CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 220529192003137954

Job options:

ID        	=	 220529192003137954
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   29-MAY-22 1MOD    1       17:36
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.93
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.87
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-05-20
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2022-05-25
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.96
REMARK   3  SIM     0.59
REMARK   3  SID     88.52
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTED
REMARK   3  ALN A TRG TIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDV
REMARK   3  ALN A TRG NDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEK
REMARK   3  ALN A TRG ERKQEEGES
REMARK   3  ALN A TPL QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTED
REMARK   3  ALN A TPL TIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYL
REMARK   3  ALN A TPL DDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEK
REMARK   3  ALN A TPL ERKQEEGES
REMARK   3  ALN A OFF 18
REMARK 970   RasMol::default
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color structure 
REMARK 970   RasMol::script1::GLS G
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color gray 
REMARK 970   select   15:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   38:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   54:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   75:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   85:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   RasMol::script2::GLS S
REMARK 970   select ligand 
REMARK 970   color cpk
REMARK 970   wireframe .3
REMARK 970   select protein 
REMARK 970   wireframe off 
REMARK 970   backbone 100 
REMARK 970   color structure 
REMARK 970   select   15:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   38:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   54:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   75:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
REMARK 970   select   85:A
REMARK 970   color green
REMARK 970   backbone off
REMARK 970   wireframe .3
AUTHOR  GlyCon 1.0 (Beta)
REMARK  This file was generated from the Glycon-programm.
REMARK  Molecular: 
ATOM      1  N   GLN A   1      25.953   9.386  -3.281  1.00  0.39           N  
ATOM      2  CA  GLN A   1      24.508   9.784  -3.418  1.00  0.39           C  
ATOM      3  C   GLN A   1      23.773   8.538  -3.852  1.00  0.39           C  
ATOM      4  O   GLN A   1      24.131   7.961  -4.871  1.00  0.39           O  
ATOM      5  CB  GLN A   1      24.353  10.937  -4.458  1.00  0.39           C  
ATOM      6  CG  GLN A   1      22.979  11.670  -4.504  1.00  0.39           C  
ATOM      7  CD  GLN A   1      23.098  12.964  -5.335  1.00  0.39           C  
ATOM      8  OE1 GLN A   1      24.018  13.131  -6.127  1.00  0.39           O  
ATOM      9  NE2 GLN A   1      22.170  13.925  -5.119  1.00  0.39           N  
ATOM     10  N   ILE A   2      22.799   8.037  -3.064  1.00  0.43           N  
ATOM     11  CA  ILE A   2      21.980   6.876  -3.409  1.00  0.43           C  
ATOM     12  C   ILE A   2      21.286   7.160  -4.733  1.00  0.43           C  
ATOM     13  O   ILE A   2      20.671   8.226  -4.811  1.00  0.43           O  
ATOM     14  CB  ILE A   2      20.978   6.654  -2.275  1.00  0.43           C  
ATOM     15  CG1 ILE A   2      21.735   6.145  -1.027  1.00  0.43           C  
ATOM     16  CG2 ILE A   2      19.835   5.695  -2.657  1.00  0.43           C  
ATOM     17  CD1 ILE A   2      20.962   6.282   0.288  1.00  0.43           C  
ATOM     18  N   PRO A   3      21.396   6.357  -5.804  1.00  0.66           N  
ATOM     19  CA  PRO A   3      20.918   6.750  -7.122  1.00  0.66           C  
ATOM     20  C   PRO A   3      19.433   7.015  -7.071  1.00  0.66           C  
ATOM     21  O   PRO A   3      18.738   6.347  -6.308  1.00  0.66           O  
ATOM     22  CB  PRO A   3      21.318   5.593  -8.060  1.00  0.66           C  
ATOM     23  CG  PRO A   3      21.595   4.404  -7.135  1.00  0.66           C  
ATOM     24  CD  PRO A   3      22.068   5.058  -5.836  1.00  0.66           C  
ATOM     25  N   LEU A   4      18.927   7.984  -7.857  1.00  0.66           N  
ATOM     26  CA  LEU A   4      17.572   8.525  -7.770  1.00  0.66           C  
ATOM     27  C   LEU A   4      16.469   7.457  -7.770  1.00  0.66           C  
ATOM     28  O   LEU A   4      15.386   7.621  -7.223  1.00  0.66           O  
ATOM     29  CB  LEU A   4      17.406   9.503  -8.963  1.00  0.66           C  
ATOM     30  CG  LEU A   4      16.147  10.390  -8.968  1.00  0.66           C  
ATOM     31  CD1 LEU A   4      16.180  11.446  -7.855  1.00  0.66           C  
ATOM     32  CD2 LEU A   4      15.976  11.057 -10.344  1.00  0.66           C  
ATOM     33  N   CYS A   5      16.785   6.298  -8.376  1.00  0.81           N  
ATOM     34  CA  CYS A   5      15.935   5.145  -8.557  1.00  0.81           C  
ATOM     35  C   CYS A   5      16.273   3.942  -7.676  1.00  0.81           C  
ATOM     36  O   CYS A   5      15.726   2.861  -7.873  1.00  0.81           O  
ATOM     37  CB  CYS A   5      16.085   4.704 -10.024  1.00  0.81           C  
ATOM     38  SG  CYS A   5      15.619   6.036 -11.172  1.00  0.81           S  
ATOM     39  N   ALA A   6      17.157   4.068  -6.662  1.00  0.81           N  
ATOM     40  CA  ALA A   6      17.583   2.955  -5.818  1.00  0.81           C  
ATOM     41  C   ALA A   6      16.454   2.254  -5.078  1.00  0.81           C  
ATOM     42  O   ALA A   6      16.402   1.032  -4.991  1.00  0.81           O  
ATOM     43  CB  ALA A   6      18.576   3.443  -4.754  1.00  0.81           C  
ATOM     44  N   ASN A   7      15.482   3.046  -4.585  1.00  0.78           N  
ATOM     45  CA  ASN A   7      14.317   2.576  -3.853  1.00  0.78           C  
ATOM     46  C   ASN A   7      13.321   1.829  -4.738  1.00  0.78           C  
ATOM     47  O   ASN A   7      12.338   1.278  -4.253  1.00  0.78           O  
ATOM     48  CB  ASN A   7      13.579   3.757  -3.165  1.00  0.78           C  
ATOM     49  CG  ASN A   7      14.476   4.449  -2.136  1.00  0.78           C  
ATOM     50  OD1 ASN A   7      15.526   3.966  -1.720  1.00  0.78           O  
ATOM     51  ND2 ASN A   7      14.057   5.663  -1.703  1.00  0.78           N  
ATOM     52  N   LEU A   8      13.547   1.815  -6.068  1.00  0.83           N  
ATOM     53  CA  LEU A   8      12.690   1.137  -7.014  1.00  0.83           C  
ATOM     54  C   LEU A   8      13.297  -0.145  -7.546  1.00  0.83           C  
ATOM     55  O   LEU A   8      12.704  -0.812  -8.390  1.00  0.83           O  
ATOM     56  CB  LEU A   8      12.379   2.043  -8.220  1.00  0.83           C  
ATOM     57  CG  LEU A   8      11.661   3.354  -7.870  1.00  0.83           C  
ATOM     58  CD1 LEU A   8      11.247   4.035  -9.167  1.00  0.83           C  
ATOM     59  CD2 LEU A   8      10.409   3.141  -7.020  1.00  0.83           C  
ATOM     60  N   VAL A   9      14.484  -0.554  -7.063  1.00  0.83           N  
ATOM     61  CA  VAL A   9      15.062  -1.836  -7.430  1.00  0.83           C  
ATOM     62  C   VAL A   9      14.350  -2.939  -6.639  1.00  0.83           C  
ATOM     63  O   VAL A   9      14.350  -2.862  -5.409  1.00  0.83           O  
ATOM     64  CB  VAL A   9      16.566  -1.873  -7.170  1.00  0.83           C  
ATOM     65  CG1 VAL A   9      17.163  -3.250  -7.527  1.00  0.83           C  
ATOM     66  CG2 VAL A   9      17.243  -0.764  -8.001  1.00  0.83           C  
ATOM     67  N   PRO A  10      13.716  -3.965  -7.220  1.00  0.90           N  
ATOM     68  CA  PRO A  10      13.045  -5.001  -6.438  1.00  0.90           C  
ATOM     69  C   PRO A  10      14.018  -5.878  -5.667  1.00  0.90           C  
ATOM     70  O   PRO A  10      15.062  -6.237  -6.211  1.00  0.90           O  
ATOM     71  CB  PRO A  10      12.316  -5.845  -7.496  1.00  0.90           C  
ATOM     72  CG  PRO A  10      12.076  -4.876  -8.653  1.00  0.90           C  
ATOM     73  CD  PRO A  10      13.353  -4.039  -8.639  1.00  0.90           C  
ATOM     74  N   VAL A  11      13.701  -6.256  -4.415  1.00  0.90           N  
ATOM     75  CA  VAL A  11      14.553  -7.098  -3.597  1.00  0.90           C  
ATOM     76  C   VAL A  11      13.752  -8.345  -3.239  1.00  0.90           C  
ATOM     77  O   VAL A  11      12.540  -8.230  -3.037  1.00  0.90           O  
ATOM     78  CB  VAL A  11      15.083  -6.402  -2.342  1.00  0.90           C  
ATOM     79  CG1 VAL A  11      16.044  -5.284  -2.791  1.00  0.90           C  
ATOM     80  CG2 VAL A  11      13.940  -5.849  -1.468  1.00  0.90           C  
ATOM     81  N   PRO A  12      14.308  -9.555  -3.191  1.00  0.94           N  
ATOM     82  CA  PRO A  12      13.592 -10.753  -2.756  1.00  0.94           C  
ATOM     83  C   PRO A  12      12.887 -10.688  -1.403  1.00  0.94           C  
ATOM     84  O   PRO A  12      13.437 -10.157  -0.438  1.00  0.94           O  
ATOM     85  CB  PRO A  12      14.645 -11.868  -2.811  1.00  0.94           C  
ATOM     86  CG  PRO A  12      15.632 -11.388  -3.877  1.00  0.94           C  
ATOM     87  CD  PRO A  12      15.656  -9.875  -3.666  1.00  0.94           C  
ATOM     88  N   ILE A  13      11.671 -11.259  -1.286  1.00  0.94           N  
ATOM     89  CA  ILE A  13      10.906 -11.250  -0.043  1.00  0.94           C  
ATOM     90  C   ILE A  13      11.326 -12.402   0.873  1.00  0.94           C  
ATOM     91  O   ILE A  13      10.991 -13.574   0.678  1.00  0.94           O  
ATOM     92  CB  ILE A  13       9.395 -11.235  -0.295  1.00  0.94           C  
ATOM     93  CG1 ILE A  13       8.987  -9.911  -0.986  1.00  0.94           C  
ATOM     94  CG2 ILE A  13       8.594 -11.426   1.013  1.00  0.94           C  
ATOM     95  CD1 ILE A  13       7.596  -9.945  -1.626  1.00  0.94           C  
ATOM     96  N   THR A  14      12.080 -12.081   1.944  1.00  0.96           N  
ATOM     97  CA  THR A  14      12.531 -13.026   2.954  1.00  0.96           C  
ATOM     98  C   THR A  14      11.464 -13.189   4.013  1.00  0.96           C  
ATOM     99  O   THR A  14      10.409 -12.560   3.978  1.00  0.96           O  
ATOM    100  CB  THR A  14      13.883 -12.679   3.602  1.00  0.96           C  
ATOM    101  OG1 THR A  14      13.816 -11.563   4.470  1.00  0.96           O  
ATOM    102  CG2 THR A  14      14.890 -12.322   2.509  1.00  0.96           C  
ATOM    103  N   ASN A  15      11.676 -14.078   4.999  1.00  0.94           N  
ATOM    104  CA  ASN A  15      10.841 -14.131   6.191  1.00  0.94           C  
ATOM    105  C   ASN A  15      10.912 -12.868   7.028  1.00  0.94           C  
ATOM    106  O   ASN A  15       9.886 -12.400   7.504  1.00  0.94           O  
ATOM    107  CB  ASN A  15      11.186 -15.367   7.044  1.00  0.94           C  
ATOM    108  CG  ASN A  15      12.653 -15.260   7.448  1.00  0.94           C  
ATOM    109  OD1 ASN A  15      13.456 -14.546   6.847  1.00  0.94           O  
ATOM    110  ND2 ASN A  15      13.045 -16.021   8.492  1.00  0.94           N  
ATOM    111  N   ALA A  16      12.112 -12.263   7.158  1.00  0.99           N  
ATOM    112  CA  ALA A  16      12.296 -10.984   7.813  1.00  0.99           C  
ATOM    113  C   ALA A  16      11.514  -9.867   7.113  1.00  0.99           C  
ATOM    114  O   ALA A  16      10.846  -9.070   7.761  1.00  0.99           O  
ATOM    115  CB  ALA A  16      13.798 -10.633   7.887  1.00  0.99           C  
ATOM    116  N   THR A  17      11.512  -9.840   5.758  1.00  0.93           N  
ATOM    117  CA  THR A  17      10.704  -8.925   4.941  1.00  0.93           C  
ATOM    118  C   THR A  17       9.218  -9.054   5.226  1.00  0.93           C  
ATOM    119  O   THR A  17       8.497  -8.068   5.345  1.00  0.93           O  
ATOM    120  CB  THR A  17      10.860  -9.152   3.429  1.00  0.93           C  
ATOM    121  OG1 THR A  17      12.221  -9.211   3.039  1.00  0.93           O  
ATOM    122  CG2 THR A  17      10.221  -8.029   2.599  1.00  0.93           C  
ATOM    123  N   LEU A  18       8.718 -10.299   5.371  1.00  0.94           N  
ATOM    124  CA  LEU A  18       7.355 -10.557   5.811  1.00  0.94           C  
ATOM    125  C   LEU A  18       7.067 -10.086   7.236  1.00  0.94           C  
ATOM    126  O   LEU A  18       6.059  -9.435   7.479  1.00  0.94           O  
ATOM    127  CB  LEU A  18       6.969 -12.048   5.668  1.00  0.94           C  
ATOM    128  CG  LEU A  18       6.918 -12.562   4.215  1.00  0.94           C  
ATOM    129  CD1 LEU A  18       6.685 -14.077   4.189  1.00  0.94           C  
ATOM    130  CD2 LEU A  18       5.851 -11.853   3.369  1.00  0.94           C  
ATOM    131  N   ASP A  19       7.975 -10.343   8.202  1.00  0.96           N  
ATOM    132  CA  ASP A  19       7.865  -9.854   9.569  1.00  0.96           C  
ATOM    133  C   ASP A  19       7.812  -8.330   9.664  1.00  0.96           C  
ATOM    134  O   ASP A  19       7.042  -7.765  10.435  1.00  0.96           O  
ATOM    135  CB  ASP A  19       9.033 -10.388  10.434  1.00  0.96           C  
ATOM    136  CG  ASP A  19       8.846 -11.852  10.695  1.00  0.96           C  
ATOM    137  OD1 ASP A  19       7.746 -12.246  11.174  1.00  0.96           O  
ATOM    138  OD2 ASP A  19       9.777 -12.662  10.432  1.00  0.96           O  
ATOM    139  N   GLN A  20       8.608  -7.632   8.834  1.00  0.92           N  
ATOM    140  CA  GLN A  20       8.602  -6.185   8.703  1.00  0.92           C  
ATOM    141  C   GLN A  20       7.297  -5.555   8.216  1.00  0.92           C  
ATOM    142  O   GLN A  20       6.992  -4.425   8.588  1.00  0.92           O  
ATOM    143  CB  GLN A  20       9.724  -5.708   7.756  1.00  0.92           C  
ATOM    144  CG  GLN A  20      11.149  -5.828   8.329  1.00  0.92           C  
ATOM    145  CD  GLN A  20      12.180  -5.458   7.261  1.00  0.92           C  
ATOM    146  OE1 GLN A  20      11.956  -5.563   6.057  1.00  0.92           O  
ATOM    147  NE2 GLN A  20      13.375  -5.012   7.719  1.00  0.92           N  
ATOM    148  N   ILE A  21       6.516  -6.240   7.350  1.00  0.95           N  
ATOM    149  CA  ILE A  21       5.249  -5.719   6.849  1.00  0.95           C  
ATOM    150  C   ILE A  21       4.049  -6.241   7.635  1.00  0.95           C  
ATOM    151  O   ILE A  21       2.909  -5.876   7.360  1.00  0.95           O  
ATOM    152  CB  ILE A  21       5.029  -6.006   5.360  1.00  0.95           C  
ATOM    153  CG1 ILE A  21       4.938  -7.518   5.053  1.00  0.95           C  
ATOM    154  CG2 ILE A  21       6.152  -5.311   4.563  1.00  0.95           C  
ATOM    155  CD1 ILE A  21       4.520  -7.839   3.616  1.00  0.95           C  
ATOM    156  N   THR A  22       4.250  -7.106   8.648  1.00  0.97           N  
ATOM    157  CA  THR A  22       3.173  -7.607   9.510  1.00  0.97           C  
ATOM    158  C   THR A  22       2.550  -6.512  10.358  1.00  0.97           C  
ATOM    159  O   THR A  22       3.242  -5.772  11.055  1.00  0.97           O  
ATOM    160  CB  THR A  22       3.626  -8.724  10.455  1.00  0.97           C  
ATOM    161  OG1 THR A  22       4.053  -9.857   9.719  1.00  0.97           O  
ATOM    162  CG2 THR A  22       2.503  -9.244  11.370  1.00  0.97           C  
ATOM    163  N   GLY A  23       1.204  -6.390  10.360  1.00  0.98           N  
ATOM    164  CA  GLY A  23       0.520  -5.393  11.180  1.00  0.98           C  
ATOM    165  C   GLY A  23      -0.388  -4.493  10.391  1.00  0.98           C  
ATOM    166  O   GLY A  23      -0.889  -4.862   9.331  1.00  0.98           O  
ATOM    167  N   LYS A  24      -0.672  -3.296  10.939  1.00  0.94           N  
ATOM    168  CA  LYS A  24      -1.634  -2.354  10.398  1.00  0.94           C  
ATOM    169  C   LYS A  24      -0.944  -1.286   9.573  1.00  0.94           C  
ATOM    170  O   LYS A  24       0.038  -0.693  10.012  1.00  0.94           O  
ATOM    171  CB  LYS A  24      -2.435  -1.654  11.531  1.00  0.94           C  
ATOM    172  CG  LYS A  24      -3.581  -0.747  11.037  1.00  0.94           C  
ATOM    173  CD  LYS A  24      -4.425  -0.139  12.176  1.00  0.94           C  
ATOM    174  CE  LYS A  24      -5.649   0.629  11.652  1.00  0.94           C  
ATOM    175  NZ  LYS A  24      -6.586   1.004  12.721  1.00  0.94           N  
ATOM    176  N   TRP A  25      -1.464  -0.996   8.367  1.00  0.91           N  
ATOM    177  CA  TRP A  25      -0.920   0.018   7.495  1.00  0.91           C  
ATOM    178  C   TRP A  25      -2.034   0.909   7.009  1.00  0.91           C  
ATOM    179  O   TRP A  25      -3.195   0.508   6.914  1.00  0.91           O  
ATOM    180  CB  TRP A  25      -0.245  -0.609   6.253  1.00  0.91           C  
ATOM    181  CG  TRP A  25       0.930  -1.490   6.606  1.00  0.91           C  
ATOM    182  CD1 TRP A  25       0.948  -2.813   6.940  1.00  0.91           C  
ATOM    183  CD2 TRP A  25       2.261  -0.996   6.804  1.00  0.91           C  
ATOM    184  NE1 TRP A  25       2.209  -3.173   7.354  1.00  0.91           N  
ATOM    185  CE2 TRP A  25       3.021  -2.066   7.324  1.00  0.91           C  
ATOM    186  CE3 TRP A  25       2.825   0.255   6.604  1.00  0.91           C  
ATOM    187  CZ2 TRP A  25       4.339  -1.874   7.713  1.00  0.91           C  
ATOM    188  CZ3 TRP A  25       4.157   0.444   6.984  1.00  0.91           C  
ATOM    189  CH2 TRP A  25       4.896  -0.591   7.574  1.00  0.91           C  
ATOM    190  N   PHE A  26      -1.691   2.157   6.672  1.00  0.95           N  
ATOM    191  CA  PHE A  26      -2.609   3.141   6.160  1.00  0.95           C  
ATOM    192  C   PHE A  26      -2.156   3.500   4.772  1.00  0.95           C  
ATOM    193  O   PHE A  26      -0.977   3.751   4.521  1.00  0.95           O  
ATOM    194  CB  PHE A  26      -2.604   4.432   7.002  1.00  0.95           C  
ATOM    195  CG  PHE A  26      -3.130   4.169   8.379  1.00  0.95           C  
ATOM    196  CD1 PHE A  26      -4.451   4.496   8.714  1.00  0.95           C  
ATOM    197  CD2 PHE A  26      -2.294   3.624   9.365  1.00  0.95           C  
ATOM    198  CE1 PHE A  26      -4.918   4.308  10.021  1.00  0.95           C  
ATOM    199  CE2 PHE A  26      -2.761   3.425  10.667  1.00  0.95           C  
ATOM    200  CZ  PHE A  26      -4.067   3.787  11.001  1.00  0.95           C  
ATOM    201  N   TYR A  27      -3.095   3.525   3.817  1.00  0.96           N  
ATOM    202  CA  TYR A  27      -2.855   4.013   2.480  1.00  0.96           C  
ATOM    203  C   TYR A  27      -2.834   5.536   2.534  1.00  0.96           C  
ATOM    204  O   TYR A  27      -3.797   6.165   2.973  1.00  0.96           O  
ATOM    205  CB  TYR A  27      -3.966   3.452   1.556  1.00  0.96           C  
ATOM    206  CG  TYR A  27      -3.964   4.022   0.164  1.00  0.96           C  
ATOM    207  CD1 TYR A  27      -5.106   4.696  -0.287  1.00  0.96           C  
ATOM    208  CD2 TYR A  27      -2.836   3.961  -0.669  1.00  0.96           C  
ATOM    209  CE1 TYR A  27      -5.094   5.385  -1.501  1.00  0.96           C  
ATOM    210  CE2 TYR A  27      -2.836   4.616  -1.912  1.00  0.96           C  
ATOM    211  CZ  TYR A  27      -3.949   5.380  -2.294  1.00  0.96           C  
ATOM    212  OH  TYR A  27      -3.992   6.232  -3.408  1.00  0.96           O  
ATOM    213  N   ILE A  28      -1.704   6.147   2.133  1.00  0.95           N  
ATOM    214  CA  ILE A  28      -1.491   7.582   2.235  1.00  0.95           C  
ATOM    215  C   ILE A  28      -1.711   8.253   0.892  1.00  0.95           C  
ATOM    216  O   ILE A  28      -2.416   9.253   0.789  1.00  0.95           O  
ATOM    217  CB  ILE A  28      -0.080   7.866   2.748  1.00  0.95           C  
ATOM    218  CG1 ILE A  28       0.215   7.132   4.082  1.00  0.95           C  
ATOM    219  CG2 ILE A  28       0.210   9.382   2.847  1.00  0.95           C  
ATOM    220  CD1 ILE A  28      -0.725   7.476   5.238  1.00  0.95           C  
ATOM    221  N   ALA A  29      -1.117   7.716  -0.191  1.00  0.95           N  
ATOM    222  CA  ALA A  29      -1.201   8.381  -1.469  1.00  0.95           C  
ATOM    223  C   ALA A  29      -0.837   7.451  -2.610  1.00  0.95           C  
ATOM    224  O   ALA A  29      -0.314   6.356  -2.401  1.00  0.95           O  
ATOM    225  CB  ALA A  29      -0.266   9.604  -1.515  1.00  0.95           C  
ATOM    226  N   SER A  30      -1.069   7.861  -3.867  1.00  0.95           N  
ATOM    227  CA  SER A  30      -0.516   7.163  -5.011  1.00  0.95           C  
ATOM    228  C   SER A  30      -0.488   8.050  -6.229  1.00  0.95           C  
ATOM    229  O   SER A  30      -1.134   9.094  -6.276  1.00  0.95           O  
ATOM    230  CB  SER A  30      -1.226   5.840  -5.407  1.00  0.95           C  
ATOM    231  OG  SER A  30      -2.581   6.045  -5.777  1.00  0.95           O  
ATOM    232  N   ALA A  31       0.292   7.658  -7.249  1.00  0.97           N  
ATOM    233  CA  ALA A  31       0.233   8.286  -8.545  1.00  0.97           C  
ATOM    234  C   ALA A  31       0.590   7.238  -9.583  1.00  0.97           C  
ATOM    235  O   ALA A  31       1.536   6.467  -9.398  1.00  0.97           O  
ATOM    236  CB  ALA A  31       1.196   9.485  -8.636  1.00  0.97           C  
ATOM    237  N   PHE A  32      -0.158   7.175 -10.699  1.00  0.92           N  
ATOM    238  CA  PHE A  32       0.062   6.196 -11.741  1.00  0.92           C  
ATOM    239  C   PHE A  32       0.006   6.887 -13.076  1.00  0.92           C  
ATOM    240  O   PHE A  32      -0.652   7.911 -13.236  1.00  0.92           O  
ATOM    241  CB  PHE A  32      -1.043   5.109 -11.787  1.00  0.92           C  
ATOM    242  CG  PHE A  32      -1.106   4.328 -10.520  1.00  0.92           C  
ATOM    243  CD1 PHE A  32      -0.365   3.148 -10.410  1.00  0.92           C  
ATOM    244  CD2 PHE A  32      -1.935   4.720  -9.458  1.00  0.92           C  
ATOM    245  CE1 PHE A  32      -0.396   2.405  -9.228  1.00  0.92           C  
ATOM    246  CE2 PHE A  32      -2.010   3.938  -8.303  1.00  0.92           C  
ATOM    247  CZ  PHE A  32      -1.220   2.795  -8.171  1.00  0.92           C  
ATOM    248  N   ARG A  33       0.673   6.318 -14.097  1.00  0.87           N  
ATOM    249  CA  ARG A  33       0.424   6.725 -15.466  1.00  0.87           C  
ATOM    250  C   ARG A  33      -0.710   5.913 -16.069  1.00  0.87           C  
ATOM    251  O   ARG A  33      -1.328   6.303 -17.051  1.00  0.87           O  
ATOM    252  CB  ARG A  33       1.673   6.523 -16.344  1.00  0.87           C  
ATOM    253  CG  ARG A  33       2.786   7.556 -16.104  1.00  0.87           C  
ATOM    254  CD  ARG A  33       3.933   7.355 -17.087  1.00  0.87           C  
ATOM    255  NE  ARG A  33       4.957   8.417 -16.830  1.00  0.87           N  
ATOM    256  CZ  ARG A  33       6.143   8.431 -17.451  1.00  0.87           C  
ATOM    257  NH1 ARG A  33       6.514   7.456 -18.270  1.00  0.87           N  
ATOM    258  NH2 ARG A  33       6.995   9.418 -17.218  1.00  0.87           N  
ATOM    259  N   ASN A  34      -1.046   4.760 -15.461  1.00  0.87           N  
ATOM    260  CA  ASN A  34      -2.224   4.013 -15.836  1.00  0.87           C  
ATOM    261  C   ASN A  34      -3.519   4.724 -15.390  1.00  0.87           C  
ATOM    262  O   ASN A  34      -3.807   4.878 -14.201  1.00  0.87           O  
ATOM    263  CB  ASN A  34      -2.111   2.560 -15.304  1.00  0.87           C  
ATOM    264  CG  ASN A  34      -3.281   1.705 -15.769  1.00  0.87           C  
ATOM    265  OD1 ASN A  34      -4.367   1.806 -15.198  1.00  0.87           O  
ATOM    266  ND2 ASN A  34      -3.101   0.896 -16.830  1.00  0.87           N  
ATOM    267  N   GLU A  35      -4.346   5.137 -16.372  1.00  0.79           N  
ATOM    268  CA  GLU A  35      -5.626   5.805 -16.191  1.00  0.79           C  
ATOM    269  C   GLU A  35      -6.687   5.012 -15.436  1.00  0.79           C  
ATOM    270  O   GLU A  35      -7.479   5.566 -14.673  1.00  0.79           O  
ATOM    271  CB  GLU A  35      -6.181   6.263 -17.566  1.00  0.79           C  
ATOM    272  CG  GLU A  35      -5.316   7.379 -18.202  1.00  0.79           C  
ATOM    273  CD  GLU A  35      -5.375   8.659 -17.364  1.00  0.79           C  
ATOM    274  OE1 GLU A  35      -4.426   9.469 -17.466  1.00  0.79           O  
ATOM    275  OE2 GLU A  35      -6.376   8.827 -16.614  1.00  0.79           O  
ATOM    276  N   GLU A  36      -6.747   3.677 -15.615  1.00  0.79           N  
ATOM    277  CA  GLU A  36      -7.690   2.815 -14.915  1.00  0.79           C  
ATOM    278  C   GLU A  36      -7.443   2.813 -13.410  1.00  0.79           C  
ATOM    279  O   GLU A  36      -8.352   2.973 -12.594  1.00  0.79           O  
ATOM    280  CB  GLU A  36      -7.603   1.384 -15.481  1.00  0.79           C  
ATOM    281  CG  GLU A  36      -8.650   0.395 -14.923  1.00  0.79           C  
ATOM    282  CD  GLU A  36      -8.504  -1.001 -15.540  1.00  0.79           C  
ATOM    283  OE1 GLU A  36      -9.277  -1.897 -15.115  1.00  0.79           O  
ATOM    284  OE2 GLU A  36      -7.630  -1.182 -16.427  1.00  0.79           O  
ATOM    285  N   TYR A  37      -6.156   2.719 -13.022  1.00  0.87           N  
ATOM    286  CA  TYR A  37      -5.714   2.840 -11.646  1.00  0.87           C  
ATOM    287  C   TYR A  37      -5.994   4.206 -11.034  1.00  0.87           C  
ATOM    288  O   TYR A  37      -6.511   4.285  -9.923  1.00  0.87           O  
ATOM    289  CB  TYR A  37      -4.211   2.517 -11.502  1.00  0.87           C  
ATOM    290  CG  TYR A  37      -3.954   1.038 -11.361  1.00  0.87           C  
ATOM    291  CD1 TYR A  37      -3.238   0.585 -10.244  1.00  0.87           C  
ATOM    292  CD2 TYR A  37      -4.362   0.094 -12.320  1.00  0.87           C  
ATOM    293  CE1 TYR A  37      -2.875  -0.758 -10.116  1.00  0.87           C  
ATOM    294  CE2 TYR A  37      -4.011  -1.259 -12.190  1.00  0.87           C  
ATOM    295  CZ  TYR A  37      -3.250  -1.686 -11.095  1.00  0.87           C  
ATOM    296  OH  TYR A  37      -2.853  -3.029 -10.940  1.00  0.87           O  
ATOM    297  N   ASN A  38      -5.718   5.313 -11.761  1.00  0.84           N  
ATOM    298  CA  ASN A  38      -6.028   6.668 -11.308  1.00  0.84           C  
ATOM    299  C   ASN A  38      -7.512   6.890 -11.027  1.00  0.84           C  
ATOM    300  O   ASN A  38      -7.882   7.448  -9.997  1.00  0.84           O  
ATOM    301  CB  ASN A  38      -5.561   7.733 -12.336  1.00  0.84           C  
ATOM    302  CG  ASN A  38      -4.963   8.941 -11.619  1.00  0.84           C  
ATOM    303  OD1 ASN A  38      -5.201   9.183 -10.436  1.00  0.84           O  
ATOM    304  ND2 ASN A  38      -4.174   9.750 -12.362  1.00  0.84           N  
ATOM    305  N   LYS A  39      -8.403   6.406 -11.914  1.00  0.79           N  
ATOM    306  CA  LYS A  39      -9.841   6.436 -11.694  1.00  0.79           C  
ATOM    307  C   LYS A  39     -10.311   5.637 -10.486  1.00  0.79           C  
ATOM    308  O   LYS A  39     -11.112   6.113  -9.690  1.00  0.79           O  
ATOM    309  CB  LYS A  39     -10.577   5.920 -12.950  1.00  0.79           C  
ATOM    310  CG  LYS A  39     -10.510   6.927 -14.105  1.00  0.79           C  
ATOM    311  CD  LYS A  39     -11.115   6.388 -15.408  1.00  0.79           C  
ATOM    312  CE  LYS A  39     -10.970   7.383 -16.560  1.00  0.79           C  
ATOM    313  NZ  LYS A  39     -11.478   6.779 -17.811  1.00  0.79           N  
ATOM    314  N   SER A  40      -9.791   4.405 -10.302  1.00  0.81           N  
ATOM    315  CA  SER A  40     -10.118   3.560  -9.153  1.00  0.81           C  
ATOM    316  C   SER A  40      -9.694   4.173  -7.826  1.00  0.81           C  
ATOM    317  O   SER A  40     -10.440   4.203  -6.849  1.00  0.81           O  
ATOM    318  CB  SER A  40      -9.439   2.171  -9.300  1.00  0.81           C  
ATOM    319  OG  SER A  40      -9.847   1.236  -8.297  1.00  0.81           O  
ATOM    320  N   VAL A  41      -8.468   4.730  -7.793  1.00  0.88           N  
ATOM    321  CA  VAL A  41      -7.917   5.439  -6.652  1.00  0.88           C  
ATOM    322  C   VAL A  41      -8.677   6.703  -6.294  1.00  0.88           C  
ATOM    323  O   VAL A  41      -8.883   6.991  -5.120  1.00  0.88           O  
ATOM    324  CB  VAL A  41      -6.437   5.714  -6.853  1.00  0.88           C  
ATOM    325  CG1 VAL A  41      -5.901   6.679  -5.787  1.00  0.88           C  
ATOM    326  CG2 VAL A  41      -5.701   4.364  -6.763  1.00  0.88           C  
ATOM    327  N   GLN A  42      -9.151   7.482  -7.287  1.00  0.83           N  
ATOM    328  CA  GLN A  42      -9.851   8.744  -7.079  1.00  0.83           C  
ATOM    329  C   GLN A  42     -11.076   8.663  -6.168  1.00  0.83           C  
ATOM    330  O   GLN A  42     -11.412   9.605  -5.452  1.00  0.83           O  
ATOM    331  CB  GLN A  42     -10.247   9.350  -8.447  1.00  0.83           C  
ATOM    332  CG  GLN A  42     -10.794  10.792  -8.363  1.00  0.83           C  
ATOM    333  CD  GLN A  42     -11.097  11.372  -9.745  1.00  0.83           C  
ATOM    334  OE1 GLN A  42     -11.022  10.737 -10.792  1.00  0.83           O  
ATOM    335  NE2 GLN A  42     -11.460  12.679  -9.746  1.00  0.83           N  
ATOM    336  N   GLU A  43     -11.762   7.508  -6.157  1.00  0.84           N  
ATOM    337  CA  GLU A  43     -12.873   7.260  -5.268  1.00  0.84           C  
ATOM    338  C   GLU A  43     -12.484   6.935  -3.824  1.00  0.84           C  
ATOM    339  O   GLU A  43     -13.318   7.009  -2.920  1.00  0.84           O  
ATOM    340  CB  GLU A  43     -13.699   6.085  -5.817  1.00  0.84           C  
ATOM    341  CG  GLU A  43     -14.303   6.336  -7.221  1.00  0.84           C  
ATOM    342  CD  GLU A  43     -15.354   5.282  -7.552  1.00  0.84           C  
ATOM    343  OE1 GLU A  43     -15.980   5.360  -8.633  1.00  0.84           O  
ATOM    344  OE2 GLU A  43     -15.567   4.380  -6.690  1.00  0.84           O  
ATOM    345  N   ILE A  44     -11.214   6.561  -3.557  1.00  0.93           N  
ATOM    346  CA  ILE A  44     -10.745   6.156  -2.238  1.00  0.93           C  
ATOM    347  C   ILE A  44     -10.525   7.371  -1.353  1.00  0.93           C  
ATOM    348  O   ILE A  44      -9.624   8.181  -1.558  1.00  0.93           O  
ATOM    349  CB  ILE A  44      -9.464   5.314  -2.296  1.00  0.93           C  
ATOM    350  CG1 ILE A  44      -9.672   4.048  -3.165  1.00  0.93           C  
ATOM    351  CG2 ILE A  44      -8.997   4.949  -0.868  1.00  0.93           C  
ATOM    352  CD1 ILE A  44      -8.400   3.221  -3.392  1.00  0.93           C  
ATOM    353  N   GLN A  45     -11.356   7.533  -0.308  1.00  0.90           N  
ATOM    354  CA  GLN A  45     -11.239   8.647   0.608  1.00  0.90           C  
ATOM    355  C   GLN A  45     -10.240   8.354   1.715  1.00  0.90           C  
ATOM    356  O   GLN A  45      -9.414   9.192   2.061  1.00  0.90           O  
ATOM    357  CB  GLN A  45     -12.633   8.991   1.175  1.00  0.90           C  
ATOM    358  CG  GLN A  45     -13.635   9.395   0.064  1.00  0.90           C  
ATOM    359  CD  GLN A  45     -15.061   9.483   0.613  1.00  0.90           C  
ATOM    360  OE1 GLN A  45     -15.655   8.457   0.934  1.00  0.90           O  
ATOM    361  NE2 GLN A  45     -15.637  10.704   0.690  1.00  0.90           N  
ATOM    362  N   ALA A  46     -10.273   7.129   2.270  1.00  0.95           N  
ATOM    363  CA  ALA A  46      -9.336   6.685   3.275  1.00  0.95           C  
ATOM    364  C   ALA A  46      -9.283   5.172   3.192  1.00  0.95           C  
ATOM    365  O   ALA A  46     -10.285   4.544   2.871  1.00  0.95           O  
ATOM    366  CB  ALA A  46      -9.780   7.099   4.693  1.00  0.95           C  
ATOM    367  N   THR A  47      -8.132   4.533   3.471  1.00  0.94           N  
ATOM    368  CA  THR A  47      -8.078   3.068   3.507  1.00  0.94           C  
ATOM    369  C   THR A  47      -7.039   2.673   4.522  1.00  0.94           C  
ATOM    370  O   THR A  47      -5.921   3.194   4.517  1.00  0.94           O  
ATOM    371  CB  THR A  47      -7.668   2.378   2.191  1.00  0.94           C  
ATOM    372  OG1 THR A  47      -8.641   2.514   1.172  1.00  0.94           O  
ATOM    373  CG2 THR A  47      -7.467   0.862   2.327  1.00  0.94           C  
ATOM    374  N   PHE A  48      -7.346   1.697   5.386  1.00  0.94           N  
ATOM    375  CA  PHE A  48      -6.362   1.072   6.238  1.00  0.94           C  
ATOM    376  C   PHE A  48      -6.527  -0.421   6.102  1.00  0.94           C  
ATOM    377  O   PHE A  48      -7.557  -0.918   5.646  1.00  0.94           O  
ATOM    378  CB  PHE A  48      -6.420   1.516   7.728  1.00  0.94           C  
ATOM    379  CG  PHE A  48      -7.725   1.215   8.413  1.00  0.94           C  
ATOM    380  CD1 PHE A  48      -8.751   2.169   8.418  1.00  0.94           C  
ATOM    381  CD2 PHE A  48      -7.927   0.000   9.089  1.00  0.94           C  
ATOM    382  CE1 PHE A  48      -9.937   1.943   9.122  1.00  0.94           C  
ATOM    383  CE2 PHE A  48      -9.115  -0.232   9.792  1.00  0.94           C  
ATOM    384  CZ  PHE A  48     -10.119   0.742   9.810  1.00  0.94           C  
ATOM    385  N   PHE A  49      -5.500  -1.188   6.476  1.00  0.93           N  
ATOM    386  CA  PHE A  49      -5.578  -2.616   6.346  1.00  0.93           C  
ATOM    387  C   PHE A  49      -4.605  -3.297   7.271  1.00  0.93           C  
ATOM    388  O   PHE A  49      -3.714  -2.671   7.840  1.00  0.93           O  
ATOM    389  CB  PHE A  49      -5.383  -3.110   4.886  1.00  0.93           C  
ATOM    390  CG  PHE A  49      -4.102  -2.637   4.276  1.00  0.93           C  
ATOM    391  CD1 PHE A  49      -4.094  -1.424   3.576  1.00  0.93           C  
ATOM    392  CD2 PHE A  49      -2.908  -3.362   4.411  1.00  0.93           C  
ATOM    393  CE1 PHE A  49      -2.911  -0.930   3.028  1.00  0.93           C  
ATOM    394  CE2 PHE A  49      -1.721  -2.867   3.859  1.00  0.93           C  
ATOM    395  CZ  PHE A  49      -1.722  -1.656   3.159  1.00  0.93           C  
ATOM    396  N   TYR A  50      -4.783  -4.616   7.443  1.00  0.94           N  
ATOM    397  CA  TYR A  50      -3.927  -5.459   8.239  1.00  0.94           C  
ATOM    398  C   TYR A  50      -3.341  -6.538   7.362  1.00  0.94           C  
ATOM    399  O   TYR A  50      -4.066  -7.194   6.611  1.00  0.94           O  
ATOM    400  CB  TYR A  50      -4.679  -6.214   9.357  1.00  0.94           C  
ATOM    401  CG  TYR A  50      -5.144  -5.291  10.431  1.00  0.94           C  
ATOM    402  CD1 TYR A  50      -4.418  -5.215  11.629  1.00  0.94           C  
ATOM    403  CD2 TYR A  50      -6.303  -4.514  10.274  1.00  0.94           C  
ATOM    404  CE1 TYR A  50      -4.855  -4.394  12.667  1.00  0.94           C  
ATOM    405  CE2 TYR A  50      -6.737  -3.675  11.311  1.00  0.94           C  
ATOM    406  CZ  TYR A  50      -6.006  -3.638  12.509  1.00  0.94           C  
ATOM    407  OH  TYR A  50      -6.350  -2.850  13.606  1.00  0.94           O  
ATOM    408  N   PHE A  51      -2.028  -6.771   7.490  1.00  0.92           N  
ATOM    409  CA  PHE A  51      -1.340  -7.877   6.865  1.00  0.92           C  
ATOM    410  C   PHE A  51      -0.961  -8.898   7.914  1.00  0.92           C  
ATOM    411  O   PHE A  51      -0.316  -8.582   8.915  1.00  0.92           O  
ATOM    412  CB  PHE A  51      -0.011  -7.443   6.197  1.00  0.92           C  
ATOM    413  CG  PHE A  51      -0.160  -6.750   4.875  1.00  0.92           C  
ATOM    414  CD1 PHE A  51      -1.224  -7.000   3.990  1.00  0.92           C  
ATOM    415  CD2 PHE A  51       0.877  -5.899   4.459  1.00  0.92           C  
ATOM    416  CE1 PHE A  51      -1.244  -6.411   2.723  1.00  0.92           C  
ATOM    417  CE2 PHE A  51       0.863  -5.316   3.187  1.00  0.92           C  
ATOM    418  CZ  PHE A  51      -0.202  -5.573   2.317  1.00  0.92           C  
ATOM    419  N   THR A  52      -1.333 -10.167   7.672  1.00  0.94           N  
ATOM    420  CA  THR A  52      -0.932 -11.291   8.507  1.00  0.94           C  
ATOM    421  C   THR A  52      -0.293 -12.344   7.596  1.00  0.94           C  
ATOM    422  O   THR A  52      -1.021 -13.099   6.945  1.00  0.94           O  
ATOM    423  CB  THR A  52      -2.123 -11.951   9.209  1.00  0.94           C  
ATOM    424  OG1 THR A  52      -2.870 -11.065  10.032  1.00  0.94           O  
ATOM    425  CG2 THR A  52      -1.681 -13.055  10.172  1.00  0.94           C  
ATOM    426  N   PRO A  53       1.030 -12.449   7.475  1.00  0.97           N  
ATOM    427  CA  PRO A  53       1.659 -13.379   6.533  1.00  0.97           C  
ATOM    428  C   PRO A  53       1.708 -14.832   6.964  1.00  0.97           C  
ATOM    429  O   PRO A  53       2.021 -15.120   8.116  1.00  0.97           O  
ATOM    430  CB  PRO A  53       3.101 -12.865   6.393  1.00  0.97           C  
ATOM    431  CG  PRO A  53       3.010 -11.382   6.737  1.00  0.97           C  
ATOM    432  CD  PRO A  53       1.951 -11.369   7.834  1.00  0.97           C  
ATOM    433  N   ASN A  54       1.494 -15.775   6.030  1.00  0.92           N  
ATOM    434  CA  ASN A  54       1.773 -17.177   6.235  1.00  0.92           C  
ATOM    435  C   ASN A  54       3.075 -17.420   5.482  1.00  0.92           C  
ATOM    436  O   ASN A  54       3.135 -17.360   4.257  1.00  0.92           O  
ATOM    437  CB  ASN A  54       0.603 -18.067   5.722  1.00  0.92           C  
ATOM    438  CG  ASN A  54      -0.725 -17.777   6.427  1.00  0.92           C  
ATOM    439  OD1 ASN A  54      -0.927 -16.716   7.022  1.00  0.92           O  
ATOM    440  ND2 ASN A  54      -1.657 -18.752   6.380  1.00  0.92           N  
ATOM    441  N   LYS A  55       4.170 -17.677   6.224  1.00  0.89           N  
ATOM    442  CA  LYS A  55       5.503 -17.844   5.677  1.00  0.89           C  
ATOM    443  C   LYS A  55       5.729 -19.210   5.051  1.00  0.89           C  
ATOM    444  O   LYS A  55       6.715 -19.415   4.353  1.00  0.89           O  
ATOM    445  CB  LYS A  55       6.557 -17.665   6.802  1.00  0.89           C  
ATOM    446  CG  LYS A  55       6.502 -16.293   7.491  1.00  0.89           C  
ATOM    447  CD  LYS A  55       7.478 -16.168   8.677  1.00  0.89           C  
ATOM    448  CE  LYS A  55       7.293 -14.850   9.436  1.00  0.89           C  
ATOM    449  NZ  LYS A  55       8.188 -14.732  10.598  1.00  0.89           N  
ATOM    450  N   THR A  56       4.831 -20.174   5.329  1.00  0.87           N  
ATOM    451  CA  THR A  56       4.903 -21.539   4.813  1.00  0.87           C  
ATOM    452  C   THR A  56       4.243 -21.651   3.457  1.00  0.87           C  
ATOM    453  O   THR A  56       4.692 -22.382   2.580  1.00  0.87           O  
ATOM    454  CB  THR A  56       4.226 -22.534   5.749  1.00  0.87           C  
ATOM    455  OG1 THR A  56       4.818 -22.476   7.041  1.00  0.87           O  
ATOM    456  CG2 THR A  56       4.395 -23.982   5.272  1.00  0.87           C  
ATOM    457  N   GLU A  57       3.133 -20.918   3.255  1.00  0.85           N  
ATOM    458  CA  GLU A  57       2.346 -21.008   2.038  1.00  0.85           C  
ATOM    459  C   GLU A  57       2.627 -19.869   1.080  1.00  0.85           C  
ATOM    460  O   GLU A  57       2.064 -19.808  -0.010  1.00  0.85           O  
ATOM    461  CB  GLU A  57       0.847 -20.957   2.403  1.00  0.85           C  
ATOM    462  CG  GLU A  57       0.360 -22.226   3.138  1.00  0.85           C  
ATOM    463  CD  GLU A  57      -1.044 -22.069   3.718  1.00  0.85           C  
ATOM    464  OE1 GLU A  57      -1.434 -22.973   4.498  1.00  0.85           O  
ATOM    465  OE2 GLU A  57      -1.691 -21.013   3.482  1.00  0.85           O  
ATOM    466  N   ASP A  58       3.507 -18.931   1.480  1.00  0.92           N  
ATOM    467  CA  ASP A  58       3.819 -17.718   0.751  1.00  0.92           C  
ATOM    468  C   ASP A  58       2.588 -16.873   0.420  1.00  0.92           C  
ATOM    469  O   ASP A  58       2.384 -16.393  -0.696  1.00  0.92           O  
ATOM    470  CB  ASP A  58       4.773 -18.004  -0.435  1.00  0.92           C  
ATOM    471  CG  ASP A  58       6.167 -18.336   0.063  1.00  0.92           C  
ATOM    472  OD1 ASP A  58       6.419 -18.312   1.299  1.00  0.92           O  
ATOM    473  OD2 ASP A  58       7.076 -18.503  -0.789  1.00  0.92           O  
ATOM    474  N   THR A  59       1.739 -16.643   1.443  1.00  0.93           N  
ATOM    475  CA  THR A  59       0.513 -15.873   1.321  1.00  0.93           C  
ATOM    476  C   THR A  59       0.473 -14.822   2.394  1.00  0.93           C  
ATOM    477  O   THR A  59       1.112 -14.926   3.439  1.00  0.93           O  
ATOM    478  CB  THR A  59      -0.805 -16.660   1.405  1.00  0.93           C  
ATOM    479  OG1 THR A  59      -0.954 -17.368   2.630  1.00  0.93           O  
ATOM    480  CG2 THR A  59      -0.863 -17.685   0.277  1.00  0.93           C  
ATOM    481  N   ILE A  60      -0.290 -13.744   2.168  1.00  0.95           N  
ATOM    482  CA  ILE A  60      -0.547 -12.743   3.183  1.00  0.95           C  
ATOM    483  C   ILE A  60      -2.040 -12.625   3.314  1.00  0.95           C  
ATOM    484  O   ILE A  60      -2.741 -12.290   2.360  1.00  0.95           O  
ATOM    485  CB  ILE A  60       0.059 -11.378   2.866  1.00  0.95           C  
ATOM    486  CG1 ILE A  60       1.589 -11.468   2.676  1.00  0.95           C  
ATOM    487  CG2 ILE A  60      -0.287 -10.371   3.984  1.00  0.95           C  
ATOM    488  CD1 ILE A  60       2.190 -10.228   2.007  1.00  0.95           C  
ATOM    489  N   PHE A  61      -2.589 -12.894   4.512  1.00  0.94           N  
ATOM    490  CA  PHE A  61      -3.990 -12.647   4.781  1.00  0.94           C  
ATOM    491  C   PHE A  61      -4.184 -11.147   4.961  1.00  0.94           C  
ATOM    492  O   PHE A  61      -3.605 -10.528   5.854  1.00  0.94           O  
ATOM    493  CB  PHE A  61      -4.473 -13.444   6.022  1.00  0.94           C  
ATOM    494  CG  PHE A  61      -5.935 -13.252   6.339  1.00  0.94           C  
ATOM    495  CD1 PHE A  61      -6.342 -12.844   7.623  1.00  0.94           C  
ATOM    496  CD2 PHE A  61      -6.913 -13.527   5.371  1.00  0.94           C  
ATOM    497  CE1 PHE A  61      -7.704 -12.728   7.934  1.00  0.94           C  
ATOM    498  CE2 PHE A  61      -8.272 -13.399   5.677  1.00  0.94           C  
ATOM    499  CZ  PHE A  61      -8.669 -12.995   6.956  1.00  0.94           C  
ATOM    500  N   LEU A  62      -4.985 -10.539   4.075  1.00  0.93           N  
ATOM    501  CA  LEU A  62      -5.240  -9.121   4.027  1.00  0.93           C  
ATOM    502  C   LEU A  62      -6.610  -8.878   4.616  1.00  0.93           C  
ATOM    503  O   LEU A  62      -7.592  -9.501   4.215  1.00  0.93           O  
ATOM    504  CB  LEU A  62      -5.203  -8.624   2.553  1.00  0.93           C  
ATOM    505  CG  LEU A  62      -5.762  -7.213   2.262  1.00  0.93           C  
ATOM    506  CD1 LEU A  62      -5.034  -6.118   3.038  1.00  0.93           C  
ATOM    507  CD2 LEU A  62      -5.715  -6.885   0.761  1.00  0.93           C  
ATOM    508  N   ARG A  63      -6.717  -7.949   5.585  1.00  0.86           N  
ATOM    509  CA  ARG A  63      -8.000  -7.450   6.037  1.00  0.86           C  
ATOM    510  C   ARG A  63      -8.062  -5.970   5.734  1.00  0.86           C  
ATOM    511  O   ARG A  63      -7.352  -5.187   6.360  1.00  0.86           O  
ATOM    512  CB  ARG A  63      -8.235  -7.659   7.561  1.00  0.86           C  
ATOM    513  CG  ARG A  63      -8.123  -9.116   8.054  1.00  0.86           C  
ATOM    514  CD  ARG A  63      -8.526  -9.334   9.520  1.00  0.86           C  
ATOM    515  NE  ARG A  63      -7.483  -8.674  10.378  1.00  0.86           N  
ATOM    516  CZ  ARG A  63      -6.414  -9.300  10.892  1.00  0.86           C  
ATOM    517  NH1 ARG A  63      -6.188 -10.586  10.665  1.00  0.86           N  
ATOM    518  NH2 ARG A  63      -5.535  -8.615  11.618  1.00  0.86           N  
ATOM    519  N   GLU A  64      -8.908  -5.557   4.779  1.00  0.88           N  
ATOM    520  CA  GLU A  64      -8.903  -4.230   4.204  1.00  0.88           C  
ATOM    521  C   GLU A  64     -10.167  -3.501   4.570  1.00  0.88           C  
ATOM    522  O   GLU A  64     -11.274  -4.035   4.487  1.00  0.88           O  
ATOM    523  CB  GLU A  64      -8.800  -4.337   2.667  1.00  0.88           C  
ATOM    524  CG  GLU A  64      -8.723  -3.004   1.884  1.00  0.88           C  
ATOM    525  CD  GLU A  64      -8.556  -3.302   0.415  1.00  0.88           C  
ATOM    526  OE1 GLU A  64      -9.502  -3.895  -0.163  1.00  0.88           O  
ATOM    527  OE2 GLU A  64      -7.490  -3.003  -0.180  1.00  0.88           O  
ATOM    528  N   TYR A  65     -10.010  -2.254   5.027  1.00  0.92           N  
ATOM    529  CA  TYR A  65     -11.093  -1.400   5.423  1.00  0.92           C  
ATOM    530  C   TYR A  65     -10.957  -0.159   4.570  1.00  0.92           C  
ATOM    531  O   TYR A  65     -10.028   0.633   4.737  1.00  0.92           O  
ATOM    532  CB  TYR A  65     -10.927  -1.000   6.896  1.00  0.92           C  
ATOM    533  CG  TYR A  65     -11.101  -2.158   7.829  1.00  0.92           C  
ATOM    534  CD1 TYR A  65     -12.298  -2.367   8.538  1.00  0.92           C  
ATOM    535  CD2 TYR A  65     -10.008  -3.003   8.064  1.00  0.92           C  
ATOM    536  CE1 TYR A  65     -12.377  -3.384   9.505  1.00  0.92           C  
ATOM    537  CE2 TYR A  65     -10.086  -4.020   9.012  1.00  0.92           C  
ATOM    538  CZ  TYR A  65     -11.252  -4.186   9.757  1.00  0.92           C  
ATOM    539  OH  TYR A  65     -11.219  -5.176  10.750  1.00  0.92           O  
ATOM    540  N   GLN A  66     -11.866   0.033   3.607  1.00  0.90           N  
ATOM    541  CA  GLN A  66     -11.740   1.067   2.607  1.00  0.90           C  
ATOM    542  C   GLN A  66     -12.948   1.977   2.630  1.00  0.90           C  
ATOM    543  O   GLN A  66     -14.088   1.536   2.493  1.00  0.90           O  
ATOM    544  CB  GLN A  66     -11.600   0.402   1.217  1.00  0.90           C  
ATOM    545  CG  GLN A  66     -11.642   1.365   0.012  1.00  0.90           C  
ATOM    546  CD  GLN A  66     -11.198   0.661  -1.270  1.00  0.90           C  
ATOM    547  OE1 GLN A  66     -11.987   0.264  -2.129  1.00  0.90           O  
ATOM    548  NE2 GLN A  66      -9.861   0.537  -1.424  1.00  0.90           N  
ATOM    549  N   THR A  67     -12.730   3.292   2.787  1.00  0.91           N  
