -25.428  0.00  0.00              
ATOM   3887  O8h NAN E  10     -10.321  -0.182 -27.486  0.00  0.00              
ATOM   3888  O9h NAN E  10     -12.008  -0.160 -25.342  0.00  0.00              
ATOM   3889  H6  NAN E  10      -7.948   0.450 -28.266  0.00  0.00              
ATOM   3890  H3  NAN E  10      -4.294   1.340 -26.753  0.00  0.00              
ATOM   3891  H21 NAN E  10      -3.764   0.288 -28.062  0.00  0.00              
ATOM   3892  H4  NAN E  10      -5.668   1.069 -29.500  0.00  0.00              
ATOM   3893  H7o NAN E  10      -7.661   1.637 -25.153  0.00  0.00              
ATOM   3894  H8o NAN E  10     -11.169  -0.559 -27.224  0.00  0.00              
ATOM   3895  H4o NAN E  10      -3.709   2.329 -29.157  0.00  0.00              
ATOM   3896  H9o NAN E  10     -12.711   0.165 -24.770  0.00  0.00              
ATOM   3897  H9R NAN E  10     -11.604   1.728 -26.135  0.00  0.00              
ATOM   3898  H9S NAN E  10     -10.817   1.380 -24.587  0.00  0.00              
ATOM   3899  H8  NAN E  10      -9.350  -0.332 -25.671  0.00  0.00              
ATOM   3900  H7  NAN E  10      -9.372   2.313 -27.259  0.00  0.00              
ATOM   3901  H1o NAN E  10      -6.860  -3.190 -28.150  0.00  0.00              
ATOM   3902  H5  NAN E  10      -6.446   2.891 -27.137  0.00  0.00              
ATOM   3903  N33 NAN E  10      -7.409   2.946 -28.991  0.00  0.00              
ATOM   3904  C34 NAN E  10      -7.227   4.301 -29.103  0.00  0.00              
ATOM   3905  C35 NAN E  10      -8.029   4.942 -30.220  0.00  0.00              
ATOM   3906  OM  NAN E  10      -6.498   4.955 -28.382  0.00  0.00              
ATOM   3907  H37 NAN E  10      -8.043   2.457 -29.639  0.00  0.00              
ATOM   3908  H35 NAN E  10      -7.835   6.039 -30.269  0.00  0.00              
ATOM   3909  H39 NAN E  10      -9.119   4.792 -30.046  0.00  0.00              
ATOM   3910  H40 NAN E  10      -7.750   4.498 -31.202  0.00  0.00              
ATOM   3911  C1  MAN E  11       5.206 -19.994 -22.379  0.00  0.00              
ATOM   3912  C2  MAN E  11       5.399 -20.633 -23.752  0.00  0.00              
ATOM   3913  C3  MAN E  11       4.148 -21.353 -24.227  0.00  0.00              
ATOM   3914  C4  MAN E  11       3.639 -22.293 -23.157  0.00  0.00              
ATOM   3915  C5  MAN E  11       3.460 -21.535 -21.843  0.00  0.00              
ATOM   3916  C6  MAN E  11       2.974 -22.377 -20.682  0.00  0.00              
ATOM   3917  O3h MAN E  11       4.470 -22.108 -25.401  0.00  0.00              
ATOM   3918  O4h MAN E  11       2.387 -22.852 -23.523  0.00  0.00              
ATOM   3919  OR  MAN E  11       4.740 -21.000 -21.471  0.00  0.00              
ATOM   3920  OW  MAN E  11       1.773 -21.868 -20.126  0.00  0.00              
ATOM   3921  H3o MAN E  11       3.947 -21.568 -26.191  0.00  0.00              
ATOM   3922  H4o MAN E  11       2.542 -23.828 -23.982  0.00  0.00              
ATOM   3923  OW  MAN E  11       6.478 -21.556 -23.677  0.00  0.00              
ATOM   3924  H5  MAN E  11       2.739 -20.775 -21.973  0.00  0.00              
ATOM   3925  H6  MAN E  11       2.876 -23.365 -20.591  0.00  0.00              
ATOM   3926  H20 MAN E  11       3.706 -22.363 -19.928  0.00  0.00              
ATOM   3927  H1  MAN E  11       6.149 -19.562 -22.043  0.00  0.00              
ATOM   3928  H2  MAN E  11       5.645 -19.833 -24.449  0.00  0.00              
ATOM   3929  H3  MAN E  11       3.381 -20.612 -24.454  0.00  0.00              
ATOM   3930  H4  MAN E  11       4.374 -23.091 -23.042  0.00  0.00              
ATOM   3931  C1  NAG E  12       7.785 -21.036 -23.871  0.00  0.00              
ATOM   3932  C2  NAG E  12       8.806 -21.735 -22.917  0.00  0.00              
ATOM   3933  C3  NAG E  12      10.261 -21.347 -23.327  0.00  0.00              
ATOM   3934  C4  NAG E  12      10.520 -21.613 -24.824  0.00  0.00              
ATOM   3935  C5  NAG E  12       9.451 -20.907 -25.702  0.00  0.00              
ATOM   3936  C6  NAG E  12       9.606 -21.228 -27.201  0.00  0.00              
ATOM   3937  C7  NAG E  12       8.546 -22.222 -20.504  0.00  0.00              
ATOM   3938  C8  NAG E  12       8.374 -21.638 -19.118  0.00  0.00              
ATOM   3939  O3h NAG E  12      11.239 -22.078 -22.583  0.00  0.00              
ATOM   3940  OR  NAG E  12      11.831 -21.149 -25.127  0.00  0.00              
ATOM   3941  OR  NAG E  12       8.113 -21.298 -25.263  0.00  0.00              
ATOM   3942  O6h NAG E  12       9.460 -22.626 -27.460  0.00  0.00              
ATOM   3943  OM  NAG E  12       8.712 -23.427 -20.648  0.00  0.00              
ATOM   3944  N15 NAG E  12       8.559 -21.341 -21.501  0.00  0.00              
ATOM   3945  H2  NAG E  12       8.686 -22.829 -23.062  0.00  0.00              
ATOM   3946  H3  NAG E  12      10.411 -20.265 -23.138  0.00  0.00              
ATOM   3947  H4  NAG E  12      10.464 -22.705 -25.010  0.00  0.00              
ATOM   3948  H5  NAG E  12       9.564 -19.811 -25.580  0.00  0.00              
ATOM   3949  H6S NAG E  12       8.858 -20.656 -27.781  0.00  0.00              
ATOM   3950  H6R NAG E  12      10.598 -20.880 -27.548  0.00  0.00              
ATOM   3951  H8  NAG E  12       7.734 -22.299 -18.508  0.00  0.00              
ATOM   3952  H24 NAG E  12       7.920 -20.632 -19.110  0.00  0.00              
ATOM   3953  H25 NAG E  12       9.357 -21.579 -18.618  0.00  0.00              
ATOM   3954  H3o NAG E  12      11.150 -21.800 -21.667  0.00  0.00              
ATOM   3955  H6o NAG E  12       9.812 -22.794 -28.338  0.00  0.00              
ATOM   3956  H29 NAG E  12       8.259 -20.405 -21.227  0.00  0.00              
ATOM   3957  H1  NAG E  12       7.768 -19.941 -23.695  0.00  0.00              
ATOM   3958  C1  GLB E  13      12.705 -22.061 -25.694  0.00  0.00              
ATOM   3959  C2  GLB E  13      13.930 -21.302 -26.190  0.00  0.00              
ATOM   3960  C3  GLB E  13      15.056 -22.238 -26.594  0.00  0.00              
ATOM   3961  C4  GLB E  13      15.336 -23.236 -25.495  0.00  0.00              
ATOM   3962  C5  GLB E  13      14.042 -23.952 -25.103  0.00  0.00              
ATOM   3963  C6  GLB E  13      14.186 -24.965 -23.989  0.00  0.00              
ATOM   3964  O2h GLB E  13      13.546 -20.503 -27.302  0.00  0.00              
ATOM   3965  O3h GLB E  13      16.236 -21.460 -26.834  0.00  0.00              
ATOM   3966  OR  GLB E  13      13.114 -22.953 -24.649  0.00  0.00              
ATOM   3967  OW  GLB E  13      13.362 -26.101 -24.196  0.00  0.00              
ATOM   3968  H2o GLB E  13      13.377 -19.509 -27.083  0.00  0.00              
ATOM   3969  H3o GLB E  13      16.361 -21.529 -27.914  0.00  0.00              
ATOM   3970  O4h GLB E  13      15.896 -22.482 -24.427  0.00  0.00              
ATOM   3971  H4o GLB E  13      16.807 -21.991 -24.768  0.00  0.00              
ATOM   3972  H5  GLB E  13      13.671 -24.483 -25.934  0.00  0.00              
ATOM   3973  H6  GLB E  13      15.001 -25.342 -23.553  0.00  0.00              
ATOM   3974  H20 GLB E  13      13.891 -24.516 -23.085  0.00  0.00              
ATOM   3975  H1  GLB E  13      12.248 -22.600 -26.524  0.00  0.00              
ATOM   3976  H2  GLB E  13      14.266 -20.659 -25.376  0.00  0.00              
ATOM   3977  H3  GLB E  13      14.764 -22.768 -27.501  0.00  0.00              
ATOM   3978  H4  GLB E  13      16.033 -24.019 -25.793  0.00  0.00              
ATOM   3979  C1  NAN E  14      12.382 -25.999 -21.971  0.00  0.00              
ATOM   3980  C2  NAN E  14      13.067 -26.897 -23.062  0.00  0.00              
ATOM   3981  C3  NAN E  14      14.408 -27.559 -22.635  0.00  0.00              
ATOM   3982  C4  NAN E  14      14.184 -28.765 -21.697  0.00  0.00              
ATOM   3983  C5  NAN E  14      13.197 -29.781 -22.312  0.00  0.00              
ATOM   3984  C6  NAN E  14      11.871 -29.083 -22.738  0.00  0.00              
ATOM   3985  C7  NAN E  14      10.894 -30.019 -23.498  0.00  0.00              
ATOM   3986  C8  NAN E  14       9.489 -29.401 -23.704  0.00  0.00              
ATOM   3987  C9  NAN E  14       8.510 -30.331 -24.433  0.00  0.00              
ATOM   3988  OW  NAN E  14      12.180 -27.927 -23.596  0.00  0.00              
ATOM   3989  OM  NAN E  14      12.843 -25.767 -20.853  0.00  0.00              
ATOM   3990  O1h NAN E  14      11.190 -25.483 -22.392  0.00  0.00              
ATOM   3991  O4h NAN E  14      15.432 -29.402 -21.467  0.00  0.00              
ATOM   3992  O7h NAN E  14      11.465 -30.319 -24.770  0.00  0.00              
ATOM   3993  O8h NAN E  14       8.895 -29.113 -22.447  0.00  0.00              
ATOM   3994  O9h NAN E  14       7.225 -29.715 -24.518  0.00  0.00              
ATOM   3995  H6  NAN E  14      11.365 -28.732 -21.817  0.00  0.00              
ATOM   3996  H3  NAN E  14      14.939 -27.907 -23.542  0.00  0.00              
ATOM   3997  H21 NAN E  14      15.073 -26.809 -22.169  0.00  0.00              
ATOM   3998  H4  NAN E  14      13.775 -28.404 -20.729  0.00  0.00              
ATOM   3999  H7o NAN E  14      11.899 -29.499 -25.028  0.00  0.00              
ATOM   4000  H8o NAN E  14       7.952 -29.114 -22.644  0.00  0.00              
ATOM   4001  H4o NAN E  14      16.053 -28.699 -21.253  0.00  0.00              
ATOM   4002  H9o NAN E  14       6.683 -30.271 -25.088  0.00  0.00              
ATOM   4003  H9R NAN E  14       8.435 -31.301 -23.904  0.00  0.00              
ATOM   4004  H9S NAN E  14       8.892 -30.562 -25.447  0.00  0.00              
ATOM   4005  H8  NAN E  14       9.585 -28.459 -24.280  0.00  0.00              