ATOM    550  CA  THR A  67     -13.791   4.285   2.792  1.00  0.91           C  
ATOM    551  C   THR A  67     -13.937   4.841   1.387  1.00  0.91           C  
ATOM    552  O   THR A  67     -13.012   5.434   0.822  1.00  0.91           O  
ATOM    553  CB  THR A  67     -13.542   5.449   3.765  1.00  0.91           C  
ATOM    554  OG1 THR A  67     -13.487   4.991   5.107  1.00  0.91           O  
ATOM    555  CG2 THR A  67     -14.697   6.467   3.668  1.00  0.91           C  
ATOM    556  N   ARG A  68     -15.117   4.647   0.777  1.00  0.83           N  
ATOM    557  CA  ARG A  68     -15.451   5.120  -0.551  1.00  0.83           C  
ATOM    558  C   ARG A  68     -16.889   5.549  -0.509  1.00  0.83           C  
ATOM    559  O   ARG A  68     -17.716   4.908   0.132  1.00  0.83           O  
ATOM    560  CB  ARG A  68     -15.353   4.025  -1.647  1.00  0.83           C  
ATOM    561  CG  ARG A  68     -13.918   3.776  -2.124  1.00  0.83           C  
ATOM    562  CD  ARG A  68     -13.706   2.539  -2.995  1.00  0.83           C  
ATOM    563  NE  ARG A  68     -14.357   2.682  -4.333  1.00  0.83           N  
ATOM    564  CZ  ARG A  68     -14.286   1.709  -5.251  1.00  0.83           C  
ATOM    565  NH1 ARG A  68     -13.722   0.539  -4.964  1.00  0.83           N  
ATOM    566  NH2 ARG A  68     -14.754   1.935  -6.469  1.00  0.83           N  
ATOM    567  N   GLN A  69     -17.207   6.668  -1.184  1.00  0.79           N  
ATOM    568  CA  GLN A  69     -18.554   7.211  -1.289  1.00  0.79           C  
ATOM    569  C   GLN A  69     -19.225   7.490   0.062  1.00  0.79           C  
ATOM    570  O   GLN A  69     -20.421   7.285   0.249  1.00  0.79           O  
ATOM    571  CB  GLN A  69     -19.441   6.332  -2.213  1.00  0.79           C  
ATOM    572  CG  GLN A  69     -18.880   6.160  -3.648  1.00  0.79           C  
ATOM    573  CD  GLN A  69     -19.748   5.220  -4.495  1.00  0.79           C  
ATOM    574  OE1 GLN A  69     -20.761   4.675  -4.069  1.00  0.79           O  
ATOM    575  NE2 GLN A  69     -19.333   5.017  -5.769  1.00  0.79           N  
ATOM    576  N   ASP A  70     -18.421   7.956   1.040  1.00  0.83           N  
ATOM    577  CA  ASP A  70     -18.795   8.195   2.420  1.00  0.83           C  
ATOM    578  C   ASP A  70     -19.317   6.958   3.165  1.00  0.83           C  
ATOM    579  O   ASP A  70     -20.047   7.059   4.154  1.00  0.83           O  
ATOM    580  CB  ASP A  70     -19.682   9.460   2.588  1.00  0.83           C  
ATOM    581  CG  ASP A  70     -18.922  10.703   2.150  1.00  0.83           C  
ATOM    582  OD1 ASP A  70     -17.719  10.822   2.512  1.00  0.83           O  
ATOM    583  OD2 ASP A  70     -19.525  11.569   1.473  1.00  0.83           O  
ATOM    584  N   GLN A  71     -18.870   5.745   2.764  1.00  0.78           N  
ATOM    585  CA  GLN A  71     -19.259   4.497   3.388  1.00  0.78           C  
ATOM    586  C   GLN A  71     -18.059   3.584   3.562  1.00  0.78           C  
ATOM    587  O   GLN A  71     -17.065   3.674   2.844  1.00  0.78           O  
ATOM    588  CB  GLN A  71     -20.306   3.750   2.528  1.00  0.78           C  
ATOM    589  CG  GLN A  71     -21.651   4.502   2.424  1.00  0.78           C  
ATOM    590  CD  GLN A  71     -22.691   3.703   1.640  1.00  0.78           C  
ATOM    591  OE1 GLN A  71     -22.422   2.732   0.939  1.00  0.78           O  
ATOM    592  NE2 GLN A  71     -23.970   4.125   1.787  1.00  0.78           N  
ATOM    593  N   CYS A  72     -18.119   2.659   4.545  1.00  0.90           N  
ATOM    594  CA  CYS A  72     -17.050   1.705   4.777  1.00  0.90           C  
ATOM    595  C   CYS A  72     -17.290   0.428   3.995  1.00  0.90           C  
ATOM    596  O   CYS A  72     -18.340  -0.203   4.102  1.00  0.90           O  
ATOM    597  CB  CYS A  72     -16.891   1.327   6.275  1.00  0.90           C  
ATOM    598  SG  CYS A  72     -15.473   0.218   6.596  1.00  0.90           S  
ATOM    599  N   ILE A  73     -16.280   0.001   3.225  1.00  0.87           N  
ATOM    600  CA  ILE A  73     -16.260  -1.256   2.513  1.00  0.87           C  
ATOM    601  C   ILE A  73     -15.197  -2.115   3.175  1.00  0.87           C  
ATOM    602  O   ILE A  73     -14.016  -1.771   3.207  1.00  0.87           O  
ATOM    603  CB  ILE A  73     -15.944  -1.056   1.034  1.00  0.87           C  
ATOM    604  CG1 ILE A  73     -17.074  -0.236   0.368  1.00  0.87           C  
ATOM    605  CG2 ILE A  73     -15.738  -2.420   0.339  1.00  0.87           C  
ATOM    606  CD1 ILE A  73     -16.763   0.205  -1.066  1.00  0.87           C  
ATOM    607  N   TYR A  74     -15.593  -3.271   3.738  1.00  0.89           N  
ATOM    608  CA  TYR A  74     -14.675  -4.218   4.341  1.00  0.89           C  
ATOM    609  C   TYR A  74     -14.495  -5.396   3.396  1.00  0.89           C  
ATOM    610  O   TYR A  74     -15.458  -5.868   2.793  1.00  0.89           O  
ATOM    611  CB  TYR A  74     -15.215  -4.678   5.723  1.00  0.89           C  
ATOM    612  CG  TYR A  74     -14.465  -5.829   6.341  1.00  0.89           C  
ATOM    613  CD1 TYR A  74     -15.048  -7.106   6.403  1.00  0.89           C  
ATOM    614  CD2 TYR A  74     -13.176  -5.643   6.855  1.00  0.89           C  
ATOM    615  CE1 TYR A  74     -14.387  -8.158   7.050  1.00  0.89           C  
ATOM    616  CE2 TYR A  74     -12.510  -6.695   7.499  1.00  0.89           C  
ATOM    617  CZ  TYR A  74     -13.129  -7.944   7.619  1.00  0.89           C  
ATOM    618  OH  TYR A  74     -12.460  -8.995   8.272  1.00  0.89           O  
ATOM    619  N   ASN A  75     -13.253  -5.897   3.244  1.00  0.87           N  
ATOM    620  CA  ASN A  75     -12.975  -7.058   2.424  1.00  0.87           C  
ATOM    621  C   ASN A  75     -11.784  -7.820   3.010  1.00  0.87           C  
ATOM    622  O   ASN A  75     -10.838  -7.230   3.538  1.00  0.87           O  
ATOM    623  CB  ASN A  75     -12.701  -6.602   0.963  1.00  0.87           C  
ATOM    624  CG  ASN A  75     -13.888  -5.865   0.353  1.00  0.87           C  
ATOM    625  OD1 ASN A  75     -14.778  -5.348   1.015  1.00  0.87           O  
ATOM    626  ND2 ASN A  75     -13.906  -5.774  -0.998  1.00  0.87           N  
ATOM    627  N   THR A  76     -11.801  -9.164   2.938  1.00  0.89           N  
ATOM    628  CA  THR A  76     -10.695 -10.022   3.327  1.00  0.89           C  
ATOM    629  C   THR A  76     -10.303 -10.905   2.192  1.00  0.89           C  
ATOM    630  O   THR A  76     -11.132 -11.437   1.461  1.00  0.89           O  
ATOM    631  CB  THR A  76     -10.905 -10.914   4.542  1.00  0.89           C  
ATOM    632  OG1 THR A  76     -12.146 -11.606   4.558  1.00  0.89           O  
ATOM    633  CG2 THR A  76     -10.898  -9.983   5.737  1.00  0.89           C  
ATOM    634  N   THR A  77      -8.990 -11.088   1.996  1.00  0.89           N  
ATOM    635  CA  THR A  77      -8.526 -11.912   0.897  1.00  0.89           C  
ATOM    636  C   THR A  77      -7.128 -12.379   1.204  1.00  0.89           C  
ATOM    637  O   THR A  77      -6.474 -11.878   2.118  1.00  0.89           O  
ATOM    638  CB  THR A  77      -8.575 -11.218  -0.471  1.00  0.89           C  
ATOM    639  OG1 THR A  77      -8.296 -12.114  -1.545  1.00  0.89           O  
ATOM    640  CG2 THR A  77      -7.579 -10.053  -0.541  1.00  0.89           C  
ATOM    641  N   TYR A  78      -6.629 -13.357   0.440  1.00  0.90           N  
ATOM    642  CA  TYR A  78      -5.268 -13.831   0.530  1.00  0.90           C  
ATOM    643  C   TYR A  78      -4.504 -13.246  -0.630  1.00  0.90           C  
ATOM    644  O   TYR A  78      -4.907 -13.356  -1.787  1.00  0.90           O  
ATOM    645  CB  TYR A  78      -5.127 -15.368   0.443  1.00  0.90           C  
ATOM    646  CG  TYR A  78      -5.601 -15.995   1.712  1.00  0.90           C  
ATOM    647  CD1 TYR A  78      -4.709 -16.185   2.778  1.00  0.90           C  
ATOM    648  CD2 TYR A  78      -6.940 -16.384   1.857  1.00  0.90           C  
ATOM    649  CE1 TYR A  78      -5.153 -16.754   3.978  1.00  0.90           C  
ATOM    650  CE2 TYR A  78      -7.388 -16.950   3.059  1.00  0.90           C  
ATOM    651  CZ  TYR A  78      -6.491 -17.131   4.120  1.00  0.90           C  
ATOM    652  OH  TYR A  78      -6.923 -17.689   5.337  1.00  0.90           O  
ATOM    653  N   LEU A  79      -3.369 -12.600  -0.341  1.00  0.91           N  
ATOM    654  CA  LEU A  79      -2.447 -12.143  -1.352  1.00  0.91           C  
ATOM    655  C   LEU A  79      -1.387 -13.205  -1.537  1.00  0.91           C  
ATOM    656  O   LEU A  79      -0.960 -13.815  -0.559  1.00  0.91           O  
ATOM    657  CB  LEU A  79      -1.730 -10.834  -0.943  1.00  0.91           C  
ATOM    658  CG  LEU A  79      -2.647  -9.680  -0.503  1.00  0.91           C  
ATOM    659  CD1 LEU A  79      -1.821  -8.444  -0.125  1.00  0.91           C  
ATOM    660  CD2 LEU A  79      -3.645  -9.317  -1.600  1.00  0.91           C  
ATOM    661  N   ASN A  80      -0.919 -13.455  -2.770  1.00  0.91           N  
ATOM    662  CA  ASN A  80       0.158 -14.400  -3.007  1.00  0.91           C  
ATOM    663  C   ASN A  80       1.481 -13.648  -2.982  1.00  0.91           C  
ATOM    664  O   ASN A  80       1.544 -12.481  -3.366  1.00  0.91           O  
ATOM    665  CB  ASN A  80       0.022 -15.120  -4.370  1.00  0.91           C  
ATOM    666  CG  ASN A  80      -1.278 -15.913  -4.433  1.00  0.91           C  
ATOM    667  OD1 ASN A  80      -1.636 -16.637  -3.507  1.00  0.91           O  
ATOM    668  ND2 ASN A  80      -2.002 -15.813  -5.574  1.00  0.91           N  
ATOM    669  N   VAL A  81       2.572 -14.287  -2.528  1.00  0.95           N  
ATOM    670  CA  VAL A  81       3.890 -13.676  -2.450  1.00  0.95           C  
ATOM    671  C   VAL A  81       4.830 -14.398  -3.393  1.00  0.95           C  
ATOM    672  O   VAL A  81       5.074 -15.596  -3.268  1.00  0.95           O  
ATOM    673  CB  VAL A  81       4.472 -13.792  -1.044  1.00  0.95           C  
ATOM    674  CG1 VAL A  81       5.888 -13.189  -0.957  1.00  0.95           C  
ATOM    675  CG2 VAL A  81       3.527 -13.100  -0.049  1.00  0.95           C  
ATOM    676  N   GLN A  82       5.425 -13.699  -4.374  1.00  0.90           N  
ATOM    677  CA  GLN A  82       6.400 -14.307  -5.253  1.00  0.90           C  
ATOM    678  C   GLN A  82       7.757 -13.840  -4.787  1.00  0.90           C  
ATOM    679  O   GLN A  82       8.239 -12.762  -5.139  1.00  0.90           O  
ATOM    680  CB  GLN A  82       6.175 -13.962  -6.742  1.00  0.90           C  
ATOM    681  CG  GLN A  82       4.787 -14.379  -7.288  1.00  0.90           C  
ATOM    682  CD  GLN A  82       3.661 -13.456  -6.800  1.00  0.90           C  
ATOM    683  OE1 GLN A  82       3.797 -12.237  -6.775  1.00  0.90           O  
ATOM    684  NE2 GLN A  82       2.492 -14.052  -6.474  1.00  0.90           N  
ATOM    685  N   ARG A  83       8.408 -14.657  -3.939  1.00  0.89           N  
ATOM    686  CA  ARG A  83       9.566 -14.228  -3.185  1.00  0.89           C  
ATOM    687  C   ARG A  83      10.764 -13.763  -3.988  1.00  0.89           C  
ATOM    688  O   ARG A  83      11.300 -12.698  -3.715  1.00  0.89           O  
ATOM    689  CB  ARG A  83      10.063 -15.359  -2.270  1.00  0.89           C  
ATOM    690  CG  ARG A  83       9.109 -15.713  -1.126  1.00  0.89           C  
ATOM    691  CD  ARG A  83       9.726 -16.766  -0.216  1.00  0.89           C  
ATOM    692  NE  ARG A  83       8.754 -16.961   0.871  1.00  0.89           N  
ATOM    693  CZ  ARG A  83       8.818 -16.463   2.102  1.00  0.89           C  
ATOM    694  NH1 ARG A  83       9.672 -15.504   2.434  1.00  0.89           N  
ATOM    695  NH2 ARG A  83       7.963 -16.922   3.002  1.00  0.89           N  
ATOM    696  N   GLU A  84      11.184 -14.523  -5.014  1.00  0.89           N  
ATOM    697  CA  GLU A  84      12.326 -14.216  -5.858  1.00  0.89           C  
ATOM    698  C   GLU A  84      12.170 -12.920  -6.640  1.00  0.89           C  
ATOM    699  O   GLU A  84      13.110 -12.149  -6.806  1.00  0.89           O  
ATOM    700  CB  GLU A  84      12.579 -15.411  -6.796  1.00  0.89           C  
ATOM    701  CG  GLU A  84      12.911 -16.707  -6.014  1.00  0.89           C  
ATOM    702  CD  GLU A  84      13.226 -17.901  -6.918  1.00  0.89           C  
ATOM    703  OE1 GLU A  84      13.663 -18.934  -6.350  1.00  0.89           O  
ATOM    704  OE2 GLU A  84      13.023 -17.797  -8.152  1.00  0.89           O  
ATOM    705  N   ASN A  85      10.932 -12.632  -7.088  1.00  0.90           N  
ATOM    706  CA  ASN A  85      10.611 -11.466  -7.891  1.00  0.90           C  
ATOM    707  C   ASN A  85      10.387 -10.207  -7.065  1.00  0.90           C  
ATOM    708  O   ASN A  85      10.318  -9.104  -7.602  1.00  0.90           O  
ATOM    709  CB  ASN A  85       9.309 -11.706  -8.696  1.00  0.90           C  
ATOM    710  CG  ASN A  85       9.471 -12.902  -9.624  1.00  0.90           C  
ATOM    711  OD1 ASN A  85      10.559 -13.341  -9.971  1.00  0.90           O  
ATOM    712  ND2 ASN A  85       8.325 -13.459 -10.084  1.00  0.90           N  
ATOM    713  N   GLY A  86      10.245 -10.348  -5.731  1.00  0.94           N  
ATOM    714  CA  GLY A  86       9.956  -9.233  -4.836  1.00  0.94           C  
ATOM    715  C   GLY A  86       8.544  -8.707  -4.923  1.00  0.94           C  
ATOM    716  O   GLY A  86       8.281  -7.544  -4.627  1.00  0.94           O  
ATOM    717  N   THR A  87       7.590  -9.551  -5.359  1.00  0.94           N  
ATOM    718  CA  THR A  87       6.249  -9.122  -5.722  1.00  0.94           C  
ATOM    719  C   THR A  87       5.174  -9.753  -4.858  1.00  0.94           C  
ATOM    720  O   THR A  87       5.327 -10.835  -4.291  1.00  0.94           O  
ATOM    721  CB  THR A  87       5.885  -9.326  -7.203  1.00  0.94           C  
ATOM    722  OG1 THR A  87       6.137 -10.641  -7.665  1.00  0.94           O  
ATOM    723  CG2 THR A  87       6.738  -8.412  -8.089  1.00  0.94           C  
ATOM    724  N   ILE A  88       4.051  -9.024  -4.704  1.00  0.93           N  
ATOM    725  CA  ILE A  88       2.842  -9.449  -4.018  1.00  0.93           C  
ATOM    726  C   ILE A  88       1.716  -9.347  -5.035  1.00  0.93           C  
ATOM    727  O   ILE A  88       1.669  -8.395  -5.820  1.00  0.93           O  
ATOM    728  CB  ILE A  88       2.526  -8.591  -2.789  1.00  0.93           C  
ATOM    729  CG1 ILE A  88       3.576  -8.822  -1.682  1.00  0.93           C  
ATOM    730  CG2 ILE A  88       1.126  -8.932  -2.242  1.00  0.93           C  
ATOM    731  CD1 ILE A  88       3.431  -7.871  -0.488  1.00  0.93           C  
ATOM    732  N   SER A  89       0.779 -10.320  -5.070  1.00  0.90           N  
ATOM    733  CA  SER A  89      -0.351 -10.276  -5.989  1.00  0.90           C  
ATOM    734  C   SER A  89      -1.724 -10.447  -5.367  1.00  0.90           C  
ATOM    735  O   SER A  89      -1.911 -11.136  -4.366  1.00  0.90           O  
ATOM    736  CB  SER A  89      -0.216 -11.246  -7.181  1.00  0.90           C  
ATOM    737  OG  SER A  89      -0.269 -12.605  -6.763  1.00  0.90           O  
ATOM    738  N   ARG A  90      -2.739  -9.764  -5.949  1.00  0.82           N  
ATOM    739  CA  ARG A  90      -4.121  -9.781  -5.495  1.00  0.82           C  
ATOM    740  C   ARG A  90      -5.053 -10.101  -6.652  1.00  0.82           C  
ATOM    741  O   ARG A  90      -4.960  -9.500  -7.721  1.00  0.82           O  
ATOM    742  CB  ARG A  90      -4.532  -8.392  -4.932  1.00  0.82           C  
ATOM    743  CG  ARG A  90      -5.906  -8.326  -4.220  1.00  0.82           C  
ATOM    744  CD  ARG A  90      -6.209  -6.921  -3.683  1.00  0.82           C  
ATOM    745  NE  ARG A  90      -7.574  -6.897  -3.062  1.00  0.82           N  
ATOM    746  CZ  ARG A  90      -7.990  -5.868  -2.310  1.00  0.82           C  
ATOM    747  NH1 ARG A  90      -7.173  -4.879  -1.977  1.00  0.82           N  
ATOM    748  NH2 ARG A  90      -9.243  -5.809  -1.874  1.00  0.82           N  
ATOM    749  N   TYR A  91      -6.006 -11.032  -6.465  1.00  0.84           N  
ATOM    750  CA  TYR A  91      -7.049 -11.301  -7.442  1.00  0.84           C  
ATOM    751  C   TYR A  91      -8.232 -10.368  -7.205  1.00  0.84           C  
ATOM    752  O   TYR A  91      -8.811 -10.344  -6.119  1.00  0.84           O  
ATOM    753  CB  TYR A  91      -7.527 -12.771  -7.374  1.00  0.84           C  
ATOM    754  CG  TYR A  91      -6.586 -13.657  -8.139  1.00  0.84           C  
ATOM    755  CD1 TYR A  91      -6.937 -14.120  -9.418  1.00  0.84           C  
ATOM    756  CD2 TYR A  91      -5.353 -14.032  -7.591  1.00  0.84           C  
ATOM    757  CE1 TYR A  91      -6.086 -14.983 -10.125  1.00  0.84           C  
ATOM    758  CE2 TYR A  91      -4.509 -14.901  -8.284  1.00  0.84           C  
ATOM    759  CZ  TYR A  91      -4.858 -15.374  -9.550  1.00  0.84           C  
ATOM    760  OH  TYR A  91      -3.944 -16.136 -10.284  1.00  0.84           O  
ATOM    761  N   VAL A  92      -8.602  -9.557  -8.220  1.00  0.80           N  
ATOM    762  CA  VAL A  92      -9.705  -8.600  -8.166  1.00  0.80           C  
ATOM    763  C   VAL A  92     -10.372  -8.603  -9.523  1.00  0.80           C  
ATOM    764  O   VAL A  92      -9.720  -8.478 -10.556  1.00  0.80           O  
ATOM    765  CB  VAL A  92      -9.258  -7.171  -7.836  1.00  0.80           C  
ATOM    766  CG1 VAL A  92     -10.331  -6.095  -8.118  1.00  0.80           C  
ATOM    767  CG2 VAL A  92      -8.893  -7.112  -6.347  1.00  0.80           C  
ATOM    768  N   GLY A  93     -11.712  -8.768  -9.577  1.00  0.80           N  
ATOM    769  CA  GLY A  93     -12.471  -8.707 -10.832  1.00  0.80           C  
ATOM    770  C   GLY A  93     -12.172  -9.782 -11.847  1.00  0.80           C  
ATOM    771  O   GLY A  93     -12.388  -9.609 -13.038  1.00  0.80           O  
ATOM    772  N   GLY A  94     -11.647 -10.935 -11.388  1.00  0.81           N  
ATOM    773  CA  GLY A  94     -11.213 -12.013 -12.270  1.00  0.81           C  
ATOM    774  C   GLY A  94      -9.839 -11.807 -12.854  1.00  0.81           C  
ATOM    775  O   GLY A  94      -9.395 -12.596 -13.677  1.00  0.81           O  
ATOM    776  N   GLN A  95      -9.124 -10.746 -12.441  1.00  0.75           N  
ATOM    777  CA  GLN A  95      -7.803 -10.434 -12.944  1.00  0.75           C  
ATOM    778  C   GLN A  95      -6.818 -10.447 -11.797  1.00  0.75           C  
ATOM    779  O   GLN A  95      -7.135 -10.033 -10.680  1.00  0.75           O  
ATOM    780  CB  GLN A  95      -7.767  -9.028 -13.588  1.00  0.75           C  
ATOM    781  CG  GLN A  95      -8.687  -8.868 -14.819  1.00  0.75           C  
ATOM    782  CD  GLN A  95      -8.187  -9.718 -15.987  1.00  0.75           C  
ATOM    783  OE1 GLN A  95      -6.992  -9.792 -16.267  1.00  0.75           O  
ATOM    784  NE2 GLN A  95      -9.123 -10.383 -16.702  1.00  0.75           N  
ATOM    785  N   GLU A  96      -5.589 -10.934 -12.034  1.00  0.77           N  
ATOM    786  CA  GLU A  96      -4.539 -10.882 -11.035  1.00  0.77           C  
ATOM    787  C   GLU A  96      -3.728  -9.608 -11.192  1.00  0.77           C  
ATOM    788  O   GLU A  96      -3.225  -9.296 -12.269  1.00  0.77           O  
ATOM    789  CB  GLU A  96      -3.610 -12.116 -11.106  1.00  0.77           C  
ATOM    790  CG  GLU A  96      -2.667 -12.253  -9.888  1.00  0.77           C  
ATOM    791  CD  GLU A  96      -1.999 -13.623  -9.736  1.00  0.77           C  
ATOM    792  OE1 GLU A  96      -1.476 -13.850  -8.614  1.00  0.77           O  
ATOM    793  OE2 GLU A  96      -2.033 -14.470 -10.661  1.00  0.77           O  
ATOM    794  N   HIS A  97      -3.596  -8.821 -10.110  1.00  0.82           N  
ATOM    795  CA  HIS A  97      -2.890  -7.557 -10.109  1.00  0.82           C  
ATOM    796  C   HIS A  97      -1.625  -7.736  -9.295  1.00  0.82           C  
ATOM    797  O   HIS A  97      -1.686  -8.143  -8.134  1.00  0.82           O  
ATOM    798  CB  HIS A  97      -3.746  -6.454  -9.453  1.00  0.82           C  
ATOM    799  CG  HIS A  97      -4.987  -6.145 -10.230  1.00  0.82           C  
ATOM    800  ND1 HIS A  97      -5.011  -5.000 -11.005  1.00  0.82           N  
ATOM    801  CD2 HIS A  97      -6.162  -6.813 -10.340  1.00  0.82           C  
ATOM    802  CE1 HIS A  97      -6.199  -4.995 -11.572  1.00  0.82           C  
ATOM    803  NE2 HIS A  97      -6.942  -6.072 -11.205  1.00  0.82           N  
ATOM    804  N   PHE A  98      -0.448  -7.447  -9.884  1.00  0.88           N  
ATOM    805  CA  PHE A  98       0.852  -7.719  -9.292  1.00  0.88           C  
ATOM    806  C   PHE A  98       1.554  -6.420  -8.967  1.00  0.88           C  
ATOM    807  O   PHE A  98       1.582  -5.498  -9.780  1.00  0.88           O  
ATOM    808  CB  PHE A  98       1.814  -8.425 -10.287  1.00  0.88           C  
ATOM    809  CG  PHE A  98       1.554  -9.899 -10.411  1.00  0.88           C  
ATOM    810  CD1 PHE A  98       2.277 -10.799  -9.612  1.00  0.88           C  
ATOM    811  CD2 PHE A  98       0.642 -10.413 -11.345  1.00  0.88           C  
ATOM    812  CE1 PHE A  98       2.060 -12.178  -9.703  1.00  0.88           C  
ATOM    813  CE2 PHE A  98       0.457 -11.797 -11.467  1.00  0.88           C  
ATOM    814  CZ  PHE A  98       1.150 -12.679 -10.633  1.00  0.88           C  
ATOM    815  N   ALA A  99       2.193  -6.338  -7.789  1.00  0.93           N  
ATOM    816  CA  ALA A  99       2.976  -5.182  -7.435  1.00  0.93           C  
ATOM    817  C   ALA A  99       4.260  -5.576  -6.748  1.00  0.93           C  
ATOM    818  O   ALA A  99       4.301  -6.478  -5.911  1.00  0.93           O  
ATOM    819  CB  ALA A  99       2.217  -4.277  -6.458  1.00  0.93           C  
ATOM    820  N   HIS A 100       5.360  -4.891  -7.089  1.00  0.92           N  
ATOM    821  CA  HIS A 100       6.622  -4.996  -6.392  1.00  0.92           C  
ATOM    822  C   HIS A 100       6.579  -4.347  -5.033  1.00  0.92           C  
ATOM    823  O   HIS A 100       6.177  -3.191  -4.898  1.00  0.92           O  
ATOM    824  CB  HIS A 100       7.771  -4.359  -7.185  1.00  0.92           C  
ATOM    825  CG  HIS A 100       8.076  -5.103  -8.437  1.00  0.92           C  
ATOM    826  ND1 HIS A 100       7.455  -4.738  -9.615  1.00  0.92           N  
ATOM    827  CD2 HIS A 100       8.905  -6.152  -8.647  1.00  0.92           C  
ATOM    828  CE1 HIS A 100       7.924  -5.569 -10.516  1.00  0.92           C  
ATOM    829  NE2 HIS A 100       8.811  -6.450  -9.989  1.00  0.92           N  
ATOM    830  N   LEU A 101       7.013  -5.073  -3.990  1.00  0.94           N  
ATOM    831  CA  LEU A 101       7.071  -4.556  -2.640  1.00  0.94           C  
ATOM    832  C   LEU A 101       8.378  -3.806  -2.468  1.00  0.94           C  
ATOM    833  O   LEU A 101       9.462  -4.374  -2.592  1.00  0.94           O  
ATOM    834  CB  LEU A 101       6.953  -5.706  -1.607  1.00  0.94           C  
ATOM    835  CG  LEU A 101       7.090  -5.321  -0.116  1.00  0.94           C  
ATOM    836  CD1 LEU A 101       6.041  -4.296   0.337  1.00  0.94           C  
ATOM    837  CD2 LEU A 101       7.041  -6.582   0.763  1.00  0.94           C  
ATOM    838  N   LEU A 102       8.305  -2.491  -2.205  1.00  0.93           N  
ATOM    839  CA  LEU A 102       9.470  -1.636  -2.175  1.00  0.93           C  
ATOM    840  C   LEU A 102       9.645  -0.990  -0.819  1.00  0.93           C  
ATOM    841  O   LEU A 102       8.703  -0.499  -0.193  1.00  0.93           O  
ATOM    842  CB  LEU A 102       9.348  -0.516  -3.216  1.00  0.93           C  
ATOM    843  CG  LEU A 102       9.221  -0.979  -4.678  1.00  0.93           C  
ATOM    844  CD1 LEU A 102       9.053   0.278  -5.527  1.00  0.93           C  
ATOM    845  CD2 LEU A 102      10.426  -1.781  -5.186  1.00  0.93           C  
ATOM    846  N   ILE A 103      10.897  -0.981  -0.340  1.00  0.86           N  
ATOM    847  CA  ILE A 103      11.253  -0.569   0.998  1.00  0.86           C  
ATOM    848  C   ILE A 103      11.876   0.815   0.977  1.00  0.86           C  
ATOM    849  O   ILE A 103      12.755   1.115   0.170  1.00  0.86           O  
ATOM    850  CB  ILE A 103      12.176  -1.589   1.661  1.00  0.86           C  
ATOM    851  CG1 ILE A 103      11.518  -2.994   1.648  1.00  0.86           C  
ATOM    852  CG2 ILE A 103      12.556  -1.061   3.061  1.00  0.86           C  
ATOM    853  CD1 ILE A 103      12.306  -4.084   2.380  1.00  0.86           C  
ATOM    854  N   LEU A 104      11.402   1.702   1.870  1.00  0.83           N  
ATOM    855  CA  LEU A 104      11.948   3.019   2.113  1.00  0.83           C  
ATOM    856  C   LEU A 104      12.857   2.968   3.325  1.00  0.83           C  
ATOM    857  O   LEU A 104      12.956   1.945   3.997  1.00  0.83           O  
ATOM    858  CB  LEU A 104      10.803   4.026   2.329  1.00  0.83           C  
ATOM    859  CG  LEU A 104       9.982   4.313   1.059  1.00  0.83           C  
ATOM    860  CD1 LEU A 104       8.849   5.310   1.338  1.00  0.83           C  
ATOM    861  CD2 LEU A 104      10.901   4.843  -0.043  1.00  0.83           C  
ATOM    862  N   ARG A 105      13.623   4.043   3.605  1.00  0.77           N  
ATOM    863  CA  ARG A 105      14.596   4.028   4.683  1.00  0.77           C  
ATOM    864  C   ARG A 105      13.953   3.969   6.059  1.00  0.77           C  
ATOM    865  O   ARG A 105      14.439   3.292   6.962  1.00  0.77           O  
ATOM    866  CB  ARG A 105      15.528   5.258   4.635  1.00  0.77           C  
ATOM    867  CG  ARG A 105      16.320   5.445   3.324  1.00  0.77           C  
ATOM    868  CD  ARG A 105      17.114   6.749   3.359  1.00  0.77           C  
ATOM    869  NE  ARG A 105      17.737   6.955   2.009  1.00  0.77           N  
ATOM    870  CZ  ARG A 105      18.043   8.170   1.537  1.00  0.77           C  
ATOM    871  NH1 ARG A 105      18.092   9.222   2.343  1.00  0.77           N  
ATOM    872  NH2 ARG A 105      18.236   8.359   0.235  1.00  0.77           N  
ATOM    873  N   ASP A 106      12.832   4.697   6.234  1.00  0.85           N  
ATOM    874  CA  ASP A 106      11.963   4.530   7.375  1.00  0.85           C  
ATOM    875  C   ASP A 106      11.251   3.168   7.307  1.00  0.85           C  
ATOM    876  O   ASP A 106      10.630   2.797   6.315  1.00  0.85           O  
ATOM    877  CB  ASP A 106      10.992   5.739   7.492  1.00  0.85           C  
ATOM    878  CG  ASP A 106      10.273   5.805   8.832  1.00  0.85           C  
ATOM    879  OD1 ASP A 106      10.407   4.870   9.662  1.00  0.85           O  
ATOM    880  OD2 ASP A 106       9.547   6.807   9.045  1.00  0.85           O  
ATOM    881  N   THR A 107      11.320   2.386   8.401  1.00  0.87           N  
ATOM    882  CA  THR A 107      10.705   1.074   8.546  1.00  0.87           C  
ATOM    883  C   THR A 107       9.218   1.182   8.773  1.00  0.87           C  
ATOM    884  O   THR A 107       8.489   0.193   8.732  1.00  0.87           O  
ATOM    885  CB  THR A 107      11.296   0.261   9.692  1.00  0.87           C  
ATOM    886  OG1 THR A 107      11.325   1.001  10.909  1.00  0.87           O  
ATOM    887  CG2 THR A 107      12.751  -0.095   9.361  1.00  0.87           C  
ATOM    888  N   LYS A 108       8.734   2.413   9.003  1.00  0.89           N  
ATOM    889  CA  LYS A 108       7.337   2.708   9.182  1.00  0.89           C  
ATOM    890  C   LYS A 108       6.645   3.073   7.889  1.00  0.89           C  
ATOM    891  O   LYS A 108       5.467   3.424   7.891  1.00  0.89           O  
ATOM    892  CB  LYS A 108       7.207   3.903  10.133  1.00  0.89           C  
ATOM    893  CG  LYS A 108       7.738   3.559  11.523  1.00  0.89           C  
ATOM    894  CD  LYS A 108       7.665   4.746  12.476  1.00  0.89           C  
ATOM    895  CE  LYS A 108       8.135   4.332  13.858  1.00  0.89           C  
ATOM    896  NZ  LYS A 108       8.091   5.516  14.726  1.00  0.89           N  
ATOM    897  N   THR A 109       7.337   2.982   6.737  1.00  0.92           N  
ATOM    898  CA  THR A 109       6.758   3.287   5.441  1.00  0.92           C  
ATOM    899  C   THR A 109       7.130   2.216   4.439  1.00  0.92           C  
ATOM    900  O   THR A 109       8.176   1.582   4.514  1.00  0.92           O  
ATOM    901  CB  THR A 109       7.160   4.646   4.864  1.00  0.92           C  
ATOM    902  OG1 THR A 109       8.566   4.782   4.731  1.00  0.92           O  
ATOM    903  CG2 THR A 109       6.713   5.771   5.797  1.00  0.92           C  
ATOM    904  N   TYR A 110       6.262   1.979   3.438  1.00  0.93           N  
ATOM    905  CA  TYR A 110       6.544   1.035   2.373  1.00  0.93           C  
ATOM    906  C   TYR A 110       5.824   1.532   1.147  1.00  0.93           C  
ATOM    907  O   TYR A 110       4.890   2.334   1.232  1.00  0.93           O  
ATOM    908  CB  TYR A 110       6.046  -0.424   2.629  1.00  0.93           C  
ATOM    909  CG  TYR A 110       6.930  -1.138   3.604  1.00  0.93           C  
ATOM    910  CD1 TYR A 110       8.256  -1.410   3.260  1.00  0.93           C  
ATOM    911  CD2 TYR A 110       6.481  -1.523   4.873  1.00  0.93           C  
ATOM    912  CE1 TYR A 110       9.150  -1.883   4.226  1.00  0.93           C  
ATOM    913  CE2 TYR A 110       7.377  -2.006   5.839  1.00  0.93           C  
ATOM    914  CZ  TYR A 110       8.731  -2.126   5.532  1.00  0.93           C  
ATOM    915  OH  TYR A 110       9.671  -2.493   6.515  1.00  0.93           O  
ATOM    916  N   MET A 111       6.243   1.060  -0.037  1.00  0.93           N  
ATOM    917  CA  MET A 111       5.582   1.386  -1.278  1.00  0.93           C  
ATOM    918  C   MET A 111       5.269   0.122  -2.050  1.00  0.93           C  
ATOM    919  O   MET A 111       5.914  -0.915  -1.893  1.00  0.93           O  
ATOM    920  CB  MET A 111       6.458   2.261  -2.205  1.00  0.93           C  
ATOM    921  CG  MET A 111       6.723   3.683  -1.698  1.00  0.93           C  
ATOM    922  SD  MET A 111       7.698   4.690  -2.862  1.00  0.93           S  
ATOM    923  CE  MET A 111       9.183   3.651  -2.992  1.00  0.93           C  
ATOM    924  N   LEU A 112       4.268   0.201  -2.941  1.00  0.94           N  
ATOM    925  CA  LEU A 112       3.950  -0.854  -3.880  1.00  0.94           C  
ATOM    926  C   LEU A 112       4.081  -0.273  -5.267  1.00  0.94           C  
ATOM    927  O   LEU A 112       3.432   0.725  -5.589  1.00  0.94           O  
ATOM    928  CB  LEU A 112       2.515  -1.422  -3.724  1.00  0.94           C  
ATOM    929  CG  LEU A 112       2.236  -2.167  -2.404  1.00  0.94           C  
ATOM    930  CD1 LEU A 112       0.763  -2.598  -2.328  1.00  0.94           C  
ATOM    931  CD2 LEU A 112       3.150  -3.385  -2.218  1.00  0.94           C  
ATOM    932  N   ALA A 113       4.932  -0.878  -6.115  1.00  0.94           N  
ATOM    933  CA  ALA A 113       5.121  -0.436  -7.478  1.00  0.94           C  
ATOM    934  C   ALA A 113       4.410  -1.354  -8.442  1.00  0.94           C  
ATOM    935  O   ALA A 113       4.627  -2.562  -8.475  1.00  0.94           O  
ATOM    936  CB  ALA A 113       6.608  -0.341  -7.879  1.00  0.94           C  
ATOM    937  N   PHE A 114       3.538  -0.766  -9.265  1.00  0.90           N  
ATOM    938  CA  PHE A 114       2.758  -1.455 -10.258  1.00  0.90           C  
ATOM    939  C   PHE A 114       3.384  -1.110 -11.583  1.00  0.90           C  
ATOM    940  O   PHE A 114       3.879   0.002 -11.778  1.00  0.90           O  
ATOM    941  CB  PHE A 114       1.287  -1.001 -10.246  1.00  0.90           C  
ATOM    942  CG  PHE A 114       0.614  -1.461  -8.981  1.00  0.90           C  
ATOM    943  CD1 PHE A 114      -0.114  -2.657  -9.005  1.00  0.90           C  
ATOM    944  CD2 PHE A 114       0.656  -0.721  -7.784  1.00  0.90           C  
ATOM    945  CE1 PHE A 114      -0.855  -3.067  -7.893  1.00  0.90           C  
ATOM    946  CE2 PHE A 114      -0.078  -1.129  -6.663  1.00  0.90           C  
ATOM    947  CZ  PHE A 114      -0.845  -2.298  -6.723  1.00  0.90           C  
ATOM    948  N   ASP A 115       3.441  -2.097 -12.491  1.00  0.83           N  
ATOM    949  CA  ASP A 115       3.936  -1.965 -13.845  1.00  0.83           C  
ATOM    950  C   ASP A 115       5.316  -1.339 -14.007  1.00  0.83           C  
ATOM    951  O   ASP A 115       5.572  -0.581 -14.933  1.00  0.83           O  
ATOM    952  CB  ASP A 115       2.865  -1.297 -14.736  1.00  0.83           C  
ATOM    953  CG  ASP A 115       1.627  -2.175 -14.771  1.00  0.83           C  
ATOM    954  OD1 ASP A 115       1.792  -3.421 -14.696  1.00  0.83           O  
ATOM    955  OD2 ASP A 115       0.512  -1.607 -14.857  1.00  0.83           O  
ATOM    956  N   VAL A 116       6.301  -1.700 -13.153  1.00  0.81           N  
ATOM    957  CA  VAL A 116       7.606  -1.036 -13.135  1.00  0.81           C  
ATOM    958  C   VAL A 116       8.421  -1.215 -14.416  1.00  0.81           C  
ATOM    959  O   VAL A 116       9.274  -0.405 -14.757  1.00  0.81           O  
ATOM    960  CB  VAL A 116       8.414  -1.421 -11.892  1.00  0.81           C  
ATOM    961  CG1 VAL A 116       9.150  -2.766 -12.054  1.00  0.81           C  
ATOM    962  CG2 VAL A 116       9.378  -0.277 -11.517  1.00  0.81           C  
ATOM    963  N   ASN A 117       8.099  -2.279 -15.184  1.00  0.79           N  
ATOM    964  CA  ASN A 117       8.723  -2.609 -16.450  1.00  0.79           C  
ATOM    965  C   ASN A 117       7.962  -2.031 -17.639  1.00  0.79           C  
ATOM    966  O   ASN A 117       8.365  -2.229 -18.781  1.00  0.79           O  
ATOM    967  CB  ASN A 117       8.759  -4.147 -16.646  1.00  0.79           C  
ATOM    968  CG  ASN A 117       9.681  -4.789 -15.617  1.00  0.79           C  
ATOM    969  OD1 ASN A 117      10.721  -4.256 -15.246  1.00  0.79           O  
ATOM    970  ND2 ASN A 117       9.319  -6.008 -15.148  1.00  0.79           N  
ATOM    971  N   ASP A 118       6.856  -1.296 -17.408  1.00  0.82           N  
ATOM    972  CA  ASP A 118       6.146  -0.605 -18.458  1.00  0.82           C  
ATOM    973  C   ASP A 118       6.089   0.874 -18.086  1.00  0.82           C  
ATOM    974  O   ASP A 118       5.363   1.314 -17.196  1.00  0.82           O  
ATOM    975  CB  ASP A 118       4.741  -1.231 -18.692  1.00  0.82           C  
ATOM    976  CG  ASP A 118       3.957  -0.558 -19.814  1.00  0.82           C  
ATOM    977  OD1 ASP A 118       4.434   0.456 -20.391  1.00  0.82           O  
ATOM    978  OD2 ASP A 118       2.825  -1.026 -20.085  1.00  0.82           O  
ATOM    979  N   GLU A 119       6.831   1.715 -18.825  1.00  0.79           N  
ATOM    980  CA  GLU A 119       6.857   3.145 -18.630  1.00  0.79           C  
ATOM    981  C   GLU A 119       5.556   3.860 -18.957  1.00  0.79           C  
ATOM    982  O   GLU A 119       5.356   5.010 -18.571  1.00  0.79           O  
ATOM    983  CB  GLU A 119       7.936   3.781 -19.521  1.00  0.79           C  
ATOM    984  CG  GLU A 119       9.361   3.223 -19.325  1.00  0.79           C  
ATOM    985  CD  GLU A 119      10.376   4.067 -20.097  1.00  0.79           C  
ATOM    986  OE1 GLU A 119      11.592   3.789 -19.950  1.00  0.79           O  
ATOM    987  OE2 GLU A 119       9.945   5.004 -20.821  1.00  0.79           O  
ATOM    988  N   LYS A 120       4.620   3.227 -19.687  1.00  0.86           N  
ATOM    989  CA  LYS A 120       3.358   3.859 -20.005  1.00  0.86           C  
ATOM    990  C   LYS A 120       2.331   3.656 -18.917  1.00  0.86           C  
ATOM    991  O   LYS A 120       1.400   4.444 -18.788  1.00  0.86           O  
ATOM    992  CB  LYS A 120       2.800   3.290 -21.324  1.00  0.86           C  
ATOM    993  CG  LYS A 120       3.708   3.618 -22.517  1.00  0.86           C  
ATOM    994  CD  LYS A 120       3.162   3.071 -23.842  1.00  0.86           C  
ATOM    995  CE  LYS A 120       4.093   3.358 -25.019  1.00  0.86           C  
ATOM    996  NZ  LYS A 120       3.555   2.727 -26.243  1.00  0.86           N  
ATOM    997  N   ASN A 121       2.504   2.612 -18.087  1.00  0.88           N  
ATOM    998  CA  ASN A 121       1.504   2.233 -17.115  1.00  0.88           C  
ATOM    999  C   ASN A 121       1.991   2.315 -15.678  1.00  0.88           C  
ATOM   1000  O   ASN A 121       1.182   2.312 -14.753  1.00  0.88           O  
ATOM   1001  CB  ASN A 121       1.013   0.808 -17.447  1.00  0.88           C  
ATOM   1002  CG  ASN A 121       0.096   0.896 -18.661  1.00  0.88           C  
ATOM   1003  OD1 ASN A 121      -0.977   1.504 -18.593  1.00  0.88           O  
ATOM   1004  ND2 ASN A 121       0.485   0.299 -19.804  1.00  0.88           N  
ATOM   1005  N   TRP A 122       3.312   2.466 -15.448  1.00  0.88           N  
ATOM   1006  CA  TRP A 122       3.912   2.459 -14.123  1.00  0.88           C  
ATOM   1007  C   TRP A 122       3.303   3.369 -13.058  1.00  0.88           C  
ATOM   1008  O   TRP A 122       2.705   4.415 -13.332  1.00  0.88           O  
ATOM   1009  CB  TRP A 122       5.462   2.631 -14.168  1.00  0.88           C  
ATOM   1010  CG  TRP A 122       6.061   3.953 -14.643  1.00  0.88           C  
ATOM   1011  CD1 TRP A 122       5.496   5.194 -14.708  1.00  0.88           C  
ATOM   1012  CD2 TRP A 122       7.419   4.112 -15.101  1.00  0.88           C  
ATOM   1013  NE1 TRP A 122       6.408   6.107 -15.172  1.00  0.88           N  
ATOM   1014  CE2 TRP A 122       7.579   5.471 -15.447  1.00  0.88           C  
ATOM   1015  CE3 TRP A 122       8.482   3.220 -15.237  1.00  0.88           C  
ATOM   1016  CZ2 TRP A 122       8.778   5.951 -15.947  1.00  0.88           C  
ATOM   1017  CZ3 TRP A 122       9.710   3.724 -15.697  1.00  0.88           C  
ATOM   1018  CH2 TRP A 122       9.857   5.070 -16.058  1.00  0.88           C  
ATOM   1019  N   GLY A 123       3.453   2.999 -11.778  1.00  0.94           N  
ATOM   1020  CA  GLY A 123       3.061   3.910 -10.725  1.00  0.94           C  
ATOM   1021  C   GLY A 123       3.322   3.357  -9.368  1.00  0.94           C  
ATOM   1022  O   GLY A 123       3.663   2.187  -9.194  1.00  0.94           O  
ATOM   1023  N   LEU A 124       3.174   4.219  -8.355  1.00  0.94           N  
ATOM   1024  CA  LEU A 124       3.565   3.920  -6.997  1.00  0.94           C  
ATOM   1025  C   LEU A 124       2.453   4.253  -6.036  1.00  0.94           C  
ATOM   1026  O   LEU A 124       1.877   5.340  -6.080  1.00  0.94           O  
ATOM   1027  CB  LEU A 124       4.780   4.763  -6.542  1.00  0.94           C  
ATOM   1028  CG  LEU A 124       6.104   4.451  -7.248  1.00  0.94           C  
ATOM   1029  CD1 LEU A 124       7.149   5.528  -6.937  1.00  0.94           C  
ATOM   1030  CD2 LEU A 124       6.624   3.070  -6.852  1.00  0.94           C  
ATOM   1031  N   SER A 125       2.171   3.337  -5.098  1.00  0.95           N  
ATOM   1032  CA  SER A 125       1.263   3.586  -3.991  1.00  0.95           C  
ATOM   1033  C   SER A 125       2.077   3.590  -2.726  1.00  0.95           C  
ATOM   1034  O   SER A 125       2.942   2.735  -2.548  1.00  0.95           O  
ATOM   1035  CB  SER A 125       0.168   2.507  -3.796  1.00  0.95           C  
ATOM   1036  OG  SER A 125      -0.836   2.558  -4.806  1.00  0.95           O  
ATOM   1037  N   VAL A 126       1.831   4.547  -1.815  1.00  0.95           N  
ATOM   1038  CA  VAL A 126       2.650   4.759  -0.627  1.00  0.95           C  
ATOM   1039  C   VAL A 126       1.831   4.534   0.636  1.00  0.95           C  
ATOM   1040  O   VAL A 126       0.643   4.870   0.707  1.00  0.95           O  
ATOM   1041  CB  VAL A 126       3.315   6.136  -0.653  1.00  0.95           C  
ATOM   1042  CG1 VAL A 126       2.316   7.278  -0.457  1.00  0.95           C  
ATOM   1043  CG2 VAL A 126       4.439   6.308   0.382  1.00  0.95           C  
ATOM   1044  N   TYR A 127       2.443   3.908   1.663  1.00  0.95           N  
ATOM   1045  CA  TYR A 127       1.749   3.436   2.845  1.00  0.95           C  
ATOM   1046  C   TYR A 127       2.596   3.720   4.076  1.00  0.95           C  
ATOM   1047  O   TYR A 127       3.825   3.756   3.996  1.00  0.95           O  
ATOM   1048  CB  TYR A 127       1.512   1.900   2.804  1.00  0.95           C  
ATOM   1049  CG  TYR A 127       0.760   1.475   1.576  1.00  0.95           C  
ATOM   1050  CD1 TYR A 127      -0.628   1.303   1.622  1.00  0.95           C  
ATOM   1051  CD2 TYR A 127       1.436   1.228   0.370  1.00  0.95           C  
ATOM   1052  CE1 TYR A 127      -1.337   0.923   0.474  1.00  0.95           C  
ATOM   1053  CE2 TYR A 127       0.732   0.839  -0.775  1.00  0.95           C  
ATOM   1054  CZ  TYR A 127      -0.659   0.703  -0.726  1.00  0.95           C  
ATOM   1055  OH  TYR A 127      -1.386   0.349  -1.876  1.00  0.95           O  
ATOM   1056  N   ALA A 128       1.959   3.918   5.248  1.00  0.96           N  
ATOM   1057  CA  ALA A 128       2.650   4.199   6.493  1.00  0.96           C  
ATOM   1058  C   ALA A 128       1.973   3.507   7.670  1.00  0.96           C  
ATOM   1059  O   ALA A 128       0.860   2.994   7.533  1.00  0.96           O  
ATOM   1060  CB  ALA A 128       2.719   5.718   6.744  1.00  0.96           C  
ATOM   1061  N   ASP A 129       2.635   3.476   8.853  1.00  0.92           N  
ATOM   1062  CA  ASP A 129       2.131   2.898  10.093  1.00  0.92           C  
ATOM   1063  C   ASP A 129       1.042   3.761  10.734  1.00  0.92           C  
ATOM   1064  O   ASP A 129       0.297   3.325  11.609  1.00  0.92           O  
ATOM   1065  CB  ASP A 129       3.300   2.577  11.094  1.00  0.92           C  
ATOM   1066  CG  ASP A 129       3.965   3.768  11.792  1.00  0.92           C  
ATOM   1067  OD1 ASP A 129       3.963   4.890  11.225  1.00  0.92           O  
ATOM   1068  OD2 ASP A 129       4.509   3.582  12.917  1.00  0.92           O  
ATOM   1069  N   LYS A 130       0.912   5.017  10.268  1.00  0.91           N  
ATOM   1070  CA  LYS A 130      -0.004   6.010  10.770  1.00  0.91           C  
ATOM   1071  C   LYS A 130      -0.737   6.653   9.614  1.00  0.91           C  
ATOM   1072  O   LYS A 130      -0.277   6.549   8.477  1.00  0.91           O  
ATOM   1073  CB  LYS A 130       0.783   7.109  11.507  1.00  0.91           C  
ATOM   1074  CG  LYS A 130       1.344   6.583  12.827  1.00  0.91           C  
ATOM   1075  CD  LYS A 130       2.147   7.649  13.565  1.00  0.91           C  
ATOM   1076  CE  LYS A 130       2.777   7.095  14.833  1.00  0.91           C  
ATOM   1077  NZ  LYS A 130       3.416   8.214  15.549  1.00  0.91           N  
ATOM   1078  N   PRO A 131      -1.871   7.314   9.842  1.00  0.93           N  
ATOM   1079  CA  PRO A 131      -2.632   7.935   8.769  1.00  0.93           C  
ATOM   1080  C   PRO A 131      -2.014   9.245   8.318  1.00  0.93           C  
ATOM   1081  O   PRO A 131      -2.260   9.654   7.184  1.00  0.93           O  
ATOM   1082  CB  PRO A 131      -4.038   8.111   9.350  1.00  0.93           C  
ATOM   1083  CG  PRO A 131      -3.867   8.102  10.869  1.00  0.93           C  
ATOM   1084  CD  PRO A 131      -2.629   7.247  11.095  1.00  0.93           C  
ATOM   1085  N   GLU A 132      -1.214   9.910   9.166  1.00  0.84           N  
ATOM   1086  CA  GLU A 132      -0.486  11.111   8.821  1.00  0.84           C  
ATOM   1087  C   GLU A 132       1.004  10.820   8.767  1.00  0.84           C  
ATOM   1088  O   GLU A 132       1.578  10.147   9.625  1.00  0.84           O  
ATOM   1089  CB  GLU A 132      -0.732  12.272   9.818  1.00  0.84           C  
ATOM   1090  CG  GLU A 132      -2.228  12.639   9.990  1.00  0.84           C  
ATOM   1091  CD  GLU A 132      -2.981  11.798  11.026  1.00  0.84           C  
ATOM   1092  OE1 GLU A 132      -4.230  11.952  11.079  1.00  0.84           O  
ATOM   1093  OE2 GLU A 132      -2.334  11.011  11.769  1.00  0.84           O  
ATOM   1094  N   THR A 133       1.676  11.329   7.720  1.00  0.87           N  
ATOM   1095  CA  THR A 133       3.093  11.124   7.481  1.00  0.87           C  
ATOM   1096  C   THR A 133       3.888  12.377   7.769  1.00  0.87           C  
ATOM   1097  O   THR A 133       3.377  13.497   7.766  1.00  0.87           O  
ATOM   1098  CB  THR A 133       3.410  10.688   6.051  1.00  0.87           C  
ATOM   1099  OG1 THR A 133       2.835  11.554   5.078  1.00  0.87           O  
ATOM   1100  CG2 THR A 133       2.806   9.301   5.819  1.00  0.87           C  
ATOM   1101  N   THR A 134       5.199  12.209   8.035  1.00  0.82           N  
ATOM   1102  CA  THR A 134       6.138  13.311   8.159  1.00  0.82           C  
ATOM   1103  C   THR A 134       6.569  13.810   6.793  1.00  0.82           C  
ATOM   1104  O   THR A 134       6.356  13.158   5.768  1.00  0.82           O  
ATOM   1105  CB  THR A 134       7.382  13.036   9.017  1.00  0.82           C  
ATOM   1106  OG1 THR A 134       8.359  12.233   8.367  1.00  0.82           O  
ATOM   1107  CG2 THR A 134       6.972  12.372  10.346  1.00  0.82           C  
ATOM   1108  N   LYS A 135       7.208  15.000   6.729  1.00  0.78           N  
ATOM   1109  CA  LYS A 135       7.733  15.545   5.488  1.00  0.78           C  
ATOM   1110  C   LYS A 135       8.828  14.674   4.901  1.00  0.78           C  
ATOM   1111  O   LYS A 135       8.886  14.444   3.698  1.00  0.78           O  
ATOM   1112  CB  LYS A 135       8.261  16.987   5.676  1.00  0.78           C  
ATOM   1113  CG  LYS A 135       7.142  18.012   5.932  1.00  0.78           C  
ATOM   1114  CD  LYS A 135       7.674  19.455   6.008  1.00  0.78           C  
ATOM   1115  CE  LYS A 135       6.578  20.495   6.256  1.00  0.78           C  
ATOM   1116  NZ  LYS A 135       7.173  21.849   6.324  1.00  0.78           N  
ATOM   1117  N   GLU A 136       9.700  14.139   5.761  1.00  0.77           N  
ATOM   1118  CA  GLU A 136      10.795  13.257   5.431  1.00  0.77           C  
ATOM   1119  C   GLU A 136      10.322  11.948   4.810  1.00  0.77           C  
ATOM   1120  O   GLU A 136      10.802  11.529   3.760  1.00  0.77           O  
ATOM   1121  CB  GLU A 136      11.628  12.968   6.709  1.00  0.77           C  
ATOM   1122  CG  GLU A 136      12.188  14.228   7.436  1.00  0.77           C  
ATOM   1123  CD  GLU A 136      11.114  15.099   8.095  1.00  0.77           C  
ATOM   1124  OE1 GLU A 136      11.265  16.342   8.106  1.00  0.77           O  
ATOM   1125  OE2 GLU A 136      10.062  14.520   8.488  1.00  0.77           O  
ATOM   1126  N   GLN A 137       9.286  11.318   5.408  1.00  0.82           N  