ATOM   4006  H7  NAN E  14      10.780 -30.957 -22.920  0.00  0.00              
ATOM   4007  H1o NAN E  14      10.823 -24.973 -21.669  0.00  0.00              
ATOM   4008  H5  NAN E  14      13.664 -30.240 -23.205  0.00  0.00              
ATOM   4009  N33 NAN E  14      12.946 -30.807 -21.326  0.00  0.00              
ATOM   4010  C34 NAN E  14      13.684 -31.962 -21.336  0.00  0.00              
ATOM   4011  C35 NAN E  14      13.304 -32.948 -20.247  0.00  0.00              
ATOM   4012  OM  NAN E  14      14.566 -32.205 -22.136  0.00  0.00              
ATOM   4013  H37 NAN E  14      12.212 -30.670 -20.615  0.00  0.00              
ATOM   4014  H35 NAN E  14      13.940 -33.860 -20.297  0.00  0.00              
ATOM   4015  H39 NAN E  14      12.242 -33.261 -20.364  0.00  0.00              
ATOM   4016  H40 NAN E  14      13.441 -32.486 -19.242  0.00  0.00              
ATOM   4017  C1  NAG E  15       1.451 -22.277 -18.805  0.00  0.00              
ATOM   4018  C2  NAG E  15       0.306 -21.392 -18.216  0.00  0.00              
ATOM   4019  C3  NAG E  15      -0.212 -22.018 -16.884  0.00  0.00              
ATOM   4020  C4  NAG E  15      -0.595 -23.502 -17.064  0.00  0.00              
ATOM   4021  C5  NAG E  15       0.585 -24.306 -17.675  0.00  0.00              
ATOM   4022  C6  NAG E  15       0.215 -25.772 -17.971  0.00  0.00              
ATOM   4023  C7  NAG E  15       0.082 -18.929 -18.312  0.00  0.00              
ATOM   4024  C8  NAG E  15       0.674 -17.598 -17.901  0.00  0.00              
ATOM   4025  O3h NAG E  15      -1.362 -21.334 -16.382  0.00  0.00              
ATOM   4026  OR  NAG E  15      -0.967 -24.013 -15.788  0.00  0.00              
ATOM   4027  OR  NAG E  15       1.033 -23.665 -18.910  0.00  0.00              
ATOM   4028  O6h NAG E  15      -0.852 -25.868 -18.917  0.00  0.00              
ATOM   4029  OM  NAG E  15      -1.005 -18.970 -18.879  0.00  0.00              
ATOM   4030  N15 NAG E  15       0.786 -20.004 -17.967  0.00  0.00              
ATOM   4031  H2  NAG E  15      -0.526 -21.409 -18.951  0.00  0.00              
ATOM   4032  H3  NAG E  15       0.592 -21.961 -16.123  0.00  0.00              
ATOM   4033  H4  NAG E  15      -1.461 -23.568 -17.753  0.00  0.00              
ATOM   4034  H5  NAG E  15       1.421 -24.311 -16.947  0.00  0.00              
ATOM   4035  H6S NAG E  15       1.105 -26.309 -18.349  0.00  0.00              
ATOM   4036  H6R NAG E  15      -0.070 -26.275 -17.027  0.00  0.00              
ATOM   4037  H8  NAG E  15       0.505 -16.850 -18.694  0.00  0.00              
ATOM   4038  H24 NAG E  15       1.760 -17.635 -17.702  0.00  0.00              
ATOM   4039  H25 NAG E  15       0.168 -17.235 -16.990  0.00  0.00              
ATOM   4040  H3o NAG E  15      -1.072 -20.446 -16.151  0.00  0.00              
ATOM   4041  H6o NAG E  15      -1.202 -26.762 -18.866  0.00  0.00              
ATOM   4042  H29 NAG E  15       1.729 -19.790 -17.641  0.00  0.00              
ATOM   4043  H1  NAG E  15       2.361 -22.212 -18.175  0.00  0.00              
ATOM   4044  C1  GLB E  16      -2.221 -24.588 -15.683  0.00  0.00              
ATOM   4045  C2  GLB E  16      -2.303 -25.310 -14.341  0.00  0.00              
ATOM   4046  C3  GLB E  16      -3.719 -25.756 -14.019  0.00  0.00              
ATOM   4047  C4  GLB E  16      -4.685 -24.604 -14.177  0.00  0.00              
ATOM   4048  C5  GLB E  16      -4.530 -23.983 -15.565  0.00  0.00              
ATOM   4049  C6  GLB E  16      -5.431 -22.799 -15.838  0.00  0.00              
ATOM   4050  O2h GLB E  16      -1.442 -26.440 -14.383  0.00  0.00              
ATOM   4051  OW  GLB E  16      -3.759 -26.218 -12.664  0.00  0.00              
ATOM   4052  OR  GLB E  16      -3.175 -23.519 -15.684  0.00  0.00              
ATOM   4053  O6h GLB E  16      -5.217 -21.745 -14.914  0.00  0.00              
ATOM   4054  H2o GLB E  16      -0.527 -26.303 -13.927  0.00  0.00              
ATOM   4055  H6o GLB E  16      -4.962 -20.704 -15.119  0.00  0.00              
ATOM   4056  O4h GLB E  16      -4.374 -23.697 -13.127  0.00  0.00              
ATOM   4057  H4o GLB E  16      -4.496 -24.197 -12.166  0.00  0.00              
ATOM   4058  H5  GLB E  16      -4.764 -24.702 -16.299  0.00  0.00              
ATOM   4059  H6S GLB E  16      -5.642 -22.325 -16.691  0.00  0.00              
ATOM   4060  H6R GLB E  16      -6.432 -23.108 -15.744  0.00  0.00              
ATOM   4061  H1  GLB E  16      -2.412 -25.297 -16.489  0.00  0.00              
ATOM   4062  H2  GLB E  16      -1.958 -24.613 -13.577  0.00  0.00              
ATOM   4063  H3  GLB E  16      -3.998 -26.560 -14.699  0.00  0.00              
ATOM   4064  H4  GLB E  16      -5.730 -24.906 -14.099  0.00  0.00              
ATOM   4065  C1  NAN E  17      -3.515 -28.549 -13.320  0.00  0.00              
ATOM   4066  C2  NAN E  17      -4.296 -27.509 -12.440  0.00  0.00              
ATOM   4067  C3  NAN E  17      -5.819 -27.401 -12.730  0.00  0.00              
ATOM   4068  C4  NAN E  17      -6.608 -28.589 -12.134  0.00  0.00              
ATOM   4069  C5  NAN E  17      -6.307 -28.765 -10.630  0.00  0.00              
ATOM   4070  C6  NAN E  17      -4.775 -28.857 -10.373  0.00  0.00              
ATOM   4071  C7  NAN E  17      -4.398 -28.886  -8.869  0.00  0.00              
ATOM   4072  C8  NAN E  17      -2.908 -29.222  -8.616  0.00  0.00              
ATOM   4073  C9  NAN E  17      -2.533 -29.277  -7.129  0.00  0.00              
ATOM   4074  OW  NAN E  17      -4.102 -27.711 -11.006  0.00  0.00              
ATOM   4075  OM  NAN E  17      -4.010 -29.231 -14.217  0.00  0.00              
ATOM   4076  O1h NAN E  17      -2.193 -28.627 -12.987  0.00  0.00              
ATOM   4077  O4h NAN E  17      -7.996 -28.351 -12.313  0.00  0.00              
ATOM   4078  O7h NAN E  17      -4.690 -27.605  -8.313  0.00  0.00              
ATOM   4079  O8h NAN E  17      -2.601 -30.504  -9.144  0.00  0.00              
ATOM   4080  O9h NAN E  17      -1.166 -29.662  -6.984  0.00  0.00              
ATOM   4081  H6  NAN E  17      -4.412 -29.796 -10.836  0.00  0.00              
ATOM   4082  H3  NAN E  17      -6.203 -26.462 -12.288  0.00  0.00              
ATOM   4083  H21 NAN E  17      -5.996 -27.312 -13.818  0.00  0.00              
ATOM   4084  H4  NAN E  17      -6.326 -29.520 -12.670  0.00  0.00              
ATOM   4085  H7o NAN E  17      -4.465 -26.990  -9.018  0.00  0.00              
ATOM   4086  H8o NAN E  17      -1.834 -30.777  -8.630  0.00  0.00              
ATOM   4087  H4o NAN E  17      -8.102 -28.078 -13.228  0.00  0.00              
ATOM   4088  H9o NAN E  17      -0.941 -29.559  -6.053  0.00  0.00              
ATOM   4089  H9R NAN E  17      -3.189 -29.992  -6.593  0.00  0.00              
ATOM   4090  H9S NAN E  17      -2.705 -28.289  -6.659  0.00  0.00              
ATOM   4091  H8  NAN E  17      -2.271 -28.466  -9.118  0.00  0.00              
ATOM   4092  H7  NAN E  17      -5.018 -29.652  -8.362  0.00  0.00              
ATOM   4093  H1o NAN E  17      -1.791 -29.294 -13.543  0.00  0.00              
ATOM   4094  H5  NAN E  17      -6.712 -27.892 -10.079  0.00  0.00              
ATOM   4095  N33 NAN E  17      -6.979 -29.963 -10.182  0.00  0.00              
ATOM   4096  C34 NAN E  17      -8.229 -29.881  -9.623  0.00  0.00              
ATOM   4097  C35 NAN E  17      -8.804 -31.218  -9.195  0.00  0.00              
ATOM   4098  OM  NAN E  17      -8.842 -28.842  -9.467  0.00  0.00              
ATOM   4099  H37 NAN E  17      -6.520 -30.879 -10.282  0.00  0.00              
ATOM   4100  H35 NAN E  17      -9.820 -31.091  -8.758  0.00  0.00              
ATOM   4101  H39 NAN E  17      -8.152 -31.688  -8.423  0.00  0.00              
ATOM   4102  H40 NAN E  17      -8.886 -31.902 -10.070  0.00  0.00              
ATOM   4103  C1  AFL E  18      12.248 -12.919 -15.382  0.00  0.00              
ATOM   4104  C2  AFL E  18      13.527 -13.651 -15.831  0.00  0.00              
ATOM   4105  C3  AFL E  18      13.284 -14.408 -17.144  0.00  0.00              
ATOM   4106  C4  AFL E  18      12.701 -13.442 -18.190  0.00  0.00              
ATOM   4107  C5  AFL E  18      11.450 -12.756 -17.621  0.00  0.00              
ATOM   4108  C6  AFL E  18      10.819 -11.736 -18.577  0.00  0.00              
ATOM   4109  OR  AFL E  18      11.747 -12.056 -16.406  0.00  0.00              
ATOM   4110  O2h AFL E  18      13.963 -14.476 -14.754  0.00  0.00              
ATOM   4111  O3h AFL E  18      14.495 -15.029 -17.562  0.00  0.00              
ATOM   4112  O4h AFL E  18      13.637 -12.429 -18.556  0.00  0.00              
ATOM   4113  H5  AFL E  18      10.688 -13.535 -17.427  0.00  0.00              
ATOM   4114  H1  AFL E  18      12.479 -12.262 -14.534  0.00  0.00              
ATOM   4115  H2  AFL E  18      14.302 -12.881 -16.019  0.00  0.00              
ATOM   4116  H2o AFL E  18      14.835 -14.809 -15.003  0.00  0.00              
ATOM   4117  H3  AFL E  18      12.537 -15.201 -16.945  0.00  0.00              
ATOM   4118  H3o AFL E  18      14.258 -15.646 -18.267  0.00  0.00              
ATOM   4119  H4  AFL E  18      12.416 -14.000 -19.103  0.00  0.00              
ATOM   4120  H4o AFL E  18      14.367 -12.880 -19.003  0.00  0.00              
ATOM   4121  H6  AFL E  18      10.571 -12.184 -19.552  0.00  0.00              
ATOM   4122  H22 AFL E  18       9.892 -11.333 -18.140  0.00  0.00              
ATOM   4123  H23 AFL E  18      11.502 -10.890 -18.752  0.00  0.00              
TER
CONECT 1523 1524 1548 1533  110
CONECT 1524 1523 1525 1537 1536
CONECT 1525 1524 1526 1538 1531
CONECT 1526 1525 1527 1539 1532