ATOM   1127  CA  GLN A 137       8.648  10.113   4.901  1.00  0.82           C  
ATOM   1128  C   GLN A 137       8.005  10.310   3.541  1.00  0.82           C  
ATOM   1129  O   GLN A 137       8.101   9.477   2.641  1.00  0.82           O  
ATOM   1130  CB  GLN A 137       7.528   9.677   5.873  1.00  0.82           C  
ATOM   1131  CG  GLN A 137       8.044   9.078   7.197  1.00  0.82           C  
ATOM   1132  CD  GLN A 137       6.875   8.763   8.138  1.00  0.82           C  
ATOM   1133  OE1 GLN A 137       5.830   9.418   8.129  1.00  0.82           O  
ATOM   1134  NE2 GLN A 137       7.045   7.717   8.970  1.00  0.82           N  
ATOM   1135  N   LEU A 138       7.314  11.448   3.363  1.00  0.87           N  
ATOM   1136  CA  LEU A 138       6.723  11.824   2.098  1.00  0.87           C  
ATOM   1137  C   LEU A 138       7.759  12.210   1.038  1.00  0.87           C  
ATOM   1138  O   LEU A 138       7.582  11.946  -0.148  1.00  0.87           O  
ATOM   1139  CB  LEU A 138       5.666  12.921   2.342  1.00  0.87           C  
ATOM   1140  CG  LEU A 138       4.680  13.169   1.184  1.00  0.87           C  
ATOM   1141  CD1 LEU A 138       3.859  11.927   0.802  1.00  0.87           C  
ATOM   1142  CD2 LEU A 138       3.744  14.332   1.541  1.00  0.87           C  
ATOM   1143  N   GLY A 139       8.899  12.813   1.447  1.00  0.87           N  
ATOM   1144  CA  GLY A 139      10.047  13.117   0.590  1.00  0.87           C  
ATOM   1145  C   GLY A 139      10.630  11.929  -0.127  1.00  0.87           C  
ATOM   1146  O   GLY A 139      10.884  11.983  -1.325  1.00  0.87           O  
ATOM   1147  N   GLU A 140      10.797  10.800   0.585  1.00  0.79           N  
ATOM   1148  CA  GLU A 140      11.263   9.545   0.014  1.00  0.79           C  
ATOM   1149  C   GLU A 140      10.338   8.984  -1.076  1.00  0.79           C  
ATOM   1150  O   GLU A 140      10.780   8.454  -2.095  1.00  0.79           O  
ATOM   1151  CB  GLU A 140      11.505   8.485   1.118  1.00  0.79           C  
ATOM   1152  CG  GLU A 140      12.644   8.855   2.104  1.00  0.79           C  
ATOM   1153  CD  GLU A 140      13.107   7.692   2.983  1.00  0.79           C  
ATOM   1154  OE1 GLU A 140      13.470   7.946   4.159  1.00  0.79           O  
ATOM   1155  OE2 GLU A 140      13.174   6.537   2.481  1.00  0.79           O  
ATOM   1156  N   PHE A 141       9.004   9.124  -0.897  1.00  0.87           N  
ATOM   1157  CA  PHE A 141       8.006   8.848  -1.924  1.00  0.87           C  
ATOM   1158  C   PHE A 141       8.139   9.758  -3.143  1.00  0.87           C  
ATOM   1159  O   PHE A 141       8.089   9.294  -4.281  1.00  0.87           O  
ATOM   1160  CB  PHE A 141       6.587   8.959  -1.302  1.00  0.87           C  
ATOM   1161  CG  PHE A 141       5.442   8.807  -2.281  1.00  0.87           C  
ATOM   1162  CD1 PHE A 141       4.483   9.827  -2.413  1.00  0.87           C  
ATOM   1163  CD2 PHE A 141       5.318   7.662  -3.082  1.00  0.87           C  
ATOM   1164  CE1 PHE A 141       3.406   9.684  -3.295  1.00  0.87           C  
ATOM   1165  CE2 PHE A 141       4.238   7.515  -3.961  1.00  0.87           C  
ATOM   1166  CZ  PHE A 141       3.276   8.523  -4.063  1.00  0.87           C  
ATOM   1167  N   TYR A 142       8.342  11.075  -2.936  1.00  0.87           N  
ATOM   1168  CA  TYR A 142       8.568  12.013  -4.024  1.00  0.87           C  
ATOM   1169  C   TYR A 142       9.812  11.695  -4.842  1.00  0.87           C  
ATOM   1170  O   TYR A 142       9.732  11.628  -6.061  1.00  0.87           O  
ATOM   1171  CB  TYR A 142       8.627  13.477  -3.526  1.00  0.87           C  
ATOM   1172  CG  TYR A 142       7.334  13.967  -2.920  1.00  0.87           C  
ATOM   1173  CD1 TYR A 142       6.064  13.604  -3.410  1.00  0.87           C  
ATOM   1174  CD2 TYR A 142       7.408  14.913  -1.885  1.00  0.87           C  
ATOM   1175  CE1 TYR A 142       4.907  14.224  -2.921  1.00  0.87           C  
ATOM   1176  CE2 TYR A 142       6.255  15.528  -1.388  1.00  0.87           C  
ATOM   1177  CZ  TYR A 142       5.012  15.213  -1.936  1.00  0.87           C  
ATOM   1178  OH  TYR A 142       3.885  15.933  -1.515  1.00  0.87           O  
ATOM   1179  N   GLU A 143      10.954  11.366  -4.197  1.00  0.79           N  
ATOM   1180  CA  GLU A 143      12.179  10.948  -4.873  1.00  0.79           C  
ATOM   1181  C   GLU A 143      11.962   9.738  -5.793  1.00  0.79           C  
ATOM   1182  O   GLU A 143      12.427   9.680  -6.932  1.00  0.79           O  
ATOM   1183  CB  GLU A 143      13.275  10.587  -3.830  1.00  0.79           C  
ATOM   1184  CG  GLU A 143      13.885  11.786  -3.053  1.00  0.79           C  
ATOM   1185  CD  GLU A 143      14.967  11.384  -2.036  1.00  0.79           C  
ATOM   1186  OE1 GLU A 143      15.520  12.310  -1.385  1.00  0.79           O  
ATOM   1187  OE2 GLU A 143      15.280  10.170  -1.894  1.00  0.79           O  
ATOM   1188  N   ALA A 144      11.171   8.753  -5.321  1.00  0.88           N  
ATOM   1189  CA  ALA A 144      10.714   7.628  -6.108  1.00  0.88           C  
ATOM   1190  C   ALA A 144       9.824   8.000  -7.313  1.00  0.88           C  
ATOM   1191  O   ALA A 144      10.000   7.473  -8.410  1.00  0.88           O  
ATOM   1192  CB  ALA A 144      10.013   6.641  -5.156  1.00  0.88           C  
ATOM   1193  N   LEU A 145       8.867   8.942  -7.156  1.00  0.88           N  
ATOM   1194  CA  LEU A 145       8.084   9.512  -8.253  1.00  0.88           C  
ATOM   1195  C   LEU A 145       8.901  10.309  -9.274  1.00  0.88           C  
ATOM   1196  O   LEU A 145       8.703  10.171 -10.481  1.00  0.88           O  
ATOM   1197  CB  LEU A 145       6.936  10.416  -7.746  1.00  0.88           C  
ATOM   1198  CG  LEU A 145       5.791   9.696  -7.010  1.00  0.88           C  
ATOM   1199  CD1 LEU A 145       4.846  10.755  -6.435  1.00  0.88           C  
ATOM   1200  CD2 LEU A 145       5.008   8.733  -7.916  1.00  0.88           C  
ATOM   1201  N   ASP A 146       9.867  11.131  -8.819  1.00  0.86           N  
ATOM   1202  CA  ASP A 146      10.804  11.880  -9.645  1.00  0.86           C  
ATOM   1203  C   ASP A 146      11.665  10.981 -10.525  1.00  0.86           C  
ATOM   1204  O   ASP A 146      11.914  11.266 -11.704  1.00  0.86           O  
ATOM   1205  CB  ASP A 146      11.714  12.766  -8.764  1.00  0.86           C  
ATOM   1206  CG  ASP A 146      10.926  13.919  -8.145  1.00  0.86           C  
ATOM   1207  OD1 ASP A 146       9.817  14.238  -8.647  1.00  0.86           O  
ATOM   1208  OD2 ASP A 146      11.455  14.527  -7.181  1.00  0.86           O  
ATOM   1209  N   CYS A 147      12.092   9.813  -9.993  1.00  0.86           N  
ATOM   1210  CA  CYS A 147      12.702   8.747 -10.783  1.00  0.86           C  
ATOM   1211  C   CYS A 147      11.786   8.275 -11.912  1.00  0.86           C  
ATOM   1212  O   CYS A 147      12.216   8.198 -13.059  1.00  0.86           O  
ATOM   1213  CB  CYS A 147      13.136   7.520  -9.925  1.00  0.86           C  
ATOM   1214  SG  CYS A 147      13.616   6.045 -10.916  1.00  0.86           S  
ATOM   1215  N   LEU A 148      10.484   8.042 -11.639  1.00  0.88           N  
ATOM   1216  CA  LEU A 148       9.560   7.516 -12.634  1.00  0.88           C  
ATOM   1217  C   LEU A 148       8.992   8.616 -13.515  1.00  0.88           C  
ATOM   1218  O   LEU A 148       8.143   8.398 -14.376  1.00  0.88           O  
ATOM   1219  CB  LEU A 148       8.351   6.817 -11.961  1.00  0.88           C  
ATOM   1220  CG  LEU A 148       8.668   5.529 -11.184  1.00  0.88           C  
ATOM   1221  CD1 LEU A 148       7.373   4.889 -10.669  1.00  0.88           C  
ATOM   1222  CD2 LEU A 148       9.428   4.523 -12.050  1.00  0.88           C  
ATOM   1223  N   ARG A 149       9.457   9.865 -13.320  1.00  0.82           N  
ATOM   1224  CA  ARG A 149       9.021  11.026 -14.063  1.00  0.82           C  
ATOM   1225  C   ARG A 149       7.503  11.169 -14.018  1.00  0.82           C  
ATOM   1226  O   ARG A 149       6.836  11.303 -15.047  1.00  0.82           O  
ATOM   1227  CB  ARG A 149       9.564  11.024 -15.518  1.00  0.82           C  
ATOM   1228  CG  ARG A 149      11.100  10.991 -15.659  1.00  0.82           C  
ATOM   1229  CD  ARG A 149      11.803  12.243 -15.130  1.00  0.82           C  
ATOM   1230  NE  ARG A 149      13.245  12.150 -15.540  1.00  0.82           N  
ATOM   1231  CZ  ARG A 149      14.213  11.579 -14.810  1.00  0.82           C  
ATOM   1232  NH1 ARG A 149      15.448  11.526 -15.315  1.00  0.82           N  
ATOM   1233  NH2 ARG A 149      14.006  11.070 -13.601  1.00  0.82           N  
ATOM   1234  N   ILE A 150       6.940  11.077 -12.800  1.00  0.90           N  
ATOM   1235  CA  ILE A 150       5.525  11.223 -12.538  1.00  0.90           C  
ATOM   1236  C   ILE A 150       5.427  12.529 -11.778  1.00  0.90           C  
ATOM   1237  O   ILE A 150       5.965  12.601 -10.672  1.00  0.90           O  
ATOM   1238  CB  ILE A 150       4.931  10.087 -11.706  1.00  0.90           C  
ATOM   1239  CG1 ILE A 150       4.943   8.773 -12.521  1.00  0.90           C  
ATOM   1240  CG2 ILE A 150       3.494  10.452 -11.272  1.00  0.90           C  
ATOM   1241  CD1 ILE A 150       4.443   7.537 -11.762  1.00  0.90           C  
ATOM   1242  N   PRO A 151       4.833  13.593 -12.302  1.00  0.92           N  
ATOM   1243  CA  PRO A 151       4.592  14.828 -11.563  1.00  0.92           C  
ATOM   1244  C   PRO A 151       3.995  14.678 -10.164  1.00  0.92           C  
ATOM   1245  O   PRO A 151       3.070  13.897  -9.953  1.00  0.92           O  
ATOM   1246  CB  PRO A 151       3.690  15.653 -12.502  1.00  0.92           C  
ATOM   1247  CG  PRO A 151       3.941  15.084 -13.902  1.00  0.92           C  
ATOM   1248  CD  PRO A 151       4.170  13.609 -13.608  1.00  0.92           C  
ATOM   1249  N   LYS A 152       4.453  15.480  -9.181  1.00  0.89           N  
ATOM   1250  CA  LYS A 152       3.884  15.500  -7.841  1.00  0.89           C  
ATOM   1251  C   LYS A 152       2.462  16.072  -7.776  1.00  0.89           C  
ATOM   1252  O   LYS A 152       1.769  15.935  -6.771  1.00  0.89           O  
ATOM   1253  CB  LYS A 152       4.801  16.300  -6.885  1.00  0.89           C  
ATOM   1254  CG  LYS A 152       4.867  17.803  -7.196  1.00  0.89           C  
ATOM   1255  CD  LYS A 152       5.821  18.549  -6.254  1.00  0.89           C  
ATOM   1256  CE  LYS A 152       5.867  20.051  -6.532  1.00  0.89           C  
ATOM   1257  NZ  LYS A 152       6.839  20.707  -5.632  1.00  0.89           N  
ATOM   1258  N   SER A 153       2.011  16.735  -8.866  1.00  0.87           N  
ATOM   1259  CA  SER A 153       0.679  17.259  -9.074  1.00  0.87           C  
ATOM   1260  C   SER A 153      -0.326  16.164  -9.349  1.00  0.87           C  
ATOM   1261  O   SER A 153      -1.512  16.337  -9.088  1.00  0.87           O  
ATOM   1262  CB  SER A 153       0.629  18.317 -10.234  1.00  0.87           C  
ATOM   1263  OG  SER A 153       1.501  17.973 -11.283  1.00  0.87           O  
ATOM   1264  N   ASP A 154       0.140  14.983  -9.795  1.00  0.90           N  
ATOM   1265  CA  ASP A 154      -0.722  13.878 -10.166  1.00  0.90           C  
ATOM   1266  C   ASP A 154      -0.941  12.924  -8.986  1.00  0.90           C  
ATOM   1267  O   ASP A 154      -1.626  11.907  -9.091  1.00  0.90           O  
ATOM   1268  CB  ASP A 154      -0.076  13.092 -11.338  1.00  0.90           C  
ATOM   1269  CG  ASP A 154       0.180  13.933 -12.589  1.00  0.90           C  
ATOM   1270  OD1 ASP A 154      -0.222  15.123 -12.654  1.00  0.90           O  
ATOM   1271  OD2 ASP A 154       0.844  13.375 -13.501  1.00  0.90           O  
ATOM   1272  N   VAL A 155      -0.365  13.238  -7.806  1.00  0.91           N  
ATOM   1273  CA  VAL A 155      -0.525  12.451  -6.592  1.00  0.91           C  
ATOM   1274  C   VAL A 155      -1.898  12.610  -5.955  1.00  0.91           C  
ATOM   1275  O   VAL A 155      -2.313  13.692  -5.539  1.00  0.91           O  
ATOM   1276  CB  VAL A 155       0.550  12.730  -5.546  1.00  0.91           C  
ATOM   1277  CG1 VAL A 155       0.382  11.790  -4.339  1.00  0.91           C  
ATOM   1278  CG2 VAL A 155       1.943  12.515  -6.153  1.00  0.91           C  
ATOM   1279  N   VAL A 156      -2.626  11.489  -5.817  1.00  0.91           N  
ATOM   1280  CA  VAL A 156      -3.899  11.427  -5.127  1.00  0.91           C  
ATOM   1281  C   VAL A 156      -3.609  11.067  -3.678  1.00  0.91           C  
ATOM   1282  O   VAL A 156      -2.874  10.119  -3.411  1.00  0.91           O  
ATOM   1283  CB  VAL A 156      -4.846  10.416  -5.768  1.00  0.91           C  
ATOM   1284  CG1 VAL A 156      -6.175  10.343  -4.989  1.00  0.91           C  
ATOM   1285  CG2 VAL A 156      -5.096  10.836  -7.231  1.00  0.91           C  
ATOM   1286  N   TYR A 157      -4.155  11.828  -2.707  1.00  0.92           N  
ATOM   1287  CA  TYR A 157      -3.944  11.621  -1.283  1.00  0.92           C  
ATOM   1288  C   TYR A 157      -5.238  11.205  -0.625  1.00  0.92           C  
ATOM   1289  O   TYR A 157      -6.320  11.665  -0.995  1.00  0.92           O  
ATOM   1290  CB  TYR A 157      -3.532  12.908  -0.521  1.00  0.92           C  
ATOM   1291  CG  TYR A 157      -2.190  13.371  -0.963  1.00  0.92           C  
ATOM   1292  CD1 TYR A 157      -1.043  12.914  -0.301  1.00  0.92           C  
ATOM   1293  CD2 TYR A 157      -2.058  14.215  -2.075  1.00  0.92           C  
ATOM   1294  CE1 TYR A 157       0.227  13.257  -0.775  1.00  0.92           C  
ATOM   1295  CE2 TYR A 157      -0.790  14.565  -2.549  1.00  0.92           C  
ATOM   1296  CZ  TYR A 157       0.347  14.071  -1.903  1.00  0.92           C  
ATOM   1297  OH  TYR A 157       1.616  14.327  -2.430  1.00  0.92           O  
ATOM   1298  N   THR A 158      -5.148  10.344   0.403  1.00  0.93           N  
ATOM   1299  CA  THR A 158      -6.248  10.075   1.312  1.00  0.93           C  
ATOM   1300  C   THR A 158      -6.476  11.226   2.260  1.00  0.93           C  
ATOM   1301  O   THR A 158      -5.586  12.028   2.539  1.00  0.93           O  
ATOM   1302  CB  THR A 158      -6.101   8.797   2.135  1.00  0.93           C  
ATOM   1303  OG1 THR A 158      -4.878   8.737   2.847  1.00  0.93           O  
ATOM   1304  CG2 THR A 158      -6.115   7.607   1.182  1.00  0.93           C  
ATOM   1305  N   ASP A 159      -7.705  11.342   2.779  1.00  0.91           N  
ATOM   1306  CA  ASP A 159      -8.023  12.266   3.836  1.00  0.91           C  
ATOM   1307  C   ASP A 159      -8.539  11.387   4.962  1.00  0.91           C  
ATOM   1308  O   ASP A 159      -9.592  10.756   4.862  1.00  0.91           O  
ATOM   1309  CB  ASP A 159      -9.044  13.323   3.334  1.00  0.91           C  
ATOM   1310  CG  ASP A 159      -9.441  14.352   4.383  1.00  0.91           C  
ATOM   1311  OD1 ASP A 159      -8.955  14.283   5.542  1.00  0.91           O  
ATOM   1312  OD2 ASP A 159     -10.290  15.210   4.022  1.00  0.91           O  
ATOM   1313  N   TRP A 160      -7.791  11.310   6.079  1.00  0.87           N  
ATOM   1314  CA  TRP A 160      -8.147  10.505   7.233  1.00  0.87           C  
ATOM   1315  C   TRP A 160      -9.392  11.019   7.955  1.00  0.87           C  
ATOM   1316  O   TRP A 160     -10.118  10.260   8.590  1.00  0.87           O  
ATOM   1317  CB  TRP A 160      -6.931  10.369   8.192  1.00  0.87           C  
ATOM   1318  CG  TRP A 160      -7.137   9.447   9.390  1.00  0.87           C  
ATOM   1319  CD1 TRP A 160      -7.103   9.748  10.725  1.00  0.87           C  
ATOM   1320  CD2 TRP A 160      -7.489   8.054   9.300  1.00  0.87           C  
ATOM   1321  NE1 TRP A 160      -7.476   8.646  11.469  1.00  0.87           N  
ATOM   1322  CE2 TRP A 160      -7.730   7.604  10.615  1.00  0.87           C  
ATOM   1323  CE3 TRP A 160      -7.638   7.197   8.213  1.00  0.87           C  
ATOM   1324  CZ2 TRP A 160      -8.161   6.309  10.860  1.00  0.87           C  
ATOM   1325  CZ3 TRP A 160      -8.075   5.890   8.461  1.00  0.87           C  
ATOM   1326  CH2 TRP A 160      -8.351   5.455   9.765  1.00  0.87           C  
ATOM   1327  N   LYS A 161      -9.740  12.315   7.797  1.00  0.86           N  
ATOM   1328  CA  LYS A 161     -10.921  12.904   8.410  1.00  0.86           C  
ATOM   1329  C   LYS A 161     -12.208  12.425   7.764  1.00  0.86           C  
ATOM   1330  O   LYS A 161     -13.303  12.589   8.297  1.00  0.86           O  
ATOM   1331  CB  LYS A 161     -10.875  14.441   8.289  1.00  0.86           C  
ATOM   1332  CG  LYS A 161      -9.671  15.071   9.002  1.00  0.86           C  
ATOM   1333  CD  LYS A 161      -9.589  16.584   8.751  1.00  0.86           C  
ATOM   1334  CE  LYS A 161      -8.375  17.225   9.418  1.00  0.86           C  
ATOM   1335  NZ  LYS A 161      -8.280  18.642   9.008  1.00  0.86           N  
ATOM   1336  N   LYS A 162     -12.088  11.793   6.585  1.00  0.86           N  
ATOM   1337  CA  LYS A 162     -13.213  11.232   5.892  1.00  0.86           C  
ATOM   1338  C   LYS A 162     -13.422   9.766   6.196  1.00  0.86           C  
ATOM   1339  O   LYS A 162     -14.357   9.186   5.655  1.00  0.86           O  
ATOM   1340  CB  LYS A 162     -13.050  11.401   4.368  1.00  0.86           C  
ATOM   1341  CG  LYS A 162     -13.094  12.874   3.954  1.00  0.86           C  
ATOM   1342  CD  LYS A 162     -12.987  13.073   2.438  1.00  0.86           C  
ATOM   1343  CE  LYS A 162     -12.993  14.558   2.079  1.00  0.86           C  
ATOM   1344  NZ  LYS A 162     -12.620  14.734   0.662  1.00  0.86           N  
ATOM   1345  N   ASP A 163     -12.611   9.126   7.074  1.00  0.88           N  
ATOM   1346  CA  ASP A 163     -12.794   7.721   7.398  1.00  0.88           C  
ATOM   1347  C   ASP A 163     -14.191   7.380   7.953  1.00  0.88           C  
ATOM   1348  O   ASP A 163     -14.856   8.162   8.637  1.00  0.88           O  
ATOM   1349  CB  ASP A 163     -11.658   7.168   8.307  1.00  0.88           C  
ATOM   1350  CG  ASP A 163     -11.797   5.657   8.393  1.00  0.88           C  
ATOM   1351  OD1 ASP A 163     -11.713   5.017   7.311  1.00  0.88           O  
ATOM   1352  OD2 ASP A 163     -12.147   5.129   9.478  1.00  0.88           O  
ATOM   1353  N   LYS A 164     -14.681   6.178   7.593  1.00  0.85           N  
ATOM   1354  CA  LYS A 164     -15.942   5.643   8.041  1.00  0.85           C  
ATOM   1355  C   LYS A 164     -15.762   4.234   8.557  1.00  0.85           C  
ATOM   1356  O   LYS A 164     -16.730   3.566   8.920  1.00  0.85           O  
ATOM   1357  CB  LYS A 164     -16.937   5.604   6.854  1.00  0.85           C  
ATOM   1358  CG  LYS A 164     -17.241   6.980   6.240  1.00  0.85           C  
ATOM   1359  CD  LYS A 164     -17.906   7.964   7.210  1.00  0.85           C  
ATOM   1360  CE  LYS A 164     -18.040   9.365   6.616  1.00  0.85           C  
ATOM   1361  NZ  LYS A 164     -18.291  10.321   7.714  1.00  0.85           N  
ATOM   1362  N   CYS A 165     -14.516   3.735   8.619  1.00  0.92           N  
ATOM   1363  CA  CYS A 165     -14.266   2.336   8.881  1.00  0.92           C  
ATOM   1364  C   CYS A 165     -13.749   2.077  10.277  1.00  0.92           C  
ATOM   1365  O   CYS A 165     -13.813   0.944  10.757  1.00  0.92           O  
ATOM   1366  CB  CYS A 165     -13.241   1.769   7.886  1.00  0.92           C  
ATOM   1367  SG  CYS A 165     -13.890   1.420   6.226  1.00  0.92           S  
ATOM   1368  N   GLU A 166     -13.314   3.117  11.005  1.00  0.84           N  
ATOM   1369  CA  GLU A 166     -12.978   3.015  12.419  1.00  0.84           C  
ATOM   1370  C   GLU A 166     -14.090   2.433  13.324  1.00  0.84           C  
ATOM   1371  O   GLU A 166     -13.762   1.597  14.171  1.00  0.84           O  
ATOM   1372  CB  GLU A 166     -12.482   4.377  12.980  1.00  0.84           C  
ATOM   1373  CG  GLU A 166     -11.637   4.246  14.274  1.00  0.84           C  
ATOM   1374  CD  GLU A 166     -11.501   5.539  15.080  1.00  0.84           C  
ATOM   1375  OE1 GLU A 166     -10.966   5.442  16.222  1.00  0.84           O  
ATOM   1376  OE2 GLU A 166     -12.017   6.597  14.658  1.00  0.84           O  
ATOM   1377  N   PRO A 167     -15.402   2.735  13.227  1.00  0.87           N  
ATOM   1378  CA  PRO A 167     -16.442   2.027  13.976  1.00  0.87           C  
ATOM   1379  C   PRO A 167     -16.521   0.535  13.696  1.00  0.87           C  
ATOM   1380  O   PRO A 167     -16.725  -0.236  14.632  1.00  0.87           O  
ATOM   1381  CB  PRO A 167     -17.752   2.736  13.579  1.00  0.87           C  
ATOM   1382  CG  PRO A 167     -17.310   4.125  13.114  1.00  0.87           C  
ATOM   1383  CD  PRO A 167     -15.973   3.832  12.442  1.00  0.87           C  
ATOM   1384  N   LEU A 168     -16.387   0.116  12.420  1.00  0.86           N  
ATOM   1385  CA  LEU A 168     -16.436  -1.280  12.002  1.00  0.86           C  
ATOM   1386  C   LEU A 168     -15.229  -2.074  12.491  1.00  0.86           C  
ATOM   1387  O   LEU A 168     -15.354  -3.197  12.975  1.00  0.86           O  
ATOM   1388  CB  LEU A 168     -16.597  -1.390  10.465  1.00  0.86           C  
ATOM   1389  CG  LEU A 168     -16.778  -2.822   9.909  1.00  0.86           C  
ATOM   1390  CD1 LEU A 168     -18.008  -3.538  10.485  1.00  0.86           C  
ATOM   1391  CD2 LEU A 168     -16.851  -2.792   8.376  1.00  0.86           C  
ATOM   1392  N   GLU A 169     -14.021  -1.467  12.436  1.00  0.86           N  
ATOM   1393  CA  GLU A 169     -12.799  -2.039  12.988  1.00  0.86           C  
ATOM   1394  C   GLU A 169     -12.907  -2.319  14.478  1.00  0.86           C  
ATOM   1395  O   GLU A 169     -12.607  -3.419  14.940  1.00  0.86           O  
ATOM   1396  CB  GLU A 169     -11.601  -1.094  12.727  1.00  0.86           C  
ATOM   1397  CG  GLU A 169     -10.297  -1.464  13.478  1.00  0.86           C  
ATOM   1398  CD  GLU A 169      -9.123  -0.588  13.093  1.00  0.86           C  
ATOM   1399  OE1 GLU A 169      -8.069  -1.159  12.694  1.00  0.86           O  
ATOM   1400  OE2 GLU A 169      -9.189   0.664  13.186  1.00  0.86           O  
ATOM   1401  N   LYS A 170     -13.442  -1.348  15.248  1.00  0.82           N  
ATOM   1402  CA  LYS A 170     -13.734  -1.490  16.664  1.00  0.82           C  
ATOM   1403  C   LYS A 170     -14.729  -2.593  16.980  1.00  0.82           C  
ATOM   1404  O   LYS A 170     -14.611  -3.280  17.994  1.00  0.82           O  
ATOM   1405  CB  LYS A 170     -14.250  -0.156  17.252  1.00  0.82           C  
ATOM   1406  CG  LYS A 170     -13.115   0.864  17.397  1.00  0.82           C  
ATOM   1407  CD  LYS A 170     -13.593   2.274  17.777  1.00  0.82           C  
ATOM   1408  CE  LYS A 170     -12.417   3.246  17.884  1.00  0.82           C  
ATOM   1409  NZ  LYS A 170     -12.864   4.652  17.792  1.00  0.82           N  
ATOM   1410  N   GLN A 171     -15.753  -2.794  16.128  1.00  0.79           N  
ATOM   1411  CA  GLN A 171     -16.641  -3.933  16.253  1.00  0.79           C  
ATOM   1412  C   GLN A 171     -15.934  -5.268  16.030  1.00  0.79           C  
ATOM   1413  O   GLN A 171     -15.997  -6.162  16.871  1.00  0.79           O  
ATOM   1414  CB  GLN A 171     -17.828  -3.799  15.277  1.00  0.79           C  
ATOM   1415  CG  GLN A 171     -18.805  -4.987  15.368  1.00  0.79           C  
ATOM   1416  CD  GLN A 171     -19.998  -4.853  14.424  1.00  0.79           C  
ATOM   1417  OE1 GLN A 171     -20.352  -3.786  13.919  1.00  0.79           O  
ATOM   1418  NE2 GLN A 171     -20.662  -6.007  14.193  1.00  0.79           N  
ATOM   1419  N   HIS A 172     -15.158  -5.391  14.933  1.00  0.81           N  
ATOM   1420  CA  HIS A 172     -14.396  -6.591  14.619  1.00  0.81           C  
ATOM   1421  C   HIS A 172     -13.323  -6.933  15.647  1.00  0.81           C  
ATOM   1422  O   HIS A 172     -13.036  -8.096  15.918  1.00  0.81           O  
ATOM   1423  CB  HIS A 172     -13.746  -6.503  13.229  1.00  0.81           C  
ATOM   1424  CG  HIS A 172     -14.715  -6.512  12.098  1.00  0.81           C  
ATOM   1425  ND1 HIS A 172     -14.218  -6.154  10.863  1.00  0.81           N  
ATOM   1426  CD2 HIS A 172     -16.006  -6.908  11.991  1.00  0.81           C  
ATOM   1427  CE1 HIS A 172     -15.218  -6.326  10.030  1.00  0.81           C  
ATOM   1428  NE2 HIS A 172     -16.329  -6.787  10.656  1.00  0.81           N  
ATOM   1429  N   GLU A 173     -12.680  -5.921  16.259  1.00  0.78           N  
ATOM   1430  CA  GLU A 173     -11.810  -6.094  17.408  1.00  0.78           C  
ATOM   1431  C   GLU A 173     -12.492  -6.689  18.630  1.00  0.78           C  
ATOM   1432  O   GLU A 173     -11.937  -7.561  19.296  1.00  0.78           O  
ATOM   1433  CB  GLU A 173     -11.170  -4.757  17.822  1.00  0.78           C  
ATOM   1434  CG  GLU A 173     -10.006  -4.323  16.909  1.00  0.78           C  
ATOM   1435  CD  GLU A 173      -9.238  -3.138  17.491  1.00  0.78           C  
ATOM   1436  OE1 GLU A 173      -8.218  -2.773  16.862  1.00  0.78           O  
ATOM   1437  OE2 GLU A 173      -9.613  -2.659  18.595  1.00  0.78           O  
ATOM   1438  N   LYS A 174     -13.721  -6.244  18.957  1.00  0.81           N  
ATOM   1439  CA  LYS A 174     -14.503  -6.827  20.032  1.00  0.81           C  
ATOM   1440  C   LYS A 174     -14.885  -8.271  19.776  1.00  0.81           C  
ATOM   1441  O   LYS A 174     -14.729  -9.114  20.655  1.00  0.81           O  
ATOM   1442  CB  LYS A 174     -15.781  -6.008  20.298  1.00  0.81           C  
ATOM   1443  CG  LYS A 174     -15.490  -4.641  20.931  1.00  0.81           C  
ATOM   1444  CD  LYS A 174     -16.749  -3.765  20.995  1.00  0.81           C  
ATOM   1445  CE  LYS A 174     -16.489  -2.377  21.579  1.00  0.81           C  
ATOM   1446  NZ  LYS A 174     -17.750  -1.604  21.592  1.00  0.81           N  
ATOM   1447  N   GLU A 175     -15.340  -8.586  18.549  1.00  0.81           N  
ATOM   1448  CA  GLU A 175     -15.704  -9.931  18.142  1.00  0.81           C  
ATOM   1449  C   GLU A 175     -14.538 -10.912  18.234  1.00  0.81           C  
ATOM   1450  O   GLU A 175     -14.657 -11.963  18.856  1.00  0.81           O  
ATOM   1451  CB  GLU A 175     -16.281  -9.879  16.708  1.00  0.81           C  
ATOM   1452  CG  GLU A 175     -17.654  -9.154  16.635  1.00  0.81           C  
ATOM   1453  CD  GLU A 175     -18.092  -8.740  15.227  1.00  0.81           C  
ATOM   1454  OE1 GLU A 175     -19.224  -8.193  15.112  1.00  0.81           O  
ATOM   1455  OE2 GLU A 175     -17.305  -8.913  14.265  1.00  0.81           O  
ATOM   1456  N   ARG A 176     -13.339 -10.531  17.732  1.00  0.76           N  
ATOM   1457  CA  ARG A 176     -12.126 -11.331  17.880  1.00  0.76           C  
ATOM   1458  C   ARG A 176     -11.729 -11.576  19.336  1.00  0.76           C  
ATOM   1459  O   ARG A 176     -11.442 -12.699  19.733  1.00  0.76           O  
ATOM   1460  CB  ARG A 176     -10.923 -10.677  17.141  1.00  0.76           C  
ATOM   1461  CG  ARG A 176     -11.034 -10.759  15.603  1.00  0.76           C  
ATOM   1462  CD  ARG A 176      -9.745 -10.425  14.836  1.00  0.76           C  
ATOM   1463  NE  ARG A 176      -9.354  -8.990  15.091  1.00  0.76           N  
ATOM   1464  CZ  ARG A 176      -9.673  -7.925  14.341  1.00  0.76           C  
ATOM   1465  NH1 ARG A 176     -10.456  -8.032  13.279  1.00  0.76           N  
ATOM   1466  NH2 ARG A 176      -9.249  -6.715  14.694  1.00  0.76           N  
ATOM   1467  N   LYS A 177     -11.766 -10.540  20.198  1.00  0.78           N  
ATOM   1468  CA  LYS A 177     -11.472 -10.684  21.617  1.00  0.78           C  
ATOM   1469  C   LYS A 177     -12.453 -11.573  22.364  1.00  0.78           C  
ATOM   1470  O   LYS A 177     -12.089 -12.263  23.312  1.00  0.78           O  
ATOM   1471  CB  LYS A 177     -11.378  -9.302  22.304  1.00  0.78           C  
ATOM   1472  CG  LYS A 177     -10.083  -8.567  21.923  1.00  0.78           C  
ATOM   1473  CD  LYS A 177     -10.010  -7.139  22.488  1.00  0.78           C  
ATOM   1474  CE  LYS A 177      -8.719  -6.410  22.097  1.00  0.78           C  
ATOM   1475  NZ  LYS A 177      -8.769  -4.991  22.523  1.00  0.78           N  
ATOM   1476  N   GLN A 178     -13.736 -11.579  21.962  1.00  0.75           N  
ATOM   1477  CA  GLN A 178     -14.703 -12.526  22.480  1.00  0.75           C  
ATOM   1478  C   GLN A 178     -14.390 -13.956  22.061  1.00  0.75           C  
ATOM   1479  O   GLN A 178     -14.315 -14.844  22.902  1.00  0.75           O  
ATOM   1480  CB  GLN A 178     -16.128 -12.100  22.075  1.00  0.75           C  
ATOM   1481  CG  GLN A 178     -16.574 -10.833  22.840  1.00  0.75           C  
ATOM   1482  CD  GLN A 178     -17.888 -10.260  22.310  1.00  0.75           C  
ATOM   1483  OE1 GLN A 178     -18.477 -10.663  21.314  1.00  0.75           O  
ATOM   1484  NE2 GLN A 178     -18.386  -9.226  23.033  1.00  0.75           N  
ATOM   1485  N   GLU A 179     -14.079 -14.187  20.771  1.00  0.73           N  
ATOM   1486  CA  GLU A 179     -13.662 -15.484  20.258  1.00  0.73           C  
ATOM   1487  C   GLU A 179     -12.385 -16.031  20.896  1.00  0.73           C  
ATOM   1488  O   GLU A 179     -12.307 -17.207  21.238  1.00  0.73           O  
ATOM   1489  CB  GLU A 179     -13.472 -15.404  18.729  1.00  0.73           C  
ATOM   1490  CG  GLU A 179     -14.784 -15.172  17.940  1.00  0.73           C  
ATOM   1491  CD  GLU A 179     -14.542 -14.943  16.445  1.00  0.73           C  
ATOM   1492  OE1 GLU A 179     -15.553 -14.912  15.699  1.00  0.73           O  
ATOM   1493  OE2 GLU A 179     -13.361 -14.803  16.030  1.00  0.73           O  
ATOM   1494  N   GLU A 180     -11.369 -15.172  21.118  1.00  0.71           N  
ATOM   1495  CA  GLU A 180     -10.143 -15.500  21.834  1.00  0.71           C  
ATOM   1496  C   GLU A 180     -10.315 -15.631  23.348  1.00  0.71           C  
ATOM   1497  O   GLU A 180      -9.448 -16.161  24.034  1.00  0.71           O  
ATOM   1498  CB  GLU A 180      -9.076 -14.404  21.584  1.00  0.71           C  
ATOM   1499  CG  GLU A 180      -8.536 -14.342  20.133  1.00  0.71           C  
ATOM   1500  CD  GLU A 180      -7.677 -13.099  19.862  1.00  0.71           C  
ATOM   1501  OE1 GLU A 180      -7.229 -12.952  18.693  1.00  0.71           O  
ATOM   1502  OE2 GLU A 180      -7.471 -12.277  20.794  1.00  0.71           O  
ATOM   1503  N   GLY A 181     -11.430 -15.132  23.926  1.00  0.74           N  
ATOM   1504  CA  GLY A 181     -11.697 -15.247  25.359  1.00  0.74           C  
ATOM   1505  C   GLY A 181     -12.639 -16.357  25.731  1.00  0.74           C  
ATOM   1506  O   GLY A 181     -12.813 -16.652  26.909  1.00  0.74           O  
ATOM   1507  N   GLU A 182     -13.278 -16.993  24.735  1.00  0.66           N  
ATOM   1508  CA  GLU A 182     -14.139 -18.142  24.937  1.00  0.66           C  
ATOM   1509  C   GLU A 182     -13.429 -19.435  24.560  1.00  0.66           C  
ATOM   1510  O   GLU A 182     -14.001 -20.520  24.658  1.00  0.66           O  
ATOM   1511  CB  GLU A 182     -15.423 -17.987  24.088  1.00  0.66           C  
ATOM   1512  CG  GLU A 182     -16.423 -16.968  24.692  1.00  0.66           C  
ATOM   1513  CD  GLU A 182     -17.724 -16.826  23.899  1.00  0.66           C  
ATOM   1514  OE1 GLU A 182     -18.620 -16.104  24.412  1.00  0.66           O  
ATOM   1515  OE2 GLU A 182     -17.852 -17.429  22.803  1.00  0.66           O  
ATOM   1516  N   SER A 183     -12.159 -19.341  24.128  1.00  0.68           N  
ATOM   1517  CA  SER A 183     -11.315 -20.473  23.791  1.00  0.68           C  
ATOM   1518  C   SER A 183     -10.288 -20.849  24.893  1.00  0.68           C  
ATOM   1519  O   SER A 183     -10.250 -20.188  25.963  1.00  0.68           O  
ATOM   1520  CB  SER A 183     -10.562 -20.257  22.447  1.00  0.68           C  
ATOM   1521  OG  SER A 183      -9.873 -19.007  22.385  1.00  0.68           O  
ATOM   1522  OXT SER A 183      -9.541 -21.846  24.668  1.00  0.68           O  
HETATM 1523  C1  NAG A   1      14.421 -16.320   8.676  0.00  0.00              
HETATM 1524  C2  NAG A   1      14.606 -17.406   9.784  0.00  0.00              
HETATM 1525  C3  NAG A   1      16.082 -17.911   9.784  0.00  0.00              
HETATM 1526  C4  NAG A   1      16.528 -18.367   8.378  0.00  0.00              
HETATM 1527  C5  NAG A   1      16.289 -17.244   7.334  0.00  0.00              
HETATM 1528  C6  NAG A   1      16.622 -17.688   5.897  0.00  0.00              
HETATM 1529  C7  NAG A   1      13.513 -17.521  12.001  0.00  0.00              
HETATM 1530  C8  NAG A   1      13.339 -16.855  13.351  0.00  0.00              
HETATM 1531  O3h NAG A   1      16.271 -19.013  10.674  0.00  0.00              
HETATM 1532  OR  NAG A   1      17.904 -18.723   8.453  0.00  0.00              
HETATM 1533  OR  NAG A   1      14.896 -16.804   7.390  0.00  0.00              
HETATM 1534  OW  NAG A   1      17.622 -16.856   5.303  0.00  0.00              
HETATM 1535  OM  NAG A   1      13.023 -18.624  11.790  0.00  0.00              
HETATM 1536  N15 NAG A   1      14.261 -16.856  11.125  0.00  0.00              
HETATM 1537  H2  NAG A   1      13.950 -18.259   9.513  0.00  0.00              
HETATM 1538  H3  NAG A   1      16.746 -17.083  10.103  0.00  0.00              
HETATM 1539  H4  NAG A   1      15.934 -19.256   8.084  0.00  0.00              
HETATM 1540  H5  NAG A   1      16.948 -16.387   7.580  0.00  0.00              
HETATM 1541  H6  NAG A   1      16.961 -18.741   5.904  0.00  0.00              
HETATM 1542  H22 NAG A   1      15.700 -17.665   5.284  0.00  0.00              
HETATM 1543  H8  NAG A   1      12.311 -17.014  13.718  0.00  0.00              
HETATM 1544  H24 NAG A   1      13.526 -15.767  13.339  0.00  0.00              
HETATM 1545  H25 NAG A   1      14.026 -17.318  14.080  0.00  0.00              
HETATM 1546  H3o NAG A   1      16.116 -18.676  11.562  0.00  0.00              
HETATM 1547  H29 NAG A   1      14.463 -15.894  11.402  0.00  0.00              
HETATM 1548  H1  NAG A   1      14.961 -15.390   8.942  0.00  0.00              
HETATM 1549  C1  NAG A   2      18.256 -20.031   8.028  0.00  0.00              
HETATM 1550  C2  NAG A   2      19.795 -20.139   7.788  0.00  0.00              
HETATM 1551  C3  NAG A   2      20.193 -21.634   7.585  0.00  0.00              
HETATM 1552  C4  NAG A   2      19.674 -22.523   8.734  0.00  0.00              
HETATM 1553  C5  NAG A   2      18.144 -22.340   8.923  0.00  0.00              
HETATM 1554  C6  NAG A   2      17.596 -23.128  10.128  0.00  0.00              
HETATM 1555  C7  NAG A   2      21.266 -18.545   6.597  0.00  0.00              
HETATM 1556  C8  NAG A   2      21.587 -17.882   5.273  0.00  0.00              
HETATM 1557  O3h NAG A   2      21.611 -21.805   7.514  0.00  0.00              
HETATM 1558  OR  NAG A   2      20.002 -23.872   8.421  0.00  0.00              
HETATM 1559  OR  NAG A   2      17.832 -20.922   9.097  0.00  0.00              
HETATM 1560  O6h NAG A   2      18.194 -22.704  11.356  0.00  0.00              
HETATM 1561  OM  NAG A   2      21.997 -18.371   7.564  0.00  0.00              
HETATM 1562  N15 NAG A   2      20.202 -19.343   6.597  0.00  0.00              
HETATM 1563  H2  NAG A   2      20.292 -19.773   8.711  0.00  0.00              
HETATM 1564  H3  NAG A   2      19.746 -21.999   6.638  0.00  0.00              
HETATM 1565  H4  NAG A   2      20.184 -22.229   9.674  0.00  0.00              
HETATM 1566  H5  NAG A   2      17.629 -22.713   8.016  0.00  0.00              
HETATM 1567  H6S NAG A   2      16.498 -23.007  10.182  0.00  0.00              
HETATM 1568  H6R NAG A   2      17.780 -24.209   9.973  0.00  0.00              
HETATM 1569  H8  NAG A   2      21.938 -16.850   5.445  0.00  0.00              
HETATM 1570  H24 NAG A   2      20.729 -17.833   4.578  0.00  0.00              
HETATM 1571  H25 NAG A   2      22.404 -18.431   4.775  0.00  0.00              
HETATM 1572  H3o NAG A   2      21.901 -21.353   6.715  0.00  0.00              
HETATM 1573  H6o NAG A   2      18.015 -23.382  12.013  0.00  0.00              
HETATM 1574  H29 NAG A   2      19.623 -19.257   5.760  0.00  0.00              
HETATM 1575  H1  NAG A   2      17.695 -20.273   7.103  0.00  0.00              
HETATM 1576  C1  BMA A   3      20.741 -24.572   9.359  0.00  0.00              
HETATM 1577  C2  BMA A   3      20.736 -26.047   8.965  0.00  0.00              
HETATM 1578  C3  BMA A   3      21.727 -26.858   9.782  0.00  0.00              
HETATM 1579  C4  BMA A   3      23.089 -26.205   9.763  0.00  0.00              
HETATM 1580  C5  BMA A   3      22.970 -24.745  10.202  0.00  0.00              
HETATM 1581  C6  BMA A   3      24.271 -23.972  10.203  0.00  0.00              
HETATM 1582  OW  BMA A   3      21.827 -28.169   9.212  0.00  0.00              
HETATM 1583  O4h BMA A   3      23.983 -26.863  10.648  0.00  0.00              
HETATM 1584  OR  BMA A   3      22.087 -24.085   9.282  0.00  0.00              
HETATM 1585  OW  BMA A   3      24.556 -23.417  11.477  0.00  0.00              
HETATM 1586  H4o BMA A   3      24.579 -27.588  10.094  0.00  0.00              
HETATM 1587  O2h BMA A   3      21.059 -26.150   7.585  0.00  0.00              
HETATM 1588  H2o BMA A   3      22.066 -25.768   7.417  0.00  0.00              
HETATM 1589  H5  BMA A   3      22.607 -24.705  11.192  0.00  0.00              
HETATM 1590  H6  BMA A   3      25.171 -24.210   9.843  0.00  0.00              
HETATM 1591  H20 BMA A   3      24.190 -23.176   9.520  0.00  0.00              
HETATM 1592  H2  BMA A   3      19.727 -26.423   9.137  0.00  0.00              
HETATM 1593  H3  BMA A   3      21.367 -26.922  10.809  0.00  0.00              
HETATM 1594  H1  BMA A   3      20.333 -24.463  10.363  0.00  0.00              
HETATM 1595  H4  BMA A   3      23.473 -26.268   8.745  0.00  0.00              
HETATM 1596  C1  MAN A   4      21.630 -29.272  10.088  0.00  0.00              
HETATM 1597  C2  MAN A   4      22.024 -30.632   9.522  0.00  0.00              
HETATM 1598  C3  MAN A   4      21.111 -31.064   8.386  0.00  0.00              
HETATM 1599  C4  MAN A   4      19.661 -30.948   8.800  0.00  0.00              
HETATM 1600  C5  MAN A   4      19.382 -29.538   9.321  0.00  0.00              
HETATM 1601  C6  MAN A   4      17.964 -29.300   9.791  0.00  0.00              
HETATM 1602  O3h MAN A   4      21.398 -32.429   8.061  0.00  0.00              
HETATM 1603  OR  MAN A   4      18.797 -31.195   7.702  0.00  0.00              
HETATM 1604  OR  MAN A   4      20.244 -29.312  10.449  0.00  0.00              
HETATM 1605  O6h MAN A   4      17.597 -30.183  10.840  0.00  0.00              
HETATM 1606  H3o MAN A   4      21.874 -32.353   7.082  0.00  0.00              
HETATM 1607  H6o MAN A   4      17.223 -29.936  11.833  0.00  0.00              
HETATM 1608  OW  MAN A   4      21.970 -31.594  10.568  0.00  0.00              
HETATM 1609  H5  MAN A   4      19.554 -28.838   8.550  0.00  0.00              
HETATM 1610  H6S MAN A   4      17.486 -28.454  10.018  0.00  0.00              
HETATM 1611  H6R MAN A   4      17.309 -29.473   8.986  0.00  0.00              
HETATM 1612  H1  MAN A   4      22.258 -29.040  10.949  0.00  0.00              
HETATM 1613  H2  MAN A   4      23.046 -30.545   9.153  0.00  0.00              
HETATM 1614  H3  MAN A   4      21.295 -30.424   7.524  0.00  0.00              
HETATM 1615  H4  MAN A   4      19.479 -31.687   9.581  0.00  0.00              
HETATM 1616  C1  NAG A   5      23.129 -31.732  11.376  0.00  0.00              
HETATM 1617  C2  NAG A   5      22.735 -31.977  12.869  0.00  0.00              
HETATM 1618  C3  NAG A   5      23.999 -32.390  13.686  0.00  0.00              
HETATM 1619  C4  NAG A   5      24.740 -33.573  13.030  0.00  0.00              
HETATM 1620  C5  NAG A   5      25.072 -33.261  11.545  0.00  0.00              
HETATM 1621  C6  NAG A   5      25.720 -34.454  10.818  0.00  0.00              
HETATM 1622  C7  NAG A   5      21.026 -30.789  14.207  0.00  0.00              
HETATM 1623  C8  NAG A   5      20.599 -29.467  14.809  0.00  0.00              
HETATM 1624  O3h NAG A   5      23.669 -32.774  15.023  0.00  0.00              
HETATM 1625  OR  NAG A   5      25.920 -33.821  13.786  0.00  0.00              
HETATM 1626  OR  NAG A   5      23.855 -32.870  10.837  0.00  0.00              
HETATM 1627  O6h NAG A   5      24.854 -35.592  10.791  0.00  0.00              
HETATM 1628  OM  NAG A   5      20.398 -31.812  14.459  0.00  0.00              
HETATM 1629  N15 NAG A   5      22.127 -30.753  13.462  0.00  0.00              
HETATM 1630  H2  NAG A   5      22.024 -32.831  12.878  0.00  0.00              
HETATM 1631  H3  NAG A   5      24.696 -31.529  13.728  0.00  0.00              
HETATM 1632  H4  NAG A   5      24.086 -34.470  13.064  0.00  0.00              
HETATM 1633  H5  NAG A   5      25.793 -32.419  11.516  0.00  0.00              
HETATM 1634  H6S NAG A   5      25.986 -34.158   9.785  0.00  0.00              
HETATM 1635  H6R NAG A   5      26.673 -34.715  11.320  0.00  0.00              
HETATM 1636  H8  NAG A   5      19.498 -29.384  14.792  0.00  0.00              
HETATM 1637  H24 NAG A   5      21.008 -28.585  14.284  0.00  0.00              
HETATM 1638  H25 NAG A   5      20.918 -29.422  15.864  0.00  0.00              
HETATM 1639  H3o NAG A   5      23.330 -31.986  15.458  0.00  0.00              
HETATM 1640  H6o NAG A   5      25.391 -36.357  10.565  0.00  0.00              
HETATM 1641  H29 NAG A   5      22.437 -29.809  13.230  0.00  0.00              
HETATM 1642  H1  NAG A   5      23.749 -30.818  11.278  0.00  0.00              
HETATM 1643  C1  GLB A   6      26.091 -35.100  14.283  0.00  0.00              
HETATM 1644  C2  GLB A   6      27.519 -35.222  14.805  0.00  0.00              
HETATM 1645  C3  GLB A   6      27.729 -36.499  15.601  0.00  0.00              
HETATM 1646  C4  GLB A   6      26.657 -36.649  16.656  0.00  0.00              
HETATM 1647  C5  GLB A   6      25.275 -36.538  16.010  0.00  0.00              
HETATM 1648  C6  GLB A   6      24.112 -36.648  16.972  0.00  0.00              
HETATM 1649  O2h GLB A   6      28.408 -35.195  13.696  0.00  0.00              
HETATM 1650  OW  GLB A   6      29.010 -36.438  16.239  0.00  0.00              
HETATM 1651  OR  GLB A   6      25.188 -35.245  15.389  0.00  0.00              
HETATM 1652  O6h GLB A   6      24.156 -35.644  17.974  0.00  0.00              
HETATM 1653  H2o GLB A   6      28.856 -34.282  13.524  0.00  0.00              
HETATM 1654  H6o GLB A   6      23.392 -34.911  18.232  0.00  0.00              
HETATM 1655  O4h GLB A   6      26.909 -35.620  17.605  0.00  0.00              
HETATM 1656  H4o GLB A   6      27.907 -35.746  18.023  0.00  0.00              
HETATM 1657  H5  GLB A   6      25.151 -37.318  15.313  0.00  0.00              
HETATM 1658  H6S GLB A   6      23.136 -36.767  16.802  0.00  0.00              
HETATM 1659  H6R GLB A   6      24.160 -37.581  17.452  0.00  0.00              
HETATM 1660  H1  GLB A   6      25.916 -35.860  13.522  0.00  0.00              
HETATM 1661  H2  GLB A   6      27.704 -34.360  15.446  0.00  0.00              
HETATM 1662  H3  GLB A   6      27.689 -37.349  14.919  0.00  0.00              
HETATM 1663  H4  GLB A   6      26.677 -37.616  17.155  0.00  0.00              
HETATM 1664  C1  NAN A   7      30.088 -37.732  14.483  0.00  0.00              
HETATM 1665  C2  NAN A   7      29.888 -37.530  16.027  0.00  0.00              
HETATM 1666  C3  NAN A   7      29.269 -38.738  16.784  0.00  0.00              
HETATM 1667  C4  NAN A   7      30.297 -39.870  17.005  0.00  0.00              
HETATM 1668  C5  NAN A   7      31.576 -39.341  17.688  0.00  0.00              
HETATM 1669  C6  NAN A   7      32.162 -38.126  16.913  0.00  0.00              
HETATM 1670  C7  NAN A   7      33.364 -37.456  17.628  0.00  0.00              
HETATM 1671  C8  NAN A   7      34.096 -36.411  16.749  0.00  0.00              
HETATM 1672  C9  NAN A   7      35.301 -35.761  17.440  0.00  0.00              
HETATM 1673  OW  NAN A   7      31.109 -37.118  16.714  0.00  0.00              
HETATM 1674  OM  NAN A   7      29.763 -38.738  13.854  0.00  0.00              
HETATM 1675  O1h NAN A   7      30.674 -36.653  13.885  0.00  0.00              
HETATM 1676  O4h NAN A   7      29.705 -40.870  17.821  0.00  0.00              
HETATM 1677  O7h NAN A   7      32.880 -36.816  18.807  0.00  0.00              
HETATM 1678  O8h NAN A   7      34.605 -37.031  15.577  0.00  0.00              
HETATM 1679  O9h NAN A   7      35.959 -34.868  16.540  0.00  0.00              
HETATM 1680  H6  NAN A   7      32.511 -38.492  15.926  0.00  0.00              
HETATM 1681  H3  NAN A   7      28.902 -38.393  17.769  0.00  0.00              
HETATM 1682  H21 NAN A   7      28.376 -39.109  16.248  0.00  0.00              
HETATM 1683  H4  NAN A   7      30.568 -40.314  16.023  0.00  0.00              
HETATM 1684  H7o NAN A   7      32.018 -36.477  18.549  0.00  0.00              
HETATM 1685  H8o NAN A   7      35.327 -36.450  15.314  0.00  0.00              
HETATM 1686  H4o NAN A   7      28.836 -41.038  17.446  0.00  0.00              
HETATM 1687  H9o NAN A   7      36.623 -34.392  17.049  0.00  0.00              
HETATM 1688  H9R NAN A   7      36.009 -36.539  17.791  0.00  0.00              
HETATM 1689  H9S NAN A   7      34.969 -35.216  18.346  0.00  0.00              
HETATM 1690  H8  NAN A   7      33.382 -35.616  16.453  0.00  0.00              
HETATM 1691  H7  NAN A   7      34.093 -38.241  17.912  0.00  0.00              
HETATM 1692  H1o NAN A   7      30.786 -36.860  12.957  0.00  0.00              
HETATM 1693  H5  NAN A   7      31.327 -39.023  18.720  0.00  0.00              
HETATM 1694  N33 NAN A   7      32.528 -40.428  17.743  0.00  0.00              
HETATM 1695  C34 NAN A   7      32.608 -41.214  18.863  0.00  0.00              
HETATM 1696  C35 NAN A   7      33.656 -42.308  18.777  0.00  0.00              
HETATM 1697  OM  NAN A   7      31.916 -41.069  19.853  0.00  0.00              
HETATM 1698  H37 NAN A   7      33.148 -40.609  16.940  0.00  0.00              
HETATM 1699  H35 NAN A   7      33.670 -42.919  19.708  0.00  0.00              
HETATM 1700  H39 NAN A   7      34.668 -41.861  18.643  0.00  0.00              
HETATM 1701  H40 NAN A   7      33.440 -42.986  17.921  0.00  0.00              
HETATM 1702  C1  NAG A   8      17.847 -32.239   7.851  0.00  0.00              
HETATM 1703  C2  NAG A   8      16.731 -32.132   6.763  0.00  0.00              
HETATM 1704  C3  NAG A   8      15.858 -33.425   6.775  0.00  0.00              