CONECT 1527 1526 1528 1540 1533
CONECT 1528 1527 1541 1542 1534
CONECT 1529 1530 1536 1535
CONECT 1530 1529 1543 1544 1545
CONECT 1531 1525 1546
CONECT 1532 1526 1549
CONECT 1533 1523 1527
CONECT 1534 1528 2028
CONECT 1535 1529
CONECT 1536 1524 1529 1547
CONECT 1537 1524
CONECT 1538 1525
CONECT 1539 1526
CONECT 1540 1527
CONECT 1541 1528
CONECT 1542 1528
CONECT 1543 1530
CONECT 1544 1530
CONECT 1545 1530
CONECT 1546 1531
CONECT 1547 1536
CONECT 1548 1523
CONECT 1549 1532 1550 1575 1559
CONECT 1550 1549 1551 1563 1562
CONECT 1551 1550 1552 1564 1557
CONECT 1552 1551 1553 1565 1558
CONECT 1553 1552 1554 1566 1559
CONECT 1554 1553 1567 1568 1560
CONECT 1555 1556 1562 1561
CONECT 1556 1555 1569 1570 1571
CONECT 1557 1551 1572
CONECT 1558 1552 1576
CONECT 1559 1549 1553
CONECT 1560 1554 1573
CONECT 1561 1555
CONECT 1562 1550 1555 1574
CONECT 1563 1550
CONECT 1564 1551
CONECT 1565 1552
CONECT 1566 1553
CONECT 1567 1554
CONECT 1568 1554
CONECT 1569 1556
CONECT 1570 1556
CONECT 1571 1556
CONECT 1572 1557
CONECT 1573 1560
CONECT 1574 1562
CONECT 1575 1549
CONECT 1576 1558 1577 1584 1594
CONECT 1577 1576 1578 1587 1592
CONECT 1578 1577 1579 1582 1593
CONECT 1579 1578 1583 1580 1595
CONECT 1580 1579 1584 1581 1589
CONECT 1581 1580 1590 1591 1585
CONECT 1582 1578 1596
CONECT 1583 1579 1586
CONECT 1584 1576 1580
CONECT 1585 1581 1788
CONECT 1586 1583
CONECT 1587 1577 1588
CONECT 1588 1587
CONECT 1589 1580
CONECT 1590 1581
CONECT 1591 1581
CONECT 1592 1577
CONECT 1593 1578
CONECT 1594 1576
CONECT 1595 1579
CONECT 1596 1582 1597 1604 1612
CONECT 1597 1596 1598 1608 1613
CONECT 1598 1597 1599 1602 1614
CONECT 1599 1598 1603 1600 1615
CONECT 1600 1599 1604 1601 1609
CONECT 1601 1600 1610 1611 1605
CONECT 1602 1598 1606
CONECT 1603 1599 1702
CONECT 1604 1596 1600
CONECT 1605 1601 1607
CONECT 1606 1602
CONECT 1607 1605
CONECT 1608 1597 1616
CONECT 1609 1600
CONECT 1610 1601
CONECT 1611 1601
CONECT 1612 1596
CONECT 1613 1597
CONECT 1614 1598
CONECT 1615 1599
CONECT 1616 1608 1617 1642 1626
CONECT 1617 1616 1618 1630 1629
CONECT 1618 1617 1619 1631 1624
CONECT 1619 1618 1620 1632 1625
CONECT 1620 1619 1621 1633 1626
CONECT 1621 1620 1634 1635 1627
CONECT 1622 1623 1629 1628
CONECT 1623 1622 1636 1637 1638
CONECT 1624 1618 1639
CONECT 1625 1619 1643
CONECT 1626 1616 1620
CONECT 1627 1621 1640
CONECT 1628 1622
CONECT 1629 1617 1622 1641
CONECT 1630 1617
CONECT 1631 1618
CONECT 1632 1619
CONECT 1633 1620
CONECT 1634 1621
CONECT 1635 1621
CONECT 1636 1623
CONECT 1637 1623
CONECT 1638 1623
CONECT 1639 1624
CONECT 1640 1627
CONECT 1641 1629
CONECT 1642 1616
CONECT 1643 1625 1644 1651 1660
CONECT 1644 1643 1645 1649 1661
CONECT 1645 1644 1646 1650 1662
CONECT 1646 1645 1655 1647 1663
CONECT 1647 1646 1651 1648 1657
CONECT 1648 1647 1658 1659 1652
CONECT 1649 1644 1653
CONECT 1650 1645 1665
CONECT 1651 1643 1647
CONECT 1652 1648 1654
CONECT 1653 1649
CONECT 1654 1652
CONECT 1655 1646 1656
CONECT 1656 1655
CONECT 1657 1647
CONECT 1658 1648
CONECT 1659 1648
CONECT 1660 1643
CONECT 1661 1644
CONECT 1662 1645
CONECT 1663 1646
CONECT 1664 1665 1674 1675
CONECT 1665 1650 1664 1666 1673
CONECT 1666 1665 1667 1681 1682
CONECT 1667 1666 1668 1676 1683
CONECT 1668 1667 1669 1693 1694
CONECT 1669 1668 1670 1673 1680
CONECT 1670 1669 1671 1677 1691
CONECT 1671 1670 1672 1678 1690
CONECT 1672 1671 1679 1688 1689
CONECT 1673 1665 1669
CONECT 1674 1664
CONECT 1675 1664 1692
CONECT 1676 1667 1686
CONECT 1677 1670 1684
CONECT 1678 1671 1685
CONECT 1679 1672 1687
CONECT 1680 1669
CONECT 1681 1666
CONECT 1682 1666
CONECT 1683 1667
CONECT 1684 1677
CONECT 1685 1678
CONECT 1686 1676
CONECT 1687 1679
CONECT 1688 1672
CONECT 1689 1672
CONECT 1690 1671
CONECT 1691 1670
CONECT 1692 1675
CONECT 1693 1668
CONECT 1694 1668 1695 1698
CONECT 1695 1694 1696 1697
CONECT 1696 1695 1699 1700 1701
CONECT 1697 1695
CONECT 1698 1694
CONECT 1699 1696
CONECT 1700 1696
CONECT 1701 1696
CONECT 1702 1603 1703 1728 1712
CONECT 1703 1702 1704 1716 1715
CONECT 1704 1703 1705 1717 1710
CONECT 1705 1704 1706 1718 1711
CONECT 1706 1705 1707 1719 1712
CONECT 1707 1706 1720 1721 1713
CONECT 1708 1709 1715 1714
CONECT 1709 1708 1722 1723 1724
CONECT 1710 1704 1725
CONECT 1711 1705 1729
CONECT 1712 1702 1706
CONECT 1713 1707 1726
CONECT 1714 1708
CONECT 1715 1703 1708 1727
CONECT 1716 1703
CONECT 1717 1704
CONECT 1718 1705
CONECT 1719 1706
CONECT 1720 1707
CONECT 1721 1707
CONECT 1722 1709
CONECT 1723 1709
CONECT 1724 1709
CONECT 1725 1710
CONECT 1726 1713
CONECT 1727 1715
CONECT 1728 1702
CONECT 1729 1711 1730 1737 1746
CONECT 1730 1729 1731 1735 1747
CONECT 1731 1730 1732 1736 1748
CONECT 1732 1731 1741 1733 1749
CONECT 1733 1732 1737 1734 1743
CONECT 1734 1733 1744 1745 1738
CONECT 1735 1730 1739
CONECT 1736 1731 1751
CONECT 1737 1729 1733
CONECT 1738 1734 1740
CONECT 1739 1735
CONECT 1740 1738
CONECT 1741 1732 1742
CONECT 1742 1741
CONECT 1743 1733
CONECT 1744 1734
CONECT 1745 1734
CONECT 1746 1729
CONECT 1747 1730
CONECT 1748 1731
CONECT 1749 1732
CONECT 1750 1751 1760 1761
CONECT 1751 1736 1750 1752 1759
CONECT 1752 1751 1753 1767 1768
CONECT 1753 1752 1754 1762 1769
CONECT 1754 1753 1755 1779 1780
CONECT 1755 1754 1756 1759 1766
CONECT 1756 1755 1757 1763 1777
CONECT 1757 1756 1758 1764 1776
CONECT 1758 1757 1765 1774 1775
CONECT 1759 1751 1755
CONECT 1760 1750
CONECT 1761 1750 1778
CONECT 1762 1753 1772
CONECT 1763 1756 1770
CONECT 1764 1757 1771
CONECT 1765 1758 1773
CONECT 1766 1755
CONECT 1767 1752
CONECT 1768 1752
CONECT 1769 1753
CONECT 1770 1763
CONECT 1771 1764
CONECT 1772 1762
CONECT 1773 1765
CONECT 1774 1758
CONECT 1775 1758
CONECT 1776 1757
CONECT 1777 1756
CONECT 1778 1761
CONECT 1779 1754
CONECT 1780 1754 1781 1784
CONECT 1781 1780 1782 1783
CONECT 1782 1781 1785 1786 1787
CONECT 1783 1781
CONECT 1784 1780
CONECT 1785 1782
CONECT 1786 1782
CONECT 1787 1782
CONECT 1788 1585 1789 1796 1804
CONECT 1789 1788 1790 1800 1805
CONECT 1790 1789 1791 1794 1806
CONECT 1791 1790 1795 1792 1807
CONECT 1792 1791 1796 1793 1801
CONECT 1793 1792 1802 1803 1797
CONECT 1794 1790 1798
CONECT 1795 1791 1799
CONECT 1796 1788 1792
CONECT 1797 1793 1894
CONECT 1798 1794
CONECT 1799 1795
CONECT 1800 1789 1808
CONECT 1801 1792
CONECT 1802 1793
CONECT 1803 1793
CONECT 1804 1788
CONECT 1805 1789
CONECT 1806 1790
CONECT 1807 1791
CONECT 1808 1800 1809 1834 1818
CONECT 1809 1808 1810 1822 1821
CONECT 1810 1809 1811 1823 1816
CONECT 1811 1810 1812 1824 1817
CONECT 1812 1811 1813 1825 1818
CONECT 1813 1812 1826 1827 1819
CONECT 1814 1815 1821 1820
CONECT 1815 1814 1828 1829 1830
CONECT 1816 1810 1831
CONECT 1817 1811 1835
CONECT 1818 1808 1812
CONECT 1819 1813 1832
CONECT 1820 1814
CONECT 1821 1809 1814 1833
CONECT 1822 1809
CONECT 1823 1810
CONECT 1824 1811
CONECT 1825 1812
CONECT 1826 1813
CONECT 1827 1813
CONECT 1828 1815
CONECT 1829 1815
CONECT 1830 1815
CONECT 1831 1816
CONECT 1832 1819
CONECT 1833 1821
CONECT 1834 1808
CONECT 1835 1817 1836 1843 1852
CONECT 1836 1835 1837 1841 1853
CONECT 1837 1836 1838 1842 1854
CONECT 1838 1837 1847 1839 1855
CONECT 1839 1838 1843 1840 1849
CONECT 1840 1839 1850 1851 1844
CONECT 1841 1836 1845
CONECT 1842 1837 1857
CONECT 1843 1835 1839
CONECT 1844 1840 1846
CONECT 1845 1841
CONECT 1846 1844
CONECT 1847 1838 1848
CONECT 1848 1847
CONECT 1849 1839
CONECT 1850 1840
CONECT 1851 1840
CONECT 1852 1835
CONECT 1853 1836
CONECT 1854 1837
CONECT 1855 1838
CONECT 1856 1857 1866 1867
CONECT 1857 1842 1856 1858 1865
CONECT 1858 1857 1859 1873 1874
CONECT 1859 1858 1860 1868 1875
CONECT 1860 1859 1861 1885 1886
CONECT 1861 1860 1862 1865 1872
CONECT 1862 1861 1863 1869 1883
CONECT 1863 1862 1864 1870 1882
CONECT 1864 1863 1871 1880 1881
CONECT 1865 1857 1861
CONECT 1866 1856
CONECT 1867 1856 1884
CONECT 1868 1859 1878
CONECT 1869 1862 1876
CONECT 1870 1863 1877
CONECT 1871 1864 1879
CONECT 1872 1861
CONECT 1873 1858
CONECT 1874 1858
CONECT 1875 1859
CONECT 1876 1869
CONECT 1877 1870
CONECT 1878 1868
CONECT 1879 1871
CONECT 1880 1864
CONECT 1881 1864
CONECT 1882 1863
CONECT 1883 1862
CONECT 1884 1867
CONECT 1885 1860
CONECT 1886 1860 1887 1890
CONECT 1887 1886 1888 1889
CONECT 1888 1887 1891 1892 1893
CONECT 1889 1887
CONECT 1890 1886
CONECT 1891 1888
CONECT 1892 1888
CONECT 1893 1888
CONECT 1894 1797 1895 1920 1904
CONECT 1895 1894 1896 1908 1907
CONECT 1896 1895 1897 1909 1902
CONECT 1897 1896 1898 1910 1903
CONECT 1898 1897 1899 1911 1904
CONECT 1899 1898 1912 1913 1905
CONECT 1900 1901 1907 1906
CONECT 1901 1900 1914 1915 1916
CONECT 1902 1896 1917
CONECT 1903 1897 1921
CONECT 1904 1894 1898
CONECT 1905 1899 1918
CONECT 1906 1900
CONECT 1907 1895 1900 1919
CONECT 1908 1895
CONECT 1909 1896
CONECT 1910 1897
CONECT 1911 1898
CONECT 1912 1899
CONECT 1913 1899
CONECT 1914 1901
CONECT 1915 1901
CONECT 1916 1901
CONECT 1917 1902
CONECT 1918 1905
CONECT 1919 1907
CONECT 1920 1894
CONECT 1921 1903 1922 1929 1938
CONECT 1922 1921 1923 1927 1939
CONECT 1923 1922 1924 1928 1940
CONECT 1924 1923 1933 1925 1941
CONECT 1925 1924 1929 1926 1935
CONECT 1926 1925 1936 1937 1930
CONECT 1927 1922 1931
CONECT 1928 1923 1942
CONECT 1929 1921 1925
CONECT 1930 1926 1932
CONECT 1931 1927
CONECT 1932 1930
CONECT 1933 1924 1934
CONECT 1934 1933
CONECT 1935 1925
CONECT 1936 1926
CONECT 1937 1926
CONECT 1938 1921
CONECT 1939 1922
CONECT 1940 1923
CONECT 1941 1924
CONECT 1942 1928 1943 1968 1952
CONECT 1943 1942 1944 1956 1955
CONECT 1944 1943 1945 1957 1950
CONECT 1945 1944 1946 1958 1951
CONECT 1946 1945 1947 1959 1952
CONECT 1947 1946 1960 1961 1953
CONECT 1948 1949 1955 1954
CONECT 1949 1948 1962 1963 1964
CONECT 1950 1944 1965
CONECT 1951 1945 1969
CONECT 1952 1942 1946
CONECT 1953 1947 1966
CONECT 1954 1948
CONECT 1955 1943 1948 1967
CONECT 1956 1943
CONECT 1957 1944
CONECT 1958 1945
CONECT 1959 1946