HETATM 1705  C4  NAG A   8      16.723 -34.697   6.664  0.00  0.00              
HETATM 1706  C5  NAG A   8      17.820 -34.716   7.763  0.00  0.00              
HETATM 1707  C6  NAG A   8      18.775 -35.917   7.628  0.00  0.00              
HETATM 1708  C7  NAG A   8      15.509 -30.109   6.029  0.00  0.00              
HETATM 1709  C8  NAG A   8      14.557 -29.003   6.434  0.00  0.00              
HETATM 1710  O3h NAG A   8      14.919 -33.446   5.698  0.00  0.00              
HETATM 1711  OR  NAG A   8      15.858 -35.823   6.774  0.00  0.00              
HETATM 1712  OR  NAG A   8      18.595 -33.478   7.709  0.00  0.00              
HETATM 1713  O6h NAG A   8      19.474 -35.901   6.382  0.00  0.00              
HETATM 1714  OM  NAG A   8      15.857 -30.226   4.860  0.00  0.00              
HETATM 1715  N15 NAG A   8      15.872 -30.940   7.003  0.00  0.00              
HETATM 1716  H2  NAG A   8      17.246 -32.072   5.780  0.00  0.00              
HETATM 1717  H3  NAG A   8      15.299 -33.472   7.732  0.00  0.00              
HETATM 1718  H4  NAG A   8      17.218 -34.711   5.671  0.00  0.00              
HETATM 1719  H5  NAG A   8      17.326 -34.790   8.752  0.00  0.00              
HETATM 1720  H6S NAG A   8      19.498 -35.911   8.466  0.00  0.00              
HETATM 1721  H6R NAG A   8      18.198 -36.857   7.726  0.00  0.00              
HETATM 1722  H8  NAG A   8      14.817 -28.071   5.902  0.00  0.00              
HETATM 1723  H24 NAG A   8      14.561 -28.783   7.516  0.00  0.00              
HETATM 1724  H25 NAG A   8      13.529 -29.276   6.139  0.00  0.00              
HETATM 1725  H3o NAG A   8      14.306 -32.721   5.856  0.00  0.00              
HETATM 1726  H6o NAG A   8      19.844 -36.778   6.246  0.00  0.00              
HETATM 1727  H29 NAG A   8      15.618 -30.615   7.937  0.00  0.00              
HETATM 1728  H1  NAG A   8      17.410 -32.187   8.869  0.00  0.00              
HETATM 1729  C1  GLB A   9      15.890 -36.743   5.742  0.00  0.00              
HETATM 1730  C2  GLB A   9      15.118 -37.983   6.185  0.00  0.00              
HETATM 1731  C3  GLB A   9      14.877 -38.946   5.035  0.00  0.00              
HETATM 1732  C4  GLB A   9      14.279 -38.220   3.852  0.00  0.00              
HETATM 1733  C5  GLB A   9      15.153 -37.020   3.485  0.00  0.00              
HETATM 1734  C6  GLB A   9      14.646 -36.193   2.325  0.00  0.00              
HETATM 1735  O2h GLB A   9      15.859 -38.633   7.211  0.00  0.00              
HETATM 1736  OW  GLB A   9      13.966 -39.962   5.471  0.00  0.00              
HETATM 1737  OR  GLB A   9      15.204 -36.153   4.631  0.00  0.00              
HETATM 1738  O6h GLB A   9      13.349 -35.671   2.572  0.00  0.00              
HETATM 1739  H2o GLB A   9      15.531 -38.440   8.168  0.00  0.00              
HETATM 1740  H6o GLB A   9      13.021 -34.631   2.546  0.00  0.00              
HETATM 1741  O4h GLB A   9      12.968 -37.847   4.255  0.00  0.00              
HETATM 1742  H4o GLB A   9      12.398 -38.741   4.511  0.00  0.00              
HETATM 1743  H5  GLB A   9      16.112 -37.356   3.205  0.00  0.00              
HETATM 1744  H6S GLB A   9      15.090 -35.475   1.793  0.00  0.00              
HETATM 1745  H6R GLB A   9      14.584 -36.807   1.474  0.00  0.00              
HETATM 1746  H1  GLB A   9      16.910 -37.024   5.480  0.00  0.00              
HETATM 1747  H2  GLB A   9      14.161 -37.644   6.582  0.00  0.00              
HETATM 1748  H3  GLB A   9      15.828 -39.393   4.746  0.00  0.00              
HETATM 1749  H4  GLB A   9      14.224 -38.835   2.954  0.00  0.00              
HETATM 1750  C1  NAN A  10      15.759 -41.525   5.985  0.00  0.00              
HETATM 1751  C2  NAN A  10      14.368 -41.309   5.288  0.00  0.00              
HETATM 1752  C3  NAN A  10      14.344 -41.565   3.755  0.00  0.00              
HETATM 1753  C4  NAN A  10      14.344 -43.074   3.421  0.00  0.00              
HETATM 1754  C5  NAN A  10      13.206 -43.812   4.159  0.00  0.00              
HETATM 1755  C6  NAN A  10      13.253 -43.524   5.687  0.00  0.00              
HETATM 1756  C7  NAN A  10      12.051 -44.117   6.468  0.00  0.00              
HETATM 1757  C8  NAN A  10      12.220 -44.044   8.005  0.00  0.00              
HETATM 1758  C9  NAN A  10      11.045 -44.651   8.783  0.00  0.00              
HETATM 1759  OW  NAN A  10      13.290 -42.070   5.912  0.00  0.00              
HETATM 1760  OM  NAN A  10      16.799 -41.839   5.407  0.00  0.00              
HETATM 1761  O1h NAN A  10      15.703 -41.326   7.335  0.00  0.00              
HETATM 1762  O4h NAN A  10      14.177 -43.230   2.019  0.00  0.00              
HETATM 1763  O7h NAN A  10      10.878 -43.397   6.091  0.00  0.00              
HETATM 1764  O8h NAN A  10      13.372 -44.773   8.404  0.00  0.00              
HETATM 1765  O9h NAN A  10      11.313 -44.607  10.186  0.00  0.00              
HETATM 1766  H6  NAN A  10      14.180 -43.981   6.088  0.00  0.00              
HETATM 1767  H3  NAN A  10      13.431 -41.106   3.330  0.00  0.00              
HETATM 1768  H21 NAN A  10      15.190 -41.048   3.267  0.00  0.00              
HETATM 1769  H4  NAN A  10      15.317 -43.514   3.722  0.00  0.00              
HETATM 1770  H7o NAN A  10      11.187 -42.492   5.982  0.00  0.00              
HETATM 1771  H8o NAN A  10      13.186 -44.994   9.322  0.00  0.00              
HETATM 1772  H4o NAN A  10      14.794 -42.617   1.609  0.00  0.00              
HETATM 1773  H9o NAN A  10      10.505 -44.877  10.636  0.00  0.00              
HETATM 1774  H9R NAN A  10      10.870 -45.696   8.461  0.00  0.00              
HETATM 1775  H9S NAN A  10      10.113 -44.097   8.554  0.00  0.00              
HETATM 1776  H8  NAN A  10      12.342 -42.986   8.309  0.00  0.00              
HETATM 1777  H7  NAN A  10      11.931 -45.181   6.181  0.00  0.00              
HETATM 1778  H1o NAN A  10      16.575 -41.502   7.690  0.00  0.00              
HETATM 1779  H5  NAN A  10      12.234 -43.465   3.757  0.00  0.00              
HETATM 1780  N33 NAN A  10      13.353 -45.226   3.894  0.00  0.00              
HETATM 1781  C34 NAN A  10      12.663 -45.805   2.861  0.00  0.00              
HETATM 1782  C35 NAN A  10      12.911 -47.293   2.710  0.00  0.00              
HETATM 1783  OM  NAN A  10      11.908 -45.205   2.119  0.00  0.00              
HETATM 1784  H37 NAN A  10      13.975 -45.797   4.482  0.00  0.00              
HETATM 1785  H35 NAN A  10      12.334 -47.708   1.851  0.00  0.00              
HETATM 1786  H39 NAN A  10      12.594 -47.833   3.631  0.00  0.00              
HETATM 1787  H40 NAN A  10      13.992 -47.489   2.526  0.00  0.00              
HETATM 1788  C1  MAN A  11      25.478 -22.335  11.518  0.00  0.00              
HETATM 1789  C2  MAN A  11      26.949 -22.727  11.412  0.00  0.00              
HETATM 1790  C3  MAN A  11      27.424 -23.493  12.636  0.00  0.00              
HETATM 1791  C4  MAN A  11      27.058 -22.749  13.900  0.00  0.00              
HETATM 1792  C5  MAN A  11      25.561 -22.437  13.905  0.00  0.00              
HETATM 1793  C6  MAN A  11      25.074 -21.671  15.114  0.00  0.00              
HETATM 1794  O3h MAN A  11      28.848 -23.630  12.567  0.00  0.00              
HETATM 1795  O4h MAN A  11      27.354 -23.525  15.051  0.00  0.00              
HETATM 1796  OR  MAN A  11      25.283 -21.628  12.750  0.00  0.00              
HETATM 1797  OW  MAN A  11      24.040 -22.361  15.797  0.00  0.00              
HETATM 1798  H3o MAN A  11      28.984 -24.694  12.374  0.00  0.00              
HETATM 1799  H4o MAN A  11      28.330 -23.242  15.443  0.00  0.00              
HETATM 1800  OW  MAN A  11      27.726 -21.546  11.258  0.00  0.00              
HETATM 1801  H5  MAN A  11      25.016 -23.340  13.892  0.00  0.00              
HETATM 1802  H6  MAN A  11      25.579 -21.219  15.846  0.00  0.00              
HETATM 1803  H20 MAN A  11      24.683 -20.749  14.793  0.00  0.00              
HETATM 1804  H1  MAN A  11      25.203 -21.720  10.661  0.00  0.00              
HETATM 1805  H2  MAN A  11      27.051 -23.356  10.528  0.00  0.00              
HETATM 1806  H3  MAN A  11      26.951 -24.475  12.642  0.00  0.00              
HETATM 1807  H4  MAN A  11      27.641 -21.829  13.924  0.00  0.00              
HETATM 1808  C1  NAG A  12      27.890 -21.052   9.937  0.00  0.00              
HETATM 1809  C2  NAG A  12      27.853 -19.489   9.925  0.00  0.00              
HETATM 1810  C3  NAG A  12      28.299 -18.964   8.525  0.00  0.00              
HETATM 1811  C4  NAG A  12      29.654 -19.563   8.097  0.00  0.00              
HETATM 1812  C5  NAG A  12      29.616 -21.114   8.160  0.00  0.00              
HETATM 1813  C6  NAG A  12      30.979 -21.756   7.841  0.00  0.00              
HETATM 1814  C7  NAG A  12      26.264 -17.994  11.093  0.00  0.00              
HETATM 1815  C8  NAG A  12      24.822 -17.553  11.224  0.00  0.00              
HETATM 1816  O3h NAG A  12      28.430 -17.541   8.505  0.00  0.00              
HETATM 1817  OR  NAG A  12      29.936 -19.103   6.779  0.00  0.00              
HETATM 1818  OR  NAG A  12      29.181 -21.545   9.487  0.00  0.00              
HETATM 1819  O6h NAG A  12      31.985 -21.353   8.774  0.00  0.00              
HETATM 1820  OM  NAG A  12      27.146 -17.410  11.712  0.00  0.00              
HETATM 1821  N15 NAG A  12      26.485 -18.991  10.239  0.00  0.00              
HETATM 1822  H2  NAG A  12      28.595 -19.144  10.676  0.00  0.00              
HETATM 1823  H3  NAG A  12      27.539 -19.258   7.772  0.00  0.00              
HETATM 1824  H4  NAG A  12      30.442 -19.201   8.789  0.00  0.00              
HETATM 1825  H5  NAG A  12      28.889 -21.479   7.406  0.00  0.00              
HETATM 1826  H6S NAG A  12      30.880 -22.858   7.845  0.00  0.00              
HETATM 1827  H6R NAG A  12      31.284 -21.477   6.814  0.00  0.00              
HETATM 1828  H8  NAG A  12      24.600 -17.300  12.275  0.00  0.00              
HETATM 1829  H24 NAG A  12      24.090 -18.315  10.901  0.00  0.00              
HETATM 1830  H25 NAG A  12      24.660 -16.641  10.624  0.00  0.00              
HETATM 1831  H3o NAG A  12      27.547 -17.183   8.644  0.00  0.00              
HETATM 1832  H6o NAG A  12      32.839 -21.567   8.388  0.00  0.00              
HETATM 1833  H29 NAG A  12      25.635 -19.461   9.927  0.00  0.00              
HETATM 1834  H1  NAG A  12      27.090 -21.469   9.294  0.00  0.00              
HETATM 1835  C1  GLB A  13      31.137 -18.443   6.587  0.00  0.00              
HETATM 1836  C2  GLB A  13      31.364 -18.293   5.086  0.00  0.00              
HETATM 1837  C3  GLB A  13      32.522 -17.361   4.775  0.00  0.00              
HETATM 1838  C4  GLB A  13      32.369 -16.057   5.524  0.00  0.00              
HETATM 1839  C5  GLB A  13      32.178 -16.335   7.015  0.00  0.00              
HETATM 1840  C6  GLB A  13      31.989 -15.104   7.875  0.00  0.00              
HETATM 1841  O2h GLB A  13      31.620 -19.579   4.538  0.00  0.00              
HETATM 1842  OW  GLB A  13      32.532 -17.094   3.367  0.00  0.00              
HETATM 1843  OR  GLB A  13      30.994 -17.137   7.160  0.00  0.00              
HETATM 1844  O6h GLB A  13      30.859 -14.344   7.472  0.00  0.00              
HETATM 1845  H2o GLB A  13      30.810 -20.022   4.080  0.00  0.00              
HETATM 1846  H6o GLB A  13      30.003 -14.036   8.071  0.00  0.00              
HETATM 1847  O4h GLB A  13      31.250 -15.406   4.935  0.00  0.00              
HETATM 1848  H4o GLB A  13      31.441 -15.243   3.874  0.00  0.00              
HETATM 1849  H5  GLB A  13      33.032 -16.825   7.392  0.00  0.00              
HETATM 1850  H6S GLB A  13      32.005 -14.994   8.866  0.00  0.00              
HETATM 1851  H6R GLB A  13      32.837 -14.491   7.776  0.00  0.00              
HETATM 1852  H1  GLB A  13      31.973 -18.985   7.030  0.00  0.00              
HETATM 1853  H2  GLB A  13      30.446 -17.888   4.659  0.00  0.00              
HETATM 1854  H3  GLB A  13      33.452 -17.844   5.074  0.00  0.00              
HETATM 1855  H4  GLB A  13      33.245 -15.413   5.449  0.00  0.00              
HETATM 1856  C1  NAN A  14      34.206 -18.805   2.929  0.00  0.00              
HETATM 1857  C2  NAN A  14      33.749 -17.324   2.678  0.00  0.00              
HETATM 1858  C3  NAN A  14      34.738 -16.228   3.166  0.00  0.00              
HETATM 1859  C4  NAN A  14      35.948 -16.078   2.216  0.00  0.00              
HETATM 1860  C5  NAN A  14      35.494 -15.853   0.757  0.00  0.00              
HETATM 1861  C6  NAN A  14      34.496 -16.959   0.307  0.00  0.00              
HETATM 1862  C7  NAN A  14      33.887 -16.711  -1.098  0.00  0.00              
HETATM 1863  C8  NAN A  14      33.092 -17.922  -1.646  0.00  0.00              
HETATM 1864  C9  NAN A  14      32.508 -17.692  -3.046  0.00  0.00              
HETATM 1865  OW  NAN A  14      33.400 -17.059   1.284  0.00  0.00              
HETATM 1866  OM  NAN A  14      35.245 -19.138   3.498  0.00  0.00              
HETATM 1867  O1h NAN A  14      33.316 -19.717   2.440  0.00  0.00              
HETATM 1868  O4h NAN A  14      36.727 -14.971   2.644  0.00  0.00              
HETATM 1869  O7h NAN A  14      33.020 -15.582  -1.013  0.00  0.00              
HETATM 1870  O8h NAN A  14      33.943 -19.053  -1.758  0.00  0.00              
HETATM 1871  O9h NAN A  14      31.854 -18.877  -3.503  0.00  0.00              
HETATM 1872  H6  NAN A  14      35.049 -17.920   0.276  0.00  0.00              
HETATM 1873  H3  NAN A  14      34.202 -15.261   3.216  0.00  0.00              
HETATM 1874  H21 NAN A  14      35.065 -16.441   4.199  0.00  0.00              
HETATM 1875  H4  NAN A  14      36.566 -16.999   2.265  0.00  0.00              
HETATM 1876  H7o NAN A  14      32.614 -15.666  -0.146  0.00  0.00              
HETATM 1877  H8o NAN A  14      33.508 -19.592  -2.426  0.00  0.00              
HETATM 1878  H4o NAN A  14      36.835 -15.073   3.594  0.00  0.00              
HETATM 1879  H9o NAN A  14      31.398 -18.650  -4.320  0.00  0.00              
HETATM 1880  H9R NAN A  14      33.309 -17.401  -3.754  0.00  0.00              
HETATM 1881  H9S NAN A  14      31.794 -16.846  -3.022  0.00  0.00              
HETATM 1882  H8  NAN A  14      32.265 -18.162  -0.948  0.00  0.00              
HETATM 1883  H7  NAN A  14      34.709 -16.485  -1.807  0.00  0.00              
HETATM 1884  H1o NAN A  14      33.675 -20.591   2.605  0.00  0.00              
HETATM 1885  H5  NAN A  14      34.993 -14.867   0.686  0.00  0.00              
HETATM 1886  N33 NAN A  14      36.673 -15.849  -0.077  0.00  0.00              
HETATM 1887  C34 NAN A  14      37.286 -14.664  -0.394  0.00  0.00              
HETATM 1888  C35 NAN A  14      38.506 -14.817  -1.282  0.00  0.00              
HETATM 1889  OM  NAN A  14      36.903 -13.573  -0.016  0.00  0.00              
HETATM 1890  H37 NAN A  14      37.054 -16.738  -0.433  0.00  0.00              
HETATM 1891  H35 NAN A  14      38.967 -13.827  -1.498  0.00  0.00              
HETATM 1892  H39 NAN A  14      38.221 -15.285  -2.251  0.00  0.00              
HETATM 1893  H40 NAN A  14      39.272 -15.452  -0.781  0.00  0.00              
HETATM 1894  C1  NAG A  15      23.209 -21.594  16.656  0.00  0.00              
HETATM 1895  C2  NAG A  15      21.938 -22.405  17.065  0.00  0.00              
HETATM 1896  C3  NAG A  15      21.182 -21.657  18.208  0.00  0.00              
HETATM 1897  C4  NAG A  15      22.119 -21.323  19.386  0.00  0.00              
HETATM 1898  C5  NAG A  15      23.367 -20.540  18.894  0.00  0.00              
HETATM 1899  C6  NAG A  15      24.384 -20.273  20.020  0.00  0.00              
HETATM 1900  C7  NAG A  15      20.462 -23.758  15.612  0.00  0.00              
HETATM 1901  C8  NAG A  15      19.497 -23.746  14.445  0.00  0.00              
HETATM 1902  O3h NAG A  15      20.095 -22.429  18.725  0.00  0.00              
HETATM 1903  OR  NAG A  15      21.372 -20.567  20.334  0.00  0.00              
HETATM 1904  OR  NAG A  15      24.024 -21.281  17.819  0.00  0.00              
HETATM 1905  O6h NAG A  15      24.883 -21.490  20.581  0.00  0.00              
HETATM 1906  OM  NAG A  15      20.638 -24.786  16.255  0.00  0.00              
HETATM 1907  N15 NAG A  15      21.032 -22.590  15.898  0.00  0.00              
HETATM 1908  H2  NAG A  15      22.292 -23.378  17.465  0.00  0.00              
HETATM 1909  H3  NAG A  15      20.779 -20.704  17.808  0.00  0.00              
HETATM 1910  H4  NAG A  15      22.459 -22.268  19.856  0.00  0.00              
HETATM 1911  H5  NAG A  15      23.035 -19.557  18.503  0.00  0.00              
HETATM 1912  H6S NAG A  15      25.221 -19.667  19.627  0.00  0.00              
HETATM 1913  H6R NAG A  15      23.904 -19.663  20.809  0.00  0.00              
HETATM 1914  H8  NAG A  15      19.598 -24.678  13.864  0.00  0.00              
HETATM 1915  H24 NAG A  15      19.646 -22.900  13.750  0.00  0.00              
HETATM 1916  H25 NAG A  15      18.461 -23.704  14.824  0.00  0.00              
HETATM 1917  H3o NAG A  15      19.458 -22.515  18.010  0.00  0.00              
HETATM 1918  H6o NAG A  15      25.298 -21.271  21.420  0.00  0.00              
HETATM 1919  H29 NAG A  15      20.897 -21.879  15.178  0.00  0.00              
HETATM 1920  H1  NAG A  15      22.928 -20.654  16.141  0.00  0.00              
HETATM 1921  C1  GLB A  16      21.322 -21.055  21.628  0.00  0.00              
HETATM 1922  C2  GLB A  16      20.727 -19.972  22.523  0.00  0.00              
HETATM 1923  C3  GLB A  16      20.393 -20.498  23.909  0.00  0.00              
HETATM 1924  C4  GLB A  16      19.569 -21.761  23.812  0.00  0.00              
HETATM 1925  C5  GLB A  16      20.278 -22.777  22.916  0.00  0.00              
HETATM 1926  C6  GLB A  16      19.538 -24.081  22.719  0.00  0.00              
HETATM 1927  O2h GLB A  16      21.663 -18.907  22.625  0.00  0.00              
HETATM 1928  OW  GLB A  16      19.643 -19.500  24.610  0.00  0.00              
HETATM 1929  OR  GLB A  16      20.432 -22.179  21.618  0.00  0.00              
HETATM 1930  O6h GLB A  16      18.257 -23.882  22.144  0.00  0.00              
HETATM 1931  H2o GLB A  16      21.469 -18.101  22.011  0.00  0.00              
HETATM 1932  H6o GLB A  16      17.847 -24.322  21.235  0.00  0.00              
HETATM 1933  O4h GLB A  16      18.307 -21.355  23.296  0.00  0.00              
HETATM 1934  H4o GLB A  16      17.855 -20.629  23.972  0.00  0.00              
HETATM 1935  H5  GLB A  16      21.208 -23.031  23.342  0.00  0.00              
HETATM 1936  H6S GLB A  16      19.839 -24.948  22.328  0.00  0.00              
HETATM 1937  H6R GLB A  16      19.399 -24.534  23.658  0.00  0.00              
HETATM 1938  H1  GLB A  16      22.310 -21.330  21.997  0.00  0.00              
HETATM 1939  H2  GLB A  16      19.817 -19.617  22.040  0.00  0.00              
HETATM 1940  H3  GLB A  16      21.323 -20.711  24.437  0.00  0.00              
HETATM 1941  H4  GLB A  16      19.427 -22.256  24.773  0.00  0.00              
HETATM 1942  C1  NAG A  17      19.780 -19.464  26.023  0.00  0.00              
HETATM 1943  C2  NAG A  17      20.807 -18.367  26.450  0.00  0.00              
HETATM 1944  C3  NAG A  17      20.745 -18.162  27.996  0.00  0.00              
HETATM 1945  C4  NAG A  17      19.305 -17.892  28.476  0.00  0.00              
HETATM 1946  C5  NAG A  17      18.344 -19.011  27.992  0.00  0.00              
HETATM 1947  C6  NAG A  17      16.874 -18.733  28.359  0.00  0.00              
HETATM 1948  C7  NAG A  17      23.031 -17.900  25.470  0.00  0.00              
HETATM 1949  C8  NAG A  17      24.426 -18.431  25.212  0.00  0.00              
HETATM 1950  O3h NAG A  17      21.555 -17.063  28.422  0.00  0.00              
HETATM 1951  OR  NAG A  17      19.331 -17.808  29.898  0.00  0.00              
HETATM 1952  OR  NAG A  17      18.455 -19.165  26.542  0.00  0.00              
HETATM 1953  O6h NAG A  17      16.398 -17.525  27.760  0.00  0.00              
HETATM 1954  OM  NAG A  17      22.755 -16.738  25.196  0.00  0.00              
HETATM 1955  N15 NAG A  17      22.189 -18.753  26.047  0.00  0.00              
HETATM 1956  H2  NAG A  17      20.491 -17.422  25.963  0.00  0.00              
HETATM 1957  H3  NAG A  17      21.109 -19.082  28.495  0.00  0.00              
HETATM 1958  H4  NAG A  17      18.961 -16.925  28.057  0.00  0.00              
HETATM 1959  H5  NAG A  17      18.637 -19.962  28.478  0.00  0.00              
HETATM 1960  H6S NAG A  17      16.244 -19.585  28.040  0.00  0.00              
HETATM 1961  H6R NAG A  17      16.777 -18.672  29.460  0.00  0.00              
HETATM 1962  H8  NAG A  17      24.801 -18.051  24.246  0.00  0.00              
HETATM 1963  H24 NAG A  17      24.485 -19.534  25.184  0.00  0.00              
HETATM 1964  H25 NAG A  17      25.110 -18.067  25.998  0.00  0.00              
HETATM 1965  H3o NAG A  17      22.467 -17.306  28.232  0.00  0.00              
HETATM 1966  H6o NAG A  17      15.590 -17.275  28.218  0.00  0.00              
HETATM 1967  H29 NAG A  17      22.528 -19.716  26.067  0.00  0.00              
HETATM 1968  H1  NAG A  17      20.100 -20.463  26.380  0.00  0.00              
HETATM 1969  C1  GLB A  18      18.823 -16.654  30.468  0.00  0.00              
HETATM 1970  C2  GLB A  18      18.685 -16.885  31.969  0.00  0.00              
HETATM 1971  C3  GLB A  18      18.380 -15.599  32.719  0.00  0.00              
HETATM 1972  C4  GLB A  18      19.363 -14.516  32.335  0.00  0.00              
HETATM 1973  C5  GLB A  18      19.392 -14.358  30.814  0.00  0.00              
HETATM 1974  C6  GLB A  18      20.361 -13.316  30.300  0.00  0.00              
HETATM 1975  O2h GLB A  18      17.642 -17.826  32.186  0.00  0.00              
HETATM 1976  OW  GLB A  18      18.486 -15.851  34.125  0.00  0.00              
HETATM 1977  OR  GLB A  18      19.793 -15.619  30.253  0.00  0.00              
HETATM 1978  O6h GLB A  18      21.696 -13.595  30.689  0.00  0.00              
HETATM 1979  H2o GLB A  18      17.961 -18.792  32.359  0.00  0.00              
HETATM 1980  H6o GLB A  18      22.576 -13.712  30.055  0.00  0.00              
HETATM 1981  O4h GLB A  18      20.614 -14.928  32.872  0.00  0.00              
HETATM 1982  H4o GLB A  18      20.528 -15.031  33.954  0.00  0.00              
HETATM 1983  H5  GLB A  18      18.439 -14.063  30.475  0.00  0.00              
HETATM 1984  H6S GLB A  18      20.459 -12.910  29.394  0.00  0.00              
HETATM 1985  H6R GLB A  18      20.099 -12.383  30.708  0.00  0.00              
HETATM 1986  H1  GLB A  18      17.853 -16.386  30.050  0.00  0.00              
HETATM 1987  H2  GLB A  18      19.631 -17.297  32.323  0.00  0.00              
HETATM 1988  H3  GLB A  18      17.369 -15.278  32.469  0.00  0.00              
HETATM 1989  H4  GLB A  18      19.100 -13.536  32.733  0.00  0.00              
HETATM 1990  C1  NAN A  19      16.088 -16.187  34.372  0.00  0.00              
HETATM 1991  C2  NAN A  19      17.378 -15.485  34.929  0.00  0.00              
HETATM 1992  C3  NAN A  19      17.340 -13.931  34.937  0.00  0.00              
HETATM 1993  C4  NAN A  19      16.470 -13.380  36.088  0.00  0.00              
HETATM 1994  C5  NAN A  19      16.904 -13.963  37.450  0.00  0.00              
HETATM 1995  C6  NAN A  19      16.942 -15.519  37.404  0.00  0.00              
HETATM 1996  C7  NAN A  19      17.510 -16.164  38.694  0.00  0.00              
HETATM 1997  C8  NAN A  19      17.323 -17.700  38.746  0.00  0.00              
HETATM 1998  C9  NAN A  19      17.862 -18.343  40.031  0.00  0.00              
HETATM 1999  OW  NAN A  19      17.758 -15.955  36.259  0.00  0.00              
HETATM 2000  OM  NAN A  19      15.102 -15.603  33.925  0.00  0.00              
HETATM 2001  O1h NAN A  19      16.167 -17.549  34.432  0.00  0.00              
HETATM 2002  O4h NAN A  19      16.599 -11.965  36.119  0.00  0.00              
HETATM 2003  O7h NAN A  19      18.903 -15.860  38.767  0.00  0.00              
HETATM 2004  O8h NAN A  19      15.941 -18.024  38.696  0.00  0.00              
HETATM 2005  O9h NAN A  19      17.585 -19.744  40.030  0.00  0.00              
HETATM 2006  H6  NAN A  19      15.901 -15.877  37.271  0.00  0.00              
HETATM 2007  H3  NAN A  19      18.373 -13.550  35.056  0.00  0.00              
HETATM 2008  H21 NAN A  19      16.995 -13.552  33.958  0.00  0.00              
HETATM 2009  H4  NAN A  19      15.409 -13.644  35.902  0.00  0.00              
HETATM 2010  H7o NAN A  19      19.195 -15.895  37.851  0.00  0.00              
HETATM 2011  H8o NAN A  19      15.902 -18.894  39.108  0.00  0.00              
HETATM 2012  H4o NAN A  19      16.490 -11.669  35.211  0.00  0.00              
HETATM 2013  H9o NAN A  19      18.047 -20.124  40.785  0.00  0.00              
HETATM 2014  H9R NAN A  19      17.404 -17.865  40.921  0.00  0.00              
HETATM 2015  H9S NAN A  19      18.952 -18.167  40.114  0.00  0.00              
HETATM 2016  H8  NAN A  19      17.832 -18.161  37.876  0.00  0.00              
HETATM 2017  H7  NAN A  19      16.996 -15.721  39.569  0.00  0.00              
HETATM 2018  H1o NAN A  19      15.340 -17.903  34.103  0.00  0.00              
HETATM 2019  H5  NAN A  19      17.916 -13.586  37.697  0.00  0.00              
HETATM 2020  N33 NAN A  19      15.967 -13.499  38.448  0.00  0.00              
HETATM 2021  C34 NAN A  19      16.243 -12.370  39.175  0.00  0.00              
HETATM 2022  C35 NAN A  19      15.173 -12.010  40.188  0.00  0.00              
HETATM 2023  OM  NAN A  19      17.250 -11.701  39.045  0.00  0.00              
HETATM 2024  H37 NAN A  19      15.092 -14.017  38.613  0.00  0.00              
HETATM 2025  H35 NAN A  19      15.445 -11.082  40.741  0.00  0.00              
HETATM 2026  H39 NAN A  19      15.052 -12.832  40.930  0.00  0.00              
HETATM 2027  H40 NAN A  19      14.200 -11.834  39.677  0.00  0.00              
HETATM 2028  C1  AFL A  20      17.711 -16.864   3.880  0.00  0.00              
HETATM 2029  C2  AFL A  20      18.817 -15.955   3.314  0.00  0.00              
HETATM 2030  C3  AFL A  20      20.204 -16.543   3.612  0.00  0.00              
HETATM 2031  C4  AFL A  20      20.259 -17.997   3.116  0.00  0.00              
HETATM 2032  C5  AFL A  20      19.095 -18.796   3.723  0.00  0.00              
HETATM 2033  C6  AFL A  20      19.038 -20.255   3.250  0.00  0.00              
HETATM 2034  OR  AFL A  20      17.832 -18.205   3.397  0.00  0.00              
HETATM 2035  O2h AFL A  20      18.617 -14.643   3.834  0.00  0.00              
HETATM 2036  O3h AFL A  20      21.204 -15.710   3.032  0.00  0.00              
HETATM 2037  O4h AFL A  20      20.160 -18.076   1.694  0.00  0.00              
HETATM 2038  H5  AFL A  20      19.227 -18.816   4.822  0.00  0.00              
HETATM 2039  H1  AFL A  20      16.732 -16.515   3.527  0.00  0.00              
HETATM 2040  H2  AFL A  20      18.691 -15.920   2.215  0.00  0.00              
HETATM 2041  H2o AFL A  20      19.228 -14.065   3.358  0.00  0.00              
HETATM 2042  H3  AFL A  20      20.345 -16.542   4.710  0.00  0.00              
HETATM 2043  H3o AFL A  20      22.048 -15.997   3.404  0.00  0.00              
HETATM 2044  H4  AFL A  20      21.212 -18.467   3.426  0.00  0.00              
HETATM 2045  H4o AFL A  20      20.956 -17.656   1.340  0.00  0.00              
HETATM 2046  H6  AFL A  20      19.982 -20.789   3.446  0.00  0.00              
HETATM 2047  H22 AFL A  20      18.229 -20.788   3.772  0.00  0.00              
HETATM 2048  H23 AFL A  20      18.830 -20.307   2.170  0.00  0.00              
HETATM 2049  C1  NAG B   1      -3.924  11.082 -11.939  0.00  0.00              
HETATM 2050  C2  NAG B   1      -3.205  11.893 -13.065  0.00  0.00              
HETATM 2051  C3  NAG B   1      -3.183  13.407 -12.689  0.00  0.00              
HETATM 2052  C4  NAG B   1      -4.591  13.930 -12.342  0.00  0.00              
HETATM 2053  C5  NAG B   1      -5.245  13.058 -11.235  0.00  0.00              
HETATM 2054  C6  NAG B   1      -6.695  13.477 -10.927  0.00  0.00              
HETATM 2055  C7  NAG B   1      -1.296  11.184 -14.471  0.00  0.00              
HETATM 2056  C8  NAG B   1       0.161  10.774 -14.493  0.00  0.00              
HETATM 2057  O3h NAG B   1      -2.672  14.215 -13.754  0.00  0.00              
HETATM 2058  OR  NAG B   1      -4.461  15.285 -11.926  0.00  0.00              
HETATM 2059  OR  NAG B   1      -5.226  11.653 -11.638  0.00  0.00              
HETATM 2060  O6h NAG B   1      -7.538  13.349 -12.075  0.00  0.00              
HETATM 2061  OM  NAG B   1      -1.908  11.344 -15.521  0.00  0.00              
HETATM 2062  N15 NAG B   1      -1.815  11.401 -13.264  0.00  0.00              
HETATM 2063  H2  NAG B   1      -3.815  11.776 -13.986  0.00  0.00              
HETATM 2064  H3  NAG B   1      -2.534  13.546 -11.800  0.00  0.00              
HETATM 2065  H4  NAG B   1      -5.226  13.884 -13.250  0.00  0.00              
HETATM 2066  H5  NAG B   1      -4.658  13.173 -10.303  0.00  0.00              
HETATM 2067  H6S NAG B   1      -7.090  12.862 -10.097  0.00  0.00              
HETATM 2068  H6R NAG B   1      -6.705  14.525 -10.568  0.00  0.00              
HETATM 2069  H8  NAG B   1       0.327  10.017 -15.279  0.00  0.00              
HETATM 2070  H24 NAG B   1       0.521  10.351 -13.538  0.00  0.00              
HETATM 2071  H25 NAG B   1       0.786  11.650 -14.741  0.00  0.00              
HETATM 2072  H3o NAG B   1      -1.751  13.965 -13.867  0.00  0.00              
HETATM 2073  H6o NAG B   1      -8.339  13.852 -11.902  0.00  0.00              
HETATM 2074  H29 NAG B   1      -1.222  11.076 -12.499  0.00  0.00              
HETATM 2075  H1  NAG B   1      -3.310  11.059 -11.017  0.00  0.00              
HETATM 2076  C1  NAG B   2      -5.234  16.250 -12.625  0.00  0.00              
HETATM 2077  C2  NAG B   2      -5.300  17.590 -11.823  0.00  0.00              
HETATM 2078  C3  NAG B   2      -5.918  18.708 -12.719  0.00  0.00              
HETATM 2079  C4  NAG B   2      -5.186  18.823 -14.071  0.00  0.00              
HETATM 2080  C5  NAG B   2      -5.142  17.449 -14.792  0.00  0.00              
HETATM 2081  C6  NAG B   2      -4.330  17.489 -16.101  0.00  0.00              
HETATM 2082  C7  NAG B   2      -5.728  17.898  -9.405  0.00  0.00              
HETATM 2083  C8  NAG B   2      -6.720  17.724  -8.274  0.00  0.00              
HETATM 2084  O3h NAG B   2      -5.862  19.990 -12.087  0.00  0.00              
HETATM 2085  OR  NAG B   2      -5.869  19.798 -14.853  0.00  0.00              
HETATM 2086  OR  NAG B   2      -4.568  16.442 -13.903  0.00  0.00              
HETATM 2087  O6h NAG B   2      -2.966  17.851 -15.867  0.00  0.00              
HETATM 2088  OM  NAG B   2      -4.671  18.487  -9.211  0.00  0.00              
HETATM 2089  N15 NAG B   2      -6.115  17.425 -10.587  0.00  0.00              
HETATM 2090  H2  NAG B   2      -4.255  17.876 -11.586  0.00  0.00              
HETATM 2091  H3  NAG B   2      -6.980  18.461 -12.921  0.00  0.00              
HETATM 2092  H4  NAG B   2      -4.145  19.162 -13.890  0.00  0.00              
HETATM 2093  H5  NAG B   2      -6.179  17.152 -15.050  0.00  0.00              
HETATM 2094  H6S NAG B   2      -4.379  16.502 -16.598  0.00  0.00              
HETATM 2095  H6R NAG B   2      -4.798  18.211 -16.799  0.00  0.00              
HETATM 2096  H8  NAG B   2      -6.186  17.482  -7.339  0.00  0.00              
HETATM 2097  H24 NAG B   2      -7.464  16.927  -8.450  0.00  0.00              
HETATM 2098  H25 NAG B   2      -7.260  18.672  -8.110  0.00  0.00              
HETATM 2099  H3o NAG B   2      -6.432  19.939 -11.314  0.00  0.00              
HETATM 2100  H6o NAG B   2      -2.588  18.106 -16.713  0.00  0.00              
HETATM 2101  H29 NAG B   2      -6.946  16.835 -10.542  0.00  0.00              
HETATM 2102  H1  NAG B   2      -6.250  15.843 -12.796  0.00  0.00              
HETATM 2103  C1  BMA B   3      -5.119  20.859 -15.329  0.00  0.00              
HETATM 2104  C2  BMA B   3      -5.959  21.615 -16.355  0.00  0.00              
HETATM 2105  C3  BMA B   3      -5.326  22.938 -16.747  0.00  0.00              
HETATM 2106  C4  BMA B   3      -4.964  23.737 -15.515  0.00  0.00              
HETATM 2107  C5  BMA B   3      -4.102  22.888 -14.582  0.00  0.00              
HETATM 2108  C6  BMA B   3      -3.691  23.571 -13.295  0.00  0.00              
HETATM 2109  OW  BMA B   3      -6.266  23.683 -17.530  0.00  0.00              
HETATM 2110  OR  BMA B   3      -4.230  24.902 -15.861  0.00  0.00              
HETATM 2111  OR  BMA B   3      -4.867  21.728 -14.218  0.00  0.00              
HETATM 2112  OW  BMA B   3      -2.282  23.603 -13.139  0.00  0.00              
HETATM 2113  O2h BMA B   3      -7.249  21.848 -15.803  0.00  0.00              
HETATM 2114  H2o BMA B   3      -7.157  22.482 -14.921  0.00  0.00              
HETATM 2115  H5  BMA B   3      -3.205  22.628 -15.072  0.00  0.00              
HETATM 2116  H6  BMA B   3      -3.992  24.432 -12.891  0.00  0.00              
HETATM 2117  H20 BMA B   3      -4.090  23.032 -12.486  0.00  0.00              
HETATM 2118  H2  BMA B   3      -6.044  20.977 -17.235  0.00  0.00              
HETATM 2119  H3  BMA B   3      -4.426  22.739 -17.329  0.00  0.00              
HETATM 2120  H1  BMA B   3      -4.192  20.525 -15.794  0.00  0.00              
HETATM 2121  H4  BMA B   3      -5.893  24.025 -15.023  0.00  0.00              
HETATM 2122  C1  MAN B   4      -5.820  24.165 -18.791  0.00  0.00              
HETATM 2123  C2  MAN B   4      -6.736  25.184 -19.461  0.00  0.00              
HETATM 2124  C3  MAN B   4      -8.053  24.567 -19.896  0.00  0.00              
HETATM 2125  C4  MAN B   4      -7.810  23.311 -20.701  0.00  0.00              
HETATM 2126  C5  MAN B   4      -6.906  22.359 -19.918  0.00  0.00              
HETATM 2127  C6  MAN B   4      -6.568  21.069 -20.631  0.00  0.00              
HETATM 2128  O3h MAN B   4      -8.760  25.515 -20.706  0.00  0.00              
HETATM 2129  O4h MAN B   4      -9.029  22.639 -20.978  0.00  0.00              
HETATM 2130  OR  MAN B   4      -5.666  23.043 -19.669  0.00  0.00              
HETATM 2131  O6h MAN B   4      -5.910  21.303 -21.866  0.00  0.00              
HETATM 2132  H3o MAN B   4      -9.594  25.809 -20.070  0.00  0.00              
HETATM 2133  H4o MAN B   4      -9.388  22.926 -21.968  0.00  0.00              
HETATM 2134  H6o MAN B   4      -4.945  20.923 -22.202  0.00  0.00              
HETATM 2135  OW  MAN B   4      -6.065  25.723 -20.593  0.00  0.00              
HETATM 2136  H5  MAN B   4      -7.386  22.079 -19.021  0.00  0.00              
HETATM 2137  H6S MAN B   4      -6.145  20.231 -20.294  0.00  0.00              
HETATM 2138  H6R MAN B   4      -7.461  20.554 -20.838  0.00  0.00              
HETATM 2139  H1  MAN B   4      -4.858  24.629 -18.571  0.00  0.00              
HETATM 2140  H2  MAN B   4      -6.925  25.974 -18.734  0.00  0.00              
HETATM 2141  H3  MAN B   4      -8.637  24.323 -19.009  0.00  0.00              
HETATM 2142  H4  MAN B   4      -7.336  23.605 -21.638  0.00  0.00              
HETATM 2143  C1  NAG B   5      -5.204  26.829 -20.367  0.00  0.00              
HETATM 2144  C2  NAG B   5      -3.930  26.730 -21.266  0.00  0.00              
HETATM 2145  C3  NAG B   5      -3.136  28.071 -21.202  0.00  0.00              
HETATM 2146  C4  NAG B   5      -4.036  29.282 -21.522  0.00  0.00              
HETATM 2147  C5  NAG B   5      -5.289  29.295 -20.605  0.00  0.00              
HETATM 2148  C6  NAG B   5      -6.271  30.428 -20.957  0.00  0.00              
HETATM 2149  C7  NAG B   5      -2.509  24.747 -21.679  0.00  0.00              
HETATM 2150  C8  NAG B   5      -1.576  23.722 -21.067  0.00  0.00              
HETATM 2151  O3h NAG B   5      -2.043  28.089 -22.125  0.00  0.00              
HETATM 2152  OR  NAG B   5      -3.255  30.461 -21.353  0.00  0.00              
HETATM 2153  OR  NAG B   5      -5.982  28.011 -20.698  0.00  0.00              
HETATM 2154  O6h NAG B   5      -6.767  30.303 -22.293  0.00  0.00              
HETATM 2155  OM  NAG B   5      -2.676  24.779 -22.892  0.00  0.00              
HETATM 2156  N15 NAG B   5      -3.058  25.605 -20.825  0.00  0.00              
HETATM 2157  H2  NAG B   5      -4.282  26.586 -22.309  0.00  0.00              
HETATM 2158  H3  NAG B   5      -2.734  28.202 -20.177  0.00  0.00              
HETATM 2159  H4  NAG B   5      -4.371  29.212 -22.578  0.00  0.00              
HETATM 2160  H5  NAG B   5      -4.958  29.451 -19.560  0.00  0.00              
HETATM 2161  H6S NAG B   5      -7.114  30.424 -20.239  0.00  0.00              
HETATM 2162  H6R NAG B   5      -5.764  31.404 -20.832  0.00  0.00              
HETATM 2163  H8  NAG B   5      -1.703  22.749 -21.573  0.00  0.00              
HETATM 2164  H24 NAG B   5      -1.736  23.561 -19.986  0.00  0.00              
HETATM 2165  H25 NAG B   5      -0.530  24.039 -21.220  0.00  0.00              
HETATM 2166  H3o NAG B   5      -1.426  27.413 -21.830  0.00  0.00              
HETATM 2167  H6o NAG B   5      -7.157  31.148 -22.536  0.00  0.00              
HETATM 2168  H29 NAG B   5      -2.937  25.346 -19.845  0.00  0.00              
HETATM 2169  H1  NAG B   5      -4.928  26.858 -19.295  0.00  0.00              
HETATM 2170  C1  GLB B   6      -3.175  31.321 -22.433  0.00  0.00              
HETATM 2171  C2  GLB B   6      -2.544  32.626 -21.957  0.00  0.00              
HETATM 2172  C3  GLB B   6      -2.177  33.539 -23.114  0.00  0.00              
HETATM 2173  C4  GLB B   6      -1.367  32.787 -24.146  0.00  0.00              
HETATM 2174  C5  GLB B   6      -2.112  31.519 -24.565  0.00  0.00              
HETATM 2175  C6  GLB B   6      -1.391  30.663 -25.583  0.00  0.00              
HETATM 2176  O2h GLB B   6      -3.466  33.285 -21.098  0.00  0.00              
HETATM 2177  O3h GLB B   6      -1.397  34.629 -22.610  0.00  0.00              
HETATM 2178  OR  GLB B   6      -2.296  30.713 -23.389  0.00  0.00              
HETATM 2179  OW  GLB B   6      -2.287  30.078 -26.515  0.00  0.00              
HETATM 2180  H2o GLB B   6      -3.281  33.164 -20.091  0.00  0.00              
HETATM 2181  H3o GLB B   6      -2.071  35.480 -22.708  0.00  0.00              
HETATM 2182  O4h GLB B   6      -0.117  32.515 -23.527  0.00  0.00              
HETATM 2183  H4o GLB B   6       0.361  33.453 -23.244  0.00  0.00              
HETATM 2184  H5  GLB B   6      -3.033  31.783 -25.007  0.00  0.00              
HETATM 2185  H6  GLB B   6      -0.574  30.844 -26.124  0.00  0.00              
HETATM 2186  H20 GLB B   6      -0.901  29.881 -25.078  0.00  0.00              
HETATM 2187  H1  GLB B   6      -4.154  31.527 -22.864  0.00  0.00              
HETATM 2188  H2  GLB B   6      -1.644  32.367 -21.399  0.00  0.00              
HETATM 2189  H3  GLB B   6      -3.094  33.911 -23.572  0.00  0.00              
HETATM 2190  H4  GLB B   6      -1.205  33.355 -25.062  0.00  0.00              
HETATM 2191  C1  NAN B   7      -1.411  27.830 -26.197  0.00  0.00              
HETATM 2192  C2  NAN B   7      -1.826  28.942 -27.225  0.00  0.00              
HETATM 2193  C3  NAN B   7      -0.689  29.446 -28.159  0.00  0.00              
HETATM 2194  C4  NAN B   7      -0.377  28.436 -29.285  0.00  0.00              
HETATM 2195  C5  NAN B   7      -1.653  28.054 -30.067  0.00  0.00              
HETATM 2196  C6  NAN B   7      -2.774  27.567 -29.101  0.00  0.00              
HETATM 2197  C7  NAN B   7      -4.130  27.306 -29.808  0.00  0.00              
HETATM 2198  C8  NAN B   7      -5.166  26.595 -28.904  0.00  0.00              
HETATM 2199  C9  NAN B   7      -6.502  26.313 -29.603  0.00  0.00              
HETATM 2200  OW  NAN B   7      -2.977  28.567 -28.043  0.00  0.00              
HETATM 2201  OM  NAN B   7      -0.276  27.375 -26.066  0.00  0.00              
HETATM 2202  O1h NAN B   7      -2.463  27.402 -25.438  0.00  0.00              
HETATM 2203  O4h NAN B   7       0.563  29.022 -30.175  0.00  0.00              
HETATM 2204  O7h NAN B   7      -4.660  28.563 -30.228  0.00  0.00              
HETATM 2205  O8h NAN B   7      -4.665  25.332 -28.491  0.00  0.00              
HETATM 2206  O9h NAN B   7      -7.371  25.594 -28.725  0.00  0.00              
HETATM 2207  H6  NAN B   7      -2.435  26.613 -28.647  0.00  0.00              
HETATM 2208  H3  NAN B   7      -1.001  30.404 -28.615  0.00  0.00              
HETATM 2209  H21 NAN B   7       0.216  29.676 -27.568  0.00  0.00              
HETATM 2210  H4  NAN B   7       0.064  27.518 -28.842  0.00  0.00              
HETATM 2211  H7o NAN B   7      -4.411  29.167 -29.521  0.00  0.00              
HETATM 2212  H8o NAN B   7      -5.464  24.833 -28.289  0.00  0.00              
HETATM 2213  H4o NAN B   7       1.253  29.396 -29.621  0.00  0.00              
HETATM 2214  H9o NAN B   7      -8.232  25.552 -29.153  0.00  0.00              
HETATM 2215  H9R NAN B   7      -6.335  25.733 -30.532  0.00  0.00              
HETATM 2216  H9S NAN B   7      -6.974  27.265 -29.914  0.00  0.00              
HETATM 2217  H8  NAN B   7      -5.357  27.216 -28.006  0.00  0.00              
HETATM 2218  H7  NAN B   7      -3.951  26.672 -30.698  0.00  0.00              
HETATM 2219  H1o NAN B   7      -2.139  26.711 -24.858  0.00  0.00              
HETATM 2220  H5  NAN B   7      -2.017  28.943 -30.619  0.00  0.00              
HETATM 2221  N33 NAN B   7      -1.299  27.018 -31.012  0.00  0.00              
HETATM 2222  C34 NAN B   7      -0.964  27.352 -32.299  0.00  0.00              
HETATM 2223  C35 NAN B   7      -0.623  26.161 -33.176  0.00  0.00              
HETATM 2224  OM  NAN B   7      -0.939  28.489 -32.729  0.00  0.00              
HETATM 2225  H37 NAN B   7      -1.299  26.031 -30.718  0.00  0.00              
HETATM 2226  H35 NAN B   7      -0.351  26.491 -34.204  0.00  0.00              
HETATM 2227  H39 NAN B   7      -1.498  25.477 -33.253  0.00  0.00              
HETATM 2228  H40 NAN B   7       0.242  25.602 -32.751  0.00  0.00              
HETATM 2229  C1  NAG B   8      -4.766  26.149 -15.444  0.00  0.00              
HETATM 2230  C2  NAG B   8      -3.684  27.273 -15.533  0.00  0.00              
HETATM 2231  C3  NAG B   8      -4.355  28.666 -15.330  0.00  0.00              
HETATM 2232  C4  NAG B   8      -5.549  28.868 -16.286  0.00  0.00              
HETATM 2233  C5  NAG B   8      -6.564  27.701 -16.153  0.00  0.00              
HETATM 2234  C6  NAG B   8      -7.723  27.803 -17.163  0.00  0.00              
HETATM 2235  C7  NAG B   8      -1.328  27.181 -14.782  0.00  0.00              
HETATM 2236  C8  NAG B   8      -0.392  27.033 -13.601  0.00  0.00              
HETATM 2237  O3h NAG B   8      -3.437  29.740 -15.554  0.00  0.00              
HETATM 2238  OR  NAG B   8      -6.151  30.119 -15.970  0.00  0.00              
HETATM 2239  OR  NAG B   8      -5.876  26.425 -16.340  0.00  0.00              
HETATM 2240  O6h NAG B   8      -7.255  27.762 -18.514  0.00  0.00              
HETATM 2241  OM  NAG B   8      -0.880  27.439 -15.894  0.00  0.00              
HETATM 2242  N15 NAG B   8      -2.624  27.068 -14.507  0.00  0.00              
HETATM 2243  H2  NAG B   8      -3.266  27.237 -16.562  0.00  0.00              
HETATM 2244  H3  NAG B   8      -4.731  28.736 -14.289  0.00  0.00              
HETATM 2245  H4  NAG B   8      -5.175  28.894 -17.329  0.00  0.00              
HETATM 2246  H5  NAG B   8      -7.002  27.728 -15.136  0.00  0.00              
HETATM 2247  H6S NAG B   8      -8.442  26.981 -16.986  0.00  0.00              
HETATM 2248  H6R NAG B   8      -8.281  28.743 -16.986  0.00  0.00              
HETATM 2249  H8  NAG B   8       0.515  26.483 -13.906  0.00  0.00              
HETATM 2250  H24 NAG B   8      -0.836  26.498 -12.744  0.00  0.00              
HETATM 2251  H25 NAG B   8      -0.072  28.031 -13.258  0.00  0.00              
HETATM 2252  H3o NAG B   8      -2.769  29.674 -14.865  0.00  0.00              
HETATM 2253  H6o NAG B   8      -7.966  28.081 -19.075  0.00  0.00              
HETATM 2254  H29 NAG B   8      -2.816  26.705 -13.572  0.00  0.00              
HETATM 2255  H1  NAG B   8      -5.145  26.050 -14.407  0.00  0.00              
HETATM 2256  C1  GLB B   9      -6.274  31.035 -17.000  0.00  0.00              
HETATM 2257  C2  GLB B   9      -7.183  32.165 -16.526  0.00  0.00              
HETATM 2258  C3  GLB B   9      -7.175  33.343 -17.486  0.00  0.00              
HETATM 2259  C4  GLB B   9      -5.757  33.761 -17.800  0.00  0.00              
HETATM 2260  C5  GLB B   9      -4.957  32.555 -18.289  0.00  0.00              
HETATM 2261  C6  GLB B   9      -3.507  32.841 -18.616  0.00  0.00              
HETATM 2262  O2h GLB B   9      -8.505  31.659 -16.398  0.00  0.00              
HETATM 2263  OW  GLB B   9      -7.863  34.440 -16.873  0.00  0.00              
HETATM 2264  OR  GLB B   9      -4.968  31.570 -17.243  0.00  0.00              
HETATM 2265  O6h GLB B   9      -2.801  33.348 -17.494  0.00  0.00              
HETATM 2266  H2o GLB B   9      -8.783  31.419 -15.434  0.00  0.00              
HETATM 2267  H6o GLB B   9      -1.892  32.959 -17.034  0.00  0.00              
HETATM 2268  O4h GLB B   9      -5.244  34.312 -16.592  0.00  0.00              
HETATM 2269  H4o GLB B   9      -5.859  35.160 -16.290  0.00  0.00              
HETATM 2270  H5  GLB B   9      -5.388  32.186 -19.179  0.00  0.00              
HETATM 2271  H6S GLB B   9      -2.826  32.290 -19.093  0.00  0.00              
HETATM 2272  H6R GLB B   9      -3.469  33.570 -19.372  0.00  0.00              
HETATM 2273  H1  GLB B   9      -6.694  30.583 -17.898  0.00  0.00              
HETATM 2274  H2  GLB B   9      -6.817  32.488 -15.552  0.00  0.00              
HETATM 2275  H3  GLB B   9      -7.680  33.050 -18.407  0.00  0.00              
HETATM 2276  H4  GLB B   9      -5.695  34.506 -18.594  0.00  0.00              
HETATM 2277  C1  NAN B  10      -9.951  33.932 -18.015  0.00  0.00              
HETATM 2278  C2  NAN B  10      -8.911  35.038 -17.616  0.00  0.00              
HETATM 2279  C3  NAN B  10      -8.233  35.777 -18.804  0.00  0.00              
HETATM 2280  C4  NAN B  10      -9.177  36.814 -19.453  0.00  0.00              
HETATM 2281  C5  NAN B  10      -9.747  37.792 -18.402  0.00  0.00              