CONECT 1960 1947
CONECT 1961 1947
CONECT 1962 1949
CONECT 1963 1949
CONECT 1964 1949
CONECT 1965 1950
CONECT 1966 1953
CONECT 1967 1955
CONECT 1968 1942
CONECT 1969 1951 1970 1977 1986
CONECT 1970 1969 1971 1975 1987
CONECT 1971 1970 1972 1976 1988
CONECT 1972 1971 1981 1973 1989
CONECT 1973 1972 1977 1974 1983
CONECT 1974 1973 1984 1985 1978
CONECT 1975 1970 1979
CONECT 1976 1971 1991
CONECT 1977 1969 1973
CONECT 1978 1974 1980
CONECT 1979 1975
CONECT 1980 1978
CONECT 1981 1972 1982
CONECT 1982 1981
CONECT 1983 1973
CONECT 1984 1974
CONECT 1985 1974
CONECT 1986 1969
CONECT 1987 1970
CONECT 1988 1971
CONECT 1989 1972
CONECT 1990 1991 2000 2001
CONECT 1991 1976 1990 1992 1999
CONECT 1992 1991 1993 2007 2008
CONECT 1993 1992 1994 2002 2009
CONECT 1994 1993 1995 2019 2020
CONECT 1995 1994 1996 1999 2006
CONECT 1996 1995 1997 2003 2017
CONECT 1997 1996 1998 2004 2016
CONECT 1998 1997 2005 2014 2015
CONECT 1999 1991 1995
CONECT 2000 1990
CONECT 2001 1990 2018
CONECT 2002 1993 2012
CONECT 2003 1996 2010
CONECT 2004 1997 2011
CONECT 2005 1998 2013
CONECT 2006 1995
CONECT 2007 1992
CONECT 2008 1992
CONECT 2009 1993
CONECT 2010 2003
CONECT 2011 2004
CONECT 2012 2002
CONECT 2013 2005
CONECT 2014 1998
CONECT 2015 1998
CONECT 2016 1997
CONECT 2017 1996
CONECT 2018 2001
CONECT 2019 1994
CONECT 2020 1994 2021 2024
CONECT 2021 2020 2022 2023
CONECT 2022 2021 2025 2026 2027
CONECT 2023 2021
CONECT 2024 2020
CONECT 2025 2022
CONECT 2026 2022
CONECT 2027 2022
CONECT 2028 1534 2029 2034 2039
CONECT 2029 2028 2030 2035 2040
CONECT 2030 2029 2031 2036 2042
CONECT 2031 2030 2032 2037 2044
CONECT 2032 2031 2033 2034 2038
CONECT 2033 2032 2046 2047 2048
CONECT 2034 2028 2032
CONECT 2035 2029 2041
CONECT 2036 2030 2043
CONECT 2037 2031 2045
CONECT 2038 2032
CONECT 2039 2028
CONECT 2040 2029
CONECT 2041 2035
CONECT 2042 2030
CONECT 2043 2036
CONECT 2044 2031
CONECT 2045 2037
CONECT 2046 2033
CONECT 2047 2033
CONECT 2048 2033
CONECT 2049 2050 2075 2059  304
CONECT 2050 2049 2051 2063 2062
CONECT 2051 2050 2052 2064 2057
CONECT 2052 2051 2053 2065 2058
CONECT 2053 2052 2054 2066 2059
CONECT 2054 2053 2067 2068 2060
CONECT 2055 2056 2062 2061
CONECT 2056 2055 2069 2070 2071
CONECT 2057 2051 2072
CONECT 2058 2052 2076
CONECT 2059 2049 2053
CONECT 2060 2054 2073
CONECT 2061 2055
CONECT 2062 2050 2055 2074
CONECT 2063 2050
CONECT 2064 2051
CONECT 2065 2052
CONECT 2066 2053
CONECT 2067 2054
CONECT 2068 2054
CONECT 2069 2056
CONECT 2070 2056
CONECT 2071 2056
CONECT 2072 2057
CONECT 2073 2060
CONECT 2074 2062
CONECT 2075 2049
CONECT 2076 2058 2077 2102 2086
CONECT 2077 2076 2078 2090 2089
CONECT 2078 2077 2079 2091 2084
CONECT 2079 2078 2080 2092 2085
CONECT 2080 2079 2081 2093 2086
CONECT 2081 2080 2094 2095 2087
CONECT 2082 2083 2089 2088
CONECT 2083 2082 2096 2097 2098
CONECT 2084 2078 2099
CONECT 2085 2079 2103
CONECT 2086 2076 2080
CONECT 2087 2081 2100
CONECT 2088 2082
CONECT 2089 2077 2082 2101
CONECT 2090 2077
CONECT 2091 2078
CONECT 2092 2079
CONECT 2093 2080
CONECT 2094 2081
CONECT 2095 2081
CONECT 2096 2083
CONECT 2097 2083
CONECT 2098 2083
CONECT 2099 2084
CONECT 2100 2087
CONECT 2101 2089
CONECT 2102 2076
CONECT 2103 2085 2104 2111 2121
CONECT 2104 2103 2105 2114 2119
CONECT 2105 2104 2106 2109 2120
CONECT 2106 2105 2110 2107 2122
CONECT 2107 2106 2111 2108 2116
CONECT 2108 2107 2117 2118 2112
CONECT 2109 2105 2123
CONECT 2110 2106 2113
CONECT 2111 2103 2107
CONECT 2112 2108 2315
CONECT 2113 2110
CONECT 2114 2104 2115
CONECT 2115 2114
CONECT 2116 2107
CONECT 2117 2108
CONECT 2118 2108
CONECT 2119 2104
CONECT 2120 2105
CONECT 2121 2103
CONECT 2122 2106
CONECT 2123 2109 2124 2131 2139
CONECT 2124 2123 2125 2135 2140
CONECT 2125 2124 2126 2129 2141
CONECT 2126 2125 2130 2127 2142
CONECT 2127 2126 2131 2128 2136
CONECT 2128 2127 2137 2138 2132
CONECT 2129 2125 2133
CONECT 2130 2126 2134
CONECT 2131 2123 2127
CONECT 2132 2128 2229
CONECT 2133 2129
CONECT 2134 2130
CONECT 2135 2124 2143
CONECT 2136 2127
CONECT 2137 2128
CONECT 2138 2128
CONECT 2139 2123
CONECT 2140 2124
CONECT 2141 2125
CONECT 2142 2126
CONECT 2143 2135 2144 2169 2153
CONECT 2144 2143 2145 2157 2156
CONECT 2145 2144 2146 2158 2151
CONECT 2146 2145 2147 2159 2152
CONECT 2147 2146 2148 2160 2153
CONECT 2148 2147 2161 2162 2154
CONECT 2149 2150 2156 2155
CONECT 2150 2149 2163 2164 2165
CONECT 2151 2145 2166
CONECT 2152 2146 2170
CONECT 2153 2143 2147
CONECT 2154 2148 2167
CONECT 2155 2149
CONECT 2156 2144 2149 2168
CONECT 2157 2144
CONECT 2158 2145
CONECT 2159 2146
CONECT 2160 2147
CONECT 2161 2148
CONECT 2162 2148
CONECT 2163 2150
CONECT 2164 2150
CONECT 2165 2150
CONECT 2166 2151
CONECT 2167 2154
CONECT 2168 2156
CONECT 2169 2143
CONECT 2170 2152 2171 2178 2187
CONECT 2171 2170 2172 2176 2188
CONECT 2172 2171 2173 2177 2189
CONECT 2173 2172 2182 2174 2190
CONECT 2174 2173 2178 2175 2184
CONECT 2175 2174 2185 2186 2179
CONECT 2176 2171 2180
CONECT 2177 2172 2181
CONECT 2178 2170 2174
CONECT 2179 2175 2192
CONECT 2180 2176
CONECT 2181 2177
CONECT 2182 2173 2183
CONECT 2183 2182
CONECT 2184 2174
CONECT 2185 2175
CONECT 2186 2175
CONECT 2187 2170
CONECT 2188 2171
CONECT 2189 2172
CONECT 2190 2173
CONECT 2191 2192 2201 2202
CONECT 2192 2179 2191 2193 2200
CONECT 2193 2192 2194 2208 2209
CONECT 2194 2193 2195 2203 2210
CONECT 2195 2194 2196 2220 2221
CONECT 2196 2195 2197 2200 2207
CONECT 2197 2196 2198 2204 2218
CONECT 2198 2197 2199 2205 2217
CONECT 2199 2198 2206 2215 2216
CONECT 2200 2192 2196
CONECT 2201 2191
CONECT 2202 2191 2219
CONECT 2203 2194 2213
CONECT 2204 2197 2211
CONECT 2205 2198 2212
CONECT 2206 2199 2214
CONECT 2207 2196
CONECT 2208 2193
CONECT 2209 2193
CONECT 2210 2194
CONECT 2211 2204
CONECT 2212 2205
CONECT 2213 2203
CONECT 2214 2206
CONECT 2215 2199
CONECT 2216 2199
CONECT 2217 2198
CONECT 2218 2197
CONECT 2219 2202
CONECT 2220 2195
CONECT 2221 2195 2222 2225
CONECT 2222 2221 2223 2224
CONECT 2223 2222 2226 2227 2228
CONECT 2224 2222
CONECT 2225 2221
CONECT 2226 2223
CONECT 2227 2223
CONECT 2228 2223
CONECT 2229 2132 2230 2255 2239
CONECT 2230 2229 2231 2243 2242
CONECT 2231 2230 2232 2244 2237
CONECT 2232 2231 2233 2245 2238
CONECT 2233 2232 2234 2246 2239
CONECT 2234 2233 2247 2248 2240
CONECT 2235 2236 2242 2241
CONECT 2236 2235 2249 2250 2251
CONECT 2237 2231 2252
CONECT 2238 2232 2256
CONECT 2239 2229 2233
CONECT 2240 2234 2253
CONECT 2241 2235
CONECT 2242 2230 2235 2254
CONECT 2243 2230
CONECT 2244 2231
CONECT 2245 2232
CONECT 2246 2233
CONECT 2247 2234
CONECT 2248 2234
CONECT 2249 2236
CONECT 2250 2236
CONECT 2251 2236
CONECT 2252 2237
CONECT 2253 2240
CONECT 2254 2242
CONECT 2255 2229
CONECT 2256 2238 2257 2264 2273
CONECT 2257 2256 2258 2262 2274
CONECT 2258 2257 2259 2263 2275
CONECT 2259 2258 2268 2260 2276
CONECT 2260 2259 2264 2261 2270
CONECT 2261 2260 2271 2272 2265
CONECT 2262 2257 2266
CONECT 2263 2258 2267
CONECT 2264 2256 2260
CONECT 2265 2261 2278
CONECT 2266 2262
CONECT 2267 2263
CONECT 2268 2259 2269
CONECT 2269 2268
CONECT 2270 2260
CONECT 2271 2261
CONECT 2272 2261
CONECT 2273 2256
CONECT 2274 2257
CONECT 2275 2258
CONECT 2276 2259
CONECT 2277 2278 2287 2288
CONECT 2278 2265 2277 2279 2286
CONECT 2279 2278 2280 2294 2295
CONECT 2280 2279 2281 2289 2296
CONECT 2281 2280 2282 2306 2307
CONECT 2282 2281 2283 2286 2293
CONECT 2283 2282 2284 2290 2304
CONECT 2284 2283 2285 2291 2303
CONECT 2285 2284 2292 2301 2302
CONECT 2286 2278 2282
CONECT 2287 2277
CONECT 2288 2277 2305
CONECT 2289 2280 2299
CONECT 2290 2283 2297
CONECT 2291 2284 2298
CONECT 2292 2285 2300
CONECT 2293 2282
CONECT 2294 2279
CONECT 2295 2279
CONECT 2296 2280
CONECT 2297 2290
CONECT 2298 2291
CONECT 2299 2289
CONECT 2300 2292
CONECT 2301 2285
CONECT 2302 2285
CONECT 2303 2284
CONECT 2304 2283
CONECT 2305 2288
CONECT 2306 2281
CONECT 2307 2281 2308 2311
CONECT 2308 2307 2309 2310
CONECT 2309 2308 2312 2313 2314
CONECT 2310 2308
CONECT 2311 2307
CONECT 2312 2309
CONECT 2313 2309
CONECT 2314 2309
CONECT 2315 2112 2316 2323 2332
CONECT 2316 2315 2317 2328 2333
CONECT 2317 2316 2318 2321 2334
CONECT 2318 2317 2322 2319 2335
CONECT 2319 2318 2323 2320 2329
CONECT 2320 2319 2330 2331 2324
CONECT 2321 2317 2325
CONECT 2322 2318 2326
CONECT 2323 2315 2319
CONECT 2324 2320 2327
CONECT 2325 2321
CONECT 2326 2322
CONECT 2327 2324
CONECT 2328 2316 2336
CONECT 2329 2319
CONECT 2330 2320
CONECT 2331 2320
CONECT 2332 2315
CONECT 2333 2316
CONECT 2334 2317
CONECT 2335 2318
CONECT 2336 2328 2337 2362 2346
CONECT 2337 2336 2338 2350 2349
CONECT 2338 2337 2339 2351 2344
CONECT 2339 2338 2340 2352 2345
CONECT 2340 2339 2341 2353 2346
CONECT 2341 2340 2354 2355 2347
CONECT 2342 2343 2349 2348
CONECT 2343 2342 2356 2357 2358
CONECT 2344 2338 2359
CONECT 2345 2339 2363
CONECT 2346 2336 2340
CONECT 2347 2341 2360
CONECT 2348 2342
CONECT 2349 2337 2342 2361
CONECT 2350 2337
CONECT 2351 2338
CONECT 2352 2339
CONECT 2353 2340
CONECT 2354 2341
CONECT 2355 2341
CONECT 2356 2343
CONECT 2357 2343
CONECT 2358 2343
CONECT 2359 2344
CONECT 2360 2347
CONECT 2361 2349
CONECT 2362 2336
CONECT 2363 2345 2364 2371 2380
CONECT 2364 2363 2365 2369 2381
CONECT 2365 2364 2366 2370 2382
CONECT 2366 2365 2375 2367 2383
CONECT 2367 2366 2371 2368 2377
CONECT 2368 2367 2378 2379 2372
CONECT 2369 2364 2373
CONECT 2370 2365 2385
CONECT 2371 2363 2367
CONECT 2372 2368 2374
CONECT 2373 2369
CONECT 2374 2372
CONECT 2375 2366 2376
CONECT 2376 2375
CONECT 2377 2367
CONECT 2378 2368
CONECT 2379 2368
CONECT 2380 2363
CONECT 2381 2364
CONECT 2382 2365
CONECT 2383 2366
CONECT 2384 2385 2394 2395
CONECT 2385 2370 2384 2386 2393
CONECT 2386 2385 2387 2401 2402
CONECT 2387 2386 2388 2396 2403
CONECT 2388 2387 2389 2413 2414
CONECT 2389 2388 2390 2393 2400
CONECT 2390 2389 2391 2397 2411
CONECT 2391 2390 2392 2398 2410