HETATM 2282  C6  NAN B  10     -10.406  37.018 -17.222  0.00  0.00              
HETATM 2283  C7  NAN B  10     -10.869  37.938 -16.062  0.00  0.00              
HETATM 2284  C8  NAN B  10     -11.736  37.206 -15.009  0.00  0.00              
HETATM 2285  C9  NAN B  10     -12.217  38.114 -13.869  0.00  0.00              
HETATM 2286  OW  NAN B  10      -9.454  36.030 -16.691  0.00  0.00              
HETATM 2287  OM  NAN B  10     -10.226  33.601 -19.168  0.00  0.00              
HETATM 2288  O1h NAN B  10     -10.541  33.352 -16.928  0.00  0.00              
HETATM 2289  O4h NAN B  10      -8.448  37.544 -20.430  0.00  0.00              
HETATM 2290  O7h NAN B  10      -9.707  38.467 -15.424  0.00  0.00              
HETATM 2291  O8h NAN B  10     -12.909  36.688 -15.618  0.00  0.00              
HETATM 2292  O9h NAN B  10     -13.065  37.381 -12.984  0.00  0.00              
HETATM 2293  H6  NAN B  10     -11.298  36.493 -17.620  0.00  0.00              
HETATM 2294  H3  NAN B  10      -7.331  36.300 -18.433  0.00  0.00              
HETATM 2295  H21 NAN B  10      -7.868  35.048 -19.550  0.00  0.00              
HETATM 2296  H4  NAN B  10     -10.018  36.283 -19.949  0.00  0.00              
HETATM 2297  H7o NAN B  10      -9.076  37.742 -15.456  0.00  0.00              
HETATM 2298  H8o NAN B  10     -13.526  36.613 -14.883  0.00  0.00              
HETATM 2299  H4o NAN B  10      -7.975  36.890 -20.951  0.00  0.00              
HETATM 2300  H9o NAN B  10     -13.238  37.947 -12.225  0.00  0.00              
HETATM 2301  H9R NAN B  10     -12.760  38.990 -14.279  0.00  0.00              
HETATM 2302  H9S NAN B  10     -11.348  38.521 -13.317  0.00  0.00              
HETATM 2303  H8  NAN B  10     -11.157  36.366 -14.575  0.00  0.00              
HETATM 2304  H7  NAN B  10     -11.464  38.772 -16.484  0.00  0.00              
HETATM 2305  H1o NAN B  10     -11.176  32.712 -17.249  0.00  0.00              
HETATM 2306  H5  NAN B  10      -8.921  38.415 -18.007  0.00  0.00              
HETATM 2307  N33 NAN B  10     -10.710  38.641 -19.066  0.00  0.00              
HETATM 2308  C34 NAN B  10     -10.324  39.860 -19.560  0.00  0.00              
HETATM 2309  C35 NAN B  10     -11.442  40.641 -20.222  0.00  0.00              
HETATM 2310  OM  NAN B  10      -9.193  40.303 -19.484  0.00  0.00              
HETATM 2311  H37 NAN B  10     -11.687  38.330 -19.168  0.00  0.00              
HETATM 2312  H35 NAN B  10     -11.069  41.616 -20.612  0.00  0.00              
HETATM 2313  H39 NAN B  10     -12.253  40.851 -19.488  0.00  0.00              
HETATM 2314  H40 NAN B  10     -11.863  40.066 -21.078  0.00  0.00              
HETATM 2315  C1  MAN B  11      -1.782  23.807 -11.823  0.00  0.00              
HETATM 2316  C2  MAN B  11      -1.822  25.248 -11.327  0.00  0.00              
HETATM 2317  C3  MAN B  11      -0.857  26.141 -12.088  0.00  0.00              
HETATM 2318  C4  MAN B  11       0.522  25.522 -12.121  0.00  0.00              
HETATM 2319  C5  MAN B  11       0.437  24.095 -12.661  0.00  0.00              
HETATM 2320  C6  MAN B  11       1.756  23.356 -12.721  0.00  0.00              
HETATM 2321  O3h MAN B  11      -0.787  27.410 -11.427  0.00  0.00              
HETATM 2322  O4h MAN B  11       1.394  26.264 -12.961  0.00  0.00              
HETATM 2323  OR  MAN B  11      -0.424  23.349 -11.786  0.00  0.00              
HETATM 2324  O6h MAN B  11       2.366  23.255 -11.443  0.00  0.00              
HETATM 2325  H3o MAN B  11      -1.291  28.079 -12.125  0.00  0.00              
HETATM 2326  H4o MAN B  11       1.975  26.963 -12.359  0.00  0.00              
HETATM 2327  H6o MAN B  11       2.688  22.357 -10.917  0.00  0.00              
HETATM 2328  OW  MAN B  11      -1.494  25.263  -9.943  0.00  0.00              
HETATM 2329  H5  MAN B  11       0.070  24.115 -13.650  0.00  0.00              
HETATM 2330  H6S MAN B  11       2.003  22.499 -13.168  0.00  0.00              
HETATM 2331  H6R MAN B  11       2.413  23.890 -13.345  0.00  0.00              
HETATM 2332  H1  MAN B  11      -2.426  23.189 -11.198  0.00  0.00              
HETATM 2333  H2  MAN B  11      -2.841  25.611 -11.468  0.00  0.00              
HETATM 2334  H3  MAN B  11      -1.224  26.267 -13.107  0.00  0.00              
HETATM 2335  H4  MAN B  11       0.910  25.524 -11.102  0.00  0.00              
HETATM 2336  C1  NAG B  12      -2.556  25.048  -9.026  0.00  0.00              
HETATM 2337  C2  NAG B  12      -2.075  24.182  -7.818  0.00  0.00              
HETATM 2338  C3  NAG B  12      -3.167  24.182  -6.703  0.00  0.00              
HETATM 2339  C4  NAG B  12      -3.590  25.615  -6.319  0.00  0.00              
HETATM 2340  C5  NAG B  12      -4.030  26.414  -7.576  0.00  0.00              
HETATM 2341  C6  NAG B  12      -4.362  27.884  -7.259  0.00  0.00              
HETATM 2342  C7  NAG B  12      -0.701  22.125  -7.868  0.00  0.00              
HETATM 2343  C8  NAG B  12      -0.618  20.682  -8.321  0.00  0.00              
HETATM 2344  O3h NAG B  12      -2.715  23.532  -5.512  0.00  0.00              
HETATM 2345  OR  NAG B  12      -4.646  25.517  -5.369  0.00  0.00              
HETATM 2346  OR  NAG B  12      -2.974  26.368  -8.586  0.00  0.00              
HETATM 2347  O6h NAG B  12      -3.231  28.581  -6.730  0.00  0.00              
HETATM 2348  OM  NAG B  12       0.178  22.598  -7.157  0.00  0.00              
HETATM 2349  N15 NAG B  12      -1.792  22.785  -8.248  0.00  0.00              
HETATM 2350  H2  NAG B  12      -1.166  24.674  -7.411  0.00  0.00              
HETATM 2351  H3  NAG B  12      -4.063  23.647  -7.078  0.00  0.00              
HETATM 2352  H4  NAG B  12      -2.726  26.134  -5.856  0.00  0.00              
HETATM 2353  H5  NAG B  12      -4.945  25.945  -7.989  0.00  0.00              
HETATM 2354  H6S NAG B  12      -4.723  28.389  -8.175  0.00  0.00              
HETATM 2355  H6R NAG B  12      -5.200  27.922  -6.536  0.00  0.00              
HETATM 2356  H8  NAG B  12       0.423  20.432  -8.592  0.00  0.00              
HETATM 2357  H24 NAG B  12      -1.257  20.450  -9.193  0.00  0.00              
HETATM 2358  H25 NAG B  12      -0.911  20.018  -7.490  0.00  0.00              
HETATM 2359  H3o NAG B  12      -2.582  22.607  -5.740  0.00  0.00              
HETATM 2360  H6o NAG B  12      -3.556  29.389  -6.322  0.00  0.00              
HETATM 2361  H29 NAG B  12      -2.342  22.297  -8.956  0.00  0.00              
HETATM 2362  H1  NAG B  12      -3.395  24.552  -9.555  0.00  0.00              
HETATM 2363  C1  GLB B  13      -4.465  26.164  -4.160  0.00  0.00              
HETATM 2364  C2  GLB B  13      -5.799  26.173  -3.420  0.00  0.00              
HETATM 2365  C3  GLB B  13      -5.650  26.631  -1.979  0.00  0.00              
HETATM 2366  C4  GLB B  13      -4.549  25.858  -1.290  0.00  0.00              
HETATM 2367  C5  GLB B  13      -3.261  25.947  -2.108  0.00  0.00              
HETATM 2368  C6  GLB B  13      -2.085  25.189  -1.530  0.00  0.00              
HETATM 2369  O2h GLB B  13      -6.692  27.038  -4.110  0.00  0.00              
HETATM 2370  O3h GLB B  13      -6.886  26.402  -1.293  0.00  0.00              
HETATM 2371  OR  GLB B  13      -3.529  25.386  -3.403  0.00  0.00              
HETATM 2372  OW  GLB B  13      -0.861  25.880  -1.726  0.00  0.00              
HETATM 2373  H2o GLB B  13      -7.366  26.561  -4.727  0.00  0.00              
HETATM 2374  H3o GLB B  13      -7.267  27.410  -1.130  0.00  0.00              
HETATM 2375  O4h GLB B  13      -5.036  24.527  -1.167  0.00  0.00              
HETATM 2376  H4o GLB B  13      -5.956  24.529  -0.583  0.00  0.00              
HETATM 2377  H5  GLB B  13      -2.955  26.954  -2.171  0.00  0.00              
HETATM 2378  H6  GLB B  13      -1.966  24.749  -0.643  0.00  0.00              
HETATM 2379  H20 GLB B  13      -2.009  24.262  -2.019  0.00  0.00              
HETATM 2380  H1  GLB B  13      -4.118  27.188  -4.296  0.00  0.00              
HETATM 2381  H2  GLB B  13      -6.187  25.154  -3.439  0.00  0.00              
HETATM 2382  H3  GLB B  13      -5.406  27.693  -1.972  0.00  0.00              
HETATM 2383  H4  GLB B  13      -4.304  26.248  -0.302  0.00  0.00              
HETATM 2384  C1  NAN B  14       0.265  23.950  -2.686  0.00  0.00              
HETATM 2385  C2  NAN B  14       0.330  25.118  -1.638  0.00  0.00              
HETATM 2386  C3  NAN B  14       0.454  24.677  -0.153  0.00  0.00              
HETATM 2387  C4  NAN B  14       1.886  24.210   0.192  0.00  0.00              
HETATM 2388  C5  NAN B  14       2.935  25.276  -0.195  0.00  0.00              
HETATM 2389  C6  NAN B  14       2.773  25.703  -1.683  0.00  0.00              
HETATM 2390  C7  NAN B  14       3.699  26.877  -2.096  0.00  0.00              
HETATM 2391  C8  NAN B  14       3.716  27.138  -3.622  0.00  0.00              
HETATM 2392  C9  NAN B  14       4.649  28.282  -4.040  0.00  0.00              
HETATM 2393  OW  NAN B  14       1.376  26.094  -1.932  0.00  0.00              
HETATM 2394  OM  NAN B  14       0.273  22.750  -2.408  0.00  0.00              
HETATM 2395  O1h NAN B  14       0.200  24.402  -3.972  0.00  0.00              
HETATM 2396  O4h NAN B  14       1.959  23.962   1.589  0.00  0.00              
HETATM 2397  O7h NAN B  14       3.250  28.053  -1.424  0.00  0.00              
HETATM 2398  O8h NAN B  14       4.180  25.984  -4.308  0.00  0.00              
HETATM 2399  O9h NAN B  14       4.660  28.408  -5.462  0.00  0.00              
HETATM 2400  H6  NAN B  14       3.026  24.828  -2.315  0.00  0.00              
HETATM 2401  H3  NAN B  14       0.193  25.533   0.496  0.00  0.00              
HETATM 2402  H21 NAN B  14      -0.288  23.891   0.076  0.00  0.00              
HETATM 2403  H4  NAN B  14       2.106  23.270  -0.357  0.00  0.00              
HETATM 2404  H7o NAN B  14       2.292  27.965  -1.418  0.00  0.00              
HETATM 2405  H8o NAN B  14       4.515  26.340  -5.137  0.00  0.00              
HETATM 2406  H4o NAN B  14       1.187  23.434   1.805  0.00  0.00              
HETATM 2407  H9o NAN B  14       5.151  29.209  -5.672  0.00  0.00              
HETATM 2408  H9R NAN B  14       5.675  28.097  -3.666  0.00  0.00              
HETATM 2409  H9S NAN B  14       4.317  29.230  -3.574  0.00  0.00              
HETATM 2410  H8  NAN B  14       2.689  27.370  -3.965  0.00  0.00              
HETATM 2411  H7  NAN B  14       4.733  26.645  -1.771  0.00  0.00              
HETATM 2412  H1o NAN B  14       0.192  23.638  -4.549  0.00  0.00              
HETATM 2413  H5  NAN B  14       2.797  26.165   0.451  0.00  0.00              
HETATM 2414  N33 NAN B  14       4.245  24.713   0.042  0.00  0.00              
HETATM 2415  C34 NAN B  14       4.883  24.941   1.233  0.00  0.00              
HETATM 2416  C35 NAN B  14       6.252  24.294   1.334  0.00  0.00              
HETATM 2417  OM  NAN B  14       4.421  25.603   2.143  0.00  0.00              
HETATM 2418  H37 NAN B  14       4.698  24.141  -0.685  0.00  0.00              
HETATM 2419  H35 NAN B  14       6.718  24.504   2.324  0.00  0.00              
HETATM 2420  H39 NAN B  14       6.926  24.694   0.543  0.00  0.00              
HETATM 2421  H40 NAN B  14       6.168  23.189   1.220  0.00  0.00              
HETATM 2422  C1  NAG C   1      -2.716 -18.767   7.326  0.00  0.00              
HETATM 2423  C2  NAG C   1      -3.517 -20.105   7.239  0.00  0.00              
HETATM 2424  C3  NAG C   1      -4.495 -20.214   8.450  0.00  0.00              
HETATM 2425  C4  NAG C   1      -3.763 -20.007   9.792  0.00  0.00              
HETATM 2426  C5  NAG C   1      -2.976 -18.669   9.789  0.00  0.00              
HETATM 2427  C6  NAG C   1      -2.144 -18.466  11.070  0.00  0.00              
HETATM 2428  C7  NAG C   1      -4.310 -21.276   5.207  0.00  0.00              
HETATM 2429  C8  NAG C   1      -5.212 -21.211   3.994  0.00  0.00              
HETATM 2430  O3h NAG C   1      -5.141 -21.489   8.503  0.00  0.00              
HETATM 2431  OR  NAG C   1      -4.741 -20.031  10.827  0.00  0.00              
HETATM 2432  OR  NAG C   1      -2.088 -18.621   8.629  0.00  0.00              
HETATM 2433  OW  NAG C   1      -2.511 -17.265  11.755  0.00  0.00              
HETATM 2434  OM  NAG C   1      -3.703 -22.308   5.468  0.00  0.00              
HETATM 2435  N15 NAG C   1      -4.282 -20.181   5.963  0.00  0.00              
HETATM 2436  H2  NAG C   1      -2.776 -20.929   7.318  0.00  0.00              
HETATM 2437  H3  NAG C   1      -5.272 -19.428   8.355  0.00  0.00              
HETATM 2438  H4  NAG C   1      -3.046 -20.838   9.944  0.00  0.00              
HETATM 2439  H5  NAG C   1      -3.700 -17.832   9.723  0.00  0.00              
HETATM 2440  H6  NAG C   1      -2.276 -19.337  11.739  0.00  0.00              
HETATM 2441  H22 NAG C   1      -1.068 -18.438  10.807  0.00  0.00              
HETATM 2442  H8  NAG C   1      -4.738 -21.730   3.143  0.00  0.00              
HETATM 2443  H24 NAG C   1      -5.451 -20.182   3.668  0.00  0.00              
HETATM 2444  H25 NAG C   1      -6.161 -21.733   4.211  0.00  0.00              
HETATM 2445  H3o NAG C   1      -5.697 -21.545   7.719  0.00  0.00              
HETATM 2446  H29 NAG C   1      -4.721 -19.369   5.527  0.00  0.00              
HETATM 2447  H1  NAG C   1      -3.380 -17.899   7.137  0.00  0.00              
HETATM 2448  C1  NAG C   2      -4.548 -20.972  11.873  0.00  0.00              
HETATM 2449  C2  NAG C   2      -5.443 -20.619  13.105  0.00  0.00              
HETATM 2450  C3  NAG C   2      -5.419 -21.799  14.127  0.00  0.00              
HETATM 2451  C4  NAG C   2      -5.777 -23.141  13.455  0.00  0.00              
HETATM 2452  C5  NAG C   2      -4.861 -23.405  12.229  0.00  0.00              
HETATM 2453  C6  NAG C   2      -5.248 -24.684  11.463  0.00  0.00              
HETATM 2454  C7  NAG C   2      -5.793 -18.403  14.147  0.00  0.00              
HETATM 2455  C8  NAG C   2      -5.151 -17.247  14.884  0.00  0.00              
HETATM 2456  O3h NAG C   2      -6.341 -21.594  15.200  0.00  0.00              
HETATM 2457  OR  NAG C   2      -5.643 -24.165  14.435  0.00  0.00              
HETATM 2458  OR  NAG C   2      -4.915 -22.264  11.317  0.00  0.00              
HETATM 2459  O6h NAG C   2      -6.579 -24.610  10.947  0.00  0.00              
HETATM 2460  OM  NAG C   2      -7.008 -18.429  13.982  0.00  0.00              
HETATM 2461  N15 NAG C   2      -4.966 -19.371  13.763  0.00  0.00              
HETATM 2462  H2  NAG C   2      -6.481 -20.510  12.727  0.00  0.00              
HETATM 2463  H3  NAG C   2      -4.399 -21.887  14.551  0.00  0.00              
HETATM 2464  H4  NAG C   2      -6.829 -23.100  13.108  0.00  0.00              
HETATM 2465  H5  NAG C   2      -3.820 -23.530  12.588  0.00  0.00              
HETATM 2466  H6S NAG C   2      -4.531 -24.852  10.638  0.00  0.00              
HETATM 2467  H6R NAG C   2      -5.153 -25.557  12.138  0.00  0.00              
HETATM 2468  H8  NAG C   2      -5.626 -16.298  14.584  0.00  0.00              
HETATM 2469  H24 NAG C   2      -4.065 -17.150  14.704  0.00  0.00              
HETATM 2470  H25 NAG C   2      -5.312 -17.368  15.969  0.00  0.00              
HETATM 2471  H3o NAG C   2      -6.026 -20.827  15.687  0.00  0.00              
HETATM 2472  H6o NAG C   2      -6.848 -25.503  10.713  0.00  0.00              
HETATM 2473  H29 NAG C   2      -3.979 -19.124  13.842  0.00  0.00              
HETATM 2474  H1  NAG C   2      -3.476 -20.983  12.155  0.00  0.00              
HETATM 2475  C1  BMA C   3      -6.749 -24.965  14.662  0.00  0.00              
HETATM 2476  C2  BMA C   3      -6.312 -26.150  15.518  0.00  0.00              
HETATM 2477  C3  BMA C   3      -7.497 -26.947  16.037  0.00  0.00              
HETATM 2478  C4  BMA C   3      -8.505 -26.032  16.693  0.00  0.00              
HETATM 2479  C5  BMA C   3      -8.885 -24.904  15.732  0.00  0.00              
HETATM 2480  C6  BMA C   3      -9.875 -23.903  16.284  0.00  0.00              
HETATM 2481  OW  BMA C   3      -7.026 -27.895  17.002  0.00  0.00              
HETATM 2482  O4h BMA C   3      -9.685 -26.738  17.040  0.00  0.00              
HETATM 2483  OR  BMA C   3      -7.685 -24.180  15.413  0.00  0.00              
HETATM 2484  OW  BMA C   3     -11.035 -23.802  15.473  0.00  0.00              
HETATM 2485  H4o BMA C   3      -9.634 -27.048  18.084  0.00  0.00              
HETATM 2486  O2h BMA C   3      -5.550 -25.663  16.616  0.00  0.00              
HETATM 2487  H2o BMA C   3      -6.175 -25.021  17.236  0.00  0.00              
HETATM 2488  H5  BMA C   3      -9.337 -25.316  14.872  0.00  0.00              
HETATM 2489  H6  BMA C   3     -10.225 -23.774  17.210  0.00  0.00              
HETATM 2490  H20 BMA C   3      -9.419 -22.955  16.307  0.00  0.00              
HETATM 2491  H2  BMA C   3      -5.690 -26.788  14.892  0.00  0.00              
HETATM 2492  H3  BMA C   3      -7.966 -27.463  15.200  0.00  0.00              
HETATM 2493  H1  BMA C   3      -7.186 -25.329  13.733  0.00  0.00              
HETATM 2494  H4  BMA C   3      -8.046 -25.626  17.595  0.00  0.00              
HETATM 2495  C1  MAN C   4      -7.393 -29.255  16.803  0.00  0.00              
HETATM 2496  C2  MAN C   4      -7.124 -30.181  17.985  0.00  0.00              
HETATM 2497  C3  MAN C   4      -5.638 -30.370  18.236  0.00  0.00              
HETATM 2498  C4  MAN C   4      -4.930 -30.756  16.958  0.00  0.00              
HETATM 2499  C5  MAN C   4      -5.252 -29.743  15.860  0.00  0.00              
HETATM 2500  C6  MAN C   4      -4.618 -30.033  14.517  0.00  0.00              
HETATM 2501  O3h MAN C   4      -5.464 -31.413  19.203  0.00  0.00              
HETATM 2502  OR  MAN C   4      -3.523 -30.780  17.142  0.00  0.00              
HETATM 2503  OR  MAN C   4      -6.675 -29.749  15.665  0.00  0.00              
HETATM 2504  O6h MAN C   4      -5.012 -31.298  14.008  0.00  0.00              
HETATM 2505  H3o MAN C   4      -5.113 -30.875  20.084  0.00  0.00              
HETATM 2506  H6o MAN C   4      -5.479 -31.526  13.050  0.00  0.00              
HETATM 2507  OW  MAN C   4      -7.726 -31.443  17.722  0.00  0.00              
HETATM 2508  H5  MAN C   4      -4.900 -28.790  16.148  0.00  0.00              
HETATM 2509  H6S MAN C   4      -4.534 -29.466  13.701  0.00  0.00              
HETATM 2510  H6R MAN C   4      -3.573 -30.049  14.635  0.00  0.00              
HETATM 2511  H1  MAN C   4      -8.464 -29.214  16.609  0.00  0.00              
HETATM 2512  H2  MAN C   4      -7.587 -29.728  18.862  0.00  0.00              
HETATM 2513  H3  MAN C   4      -5.224 -29.434  18.613  0.00  0.00              
HETATM 2514  H4  MAN C   4      -5.277 -31.750  16.675  0.00  0.00              
HETATM 2515  C1  NAG C   5      -9.093 -31.590  18.074  0.00  0.00              
HETATM 2516  C2  NAG C   5      -9.848 -32.448  17.009  0.00  0.00              
HETATM 2517  C3  NAG C   5     -11.266 -32.822  17.544  0.00  0.00              
HETATM 2518  C4  NAG C   5     -11.196 -33.474  18.939  0.00  0.00              
HETATM 2519  C5  NAG C   5     -10.411 -32.573  19.930  0.00  0.00              
HETATM 2520  C6  NAG C   5     -10.223 -33.229  21.311  0.00  0.00              
HETATM 2521  C7  NAG C   5      -9.727 -32.269  14.544  0.00  0.00              
HETATM 2522  C8  NAG C   5      -9.993 -31.398  13.335  0.00  0.00              
HETATM 2523  O3h NAG C   5     -11.943 -33.734  16.674  0.00  0.00              
HETATM 2524  OR  NAG C   5     -12.530 -33.697  19.384  0.00  0.00              
HETATM 2525  OR  NAG C   5      -9.100 -32.248  19.371  0.00  0.00              
HETATM 2526  O6h NAG C   5      -9.479 -34.447  21.221  0.00  0.00              
HETATM 2527  OM  NAG C   5      -9.359 -33.430  14.398  0.00  0.00              
HETATM 2528  N15 NAG C   5      -9.972 -31.706  15.724  0.00  0.00              
HETATM 2529  H2  NAG C   5      -9.269 -33.388  16.883  0.00  0.00              
HETATM 2530  H3  NAG C   5     -11.874 -31.898  17.626  0.00  0.00              
HETATM 2531  H4  NAG C   5     -10.670 -34.448  18.855  0.00  0.00              
HETATM 2532  H5  NAG C   5     -10.981 -31.634  20.079  0.00  0.00              
HETATM 2533  H6S NAG C   5      -9.709 -32.523  21.990  0.00  0.00              
HETATM 2534  H6R NAG C   5     -11.216 -33.424  21.762  0.00  0.00              
HETATM 2535  H8  NAG C   5      -9.221 -31.577  12.566  0.00  0.00              
HETATM 2536  H24 NAG C   5     -10.001 -30.316  13.557  0.00  0.00              
HETATM 2537  H25 NAG C   5     -10.968 -31.668  12.894  0.00  0.00              
HETATM 2538  H3o NAG C   5     -12.096 -33.263  15.850  0.00  0.00              
HETATM 2539  H6o NAG C   5      -9.614 -34.927  22.043  0.00  0.00              
HETATM 2540  H29 NAG C   5     -10.124 -30.698  15.675  0.00  0.00              
HETATM 2541  H1  NAG C   5      -9.553 -30.585  18.168  0.00  0.00              
HETATM 2542  C1  GLB C   6     -12.867 -34.991  19.739  0.00  0.00              
HETATM 2543  C2  GLB C   6     -14.221 -34.956  20.440  0.00  0.00              
HETATM 2544  C3  GLB C   6     -14.796 -36.347  20.639  0.00  0.00              
HETATM 2545  C4  GLB C   6     -14.779 -37.119  19.339  0.00  0.00              
HETATM 2546  C5  GLB C   6     -13.368 -37.108  18.748  0.00  0.00              
HETATM 2547  C6  GLB C   6     -13.224 -37.831  17.428  0.00  0.00              
HETATM 2548  O2h GLB C   6     -14.060 -34.317  21.699  0.00  0.00              
HETATM 2549  O3h GLB C   6     -16.150 -36.224  21.093  0.00  0.00              
HETATM 2550  OR  GLB C   6     -13.002 -35.737  18.522  0.00  0.00              
HETATM 2551  O6h GLB C   6     -14.069 -37.284  16.428  0.00  0.00              
HETATM 2552  H2o GLB C   6     -14.347 -33.326  21.722  0.00  0.00              
HETATM 2553  H3o GLB C   6     -16.093 -36.561  22.128  0.00  0.00              
HETATM 2554  H6o GLB C   6     -13.795 -36.897  15.448  0.00  0.00              
HETATM 2555  O4h GLB C   6     -15.734 -36.480  18.502  0.00  0.00              
HETATM 2556  H4o GLB C   6     -16.715 -36.513  18.977  0.00  0.00              
HETATM 2557  H5  GLB C   6     -12.706 -37.585  19.416  0.00  0.00              
HETATM 2558  H6S GLB C   6     -12.410 -38.107  16.922  0.00  0.00              
HETATM 2559  H6R GLB C   6     -13.500 -38.837  17.562  0.00  0.00              
HETATM 2560  H1  GLB C   6     -12.125 -35.436  20.401  0.00  0.00              
HETATM 2561  H2  GLB C   6     -14.895 -34.369  19.815  0.00  0.00              
HETATM 2562  H3  GLB C   6     -14.197 -36.873  21.383  0.00  0.00              
HETATM 2563  H4  GLB C   6     -15.044 -38.169  19.459  0.00  0.00              
HETATM 2564  C1  NAG C   7      -2.856 -31.999  16.849  0.00  0.00              
HETATM 2565  C2  NAG C   7      -1.317 -31.767  16.709  0.00  0.00              
HETATM 2566  C3  NAG C   7      -0.580 -33.140  16.656  0.00  0.00              
HETATM 2567  C4  NAG C   7      -0.971 -34.043  17.844  0.00  0.00              
HETATM 2568  C5  NAG C   7      -2.514 -34.204  17.929  0.00  0.00              
HETATM 2569  C6  NAG C   7      -2.960 -35.013  19.162  0.00  0.00              
HETATM 2570  C7  NAG C   7      -0.156 -29.963  15.474  0.00  0.00              
HETATM 2571  C8  NAG C   7       0.106 -29.338  14.120  0.00  0.00              
HETATM 2572  O3h NAG C   7       0.841 -32.986  16.682  0.00  0.00              
HETATM 2573  OR  NAG C   7      -0.326 -35.299  17.667  0.00  0.00              
HETATM 2574  OR  NAG C   7      -3.147 -32.888  17.963  0.00  0.00              
HETATM 2575  O6h NAG C   7      -2.568 -34.378  20.382  0.00  0.00              
HETATM 2576  OM  NAG C   7       0.441 -29.560  16.464  0.00  0.00              
HETATM 2577  N15 NAG C   7      -1.012 -30.983  15.480  0.00  0.00              
HETATM 2578  H2  NAG C   7      -0.987 -31.233  17.625  0.00  0.00              
HETATM 2579  H3  NAG C   7      -0.861 -33.664  15.719  0.00  0.00              
HETATM 2580  H4  NAG C   7      -0.613 -33.576  18.785  0.00  0.00              
HETATM 2581  H5  NAG C   7      -2.861 -34.748  17.028  0.00  0.00              
HETATM 2582  H6S NAG C   7      -4.058 -35.144  19.141  0.00  0.00              
HETATM 2583  H6R NAG C   7      -2.527 -36.030  19.109  0.00  0.00              
HETATM 2584  H8  NAG C   7       0.203 -28.244  14.223  0.00  0.00              
HETATM 2585  H24 NAG C   7      -0.685 -29.536  13.375  0.00  0.00              
HETATM 2586  H25 NAG C   7       1.062 -29.718  13.718  0.00  0.00              
HETATM 2587  H3o NAG C   7       1.081 -32.536  15.866  0.00  0.00              
HETATM 2588  H6o NAG C   7      -2.639 -35.032  21.083  0.00  0.00              
HETATM 2589  H29 NAG C   7      -1.530 -31.090  14.607  0.00  0.00              
HETATM 2590  H1  NAG C   7      -3.276 -32.427  15.917  0.00  0.00              
HETATM 2591  C1  GLB C   8       0.478 -35.745  18.701  0.00  0.00              
HETATM 2592  C2  GLB C   8       0.834 -37.204  18.434  0.00  0.00              
HETATM 2593  C3  GLB C   8       1.917 -37.709  19.372  0.00  0.00              
HETATM 2594  C4  GLB C   8       3.096 -36.762  19.377  0.00  0.00              
HETATM 2595  C5  GLB C   8       2.619 -35.343  19.683  0.00  0.00              
HETATM 2596  C6  GLB C   8       3.708 -34.291  19.694  0.00  0.00              
HETATM 2597  O2h GLB C   8      -0.341 -37.991  18.588  0.00  0.00              
HETATM 2598  OW  GLB C   8       2.351 -38.997  18.921  0.00  0.00              
HETATM 2599  OR  GLB C   8       1.682 -34.968  18.660  0.00  0.00              
HETATM 2600  O6h GLB C   8       4.384 -34.216  18.449  0.00  0.00              
HETATM 2601  H2o GLB C   8      -0.810 -38.244  17.706  0.00  0.00              
HETATM 2602  H6o GLB C   8       4.522 -33.348  17.804  0.00  0.00              
HETATM 2603  O4h GLB C   8       3.688 -36.882  18.090  0.00  0.00              
HETATM 2604  H4o GLB C   8       3.998 -37.914  17.926  0.00  0.00              
HETATM 2605  H5  GLB C   8       2.182 -35.319  20.643  0.00  0.00              
HETATM 2606  H6S GLB C   8       3.698 -33.347  20.013  0.00  0.00              
HETATM 2607  H6R GLB C   8       4.417 -34.550  20.426  0.00  0.00              
HETATM 2608  H1  GLB C   8      -0.020 -35.663  19.667  0.00  0.00              
HETATM 2609  H2  GLB C   8       1.186 -37.269  17.404  0.00  0.00              
HETATM 2610  H3  GLB C   8       1.504 -37.781  20.378  0.00  0.00              
HETATM 2611  H4  GLB C   8       3.835 -37.001  20.142  0.00  0.00              
HETATM 2612  C1  NAN C   9       0.899 -40.172  20.480  0.00  0.00              
HETATM 2613  C2  NAN C   9       2.341 -40.048  19.872  0.00  0.00              
HETATM 2614  C3  NAN C   9       3.470 -39.725  20.890  0.00  0.00              
HETATM 2615  C4  NAN C   9       3.864 -40.961  21.728  0.00  0.00              
HETATM 2616  C5  NAN C   9       4.216 -42.163  20.824  0.00  0.00              
HETATM 2617  C6  NAN C   9       3.070 -42.451  19.810  0.00  0.00              
HETATM 2618  C7  NAN C   9       3.421 -43.554  18.776  0.00  0.00              
HETATM 2619  C8  NAN C   9       2.206 -44.009  17.929  0.00  0.00              
HETATM 2620  C9  NAN C   9       2.540 -45.117  16.921  0.00  0.00              
HETATM 2621  OW  NAN C   9       2.734 -41.216  19.086  0.00  0.00              
HETATM 2622  OM  NAN C   9       0.614 -40.000  21.666  0.00  0.00              
HETATM 2623  O1h NAN C   9      -0.038 -40.499  19.544  0.00  0.00              
HETATM 2624  O4h NAN C   9       4.991 -40.629  22.527  0.00  0.00              
HETATM 2625  O7h NAN C   9       4.431 -43.043  17.907  0.00  0.00              
HETATM 2626  O8h NAN C   9       1.197 -44.541  18.774  0.00  0.00              
HETATM 2627  O9h NAN C   9       1.356 -45.527  16.236  0.00  0.00              
HETATM 2628  H6  NAN C   9       2.187 -42.792  20.387  0.00  0.00              
HETATM 2629  H3  NAN C   9       4.360 -39.371  20.337  0.00  0.00              
HETATM 2630  H21 NAN C   9       3.170 -38.883  21.540  0.00  0.00              
HETATM 2631  H4  NAN C   9       3.018 -41.241  22.388  0.00  0.00              
HETATM 2632  H7o NAN C   9       4.197 -42.115  17.801  0.00  0.00              
HETATM 2633  H8o NAN C   9       0.699 -45.119  18.187  0.00  0.00              
HETATM 2634  H4o NAN C   9       4.786 -39.783  22.934  0.00  0.00              
HETATM 2635  H9o NAN C   9       1.630 -46.124  15.532  0.00  0.00              
HETATM 2636  H9R NAN C   9       3.000 -45.982  17.438  0.00  0.00              
HETATM 2637  H9S NAN C   9       3.295 -44.753  16.197  0.00  0.00              
HETATM 2638  H8  NAN C   9       1.794 -43.139  17.381  0.00  0.00              
HETATM 2639  H7  NAN C   9       3.819 -44.435  19.316  0.00  0.00              
HETATM 2640  H1o NAN C   9      -0.881 -40.582  19.991  0.00  0.00              
HETATM 2641  H5  NAN C   9       5.143 -41.933  20.263  0.00  0.00              
HETATM 2642  N33 NAN C   9       4.448 -43.305  21.679  0.00  0.00              
HETATM 2643  C34 NAN C   9       5.723 -43.612  22.081  0.00  0.00              
HETATM 2644  C35 NAN C   9       5.812 -44.839  22.969  0.00  0.00              
HETATM 2645  OM  NAN C   9       6.712 -42.977  21.767  0.00  0.00              
HETATM 2646  H37 NAN C   9       3.657 -43.889  21.985  0.00  0.00              
HETATM 2647  H35 NAN C   9       6.866 -45.034  23.272  0.00  0.00              
HETATM 2648  H39 NAN C   9       5.438 -45.736  22.424  0.00  0.00              
HETATM 2649  H40 NAN C   9       5.208 -44.694  23.893  0.00  0.00              
HETATM 2650  C1  MAN C  10     -11.822 -22.626  15.615  0.00  0.00              
HETATM 2651  C2  MAN C  10     -12.734 -22.596  16.838  0.00  0.00              
HETATM 2652  C3  MAN C  10     -13.851 -23.620  16.743  0.00  0.00              
HETATM 2653  C4  MAN C  10     -14.569 -23.498  15.418  0.00  0.00              
HETATM 2654  C5  MAN C  10     -13.559 -23.571  14.272  0.00  0.00              
HETATM 2655  C6  MAN C  10     -14.153 -23.437  12.888  0.00  0.00              
HETATM 2656  O3h MAN C  10     -14.782 -23.384  17.805  0.00  0.00              
HETATM 2657  O4h MAN C  10     -15.508 -24.548  15.249  0.00  0.00              
HETATM 2658  OR  MAN C  10     -12.632 -22.486  14.441  0.00  0.00              
HETATM 2659  OW  MAN C  10     -13.842 -24.552  12.067  0.00  0.00              
HETATM 2660  H3o MAN C  10     -14.628 -24.240  18.462  0.00  0.00              
HETATM 2661  H4o MAN C  10     -16.498 -24.206  15.552  0.00  0.00              
HETATM 2662  OW  MAN C  10     -13.291 -21.293  16.959  0.00  0.00              
HETATM 2663  H5  MAN C  10     -13.074 -24.507  14.291  0.00  0.00              
HETATM 2664  H6  MAN C  10     -15.072 -23.179  12.596  0.00  0.00              
HETATM 2665  H20 MAN C  10     -13.750 -22.581  12.429  0.00  0.00              
HETATM 2666  H1  MAN C  10     -11.088 -21.824  15.689  0.00  0.00              
HETATM 2667  H2  MAN C  10     -12.112 -22.814  17.708  0.00  0.00              
HETATM 2668  H3  MAN C  10     -13.421 -24.619  16.833  0.00  0.00              
HETATM 2669  H4  MAN C  10     -15.088 -22.541  15.409  0.00  0.00              
HETATM 2670  C1  NAG C  11     -12.523 -20.326  17.660  0.00  0.00              
HETATM 2671  C2  NAG C  11     -12.653 -18.923  16.985  0.00  0.00              
HETATM 2672  C3  NAG C  11     -12.027 -17.834  17.910  0.00  0.00              
HETATM 2673  C4  NAG C  11     -12.608 -17.898  19.337  0.00  0.00              
HETATM 2674  C5  NAG C  11     -12.463 -19.327  19.928  0.00  0.00              
HETATM 2675  C6  NAG C  11     -13.123 -19.469  21.312  0.00  0.00              
HETATM 2676  C7  NAG C  11     -12.526 -18.376  14.575  0.00  0.00              
HETATM 2677  C8  NAG C  11     -11.656 -18.366  13.334  0.00  0.00              
HETATM 2678  O3h NAG C  11     -12.255 -16.513  17.411  0.00  0.00              
HETATM 2679  OR  NAG C  11     -11.922 -16.936  20.131  0.00  0.00              
HETATM 2680  OR  NAG C  11     -13.054 -20.302  19.013  0.00  0.00              
HETATM 2681  O6h NAG C  11     -14.529 -19.210  21.259  0.00  0.00              
HETATM 2682  OM  NAG C  11     -13.641 -17.868  14.548  0.00  0.00              
HETATM 2683  N15 NAG C  11     -11.972 -18.910  15.659  0.00  0.00              
HETATM 2684  H2  NAG C  11     -13.738 -18.712  16.886  0.00  0.00              
HETATM 2685  H3  NAG C  11     -10.934 -18.002  17.976  0.00  0.00              
HETATM 2686  H4  NAG C  11     -13.687 -17.640  19.300  0.00  0.00              
HETATM 2687  H5  NAG C  11     -11.384 -19.552  20.045  0.00  0.00              
HETATM 2688  H6S NAG C  11     -12.941 -20.486  21.707  0.00  0.00              
HETATM 2689  H6R NAG C  11     -12.638 -18.771  22.022  0.00  0.00              
HETATM 2690  H8  NAG C  11     -12.272 -18.574  12.442  0.00  0.00              
HETATM 2691  H24 NAG C  11     -10.837 -19.105  13.356  0.00  0.00              
HETATM 2692  H25 NAG C  11     -11.215 -17.362  13.203  0.00  0.00              
HETATM 2693  H3o NAG C  11     -11.774 -16.448  16.580  0.00  0.00              
HETATM 2694  H6o NAG C  11     -14.829 -19.062  22.159  0.00  0.00              
HETATM 2695  H29 NAG C  11     -11.107 -19.419  15.472  0.00  0.00              
HETATM 2696  H1  NAG C  11     -11.465 -20.654  17.686  0.00  0.00              
HETATM 2697  C1  GLB C  12     -12.694 -15.990  20.781  0.00  0.00              
HETATM 2698  C2  GLB C  12     -11.806 -15.253  21.778  0.00  0.00              
HETATM 2699  C3  GLB C  12     -12.493 -14.027  22.356  0.00  0.00              
HETATM 2700  C4  GLB C  12     -13.053 -13.162  21.251  0.00  0.00              
HETATM 2701  C5  GLB C  12     -13.945 -14.003  20.337  0.00  0.00              
HETATM 2702  C6  GLB C  12     -14.551 -13.252  19.171  0.00  0.00              
HETATM 2703  O2h GLB C  12     -11.462 -16.151  22.825  0.00  0.00              
HETATM 2704  OW  GLB C  12     -11.531 -13.271  23.102  0.00  0.00              
HETATM 2705  OR  GLB C  12     -13.137 -15.056  19.787  0.00  0.00              
HETATM 2706  O6h GLB C  12     -13.556 -12.686  18.331  0.00  0.00              
HETATM 2707  H2o GLB C  12     -10.525 -16.572  22.742  0.00  0.00              
HETATM 2708  H6o GLB C  12     -13.414 -12.829  17.260  0.00  0.00              
HETATM 2709  O4h GLB C  12     -11.922 -12.624  20.576  0.00  0.00              
HETATM 2710  H4o GLB C  12     -11.322 -12.044  21.278  0.00  0.00              
HETATM 2711  H5  GLB C  12     -14.758 -14.382  20.892  0.00  0.00              
HETATM 2712  H6S GLB C  12     -15.275 -13.511  18.536  0.00  0.00              
HETATM 2713  H6R GLB C  12     -15.137 -12.465  19.545  0.00  0.00              
HETATM 2714  H1  GLB C  12     -13.534 -16.443  21.307  0.00  0.00              
HETATM 2715  H2  GLB C  12     -10.905 -14.947  21.246  0.00  0.00              
HETATM 2716  H3  GLB C  12     -13.303 -14.353  23.009  0.00  0.00              
HETATM 2717  H4  GLB C  12     -13.680 -12.349  21.616  0.00  0.00              
HETATM 2718  C1  NAG C  13     -12.017 -12.518  24.204  0.00  0.00              
HETATM 2719  C2  NAG C  13     -11.798 -13.294  25.543  0.00  0.00              
HETATM 2720  C3  NAG C  13     -12.088 -12.351  26.751  0.00  0.00              
HETATM 2721  C4  NAG C  13     -11.289 -11.035  26.651  0.00  0.00              
HETATM 2722  C5  NAG C  13     -11.542 -10.339  25.286  0.00  0.00              
HETATM 2723  C6  NAG C  13     -10.686  -9.073  25.095  0.00  0.00              
HETATM 2724  C7  NAG C  13     -12.249 -15.682  26.010  0.00  0.00              
HETATM 2725  C8  NAG C  13     -13.304 -16.764  26.109  0.00  0.00              
HETATM 2726  O3h NAG C  13     -11.756 -12.964  27.999  0.00  0.00              
HETATM 2727  OR  NAG C  13     -11.681 -10.205  27.738  0.00  0.00              
HETATM 2728  OR  NAG C  13     -11.267 -11.273  24.196  0.00  0.00              
HETATM 2729  O6h NAG C  13      -9.287  -9.371  25.128  0.00  0.00              
HETATM 2730  OM  NAG C  13     -11.091 -15.920  26.335  0.00  0.00              
HETATM 2731  N15 NAG C  13     -12.683 -14.490  25.612  0.00  0.00              
HETATM 2732  H2  NAG C  13     -10.726 -13.580  25.577  0.00  0.00              
HETATM 2733  H3  NAG C  13     -13.167 -12.098  26.759  0.00  0.00              
HETATM 2734  H4  NAG C  13     -10.207 -11.264  26.736  0.00  0.00              
HETATM 2735  H5  NAG C  13     -12.606 -10.034  25.238  0.00  0.00              
HETATM 2736  H6S NAG C  13     -10.946  -8.590  24.136  0.00  0.00              
HETATM 2737  H6R NAG C  13     -10.935  -8.340  25.889  0.00  0.00              
HETATM 2738  H8  NAG C  13     -12.886 -17.728  25.773  0.00  0.00              
HETATM 2739  H24 NAG C  13     -14.209 -16.562  25.508  0.00  0.00              
HETATM 2740  H25 NAG C  13     -13.608 -16.886  27.163  0.00  0.00              
HETATM 2741  H3o NAG C  13     -12.355 -13.708  28.106  0.00  0.00              
HETATM 2742  H6o NAG C  13      -8.820  -8.542  25.262  0.00  0.00              
HETATM 2743  H29 NAG C  13     -13.633 -14.502  25.237  0.00  0.00              
HETATM 2744  H1  NAG C  13     -13.093 -12.301  24.047  0.00  0.00              
HETATM 2745  C1  GLB C  14     -10.679  -9.750  28.576  0.00  0.00              
HETATM 2746  C2  GLB C  14     -11.266  -8.672  29.481  0.00  0.00              
HETATM 2747  C3  GLB C  14     -10.317  -8.291  30.605  0.00  0.00              
HETATM 2748  C4  GLB C  14      -9.831  -9.526  31.328  0.00  0.00              
HETATM 2749  C5  GLB C  14      -9.240 -10.516  30.324  0.00  0.00              
HETATM 2750  C6  GLB C  14      -8.738 -11.811  30.926  0.00  0.00              
HETATM 2751  O2h GLB C  14     -11.556  -7.527  28.689  0.00  0.00              
HETATM 2752  OW  GLB C  14     -11.015  -7.450  31.530  0.00  0.00              
HETATM 2753  OR  GLB C  14     -10.278 -10.860  29.390  0.00  0.00              
HETATM 2754  O6h GLB C  14      -9.765 -12.513  31.607  0.00  0.00              
HETATM 2755  H2o GLB C  14     -12.546  -7.430  28.416  0.00  0.00              
HETATM 2756  H6o GLB C  14     -10.107 -13.536  31.449  0.00  0.00              
HETATM 2757  O4h GLB C  14     -10.967 -10.042  32.011  0.00  0.00              
HETATM 2758  H4o GLB C  14     -11.347  -9.291  32.704  0.00  0.00              
HETATM 2759  H5  GLB C  14      -8.411 -10.077  29.844  0.00  0.00              
HETATM 2760  H6S GLB C  14      -8.178 -12.537  30.531  0.00  0.00              
HETATM 2761  H6R GLB C  14      -7.986 -11.587  31.624  0.00  0.00              
HETATM 2762  H1  GLB C  14      -9.838  -9.339  28.017  0.00  0.00              
HETATM 2763  H2  GLB C  14     -12.188  -9.070  29.903  0.00  0.00              
HETATM 2764  H3  GLB C  14      -9.465  -7.759  30.181  0.00  0.00              
HETATM 2765  H4  GLB C  14      -9.038  -9.319  32.047  0.00  0.00              
HETATM 2766  C1  NAN C  15     -10.140  -5.411  30.531  0.00  0.00              
HETATM 2767  C2  NAN C  15     -10.410  -6.210  31.856  0.00  0.00              
HETATM 2768  C3  NAN C  15      -9.149  -6.549  32.699  0.00  0.00              
HETATM 2769  C4  NAN C  15      -8.627  -5.321  33.476  0.00  0.00              
HETATM 2770  C5  NAN C  15      -9.744  -4.674  34.324  0.00  0.00              
HETATM 2771  C6  NAN C  15     -10.994  -4.359  33.451  0.00  0.00              
HETATM 2772  C7  NAN C  15     -12.206  -3.844  34.269  0.00  0.00              
HETATM 2773  C8  NAN C  15     -13.358  -3.302  33.386  0.00  0.00              
HETATM 2774  C9  NAN C  15     -14.551  -2.767  34.188  0.00  0.00              
HETATM 2775  OW  NAN C  15     -11.399  -5.570  32.719  0.00  0.00              
HETATM 2776  OM  NAN C  15      -9.029  -5.081  30.119  0.00  0.00              
HETATM 2777  O1h NAN C  15     -11.290  -5.108  29.859  0.00  0.00              
HETATM 2778  O4h NAN C  15      -7.570  -5.738  34.329  0.00  0.00              
HETATM 2779  O7h NAN C  15     -12.696  -4.922  35.066  0.00  0.00              
HETATM 2780  O8h NAN C  15     -12.897  -2.214  32.598  0.00  0.00              
HETATM 2781  O9h NAN C  15     -15.532  -2.225  33.303  0.00  0.00              
HETATM 2782  H6  NAN C  15     -10.709  -3.571  32.726  0.00  0.00              
HETATM 2783  H3  NAN C  15      -9.408  -7.345  33.423  0.00  0.00              
HETATM 2784  H21 NAN C  15      -8.362  -6.979  32.054  0.00  0.00              
HETATM 2785  H4  NAN C  15      -8.239  -4.571  32.756  0.00  0.00              
HETATM 2786  H7o NAN C  15     -12.584  -5.694  34.503  0.00  0.00              
HETATM 2787  H8o NAN C  15     -13.703  -1.725  32.403  0.00  0.00              
HETATM 2788  H4o NAN C  15      -6.991  -6.282  33.788  0.00  0.00              
HETATM 2789  H9o NAN C  15     -16.308  -2.021  33.834  0.00  0.00              
HETATM 2790  H9R NAN C  15     -14.215  -1.994  34.907  0.00  0.00              
HETATM 2791  H9S NAN C  15     -14.993  -3.582  34.796  0.00  0.00              
HETATM 2792  H8  NAN C  15     -13.712  -4.108  32.712  0.00  0.00              
HETATM 2793  H7  NAN C  15     -11.866  -3.026  34.934  0.00  0.00              
HETATM 2794  H1o NAN C  15     -11.047  -4.601  29.084  0.00  0.00              
HETATM 2795  H5  NAN C  15     -10.035  -5.377  35.129  0.00  0.00              
HETATM 2796  N33 NAN C  15      -9.209  -3.469  34.915  0.00  0.00              
HETATM 2797  C34 NAN C  15      -8.675  -3.502  36.177  0.00  0.00              
HETATM 2798  C35 NAN C  15      -8.159  -2.162  36.666  0.00  0.00              
HETATM 2799  OM  NAN C  15      -8.611  -4.501  36.867  0.00  0.00              
HETATM 2800  H37 NAN C  15      -9.229  -2.584  34.387  0.00  0.00              
HETATM 2801  H35 NAN C  15      -7.729  -2.251  37.689  0.00  0.00              
HETATM 2802  H39 NAN C  15      -8.989  -1.420  36.703  0.00  0.00              
HETATM 2803  H40 NAN C  15      -7.361  -1.783  35.988  0.00  0.00              
HETATM 2804  C1  NAG C  16     -13.951 -24.368  10.664  0.00  0.00              
HETATM 2805  C2  NAG C  16     -13.267 -25.547   9.898  0.00  0.00              
HETATM 2806  C3  NAG C  16     -13.626 -25.468   8.382  0.00  0.00              
HETATM 2807  C4  NAG C  16     -15.150 -25.378   8.161  0.00  0.00              
HETATM 2808  C5  NAG C  16     -15.755 -24.201   8.973  0.00  0.00              
HETATM 2809  C6  NAG C  16     -17.290 -24.133   8.866  0.00  0.00              
HETATM 2810  C7  NAG C  16     -11.065 -26.582  10.350  0.00  0.00              
HETATM 2811  C8  NAG C  16      -9.566 -26.371  10.398  0.00  0.00              
HETATM 2812  O3h NAG C  16     -13.152 -26.608   7.661  0.00  0.00              
HETATM 2813  OR  NAG C  16     -15.378 -25.219   6.765  0.00  0.00              
HETATM 2814  OR  NAG C  16     -15.376 -24.321  10.379  0.00  0.00              
HETATM 2815  O6h NAG C  16     -17.909 -25.317   9.378  0.00  0.00              
HETATM 2816  OM  NAG C  16     -11.535 -27.702  10.513  0.00  0.00              
HETATM 2817  N15 NAG C  16     -11.789 -25.500  10.070  0.00  0.00              
HETATM 2818  H2  NAG C  16     -13.695 -26.486  10.306  0.00  0.00              
HETATM 2819  H3  NAG C  16     -13.161 -24.559   7.949  0.00  0.00              
HETATM 2820  H4  NAG C  16     -15.620 -26.322   8.505  0.00  0.00              
HETATM 2821  H5  NAG C  16     -15.350 -23.250   8.570  0.00  0.00              
HETATM 2822  H6S NAG C  16     -17.661 -23.246   9.415  0.00  0.00              
HETATM 2823  H6R NAG C  16     -17.578 -23.984   7.808  0.00  0.00              
HETATM 2824  H8  NAG C  16      -9.127 -26.974  11.212  0.00  0.00              
HETATM 2825  H24 NAG C  16      -9.267 -25.321  10.563  0.00  0.00              
HETATM 2826  H25 NAG C  16      -9.115 -26.715   9.451  0.00  0.00              
HETATM 2827  H3o NAG C  16     -12.191 -26.575   7.697  0.00  0.00              
HETATM 2828  H6o NAG C  16     -18.815 -25.329   9.058  0.00  0.00              
HETATM 2829  H29 NAG C  16     -11.259 -24.629  10.114  0.00  0.00              
HETATM 2830  H1  NAG C  16     -13.488 -23.399  10.389  0.00  0.00              
HETATM 2831  C1  GLB C  17     -16.207 -26.143   6.154  0.00  0.00              
HETATM 2832  C2  GLB C  17     -16.539 -25.635   4.755  0.00  0.00              
HETATM 2833  C3  GLB C  17     -17.231 -26.694   3.913  0.00  0.00              
HETATM 2834  C4  GLB C  17     -16.454 -27.990   3.947  0.00  0.00              
HETATM 2835  C5  GLB C  17     -16.209 -28.410   5.396  0.00  0.00              
HETATM 2836  C6  GLB C  17     -15.416 -29.687   5.565  0.00  0.00              
HETATM 2837  O2h GLB C  17     -17.377 -24.493   4.876  0.00  0.00              
HETATM 2838  OW  GLB C  17     -17.308 -26.227   2.561  0.00  0.00              
HETATM 2839  OR  GLB C  17     -15.461 -27.361   6.033  0.00  0.00              
HETATM 2840  O6h GLB C  17     -14.134 -29.599   4.962  0.00  0.00              
HETATM 2841  H2o GLB C  17     -16.892 -23.589   4.777  0.00  0.00              
HETATM 2842  H6o GLB C  17     -13.158 -29.758   5.421  0.00  0.00              
HETATM 2843  O4h GLB C  17     -15.250 -27.732   3.234  0.00  0.00              
HETATM 2844  H4o GLB C  17     -15.489 -27.430   2.214  0.00  0.00              
HETATM 2845  H5  GLB C  17     -17.134 -28.577   5.874  0.00  0.00              
HETATM 2846  H6S GLB C  17     -15.258 -30.254   6.370  0.00  0.00              
HETATM 2847  H6R GLB C  17     -15.935 -30.471   5.094  0.00  0.00              
HETATM 2848  H1  GLB C  17     -17.131 -26.294   6.715  0.00  0.00              
HETATM 2849  H2  GLB C  17     -15.598 -25.352   4.281  0.00  0.00              
HETATM 2850  H3  GLB C  17     -18.233 -26.860   4.312  0.00  0.00              
HETATM 2851  H4  GLB C  17     -16.983 -28.820   3.479  0.00  0.00              
HETATM 2852  C1  NAG C  18     -18.408 -26.678   1.785  0.00  0.00              
HETATM 2853  C2  NAG C  18     -19.543 -25.606   1.759  0.00  0.00              
HETATM 2854  C3  NAG C  18     -20.616 -26.000   0.695  0.00  0.00              
HETATM 2855  C4  NAG C  18     -19.978 -26.271  -0.683  0.00  0.00              
HETATM 2856  C5  NAG C  18     -18.845 -27.328  -0.567  0.00  0.00              
HETATM 2857  C6  NAG C  18     -18.108 -27.556  -1.900  0.00  0.00              
HETATM 2858  C7  NAG C  18     -20.452 -24.304   3.657  0.00  0.00              
HETATM 2859  C8  NAG C  18     -21.188 -24.362   4.979  0.00  0.00              