CONECT 2392 2391 2399 2408 2409
CONECT 2393 2385 2389
CONECT 2394 2384
CONECT 2395 2384 2412
CONECT 2396 2387 2406
CONECT 2397 2390 2404
CONECT 2398 2391 2405
CONECT 2399 2392 2407
CONECT 2400 2389
CONECT 2401 2386
CONECT 2402 2386
CONECT 2403 2387
CONECT 2404 2397
CONECT 2405 2398
CONECT 2406 2396
CONECT 2407 2399
CONECT 2408 2392
CONECT 2409 2392
CONECT 2410 2391
CONECT 2411 2390
CONECT 2412 2395
CONECT 2413 2388
CONECT 2414 2388 2415 2418
CONECT 2415 2414 2416 2417
CONECT 2416 2415 2419 2420 2421
CONECT 2417 2415
CONECT 2418 2414
CONECT 2419 2416
CONECT 2420 2416
CONECT 2421 2416
CONECT 2422 2423 2447 2432  440
CONECT 2423 2422 2424 2436 2435
CONECT 2424 2423 2425 2437 2430
CONECT 2425 2424 2426 2438 2431
CONECT 2426 2425 2427 2439 2432
CONECT 2427 2426 2440 2441 2433
CONECT 2428 2429 2435 2434
CONECT 2429 2428 2442 2443 2444
CONECT 2430 2424 2445
CONECT 2431 2425 2448
CONECT 2432 2422 2426
CONECT 2433 2427 2927
CONECT 2434 2428
CONECT 2435 2423 2428 2446
CONECT 2436 2423
CONECT 2437 2424
CONECT 2438 2425
CONECT 2439 2426
CONECT 2440 2427
CONECT 2441 2427
CONECT 2442 2429
CONECT 2443 2429
CONECT 2444 2429
CONECT 2445 2430
CONECT 2446 2435
CONECT 2447 2422
CONECT 2448 2431 2449 2474 2458
CONECT 2449 2448 2450 2462 2461
CONECT 2450 2449 2451 2463 2456
CONECT 2451 2450 2452 2464 2457
CONECT 2452 2451 2453 2465 2458
CONECT 2453 2452 2466 2467 2459
CONECT 2454 2455 2461 2460
CONECT 2455 2454 2468 2469 2470
CONECT 2456 2450 2471
CONECT 2457 2451 2475
CONECT 2458 2448 2452
CONECT 2459 2453 2472
CONECT 2460 2454
CONECT 2461 2449 2454 2473
CONECT 2462 2449
CONECT 2463 2450
CONECT 2464 2451
CONECT 2465 2452
CONECT 2466 2453
CONECT 2467 2453
CONECT 2468 2455
CONECT 2469 2455
CONECT 2470 2455
CONECT 2471 2456
CONECT 2472 2459
CONECT 2473 2461
CONECT 2474 2448
CONECT 2475 2457 2476 2483 2493
CONECT 2476 2475 2477 2486 2491
CONECT 2477 2476 2478 2481 2492
CONECT 2478 2477 2482 2479 2494
CONECT 2479 2478 2483 2480 2488
CONECT 2480 2479 2489 2490 2484
CONECT 2481 2477 2495
CONECT 2482 2478 2485
CONECT 2483 2475 2479
CONECT 2484 2480 2687
CONECT 2485 2482
CONECT 2486 2476 2487
CONECT 2487 2486
CONECT 2488 2479
CONECT 2489 2480
CONECT 2490 2480
CONECT 2491 2476
CONECT 2492 2477
CONECT 2493 2475
CONECT 2494 2478
CONECT 2495 2481 2496 2503 2511
CONECT 2496 2495 2497 2507 2512
CONECT 2497 2496 2498 2501 2513
CONECT 2498 2497 2502 2499 2514
CONECT 2499 2498 2503 2500 2508
CONECT 2500 2499 2509 2510 2504
CONECT 2501 2497 2505
CONECT 2502 2498 2601
CONECT 2503 2495 2499
CONECT 2504 2500 2506
CONECT 2505 2501
CONECT 2506 2504
CONECT 2507 2496 2515
CONECT 2508 2499
CONECT 2509 2500
CONECT 2510 2500
CONECT 2511 2495
CONECT 2512 2496
CONECT 2513 2497
CONECT 2514 2498
CONECT 2515 2507 2516 2541 2525
CONECT 2516 2515 2517 2529 2528
CONECT 2517 2516 2518 2530 2523
CONECT 2518 2517 2519 2531 2524
CONECT 2519 2518 2520 2532 2525
CONECT 2520 2519 2533 2534 2526
CONECT 2521 2522 2528 2527
CONECT 2522 2521 2535 2536 2537
CONECT 2523 2517 2538
CONECT 2524 2518 2542
CONECT 2525 2515 2519
CONECT 2526 2520 2539
CONECT 2527 2521
CONECT 2528 2516 2521 2540
CONECT 2529 2516
CONECT 2530 2517
CONECT 2531 2518
CONECT 2532 2519
CONECT 2533 2520
CONECT 2534 2520
CONECT 2535 2522
CONECT 2536 2522
CONECT 2537 2522
CONECT 2538 2523
CONECT 2539 2526
CONECT 2540 2528
CONECT 2541 2515
CONECT 2542 2524 2543 2550 2559
CONECT 2543 2542 2544 2548 2560
CONECT 2544 2543 2545 2549 2561
CONECT 2545 2544 2554 2546 2562
CONECT 2546 2545 2550 2547 2556
CONECT 2547 2546 2557 2558 2551
CONECT 2548 2543 2552
CONECT 2549 2544 2564
CONECT 2550 2542 2546
CONECT 2551 2547 2553
CONECT 2552 2548
CONECT 2553 2551
CONECT 2554 2545 2555
CONECT 2555 2554
CONECT 2556 2546
CONECT 2557 2547
CONECT 2558 2547
CONECT 2559 2542
CONECT 2560 2543
CONECT 2561 2544
CONECT 2562 2545
CONECT 2563 2564 2573 2574
CONECT 2564 2549 2563 2565 2572
CONECT 2565 2564 2566 2580 2581
CONECT 2566 2565 2567 2575 2582
CONECT 2567 2566 2568 2592 2593
CONECT 2568 2567 2569 2572 2579
CONECT 2569 2568 2570 2576 2590
CONECT 2570 2569 2571 2577 2589
CONECT 2571 2570 2578 2587 2588
CONECT 2572 2564 2568
CONECT 2573 2563
CONECT 2574 2563 2591
CONECT 2575 2566 2585
CONECT 2576 2569 2583
CONECT 2577 2570 2584
CONECT 2578 2571 2586
CONECT 2579 2568
CONECT 2580 2565
CONECT 2581 2565
CONECT 2582 2566
CONECT 2583 2576
CONECT 2584 2577
CONECT 2585 2575
CONECT 2586 2578
CONECT 2587 2571
CONECT 2588 2571
CONECT 2589 2570
CONECT 2590 2569
CONECT 2591 2574
CONECT 2592 2567
CONECT 2593 2567 2594 2597
CONECT 2594 2593 2595 2596
CONECT 2595 2594 2598 2599 2600
CONECT 2596 2594
CONECT 2597 2593
CONECT 2598 2595
CONECT 2599 2595
CONECT 2600 2595
CONECT 2601 2502 2602 2627 2611
CONECT 2602 2601 2603 2615 2614
CONECT 2603 2602 2604 2616 2609
CONECT 2604 2603 2605 2617 2610
CONECT 2605 2604 2606 2618 2611
CONECT 2606 2605 2619 2620 2612
CONECT 2607 2608 2614 2613
CONECT 2608 2607 2621 2622 2623
CONECT 2609 2603 2624
CONECT 2610 2604 2628
CONECT 2611 2601 2605
CONECT 2612 2606 2625
CONECT 2613 2607
CONECT 2614 2602 2607 2626
CONECT 2615 2602
CONECT 2616 2603
CONECT 2617 2604
CONECT 2618 2605
CONECT 2619 2606
CONECT 2620 2606
CONECT 2621 2608
CONECT 2622 2608
CONECT 2623 2608
CONECT 2624 2609
CONECT 2625 2612
CONECT 2626 2614
CONECT 2627 2601
CONECT 2628 2610 2629 2636 2645
CONECT 2629 2628 2630 2634 2646
CONECT 2630 2629 2631 2635 2647
CONECT 2631 2630 2640 2632 2648
CONECT 2632 2631 2636 2633 2642
CONECT 2633 2632 2643 2644 2637
CONECT 2634 2629 2638
CONECT 2635 2630 2650
CONECT 2636 2628 2632
CONECT 2637 2633 2639
CONECT 2638 2634
CONECT 2639 2637
CONECT 2640 2631 2641
CONECT 2641 2640
CONECT 2642 2632
CONECT 2643 2633
CONECT 2644 2633
CONECT 2645 2628
CONECT 2646 2629
CONECT 2647 2630
CONECT 2648 2631
CONECT 2649 2650 2659 2660
CONECT 2650 2635 2649 2651 2658
CONECT 2651 2650 2652 2666 2667
CONECT 2652 2651 2653 2661 2668
CONECT 2653 2652 2654 2678 2679
CONECT 2654 2653 2655 2658 2665
CONECT 2655 2654 2656 2662 2676
CONECT 2656 2655 2657 2663 2675
CONECT 2657 2656 2664 2673 2674
CONECT 2658 2650 2654
CONECT 2659 2649
CONECT 2660 2649 2677
CONECT 2661 2652 2671
CONECT 2662 2655 2669
CONECT 2663 2656 2670
CONECT 2664 2657 2672
CONECT 2665 2654
CONECT 2666 2651
CONECT 2667 2651
CONECT 2668 2652
CONECT 2669 2662
CONECT 2670 2663
CONECT 2671 2661
CONECT 2672 2664
CONECT 2673 2657
CONECT 2674 2657
CONECT 2675 2656
CONECT 2676 2655
CONECT 2677 2660
CONECT 2678 2653
CONECT 2679 2653 2680 2683
CONECT 2680 2679 2681 2682
CONECT 2681 2680 2684 2685 2686
CONECT 2682 2680
CONECT 2683 2679
CONECT 2684 2681
CONECT 2685 2681
CONECT 2686 2681
CONECT 2687 2484 2688 2695 2703
CONECT 2688 2687 2689 2699 2704
CONECT 2689 2688 2690 2693 2705
CONECT 2690 2689 2694 2691 2706
CONECT 2691 2690 2695 2692 2700
CONECT 2692 2691 2701 2702 2696
CONECT 2693 2689 2697
CONECT 2694 2690 2698
CONECT 2695 2687 2691
CONECT 2696 2692 2841
CONECT 2697 2693
CONECT 2698 2694
CONECT 2699 2688 2707
CONECT 2700 2691
CONECT 2701 2692
CONECT 2702 2692
CONECT 2703 2687
CONECT 2704 2688
CONECT 2705 2689
CONECT 2706 2690
CONECT 2707 2699 2708 2733 2717
CONECT 2708 2707 2709 2721 2720
CONECT 2709 2708 2710 2722 2715
CONECT 2710 2709 2711 2723 2716
CONECT 2711 2710 2712 2724 2717
CONECT 2712 2711 2725 2726 2718
CONECT 2713 2714 2720 2719
CONECT 2714 2713 2727 2728 2729
CONECT 2715 2709 2730
CONECT 2716 2710 2734
CONECT 2717 2707 2711
CONECT 2718 2712 2731
CONECT 2719 2713
CONECT 2720 2708 2713 2732
CONECT 2721 2708
CONECT 2722 2709
CONECT 2723 2710
CONECT 2724 2711
CONECT 2725 2712
CONECT 2726 2712
CONECT 2727 2714
CONECT 2728 2714
CONECT 2729 2714
CONECT 2730 2715
CONECT 2731 2718
CONECT 2732 2720
CONECT 2733 2707
CONECT 2734 2716 2735 2742 2751
CONECT 2735 2734 2736 2740 2752
CONECT 2736 2735 2737 2741 2753
CONECT 2737 2736 2746 2738 2754
CONECT 2738 2737 2742 2739 2748
CONECT 2739 2738 2749 2750 2743
CONECT 2740 2735 2744
CONECT 2741 2736 2755
CONECT 2742 2734 2738
CONECT 2743 2739 2745
CONECT 2744 2740
CONECT 2745 2743
CONECT 2746 2737 2747
CONECT 2747 2746
CONECT 2748 2738
CONECT 2749 2739
CONECT 2750 2739
CONECT 2751 2734
CONECT 2752 2735
CONECT 2753 2736
CONECT 2754 2737
CONECT 2755 2741 2756 2781 2765
CONECT 2756 2755 2757 2769 2768
CONECT 2757 2756 2758 2770 2763
CONECT 2758 2757 2759 2771 2764
CONECT 2759 2758 2760 2772 2765
CONECT 2760 2759 2773 2774 2766
CONECT 2761 2762 2768 2767
CONECT 2762 2761 2775 2776 2777
CONECT 2763 2757 2778
CONECT 2764 2758 2782
CONECT 2765 2755 2759
CONECT 2766 2760 2779
CONECT 2767 2761
CONECT 2768 2756 2761 2780
CONECT 2769 2756
CONECT 2770 2757
CONECT 2771 2758
CONECT 2772 2759
CONECT 2773 2760
CONECT 2774 2760
CONECT 2775 2762
CONECT 2776 2762
CONECT 2777 2762
CONECT 2778 2763
CONECT 2779 2766
CONECT 2780 2768
CONECT 2781 2755
CONECT 2782 2764 2783 2790 2799
CONECT 2783 2782 2784 2788 2800
CONECT 2784 2783 2785 2789 2801
CONECT 2785 2784 2794 2786 2802
CONECT 2786 2785 2790 2787 2796
CONECT 2787 2786 2797 2798 2791
CONECT 2788 2783 2792
CONECT 2789 2784 2804
CONECT 2790 2782 2786
CONECT 2791 2787 2793
CONECT 2792 2788
CONECT 2793 2791
CONECT 2794 2785 2795
CONECT 2795 2794
CONECT 2796 2786
CONECT 2797 2787
CONECT 2798 2787
CONECT 2799 2782
CONECT 2800 2783
CONECT 2801 2784
CONECT 2802 2785
CONECT 2803 2804 2813 2814
CONECT 2804 2789 2803 2805 2812
CONECT 2805 2804 2806 2820 2821
CONECT 2806 2805 2807 2815 2822
CONECT 2807 2806 2808 2832 2833
CONECT 2808 2807 2809 2812 2819
CONECT 2809 2808 2810 2816 2830
CONECT 2810 2809 2811 2817 2829
CONECT 2811 2810 2818 2827 2828
CONECT 2812 2804 2808
CONECT 2813 2803
CONECT 2814 2803 2831
CONECT 2815 2806 2825
CONECT 2816 2809 2823
CONECT 2817 2810 2824
CONECT 2818 2811 2826
CONECT 2819 2808
CONECT 2820 2805
CONECT 2821 2805
CONECT 2822 2806
CONECT 2823 2816
CONECT 2824 2817
CONECT 2825 2815
CONECT 2826 2818