HETATM 2860  O3h NAG C  18     -21.598 -24.976   0.522  0.00  0.00              
HETATM 2861  OR  NAG C  18     -21.010 -26.709  -1.561  0.00  0.00              
HETATM 2862  OR  NAG C  18     -17.881 -26.911   0.449  0.00  0.00              
HETATM 2863  O6h NAG C  18     -17.479 -26.361  -2.369  0.00  0.00              
HETATM 2864  OM  NAG C  18     -20.188 -23.223   3.146  0.00  0.00              
HETATM 2865  N15 NAG C  18     -20.182 -25.481   3.098  0.00  0.00              
HETATM 2866  H2  NAG C  18     -19.076 -24.650   1.440  0.00  0.00              
HETATM 2867  H3  NAG C  18     -21.126 -26.927   1.027  0.00  0.00              
HETATM 2868  H4  NAG C  18     -19.542 -25.328  -1.070  0.00  0.00              
HETATM 2869  H5  NAG C  18     -19.295 -28.294  -0.263  0.00  0.00              
HETATM 2870  H6S NAG C  18     -17.353 -28.356  -1.773  0.00  0.00              
HETATM 2871  H6R NAG C  18     -18.826 -27.928  -2.657  0.00  0.00              
HETATM 2872  H8  NAG C  18     -20.806 -23.578   5.656  0.00  0.00              
HETATM 2873  H24 NAG C  18     -21.095 -25.330   5.501  0.00  0.00              
HETATM 2874  H25 NAG C  18     -22.260 -24.160   4.813  0.00  0.00              
HETATM 2875  H3o NAG C  18     -22.075 -24.912   1.355  0.00  0.00              
HETATM 2876  H6o NAG C  18     -17.264 -26.494  -3.297  0.00  0.00              
HETATM 2877  H29 NAG C  18     -20.332 -26.277   3.720  0.00  0.00              
HETATM 2878  H1  NAG C  18     -18.778 -27.634   2.206  0.00  0.00              
HETATM 2879  C1  GLB C  19     -21.180 -25.997  -2.735  0.00  0.00              
HETATM 2880  C2  GLB C  19     -22.122 -26.786  -3.639  0.00  0.00              
HETATM 2881  C3  GLB C  19     -22.575 -25.973  -4.839  0.00  0.00              
HETATM 2882  C4  GLB C  19     -23.103 -24.627  -4.399  0.00  0.00              
HETATM 2883  C5  GLB C  19     -22.064 -23.922  -3.527  0.00  0.00              
HETATM 2884  C6  GLB C  19     -22.485 -22.568  -3.001  0.00  0.00              
HETATM 2885  O2h GLB C  19     -21.448 -27.959  -4.078  0.00  0.00              
HETATM 2886  OW  GLB C  19     -23.617 -26.690  -5.512  0.00  0.00              
HETATM 2887  OR  GLB C  19     -21.814 -24.759  -2.386  0.00  0.00              
HETATM 2888  O6h GLB C  19     -23.665 -22.649  -2.215  0.00  0.00              
HETATM 2889  H2o GLB C  19     -21.691 -28.816  -3.560  0.00  0.00              
HETATM 2890  H6o GLB C  19     -23.819 -22.315  -1.189  0.00  0.00              
HETATM 2891  O4h GLB C  19     -24.314 -24.900  -3.705  0.00  0.00              
HETATM 2892  H4o GLB C  19     -25.009 -25.409  -4.374  0.00  0.00              
HETATM 2893  H5  GLB C  19     -21.189 -23.756  -4.090  0.00  0.00              
HETATM 2894  H6S GLB C  19     -21.957 -21.848  -2.558  0.00  0.00              
HETATM 2895  H6R GLB C  19     -22.689 -21.938  -3.818  0.00  0.00              
HETATM 2896  H1  GLB C  19     -20.234 -25.831  -3.250  0.00  0.00              
HETATM 2897  H2  GLB C  19     -22.990 -27.064  -3.039  0.00  0.00              
HETATM 2898  H3  GLB C  19     -21.725 -25.830  -5.507  0.00  0.00              
HETATM 2899  H4  GLB C  19     -23.305 -23.952  -5.231  0.00  0.00              
HETATM 2900  C1  NAN C  20     -22.082 -27.646  -7.139  0.00  0.00              
HETATM 2901  C2  NAN C  20     -23.450 -26.914  -6.901  0.00  0.00              
HETATM 2902  C3  NAN C  20     -23.593 -25.526  -7.586  0.00  0.00              
HETATM 2903  C4  NAN C  20     -23.857 -25.654  -9.103  0.00  0.00              
HETATM 2904  C5  NAN C  20     -25.063 -26.576  -9.387  0.00  0.00              
HETATM 2905  C6  NAN C  20     -24.893 -27.952  -8.677  0.00  0.00              
HETATM 2906  C7  NAN C  20     -26.136 -28.870  -8.801  0.00  0.00              
HETATM 2907  C8  NAN C  20     -25.881 -30.317  -8.313  0.00  0.00              
HETATM 2908  C9  NAN C  20     -27.099 -31.239  -8.455  0.00  0.00              
HETATM 2909  OW  NAN C  20     -24.608 -27.735  -7.250  0.00  0.00              
HETATM 2910  OM  NAN C  20     -21.137 -27.189  -7.782  0.00  0.00              
HETATM 2911  O1h NAN C  20     -22.036 -28.876  -6.549  0.00  0.00              
HETATM 2912  O4h NAN C  20     -24.118 -24.362  -9.631  0.00  0.00              
HETATM 2913  O7h NAN C  20     -27.192 -28.297  -8.033  0.00  0.00              
HETATM 2914  O8h NAN C  20     -24.846 -30.915  -9.079  0.00  0.00              
HETATM 2915  O9h NAN C  20     -26.758 -32.566  -8.050  0.00  0.00              
HETATM 2916  H6  NAN C  20     -24.035 -28.470  -9.149  0.00  0.00              
HETATM 2917  H3  NAN C  20     -24.438 -24.984  -7.122  0.00  0.00              
HETATM 2918  H21 NAN C  20     -22.698 -24.907  -7.388  0.00  0.00              
HETATM 2919  H4  NAN C  20     -22.956 -26.074  -9.597  0.00  0.00              
HETATM 2920  H7o NAN C  20     -26.744 -27.924  -7.267  0.00  0.00              
HETATM 2921  H8o NAN C  20     -25.019 -31.858  -8.987  0.00  0.00              
HETATM 2922  H4o NAN C  20     -23.430 -23.789  -9.280  0.00  0.00              
HETATM 2923  H9o NAN C  20     -27.575 -33.075  -8.034  0.00  0.00              
HETATM 2924  H9R NAN C  20     -27.459 -31.241  -9.503  0.00  0.00              
HETATM 2925  H9S NAN C  20     -27.937 -30.855  -7.841  0.00  0.00              
HETATM 2926  H8  NAN C  20     -25.572 -30.295  -7.249  0.00  0.00              
HETATM 2927  H7  NAN C  20     -26.442 -28.913  -9.866  0.00  0.00              
HETATM 2928  H1o NAN C  20     -21.189 -29.268  -6.759  0.00  0.00              
HETATM 2929  H5  NAN C  20     -25.985 -26.089  -9.012  0.00  0.00              
HETATM 2930  N33 NAN C  20     -25.163 -26.742 -10.819  0.00  0.00              
HETATM 2931  C34 NAN C  20     -25.990 -25.926 -11.548  0.00  0.00              
HETATM 2932  C35 NAN C  20     -25.996 -26.224 -13.035  0.00  0.00              
HETATM 2933  OM  NAN C  20     -26.672 -25.039 -11.071  0.00  0.00              
HETATM 2934  H37 NAN C  20     -24.614 -27.474 -11.293  0.00  0.00              
HETATM 2935  H35 NAN C  20     -26.675 -25.527 -13.577  0.00  0.00              
HETATM 2936  H39 NAN C  20     -26.351 -27.264 -13.219  0.00  0.00              
HETATM 2937  H40 NAN C  20     -24.973 -26.107 -13.459  0.00  0.00              
HETATM 2938  C1  AFL C  21      -1.563 -16.731  12.678  0.00  0.00              
HETATM 2939  C2  AFL C  21      -2.032 -15.445  13.384  0.00  0.00              
HETATM 2940  C3  AFL C  21      -3.150 -15.759  14.389  0.00  0.00              
HETATM 2941  C4  AFL C  21      -2.684 -16.874  15.340  0.00  0.00              
HETATM 2942  C5  AFL C  21      -2.217 -18.089  14.524  0.00  0.00              
HETATM 2943  C6  AFL C  21      -1.689 -19.242  15.385  0.00  0.00              
HETATM 2944  OR  AFL C  21      -1.166 -17.734  13.617  0.00  0.00              
HETATM 2945  O2h AFL C  21      -2.397 -14.500  12.382  0.00  0.00              
HETATM 2946  O3h AFL C  21      -3.525 -14.562  15.065  0.00  0.00              
HETATM 2947  O4h AFL C  21      -1.600 -16.449  16.165  0.00  0.00              
HETATM 2948  H5  AFL C  21      -3.085 -18.476  13.957  0.00  0.00              
HETATM 2949  H1  AFL C  21      -0.667 -16.518  12.083  0.00  0.00              
HETATM 2950  H2  AFL C  21      -1.169 -15.041  13.949  0.00  0.00              
HETATM 2951  H2o AFL C  21      -2.548 -13.663  12.839  0.00  0.00              
HETATM 2952  H3  AFL C  21      -4.026 -16.126  13.820  0.00  0.00              
HETATM 2953  H3o AFL C  21      -4.349 -14.757  15.531  0.00  0.00              
HETATM 2954  H4  AFL C  21      -3.520 -17.186  15.995  0.00  0.00              
HETATM 2955  H4o AFL C  21      -1.950 -15.754  16.739  0.00  0.00              
HETATM 2956  H6  AFL C  21      -2.431 -19.574  16.130  0.00  0.00              
HETATM 2957  H22 AFL C  21      -1.437 -20.104  14.747  0.00  0.00              
HETATM 2958  H23 AFL C  21      -0.774 -18.944  15.920  0.00  0.00              
HETATM 2959  C1  NAG D   1     -15.124  -5.504  -1.675  0.00  0.00              
HETATM 2960  C2  NAG D   1     -14.954  -5.693  -3.216  0.00  0.00              
HETATM 2961  C3  NAG D   1     -16.351  -5.656  -3.909  0.00  0.00              
HETATM 2962  C4  NAG D   1     -17.336  -6.650  -3.260  0.00  0.00              
HETATM 2963  C5  NAG D   1     -17.430  -6.411  -1.728  0.00  0.00              
HETATM 2964  C6  NAG D   1     -18.322  -7.448  -1.019  0.00  0.00              
HETATM 2965  C7  NAG D   1     -13.105  -4.893  -4.653  0.00  0.00              
HETATM 2966  C8  NAG D   1     -12.375  -3.685  -5.202  0.00  0.00              
HETATM 2967  O3h NAG D   1     -16.267  -5.978  -5.299  0.00  0.00              
HETATM 2968  OR  NAG D   1     -18.600  -6.484  -3.890  0.00  0.00              
HETATM 2969  OR  NAG D   1     -16.093  -6.446  -1.139  0.00  0.00              
HETATM 2970  O6h NAG D   1     -17.818  -8.776  -1.175  0.00  0.00              
HETATM 2971  OM  NAG D   1     -12.820  -6.017  -5.050  0.00  0.00              
HETATM 2972  N15 NAG D   1     -14.079  -4.632  -3.786  0.00  0.00              
HETATM 2973  H2  NAG D   1     -14.519  -6.704  -3.370  0.00  0.00              
HETATM 2974  H3  NAG D   1     -16.774  -4.636  -3.807  0.00  0.00              
HETATM 2975  H4  NAG D   1     -16.971  -7.683  -3.434  0.00  0.00              
HETATM 2976  H5  NAG D   1     -17.875  -5.412  -1.554  0.00  0.00              
HETATM 2977  H6S NAG D   1     -18.399  -7.197   0.056  0.00  0.00              
HETATM 2978  H6R NAG D   1     -19.351  -7.384  -1.424  0.00  0.00              
HETATM 2979  H8  NAG D   1     -11.300  -3.911  -5.307  0.00  0.00              
HETATM 2980  H24 NAG D   1     -12.468  -2.783  -4.572  0.00  0.00              
HETATM 2981  H25 NAG D   1     -12.762  -3.446  -6.208  0.00  0.00              
HETATM 2982  H3o NAG D   1     -15.758  -5.273  -5.712  0.00  0.00              
HETATM 2983  H6o NAG D   1     -18.527  -9.383  -0.945  0.00  0.00              
HETATM 2984  H29 NAG D   1     -14.083  -3.667  -3.451  0.00  0.00              
HETATM 2985  H1  NAG D   1     -15.446  -4.470  -1.439  0.00  0.00              
HETATM 2986  C1  NAG D   2     -19.189  -7.638  -4.471  0.00  0.00              
HETATM 2987  C2  NAG D   2     -20.706  -7.401  -4.757  0.00  0.00              
HETATM 2988  C3  NAG D   2     -21.265  -8.567  -5.630  0.00  0.00              
HETATM 2989  C4  NAG D   2     -20.416  -8.788  -6.898  0.00  0.00              
HETATM 2990  C5  NAG D   2     -18.921  -8.991  -6.531  0.00  0.00              
HETATM 2991  C6  NAG D   2     -18.016  -9.112  -7.771  0.00  0.00              
HETATM 2992  C7  NAG D   2     -22.393  -6.370  -3.269  0.00  0.00              
HETATM 2993  C8  NAG D   2     -23.145  -6.481  -1.959  0.00  0.00              
HETATM 2994  O3h NAG D   2     -22.611  -8.324  -6.050  0.00  0.00              
HETATM 2995  OR  NAG D   2     -20.942  -9.921  -7.582  0.00  0.00              
HETATM 2996  OR  NAG D   2     -18.458  -7.877  -5.705  0.00  0.00              
HETATM 2997  O6h NAG D   2     -18.061  -7.932  -8.577  0.00  0.00              
HETATM 2998  OM  NAG D   2     -22.680  -5.490  -4.071  0.00  0.00              
HETATM 2999  N15 NAG D   2     -21.475  -7.308  -3.485  0.00  0.00              
HETATM 3000  H2  NAG D   2     -20.780  -6.463  -5.346  0.00  0.00              
HETATM 3001  H3  NAG D   2     -21.245  -9.503  -5.035  0.00  0.00              
HETATM 3002  H4  NAG D   2     -20.501  -7.894  -7.548  0.00  0.00              
HETATM 3003  H5  NAG D   2     -18.825  -9.931  -5.952  0.00  0.00              
HETATM 3004  H6S NAG D   2     -16.975  -9.311  -7.453  0.00  0.00              
HETATM 3005  H6R NAG D   2     -18.328  -9.990  -8.369  0.00  0.00              
HETATM 3006  H8  NAG D   2     -23.323  -5.475  -1.542  0.00  0.00              
HETATM 3007  H24 NAG D   2     -22.619  -7.074  -1.190  0.00  0.00              
HETATM 3008  H25 NAG D   2     -24.131  -6.943  -2.138  0.00  0.00              
HETATM 3009  H3o NAG D   2     -23.149  -8.320  -5.252  0.00  0.00              
HETATM 3010  H6o NAG D   2     -17.696  -8.156  -9.438  0.00  0.00              
HETATM 3011  H29 NAG D   2     -21.258  -7.869  -2.660  0.00  0.00              
HETATM 3012  H1  NAG D   2     -19.047  -8.498  -3.787  0.00  0.00              
HETATM 3013  C1  BMA D   3     -21.316  -9.739  -8.901  0.00  0.00              
HETATM 3014  C2  BMA D   3     -21.577 -11.111  -9.516  0.00  0.00              
HETATM 3015  C3  BMA D   3     -22.238 -11.009 -10.880  0.00  0.00              
HETATM 3016  C4  BMA D   3     -23.448 -10.107 -10.816  0.00  0.00              
HETATM 3017  C5  BMA D   3     -23.057  -8.758 -10.212  0.00  0.00              
HETATM 3018  C6  BMA D   3     -24.193  -7.768 -10.072  0.00  0.00              
HETATM 3019  OW  BMA D   3     -22.651 -12.319 -11.289  0.00  0.00              
HETATM 3020  O4h BMA D   3     -23.982  -9.876 -12.111  0.00  0.00              
HETATM 3021  OR  BMA D   3     -22.546  -9.004  -8.892  0.00  0.00              
HETATM 3022  OW  BMA D   3     -23.923  -6.552 -10.753  0.00  0.00              
HETATM 3023  H4o BMA D   3     -24.799 -10.572 -12.299  0.00  0.00              
HETATM 3024  O2h BMA D   3     -22.413 -11.853  -8.636  0.00  0.00              
HETATM 3025  H2o BMA D   3     -23.374 -11.348  -8.536  0.00  0.00              
HETATM 3026  H5  BMA D   3     -22.340  -8.292 -10.830  0.00  0.00              
HETATM 3027  H6  BMA D   3     -25.177  -7.886 -10.184  0.00  0.00              
HETATM 3028  H20 BMA D   3     -24.319  -7.542  -9.053  0.00  0.00              
HETATM 3029  H2  BMA D   3     -20.612 -11.608  -9.615  0.00  0.00              
HETATM 3030  H3  BMA D   3     -21.518 -10.603 -11.590  0.00  0.00              
HETATM 3031  H1  BMA D   3     -20.546  -9.224  -9.476  0.00  0.00              
HETATM 3032  H4  BMA D   3     -24.197 -10.600 -10.196  0.00  0.00              
HETATM 3033  C1  MAN D   4     -22.218 -12.762 -12.570  0.00  0.00              
HETATM 3034  C2  MAN D   4     -22.903 -14.022 -13.088  0.00  0.00              
HETATM 3035  C3  MAN D   4     -22.532 -15.250 -12.273  0.00  0.00              
HETATM 3036  C4  MAN D   4     -21.031 -15.359 -12.135  0.00  0.00              
HETATM 3037  C5  MAN D   4     -20.465 -14.051 -11.582  0.00  0.00              
HETATM 3038  C6  MAN D   4     -18.961 -14.026 -11.418  0.00  0.00              
HETATM 3039  O3h MAN D   4     -23.027 -16.414 -12.946  0.00  0.00              
HETATM 3040  OR  MAN D   4     -20.677 -16.408 -11.247  0.00  0.00              
HETATM 3041  OR  MAN D   4     -20.806 -13.004 -12.505  0.00  0.00              
HETATM 3042  O6h MAN D   4     -18.290 -14.252 -12.647  0.00  0.00              
HETATM 3043  H3o MAN D   4     -23.835 -16.749 -12.296  0.00  0.00              
HETATM 3044  H6o MAN D   4     -17.544 -13.626 -13.137  0.00  0.00              
HETATM 3045  OW  MAN D   4     -22.526 -14.220 -14.446  0.00  0.00              
HETATM 3046  H5  MAN D   4     -20.865 -13.875 -10.622  0.00  0.00              
HETATM 3047  H6S MAN D   4     -18.368 -13.379 -10.942  0.00  0.00              
HETATM 3048  H6R MAN D   4     -18.682 -14.793 -10.756  0.00  0.00              
HETATM 3049  H1  MAN D   4     -22.447 -11.925 -13.230  0.00  0.00              
HETATM 3050  H2  MAN D   4     -23.978 -13.855 -13.024  0.00  0.00              
HETATM 3051  H3  MAN D   4     -22.984 -15.166 -11.285  0.00  0.00              
HETATM 3052  H4  MAN D   4     -20.621 -15.566 -13.123  0.00  0.00              
HETATM 3053  C1  NAG D   5     -23.292 -13.546 -15.431  0.00  0.00              
HETATM 3054  C2  NAG D   5     -22.376 -13.037 -16.590  0.00  0.00              
HETATM 3055  C3  NAG D   5     -23.258 -12.542 -17.780  0.00  0.00              
HETATM 3056  C4  NAG D   5     -24.283 -13.611 -18.212  0.00  0.00              
HETATM 3057  C5  NAG D   5     -25.135 -14.079 -17.002  0.00  0.00              
HETATM 3058  C6  NAG D   5     -26.102 -15.222 -17.363  0.00  0.00              
HETATM 3059  C7  NAG D   5     -20.198 -11.878 -16.413  0.00  0.00              
HETATM 3060  C8  NAG D   5     -19.472 -10.638 -15.935  0.00  0.00              
HETATM 3061  O3h NAG D   5     -22.471 -12.209 -18.926  0.00  0.00              
HETATM 3062  OR  NAG D   5     -25.096 -13.043 -19.233  0.00  0.00              
HETATM 3063  OR  NAG D   5     -24.256 -14.518 -15.920  0.00  0.00              
HETATM 3064  O6h NAG D   5     -25.404 -16.383 -17.820  0.00  0.00              
HETATM 3065  OM  NAG D   5     -19.602 -12.725 -17.068  0.00  0.00              
HETATM 3066  N15 NAG D   5     -21.495 -11.932 -16.122  0.00  0.00              
HETATM 3067  H2  NAG D   5     -21.785 -13.910 -16.940  0.00  0.00              
HETATM 3068  H3  NAG D   5     -23.815 -11.638 -17.461  0.00  0.00              
HETATM 3069  H4  NAG D   5     -23.738 -14.486 -18.622  0.00  0.00              
HETATM 3070  H5  NAG D   5     -25.743 -13.223 -16.648  0.00  0.00              
HETATM 3071  H6S NAG D   5     -26.721 -15.476 -16.482  0.00  0.00              
HETATM 3072  H6R NAG D   5     -26.806 -14.873 -18.143  0.00  0.00              
HETATM 3073  H8  NAG D   5     -18.459 -10.905 -15.588  0.00  0.00              
HETATM 3074  H24 NAG D   5     -19.981 -10.112 -15.108  0.00  0.00              
HETATM 3075  H25 NAG D   5     -19.357  -9.931 -16.775  0.00  0.00              
HETATM 3076  H3o NAG D   5     -21.931 -11.453 -18.676  0.00  0.00              
HETATM 3077  H6o NAG D   5     -26.043 -16.948 -18.262  0.00  0.00              
HETATM 3078  H29 NAG D   5     -21.795 -11.227 -15.447  0.00  0.00              
HETATM 3079  H1  NAG D   5     -23.830 -12.700 -14.957  0.00  0.00              
HETATM 3080  C1  GLB D   6     -25.163 -13.724 -20.436  0.00  0.00              
HETATM 3081  C2  GLB D   6     -26.286 -13.114 -21.269  0.00  0.00              
HETATM 3082  C3  GLB D   6     -26.272 -13.618 -22.702  0.00  0.00              
HETATM 3083  C4  GLB D   6     -24.892 -13.474 -23.301  0.00  0.00              
HETATM 3084  C5  GLB D   6     -23.861 -14.146 -22.395  0.00  0.00              
HETATM 3085  C6  GLB D   6     -22.430 -14.049 -22.877  0.00  0.00              
HETATM 3086  O2h GLB D   6     -27.527 -13.438 -20.656  0.00  0.00              
HETATM 3087  OW  GLB D   6     -27.202 -12.844 -23.469  0.00  0.00              
HETATM 3088  OR  GLB D   6     -23.919 -13.499 -21.114  0.00  0.00              
HETATM 3089  O6h GLB D   6     -22.008 -12.702 -23.016  0.00  0.00              
HETATM 3090  H2o GLB D   6     -27.935 -12.685 -20.082  0.00  0.00              
HETATM 3091  H6o GLB D   6     -21.148 -12.211 -22.558  0.00  0.00              
HETATM 3092  O4h GLB D   6     -24.680 -12.074 -23.439  0.00  0.00              
HETATM 3093  H4o GLB D   6     -25.448 -11.652 -24.086  0.00  0.00              
HETATM 3094  H5  GLB D   6     -24.074 -15.176 -22.325  0.00  0.00              
HETATM 3095  H6S GLB D   6     -21.607 -14.523 -22.572  0.00  0.00              
HETATM 3096  H6R GLB D   6     -22.361 -14.504 -23.823  0.00  0.00              
HETATM 3097  H1  GLB D   6     -25.353 -14.788 -20.291  0.00  0.00              
HETATM 3098  H2  GLB D   6     -26.144 -12.033 -21.262  0.00  0.00              
HETATM 3099  H3  GLB D   6     -26.563 -14.669 -22.707  0.00  0.00              
HETATM 3100  H4  GLB D   6     -24.795 -13.954 -24.275  0.00  0.00              
HETATM 3101  C1  GLA D   7     -27.908 -13.521 -24.502  0.00  0.00              
HETATM 3102  C2  GLA D   7     -28.582 -12.617 -25.529  0.00  0.00              
HETATM 3103  C3  GLA D   7     -29.735 -11.831 -24.928  0.00  0.00              
HETATM 3104  C4  GLA D   7     -30.674 -12.752 -24.184  0.00  0.00              
HETATM 3105  C5  GLA D   7     -29.889 -13.582 -23.168  0.00  0.00              
HETATM 3106  C6  GLA D   7     -30.719 -14.565 -22.370  0.00  0.00              
HETATM 3107  O2h GLA D   7     -27.609 -11.722 -26.050  0.00  0.00              
HETATM 3108  OW  GLA D   7     -30.452 -11.185 -25.987  0.00  0.00              
HETATM 3109  OR  GLA D   7     -28.910 -14.344 -23.890  0.00  0.00              
HETATM 3110  O6h GLA D   7     -31.382 -15.500 -23.208  0.00  0.00              
HETATM 3111  H2o GLA D   7     -27.200 -12.006 -27.020  0.00  0.00              
HETATM 3112  H6o GLA D   7     -31.335 -16.588 -23.178  0.00  0.00              
HETATM 3113  O4h GLA D   7     -31.299 -13.548 -25.183  0.00  0.00              
HETATM 3114  H4o GLA D   7     -31.834 -12.903 -25.881  0.00  0.00              
HETATM 3115  H5  GLA D   7     -29.442 -12.939 -22.461  0.00  0.00              
HETATM 3116  H6S GLA D   7     -30.494 -15.097 -21.557  0.00  0.00              
HETATM 3117  H6R GLA D   7     -31.455 -14.033 -21.841  0.00  0.00              
HETATM 3118  H1  GLA D   7     -27.144 -14.124 -24.993  0.00  0.00              
HETATM 3119  H2  GLA D   7     -28.957 -13.258 -26.327  0.00  0.00              
HETATM 3120  H3  GLA D   7     -29.332 -11.088 -24.239  0.00  0.00              
HETATM 3121  H4  GLA D   7     -31.436 -12.220 -23.614  0.00  0.00              
HETATM 3122  C1  NGA D   8     -31.148 -10.033 -25.663  0.00  0.00              
HETATM 3123  C2  NGA D   8     -30.407  -8.843 -26.263  0.00  0.00              
HETATM 3124  C3  NGA D   8     -31.222  -7.563 -26.183  0.00  0.00              
HETATM 3125  C4  NGA D   8     -32.611  -7.786 -26.737  0.00  0.00              
HETATM 3126  C5  NGA D   8     -33.261  -8.982 -26.041  0.00  0.00              
HETATM 3127  C6  NGA D   8     -34.653  -9.323 -26.526  0.00  0.00              
HETATM 3128  OW  NGA D   8     -30.566  -6.551 -26.956  0.00  0.00              
HETATM 3129  OR  NGA D   8     -32.434 -10.132 -26.288  0.00  0.00              
HETATM 3130  O6h NGA D   8     -34.673  -9.621 -27.913  0.00  0.00              
HETATM 3131  H6o NGA D   8     -35.039 -10.521 -28.407  0.00  0.00              
HETATM 3132  O4h NGA D   8     -32.439  -7.984 -28.134  0.00  0.00              
HETATM 3133  H4o NGA D   8     -31.966  -7.106 -28.571  0.00  0.00              
HETATM 3134  H5  NGA D   8     -33.354  -8.780 -25.009  0.00  0.00              
HETATM 3135  H6S NGA D   8     -35.344  -9.934 -26.144  0.00  0.00              
HETATM 3136  H6R NGA D   8     -35.277  -8.492 -26.369  0.00  0.00              
HETATM 3137  H1  NGA D   8     -31.236  -9.901 -24.585  0.00  0.00              
HETATM 3138  H2  NGA D   8     -30.204  -9.081 -27.307  0.00  0.00              
HETATM 3139  H3  NGA D   8     -31.291  -7.255 -25.140  0.00  0.00              
HETATM 3140  H4  NGA D   8     -33.281  -6.942 -26.568  0.00  0.00              
HETATM 3141  N23 NGA D   8     -29.160  -8.673 -25.551  0.00  0.00              
HETATM 3142  C24 NGA D   8     -28.022  -8.327 -26.234  0.00  0.00              
HETATM 3143  C25 NGA D   8     -26.793  -8.192 -25.356  0.00  0.00              
HETATM 3144  OM  NGA D   8     -27.973  -8.144 -27.434  0.00  0.00              
HETATM 3145  H27 NGA D   8     -29.127  -8.812 -24.531  0.00  0.00              
HETATM 3146  H25 NGA D   8     -25.904  -7.901 -25.960  0.00  0.00              
HETATM 3147  H29 NGA D   8     -26.568  -9.161 -24.856  0.00  0.00              
HETATM 3148  H30 NGA D   8     -26.954  -7.409 -24.580  0.00  0.00              
HETATM 3149  C1  AFL D   9     -30.179  -5.361 -26.270  0.00  0.00              
HETATM 3150  C2  AFL D   9     -29.295  -4.416 -27.105  0.00  0.00              
HETATM 3151  C3  AFL D   9     -30.116  -3.756 -28.223  0.00  0.00              
HETATM 3152  C4  AFL D   9     -31.363  -3.092 -27.618  0.00  0.00              
HETATM 3153  C5  AFL D   9     -32.148  -4.122 -26.789  0.00  0.00              
HETATM 3154  C6  AFL D   9     -33.391  -3.541 -26.105  0.00  0.00              
HETATM 3155  OR  AFL D   9     -31.332  -4.689 -25.757  0.00  0.00              
HETATM 3156  O2h AFL D   9     -28.170  -5.159 -27.568  0.00  0.00              
HETATM 3157  O3h AFL D   9     -29.286  -2.849 -28.943  0.00  0.00              
HETATM 3158  O4h AFL D   9     -31.021  -2.001 -26.764  0.00  0.00              
HETATM 3159  H5  AFL D   9     -32.495  -4.920 -27.472  0.00  0.00              
HETATM 3160  H1  AFL D   9     -29.623  -5.703 -25.389  0.00  0.00              
HETATM 3161  H2  AFL D   9     -28.933  -3.616 -26.431  0.00  0.00              
HETATM 3162  H2o AFL D   9     -27.564  -4.519 -27.963  0.00  0.00              
HETATM 3163  H3  AFL D   9     -30.444  -4.552 -28.918  0.00  0.00              
HETATM 3164  H3o AFL D   9     -29.771  -2.610 -29.744  0.00  0.00              
HETATM 3165  H4  AFL D   9     -32.019  -2.712 -28.424  0.00  0.00              
HETATM 3166  H4o AFL D   9     -30.622  -1.326 -27.329  0.00  0.00              
HETATM 3167  H6  AFL D   9     -34.074  -3.065 -26.826  0.00  0.00              
HETATM 3168  H22 AFL D   9     -33.944  -4.342 -25.587  0.00  0.00              
HETATM 3169  H23 AFL D   9     -33.108  -2.791 -25.351  0.00  0.00              
HETATM 3170  C1  NAG D  10     -19.826 -17.424 -11.755  0.00  0.00              
HETATM 3171  C2  NAG D  10     -19.209 -18.264 -10.592  0.00  0.00              
HETATM 3172  C3  NAG D  10     -18.501 -19.527 -11.171  0.00  0.00              
HETATM 3173  C4  NAG D  10     -19.438 -20.332 -12.096  0.00  0.00              
HETATM 3174  C5  NAG D  10     -20.027 -19.423 -13.209  0.00  0.00              
HETATM 3175  C6  NAG D  10     -21.051 -20.156 -14.096  0.00  0.00              
HETATM 3176  C7  NAG D  10     -18.209 -17.439  -8.483  0.00  0.00              
HETATM 3177  C8  NAG D  10     -17.093 -16.631  -7.856  0.00  0.00              
HETATM 3178  O3h NAG D  10     -18.052 -20.410 -10.140  0.00  0.00              
HETATM 3179  OR  NAG D  10     -18.687 -21.408 -12.647  0.00  0.00              
HETATM 3180  OR  NAG D  10     -20.664 -18.253 -12.607  0.00  0.00              
HETATM 3181  O6h NAG D  10     -22.171 -20.620 -13.338  0.00  0.00              
HETATM 3182  OM  NAG D  10     -18.987 -18.068  -7.775  0.00  0.00              
HETATM 3183  N15 NAG D  10     -18.234 -17.451  -9.814  0.00  0.00              
HETATM 3184  H2  NAG D  10     -20.054 -18.603  -9.956  0.00  0.00              
HETATM 3185  H3  NAG D  10     -17.623 -19.206 -11.767  0.00  0.00              
HETATM 3186  H4  NAG D  10     -20.275 -20.739 -11.493  0.00  0.00              
HETATM 3187  H5  NAG D  10     -19.198 -19.084 -13.862  0.00  0.00              
HETATM 3188  H6S NAG D  10     -21.393 -19.480 -14.903  0.00  0.00              
HETATM 3189  H6R NAG D  10     -20.555 -21.009 -14.598  0.00  0.00              
HETATM 3190  H8  NAG D  10     -17.463 -16.115  -6.953  0.00  0.00              
HETATM 3191  H24 NAG D  10     -16.664 -15.866  -8.526  0.00  0.00              
HETATM 3192  H25 NAG D  10     -16.281 -17.308  -7.539  0.00  0.00              
HETATM 3193  H3o NAG D  10     -17.371 -19.935  -9.652  0.00  0.00              
HETATM 3194  H6o NAG D  10     -22.631 -21.271 -13.875  0.00  0.00              
HETATM 3195  H29 NAG D  10     -17.617 -16.759 -10.242  0.00  0.00              
HETATM 3196  H1  NAG D  10     -19.029 -16.955 -12.368  0.00  0.00              
HETATM 3197  C1  GLB D  11     -19.184 -22.685 -12.455  0.00  0.00              
HETATM 3198  C2  GLB D  11     -18.399 -23.640 -13.349  0.00  0.00              
HETATM 3199  C3  GLB D  11     -18.694 -25.095 -13.025  0.00  0.00              
HETATM 3200  C4  GLB D  11     -18.542 -25.349 -11.543  0.00  0.00              
HETATM 3201  C5  GLB D  11     -19.393 -24.352 -10.755  0.00  0.00              
HETATM 3202  C6  GLB D  11     -19.308 -24.487  -9.251  0.00  0.00              
HETATM 3203  O2h GLB D  11     -18.737 -23.372 -14.703  0.00  0.00              
HETATM 3204  OW  GLB D  11     -17.768 -25.921 -13.739  0.00  0.00              
HETATM 3205  OR  GLB D  11     -18.934 -23.031 -11.087  0.00  0.00              
HETATM 3206  O6h GLB D  11     -17.981 -24.324  -8.779  0.00  0.00              
HETATM 3207  H2o GLB D  11     -18.053 -22.793 -15.213  0.00  0.00              
HETATM 3208  H6o GLB D  11     -17.608 -23.620  -8.033  0.00  0.00              
HETATM 3209  O4h GLB D  11     -17.152 -25.222 -11.273  0.00  0.00              
HETATM 3210  H4o GLB D  11     -16.598 -25.950 -11.866  0.00  0.00              
HETATM 3211  H5  GLB D  11     -20.410 -24.487 -11.003  0.00  0.00              
HETATM 3212  H6S GLB D  11     -19.866 -24.086  -8.529  0.00  0.00              
HETATM 3213  H6R GLB D  11     -19.626 -25.453  -8.982  0.00  0.00              
HETATM 3214  H1  GLB D  11     -20.245 -22.747 -12.698  0.00  0.00              
HETATM 3215  H2  GLB D  11     -17.340 -23.440 -13.188  0.00  0.00              
HETATM 3216  H3  GLB D  11     -19.715 -25.323 -13.330  0.00  0.00              
HETATM 3217  H4  GLB D  11     -18.883 -26.338 -11.238  0.00  0.00              
HETATM 3218  C1  GLA D  12     -18.249 -27.174 -14.211  0.00  0.00              
HETATM 3219  C2  GLA D  12     -17.172 -28.176 -14.617  0.00  0.00              
HETATM 3220  C3  GLA D  12     -16.417 -27.728 -15.857  0.00  0.00              
HETATM 3221  C4  GLA D  12     -17.381 -27.357 -16.960  0.00  0.00              
HETATM 3222  C5  GLA D  12     -18.389 -26.331 -16.443  0.00  0.00              
HETATM 3223  C6  GLA D  12     -19.429 -25.895 -17.452  0.00  0.00              
HETATM 3224  O2h GLA D  12     -16.266 -28.328 -13.531  0.00  0.00              
HETATM 3225  OW  GLA D  12     -15.586 -28.808 -16.302  0.00  0.00              
HETATM 3226  OR  GLA D  12     -19.094 -26.929 -15.342  0.00  0.00              
HETATM 3227  O6h GLA D  12     -20.196 -26.989 -17.930  0.00  0.00              
HETATM 3228  H2o GLA D  12     -16.432 -29.216 -12.921  0.00  0.00              
HETATM 3229  H6o GLA D  12     -21.278 -27.114 -17.916  0.00  0.00              
HETATM 3230  O4h GLA D  12     -17.991 -28.578 -17.362  0.00  0.00              
HETATM 3231  H4o GLA D  12     -17.224 -29.270 -17.711  0.00  0.00              
HETATM 3232  H5  GLA D  12     -17.880 -25.455 -16.152  0.00  0.00              
HETATM 3233  H6S GLA D  12     -20.083 -25.141 -17.428  0.00  0.00              
HETATM 3234  H6R GLA D  12     -18.938 -25.465 -18.276  0.00  0.00              
HETATM 3235  H1  GLA D  12     -18.818 -27.572 -13.371  0.00  0.00              
HETATM 3236  H2  GLA D  12     -17.670 -29.123 -14.816  0.00  0.00              
HETATM 3237  H3  GLA D  12     -15.804 -26.864 -15.602  0.00  0.00              
HETATM 3238  H4  GLA D  12     -16.894 -26.893 -17.818  0.00  0.00              
HETATM 3239  C1  NGA D  13     -14.457 -28.474 -17.028  0.00  0.00              
HETATM 3240  C2  NGA D  13     -13.236 -28.709 -16.144  0.00  0.00              
HETATM 3241  C3  NGA D  13     -11.938 -28.618 -16.927  0.00  0.00              
HETATM 3242  C4  NGA D  13     -12.001 -29.488 -18.161  0.00  0.00              
HETATM 3243  C5  NGA D  13     -13.246 -29.142 -18.977  0.00  0.00              
HETATM 3244  C6  NGA D  13     -13.436 -29.966 -20.232  0.00  0.00              
HETATM 3245  OW  NGA D  13     -10.864 -29.065 -16.092  0.00  0.00              
HETATM 3246  OR  NGA D  13     -14.392 -29.373 -18.142  0.00  0.00              
HETATM 3247  O6h NGA D  13     -13.532 -31.352 -19.946  0.00  0.00              
HETATM 3248  H6o NGA D  13     -14.330 -32.046 -20.211  0.00  0.00              
HETATM 3249  O4h NGA D  13     -12.008 -30.828 -17.684  0.00  0.00              
HETATM 3250  H4o NGA D  13     -11.102 -31.012 -17.105  0.00  0.00              
HETATM 3251  H5  NGA D  13     -13.189 -28.138 -19.295  0.00  0.00              
HETATM 3252  H6S NGA D  13     -14.056 -29.842 -21.005  0.00  0.00              
HETATM 3253  H6R NGA D  13     -12.603 -29.826 -20.857  0.00  0.00              
HETATM 3254  H1  NGA D  13     -14.475 -27.434 -17.353  0.00  0.00              
HETATM 3255  H2  NGA D  13     -13.333 -29.708 -15.716  0.00  0.00              
HETATM 3256  H3  NGA D  13     -11.778 -27.580 -17.223  0.00  0.00              
HETATM 3257  H4  NGA D  13     -11.154 -29.346 -18.832  0.00  0.00              
HETATM 3258  N23 NGA D  13     -13.239 -27.725 -15.086  0.00  0.00              
HETATM 3259  C24 NGA D  13     -12.863 -28.080 -13.817  0.00  0.00              
HETATM 3260  C25 NGA D  13     -12.923 -26.944 -12.813  0.00  0.00              
HETATM 3261  OM  NGA D  13     -12.514 -29.199 -13.494  0.00  0.00              
HETATM 3262  H27 NGA D  13     -13.523 -26.755 -15.286  0.00  0.00              
HETATM 3263  H25 NGA D  13     -12.599 -27.288 -11.804  0.00  0.00              
HETATM 3264  H29 NGA D  13     -13.965 -26.560 -12.729  0.00  0.00              
HETATM 3265  H30 NGA D  13     -12.251 -26.113 -13.127  0.00  0.00              
HETATM 3266  C1  AFL D  14      -9.807 -28.139 -15.843  0.00  0.00              
HETATM 3267  C2  AFL D  14      -8.803 -28.606 -14.772  0.00  0.00              
HETATM 3268  C3  AFL D  14      -7.945 -29.763 -15.306  0.00  0.00              
HETATM 3269  C4  AFL D  14      -7.306 -29.352 -16.642  0.00  0.00              
HETATM 3270  C5  AFL D  14      -8.399 -28.882 -17.616  0.00  0.00              
HETATM 3271  C6  AFL D  14      -7.854 -28.407 -18.968  0.00  0.00              
HETATM 3272  OR  AFL D  14      -9.151 -27.794 -17.066  0.00  0.00              
HETATM 3273  O2h AFL D  14      -9.534 -28.919 -13.590  0.00  0.00              
HETATM 3274  O3h AFL D  14      -6.992 -30.138 -14.316  0.00  0.00              
HETATM 3275  O4h AFL D  14      -6.369 -28.289 -16.477  0.00  0.00              
HETATM 3276  H5  AFL D  14      -9.071 -29.738 -17.818  0.00  0.00              
HETATM 3277  H1  AFL D  14     -10.301 -27.219 -15.507  0.00  0.00              
HETATM 3278  H2  AFL D  14      -8.129 -27.755 -14.555  0.00  0.00              
HETATM 3279  H2o AFL D  14      -8.878 -29.069 -12.897  0.00  0.00              
HETATM 3280  H3  AFL D  14      -8.615 -30.626 -15.487  0.00  0.00              
HETATM 3281  H3o AFL D  14      -6.615 -30.980 -14.604  0.00  0.00              
HETATM 3282  H4  AFL D  14      -6.779 -30.216 -17.090  0.00  0.00              
HETATM 3283  H4o AFL D  14      -5.643 -28.644 -15.946  0.00  0.00              
HETATM 3284  H6  AFL D  14      -7.242 -29.180 -19.460  0.00  0.00              
HETATM 3285  H22 AFL D  14      -8.687 -28.150 -19.642  0.00  0.00              
HETATM 3286  H23 AFL D  14      -7.235 -27.504 -18.846  0.00  0.00              
HETATM 3287  C1  MAN D  15     -24.672  -5.411 -10.354  0.00  0.00              
HETATM 3288  C2  MAN D  15     -26.096  -5.343 -10.899  0.00  0.00              
HETATM 3289  C3  MAN D  15     -26.122  -5.135 -12.404  0.00  0.00              
HETATM 3290  C4  MAN D  15     -25.243  -3.968 -12.791  0.00  0.00              
HETATM 3291  C5  MAN D  15     -23.841  -4.162 -12.215  0.00  0.00              
HETATM 3292  C6  MAN D  15     -22.868  -3.043 -12.516  0.00  0.00              
HETATM 3293  O3h MAN D  15     -27.471  -4.861 -12.805  0.00  0.00              
HETATM 3294  OR  MAN D  15     -25.133  -3.860 -14.202  0.00  0.00              
HETATM 3295  OR  MAN D  15     -23.964  -4.240 -10.785  0.00  0.00              
HETATM 3296  OW  MAN D  15     -21.707  -3.515 -13.183  0.00  0.00              
HETATM 3297  H3o MAN D  15     -27.752  -5.760 -13.351  0.00  0.00              
HETATM 3298  OW  MAN D  15     -26.779  -4.274 -10.257  0.00  0.00              
HETATM 3299  H5  MAN D  15     -23.413  -5.036 -12.621  0.00  0.00              
HETATM 3300  H6  MAN D  15     -23.016  -2.140 -12.914  0.00  0.00              
HETATM 3301  H20 MAN D  15     -22.560  -2.611 -11.608  0.00  0.00              
HETATM 3302  H1  MAN D  15     -24.700  -5.478  -9.267  0.00  0.00              
HETATM 3303  H2  MAN D  15     -26.579  -6.290 -10.654  0.00  0.00              
HETATM 3304  H3  MAN D  15     -25.762  -6.040 -12.891  0.00  0.00              
HETATM 3305  H4  MAN D  15     -25.700  -3.062 -12.392  0.00  0.00              
HETATM 3306  C1  NAG D  16     -27.399  -4.560  -9.013  0.00  0.00              
HETATM 3307  C2  NAG D  16     -27.249  -3.353  -8.031  0.00  0.00              
HETATM 3308  C3  NAG D  16     -28.156  -3.576  -6.781  0.00  0.00              
HETATM 3309  C4  NAG D  16     -29.614  -3.880  -7.182  0.00  0.00              
HETATM 3310  C5  NAG D  16     -29.674  -5.073  -8.174  0.00  0.00              
HETATM 3311  C6  NAG D  16     -31.101  -5.349  -8.686  0.00  0.00              
HETATM 3312  C7  NAG D  16     -25.223  -2.010  -7.567  0.00  0.00              
HETATM 3313  C8  NAG D  16     -23.811  -2.017  -7.019  0.00  0.00              
HETATM 3314  O3h NAG D  16     -28.174  -2.432  -5.923  0.00  0.00              
HETATM 3315  OR  NAG D  16     -30.344  -4.157  -5.991  0.00  0.00              
HETATM 3316  OR  NAG D  16     -28.798  -4.812  -9.315  0.00  0.00              
HETATM 3317  O6h NAG D  16     -31.637  -4.227  -9.391  0.00  0.00              
HETATM 3318  OM  NAG D  16     -25.750  -0.953  -7.895  0.00  0.00              
HETATM 3319  N15 NAG D  16     -25.831  -3.193  -7.604  0.00  0.00              
HETATM 3320  H2  NAG D  16     -27.616  -2.454  -8.568  0.00  0.00              
HETATM 3321  H3  NAG D  16     -27.769  -4.441  -6.205  0.00  0.00              
HETATM 3322  H4  NAG D  16     -30.045  -2.987  -7.677  0.00  0.00              
HETATM 3323  H5  NAG D  16     -29.323  -5.985  -7.651  0.00  0.00              
HETATM 3324  H6S NAG D  16     -31.094  -6.240  -9.341  0.00  0.00              
HETATM 3325  H6R NAG D  16     -31.754  -5.603  -7.828  0.00  0.00              
HETATM 3326  H8  NAG D  16     -23.184  -1.309  -7.589  0.00  0.00              
HETATM 3327  H24 NAG D  16     -23.321  -3.006  -7.060  0.00  0.00              
HETATM 3328  H25 NAG D  16     -23.822  -1.678  -5.969  0.00  0.00              
HETATM 3329  H3o NAG D  16     -27.281  -2.336  -5.578  0.00  0.00              
HETATM 3330  H6o NAG D  16     -32.587  -4.356  -9.457  0.00  0.00              
HETATM 3331  H29 NAG D  16     -25.205  -3.982  -7.441  0.00  0.00              
HETATM 3332  H1  NAG D  16     -26.943  -5.475  -8.583  0.00  0.00              
HETATM 3333  C1  GLB D  17     -31.471  -3.391  -5.753  0.00  0.00              
HETATM 3334  C2  GLB D  17     -32.245  -4.028  -4.602  0.00  0.00              
HETATM 3335  C3  GLB D  17     -33.358  -3.126  -4.096  0.00  0.00              
HETATM 3336  C4  GLB D  17     -32.828  -1.740  -3.809  0.00  0.00              
HETATM 3337  C5  GLB D  17     -32.101  -1.199  -5.041  0.00  0.00              
HETATM 3338  C6  GLB D  17     -31.502   0.180  -4.873  0.00  0.00              
HETATM 3339  O2h GLB D  17     -32.790  -5.261  -5.053  0.00  0.00              
HETATM 3340  OW  GLB D  17     -33.887  -3.685  -2.886  0.00  0.00              
HETATM 3341  OR  GLB D  17     -31.019  -2.097  -5.337  0.00  0.00              
HETATM 3342  O6h GLB D  17     -30.559   0.223  -3.813  0.00  0.00              
HETATM 3343  H2o GLB D  17     -32.256  -6.098  -4.775  0.00  0.00              
HETATM 3344  H6o GLB D  17     -29.516   0.539  -3.847  0.00  0.00              
HETATM 3345  O4h GLB D  17     -31.975  -1.882  -2.681  0.00  0.00              
HETATM 3346  H4o GLB D  17     -32.546  -2.278  -1.841  0.00  0.00              
HETATM 3347  H5  GLB D  17     -32.780  -1.125  -5.844  0.00  0.00              
HETATM 3348  H6S GLB D  17     -31.127   0.814  -5.547  0.00  0.00              
HETATM 3349  H6R GLB D  17     -32.273   0.856  -4.641  0.00  0.00              
HETATM 3350  H1  GLB D  17     -32.113  -3.329  -6.631  0.00  0.00              
HETATM 3351  H2  GLB D  17     -31.533  -4.215  -3.797  0.00  0.00              
HETATM 3352  H3  GLB D  17     -34.137  -3.069  -4.855  0.00  0.00              
HETATM 3353  H4  GLB D  17     -33.613  -1.019  -3.584  0.00  0.00              
HETATM 3354  C1  GLA D  18     -35.282  -3.527  -2.659  0.00  0.00              
HETATM 3355  C2  GLA D  18     -35.741  -3.780  -1.226  0.00  0.00              
HETATM 3356  C3  GLA D  18     -35.598  -5.241  -0.832  0.00  0.00              
HETATM 3357  C4  GLA D  18     -36.242  -6.134  -1.867  0.00  0.00              
HETATM 3358  C5  GLA D  18     -35.683  -5.807  -3.253  0.00  0.00              
HETATM 3359  C6  GLA D  18     -36.268  -6.623  -4.385  0.00  0.00              
HETATM 3360  O2h GLA D  18     -34.964  -2.968  -0.354  0.00  0.00              
HETATM 3361  OW  GLA D  18     -36.248  -5.441   0.430  0.00  0.00              
HETATM 3362  OR  GLA D  18     -35.980  -4.428  -3.528  0.00  0.00              
HETATM 3363  O6h GLA D  18     -37.674  -6.461  -4.483  0.00  0.00              
HETATM 3364  H2o GLA D  18     -35.455  -2.053  -0.026  0.00  0.00              
HETATM 3365  H6o GLA D  18     -38.261  -6.139  -5.344  0.00  0.00              
HETATM 3366  O4h GLA D  18     -37.639  -5.895  -1.763  0.00  0.00              
HETATM 3367  H4o GLA D  18     -37.976  -6.137  -0.755  0.00  0.00              
HETATM 3368  H5  GLA D  18     -34.645  -5.995  -3.265  0.00  0.00              
HETATM 3369  H6S GLA D  18     -35.977  -6.723  -5.334  0.00  0.00              
HETATM 3370  H6R GLA D  18     -36.077  -7.640  -4.201  0.00  0.00              
HETATM 3371  H1  GLA D  18     -35.477  -2.489  -2.925  0.00  0.00              
HETATM 3372  H2  GLA D  18     -36.788  -3.488  -1.165  0.00  0.00              
HETATM 3373  H3  GLA D  18     -34.538  -5.481  -0.751  0.00  0.00              
HETATM 3374  H4  GLA D  18     -36.041  -7.193  -1.705  0.00  0.00              
HETATM 3375  C1  NGA D  19     -35.794  -6.488   1.211  0.00  0.00              
HETATM 3376  C2  NGA D  19     -35.025  -5.903   2.393  0.00  0.00              
HETATM 3377  C3  NGA D  19     -34.707  -6.954   3.443  0.00  0.00              
HETATM 3378  C4  NGA D  19     -35.954  -7.722   3.818  0.00  0.00              
HETATM 3379  C5  NGA D  19     -36.617  -8.281   2.560  0.00  0.00              
HETATM 3380  C6  NGA D  19     -37.894  -9.054   2.802  0.00  0.00              
HETATM 3381  OW  NGA D  19     -34.191  -6.298   4.606  0.00  0.00              
HETATM 3382  OR  NGA D  19     -36.951  -7.169   1.713  0.00  0.00              
HETATM 3383  O6h NGA D  19     -38.881  -8.261   3.443  0.00  0.00              
HETATM 3384  H6o NGA D  19     -39.898  -8.050   3.115  0.00  0.00              
HETATM 3385  O4h NGA D  19     -36.778  -6.796   4.514  0.00  0.00              
HETATM 3386  H4o NGA D  19     -36.250  -6.426   5.393  0.00  0.00              
HETATM 3387  H5  NGA D  19     -35.957  -8.952   2.085  0.00  0.00              
HETATM 3388  H6S NGA D  19     -38.425  -9.643   2.195  0.00  0.00              
HETATM 3389  H6R NGA D  19     -37.681  -9.868   3.433  0.00  0.00              
HETATM 3390  H1  NGA D  19     -35.144  -7.161   0.652  0.00  0.00              
HETATM 3391  H2  NGA D  19     -35.650  -5.126   2.833  0.00  0.00              
HETATM 3392  H3  NGA D  19     -33.964  -7.642   3.037  0.00  0.00              
HETATM 3393  H4  NGA D  19     -35.752  -8.581   4.458  0.00  0.00              
HETATM 3394  N23 NGA D  19     -33.799  -5.319   1.898  0.00  0.00              
HETATM 3395  C24 NGA D  19     -33.341  -4.140   2.425  0.00  0.00              
HETATM 3396  C25 NGA D  19     -32.049  -3.646   1.802  0.00  0.00              
HETATM 3397  OM  NGA D  19     -33.901  -3.520   3.308  0.00  0.00              
HETATM 3398  H27 NGA D  19     -33.271  -5.789   1.149  0.00  0.00              
HETATM 3399  H25 NGA D  19     -31.718  -2.692   2.274  0.00  0.00              
HETATM 3400  H29 NGA D  19     -32.191  -3.461   0.713  0.00  0.00              
HETATM 3401  H30 NGA D  19     -31.238  -4.398   1.942  0.00  0.00              
HETATM 3402  C1  AFL D  20     -32.883  -6.674   5.035  0.00  0.00              
HETATM 3403  C2  AFL D  20     -32.310  -5.783   6.155  0.00  0.00              
HETATM 3404  C3  AFL D  20     -33.045  -6.039   7.477  0.00  0.00              
HETATM 3405  C4  AFL D  20     -33.026  -7.545   7.790  0.00  0.00              
HETATM 3406  C5  AFL D  20     -33.595  -8.328   6.596  0.00  0.00              
HETATM 3407  C6  AFL D  20     -33.577  -9.849   6.794  0.00  0.00              
HETATM 3408  OR  AFL D  20     -32.857  -8.057   5.397  0.00  0.00              
HETATM 3409  O2h AFL D  20     -32.362  -4.430   5.710  0.00  0.00              
HETATM 3410  O3h AFL D  20     -32.460  -5.243   8.504  0.00  0.00              
HETATM 3411  O4h AFL D  20     -31.704  -8.018   8.044  0.00  0.00              
HETATM 3412  H5  AFL D  20     -34.652  -8.030   6.460  0.00  0.00              
HETATM 3413  H1  AFL D  20     -32.252  -6.594   4.143  0.00  0.00              
HETATM 3414  H2  AFL D  20     -31.249  -6.066   6.294  0.00  0.00              
HETATM 3415  H2o AFL D  20     -31.871  -3.911   6.361  0.00  0.00              
HETATM 3416  H3  AFL D  20     -34.097  -5.720   7.349  0.00  0.00              
HETATM 3417  H3o AFL D  20     -33.063  -5.279   9.257  0.00  0.00              
HETATM 3418  H4  AFL D  20     -33.649  -7.754   8.680  0.00  0.00              
HETATM 3419  H4o AFL D  20     -31.411  -7.585   8.858  0.00  0.00              
HETATM 3420  H6  AFL D  20     -34.111 -10.152   7.708  0.00  0.00              
HETATM 3421  H22 AFL D  20     -34.059 -10.346   5.936  0.00  0.00              
HETATM 3422  H23 AFL D  20     -32.543 -10.223   6.859  0.00  0.00              
HETATM 3423  C1  NAG D  21     -25.528  -2.628 -14.787  0.00  0.00              
HETATM 3424  C2  NAG D  21     -24.987  -2.511 -16.248  0.00  0.00              
HETATM 3425  C3  NAG D  21     -25.647  -1.289 -16.958  0.00  0.00              
HETATM 3426  C4  NAG D  21     -27.187  -1.338 -16.862  0.00  0.00              
HETATM 3427  C5  NAG D  21     -27.642  -1.478 -15.384  0.00  0.00              
HETATM 3428  C6  NAG D  21     -29.168  -1.635 -15.244  0.00  0.00              
HETATM 3429  C7  NAG D  21     -22.716  -3.038 -17.077  0.00  0.00              
HETATM 3430  C8  NAG D  21     -21.244  -2.690 -17.010  0.00  0.00              
HETATM 3431  O3h NAG D  21     -25.304  -1.225 -18.344  0.00  0.00              
HETATM 3432  OR  NAG D  21     -27.697  -0.147 -17.452  0.00  0.00              
HETATM 3433  OR  NAG D  21     -26.982  -2.629 -14.770  0.00  0.00              
HETATM 3434  O6h NAG D  21     -29.642  -2.808 -15.910  0.00  0.00              
HETATM 3435  OM  NAG D  21     -23.117  -3.864 -17.890  0.00  0.00              
HETATM 3436  N15 NAG D  21     -23.506  -2.357 -16.252  0.00  0.00              