CONECT 2827 2811
CONECT 2828 2811
CONECT 2829 2810
CONECT 2830 2809
CONECT 2831 2814
CONECT 2832 2807
CONECT 2833 2807 2834 2837
CONECT 2834 2833 2835 2836
CONECT 2835 2834 2838 2839 2840
CONECT 2836 2834
CONECT 2837 2833
CONECT 2838 2835
CONECT 2839 2835
CONECT 2840 2835
CONECT 2841 2696 2842 2867 2851
CONECT 2842 2841 2843 2855 2854
CONECT 2843 2842 2844 2856 2849
CONECT 2844 2843 2845 2857 2850
CONECT 2845 2844 2846 2858 2851
CONECT 2846 2845 2859 2860 2852
CONECT 2847 2848 2854 2853
CONECT 2848 2847 2861 2862 2863
CONECT 2849 2843 2864
CONECT 2850 2844 2868
CONECT 2851 2841 2845
CONECT 2852 2846 2865
CONECT 2853 2847
CONECT 2854 2842 2847 2866
CONECT 2855 2842
CONECT 2856 2843
CONECT 2857 2844
CONECT 2858 2845
CONECT 2859 2846
CONECT 2860 2846
CONECT 2861 2848
CONECT 2862 2848
CONECT 2863 2848
CONECT 2864 2849
CONECT 2865 2852
CONECT 2866 2854
CONECT 2867 2841
CONECT 2868 2850 2869 2876 2885
CONECT 2869 2868 2870 2874 2886
CONECT 2870 2869 2871 2875 2887
CONECT 2871 2870 2880 2872 2888
CONECT 2872 2871 2876 2873 2882
CONECT 2873 2872 2883 2884 2877
CONECT 2874 2869 2878
CONECT 2875 2870 2890
CONECT 2876 2868 2872
CONECT 2877 2873 2879
CONECT 2878 2874
CONECT 2879 2877
CONECT 2880 2871 2881
CONECT 2881 2880
CONECT 2882 2872
CONECT 2883 2873
CONECT 2884 2873
CONECT 2885 2868
CONECT 2886 2869
CONECT 2887 2870
CONECT 2888 2871
CONECT 2889 2890 2899 2900
CONECT 2890 2875 2889 2891 2898
CONECT 2891 2890 2892 2906 2907
CONECT 2892 2891 2893 2901 2908
CONECT 2893 2892 2894 2918 2919
CONECT 2894 2893 2895 2898 2905
CONECT 2895 2894 2896 2902 2916
CONECT 2896 2895 2897 2903 2915
CONECT 2897 2896 2904 2913 2914
CONECT 2898 2890 2894
CONECT 2899 2889
CONECT 2900 2889 2917
CONECT 2901 2892 2911
CONECT 2902 2895 2909
CONECT 2903 2896 2910
CONECT 2904 2897 2912
CONECT 2905 2894
CONECT 2906 2891
CONECT 2907 2891
CONECT 2908 2892
CONECT 2909 2902
CONECT 2910 2903
CONECT 2911 2901
CONECT 2912 2904
CONECT 2913 2897
CONECT 2914 2897
CONECT 2915 2896
CONECT 2916 2895
CONECT 2917 2900
CONECT 2918 2893
CONECT 2919 2893 2920 2923
CONECT 2920 2919 2921 2922
CONECT 2921 2920 2924 2925 2926
CONECT 2922 2920
CONECT 2923 2919
CONECT 2924 2921
CONECT 2925 2921
CONECT 2926 2921
CONECT 2927 2433 2928 2933 2938
CONECT 2928 2927 2929 2934 2939
CONECT 2929 2928 2930 2935 2941
CONECT 2930 2929 2931 2936 2943
CONECT 2931 2930 2932 2933 2937
CONECT 2932 2931 2945 2946 2947
CONECT 2933 2927 2931
CONECT 2934 2928 2940
CONECT 2935 2929 2942
CONECT 2936 2930 2944
CONECT 2937 2931
CONECT 2938 2927
CONECT 2939 2928
CONECT 2940 2934
CONECT 2941 2929
CONECT 2942 2935
CONECT 2943 2930
CONECT 2944 2936
CONECT 2945 2932
CONECT 2946 2932
CONECT 2947 2932
CONECT 2948 2949 2974 2958  626
CONECT 2949 2948 2950 2962 2961
CONECT 2950 2949 2951 2963 2956
CONECT 2951 2950 2952 2964 2957
CONECT 2952 2951 2953 2965 2958
CONECT 2953 2952 2966 2967 2959
CONECT 2954 2955 2961 2960
CONECT 2955 2954 2968 2969 2970
CONECT 2956 2950 2971
CONECT 2957 2951 2975
CONECT 2958 2948 2952
CONECT 2959 2953 2972
CONECT 2960 2954
CONECT 2961 2949 2954 2973
CONECT 2962 2949
CONECT 2963 2950
CONECT 2964 2951
CONECT 2965 2952
CONECT 2966 2953
CONECT 2967 2953
CONECT 2968 2955
CONECT 2969 2955
CONECT 2970 2955
CONECT 2971 2956
CONECT 2972 2959
CONECT 2973 2961
CONECT 2974 2948
CONECT 2975 2957 2976 3001 2985
CONECT 2976 2975 2977 2989 2988
CONECT 2977 2976 2978 2990 2983
CONECT 2978 2977 2979 2991 2984
CONECT 2979 2978 2980 2992 2985
CONECT 2980 2979 2993 2994 2986
CONECT 2981 2982 2988 2987
CONECT 2982 2981 2995 2996 2997
CONECT 2983 2977 2998
CONECT 2984 2978 3002
CONECT 2985 2975 2979
CONECT 2986 2980 2999
CONECT 2987 2981
CONECT 2988 2976 2981 3000
CONECT 2989 2976
CONECT 2990 2977
CONECT 2991 2978
CONECT 2992 2979
CONECT 2993 2980
CONECT 2994 2980
CONECT 2995 2982
CONECT 2996 2982
CONECT 2997 2982
CONECT 2998 2983
CONECT 2999 2986
CONECT 3000 2988
CONECT 3001 2975
CONECT 3002 2984 3003 3010 3020
CONECT 3003 3002 3004 3013 3018
CONECT 3004 3003 3005 3008 3019
CONECT 3005 3004 3009 3006 3021
CONECT 3006 3005 3010 3007 3015
CONECT 3007 3006 3016 3017 3011
CONECT 3008 3004 3022
CONECT 3009 3005 3012
CONECT 3010 3002 3006
CONECT 3011 3007 3276
CONECT 3012 3009
CONECT 3013 3003 3014
CONECT 3014 3013
CONECT 3015 3006
CONECT 3016 3007
CONECT 3017 3007
CONECT 3018 3003
CONECT 3019 3004
CONECT 3020 3002
CONECT 3021 3005
CONECT 3022 3008 3023 3030 3038
CONECT 3023 3022 3024 3034 3039
CONECT 3024 3023 3025 3028 3040
CONECT 3025 3024 3029 3026 3041
CONECT 3026 3025 3030 3027 3035
CONECT 3027 3026 3036 3037 3031
CONECT 3028 3024 3032
CONECT 3029 3025 3159
CONECT 3030 3022 3026
CONECT 3031 3027 3033
CONECT 3032 3028
CONECT 3033 3031
CONECT 3034 3023 3042
CONECT 3035 3026
CONECT 3036 3027
CONECT 3037 3027
CONECT 3038 3022
CONECT 3039 3023
CONECT 3040 3024
CONECT 3041 3025
CONECT 3042 3034 3043 3068 3052
CONECT 3043 3042 3044 3056 3055
CONECT 3044 3043 3045 3057 3050
CONECT 3045 3044 3046 3058 3051
CONECT 3046 3045 3047 3059 3052
CONECT 3047 3046 3060 3061 3053
CONECT 3048 3049 3055 3054
CONECT 3049 3048 3062 3063 3064
CONECT 3050 3044 3065
CONECT 3051 3045 3069
CONECT 3052 3042 3046
CONECT 3053 3047 3066
CONECT 3054 3048
CONECT 3055 3043 3048 3067
CONECT 3056 3043
CONECT 3057 3044
CONECT 3058 3045
CONECT 3059 3046
CONECT 3060 3047
CONECT 3061 3047
CONECT 3062 3049
CONECT 3063 3049
CONECT 3064 3049
CONECT 3065 3050
CONECT 3066 3053
CONECT 3067 3055
CONECT 3068 3042
CONECT 3069 3051 3070 3077 3086
CONECT 3070 3069 3071 3075 3087
CONECT 3071 3070 3072 3076 3088
CONECT 3072 3071 3081 3073 3089
CONECT 3073 3072 3077 3074 3083
CONECT 3074 3073 3084 3085 3078
CONECT 3075 3070 3079
CONECT 3076 3071 3090
CONECT 3077 3069 3073
CONECT 3078 3074 3080
CONECT 3079 3075
CONECT 3080 3078
CONECT 3081 3072 3082
CONECT 3082 3081
CONECT 3083 3073
CONECT 3084 3074
CONECT 3085 3074
CONECT 3086 3069
CONECT 3087 3070
CONECT 3088 3071
CONECT 3089 3072
CONECT 3090 3076 3091 3098 3107
CONECT 3091 3090 3092 3096 3108
CONECT 3092 3091 3093 3097 3109
CONECT 3093 3092 3102 3094 3110
CONECT 3094 3093 3098 3095 3104
CONECT 3095 3094 3105 3106 3099
CONECT 3096 3091 3100
CONECT 3097 3092 3111
CONECT 3098 3090 3094
CONECT 3099 3095 3101
CONECT 3100 3096
CONECT 3101 3099
CONECT 3102 3093 3103
CONECT 3103 3102
CONECT 3104 3094
CONECT 3105 3095
CONECT 3106 3095
CONECT 3107 3090
CONECT 3108 3091
CONECT 3109 3092
CONECT 3110 3093
CONECT 3111 3097 3112 3118 3126
CONECT 3112 3111 3113 3127 3130
CONECT 3113 3112 3114 3117 3128
CONECT 3114 3113 3121 3115 3129
CONECT 3115 3114 3118 3116 3123
CONECT 3116 3115 3124 3125 3119
CONECT 3117 3113 3138
CONECT 3118 3111 3115
CONECT 3119 3116 3120
CONECT 3120 3119
CONECT 3121 3114 3122
CONECT 3122 3121
CONECT 3123 3115
CONECT 3124 3116
CONECT 3125 3116
CONECT 3126 3111
CONECT 3127 3112
CONECT 3128 3113
CONECT 3129 3114
CONECT 3130 3112 3131 3134
CONECT 3131 3130 3132 3133
CONECT 3132 3131 3135 3136 3137
CONECT 3133 3131
CONECT 3134 3130
CONECT 3135 3132
CONECT 3136 3132
CONECT 3137 3132
CONECT 3138 3117 3139 3144 3149
CONECT 3139 3138 3140 3145 3150
CONECT 3140 3139 3141 3146 3152
CONECT 3141 3140 3142 3147 3154
CONECT 3142 3141 3143 3144 3148
CONECT 3143 3142 3156 3157 3158
CONECT 3144 3138 3142
CONECT 3145 3139 3151
CONECT 3146 3140 3153
CONECT 3147 3141 3155
CONECT 3148 3142
CONECT 3149 3138
CONECT 3150 3139
CONECT 3151 3145
CONECT 3152 3140
CONECT 3153 3146
CONECT 3154 3141
CONECT 3155 3147
CONECT 3156 3143
CONECT 3157 3143
CONECT 3158 3143
CONECT 3159 3029 3160 3185 3169
CONECT 3160 3159 3161 3173 3172
CONECT 3161 3160 3162 3174 3167
CONECT 3162 3161 3163 3175 3168
CONECT 3163 3162 3164 3176 3169
CONECT 3164 3163 3177 3178 3170
CONECT 3165 3166 3172 3171
CONECT 3166 3165 3179 3180 3181
CONECT 3167 3161 3182
CONECT 3168 3162 3186
CONECT 3169 3159 3163
CONECT 3170 3164 3183
CONECT 3171 3165
CONECT 3172 3160 3165 3184
CONECT 3173 3160
CONECT 3174 3161
CONECT 3175 3162
CONECT 3176 3163
CONECT 3177 3164
CONECT 3178 3164
CONECT 3179 3166
CONECT 3180 3166
CONECT 3181 3166
CONECT 3182 3167
CONECT 3183 3170
CONECT 3184 3172
CONECT 3185 3159
CONECT 3186 3168 3187 3194 3203
CONECT 3187 3186 3188 3192 3204
CONECT 3188 3187 3189 3193 3205
CONECT 3189 3188 3198 3190 3206
CONECT 3190 3189 3194 3191 3200
CONECT 3191 3190 3201 3202 3195
CONECT 3192 3187 3196
CONECT 3193 3188 3207
CONECT 3194 3186 3190
CONECT 3195 3191 3197
CONECT 3196 3192
CONECT 3197 3195
CONECT 3198 3189 3199
CONECT 3199 3198
CONECT 3200 3190
CONECT 3201 3191
CONECT 3202 3191
CONECT 3203 3186
CONECT 3204 3187
CONECT 3205 3188
CONECT 3206 3189
CONECT 3207 3193 3208 3215 3224
CONECT 3208 3207 3209 3213 3225
CONECT 3209 3208 3210 3214 3226
CONECT 3210 3209 3219 3211 3227
CONECT 3211 3210 3215 3212 3221
CONECT 3212 3211 3222 3223 3216
CONECT 3213 3208 3217
CONECT 3214 3209 3228
CONECT 3215 3207 3211
CONECT 3216 3212 3218
CONECT 3217 3213
CONECT 3218 3216
CONECT 3219 3210 3220
CONECT 3220 3219
CONECT 3221 3211
CONECT 3222 3212
CONECT 3223 3212
CONECT 3224 3207
CONECT 3225 3208
CONECT 3226 3209
CONECT 3227 3210
CONECT 3228 3214 3229 3235 3243
CONECT 3229 3228 3230 3244 3247
CONECT 3230 3229 3231 3234 3245
CONECT 3231 3230 3238 3232 3246
CONECT 3232 3231 3235 3233 3240
CONECT 3233 3232 3241 3242 3236
CONECT 3234 3230 3255
CONECT 3235 3228 3232
CONECT 3236 3233 3237
CONECT 3237 3236
CONECT 3238 3231 3239
CONECT 3239 3238
CONECT 3240 3232
CONECT 3241 3233
CONECT 3242 3233
CONECT 3243 3228
CONECT 3244 3229
CONECT 3245 3230
CONECT 3246 3231
CONECT 3247 3229 3248 3251
CONECT 3248 3247 3249 3250
CONECT 3249 3248 3252 3253 3254
CONECT 3250 3248
CONECT 3251 3247
CONECT 3252 3249
CONECT 3253 3249
CONECT 3254 3249
CONECT 3255 3234 3256 3261 3266
CONECT 3256 3255 3257 3262 3267
CONECT 3257 3256 3258 3263 3269
CONECT 3258 3257 3259 3264 3271
CONECT 3259 3258 3260 3261 3265
CONECT 3260 3259 3273 3274 3275
CONECT 3261 3255 3259
CONECT 3262 3256 3268
CONECT 3263 3257 3270
CONECT 3264 3258 3272
CONECT 3265 3259
CONECT 3266 3255
CONECT 3267 3256
CONECT 3268 3262
CONECT 3269 3257
CONECT 3270 3263
CONECT 3271 3258
CONECT 3272 3264
CONECT 3273 3260
CONECT 3274 3260
CONECT 3275 3260
CONECT 3276 3011 3277 3284 3291
CONECT 3277 3276 3278 3287 3292
CONECT 3278 3277 3279 3282 3293
CONECT 3279 3278 3283 3280 3294
CONECT 3280 3279 3284 3281 3288
CONECT 3281 3280 3289 3290 3285
CONECT 3282 3278 3286
CONECT 3283 3279 3412
CONECT 3284 3276 3280
CONECT 3285 3281 3529
CONECT 3286 3282
CONECT 3287 3277 3295
CONECT 3288 3280
CONECT 3289 3281
CONECT 3290 3281
CONECT 3291 3276
CONECT 3292 3277
CONECT 3293 3278
CONECT 3294 3279
CONECT 3295 3287 3296 3321 3305
CONECT 3296 3295 3297 3309 3308
CONECT 3297 3296 3298 3310 3303
CONECT 3298 3297 3299 3311 3304
CONECT 3299 3298 3300 3312 3305
CONECT 3300 3299 3313 3314 3306
CONECT 3301 3302 3308 3307
CONECT 3302 3301 3315 3316 3317
CONECT 3303 3297 3318
CONECT 3304 3298 3322
CONECT 3305 3295 3299
CONECT 3306 3300 3319
CONECT 3307 3301
CONECT 3308 3296 3301 3320
CONECT 3309 3296
CONECT 3310 3297
CONECT 3311 3298
CONECT 3312 3299
CONECT 3313 3300
CONECT 3314 3300
CONECT 3315 3302
CONECT 3316 3302
CONECT 3317 3302
CONECT 3318 3303
CONECT 3319 3306
CONECT 3320 3308
CONECT 3321 3295
CONECT 3322 3304 3323 3330 3339
CONECT 3323 3322 3324 3328 3340
CONECT 3324 3323 3325 3329 3341
CONECT 3325 3324 3334 3326 3342
CONECT 3326 3325 3330 3327 3336
CONECT 3327 3326 3337 3338 3331
CONECT 3328 3323 3332
CONECT 3329 3324 3343
CONECT 3330 3322 3326
CONECT 3331 3327 3333
CONECT 3332 3328
CONECT 3333 3331
CONECT 3334 3325 3335
CONECT 3335 3334
CONECT 3336 3326
CONECT 3337 3327
CONECT 3338 3327
CONECT 3339 3322
CONECT 3340 3323
CONECT 3341 3324
CONECT 3342 3325
CONECT 3343 3329 3344 3351 3360
CONECT 3344 3343 3345 3349 3361
CONECT 3345 3344 3346 3350 3362
CONECT 3346 3345 3355 3347 3363
CONECT 3347 3346 3351 3348 3357
CONECT 3348 3347 3358 3359 3352
CONECT 3349 3344 3353
CONECT 3350 3345 3364
CONECT 3351 3343 3347
CONECT 3352 3348 3354
CONECT 3353 3349
CONECT 3354 3352
CONECT 3355 3346 3356
CONECT 3356 3355
CONECT 3357 3347
CONECT 3358 3348
CONECT 3359 3348
CONECT 3360 3343
CONECT 3361 3344
CONECT 3362 3345
CONECT 3363 3346
CONECT 3364 3350 3365 3371 3379
CONECT 3365 3364 3366 3380 3383
CONECT 3366 3365 3367 3370 3381
CONECT 3367 3366 3374 3368 3382
CONECT 3368 3367 3371 3369 3376
CONECT 3369 3368 3377 3378 3372
CONECT 3370 3366 3391
CONECT 3371 3364 3368
CONECT 3372 3369 3373
CONECT 3373 3372
CONECT 3374 3367 3375
CONECT 3375 3374
CONECT 3376 3368
CONECT 3377 3369
CONECT 3378 3369
CONECT 3379 3364
CONECT 3380 3365
CONECT 3381 3366
CONECT 3382 3367
CONECT 3383 3365 3384 3387
CONECT 3384 3383 3385 3386
CONECT 3385 3384 3388 3389 3390
CONECT 3386 3384
CONECT 3387 3383
CONECT 3388 3385
CONECT 3389 3385
CONECT 3390 3385
CONECT 3391 3370 3392 3397 3402
CONECT 3392 3391 3393 3398 3403
CONECT 3393 3392 3394 3399 3405
CONECT 3394 3393 3395 3400 3407
CONECT 3395 3394 3396 3397 3401
CONECT 3396 3395 3409 3410 3411
CONECT 3397 3391 3395
CONECT 3398 3392 3404
CONECT 3399 3393 3406
CONECT 3400 3394 3408
CONECT 3401 3395
CONECT 3402 3391
CONECT 3403 3392
CONECT 3404 3398
CONECT 3405 3393
CONECT 3406 3399
CONECT 3407 3394
CONECT 3408 3400
CONECT 3409 3396
CONECT 3410 3396
CONECT 3411 3396
CONECT 3412 3283 3413 3438 3422
CONECT 3413 3412 3414 3426 3425
CONECT 3414 3413 3415 3427 3420
CONECT 3415 3414 3416 3428 3421
CONECT 3416 3415 3417 3429 3422
CONECT 3417 3416 3430 3431 3423
CONECT 3418 3419 3425 3424
CONECT 3419 3418 3432 3433 3434
CONECT 3420 3414 3435
CONECT 3421 3415 3439
CONECT 3422 3412 3416
CONECT 3423 3417 3436
CONECT 3424 3418
CONECT 3425 3413 3418 3437
CONECT 3426 3413
CONECT 3427 3414
CONECT 3428 3415
CONECT 3429 3416
CONECT 3430 3417
CONECT 3431 3417
CONECT 3432 3419
CONECT 3433 3419
CONECT 3434 3419
CONECT 3435 3420
CONECT 3436 3423
CONECT 3437 3425
CONECT 3438 3412
CONECT 3439 3421 3440 3447 3456
CONECT 3440 3439 3441 3445 3457
CONECT 3441 3440 3442 3446 3458
CONECT 3442 3441 3451 3443 3459
CONECT 3443 3442 3447 3444 3453
CONECT 3444 3443 3454 3455 3448
CONECT 3445 3440 3449
CONECT 3446 3441 3460
CONECT 3447 3439 3443
CONECT 3448 3444 3450
CONECT 3449 3445
CONECT 3450 3448
CONECT 3451 3442 3452
CONECT 3452 3451
CONECT 3453 3443
CONECT 3454 3444
CONECT 3455 3444
CONECT 3456 3439
CONECT 3457 3440
CONECT 3458 3441
CONECT 3459 3442
CONECT 3460 3446 3461 3468 3477
CONECT 3461 3460 3462 3466 3478
CONECT 3462 3461 3463 3467 3479
CONECT 3463 3462 3472 3464 3480
CONECT 3464 3463 3468 3465 3474
CONECT 3465 3464 3475 3476 3469
CONECT 3466 3461 3470
CONECT 3467 3462 3481
CONECT 3468 3460 3464
CONECT 3469 3465 3471
CONECT 3470 3466
CONECT 3471 3469
CONECT 3472 3463 3473
CONECT 3473 3472
CONECT 3474 3464
CONECT 3475 3465
CONECT 3476 3465
CONECT 3477 3460
CONECT 3478 3461
CONECT 3479 3462
CONECT 3480 3463
CONECT 3481 3467 3482 3488 3496
CONECT 3482 3481 3483 3497 3500
CONECT 3483 3482 3484 3487 3498
CONECT 3484 3483 3491 3485 3499
CONECT 3485 3484 3488 3486 3493
CONECT 3486 3485 3494 3495 3489
CONECT 3487 3483 3508
CONECT 3488 3481 3485
CONECT 3489 3486 3490
CONECT 3490 3489
CONECT 3491 3484 3492
CONECT 3492 3491
CONECT 3493 3485
CONECT 3494 3486
CONECT 3495 3486
CONECT 3496 3481
CONECT 3497 3482
CONECT 3498 3483
CONECT 3499 3484
CONECT 3500 3482 3501 3504
CONECT 3501 3500 3502 3503
CONECT 3502 3501 3505 3506 3507
CONECT 3503 3501
CONECT 3504 3500
CONECT 3505 3502
CONECT 3506 3502
CONECT 3507 3502
CONECT 3508 3487 3509 3514 3519
CONECT 3509 3508 3510 3515 3520
CONECT 3510 3509 3511 3516 3522
CONECT 3511 3510 3512 3517 3524
CONECT 3512 3511 3513 3514 3518
CONECT 3513 3512 3526 3527 3528
CONECT 3514 3508 3512
CONECT 3515 3509 3521
CONECT 3516 3510 3523
CONECT 3517 3511 3525
CONECT 3518 3512
CONECT 3519 3508
CONECT 3520 3509
CONECT 3521 3515
CONECT 3522 3510
CONECT 3523 3516
CONECT 3524 3511
CONECT 3525 3517
CONECT 3526 3513
CONECT 3527 3513
CONECT 3528 3513
CONECT 3529 3285 3530 3555 3539
CONECT 3530 3529 3531 3543 3542
CONECT 3531 3530 3532 3544 3537
CONECT 3532 3531 3533 3545 3538
CONECT 3533 3532 3534 3546 3539
CONECT 3534 3533 3547 3548 3540
CONECT 3535 3536 3542 3541
CONECT 3536 3535 3549 3550 3551
CONECT 3537 3531 3552
CONECT 3538 3532 3556
CONECT 3539 3529 3533
CONECT 3540 3534 3553
CONECT 3541 3535
CONECT 3542 3530 3535 3554
CONECT 3543 3530
CONECT 3544 3531
CONECT 3545 3532
CONECT 3546 3533
CONECT 3547 3534
CONECT 3548 3534
CONECT 3549 3536
CONECT 3550 3536
CONECT 3551 3536
CONECT 3552 3537
CONECT 3553 3540
CONECT 3554 3542
CONECT 3555 3529
CONECT 3556 3538 3557 3564 3573
CONECT 3557 3556 3558 3562 3574
CONECT 3558 3557 3559 3563 3575
CONECT 3559 3558 3568 3560 3576
CONECT 3560 3559 3564 3561 3570
CONECT 3561 3560 3571 3572 3565
CONECT 3562 3557 3566
CONECT 3563 3558 3577
CONECT 3564 3556 3560
CONECT 3565 3561 3567
CONECT 3566 3562
CONECT 3567 3565
CONECT 3568 3559 3569
CONECT 3569 3568
CONECT 3570 3560
CONECT 3571 3561
CONECT 3572 3561
CONECT 3573 3556
CONECT 3574 3557
CONECT 3575 3558
CONECT 3576 3559
CONECT 3577 3563 3578 3585 3594
CONECT 3578 3577 3579 3583 3595
CONECT 3579 3578 3580 3584 3596
CONECT 3580 3579 3589 3581 3597
CONECT 3581 3580 3585 3582 3591
CONECT 3582 3581 3592 3593 3586
CONECT 3583 3578 3587
CONECT 3584 3579 3598
CONECT 3585 3577 3581
CONECT 3586 3582 3588
CONECT 3587 3583
CONECT 3588 3586
CONECT 3589 3580 3590
CONECT 3590 3589
CONECT 3591 3581
CONECT 3592 3582
CONECT 3593 3582
CONECT 3594 3577
CONECT 3595 3578
CONECT 3596 3579
CONECT 3597 3580
CONECT 3598 3584 3599 3605 3613
CONECT 3599 3598 3600 3614 3617
CONECT 3600 3599 3601 3604 3615
CONECT 3601 3600 3608 3602 3616
CONECT 3602 3601 3605 3603 3610
CONECT 3603 3602 3611 3612 3606
CONECT 3604 3600 3625
CONECT 3605 3598 3602
CONECT 3606 3603 3607
CONECT 3607 3606
CONECT 3608 3601 3609
CONECT 3609 3608
CONECT 3610 3602
CONECT 3611 3603
CONECT 3612 3603
CONECT 3613 3598
CONECT 3614 3599
CONECT 3615 3600
CONECT 3616 3601
CONECT 3617 3599 3618 3621
CONECT 3618 3617 3619 3620
CONECT 3619 3618 3622 3623 3624
CONECT 3620 3618
CONECT 3621 3617
CONECT 3622 3619
CONECT 3623 3619
CONECT 3624 3619
CONECT 3625 3604 3626 3631 3636
CONECT 3626 3625 3627 3632 3637
CONECT 3627 3626 3628 3633 3639
CONECT 3628 3627 3629 3634 3641
CONECT 3629 3628 3630 3631 3635
CONECT 3630 3629 3643 3644 3645
CONECT 3631 3625 3629
CONECT 3632 3626 3638
CONECT 3633 3627 3640
CONECT 3634 3628 3642
CONECT 3635 3629
CONECT 3636 3625
CONECT 3637 3626
CONECT 3638 3632
CONECT 3639 3627
CONECT 3640 3633
CONECT 3641 3628
CONECT 3642 3634
CONECT 3643 3630
CONECT 3644 3630
CONECT 3645 3630
CONECT 3646 3647 3671 3656  712
CONECT 3647 3646 3648 3660 3659
CONECT 3648 3647 3649 3661 3654
CONECT 3649 3648 3650 3662 3655
CONECT 3650 3649 3651 3663 3656
CONECT 3651 3650 3664 3665 3657
CONECT 3652 3653 3659 3658
CONECT 3653 3652 3666 3667 3668
CONECT 3654 3648 3669
CONECT 3655 3649 3672
CONECT 3656 3646 3650
CONECT 3657 3651 4103
CONECT 3658 3652
CONECT 3659 3647 3652 3670
CONECT 3660 3647
CONECT 3661 3648
CONECT 3662 3649
CONECT 3663 3650
CONECT 3664 3651
CONECT 3665 3651
CONECT 3666 3653
CONECT 3667 3653
CONECT 3668 3653
CONECT 3669 3654
CONECT 3670 3659
CONECT 3671 3646
CONECT 3672 3655 3673 3698 3682
CONECT 3673 3672 3674 3686 3685
CONECT 3674 3673 3675 3687 3680
CONECT 3675 3674 3676 3688 3681
CONECT 3676 3675 3677 3689 3682
CONECT 3677 3676 3690 3691 3683
CONECT 3678 3679 3685 3684
CONECT 3679 3678 3692 3693 3694
CONECT 3680 3674 3695
CONECT 3681 3675 3699
CONECT 3682 3672 3676
CONECT 3683 3677 3696
CONECT 3684 3678
CONECT 3685 3673 3678 3697
CONECT 3686 3673
CONECT 3687 3674
CONECT 3688 3675
CONECT 3689 3676
CONECT 3690 3677