HETATM 3437  H2  NAG D  21     -25.302  -3.432 -16.783  0.00  0.00              
HETATM 3438  H3  NAG D  21     -25.302  -0.357 -16.466  0.00  0.00              
HETATM 3439  H4  NAG D  21     -27.555  -2.216 -17.430  0.00  0.00              
HETATM 3440  H5  NAG D  21     -27.348  -0.561 -14.836  0.00  0.00              
HETATM 3441  H6S NAG D  21     -29.440  -1.675 -14.173  0.00  0.00              
HETATM 3442  H6R NAG D  21     -29.668  -0.738 -15.657  0.00  0.00              
HETATM 3443  H8  NAG D  21     -20.635  -3.603 -17.124  0.00  0.00              
HETATM 3444  H24 NAG D  21     -20.942  -2.203 -16.066  0.00  0.00              
HETATM 3445  H25 NAG D  21     -20.987  -2.016 -17.845  0.00  0.00              
HETATM 3446  H3o NAG D  21     -24.357  -1.063 -18.384  0.00  0.00              
HETATM 3447  H6o NAG D  21     -30.594  -2.719 -16.009  0.00  0.00              
HETATM 3448  H29 NAG D  21     -22.999  -1.825 -15.543  0.00  0.00              
HETATM 3449  H1  NAG D  21     -25.153  -1.794 -14.161  0.00  0.00              
HETATM 3450  C1  GLB D  22     -28.612  -0.297 -18.479  0.00  0.00              
HETATM 3451  C2  GLB D  22     -29.232   1.067 -18.768  0.00  0.00              
HETATM 3452  C3  GLB D  22     -30.056   1.060 -20.045  0.00  0.00              
HETATM 3453  C4  GLB D  22     -29.258   0.474 -21.187  0.00  0.00              
HETATM 3454  C5  GLB D  22     -28.715  -0.899 -20.790  0.00  0.00              
HETATM 3455  C6  GLB D  22     -27.874  -1.582 -21.847  0.00  0.00              
HETATM 3456  O2h GLB D  22     -30.054   1.431 -17.667  0.00  0.00              
HETATM 3457  OW  GLB D  22     -30.416   2.408 -20.366  0.00  0.00              
HETATM 3458  OR  GLB D  22     -27.877  -0.718 -19.636  0.00  0.00              
HETATM 3459  O6h GLB D  22     -26.744  -0.806 -22.209  0.00  0.00              
HETATM 3460  H2o GLB D  22     -29.621   2.090 -17.004  0.00  0.00              
HETATM 3461  H6o GLB D  22     -25.692  -1.090 -22.188  0.00  0.00              
HETATM 3462  O4h GLB D  22     -28.230   1.418 -21.460  0.00  0.00              
HETATM 3463  H4o GLB D  22     -28.678   2.376 -21.728  0.00  0.00              
HETATM 3464  H5  GLB D  22     -29.520  -1.551 -20.592  0.00  0.00              
HETATM 3465  H6S GLB D  22     -27.544  -2.521 -21.908  0.00  0.00              
HETATM 3466  H6R GLB D  22     -28.460  -1.714 -22.709  0.00  0.00              
HETATM 3467  H1  GLB D  22     -29.398  -1.007 -18.223  0.00  0.00              
HETATM 3468  H2  GLB D  22     -28.414   1.780 -18.868  0.00  0.00              
HETATM 3469  H3  GLB D  22     -30.952   0.459 -19.881  0.00  0.00              
HETATM 3470  H4  GLB D  22     -29.851   0.312 -22.087  0.00  0.00              
HETATM 3471  C1  GLA D  23     -31.691   2.612 -20.963  0.00  0.00              
HETATM 3472  C2  GLA D  23     -31.887   3.968 -21.634  0.00  0.00              
HETATM 3473  C3  GLA D  23     -31.911   5.104 -20.626  0.00  0.00              
HETATM 3474  C4  GLA D  23     -32.889   4.803 -19.512  0.00  0.00              
HETATM 3475  C5  GLA D  23     -32.575   3.438 -18.902  0.00  0.00              
HETATM 3476  C6  GLA D  23     -33.502   3.009 -17.787  0.00  0.00              
HETATM 3477  O2h GLA D  23     -30.828   4.169 -22.561  0.00  0.00              
HETATM 3478  OW  GLA D  23     -32.318   6.303 -21.296  0.00  0.00              
HETATM 3479  OR  GLA D  23     -32.689   2.457 -19.946  0.00  0.00              
HETATM 3480  O6h GLA D  23     -34.853   2.942 -18.215  0.00  0.00              
HETATM 3481  H2o GLA D  23     -31.084   3.961 -23.600  0.00  0.00              
HETATM 3482  H6o GLA D  23     -35.539   2.097 -18.163  0.00  0.00              
HETATM 3483  O4h GLA D  23     -34.178   4.860 -20.110  0.00  0.00              
HETATM 3484  H4o GLA D  23     -34.341   5.851 -20.533  0.00  0.00              
HETATM 3485  H5  GLA D  23     -31.606   3.455 -18.485  0.00  0.00              
HETATM 3486  H6S GLA D  23     -33.427   2.262 -17.128  0.00  0.00              
HETATM 3487  H6R GLA D  23     -33.448   3.718 -17.013  0.00  0.00              
HETATM 3488  H1  GLA D  23     -31.762   1.822 -21.711  0.00  0.00              
HETATM 3489  H2  GLA D  23     -32.838   3.932 -22.165  0.00  0.00              
HETATM 3490  H3  GLA D  23     -30.911   5.226 -20.210  0.00  0.00              
HETATM 3491  H4  GLA D  23     -32.837   5.518 -18.691  0.00  0.00              
HETATM 3492  C1  NGA D  24     -31.895   7.502 -20.750  0.00  0.00              
HETATM 3493  C2  NGA D  24     -30.819   8.087 -21.660  0.00  0.00              
HETATM 3494  C3  NGA D  24     -30.474   9.519 -21.288  0.00  0.00              
HETATM 3495  C4  NGA D  24     -31.729  10.354 -21.177  0.00  0.00              
HETATM 3496  C5  NGA D  24     -32.716   9.684 -20.220  0.00  0.00              
HETATM 3497  C6  NGA D  24     -34.027  10.415 -20.041  0.00  0.00              
HETATM 3498  OW  NGA D  24     -29.633  10.069 -22.308  0.00  0.00              
HETATM 3499  OR  NGA D  24     -33.024   8.385 -20.753  0.00  0.00              
HETATM 3500  O6h NGA D  24     -34.720  10.570 -21.270  0.00  0.00              
HETATM 3501  H6o NGA D  24     -35.734  10.257 -21.521  0.00  0.00              
HETATM 3502  O4h NGA D  24     -32.231  10.467 -22.502  0.00  0.00              
HETATM 3503  H4o NGA D  24     -31.484  10.943 -23.136  0.00  0.00              
HETATM 3504  H5  NGA D  24     -32.284   9.621 -19.259  0.00  0.00              
HETATM 3505  H6S NGA D  24     -34.758  10.288 -19.375  0.00  0.00              
HETATM 3506  H6R NGA D  24     -33.828  11.377 -19.665  0.00  0.00              
HETATM 3507  H1  NGA D  24     -31.491   7.372 -19.746  0.00  0.00              
HETATM 3508  H2  NGA D  24     -31.206   8.059 -22.678  0.00  0.00              
HETATM 3509  H3  NGA D  24     -29.952   9.517 -20.331  0.00  0.00              
HETATM 3510  H4  NGA D  24     -31.547  11.350 -20.771  0.00  0.00              
HETATM 3511  N23 NGA D  24     -29.639   7.259 -21.564  0.00  0.00              
HETATM 3512  C24 NGA D  24     -28.895   6.994 -22.685  0.00  0.00              
HETATM 3513  C25 NGA D  24     -27.691   6.106 -22.432  0.00  0.00              
HETATM 3514  OM  NGA D  24     -29.156   7.414 -23.796  0.00  0.00              
HETATM 3515  H27 NGA D  24     -29.356   6.868 -20.654  0.00  0.00              
HETATM 3516  H25 NGA D  24     -27.119   5.932 -23.372  0.00  0.00              
HETATM 3517  H29 NGA D  24     -28.017   5.116 -22.038  0.00  0.00              
HETATM 3518  H30 NGA D  24     -27.006   6.585 -21.695  0.00  0.00              
HETATM 3519  C1  AFL D  25     -28.346  10.535 -21.907  0.00  0.00              
HETATM 3520  C2  AFL D  25     -27.421  10.911 -23.079  0.00  0.00              
HETATM 3521  C3  AFL D  25     -27.906  12.199 -23.759  0.00  0.00              
HETATM 3522  C4  AFL D  25     -28.074  13.303 -22.700  0.00  0.00              
HETATM 3523  C5  AFL D  25     -28.993  12.803 -21.574  0.00  0.00              
HETATM 3524  C6  AFL D  25     -29.186  13.823 -20.443  0.00  0.00              
HETATM 3525  OR  AFL D  25     -28.477  11.611 -20.972  0.00  0.00              
HETATM 3526  O2h AFL D  25     -27.337   9.788 -23.952  0.00  0.00              
HETATM 3527  O3h AFL D  25     -27.002  12.552 -24.802  0.00  0.00              
HETATM 3528  O4h AFL D  25     -26.825  13.680 -22.123  0.00  0.00              
HETATM 3529  H5  AFL D  25     -29.992  12.605 -22.006  0.00  0.00              
HETATM 3530  H1  AFL D  25     -27.902   9.707 -21.339  0.00  0.00              
HETATM 3531  H2  AFL D  25     -26.414  11.105 -22.660  0.00  0.00              
HETATM 3532  H2o AFL D  25     -26.645   9.993 -24.595  0.00  0.00              
HETATM 3533  H3  AFL D  25     -28.895  11.993 -24.210  0.00  0.00              
HETATM 3534  H3o AFL D  25     -27.441  13.237 -25.323  0.00  0.00              
HETATM 3535  H4  AFL D  25     -28.531  14.200 -23.159  0.00  0.00              
HETATM 3536  H4o AFL D  25     -26.306  14.083 -22.833  0.00  0.00              
HETATM 3537  H6  AFL D  25     -29.567  14.786 -20.817  0.00  0.00              
HETATM 3538  H22 AFL D  25     -29.907  13.433 -19.705  0.00  0.00              
HETATM 3539  H23 AFL D  25     -28.237  14.008 -19.917  0.00  0.00              
HETATM 3540  C1  NAG D  26     -20.555  -2.687 -13.134  0.00  0.00              
HETATM 3541  C2  NAG D  26     -19.290  -3.473 -13.608  0.00  0.00              
HETATM 3542  C3  NAG D  26     -18.099  -2.485 -13.802  0.00  0.00              
HETATM 3543  C4  NAG D  26     -18.481  -1.302 -14.716  0.00  0.00              
HETATM 3544  C5  NAG D  26     -19.758  -0.591 -14.190  0.00  0.00              
HETATM 3545  C6  NAG D  26     -20.241   0.532 -15.127  0.00  0.00              
HETATM 3546  C7  NAG D  26     -18.595  -5.763 -12.979  0.00  0.00              
HETATM 3547  C8  NAG D  26     -18.155  -6.676 -11.855  0.00  0.00              
HETATM 3548  O3h NAG D  26     -16.961  -3.126 -14.382  0.00  0.00              
HETATM 3549  OR  NAG D  26     -17.372  -0.412 -14.762  0.00  0.00              
HETATM 3550  OR  NAG D  26     -20.832  -1.567 -14.018  0.00  0.00              
HETATM 3551  O6h NAG D  26     -20.580   0.033 -16.423  0.00  0.00              
HETATM 3552  OM  NAG D  26     -18.589  -6.166 -14.137  0.00  0.00              
HETATM 3553  N15 NAG D  26     -18.920  -4.524 -12.620  0.00  0.00              
HETATM 3554  H2  NAG D  26     -19.537  -3.914 -14.597  0.00  0.00              
HETATM 3555  H3  NAG D  26     -17.807  -2.077 -12.814  0.00  0.00              
HETATM 3556  H4  NAG D  26     -18.687  -1.687 -15.736  0.00  0.00              
HETATM 3557  H5  NAG D  26     -19.527  -0.133 -13.208  0.00  0.00              
HETATM 3558  H6S NAG D  26     -21.116   1.039 -14.677  0.00  0.00              
HETATM 3559  H6R NAG D  26     -19.449   1.302 -15.214  0.00  0.00              
HETATM 3560  H8  NAG D  26     -18.543  -7.696 -12.023  0.00  0.00              
HETATM 3561  H24 NAG D  26     -18.492  -6.350 -10.855  0.00  0.00              
HETATM 3562  H25 NAG D  26     -17.053  -6.740 -11.842  0.00  0.00              
HETATM 3563  H3o NAG D  26     -16.654  -3.773 -13.738  0.00  0.00              
HETATM 3564  H6o NAG D  26     -20.622   0.784 -17.019  0.00  0.00              
HETATM 3565  H29 NAG D  26     -19.017  -4.400 -11.612  0.00  0.00              
HETATM 3566  H1  NAG D  26     -20.421  -2.316 -12.098  0.00  0.00              
HETATM 3567  C1  GLB D  27     -16.867  -0.102 -16.013  0.00  0.00              
HETATM 3568  C2  GLB D  27     -15.892   1.061 -15.858  0.00  0.00              
HETATM 3569  C3  GLB D  27     -15.094   1.309 -17.127  0.00  0.00              
HETATM 3570  C4  GLB D  27     -14.470   0.023 -17.619  0.00  0.00              
HETATM 3571  C5  GLB D  27     -15.546  -1.054 -17.761  0.00  0.00              
HETATM 3572  C6  GLB D  27     -15.041  -2.402 -18.228  0.00  0.00              
HETATM 3573  O2h GLB D  27     -16.632   2.228 -15.519  0.00  0.00              
HETATM 3574  OW  GLB D  27     -14.056   2.254 -16.839  0.00  0.00              
HETATM 3575  OR  GLB D  27     -16.139  -1.250 -16.468  0.00  0.00              
HETATM 3576  O6h GLB D  27     -14.067  -2.938 -17.345  0.00  0.00              
HETATM 3577  H2o GLB D  27     -16.626   2.467 -14.516  0.00  0.00              
HETATM 3578  H6o GLB D  27     -14.073  -3.901 -16.834  0.00  0.00              
HETATM 3579  O4h GLB D  27     -13.475  -0.312 -16.659  0.00  0.00              
HETATM 3580  H4o GLB D  27     -12.744   0.495 -16.596  0.00  0.00              
HETATM 3581  H5  GLB D  27     -16.257  -0.747 -18.477  0.00  0.00              
HETATM 3582  H6S GLB D  27     -15.536  -3.207 -18.548  0.00  0.00              
HETATM 3583  H6R GLB D  27     -14.587  -2.285 -19.169  0.00  0.00              
HETATM 3584  H1  GLB D  27     -17.656   0.176 -16.712  0.00  0.00              
HETATM 3585  H2  GLB D  27     -15.213   0.808 -15.044  0.00  0.00              
HETATM 3586  H3  GLB D  27     -15.762   1.705 -17.891  0.00  0.00              
HETATM 3587  H4  GLB D  27     -14.009   0.119 -18.602  0.00  0.00              
HETATM 3588  C1  GLA D  28     -13.712   3.169 -17.871  0.00  0.00              
HETATM 3589  C2  GLA D  28     -12.380   3.888 -17.686  0.00  0.00              
HETATM 3590  C3  GLA D  28     -12.410   4.853 -16.512  0.00  0.00              
HETATM 3591  C4  GLA D  28     -13.612   5.766 -16.608  0.00  0.00              
HETATM 3592  C5  GLA D  28     -14.884   4.932 -16.761  0.00  0.00              
HETATM 3593  C6  GLA D  28     -16.160   5.735 -16.890  0.00  0.00              
HETATM 3594  O2h GLA D  28     -11.365   2.914 -17.481  0.00  0.00              
HETATM 3595  OW  GLA D  28     -11.216   5.645 -16.538  0.00  0.00              
HETATM 3596  OR  GLA D  28     -14.752   4.152 -17.961  0.00  0.00              
HETATM 3597  O6h GLA D  28     -16.128   6.605 -18.010  0.00  0.00              
HETATM 3598  H2o GLA D  28     -10.770   2.681 -18.364  0.00  0.00              
HETATM 3599  H6o GLA D  28     -16.832   6.669 -18.839  0.00  0.00              
HETATM 3600  O4h GLA D  28     -13.365   6.608 -17.725  0.00  0.00              
HETATM 3601  H4o GLA D  28     -12.444   7.168 -17.562  0.00  0.00              
HETATM 3602  H5  GLA D  28     -15.008   4.323 -15.909  0.00  0.00              
HETATM 3603  H6S GLA D  28     -17.115   5.450 -16.841  0.00  0.00              
HETATM 3604  H6R GLA D  28     -16.274   6.326 -16.028  0.00  0.00              
HETATM 3605  H1  GLA D  28     -13.671   2.553 -18.769  0.00  0.00              
HETATM 3606  H2  GLA D  28     -12.179   4.440 -18.605  0.00  0.00              
HETATM 3607  H3  GLA D  28     -12.460   4.279 -15.588  0.00  0.00              
HETATM 3608  H4  GLA D  28     -13.759   6.376 -15.717  0.00  0.00              
HETATM 3609  C1  NGA D  29     -10.780   6.164 -15.332  0.00  0.00              
HETATM 3610  C2  NGA D  29      -9.531   5.397 -14.908  0.00  0.00              
HETATM 3611  C3  NGA D  29      -8.830   6.055 -13.731  0.00  0.00              
HETATM 3612  C4  NGA D  29      -8.607   7.526 -14.002  0.00  0.00              
HETATM 3613  C5  NGA D  29      -9.930   8.188 -14.388  0.00  0.00              
HETATM 3614  C6  NGA D  29      -9.835   9.663 -14.709  0.00  0.00              
HETATM 3615  OW  NGA D  29      -7.563   5.416 -13.536  0.00  0.00              
HETATM 3616  OR  NGA D  29     -10.418   7.530 -15.570  0.00  0.00              
HETATM 3617  O6h NGA D  29      -8.944   9.916 -15.784  0.00  0.00              
HETATM 3618  H6o NGA D  29      -9.141  10.442 -16.718  0.00  0.00              
HETATM 3619  O4h NGA D  29      -7.637   7.580 -15.041  0.00  0.00              
HETATM 3620  H4o NGA D  29      -6.722   7.086 -14.711  0.00  0.00              
HETATM 3621  H5  NGA D  29     -10.609   8.108 -13.586  0.00  0.00              
HETATM 3622  H6S NGA D  29     -10.547  10.351 -14.828  0.00  0.00              
HETATM 3623  H6R NGA D  29      -9.464  10.169 -13.864  0.00  0.00              
HETATM 3624  H1  NGA D  29     -11.539   6.079 -14.555  0.00  0.00              
HETATM 3625  H2  NGA D  29      -8.859   5.374 -15.765  0.00  0.00              
HETATM 3626  H3  NGA D  29      -9.451   5.939 -12.843  0.00  0.00              
HETATM 3627  H4  NGA D  29      -8.240   8.071 -13.133  0.00  0.00              
HETATM 3628  N23 NGA D  29      -9.917   4.050 -14.555  0.00  0.00              
HETATM 3629  C24 NGA D  29      -9.114   2.994 -14.902  0.00  0.00              
HETATM 3630  C25 NGA D  29      -9.652   1.642 -14.472  0.00  0.00              
HETATM 3631  OM  NGA D  29      -8.063   3.100 -15.504  0.00  0.00              
HETATM 3632  H27 NGA D  29     -10.796   3.884 -14.044  0.00  0.00              
HETATM 3633  H25 NGA D  29      -8.957   0.824 -14.770  0.00  0.00              
HETATM 3634  H29 NGA D  29     -10.639   1.449 -14.952  0.00  0.00              
HETATM 3635  H30 NGA D  29      -9.772   1.607 -13.365  0.00  0.00              
HETATM 3636  C1  AFL D  30      -7.331   4.813 -12.264  0.00  0.00              
HETATM 3637  C2  AFL D  30      -6.046   3.966 -12.197  0.00  0.00              
HETATM 3638  C3  AFL D  30      -4.803   4.867 -12.231  0.00  0.00              
HETATM 3639  C4  AFL D  30      -4.918   5.937 -11.132  0.00  0.00              
HETATM 3640  C5  AFL D  30      -6.246   6.696 -11.286  0.00  0.00              
HETATM 3641  C6  AFL D  30      -6.475   7.759 -10.205  0.00  0.00              
HETATM 3642  OR  AFL D  30      -7.364   5.802 -11.232  0.00  0.00              
HETATM 3643  O2h AFL D  30      -6.098   3.003 -13.248  0.00  0.00              
HETATM 3644  O3h AFL D  30      -3.634   4.061 -12.113  0.00  0.00              
HETATM 3645  O4h AFL D  30      -4.881   5.363  -9.827  0.00  0.00              
HETATM 3646  H5  AFL D  30      -6.232   7.220 -12.261  0.00  0.00              
HETATM 3647  H1  AFL D  30      -8.203   4.173 -12.083  0.00  0.00              
HETATM 3648  H2  AFL D  30      -6.052   3.429 -11.229  0.00  0.00              
HETATM 3649  H2o AFL D  30      -5.360   2.398 -13.099  0.00  0.00              
HETATM 3650  H3  AFL D  30      -4.778   5.374 -13.214  0.00  0.00              
HETATM 3651  H3o AFL D  30      -2.885   4.631 -12.336  0.00  0.00              
HETATM 3652  H4  AFL D  30      -4.084   6.660 -11.220  0.00  0.00              
HETATM 3653  H4o AFL D  30      -3.998   4.982  -9.720  0.00  0.00              
HETATM 3654  H6  AFL D  30      -5.648   8.487 -10.161  0.00  0.00              
HETATM 3655  H22 AFL D  30      -7.405   8.311 -10.411  0.00  0.00              
HETATM 3656  H23 AFL D  30      -6.576   7.293  -9.213  0.00  0.00              
HETATM 3657  C1  NAG E   1       8.348 -14.271 -11.250  0.00  0.00              
HETATM 3658  C2  NAG E   1       6.896 -14.591 -11.729  0.00  0.00              
HETATM 3659  C3  NAG E   1       6.941 -15.249 -13.143  0.00  0.00              
HETATM 3660  C4  NAG E   1       7.758 -14.401 -14.139  0.00  0.00              
HETATM 3661  C5  NAG E   1       9.177 -14.107 -13.579  0.00  0.00              
HETATM 3662  C6  NAG E   1       9.995 -13.176 -14.493  0.00  0.00              
HETATM 3663  C7  NAG E   1       4.962 -15.303 -10.359  0.00  0.00              
HETATM 3664  C8  NAG E   1       4.391 -16.378  -9.457  0.00  0.00              
HETATM 3665  O3h NAG E   1       5.634 -15.422 -13.694  0.00  0.00              
HETATM 3666  OR  NAG E   1       7.822 -15.117 -15.368  0.00  0.00              
HETATM 3667  OR  NAG E   1       9.069 -13.505 -12.252  0.00  0.00              
HETATM 3668  OW  NAG E   1      11.216 -13.788 -14.916  0.00  0.00              
HETATM 3669  OM  NAG E   1       4.266 -14.356 -10.704  0.00  0.00              
HETATM 3670  N15 NAG E   1       6.212 -15.502 -10.770  0.00  0.00              
HETATM 3671  H2  NAG E   1       6.364 -13.620 -11.817  0.00  0.00              
HETATM 3672  H3  NAG E   1       7.424 -16.244 -13.060  0.00  0.00              
HETATM 3673  H4  NAG E   1       7.236 -13.436 -14.303  0.00  0.00              
HETATM 3674  H5  NAG E   1       9.728 -15.065 -13.496  0.00  0.00              
HETATM 3675  H6  NAG E   1       9.388 -12.894 -15.374  0.00  0.00              
HETATM 3676  H22 NAG E   1      10.212 -12.232 -13.955  0.00  0.00              
HETATM 3677  H8  NAG E   1       3.763 -15.918  -8.675  0.00  0.00              
HETATM 3678  H24 NAG E   1       5.158 -16.993  -8.952  0.00  0.00              
HETATM 3679  H25 NAG E   1       3.744 -17.049 -10.047  0.00  0.00              
HETATM 3680  H3o NAG E   1       5.183 -16.058 -13.131  0.00  0.00              
HETATM 3681  H29 NAG E   1       6.694 -16.252 -10.271  0.00  0.00              
HETATM 3682  H1  NAG E   1       8.904 -15.204 -11.028  0.00  0.00              
HETATM 3683  C1  NAG E   2       7.360 -14.445 -16.530  0.00  0.00              
HETATM 3684  C2  NAG E   2       7.853 -15.173 -17.822  0.00  0.00              
HETATM 3685  C3  NAG E   2       7.121 -14.585 -19.069  0.00  0.00              
HETATM 3686  C4  NAG E   2       5.590 -14.597 -18.889  0.00  0.00              
HETATM 3687  C5  NAG E   2       5.185 -13.877 -17.573  0.00  0.00              
HETATM 3688  C6  NAG E   2       3.671 -13.953 -17.296  0.00  0.00              
HETATM 3689  C7  NAG E   2      10.119 -16.040 -18.310  0.00  0.00              
HETATM 3690  C8  NAG E   2      11.576 -15.691 -18.524  0.00  0.00              
HETATM 3691  O3h NAG E   2       7.422 -15.318 -20.259  0.00  0.00              
HETATM 3692  OR  NAG E   2       5.014 -13.964 -20.026  0.00  0.00              
HETATM 3693  OR  NAG E   2       5.909 -14.462 -16.447  0.00  0.00              
HETATM 3694  O6h NAG E   2       3.225 -15.305 -17.154  0.00  0.00              
HETATM 3695  OM  NAG E   2       9.729 -17.188 -18.489  0.00  0.00              
HETATM 3696  N15 NAG E   2       9.326 -15.023 -17.983  0.00  0.00              
HETATM 3697  H2  NAG E   2       7.561 -16.240 -17.722  0.00  0.00              
HETATM 3698  H3  NAG E   2       7.444 -13.534 -19.212  0.00  0.00              
HETATM 3699  H4  NAG E   2       5.242 -15.648 -18.837  0.00  0.00              
HETATM 3700  H5  NAG E   2       5.456 -12.806 -17.659  0.00  0.00              
HETATM 3701  H6S NAG E   2       3.433 -13.378 -16.382  0.00  0.00              
HETATM 3702  H6R NAG E   2       3.122 -13.460 -18.122  0.00  0.00              
HETATM 3703  H8  NAG E   2      12.218 -16.496 -18.127  0.00  0.00              
HETATM 3704  H24 NAG E   2      11.886 -14.746 -18.041  0.00  0.00              
HETATM 3705  H25 NAG E   2      11.781 -15.608 -19.605  0.00  0.00              
HETATM 3706  H3o NAG E   2       8.360 -15.190 -20.430  0.00  0.00              
HETATM 3707  H6o NAG E   2       2.269 -15.304 -17.241  0.00  0.00              
HETATM 3708  H29 NAG E   2       9.831 -14.173 -17.728  0.00  0.00              
HETATM 3709  H1  NAG E   2       7.719 -13.397 -16.509  0.00  0.00              
HETATM 3710  C1  BMA E   3       4.077 -14.688 -20.741  0.00  0.00              
HETATM 3711  C2  BMA E   3       3.392 -13.744 -21.724  0.00  0.00              
HETATM 3712  C3  BMA E   3       2.531 -14.492 -22.728  0.00  0.00              
HETATM 3713  C4  BMA E   3       3.319 -15.611 -23.372  0.00  0.00              
HETATM 3714  C5  BMA E   3       3.930 -16.502 -22.290  0.00  0.00              
HETATM 3715  C6  BMA E   3       4.766 -17.651 -22.809  0.00  0.00              
HETATM 3716  OW  BMA E   3       2.107 -13.573 -23.743  0.00  0.00              
HETATM 3717  O4h BMA E   3       2.485 -16.414 -24.192  0.00  0.00              
HETATM 3718  OR  BMA E   3       4.793 -15.682 -21.486  0.00  0.00              
HETATM 3719  OW  BMA E   3       4.293 -18.905 -22.341  0.00  0.00              
HETATM 3720  H4o BMA E   3       2.559 -16.081 -25.227  0.00  0.00              
HETATM 3721  O2h BMA E   3       4.391 -13.002 -22.413  0.00  0.00              
HETATM 3722  H2o BMA E   3       5.017 -13.682 -22.991  0.00  0.00              
HETATM 3723  H5  BMA E   3       3.159 -16.939 -21.719  0.00  0.00              
HETATM 3724  H6  BMA E   3       5.096 -17.853 -23.729  0.00  0.00              
HETATM 3725  H20 BMA E   3       5.752 -17.534 -22.463  0.00  0.00              
HETATM 3726  H2  BMA E   3       2.767 -13.069 -21.141  0.00  0.00              
HETATM 3727  H3  BMA E   3       1.667 -14.907 -22.211  0.00  0.00              
HETATM 3728  H1  BMA E   3       3.328 -15.139 -20.089  0.00  0.00              
HETATM 3729  H4  BMA E   3       4.102 -15.157 -23.981  0.00  0.00              
HETATM 3730  C1  MAN E   4       0.712 -13.504 -24.009  0.00  0.00              
HETATM 3731  C2  MAN E   4       0.326 -12.743 -25.273  0.00  0.00              
HETATM 3732  C3  MAN E   4       0.621 -11.258 -25.157  0.00  0.00              
HETATM 3733  C4  MAN E   4       0.032 -10.700 -23.880  0.00  0.00              
HETATM 3734  C5  MAN E   4       0.512 -11.524 -22.686  0.00  0.00              
HETATM 3735  C6  MAN E   4      -0.028 -11.079 -21.345  0.00  0.00              
HETATM 3736  O3h MAN E   4       0.034 -10.583 -26.277  0.00  0.00              
HETATM 3737  OR  MAN E   4       0.434  -9.353 -23.680  0.00  0.00              
HETATM 3738  OR  MAN E   4       0.074 -12.878 -22.887  0.00  0.00              
HETATM 3739  O6h MAN E   4      -1.446 -11.120 -21.304  0.00  0.00              
HETATM 3740  H3o MAN E   4       0.902 -10.277 -26.862  0.00  0.00              
HETATM 3741  H6o MAN E   4      -2.088 -11.649 -20.599  0.00  0.00              
HETATM 3742  OW  MAN E   4      -1.062 -12.936 -25.516  0.00  0.00              
HETATM 3743  H5  MAN E   4       1.563 -11.459 -22.612  0.00  0.00              
HETATM 3744  H6S MAN E   4       0.241 -11.330 -20.417  0.00  0.00              
HETATM 3745  H6R MAN E   4       0.266 -10.083 -21.178  0.00  0.00              
HETATM 3746  H1  MAN E   4       0.408 -14.547 -24.105  0.00  0.00              
HETATM 3747  H2  MAN E   4       0.907 -13.165 -26.093  0.00  0.00              
HETATM 3748  H3  MAN E   4       1.700 -11.113 -25.153  0.00  0.00              
HETATM 3749  H4  MAN E   4      -1.053 -10.747 -23.966  0.00  0.00              
HETATM 3750  C1  NAG E   5      -1.433 -14.094 -26.248  0.00  0.00              
HETATM 3751  C2  NAG E   5      -2.756 -14.703 -25.683  0.00  0.00              
HETATM 3752  C3  NAG E   5      -3.287 -15.803 -26.655  0.00  0.00              
HETATM 3753  C4  NAG E   5      -3.405 -15.276 -28.100  0.00  0.00              
HETATM 3754  C5  NAG E   5      -2.058 -14.667 -28.577  0.00  0.00              
HETATM 3755  C6  NAG E   5      -2.154 -14.034 -29.978  0.00  0.00              
HETATM 3756  C7  NAG E   5      -3.370 -15.084 -23.316  0.00  0.00              
HETATM 3757  C8  NAG E   5      -3.043 -15.830 -22.040  0.00  0.00              
HETATM 3758  O3h NAG E   5      -4.575 -16.286 -26.265  0.00  0.00              
HETATM 3759  OR  NAG E   5      -3.806 -16.364 -28.928  0.00  0.00              
HETATM 3760  OR  NAG E   5      -1.608 -13.656 -27.622  0.00  0.00              
HETATM 3761  O6h NAG E   5      -3.099 -12.961 -30.010  0.00  0.00              
HETATM 3762  OM  NAG E   5      -4.378 -14.389 -23.382  0.00  0.00              
HETATM 3763  N15 NAG E   5      -2.536 -15.288 -24.331  0.00  0.00              
HETATM 3764  H2  NAG E   5      -3.503 -13.880 -25.653  0.00  0.00              
HETATM 3765  H3  NAG E   5      -2.577 -16.655 -26.656  0.00  0.00              
HETATM 3766  H4  NAG E   5      -4.182 -14.485 -28.133  0.00  0.00              
HETATM 3767  H5  NAG E   5      -1.303 -15.478 -28.626  0.00  0.00              
HETATM 3768  H6S NAG E   5      -1.157 -13.668 -30.288  0.00  0.00              
HETATM 3769  H6R NAG E   5      -2.440 -14.812 -30.713  0.00  0.00              
HETATM 3770  H8  NAG E   5      -3.258 -15.192 -21.166  0.00  0.00              
HETATM 3771  H24 NAG E   5      -1.989 -16.152 -21.968  0.00  0.00              
HETATM 3772  H25 NAG E   5      -3.684 -16.725 -21.961  0.00  0.00              
HETATM 3773  H3o NAG E   5      -4.456 -16.728 -25.419  0.00  0.00              
HETATM 3774  H6o NAG E   5      -3.302 -12.784 -30.933  0.00  0.00              
HETATM 3775  H29 NAG E   5      -1.674 -15.767 -24.066  0.00  0.00              
HETATM 3776  H1  NAG E   5      -0.609 -14.833 -26.198  0.00  0.00              
HETATM 3777  C1  GLB E   6      -4.953 -16.190 -29.681  0.00  0.00              
HETATM 3778  C2  GLB E   6      -5.041 -17.335 -30.686  0.00  0.00              
HETATM 3779  C3  GLB E   6      -6.389 -17.379 -31.385  0.00  0.00              
HETATM 3780  C4  GLB E   6      -7.511 -17.339 -30.373  0.00  0.00              
HETATM 3781  C5  GLB E   6      -7.331 -16.138 -29.444  0.00  0.00              
HETATM 3782  C6  GLB E   6      -8.383 -16.001 -28.367  0.00  0.00              
HETATM 3783  O2h GLB E   6      -4.005 -17.172 -31.647  0.00  0.00              
HETATM 3784  O3h GLB E   6      -6.477 -18.595 -32.137  0.00  0.00              
HETATM 3785  OR  GLB E   6      -6.064 -16.287 -28.781  0.00  0.00              
HETATM 3786  OW  GLB E   6      -8.716 -14.644 -28.121  0.00  0.00              
HETATM 3787  H2o GLB E   6      -3.172 -17.757 -31.488  0.00  0.00              
HETATM 3788  H3o GLB E   6      -6.429 -18.249 -33.169  0.00  0.00              
HETATM 3789  O4h GLB E   6      -7.452 -18.584 -29.687  0.00  0.00              
HETATM 3790  H4o GLB E   6      -7.577 -19.399 -30.400  0.00  0.00              
HETATM 3791  H5  GLB E   6      -7.375 -15.249 -30.009  0.00  0.00              
HETATM 3792  H6  GLB E   6      -9.247 -16.482 -28.236  0.00  0.00              
HETATM 3793  H20 GLB E   6      -8.004 -16.403 -27.473  0.00  0.00              
HETATM 3794  H1  GLB E   6      -4.950 -15.239 -30.213  0.00  0.00              
HETATM 3795  H2  GLB E   6      -4.886 -18.262 -30.135  0.00  0.00              
HETATM 3796  H3  GLB E   6      -6.468 -16.518 -32.050  0.00  0.00              
HETATM 3797  H4  GLB E   6      -8.495 -17.222 -30.827  0.00  0.00              
HETATM 3798  C1  NAN E   7      -8.401 -14.832 -25.716  0.00  0.00              
HETATM 3799  C2  NAN E   7      -9.335 -14.349 -26.881  0.00  0.00              
HETATM 3800  C3  NAN E   7     -10.741 -15.010 -26.928  0.00  0.00              
HETATM 3801  C4  NAN E   7     -11.686 -14.435 -25.850  0.00  0.00              
HETATM 3802  C5  NAN E   7     -11.761 -12.895 -25.931  0.00  0.00              
HETATM 3803  C6  NAN E   7     -10.337 -12.266 -25.894  0.00  0.00              
HETATM 3804  C7  NAN E   7     -10.331 -10.731 -26.119  0.00  0.00              
HETATM 3805  C8  NAN E   7      -8.956 -10.075 -25.841  0.00  0.00              
HETATM 3806  C9  NAN E   7      -8.949  -8.553 -26.039  0.00  0.00              
HETATM 3807  OW  NAN E   7      -9.496 -12.897 -26.923  0.00  0.00              
HETATM 3808  OM  NAN E   7      -8.690 -15.697 -24.889  0.00  0.00              
HETATM 3809  O1h NAN E   7      -7.200 -14.181 -25.704  0.00  0.00              
HETATM 3810  O4h NAN E   7     -12.985 -14.979 -26.046  0.00  0.00              
HETATM 3811  O7h NAN E   7     -10.704 -10.480 -27.473  0.00  0.00              
HETATM 3812  O8h NAN E   7      -8.575 -10.296 -24.491  0.00  0.00              
HETATM 3813  O9h NAN E   7      -7.669  -8.022 -25.693  0.00  0.00              
HETATM 3814  H6  NAN E   7      -9.906 -12.467 -24.893  0.00  0.00              
HETATM 3815  H3  NAN E   7     -11.186 -14.833 -27.925  0.00  0.00              
HETATM 3816  H21 NAN E   7     -10.650 -16.108 -26.834  0.00  0.00              
HETATM 3817  H4  NAN E   7     -11.317 -14.728 -24.845  0.00  0.00              
HETATM 3818  H7o NAN E   7     -10.298 -11.200 -27.964  0.00  0.00              
HETATM 3819  H8o NAN E   7      -7.963  -9.575 -24.314  0.00  0.00              
HETATM 3820  H4o NAN E   7     -12.860 -15.926 -26.162  0.00  0.00              
HETATM 3821  H9o NAN E   7      -7.670  -7.094 -25.952  0.00  0.00              
HETATM 3822  H9R NAN E   7      -9.738  -8.082 -25.418  0.00  0.00              
HETATM 3823  H9S NAN E   7      -9.196  -8.307 -27.090  0.00  0.00              
HETATM 3824  H8  NAN E   7      -8.194 -10.526 -26.508  0.00  0.00              
HETATM 3825  H7  NAN E   7     -11.079 -10.270 -25.444  0.00  0.00              
HETATM 3826  H1o NAN E   7      -6.700 -14.508 -24.955  0.00  0.00              
HETATM 3827  H5  NAN E   7     -12.256 -12.608 -26.880  0.00  0.00              
HETATM 3828  N33 NAN E   7     -12.559 -12.431 -24.819  0.00  0.00              
HETATM 3829  C34 NAN E   7     -13.902 -12.212 -24.985  0.00  0.00              
HETATM 3830  C35 NAN E   7     -14.607 -11.722 -23.733  0.00  0.00              
HETATM 3831  OM  NAN E   7     -14.501 -12.380 -26.029  0.00  0.00              
HETATM 3832  H37 NAN E   7     -12.119 -12.267 -23.903  0.00  0.00              
HETATM 3833  H35 NAN E   7     -15.694 -11.569 -23.923  0.00  0.00              
HETATM 3834  H39 NAN E   7     -14.175 -10.750 -23.404  0.00  0.00              
HETATM 3835  H40 NAN E   7     -14.501 -12.467 -22.912  0.00  0.00              
HETATM 3836  C1  NAG E   8      -0.597  -8.387 -23.546  0.00  0.00              
HETATM 3837  C2  NAG E   8      -0.035  -7.059 -22.942  0.00  0.00              
HETATM 3838  C3  NAG E   8      -1.112  -5.935 -23.051  0.00  0.00              
HETATM 3839  C4  NAG E   8      -1.643  -5.793 -24.492  0.00  0.00              
HETATM 3840  C5  NAG E   8      -2.160  -7.157 -25.025  0.00  0.00              
HETATM 3841  C6  NAG E   8      -2.605  -7.088 -26.498  0.00  0.00              
HETATM 3842  C7  NAG E   8       1.498  -6.790 -21.019  0.00  0.00              
HETATM 3843  C8  NAG E   8       1.691  -6.990 -19.531  0.00  0.00              
HETATM 3844  O3h NAG E   8      -0.596  -4.661 -22.654  0.00  0.00              
HETATM 3845  OR  NAG E   8      -2.678  -4.815 -24.479  0.00  0.00              
HETATM 3846  OR  NAG E   8      -1.116  -8.170 -24.886  0.00  0.00              
HETATM 3847  O6h NAG E   8      -1.528  -6.716 -27.361  0.00  0.00              
HETATM 3848  OM  NAG E   8       2.344  -6.192 -21.674  0.00  0.00              
HETATM 3849  N15 NAG E   8       0.354  -7.250 -21.517  0.00  0.00              
HETATM 3850  H2  NAG E   8       0.835  -6.765 -23.565  0.00  0.00              
HETATM 3851  H3  NAG E   8      -1.967  -6.190 -22.392  0.00  0.00              
HETATM 3852  H4  NAG E   8      -0.819  -5.447 -25.147  0.00  0.00              
HETATM 3853  H5  NAG E   8      -3.039  -7.460 -24.422  0.00  0.00              
HETATM 3854  H6S NAG E   8      -3.015  -8.069 -26.807  0.00  0.00              
HETATM 3855  H6R NAG E   8      -3.437  -6.363 -26.596  0.00  0.00              
HETATM 3856  H8  NAG E   8       2.746  -7.240 -19.318  0.00  0.00              
HETATM 3857  H24 NAG E   8       1.064  -7.793 -19.102  0.00  0.00              
HETATM 3858  H25 NAG E   8       1.461  -6.050 -19.000  0.00  0.00              
HETATM 3859  H3o NAG E   8      -0.392  -4.730 -21.716  0.00  0.00              
HETATM 3860  H6o NAG E   8      -1.911  -6.445 -28.199  0.00  0.00              
HETATM 3861  H29 NAG E   8      -0.164  -7.850 -20.873  0.00  0.00              
HETATM 3862  H1  NAG E   8      -1.400  -8.802 -22.903  0.00  0.00              
HETATM 3863  C1  GLB E   9      -2.536  -3.740 -25.339  0.00  0.00              
HETATM 3864  C2  GLB E   9      -3.859  -2.979 -25.371  0.00  0.00              
HETATM 3865  C3  GLB E   9      -3.730  -1.643 -26.083  0.00  0.00              
HETATM 3866  C4  GLB E   9      -2.564  -0.857 -25.527  0.00  0.00              
HETATM 3867  C5  GLB E   9      -1.296  -1.710 -25.572  0.00  0.00              
HETATM 3868  C6  GLB E   9      -0.057  -1.040 -25.019  0.00  0.00              
HETATM 3869  O2h GLB E   9      -4.825  -3.785 -26.034  0.00  0.00              
HETATM 3870  OW  GLB E   9      -4.937  -0.897 -25.881  0.00  0.00              
HETATM 3871  OR  GLB E   9      -1.533  -2.883 -24.777  0.00  0.00              
HETATM 3872  O6h GLB E   9      -0.222  -0.658 -23.663  0.00  0.00              
HETATM 3873  H2o GLB E   9      -5.466  -4.294 -25.406  0.00  0.00              
HETATM 3874  H6o GLB E   9       0.392  -0.928 -22.804  0.00  0.00              
HETATM 3875  O4h GLB E   9      -2.942  -0.495 -24.205  0.00  0.00              
HETATM 3876  H4o GLB E   9      -3.853   0.101 -24.237  0.00  0.00              
HETATM 3877  H5  GLB E   9      -1.072  -1.953 -26.574  0.00  0.00              
HETATM 3878  H6S GLB E   9       0.904  -1.303 -25.075  0.00  0.00              
HETATM 3879  H6R GLB E   9       0.131  -0.169 -25.575  0.00  0.00              
HETATM 3880  H1  GLB E   9      -2.274  -4.058 -26.347  0.00  0.00              
HETATM 3881  H2  GLB E   9      -4.164  -2.814 -24.338  0.00  0.00              
HETATM 3882  H3  GLB E   9      -3.572  -1.824 -27.146  0.00  0.00              
HETATM 3883  H4  GLB E   9      -2.341   0.043 -26.101  0.00  0.00              
HETATM 3884  C1  NAN E  10      -5.868  -1.586 -28.021  0.00  0.00              
HETATM 3885  C2  NAN E  10      -5.584  -0.395 -27.037  0.00  0.00              
HETATM 3886  C3  NAN E  10      -4.665   0.728 -27.597  0.00  0.00              
HETATM 3887  C4  NAN E  10      -5.413   1.646 -28.587  0.00  0.00              
HETATM 3888  C5  NAN E  10      -6.711   2.205 -27.966  0.00  0.00              
HETATM 3889  C6  NAN E  10      -7.600   1.057 -27.406  0.00  0.00              
HETATM 3890  C7  NAN E  10      -8.850   1.560 -26.637  0.00  0.00              
HETATM 3891  C8  NAN E  10      -9.854   0.433 -26.295  0.00  0.00              
HETATM 3892  C9  NAN E  10     -11.106   0.926 -25.555  0.00  0.00              
HETATM 3893  OW  NAN E  10      -6.800   0.213 -26.505  0.00  0.00              
HETATM 3894  OM  NAN E  10      -5.397  -1.697 -29.153  0.00  0.00              
HETATM 3895  O1h NAN E  10      -6.714  -2.514 -27.487  0.00  0.00              
HETATM 3896  O4h NAN E  10      -4.558   2.724 -28.944  0.00  0.00              
HETATM 3897  O7h NAN E  10      -8.410   2.177 -25.428  0.00  0.00              
HETATM 3898  O8h NAN E  10     -10.321  -0.182 -27.486  0.00  0.00              
HETATM 3899  O9h NAN E  10     -12.008  -0.160 -25.342  0.00  0.00              
HETATM 3900  H6  NAN E  10      -7.948   0.450 -28.266  0.00  0.00              
HETATM 3901  H3  NAN E  10      -4.294   1.340 -26.753  0.00  0.00              
HETATM 3902  H21 NAN E  10      -3.764   0.288 -28.062  0.00  0.00              
HETATM 3903  H4  NAN E  10      -5.668   1.069 -29.501  0.00  0.00              
HETATM 3904  H7o NAN E  10      -7.661   1.637 -25.153  0.00  0.00              
HETATM 3905  H8o NAN E  10     -11.169  -0.559 -27.224  0.00  0.00              
HETATM 3906  H4o NAN E  10      -3.709   2.329 -29.157  0.00  0.00              
HETATM 3907  H9o NAN E  10     -12.711   0.165 -24.770  0.00  0.00              
HETATM 3908  H9R NAN E  10     -11.604   1.728 -26.135  0.00  0.00              
HETATM 3909  H9S NAN E  10     -10.817   1.380 -24.587  0.00  0.00              
HETATM 3910  H8  NAN E  10      -9.350  -0.332 -25.671  0.00  0.00              
HETATM 3911  H7  NAN E  10      -9.372   2.313 -27.259  0.00  0.00              
HETATM 3912  H1o NAN E  10      -6.860  -3.190 -28.150  0.00  0.00              
HETATM 3913  H5  NAN E  10      -6.446   2.891 -27.137  0.00  0.00              
HETATM 3914  N33 NAN E  10      -7.409   2.947 -28.992  0.00  0.00              
HETATM 3915  C34 NAN E  10      -7.227   4.301 -29.103  0.00  0.00              
HETATM 3916  C35 NAN E  10      -8.029   4.942 -30.220  0.00  0.00              
HETATM 3917  OM  NAN E  10      -6.498   4.955 -28.383  0.00  0.00              
HETATM 3918  H37 NAN E  10      -8.043   2.457 -29.639  0.00  0.00              
HETATM 3919  H35 NAN E  10      -7.835   6.039 -30.270  0.00  0.00              
HETATM 3920  H39 NAN E  10      -9.119   4.792 -30.046  0.00  0.00              
HETATM 3921  H40 NAN E  10      -7.750   4.498 -31.202  0.00  0.00              
HETATM 3922  C1  MAN E  11       5.206 -19.994 -22.379  0.00  0.00              
HETATM 3923  C2  MAN E  11       5.399 -20.633 -23.752  0.00  0.00              
HETATM 3924  C3  MAN E  11       4.148 -21.353 -24.227  0.00  0.00              
HETATM 3925  C4  MAN E  11       3.639 -22.293 -23.157  0.00  0.00              
HETATM 3926  C5  MAN E  11       3.460 -21.535 -21.843  0.00  0.00              
HETATM 3927  C6  MAN E  11       2.974 -22.377 -20.682  0.00  0.00              
HETATM 3928  O3h MAN E  11       4.470 -22.108 -25.401  0.00  0.00              
HETATM 3929  O4h MAN E  11       2.387 -22.852 -23.523  0.00  0.00              
HETATM 3930  OR  MAN E  11       4.740 -21.000 -21.471  0.00  0.00              
HETATM 3931  OW  MAN E  11       1.773 -21.868 -20.126  0.00  0.00              
HETATM 3932  H3o MAN E  11       3.947 -21.568 -26.191  0.00  0.00              
HETATM 3933  H4o MAN E  11       2.542 -23.828 -23.982  0.00  0.00              
HETATM 3934  OW  MAN E  11       6.478 -21.556 -23.677  0.00  0.00              
HETATM 3935  H5  MAN E  11       2.739 -20.775 -21.973  0.00  0.00              
HETATM 3936  H6  MAN E  11       2.876 -23.365 -20.591  0.00  0.00              
HETATM 3937  H20 MAN E  11       3.707 -22.363 -19.928  0.00  0.00              
HETATM 3938  H1  MAN E  11       6.149 -19.562 -22.043  0.00  0.00              
HETATM 3939  H2  MAN E  11       5.645 -19.833 -24.449  0.00  0.00              
HETATM 3940  H3  MAN E  11       3.381 -20.612 -24.454  0.00  0.00              
HETATM 3941  H4  MAN E  11       4.374 -23.091 -23.042  0.00  0.00              
HETATM 3942  C1  NAG E  12       7.785 -21.036 -23.871  0.00  0.00              
HETATM 3943  C2  NAG E  12       8.806 -21.735 -22.917  0.00  0.00              
HETATM 3944  C3  NAG E  12      10.261 -21.347 -23.327  0.00  0.00              
HETATM 3945  C4  NAG E  12      10.520 -21.613 -24.824  0.00  0.00              
HETATM 3946  C5  NAG E  12       9.451 -20.907 -25.702  0.00  0.00              
HETATM 3947  C6  NAG E  12       9.606 -21.228 -27.201  0.00  0.00              
HETATM 3948  C7  NAG E  12       8.546 -22.222 -20.504  0.00  0.00              
HETATM 3949  C8  NAG E  12       8.375 -21.638 -19.118  0.00  0.00              
HETATM 3950  O3h NAG E  12      11.239 -22.078 -22.583  0.00  0.00              
HETATM 3951  OR  NAG E  12      11.831 -21.149 -25.127  0.00  0.00              
HETATM 3952  OR  NAG E  12       8.113 -21.298 -25.263  0.00  0.00              
HETATM 3953  O6h NAG E  12       9.460 -22.626 -27.460  0.00  0.00              
HETATM 3954  OM  NAG E  12       8.712 -23.427 -20.648  0.00  0.00              
HETATM 3955  N15 NAG E  12       8.560 -21.341 -21.501  0.00  0.00              
HETATM 3956  H2  NAG E  12       8.686 -22.829 -23.062  0.00  0.00              
HETATM 3957  H3  NAG E  12      10.412 -20.265 -23.138  0.00  0.00              
HETATM 3958  H4  NAG E  12      10.464 -22.705 -25.010  0.00  0.00              
HETATM 3959  H5  NAG E  12       9.564 -19.811 -25.580  0.00  0.00              
HETATM 3960  H6S NAG E  12       8.858 -20.656 -27.781  0.00  0.00              
HETATM 3961  H6R NAG E  12      10.598 -20.880 -27.548  0.00  0.00              
HETATM 3962  H8  NAG E  12       7.734 -22.299 -18.508  0.00  0.00              
HETATM 3963  H24 NAG E  12       7.920 -20.632 -19.110  0.00  0.00              
HETATM 3964  H25 NAG E  12       9.357 -21.579 -18.618  0.00  0.00              
HETATM 3965  H3o NAG E  12      11.150 -21.800 -21.667  0.00  0.00              
HETATM 3966  H6o NAG E  12       9.813 -22.794 -28.338  0.00  0.00              
HETATM 3967  H29 NAG E  12       8.259 -20.405 -21.227  0.00  0.00              
HETATM 3968  H1  NAG E  12       7.768 -19.941 -23.695  0.00  0.00              
HETATM 3969  C1  GLB E  13      12.705 -22.061 -25.694  0.00  0.00              
HETATM 3970  C2  GLB E  13      13.930 -21.302 -26.190  0.00  0.00              
HETATM 3971  C3  GLB E  13      15.057 -22.238 -26.594  0.00  0.00              
HETATM 3972  C4  GLB E  13      15.336 -23.236 -25.495  0.00  0.00              
HETATM 3973  C5  GLB E  13      14.043 -23.952 -25.102  0.00  0.00              
HETATM 3974  C6  GLB E  13      14.187 -24.965 -23.989  0.00  0.00              
HETATM 3975  O2h GLB E  13      13.546 -20.503 -27.302  0.00  0.00              
HETATM 3976  O3h GLB E  13      16.237 -21.460 -26.834  0.00  0.00              
HETATM 3977  OR  GLB E  13      13.114 -22.953 -24.649  0.00  0.00              
HETATM 3978  OW  GLB E  13      13.362 -26.101 -24.196  0.00  0.00              
HETATM 3979  H2o GLB E  13      13.377 -19.509 -27.083  0.00  0.00              
HETATM 3980  H3o GLB E  13      16.361 -21.529 -27.914  0.00  0.00              
HETATM 3981  O4h GLB E  13      15.897 -22.482 -24.427  0.00  0.00              
HETATM 3982  H4o GLB E  13      16.807 -21.991 -24.768  0.00  0.00              
HETATM 3983  H5  GLB E  13      13.671 -24.483 -25.934  0.00  0.00              
HETATM 3984  H6  GLB E  13      15.001 -25.342 -23.553  0.00  0.00              
HETATM 3985  H20 GLB E  13      13.891 -24.516 -23.085  0.00  0.00              
HETATM 3986  H1  GLB E  13      12.248 -22.600 -26.524  0.00  0.00              
HETATM 3987  H2  GLB E  13      14.266 -20.659 -25.376  0.00  0.00              
HETATM 3988  H3  GLB E  13      14.764 -22.768 -27.501  0.00  0.00              
HETATM 3989  H4  GLB E  13      16.033 -24.019 -25.793  0.00  0.00              
HETATM 3990  C1  NAN E  14      12.382 -25.999 -21.971  0.00  0.00              
HETATM 3991  C2  NAN E  14      13.067 -26.897 -23.062  0.00  0.00              
HETATM 3992  C3  NAN E  14      14.408 -27.559 -22.635  0.00  0.00              
HETATM 3993  C4  NAN E  14      14.184 -28.765 -21.697  0.00  0.00              
HETATM 3994  C5  NAN E  14      13.197 -29.781 -22.312  0.00  0.00              
HETATM 3995  C6  NAN E  14      11.871 -29.083 -22.738  0.00  0.00              
HETATM 3996  C7  NAN E  14      10.894 -30.019 -23.498  0.00  0.00              
HETATM 3997  C8  NAN E  14       9.490 -29.401 -23.704  0.00  0.00              
HETATM 3998  C9  NAN E  14       8.510 -30.331 -24.433  0.00  0.00              
HETATM 3999  OW  NAN E  14      12.180 -27.927 -23.596  0.00  0.00              
HETATM 4000  OM  NAN E  14      12.843 -25.767 -20.853  0.00  0.00              
HETATM 4001  O1h NAN E  14      11.190 -25.483 -22.392  0.00  0.00              
HETATM 4002  O4h NAN E  14      15.432 -29.402 -21.467  0.00  0.00              
HETATM 4003  O7h NAN E  14      11.465 -30.319 -24.770  0.00  0.00              
HETATM 4004  O8h NAN E  14       8.895 -29.113 -22.447  0.00  0.00              
HETATM 4005  O9h NAN E  14       7.225 -29.715 -24.518  0.00  0.00              
HETATM 4006  H6  NAN E  14      11.365 -28.731 -21.817  0.00  0.00              
HETATM 4007  H3  NAN E  14      14.939 -27.907 -23.542  0.00  0.00              
HETATM 4008  H21 NAN E  14      15.073 -26.809 -22.169  0.00  0.00              
HETATM 4009  H4  NAN E  14      13.775 -28.404 -20.729  0.00  0.00              
HETATM 4010  H7o NAN E  14      11.899 -29.499 -25.028  0.00  0.00              
HETATM 4011  H8o NAN E  14       7.952 -29.114 -22.644  0.00  0.00              
HETATM 4012  H4o NAN E  14      16.053 -28.699 -21.253  0.00  0.00              
HETATM 4013  H9o NAN E  14       6.683 -30.271 -25.088  0.00  0.00              