CONECT 3691 3677
CONECT 3692 3679
CONECT 3693 3679
CONECT 3694 3679
CONECT 3695 3680
CONECT 3696 3683
CONECT 3697 3685
CONECT 3698 3672
CONECT 3699 3681 3700 3707 3717
CONECT 3700 3699 3701 3710 3715
CONECT 3701 3700 3702 3705 3716
CONECT 3702 3701 3706 3703 3718
CONECT 3703 3702 3707 3704 3712
CONECT 3704 3703 3713 3714 3708
CONECT 3705 3701 3719
CONECT 3706 3702 3709
CONECT 3707 3699 3703
CONECT 3708 3704 3911
CONECT 3709 3706
CONECT 3710 3700 3711
CONECT 3711 3710
CONECT 3712 3703
CONECT 3713 3704
CONECT 3714 3704
CONECT 3715 3700
CONECT 3716 3701
CONECT 3717 3699
CONECT 3718 3702
CONECT 3719 3705 3720 3727 3735
CONECT 3720 3719 3721 3731 3736
CONECT 3721 3720 3722 3725 3737
CONECT 3722 3721 3726 3723 3738
CONECT 3723 3722 3727 3724 3732
CONECT 3724 3723 3733 3734 3728
CONECT 3725 3721 3729
CONECT 3726 3722 3825
CONECT 3727 3719 3723
CONECT 3728 3724 3730
CONECT 3729 3725
CONECT 3730 3728
CONECT 3731 3720 3739
CONECT 3732 3723
CONECT 3733 3724
CONECT 3734 3724
CONECT 3735 3719
CONECT 3736 3720
CONECT 3737 3721
CONECT 3738 3722
CONECT 3739 3731 3740 3765 3749
CONECT 3740 3739 3741 3753 3752
CONECT 3741 3740 3742 3754 3747
CONECT 3742 3741 3743 3755 3748
CONECT 3743 3742 3744 3756 3749
CONECT 3744 3743 3757 3758 3750
CONECT 3745 3746 3752 3751
CONECT 3746 3745 3759 3760 3761
CONECT 3747 3741 3762
CONECT 3748 3742 3766
CONECT 3749 3739 3743
CONECT 3750 3744 3763
CONECT 3751 3745
CONECT 3752 3740 3745 3764
CONECT 3753 3740
CONECT 3754 3741
CONECT 3755 3742
CONECT 3756 3743
CONECT 3757 3744
CONECT 3758 3744
CONECT 3759 3746
CONECT 3760 3746
CONECT 3761 3746
CONECT 3762 3747
CONECT 3763 3750
CONECT 3764 3752
CONECT 3765 3739
CONECT 3766 3748 3767 3774 3783
CONECT 3767 3766 3768 3772 3784
CONECT 3768 3767 3769 3773 3785
CONECT 3769 3768 3778 3770 3786
CONECT 3770 3769 3774 3771 3780
CONECT 3771 3770 3781 3782 3775
CONECT 3772 3767 3776
CONECT 3773 3768 3777
CONECT 3774 3766 3770
CONECT 3775 3771 3788
CONECT 3776 3772
CONECT 3777 3773
CONECT 3778 3769 3779
CONECT 3779 3778
CONECT 3780 3770
CONECT 3781 3771
CONECT 3782 3771
CONECT 3783 3766
CONECT 3784 3767
CONECT 3785 3768
CONECT 3786 3769
CONECT 3787 3788 3797 3798
CONECT 3788 3775 3787 3789 3796
CONECT 3789 3788 3790 3804 3805
CONECT 3790 3789 3791 3799 3806
CONECT 3791 3790 3792 3816 3817
CONECT 3792 3791 3793 3796 3803
CONECT 3793 3792 3794 3800 3814
CONECT 3794 3793 3795 3801 3813
CONECT 3795 3794 3802 3811 3812
CONECT 3796 3788 3792
CONECT 3797 3787
CONECT 3798 3787 3815
CONECT 3799 3790 3809
CONECT 3800 3793 3807
CONECT 3801 3794 3808
CONECT 3802 3795 3810
CONECT 3803 3792
CONECT 3804 3789
CONECT 3805 3789
CONECT 3806 3790
CONECT 3807 3800
CONECT 3808 3801
CONECT 3809 3799
CONECT 3810 3802
CONECT 3811 3795
CONECT 3812 3795
CONECT 3813 3794
CONECT 3814 3793
CONECT 3815 3798
CONECT 3816 3791
CONECT 3817 3791 3818 3821
CONECT 3818 3817 3819 3820
CONECT 3819 3818 3822 3823 3824
CONECT 3820 3818
CONECT 3821 3817
CONECT 3822 3819
CONECT 3823 3819
CONECT 3824 3819
CONECT 3825 3726 3826 3851 3835
CONECT 3826 3825 3827 3839 3838
CONECT 3827 3826 3828 3840 3833
CONECT 3828 3827 3829 3841 3834
CONECT 3829 3828 3830 3842 3835
CONECT 3830 3829 3843 3844 3836
CONECT 3831 3832 3838 3837
CONECT 3832 3831 3845 3846 3847
CONECT 3833 3827 3848
CONECT 3834 3828 3852
CONECT 3835 3825 3829
CONECT 3836 3830 3849
CONECT 3837 3831
CONECT 3838 3826 3831 3850
CONECT 3839 3826
CONECT 3840 3827
CONECT 3841 3828
CONECT 3842 3829
CONECT 3843 3830
CONECT 3844 3830
CONECT 3845 3832
CONECT 3846 3832
CONECT 3847 3832
CONECT 3848 3833
CONECT 3849 3836
CONECT 3850 3838
CONECT 3851 3825
CONECT 3852 3834 3853 3860 3869
CONECT 3853 3852 3854 3858 3870
CONECT 3854 3853 3855 3859 3871
CONECT 3855 3854 3864 3856 3872
CONECT 3856 3855 3860 3857 3866
CONECT 3857 3856 3867 3868 3861
CONECT 3858 3853 3862
CONECT 3859 3854 3874
CONECT 3860 3852 3856
CONECT 3861 3857 3863
CONECT 3862 3858
CONECT 3863 3861
CONECT 3864 3855 3865
CONECT 3865 3864
CONECT 3866 3856
CONECT 3867 3857
CONECT 3868 3857
CONECT 3869 3852
CONECT 3870 3853
CONECT 3871 3854
CONECT 3872 3855
CONECT 3873 3874 3883 3884
CONECT 3874 3859 3873 3875 3882
CONECT 3875 3874 3876 3890 3891
CONECT 3876 3875 3877 3885 3892
CONECT 3877 3876 3878 3902 3903
CONECT 3878 3877 3879 3882 3889
CONECT 3879 3878 3880 3886 3900
CONECT 3880 3879 3881 3887 3899
CONECT 3881 3880 3888 3897 3898
CONECT 3882 3874 3878
CONECT 3883 3873
CONECT 3884 3873 3901
CONECT 3885 3876 3895
CONECT 3886 3879 3893
CONECT 3887 3880 3894
CONECT 3888 3881 3896
CONECT 3889 3878
CONECT 3890 3875
CONECT 3891 3875
CONECT 3892 3876
CONECT 3893 3886
CONECT 3894 3887
CONECT 3895 3885
CONECT 3896 3888
CONECT 3897 3881
CONECT 3898 3881
CONECT 3899 3880
CONECT 3900 3879
CONECT 3901 3884
CONECT 3902 3877
CONECT 3903 3877 3904 3907
CONECT 3904 3903 3905 3906
CONECT 3905 3904 3908 3909 3910
CONECT 3906 3904
CONECT 3907 3903
CONECT 3908 3905
CONECT 3909 3905
CONECT 3910 3905
CONECT 3911 3708 3912 3919 3927
CONECT 3912 3911 3913 3923 3928
CONECT 3913 3912 3914 3917 3929
CONECT 3914 3913 3918 3915 3930
CONECT 3915 3914 3919 3916 3924
CONECT 3916 3915 3925 3926 3920
CONECT 3917 3913 3921
CONECT 3918 3914 3922
CONECT 3919 3911 3915
CONECT 3920 3916 4017
CONECT 3921 3917
CONECT 3922 3918
CONECT 3923 3912 3931
CONECT 3924 3915
CONECT 3925 3916
CONECT 3926 3916
CONECT 3927 3911
CONECT 3928 3912
CONECT 3929 3913
CONECT 3930 3914
CONECT 3931 3923 3932 3957 3941
CONECT 3932 3931 3933 3945 3944
CONECT 3933 3932 3934 3946 3939
CONECT 3934 3933 3935 3947 3940
CONECT 3935 3934 3936 3948 3941
CONECT 3936 3935 3949 3950 3942
CONECT 3937 3938 3944 3943
CONECT 3938 3937 3951 3952 3953
CONECT 3939 3933 3954
CONECT 3940 3934 3958
CONECT 3941 3931 3935
CONECT 3942 3936 3955
CONECT 3943 3937
CONECT 3944 3932 3937 3956
CONECT 3945 3932
CONECT 3946 3933
CONECT 3947 3934
CONECT 3948 3935
CONECT 3949 3936
CONECT 3950 3936
CONECT 3951 3938
CONECT 3952 3938
CONECT 3953 3938
CONECT 3954 3939
CONECT 3955 3942
CONECT 3956 3944
CONECT 3957 3931
CONECT 3958 3940 3959 3966 3975
CONECT 3959 3958 3960 3964 3976
CONECT 3960 3959 3961 3965 3977
CONECT 3961 3960 3970 3962 3978
CONECT 3962 3961 3966 3963 3972
CONECT 3963 3962 3973 3974 3967
CONECT 3964 3959 3968
CONECT 3965 3960 3969
CONECT 3966 3958 3962
CONECT 3967 3963 3980
CONECT 3968 3964
CONECT 3969 3965
CONECT 3970 3961 3971
CONECT 3971 3970
CONECT 3972 3962
CONECT 3973 3963
CONECT 3974 3963
CONECT 3975 3958
CONECT 3976 3959
CONECT 3977 3960
CONECT 3978 3961
CONECT 3979 3980 3989 3990
CONECT 3980 3967 3979 3981 3988
CONECT 3981 3980 3982 3996 3997
CONECT 3982 3981 3983 3991 3998
CONECT 3983 3982 3984 4008 4009
CONECT 3984 3983 3985 3988 3995
CONECT 3985 3984 3986 3992 4006
CONECT 3986 3985 3987 3993 4005
CONECT 3987 3986 3994 4003 4004
CONECT 3988 3980 3984
CONECT 3989 3979
CONECT 3990 3979 4007
CONECT 3991 3982 4001
CONECT 3992 3985 3999
CONECT 3993 3986 4000
CONECT 3994 3987 4002
CONECT 3995 3984
CONECT 3996 3981
CONECT 3997 3981
CONECT 3998 3982
CONECT 3999 3992
CONECT 4000 3993
CONECT 4001 3991
CONECT 4002 3994
CONECT 4003 3987
CONECT 4004 3987
CONECT 4005 3986
CONECT 4006 3985
CONECT 4007 3990
CONECT 4008 3983
CONECT 4009 3983 4010 4013
CONECT 4010 4009 4011 4012
CONECT 4011 4010 4014 4015 4016
CONECT 4012 4010
CONECT 4013 4009
CONECT 4014 4011
CONECT 4015 4011
CONECT 4016 4011
CONECT 4017 3920 4018 4043 4027
CONECT 4018 4017 4019 4031 4030
CONECT 4019 4018 4020 4032 4025
CONECT 4020 4019 4021 4033 4026
CONECT 4021 4020 4022 4034 4027
CONECT 4022 4021 4035 4036 4028
CONECT 4023 4024 4030 4029
CONECT 4024 4023 4037 4038 4039
CONECT 4025 4019 4040
CONECT 4026 4020 4044
CONECT 4027 4017 4021
CONECT 4028 4022 4041
CONECT 4029 4023
CONECT 4030 4018 4023 4042
CONECT 4031 4018
CONECT 4032 4019
CONECT 4033 4020
CONECT 4034 4021
CONECT 4035 4022
CONECT 4036 4022
CONECT 4037 4024
CONECT 4038 4024
CONECT 4039 4024
CONECT 4040 4025
CONECT 4041 4028
CONECT 4042 4030
CONECT 4043 4017
CONECT 4044 4026 4045 4052 4061
CONECT 4045 4044 4046 4050 4062
CONECT 4046 4045 4047 4051 4063
CONECT 4047 4046 4056 4048 4064
CONECT 4048 4047 4052 4049 4058
CONECT 4049 4048 4059 4060 4053
CONECT 4050 4045 4054
CONECT 4051 4046 4066
CONECT 4052 4044 4048
CONECT 4053 4049 4055
CONECT 4054 4050
CONECT 4055 4053
CONECT 4056 4047 4057
CONECT 4057 4056
CONECT 4058 4048
CONECT 4059 4049
CONECT 4060 4049
CONECT 4061 4044
CONECT 4062 4045
CONECT 4063 4046
CONECT 4064 4047
CONECT 4065 4066 4075 4076
CONECT 4066 4051 4065 4067 4074
CONECT 4067 4066 4068 4082 4083
CONECT 4068 4067 4069 4077 4084
CONECT 4069 4068 4070 4094 4095
CONECT 4070 4069 4071 4074 4081
CONECT 4071 4070 4072 4078 4092
CONECT 4072 4071 4073 4079 4091
CONECT 4073 4072 4080 4089 4090
CONECT 4074 4066 4070
CONECT 4075 4065
CONECT 4076 4065 4093
CONECT 4077 4068 4087
CONECT 4078 4071 4085
CONECT 4079 4072 4086
CONECT 4080 4073 4088
CONECT 4081 4070
CONECT 4082 4067
CONECT 4083 4067
CONECT 4084 4068
CONECT 4085 4078
CONECT 4086 4079
CONECT 4087 4077
CONECT 4088 4080
CONECT 4089 4073
CONECT 4090 4073
CONECT 4091 4072
CONECT 4092 4071
CONECT 4093 4076
CONECT 4094 4069
CONECT 4095 4069 4096 4099
CONECT 4096 4095 4097 4098
CONECT 4097 4096 4100 4101 4102
CONECT 4098 4096
CONECT 4099 4095
CONECT 4100 4097
CONECT 4101 4097
CONECT 4102 4097
CONECT 4103 3657 4104 4109 4114
CONECT 4104 4103 4105 4110 4115
CONECT 4105 4104 4106 4111 4117
CONECT 4106 4105 4107 4112 4119
CONECT 4107 4106 4108 4109 4113
CONECT 4108 4107 4121 4122 4123
CONECT 4109 4103 4107
CONECT 4110 4104 4116
CONECT 4111 4105 4118
CONECT 4112 4106 4120
CONECT 4113 4107
CONECT 4114 4103
CONECT 4115 4104
CONECT 4116 4110
CONECT 4117 4105
CONECT 4118 4111
CONECT 4119 4106
CONECT 4120 4112
CONECT 4121 4108
CONECT 4122 4108
CONECT 4123 4108
END



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.