HETATM 4014  H9R NAN E  14       8.435 -31.301 -23.904  0.00  0.00              
HETATM 4015  H9S NAN E  14       8.892 -30.562 -25.447  0.00  0.00              
HETATM 4016  H8  NAN E  14       9.585 -28.459 -24.280  0.00  0.00              
HETATM 4017  H7  NAN E  14      10.780 -30.957 -22.920  0.00  0.00              
HETATM 4018  H1o NAN E  14      10.823 -24.973 -21.669  0.00  0.00              
HETATM 4019  H5  NAN E  14      13.664 -30.240 -23.205  0.00  0.00              
HETATM 4020  N33 NAN E  14      12.946 -30.807 -21.326  0.00  0.00              
HETATM 4021  C34 NAN E  14      13.684 -31.962 -21.336  0.00  0.00              
HETATM 4022  C35 NAN E  14      13.304 -32.948 -20.247  0.00  0.00              
HETATM 4023  OM  NAN E  14      14.566 -32.205 -22.136  0.00  0.00              
HETATM 4024  H37 NAN E  14      12.212 -30.670 -20.615  0.00  0.00              
HETATM 4025  H35 NAN E  14      13.940 -33.860 -20.297  0.00  0.00              
HETATM 4026  H39 NAN E  14      12.242 -33.261 -20.364  0.00  0.00              
HETATM 4027  H40 NAN E  14      13.441 -32.486 -19.242  0.00  0.00              
HETATM 4028  C1  NAG E  15       1.451 -22.277 -18.805  0.00  0.00              
HETATM 4029  C2  NAG E  15       0.306 -21.392 -18.216  0.00  0.00              
HETATM 4030  C3  NAG E  15      -0.212 -22.018 -16.884  0.00  0.00              
HETATM 4031  C4  NAG E  15      -0.595 -23.502 -17.064  0.00  0.00              
HETATM 4032  C5  NAG E  15       0.585 -24.306 -17.675  0.00  0.00              
HETATM 4033  C6  NAG E  15       0.215 -25.772 -17.971  0.00  0.00              
HETATM 4034  C7  NAG E  15       0.082 -18.929 -18.312  0.00  0.00              
HETATM 4035  C8  NAG E  15       0.674 -17.598 -17.901  0.00  0.00              
HETATM 4036  O3h NAG E  15      -1.362 -21.334 -16.382  0.00  0.00              
HETATM 4037  OR  NAG E  15      -0.967 -24.013 -15.788  0.00  0.00              
HETATM 4038  OR  NAG E  15       1.033 -23.665 -18.910  0.00  0.00              
HETATM 4039  O6h NAG E  15      -0.852 -25.868 -18.917  0.00  0.00              
HETATM 4040  OM  NAG E  15      -1.005 -18.970 -18.879  0.00  0.00              
HETATM 4041  N15 NAG E  15       0.786 -20.004 -17.968  0.00  0.00              
HETATM 4042  H2  NAG E  15      -0.526 -21.409 -18.951  0.00  0.00              
HETATM 4043  H3  NAG E  15       0.593 -21.961 -16.123  0.00  0.00              
HETATM 4044  H4  NAG E  15      -1.461 -23.568 -17.753  0.00  0.00              
HETATM 4045  H5  NAG E  15       1.421 -24.311 -16.947  0.00  0.00              
HETATM 4046  H6S NAG E  15       1.105 -26.309 -18.349  0.00  0.00              
HETATM 4047  H6R NAG E  15      -0.070 -26.275 -17.027  0.00  0.00              
HETATM 4048  H8  NAG E  15       0.505 -16.849 -18.694  0.00  0.00              
HETATM 4049  H24 NAG E  15       1.760 -17.635 -17.702  0.00  0.00              
HETATM 4050  H25 NAG E  15       0.168 -17.235 -16.990  0.00  0.00              
HETATM 4051  H3o NAG E  15      -1.072 -20.446 -16.151  0.00  0.00              
HETATM 4052  H6o NAG E  15      -1.202 -26.762 -18.866  0.00  0.00              
HETATM 4053  H29 NAG E  15       1.729 -19.790 -17.641  0.00  0.00              
HETATM 4054  H1  NAG E  15       2.361 -22.212 -18.175  0.00  0.00              
HETATM 4055  C1  GLB E  16      -2.221 -24.588 -15.683  0.00  0.00              
HETATM 4056  C2  GLB E  16      -2.303 -25.310 -14.341  0.00  0.00              
HETATM 4057  C3  GLB E  16      -3.719 -25.756 -14.019  0.00  0.00              
HETATM 4058  C4  GLB E  16      -4.685 -24.604 -14.177  0.00  0.00              
HETATM 4059  C5  GLB E  16      -4.530 -23.983 -15.565  0.00  0.00              
HETATM 4060  C6  GLB E  16      -5.431 -22.799 -15.838  0.00  0.00              
HETATM 4061  O2h GLB E  16      -1.442 -26.440 -14.384  0.00  0.00              
HETATM 4062  OW  GLB E  16      -3.759 -26.218 -12.664  0.00  0.00              
HETATM 4063  OR  GLB E  16      -3.175 -23.519 -15.685  0.00  0.00              
HETATM 4064  O6h GLB E  16      -5.217 -21.744 -14.914  0.00  0.00              
HETATM 4065  H2o GLB E  16      -0.527 -26.303 -13.927  0.00  0.00              
HETATM 4066  H6o GLB E  16      -4.962 -20.704 -15.119  0.00  0.00              
HETATM 4067  O4h GLB E  16      -4.374 -23.697 -13.127  0.00  0.00              
HETATM 4068  H4o GLB E  16      -4.496 -24.197 -12.166  0.00  0.00              
HETATM 4069  H5  GLB E  16      -4.764 -24.702 -16.299  0.00  0.00              
HETATM 4070  H6S GLB E  16      -5.642 -22.325 -16.691  0.00  0.00              
HETATM 4071  H6R GLB E  16      -6.432 -23.108 -15.744  0.00  0.00              
HETATM 4072  H1  GLB E  16      -2.412 -25.297 -16.490  0.00  0.00              
HETATM 4073  H2  GLB E  16      -1.958 -24.613 -13.577  0.00  0.00              
HETATM 4074  H3  GLB E  16      -3.998 -26.560 -14.700  0.00  0.00              
HETATM 4075  H4  GLB E  16      -5.730 -24.906 -14.099  0.00  0.00              
HETATM 4076  C1  NAN E  17      -3.515 -28.549 -13.320  0.00  0.00              
HETATM 4077  C2  NAN E  17      -4.296 -27.509 -12.440  0.00  0.00              
HETATM 4078  C3  NAN E  17      -5.819 -27.401 -12.730  0.00  0.00              
HETATM 4079  C4  NAN E  17      -6.608 -28.589 -12.135  0.00  0.00              
HETATM 4080  C5  NAN E  17      -6.307 -28.765 -10.630  0.00  0.00              
HETATM 4081  C6  NAN E  17      -4.775 -28.857 -10.373  0.00  0.00              
HETATM 4082  C7  NAN E  17      -4.398 -28.886  -8.869  0.00  0.00              
HETATM 4083  C8  NAN E  17      -2.908 -29.222  -8.616  0.00  0.00              
HETATM 4084  C9  NAN E  17      -2.533 -29.277  -7.129  0.00  0.00              
HETATM 4085  OW  NAN E  17      -4.102 -27.711 -11.006  0.00  0.00              
HETATM 4086  OM  NAN E  17      -4.010 -29.231 -14.217  0.00  0.00              
HETATM 4087  O1h NAN E  17      -2.193 -28.627 -12.987  0.00  0.00              
HETATM 4088  O4h NAN E  17      -7.996 -28.351 -12.313  0.00  0.00              
HETATM 4089  O7h NAN E  17      -4.690 -27.605  -8.313  0.00  0.00              
HETATM 4090  O8h NAN E  17      -2.601 -30.504  -9.144  0.00  0.00              
HETATM 4091  O9h NAN E  17      -1.166 -29.662  -6.984  0.00  0.00              
HETATM 4092  H6  NAN E  17      -4.412 -29.796 -10.836  0.00  0.00              
HETATM 4093  H3  NAN E  17      -6.203 -26.462 -12.288  0.00  0.00              
HETATM 4094  H21 NAN E  17      -5.996 -27.311 -13.818  0.00  0.00              
HETATM 4095  H4  NAN E  17      -6.326 -29.520 -12.670  0.00  0.00              
HETATM 4096  H7o NAN E  17      -4.465 -26.990  -9.018  0.00  0.00              
HETATM 4097  H8o NAN E  17      -1.834 -30.777  -8.630  0.00  0.00              
HETATM 4098  H4o NAN E  17      -8.102 -28.078 -13.228  0.00  0.00              
HETATM 4099  H9o NAN E  17      -0.941 -29.559  -6.053  0.00  0.00              
HETATM 4100  H9R NAN E  17      -3.189 -29.991  -6.593  0.00  0.00              
HETATM 4101  H9S NAN E  17      -2.705 -28.289  -6.660  0.00  0.00              
HETATM 4102  H8  NAN E  17      -2.272 -28.466  -9.118  0.00  0.00              
HETATM 4103  H7  NAN E  17      -5.018 -29.652  -8.363  0.00  0.00              
HETATM 4104  H1o NAN E  17      -1.791 -29.294 -13.543  0.00  0.00              
HETATM 4105  H5  NAN E  17      -6.712 -27.892 -10.079  0.00  0.00              
HETATM 4106  N33 NAN E  17      -6.979 -29.963 -10.182  0.00  0.00              
HETATM 4107  C34 NAN E  17      -8.229 -29.881  -9.623  0.00  0.00              
HETATM 4108  C35 NAN E  17      -8.804 -31.218  -9.195  0.00  0.00              
HETATM 4109  OM  NAN E  17      -8.842 -28.842  -9.467  0.00  0.00              
HETATM 4110  H37 NAN E  17      -6.520 -30.879 -10.283  0.00  0.00              
HETATM 4111  H35 NAN E  17      -9.820 -31.091  -8.758  0.00  0.00              
HETATM 4112  H39 NAN E  17      -8.152 -31.688  -8.423  0.00  0.00              
HETATM 4113  H40 NAN E  17      -8.886 -31.902 -10.070  0.00  0.00              
HETATM 4114  C1  AFL E  18      12.248 -12.919 -15.382  0.00  0.00              
HETATM 4115  C2  AFL E  18      13.527 -13.651 -15.831  0.00  0.00              
HETATM 4116  C3  AFL E  18      13.284 -14.408 -17.144  0.00  0.00              
HETATM 4117  C4  AFL E  18      12.701 -13.442 -18.190  0.00  0.00              
HETATM 4118  C5  AFL E  18      11.450 -12.756 -17.621  0.00  0.00              
HETATM 4119  C6  AFL E  18      10.819 -11.736 -18.577  0.00  0.00              
HETATM 4120  OR  AFL E  18      11.747 -12.056 -16.406  0.00  0.00              
HETATM 4121  O2h AFL E  18      13.963 -14.476 -14.754  0.00  0.00              
HETATM 4122  O3h AFL E  18      14.495 -15.028 -17.562  0.00  0.00              
HETATM 4123  O4h AFL E  18      13.637 -12.429 -18.556  0.00  0.00              
HETATM 4124  H5  AFL E  18      10.688 -13.535 -17.427  0.00  0.00              
HETATM 4125  H1  AFL E  18      12.479 -12.262 -14.534  0.00  0.00              
HETATM 4126  H2  AFL E  18      14.302 -12.881 -16.019  0.00  0.00              
HETATM 4127  H2o AFL E  18      14.835 -14.809 -15.003  0.00  0.00              
HETATM 4128  H3  AFL E  18      12.537 -15.201 -16.945  0.00  0.00              
HETATM 4129  H3o AFL E  18      14.258 -15.646 -18.267  0.00  0.00              
HETATM 4130  H4  AFL E  18      12.416 -14.000 -19.103  0.00  0.00              
HETATM 4131  H4o AFL E  18      14.367 -12.880 -19.003  0.00  0.00              
HETATM 4132  H6  AFL E  18      10.571 -12.184 -19.552  0.00  0.00              
HETATM 4133  H22 AFL E  18       9.892 -11.333 -18.140  0.00  0.00              
HETATM 4134  H23 AFL E  18      11.502 -10.890 -18.752  0.00  0.00              
TER
CONECT 1523 1524 1548 1533  110
CONECT 1524 1523 1525 1537 1536
CONECT 1525 1524 1526 1538 1531
CONECT 1526 1525 1527 1539 1532
CONECT 1527 1526 1528 1540 1533
CONECT 1528 1527 1541 1542 1534
CONECT 1529 1530 1536 1535
CONECT 1530 1529 1543 1544 1545
CONECT 1531 1525 1546
CONECT 1532 1526 1549
CONECT 1533 1523 1527
CONECT 1534 1528 2028
CONECT 1535 1529
CONECT 1536 1524 1529 1547
CONECT 1537 1524
CONECT 1538 1525
CONECT 1539 1526
CONECT 1540 1527
CONECT 1541 1528
CONECT 1542 1528
CONECT 1543 1530
CONECT 1544 1530
CONECT 1545 1530
CONECT 1546 1531
CONECT 1547 1536
CONECT 1548 1523
CONECT 1549 1532 1550 1575 1559
CONECT 1550 1549 1551 1563 1562
CONECT 1551 1550 1552 1564 1557
CONECT 1552 1551 1553 1565 1558
CONECT 1553 1552 1554 1566 1559
CONECT 1554 1553 1567 1568 1560
CONECT 1555 1556 1562 1561
CONECT 1556 1555 1569 1570 1571
CONECT 1557 1551 1572
CONECT 1558 1552 1576
CONECT 1559 1549 1553
CONECT 1560 1554 1573
CONECT 1561 1555
CONECT 1562 1550 1555 1574
CONECT 1563 1550
CONECT 1564 1551
CONECT 1565 1552
CONECT 1566 1553
CONECT 1567 1554
CONECT 1568 1554
CONECT 1569 1556
CONECT 1570 1556
CONECT 1571 1556
CONECT 1572 1557
CONECT 1573 1560
CONECT 1574 1562
CONECT 1575 1549
CONECT 1576 1558 1577 1584 1594
CONECT 1577 1576 1578 1587 1592
CONECT 1578 1577 1579 1582 1593
CONECT 1579 1578 1583 1580 1595
CONECT 1580 1579 1584 1581 1589
CONECT 1581 1580 1590 1591 1585
CONECT 1582 1578 1596
CONECT 1583 1579 1586
CONECT 1584 1576 1580
CONECT 1585 1581 1788
CONECT 1586 1583
CONECT 1587 1577 1588
CONECT 1588 1587
CONECT 1589 1580
CONECT 1590 1581
CONECT 1591 1581
CONECT 1592 1577
CONECT 1593 1578
CONECT 1594 1576
CONECT 1595 1579
CONECT 1596 1582 1597 1604 1612
CONECT 1597 1596 1598 1608 1613
CONECT 1598 1597 1599 1602 1614
CONECT 1599 1598 1603 1600 1615
CONECT 1600 1599 1604 1601 1609
CONECT 1601 1600 1610 1611 1605
CONECT 1602 1598 1606
CONECT 1603 1599 1702
CONECT 1604 1596 1600
CONECT 1605 1601 1607
CONECT 1606 1602
CONECT 1607 1605
CONECT 1608 1597 1616
CONECT 1609 1600
CONECT 1610 1601
CONECT 1611 1601
CONECT 1612 1596
CONECT 1613 1597
CONECT 1614 1598
CONECT 1615 1599
CONECT 1616 1608 1617 1642 1626
CONECT 1617 1616 1618 1630 1629
CONECT 1618 1617 1619 1631 1624
CONECT 1619 1618 1620 1632 1625
CONECT 1620 1619 1621 1633 1626
CONECT 1621 1620 1634 1635 1627
CONECT 1622 1623 1629 1628
CONECT 1623 1622 1636 1637 1638
CONECT 1624 1618 1639
CONECT 1625 1619 1643
CONECT 1626 1616 1620
CONECT 1627 1621 1640
CONECT 1628 1622
CONECT 1629 1617 1622 1641
CONECT 1630 1617
CONECT 1631 1618
CONECT 1632 1619
CONECT 1633 1620
CONECT 1634 1621
CONECT 1635 1621
CONECT 1636 1623
CONECT 1637 1623
CONECT 1638 1623
CONECT 1639 1624
CONECT 1640 1627
CONECT 1641 1629
CONECT 1642 1616
CONECT 1643 1625 1644 1651 1660
CONECT 1644 1643 1645 1649 1661
CONECT 1645 1644 1646 1650 1662
CONECT 1646 1645 1655 1647 1663
CONECT 1647 1646 1651 1648 1657
CONECT 1648 1647 1658 1659 1652
CONECT 1649 1644 1653
CONECT 1650 1645 1665
CONECT 1651 1643 1647
CONECT 1652 1648 1654
CONECT 1653 1649
CONECT 1654 1652
CONECT 1655 1646 1656
CONECT 1656 1655
CONECT 1657 1647
CONECT 1658 1648
CONECT 1659 1648
CONECT 1660 1643
CONECT 1661 1644
CONECT 1662 1645
CONECT 1663 1646
CONECT 1664 1665 1674 1675
CONECT 1665 1650 1664 1666 1673
CONECT 1666 1665 1667 1681 1682
CONECT 1667 1666 1668 1676 1683
CONECT 1668 1667 1669 1693 1694
CONECT 1669 1668 1670 1673 1680
CONECT 1670 1669 1671 1677 1691
CONECT 1671 1670 1672 1678 1690
CONECT 1672 1671 1679 1688 1689
CONECT 1673 1665 1669
CONECT 1674 1664
CONECT 1675 1664 1692
CONECT 1676 1667 1686
CONECT 1677 1670 1684
CONECT 1678 1671 1685
CONECT 1679 1672 1687
CONECT 1680 1669
CONECT 1681 1666
CONECT 1682 1666
CONECT 1683 1667
CONECT 1684 1677
CONECT 1685 1678
CONECT 1686 1676
CONECT 1687 1679
CONECT 1688 1672
CONECT 1689 1672
CONECT 1690 1671
CONECT 1691 1670
CONECT 1692 1675
CONECT 1693 1668
CONECT 1694 1668 1695 1698
CONECT 1695 1694 1696 1697
CONECT 1696 1695 1699 1700 1701
CONECT 1697 1695
CONECT 1698 1694
CONECT 1699 1696
CONECT 1700 1696
CONECT 1701 1696
CONECT 1702 1603 1703 1728 1712
CONECT 1703 1702 1704 1716 1715
CONECT 1704 1703 1705 1717 1710
CONECT 1705 1704 1706 1718 1711
CONECT 1706 1705 1707 1719 1712
CONECT 1707 1706 1720 1721 1713
CONECT 1708 1709 1715 1714
CONECT 1709 1708 1722 1723 1724
CONECT 1710 1704 1725
CONECT 1711 1705 1729
CONECT 1712 1702 1706
CONECT 1713 1707 1726
CONECT 1714 1708
CONECT 1715 1703 1708 1727
CONECT 1716 1703
CONECT 1717 1704
CONECT 1718 1705
CONECT 1719 1706
CONECT 1720 1707
CONECT 1721 1707
CONECT 1722 1709
CONECT 1723 1709
CONECT 1724 1709
CONECT 1725 1710
CONECT 1726 1713
CONECT 1727 1715
CONECT 1728 1702
CONECT 1729 1711 1730 1737 1746
CONECT 1730 1729 1731 1735 1747
CONECT 1731 1730 1732 1736 1748
CONECT 1732 1731 1741 1733 1749
CONECT 1733 1732 1737 1734 1743
CONECT 1734 1733 1744 1745 1738
CONECT 1735 1730 1739
CONECT 1736 1731 1751
CONECT 1737 1729 1733
CONECT 1738 1734 1740
CONECT 1739 1735
CONECT 1740 1738
CONECT 1741 1732 1742
CONECT 1742 1741
CONECT 1743 1733
CONECT 1744 1734
CONECT 1745 1734
CONECT 1746 1729
CONECT 1747 1730
CONECT 1748 1731
CONECT 1749 1732
CONECT 1750 1751 1760 1761
CONECT 1751 1736 1750 1752 1759
CONECT 1752 1751 1753 1767 1768
CONECT 1753 1752 1754 1762 1769
CONECT 1754 1753 1755 1779 1780
CONECT 1755 1754 1756 1759 1766
CONECT 1756 1755 1757 1763 1777
CONECT 1757 1756 1758 1764 1776
CONECT 1758 1757 1765 1774 1775
CONECT 1759 1751 1755
CONECT 1760 1750
CONECT 1761 1750 1778
CONECT 1762 1753 1772
CONECT 1763 1756 1770
CONECT 1764 1757 1771
CONECT 1765 1758 1773
CONECT 1766 1755
CONECT 1767 1752
CONECT 1768 1752
CONECT 1769 1753
CONECT 1770 1763
CONECT 1771 1764
CONECT 1772 1762
CONECT 1773 1765
CONECT 1774 1758
CONECT 1775 1758
CONECT 1776 1757
CONECT 1777 1756
CONECT 1778 1761
CONECT 1779 1754
CONECT 1780 1754 1781 1784
CONECT 1781 1780 1782 1783
CONECT 1782 1781 1785 1786 1787
CONECT 1783 1781
CONECT 1784 1780
CONECT 1785 1782
CONECT 1786 1782
CONECT 1787 1782
CONECT 1788 1585 1789 1796 1804
CONECT 1789 1788 1790 1800 1805
CONECT 1790 1789 1791 1794 1806
CONECT 1791 1790 1795 1792 1807
CONECT 1792 1791 1796 1793 1801
CONECT 1793 1792 1802 1803 1797
CONECT 1794 1790 1798
CONECT 1795 1791 1799
CONECT 1796 1788 1792
CONECT 1797 1793 1894
CONECT 1798 1794
CONECT 1799 1795
CONECT 1800 1789 1808
CONECT 1801 1792
CONECT 1802 1793
CONECT 1803 1793
CONECT 1804 1788
CONECT 1805 1789
CONECT 1806 1790
CONECT 1807 1791
CONECT 1808 1800 1809 1834 1818
CONECT 1809 1808 1810 1822 1821
CONECT 1810 1809 1811 1823 1816
CONECT 1811 1810 1812 1824 1817
CONECT 1812 1811 1813 1825 1818
CONECT 1813 1812 1826 1827 1819
CONECT 1814 1815 1821 1820
CONECT 1815 1814 1828 1829 1830
CONECT 1816 1810 1831
CONECT 1817 1811 1835
CONECT 1818 1808 1812
CONECT 1819 1813 1832
CONECT 1820 1814
CONECT 1821 1809 1814 1833
CONECT 1822 1809
CONECT 1823 1810
CONECT 1824 1811
CONECT 1825 1812
CONECT 1826 1813
CONECT 1827 1813
CONECT 1828 1815
CONECT 1829 1815
CONECT 1830 1815
CONECT 1831 1816
CONECT 1832 1819
CONECT 1833 1821
CONECT 1834 1808
CONECT 1835 1817 1836 1843 1852
CONECT 1836 1835 1837 1841 1853
CONECT 1837 1836 1838 1842 1854
CONECT 1838 1837 1847 1839 1855
CONECT 1839 1838 1843 1840 1849
CONECT 1840 1839 1850 1851 1844
CONECT 1841 1836 1845
CONECT 1842 1837 1857
CONECT 1843 1835 1839
CONECT 1844 1840 1846
CONECT 1845 1841
CONECT 1846 1844
CONECT 1847 1838 1848
CONECT 1848 1847
CONECT 1849 1839
CONECT 1850 1840
CONECT 1851 1840
CONECT 1852 1835
CONECT 1853 1836
CONECT 1854 1837
CONECT 1855 1838
CONECT 1856 1857 1866 1867
CONECT 1857 1842 1856 1858 1865
CONECT 1858 1857 1859 1873 1874
CONECT 1859 1858 1860 1868 1875
CONECT 1860 1859 1861 1885 1886
CONECT 1861 1860 1862 1865 1872
CONECT 1862 1861 1863 1869 1883
CONECT 1863 1862 1864 1870 1882
CONECT 1864 1863 1871 1880 1881
CONECT 1865 1857 1861
CONECT 1866 1856
CONECT 1867 1856 1884
CONECT 1868 1859 1878
CONECT 1869 1862 1876
CONECT 1870 1863 1877
CONECT 1871 1864 1879
CONECT 1872 1861
CONECT 1873 1858
CONECT 1874 1858
CONECT 1875 1859
CONECT 1876 1869
CONECT 1877 1870
CONECT 1878 1868
CONECT 1879 1871
CONECT 1880 1864
CONECT 1881 1864
CONECT 1882 1863
CONECT 1883 1862
CONECT 1884 1867
CONECT 1885 1860
CONECT 1886 1860 1887 1890
CONECT 1887 1886 1888 1889
CONECT 1888 1887 1891 1892 1893
CONECT 1889 1887
CONECT 1890 1886
CONECT 1891 1888
CONECT 1892 1888
CONECT 1893 1888
CONECT 1894 1797 1895 1920 1904
CONECT 1895 1894 1896 1908 1907
CONECT 1896 1895 1897 1909 1902
CONECT 1897 1896 1898 1910 1903
CONECT 1898 1897 1899 1911 1904
CONECT 1899 1898 1912 1913 1905
CONECT 1900 1901 1907 1906
CONECT 1901 1900 1914 1915 1916
CONECT 1902 1896 1917
CONECT 1903 1897 1921
CONECT 1904 1894 1898
CONECT 1905 1899 1918
CONECT 1906 1900
CONECT 1907 1895 1900 1919
CONECT 1908 1895
CONECT 1909 1896
CONECT 1910 1897
CONECT 1911 1898
CONECT 1912 1899
CONECT 1913 1899
CONECT 1914 1901
CONECT 1915 1901
CONECT 1916 1901
CONECT 1917 1902
CONECT 1918 1905
CONECT 1919 1907
CONECT 1920 1894
CONECT 1921 1903 1922 1929 1938
CONECT 1922 1921 1923 1927 1939
CONECT 1923 1922 1924 1928 1940
CONECT 1924 1923 1933 1925 1941
CONECT 1925 1924 1929 1926 1935
CONECT 1926 1925 1936 1937 1930
CONECT 1927 1922 1931
CONECT 1928 1923 1942
CONECT 1929 1921 1925
CONECT 1930 1926 1932
CONECT 1931 1927
CONECT 1932 1930
CONECT 1933 1924 1934
CONECT 1934 1933
CONECT 1935 1925
CONECT 1936 1926
CONECT 1937 1926
CONECT 1938 1921
CONECT 1939 1922
CONECT 1940 1923
CONECT 1941 1924
CONECT 1942 1928 1943 1968 1952
CONECT 1943 1942 1944 1956 1955
CONECT 1944 1943 1945 1957 1950
CONECT 1945 1944 1946 1958 1951
CONECT 1946 1945 1947 1959 1952
CONECT 1947 1946 1960 1961 1953
CONECT 1948 1949 1955 1954
CONECT 1949 1948 1962 1963 1964
CONECT 1950 1944 1965
CONECT 1951 1945 1969
CONECT 1952 1942 1946
CONECT 1953 1947 1966
CONECT 1954 1948
CONECT 1955 1943 1948 1967
CONECT 1956 1943
CONECT 1957 1944
CONECT 1958 1945
CONECT 1959 1946
CONECT 1960 1947
CONECT 1961 1947
CONECT 1962 1949
CONECT 1963 1949
CONECT 1964 1949
CONECT 1965 1950
CONECT 1966 1953
CONECT 1967 1955
CONECT 1968 1942
CONECT 1969 1951 1970 1977 1986
CONECT 1970 1969 1971 1975 1987
CONECT 1971 1970 1972 1976 1988
CONECT 1972 1971 1981 1973 1989
CONECT 1973 1972 1977 1974 1983
CONECT 1974 1973 1984 1985 1978
CONECT 1975 1970 1979
CONECT 1976 1971 1991
CONECT 1977 1969 1973
CONECT 1978 1974 1980
CONECT 1979 1975
CONECT 1980 1978
CONECT 1981 1972 1982
CONECT 1982 1981
CONECT 1983 1973
CONECT 1984 1974
CONECT 1985 1974
CONECT 1986 1969
CONECT 1987 1970
CONECT 1988 1971
CONECT 1989 1972
CONECT 1990 1991 2000 2001
CONECT 1991 1976 1990 1992 1999
CONECT 1992 1991 1993 2007 2008
CONECT 1993 1992 1994 2002 2009
CONECT 1994 1993 1995 2019 2020
CONECT 1995 1994 1996 1999 2006
CONECT 1996 1995 1997 2003 2017
CONECT 1997 1996 1998 2004 2016
CONECT 1998 1997 2005 2014 2015
CONECT 1999 1991 1995
CONECT 2000 1990
CONECT 2001 1990 2018
CONECT 2002 1993 2012
CONECT 2003 1996 2010
CONECT 2004 1997 2011
CONECT 2005 1998 2013
CONECT 2006 1995
CONECT 2007 1992
CONECT 2008 1992
CONECT 2009 1993
CONECT 2010 2003
CONECT 2011 2004
CONECT 2012 2002
CONECT 2013 2005
CONECT 2014 1998
CONECT 2015 1998
CONECT 2016 1997
CONECT 2017 1996
CONECT 2018 2001
CONECT 2019 1994
CONECT 2020 1994 2021 2024
CONECT 2021 2020 2022 2023
CONECT 2022 2021 2025 2026 2027
CONECT 2023 2021
CONECT 2024 2020
CONECT 2025 2022
CONECT 2026 2022
CONECT 2027 2022
CONECT 2028 1534 2029 2034 2039
CONECT 2029 2028 2030 2035 2040
CONECT 2030 2029 2031 2036 2042
CONECT 2031 2030 2032 2037 2044
CONECT 2032 2031 2033 2034 2038
CONECT 2033 2032 2046 2047 2048
CONECT 2034 2028 2032
CONECT 2035 2029 2041
CONECT 2036 2030 2043
CONECT 2037 2031 2045
CONECT 2038 2032
CONECT 2039 2028
CONECT 2040 2029
CONECT 2041 2035
CONECT 2042 2030
CONECT 2043 2036
CONECT 2044 2031
CONECT 2045 2037
CONECT 2046 2033
CONECT 2047 2033
CONECT 2048 2033
CONECT 2049 2050 2075 2059  304
CONECT 2050 2049 2051 2063 2062
CONECT 2051 2050 2052 2064 2057
CONECT 2052 2051 2053 2065 2058
CONECT 2053 2052 2054 2066 2059
CONECT 2054 2053 2067 2068 2060
CONECT 2055 2056 2062 2061
CONECT 2056 2055 2069 2070 2071
CONECT 2057 2051 2072
CONECT 2058 2052 2076
CONECT 2059 2049 2053
CONECT 2060 2054 2073
CONECT 2061 2055
CONECT 2062 2050 2055 2074
CONECT 2063 2050
CONECT 2064 2051
CONECT 2065 2052
CONECT 2066 2053
CONECT 2067 2054
CONECT 2068 2054
CONECT 2069 2056
CONECT 2070 2056
CONECT 2071 2056
CONECT 2072 2057
CONECT 2073 2060
CONECT 2074 2062
CONECT 2075 2049
CONECT 2076 2058 2077 2102 2086
CONECT 2077 2076 2078 2090 2089
CONECT 2078 2077 2079 2091 2084
CONECT 2079 2078 2080 2092 2085
CONECT 2080 2079 2081 2093 2086
CONECT 2081 2080 2094 2095 2087
CONECT 2082 2083 2089 2088
CONECT 2083 2082 2096 2097 2098
CONECT 2084 2078 2099
CONECT 2085 2079 2103
CONECT 2086 2076 2080
CONECT 2087 2081 2100
CONECT 2088 2082
CONECT 2089 2077 2082 2101
CONECT 2090 2077
CONECT 2091 2078
CONECT 2092 2079
CONECT 2093 2080
CONECT 2094 2081
CONECT 2095 2081
CONECT 2096 2083
CONECT 2097 2083
CONECT 2098 2083
CONECT 2099 2084
CONECT 2100 2087
CONECT 2101 2089
CONECT 2102 2076
CONECT 2103 2085 2104 2111 2120
CONECT 2104 2103 2105 2113 2118
CONECT 2105 2104 2106 2109 2119
CONECT 2106 2105 2110 2107 2121
CONECT 2107 2106 2111 2108 2115
CONECT 2108 2107 2116 2117 2112
CONECT 2109 2105 2122
CONECT 2110 2106 2229
CONECT 2111 2103 2107
CONECT 2112 2108 2315
CONECT 2113 2104 2114
CONECT 2114 2113
CONECT 2115 2107
CONECT 2116 2108
CONECT 2117 2108
CONECT 2118 2104
CONECT 2119 2105
CONECT 2120 2103
CONECT 2121 2106
CONECT 2122 2109 2123 2130 2139
CONECT 2123 2122 2124 2135 2140
CONECT 2124 2123 2125 2128 2141
CONECT 2125 2124 2129 2126 2142
CONECT 2126 2125 2130 2127 2136
CONECT 2127 2126 2137 2138 2131
CONECT 2128 2124 2132
CONECT 2129 2125 2133
CONECT 2130 2122 2126
CONECT 2131 2127 2134
CONECT 2132 2128
CONECT 2133 2129
CONECT 2134 2131
CONECT 2135 2123 2143
CONECT 2136 2126
CONECT 2137 2127
CONECT 2138 2127
CONECT 2139 2122
CONECT 2140 2123
CONECT 2141 2124
CONECT 2142 2125
CONECT 2143 2135 2144 2169 2153
CONECT 2144 2143 2145 2157 2156
CONECT 2145 2144 2146 2158 2151
CONECT 2146 2145 2147 2159 2152
CONECT 2147 2146 2148 2160 2153
CONECT 2148 2147 2161 2162 2154
CONECT 2149 2150 2156 2155
CONECT 2150 2149 2163 2164 2165
CONECT 2151 2145 2166
CONECT 2152 2146 2170
CONECT 2153 2143 2147
CONECT 2154 2148 2167
CONECT 2155 2149
CONECT 2156 2144 2149 2168
CONECT 2157 2144
CONECT 2158 2145
CONECT 2159 2146
CONECT 2160 2147
CONECT 2161 2148
CONECT 2162 2148
CONECT 2163 2150
CONECT 2164 2150
CONECT 2165 2150
CONECT 2166 2151
CONECT 2167 2154
CONECT 2168 2156
CONECT 2169 2143
CONECT 2170 2152 2171 2178 2187
CONECT 2171 2170 2172 2176 2188
CONECT 2172 2171 2173 2177 2189
CONECT 2173 2172 2182 2174 2190
CONECT 2174 2173 2178 2175 2184
CONECT 2175 2174 2185 2186 2179
CONECT 2176 2171 2180
CONECT 2177 2172 2181
CONECT 2178 2170 2174
CONECT 2179 2175 2192
CONECT 2180 2176
CONECT 2181 2177
CONECT 2182 2173 2183
CONECT 2183 2182
CONECT 2184 2174
CONECT 2185 2175
CONECT 2186 2175
CONECT 2187 2170
CONECT 2188 2171
CONECT 2189 2172
CONECT 2190 2173
CONECT 2191 2192 2201 2202
CONECT 2192 2179 2191 2193 2200
CONECT 2193 2192 2194 2208 2209
CONECT 2194 2193 2195 2203 2210
CONECT 2195 2194 2196 2220 2221
CONECT 2196 2195 2197 2200 2207
CONECT 2197 2196 2198 2204 2218
CONECT 2198 2197 2199 2205 2217
CONECT 2199 2198 2206 2215 2216
CONECT 2200 2192 2196
CONECT 2201 2191
CONECT 2202 2191 2219
CONECT 2203 2194 2213
CONECT 2204 2197 2211
CONECT 2205 2198 2212
CONECT 2206 2199 2214
CONECT 2207 2196
CONECT 2208 2193
CONECT 2209 2193
CONECT 2210 2194
CONECT 2211 2204
CONECT 2212 2205
CONECT 2213 2203
CONECT 2214 2206
CONECT 2215 2199
CONECT 2216 2199
CONECT 2217 2198
CONECT 2218 2197
CONECT 2219 2202
CONECT 2220 2195
CONECT 2221 2195 2222 2225
CONECT 2222 2221 2223 2224
CONECT 2223 2222 2226 2227 2228
CONECT 2224 2222
CONECT 2225 2221
CONECT 2226 2223
CONECT 2227 2223
CONECT 2228 2223
CONECT 2229 2110 2230 2255 2239
CONECT 2230 2229 2231 2243 2242
CONECT 2231 2230 2232 2244 2237
CONECT 2232 2231 2233 2245 2238
CONECT 2233 2232 2234 2246 2239
CONECT 2234 2233 2247 2248 2240
CONECT 2235 2236 2242 2241
CONECT 2236 2235 2249 2250 2251
CONECT 2237 2231 2252
CONECT 2238 2232 2256
CONECT 2239 2229 2233
CONECT 2240 2234 2253
CONECT 2241 2235
CONECT 2242 2230 2235 2254
CONECT 2243 2230
CONECT 2244 2231
CONECT 2245 2232
CONECT 2246 2233
CONECT 2247 2234
CONECT 2248 2234
CONECT 2249 2236
CONECT 2250 2236
CONECT 2251 2236
CONECT 2252 2237
CONECT 2253 2240
CONECT 2254 2242
CONECT 2255 2229
CONECT 2256 2238 2257 2264 2273
CONECT 2257 2256 2258 2262 2274
CONECT 2258 2257 2259 2263 2275
CONECT 2259 2258 2268 2260 2276
CONECT 2260 2259 2264 2261 2270
CONECT 2261 2260 2271 2272 2265
CONECT 2262 2257 2266
CONECT 2263 2258 2278
CONECT 2264 2256 2260
CONECT 2265 2261 2267
CONECT 2266 2262
CONECT 2267 2265
CONECT 2268 2259 2269
CONECT 2269 2268
CONECT 2270 2260
CONECT 2271 2261
CONECT 2272 2261
CONECT 2273 2256
CONECT 2274 2257
CONECT 2275 2258
CONECT 2276 2259
CONECT 2277 2278 2287 2288
CONECT 2278 2263 2277 2279 2286
CONECT 2279 2278 2280 2294 2295
CONECT 2280 2279 2281 2289 2296
CONECT 2281 2280 2282 2306 2307
CONECT 2282 2281 2283 2286 2293
CONECT 2283 2282 2284 2290 2304
CONECT 2284 2283 2285 2291 2303
CONECT 2285 2284 2292 2301 2302
CONECT 2286 2278 2282
CONECT 2287 2277
CONECT 2288 2277 2305
CONECT 2289 2280 2299
CONECT 2290 2283 2297
CONECT 2291 2284 2298
CONECT 2292 2285 2300
CONECT 2293 2282
CONECT 2294 2279
CONECT 2295 2279
CONECT 2296 2280
CONECT 2297 2290
CONECT 2298 2291
CONECT 2299 2289
CONECT 2300 2292
CONECT 2301 2285
CONECT 2302 2285
CONECT 2303 2284
CONECT 2304 2283
CONECT 2305 2288
CONECT 2306 2281
CONECT 2307 2281 2308 2311
CONECT 2308 2307 2309 2310
CONECT 2309 2308 2312 2313 2314
CONECT 2310 2308
CONECT 2311 2307
CONECT 2312 2309
CONECT 2313 2309
CONECT 2314 2309
CONECT 2315 2112 2316 2323 2332
CONECT 2316 2315 2317 2328 2333
CONECT 2317 2316 2318 2321 2334
CONECT 2318 2317 2322 2319 2335
CONECT 2319 2318 2323 2320 2329
CONECT 2320 2319 2330 2331 2324
CONECT 2321 2317 2325
CONECT 2322 2318 2326
CONECT 2323 2315 2319
CONECT 2324 2320 2327
CONECT 2325 2321
CONECT 2326 2322
CONECT 2327 2324
CONECT 2328 2316 2336
CONECT 2329 2319
CONECT 2330 2320
CONECT 2331 2320
CONECT 2332 2315
CONECT 2333 2316
CONECT 2334 2317
CONECT 2335 2318
CONECT 2336 2328 2337 2362 2346
CONECT 2337 2336 2338 2350 2349
CONECT 2338 2337 2339 2351 2344
CONECT 2339 2338 2340 2352 2345
CONECT 2340 2339 2341 2353 2346
CONECT 2341 2340 2354 2355 2347
CONECT 2342 2343 2349 2348
CONECT 2343 2342 2356 2357 2358
CONECT 2344 2338 2359
CONECT 2345 2339 2363
CONECT 2346 2336 2340
CONECT 2347 2341 2360
CONECT 2348 2342
CONECT 2349 2337 2342 2361
CONECT 2350 2337
CONECT 2351 2338
CONECT 2352 2339
CONECT 2353 2340
CONECT 2354 2341
CONECT 2355 2341
CONECT 2356 2343
CONECT 2357 2343
CONECT 2358 2343
CONECT 2359 2344
CONECT 2360 2347
CONECT 2361 2349
CONECT 2362 2336
CONECT 2363 2345 2364 2371 2380
CONECT 2364 2363 2365 2369 2381
CONECT 2365 2364 2366 2370 2382
CONECT 2366 2365 2375 2367 2383
CONECT 2367 2366 2371 2368 2377
CONECT 2368 2367 2378 2379 2372
CONECT 2369 2364 2373
CONECT 2370 2365 2374
CONECT 2371 2363 2367
CONECT 2372 2368 2385
CONECT 2373 2369
CONECT 2374 2370
CONECT 2375 2366 2376
CONECT 2376 2375
CONECT 2377 2367
CONECT 2378 2368
CONECT 2379 2368
CONECT 2380 2363
CONECT 2381 2364
CONECT 2382 2365
CONECT 2383 2366
CONECT 2384 2385 2394 2395
CONECT 2385 2372 2384 2386 2393
CONECT 2386 2385 2387 2401 2402
CONECT 2387 2386 2388 2396 2403
CONECT 2388 2387 2389 2413 2414
CONECT 2389 2388 2390 2393 2400
CONECT 2390 2389 2391 2397 2411
CONECT 2391 2390 2392 2398 2410
CONECT 2392 2391 2399 2408 2409
CONECT 2393 2385 2389
CONECT 2394 2384
CONECT 2395 2384 2412
CONECT 2396 2387 2406
CONECT 2397 2390 2404
CONECT 2398 2391 2405
CONECT 2399 2392 2407
CONECT 2400 2389
CONECT 2401 2386
CONECT 2402 2386
CONECT 2403 2387
CONECT 2404 2397
CONECT 2405 2398
CONECT 2406 2396
CONECT 2407 2399
CONECT 2408 2392
CONECT 2409 2392
CONECT 2410 2391
CONECT 2411 2390
CONECT 2412 2395
CONECT 2413 2388
CONECT 2414 2388 2415 2418
CONECT 2415 2414 2416 2417
CONECT 2416 2415 2419 2420 2421
CONECT 2417 2415
CONECT 2418 2414
CONECT 2419 2416
CONECT 2420 2416
CONECT 2421 2416
CONECT 2422 2423 2447 2432  440
CONECT 2423 2422 2424 2436 2435
CONECT 2424 2423 2425 2437 2430
CONECT 2425 2424 2426 2438 2431
CONECT 2426 2425 2427 2439 2432
CONECT 2427 2426 2440 2441 2433
CONECT 2428 2429 2435 2434
CONECT 2429 2428 2442 2443 2444
CONECT 2430 2424 2445
CONECT 2431 2425 2448
CONECT 2432 2422 2426
CONECT 2433 2427 2938
CONECT 2434 2428
CONECT 2435 2423 2428 2446
CONECT 2436 2423
CONECT 2437 2424
CONECT 2438 2425
CONECT 2439 2426
CONECT 2440 2427
CONECT 2441 2427
CONECT 2442 2429
CONECT 2443 2429
CONECT 2444 2429
CONECT 2445 2430
CONECT 2446 2435
CONECT 2447 2422
CONECT 2448 2431 2449 2474 2458
CONECT 2449 2448 2450 2462 2461
CONECT 2450 2449 2451 2463 2456
CONECT 2451 2450 2452 2464 2457
CONECT 2452 2451 2453 2465 2458
CONECT 2453 2452 2466 2467 2459
CONECT 2454 2455 2461 2460
CONECT 2455 2454 2468 2469 2470
CONECT 2456 2450 2471
CONECT 2457 2451 2475
CONECT 2458 2448 2452
CONECT 2459 2453 2472
CONECT 2460 2454
CONECT 2461 2449 2454 2473
CONECT 2462 2449
CONECT 2463 2450
CONECT 2464 2451
CONECT 2465 2452
CONECT 2466 2453
CONECT 2467 2453
CONECT 2468 2455
CONECT 2469 2455
CONECT 2470 2455
CONECT 2471 2456
CONECT 2472 2459
CONECT 2473 2461
CONECT 2474 2448
CONECT 2475 2457 2476 2483 2493
CONECT 2476 2475 2477 2486 2491
CONECT 2477 2476 2478 2481 2492
CONECT 2478 2477 2482 2479 2494
CONECT 2479 2478 2483 2480 2488
CONECT 2480 2479 2489 2490 2484
CONECT 2481 2477 2495
CONECT 2482 2478 2485
CONECT 2483 2475 2479
CONECT 2484 2480 2650
CONECT 2485 2482
CONECT 2486 2476 2487
CONECT 2487 2486
CONECT 2488 2479
CONECT 2489 2480
CONECT 2490 2480
CONECT 2491 2476
CONECT 2492 2477
CONECT 2493 2475
CONECT 2494 2478
CONECT 2495 2481 2496 2503 2511
CONECT 2496 2495 2497 2507 2512
CONECT 2497 2496 2498 2501 2513
CONECT 2498 2497 2502 2499 2514
CONECT 2499 2498 2503 2500 2508
CONECT 2500 2499 2509 2510 2504
CONECT 2501 2497 2505
CONECT 2502 2498 2564
CONECT 2503 2495 2499
CONECT 2504 2500 2506
CONECT 2505 2501
CONECT 2506 2504
CONECT 2507 2496 2515
CONECT 2508 2499
CONECT 2509 2500
CONECT 2510 2500
CONECT 2511 2495
CONECT 2512 2496
CONECT 2513 2497
CONECT 2514 2498
CONECT 2515 2507 2516 2541 2525
CONECT 2516 2515 2517 2529 2528
CONECT 2517 2516 2518 2530 2523
CONECT 2518 2517 2519 2531 2524
CONECT 2519 2518 2520 2532 2525
CONECT 2520 2519 2533 2534 2526
CONECT 2521 2522 2528 2527
CONECT 2522 2521 2535 2536 2537
CONECT 2523 2517 2538
CONECT 2524 2518 2542
CONECT 2525 2515 2519
CONECT 2526 2520 2539
CONECT 2527 2521
CONECT 2528 2516 2521 2540
CONECT 2529 2516
CONECT 2530 2517
CONECT 2531 2518
CONECT 2532 2519
CONECT 2533 2520
CONECT 2534 2520
CONECT 2535 2522
CONECT 2536 2522
CONECT 2537 2522
CONECT 2538 2523
CONECT 2539 2526
CONECT 2540 2528
CONECT 2541 2515
CONECT 2542 2524 2543 2550 2560
CONECT 2543 2542 2544 2548 2561
CONECT 2544 2543 2545 2549 2562
CONECT 2545 2544 2555 2546 2563
CONECT 2546 2545 2550 2547 2557
CONECT 2547 2546 2558 2559 2551
CONECT 2548 2543 2552
CONECT 2549 2544 2553
CONECT 2550 2542 2546
CONECT 2551 2547 2554
CONECT 2552 2548
CONECT 2553 2549
CONECT 2554 2551
CONECT 2555 2545 2556
CONECT 2556 2555
CONECT 2557 2546
CONECT 2558 2547
CONECT 2559 2547
CONECT 2560 2542
CONECT 2561 2543
CONECT 2562 2544
CONECT 2563 2545
CONECT 2564 2502 2565 2590 2574
CONECT 2565 2564 2566 2578 2577
CONECT 2566 2565 2567 2579 2572
CONECT 2567 2566 2568 2580 2573
CONECT 2568 2567 2569 2581 2574
CONECT 2569 2568 2582 2583 2575
CONECT 2570 2571 2577 2576
CONECT 2571 2570 2584 2585 2586
CONECT 2572 2566 2587
CONECT 2573 2567 2591
CONECT 2574 2564 2568
CONECT 2575 2569 2588
CONECT 2576 2570
CONECT 2577 2565 2570 2589
CONECT 2578 2565
CONECT 2579 2566
CONECT 2580 2567
CONECT 2581 2568
CONECT 2582 2569
CONECT 2583 2569
CONECT 2584 2571
CONECT 2585 2571
CONECT 2586 2571
CONECT 2587 2572
CONECT 2588 2575
CONECT 2589 2577
CONECT 2590 2564
CONECT 2591 2573 2592 2599 2608
CONECT 2592 2591 2593 2597 2609
CONECT 2593 2592 2594 2598 2610
CONECT 2594 2593 2603 2595 2611
CONECT 2595 2594 2599 2596 2605
CONECT 2596 2595 2606 2607 2600
CONECT 2597 2592 2601
CONECT 2598 2593 2613
CONECT 2599 2591 2595
CONECT 2600 2596 2602
CONECT 2601 2597
CONECT 2602 2600
CONECT 2603 2594 2604
CONECT 2604 2603
CONECT 2605 2595
CONECT 2606 2596
CONECT 2607 2596
CONECT 2608 2591
CONECT 2609 2592
CONECT 2610 2593
CONECT 2611 2594
CONECT 2612 2613 2622 2623
CONECT 2613 2598 2612 2614 2621
CONECT 2614 2613 2615 2629 2630
CONECT 2615 2614 2616 2624 2631
CONECT 2616 2615 2617 2641 2642
CONECT 2617 2616 2618 2621 2628
CONECT 2618 2617 2619 2625 2639
CONECT 2619 2618 2620 2626 2638
CONECT 2620 2619 2627 2636 2637
CONECT 2621 2613 2617
CONECT 2622 2612
CONECT 2623 2612 2640
CONECT 2624 2615 2634
CONECT 2625 2618 2632
CONECT 2626 2619 2633
CONECT 2627 2620 2635
CONECT 2628 2617
CONECT 2629 2614
CONECT 2630 2614
CONECT 2631 2615
CONECT 2632 2625
CONECT 2633 2626
CONECT 2634 2624
CONECT 2635 2627
CONECT 2636 2620
CONECT 2637 2620
CONECT 2638 2619
CONECT 2639 2618
CONECT 2640 2623
CONECT 2641 2616
CONECT 2642 2616 2643 2646
CONECT 2643 2642 2644 2645
CONECT 2644 2643 2647 2648 2649
CONECT 2645 2643
CONECT 2646 2642
CONECT 2647 2644
CONECT 2648 2644
CONECT 2649 2644
CONECT 2650 2484 2651 2658 2666
CONECT 2651 2650 2652 2662 2667
CONECT 2652 2651 2653 2656 2668
CONECT 2653 2652 2657 2654 2669
CONECT 2654 2653 2658 2655 2663
CONECT 2655 2654 2664 2665 2659
CONECT 2656 2652 2660
CONECT 2657 2653 2661
CONECT 2658 2650 2654
CONECT 2659 2655 2804
CONECT 2660 2656
CONECT 2661 2657
CONECT 2662 2651 2670
CONECT 2663 2654
CONECT 2664 2655
CONECT 2665 2655
CONECT 2666 2650
CONECT 2667 2651
CONECT 2668 2652
CONECT 2669 2653
CONECT 2670 2662 2671 2696 2680
CONECT 2671 2670 2672 2684 2683
CONECT 2672 2671 2673 2685 2678
CONECT 2673 2672 2674 2686 2679
CONECT 2674 2673 2675 2687 2680
CONECT 2675 2674 2688 2689 2681
CONECT 2676 2677 2683 2682
CONECT 2677 2676 2690 2691 2692
CONECT 2678 2672 2693
CONECT 2679 2673 2697
CONECT 2680 2670 2674
CONECT 2681 2675 2694
CONECT 2682 2676
CONECT 2683 2671 2676 2695
CONECT 2684 2671
CONECT 2685 2672
CONECT 2686 2673
CONECT 2687 2674
CONECT 2688 2675
CONECT 2689 2675
CONECT 2690 2677
CONECT 2691 2677
CONECT 2692 2677
CONECT 2693 2678
CONECT 2694 2681
CONECT 2695 2683
CONECT 2696 2670
CONECT 2697 2679 2698 2705 2714
CONECT 2698 2697 2699 2703 2715
CONECT 2699 2698 2700 2704 2716
CONECT 2700 2699 2709 2701 2717
CONECT 2701 2700 2705 2702 2711
CONECT 2702 2701 2712 2713 2706
CONECT 2703 2698 2707
CONECT 2704 2699 2718
CONECT 2705 2697 2701
CONECT 2706 2702 2708
CONECT 2707 2703
CONECT 2708 2706
CONECT 2709 2700 2710
CONECT 2710 2709
CONECT 2711 2701
CONECT 2712 2702
CONECT 2713 2702
CONECT 2714 2697
CONECT 2715 2698
CONECT 2716 2699
CONECT 2717 2700
CONECT 2718 2704 2719 2744 2728
CONECT 2719 2718 2720 2732 2731
CONECT 2720 2719 2721 2733 2726
CONECT 2721 2720 2722 2734 2727
CONECT 2722 2721 2723 2735 2728
CONECT 2723 2722 2736 2737 2729
CONECT 2724 2725 2731 2730
CONECT 2725 2724 2738 2739 2740
CONECT 2726 2720 2741
CONECT 2727 2721 2745
CONECT 2728 2718 2722
CONECT 2729 2723 2742
CONECT 2730 2724
CONECT 2731 2719 2724 2743
CONECT 2732 2719
CONECT 2733 2720
CONECT 2734 2721
CONECT 2735 2722
CONECT 2736 2723
CONECT 2737 2723
CONECT 2738 2725
CONECT 2739 2725
CONECT 2740 2725
CONECT 2741 2726
CONECT 2742 2729
CONECT 2743 2731
CONECT 2744 2718
CONECT 2745 2727 2746 2753 2762
CONECT 2746 2745 2747 2751 2763
CONECT 2747 2746 2748 2752 2764
CONECT 2748 2747 2757 2749 2765
CONECT 2749 2748 2753 2750 2759
CONECT 2750 2749 2760 2761 2754
CONECT 2751 2746 2755
CONECT 2752 2747 2767
CONECT 2753 2745 2749
CONECT 2754 2750 2756
CONECT 2755 2751
CONECT 2756 2754
CONECT 2757 2748 2758
CONECT 2758 2757
CONECT 2759 2749
CONECT 2760 2750
CONECT 2761 2750
CONECT 2762 2745
CONECT 2763 2746
CONECT 2764 2747
CONECT 2765 2748
CONECT 2766 2767 2776 2777
CONECT 2767 2752 2766 2768 2775
CONECT 2768 2767 2769 2783 2784
CONECT 2769 2768 2770 2778 2785
CONECT 2770 2769 2771 2795 2796
CONECT 2771 2770 2772 2775 2782
CONECT 2772 2771 2773 2779 2793
CONECT 2773 2772 2774 2780 2792
CONECT 2774 2773 2781 2790 2791
CONECT 2775 2767 2771
CONECT 2776 2766
CONECT 2777 2766 2794
CONECT 2778 2769 2788
CONECT 2779 2772 2786
CONECT 2780 2773 2787
CONECT 2781 2774 2789
CONECT 2782 2771
CONECT 2783 2768
CONECT 2784 2768
CONECT 2785 2769
CONECT 2786 2779
CONECT 2787 2780
CONECT 2788 2778
CONECT 2789 2781
CONECT 2790 2774
CONECT 2791 2774
CONECT 2792 2773
CONECT 2793 2772
CONECT 2794 2777
CONECT 2795 2770
CONECT 2796 2770 2797 2800
CONECT 2797 2796 2798 2799
CONECT 2798 2797 2801 2802 2803
CONECT 2799 2797
CONECT 2800 2796
CONECT 2801 2798
CONECT 2802 2798
CONECT 2803 2798
CONECT 2804 2659 2805 2830 2814
CONECT 2805 2804 2806 2818 2817
CONECT 2806 2805 2807 2819 2812
CONECT 2807 2806 2808 2820 2813
CONECT 2808 2807 2809 2821 2814
CONECT 2809 2808 2822 2823 2815
CONECT 2810 2811 2817 2816
CONECT 2811 2810 2824 2825 2826
CONECT 2812 2806 2827
CONECT 2813 2807 2831
CONECT 2814 2804 2808
CONECT 2815 2809 2828
CONECT 2816 2810
CONECT 2817 2805 2810 2829
CONECT 2818 2805
CONECT 2819 2806
CONECT 2820 2807
CONECT 2821 2808
CONECT 2822 2809
CONECT 2823 2809
CONECT 2824 2811
CONECT 2825 2811
CONECT 2826 2811
CONECT 2827 2812
CONECT 2828 2815
CONECT 2829 2817
CONECT 2830 2804
CONECT 2831 2813 2832 2839 2848
CONECT 2832 2831 2833 2837 2849
CONECT 2833 2832 2834 2838 2850
CONECT 2834 2833 2843 2835 2851
CONECT 2835 2834 2839 2836 2845
CONECT 2836 2835 2846 2847 2840
CONECT 2837 2832 2841
CONECT 2838 2833 2852
CONECT 2839 2831 2835
CONECT 2840 2836 2842
CONECT 2841 2837
CONECT 2842 2840
CONECT 2843 2834 2844
CONECT 2844 2843
CONECT 2845 2835
CONECT 2846 2836
CONECT 2847 2836
CONECT 2848 2831
CONECT 2849 2832
CONECT 2850 2833
CONECT 2851 2834
CONECT 2852 2838 2853 2878 2862
CONECT 2853 2852 2854 2866 2865
CONECT 2854 2853 2855 2867 2860
CONECT 2855 2854 2856 2868 2861
CONECT 2856 2855 2857 2869 2862
CONECT 2857 2856 2870 2871 2863
CONECT 2858 2859 2865 2864
CONECT 2859 2858 2872 2873 2874
CONECT 2860 2854 2875
CONECT 2861 2855 2879
CONECT 2862 2852 2856
CONECT 2863 2857 2876
CONECT 2864 2858
CONECT 2865 2853 2858 2877
CONECT 2866 2853
CONECT 2867 2854
CONECT 2868 2855
CONECT 2869 2856
CONECT 2870 2857
CONECT 2871 2857
CONECT 2872 2859
CONECT 2873 2859
CONECT 2874 2859
CONECT 2875 2860
CONECT 2876 2863
CONECT 2877 2865
CONECT 2878 2852
CONECT 2879 2861 2880 2887 2896
CONECT 2880 2879 2881 2885 2897
CONECT 2881 2880 2882 2886 2898
CONECT 2882 2881 2891 2883 2899
CONECT 2883 2882 2887 2884 2893
CONECT 2884 2883 2894 2895 2888
CONECT 2885 2880 2889
CONECT 2886 2881 2901
CONECT 2887 2879 2883
CONECT 2888 2884 2890
CONECT 2889 2885
CONECT 2890 2888
CONECT 2891 2882 2892
CONECT 2892 2891
CONECT 2893 2883
CONECT 2894 2884
CONECT 2895 2884
CONECT 2896 2879
CONECT 2897 2880
CONECT 2898 2881
CONECT 2899 2882
CONECT 2900 2901 2910 2911
CONECT 2901 2886 2900 2902 2909
CONECT 2902 2901 2903 2917 2918
CONECT 2903 2902 2904 2912 2919
CONECT 2904 2903 2905 2929 2930
CONECT 2905 2904 2906 2909 2916
CONECT 2906 2905 2907 2913 2927
CONECT 2907 2906 2908 2914 2926
CONECT 2908 2907 2915 2924 2925
CONECT 2909 2901 2905
CONECT 2910 2900
CONECT 2911 2900 2928
CONECT 2912 2903 2922
CONECT 2913 2906 2920
CONECT 2914 2907 2921
CONECT 2915 2908 2923
CONECT 2916 2905
CONECT 2917 2902
CONECT 2918 2902
CONECT 2919 2903
CONECT 2920 2913
CONECT 2921 2914
CONECT 2922 2912
CONECT 2923 2915
CONECT 2924 2908
CONECT 2925 2908
CONECT 2926 2907
CONECT 2927 2906
CONECT 2928 2911
CONECT 2929 2904
CONECT 2930 2904 2931 2934
CONECT 2931 2930 2932 2933
CONECT 2932 2931 2935 2936 2937
CONECT 2933 2931
CONECT 2934 2930
CONECT 2935 2932
CONECT 2936 2932
CONECT 2937 2932
CONECT 2938 2433 2939 2944 2949
CONECT 2939 2938 2940 2945 2950
CONECT 2940 2939 2941 2946 2952
CONECT 2941 2940 2942 2947 2954
CONECT 2942 2941 2943 2944 2948
CONECT 2943 2942 2956 2957 2958
CONECT 2944 2938 2942
CONECT 2945 2939 2951
CONECT 2946 2940 2953
CONECT 2947 2941 2955
CONECT 2948 2942
CONECT 2949 2938
CONECT 2950 2939
CONECT 2951 2945
CONECT 2952 2940
CONECT 2953 2946
CONECT 2954 2941
CONECT 2955 2947
CONECT 2956 2943
CONECT 2957 2943
CONECT 2958 2943
CONECT 2959 2960 2985 2969  626
CONECT 2960 2959 2961 2973 2972
CONECT 2961 2960 2962 2974 2967
CONECT 2962 2961 2963 2975 2968
CONECT 2963 2962 2964 2976 2969
CONECT 2964 2963 2977 2978 2970
CONECT 2965 2966 2972 2971
CONECT 2966 2965 2979 2980 2981
CONECT 2967 2961 2982
CONECT 2968 2962 2986
CONECT 2969 2959 2963
CONECT 2970 2964 2983
CONECT 2971 2965
CONECT 2972 2960 2965 2984
CONECT 2973 2960
CONECT 2974 2961
CONECT 2975 2962
CONECT 2976 2963
CONECT 2977 2964
CONECT 2978 2964
CONECT 2979 2966
CONECT 2980 2966
CONECT 2981 2966
CONECT 2982 2967
CONECT 2983 2970
CONECT 2984 2972
CONECT 2985 2959
CONECT 2986 2968 2987 3012 2996
CONECT 2987 2986 2988 3000 2999
CONECT 2988 2987 2989 3001 2994
CONECT 2989 2988 2990 3002 2995
CONECT 2990 2989 2991 3003 2996
CONECT 2991 2990 3004 3005 2997
CONECT 2992 2993 2999 2998
CONECT 2993 2992 3006 3007 3008
CONECT 2994 2988 3009
CONECT 2995 2989 3013
CONECT 2996 2986 2990
CONECT 2997 2991 3010
CONECT 2998 2992
CONECT 2999 2987 2992 3011
CONECT 3000 2987
CONECT 3001 2988
CONECT 3002 2989
CONECT 3003 2990
CONECT 3004 2991
CONECT 3005 2991
CONECT 3006 2993
CONECT 3007 2993
CONECT 3008 2993
CONECT 3009 2994
CONECT 3010 2997
CONECT 3011 2999
CONECT 3012 2986
CONECT 3013 2995 3014 3021 3031
CONECT 3014 3013 3015 3024 3029
CONECT 3015 3014 3016 3019 3030
CONECT 3016 3015 3020 3017 3032
CONECT 3017 3016 3021 3018 3026
CONECT 3018 3017 3027 3028 3022
CONECT 3019 3015 3033
CONECT 3020 3016 3023
CONECT 3021 3013 3017
CONECT 3022 3018 3287
CONECT 3023 3020
CONECT 3024 3014 3025
CONECT 3025 3024
CONECT 3026 3017
CONECT 3027 3018
CONECT 3028 3018
CONECT 3029 3014
CONECT 3030 3015
CONECT 3031 3013
CONECT 3032 3016
CONECT 3033 3019 3034 3041 3049
CONECT 3034 3033 3035 3045 3050
CONECT 3035 3034 3036 3039 3051
CONECT 3036 3035 3040 3037 3052
CONECT 3037 3036 3041 3038 3046
CONECT 3038 3037 3047 3048 3042
CONECT 3039 3035 3043
CONECT 3040 3036 3170
CONECT 3041 3033 3037
CONECT 3042 3038 3044
CONECT 3043 3039
CONECT 3044 3042
CONECT 3045 3034 3053
CONECT 3046 3037
CONECT 3047 3038
CONECT 3048 3038
CONECT 3049 3033
CONECT 3050 3034
CONECT 3051 3035
CONECT 3052 3036
CONECT 3053 3045 3054 3079 3063
CONECT 3054 3053 3055 3067 3066
CONECT 3055 3054 3056 3068 3061
CONECT 3056 3055 3057 3069 3062
CONECT 3057 3056 3058 3070 3063
CONECT 3058 3057 3071 3072 3064
CONECT 3059 3060 3066 3065
CONECT 3060 3059 3073 3074 3075
CONECT 3061 3055 3076
CONECT 3062 3056 3080
CONECT 3063 3053 3057
CONECT 3064 3058 3077
CONECT 3065 3059
CONECT 3066 3054 3059 3078
CONECT 3067 3054
CONECT 3068 3055
CONECT 3069 3056
CONECT 3070 3057
CONECT 3071 3058
CONECT 3072 3058
CONECT 3073 3060
CONECT 3074 3060
CONECT 3075 3060
CONECT 3076 3061
CONECT 3077 3064
CONECT 3078 3066
CONECT 3079 3053
CONECT 3080 3062 3081 3088 3097
CONECT 3081 3080 3082 3086 3098
CONECT 3082 3081 3083 3087 3099
CONECT 3083 3082 3092 3084 3100
CONECT 3084 3083 3088 3085 3094
CONECT 3085 3084 3095 3096 3089
CONECT 3086 3081 3090
CONECT 3087 3082 3101
CONECT 3088 3080 3084
CONECT 3089 3085 3091
CONECT 3090 3086
CONECT 3091 3089
CONECT 3092 3083 3093
CONECT 3093 3092
CONECT 3094 3084
CONECT 3095 3085
CONECT 3096 3085
CONECT 3097 3080
CONECT 3098 3081
CONECT 3099 3082
CONECT 3100 3083
CONECT 3101 3087 3102 3109 3118
CONECT 3102 3101 3103 3107 3119
CONECT 3103 3102 3104 3108 3120
CONECT 3104 3103 3113 3105 3121
CONECT 3105 3104 3109 3106 3115
CONECT 3106 3105 3116 3117 3110
CONECT 3107 3102 3111
CONECT 3108 3103 3122
CONECT 3109 3101 3105
CONECT 3110 3106 3112
CONECT 3111 3107
CONECT 3112 3110
CONECT 3113 3104 3114
CONECT 3114 3113
CONECT 3115 3105
CONECT 3116 3106
CONECT 3117 3106
CONECT 3118 3101
CONECT 3119 3102
CONECT 3120 3103
CONECT 3121 3104
CONECT 3122 3108 3123 3129 3137
CONECT 3123 3122 3124 3138 3141
CONECT 3124 3123 3125 3128 3139
CONECT 3125 3124 3132 3126 3140
CONECT 3126 3125 3129 3127 3134
CONECT 3127 3126 3135 3136 3130
CONECT 3128 3124 3149
CONECT 3129 3122 3126
CONECT 3130 3127 3131
CONECT 3131 3130
CONECT 3132 3125 3133
CONECT 3133 3132
CONECT 3134 3126
CONECT 3135 3127
CONECT 3136 3127
CONECT 3137 3122
CONECT 3138 3123
CONECT 3139 3124
CONECT 3140 3125
CONECT 3141 3123 3142 3145
CONECT 3142 3141 3143 3144
CONECT 3143 3142 3146 3147 3148
CONECT 3144 3142
CONECT 3145 3141
CONECT 3146 3143
CONECT 3147 3143
CONECT 3148 3143
CONECT 3149 3128 3150 3155 3160
CONECT 3150 3149 3151 3156 3161
CONECT 3151 3150 3152 3157 3163
CONECT 3152 3151 3153 3158 3165
CONECT 3153 3152 3154 3155 3159
CONECT 3154 3153 3167 3168 3169
CONECT 3155 3149 3153
CONECT 3156 3150 3162
CONECT 3157 3151 3164
CONECT 3158 3152 3166
CONECT 3159 3153
CONECT 3160 3149
CONECT 3161 3150
CONECT 3162 3156
CONECT 3163 3151
CONECT 3164 3157
CONECT 3165 3152
CONECT 3166 3158
CONECT 3167 3154
CONECT 3168 3154
CONECT 3169 3154
CONECT 3170 3040 3171 3196 3180
CONECT 3171 3170 3172 3184 3183
CONECT 3172 3171 3173 3185 3178
CONECT 3173 3172 3174 3186 3179
CONECT 3174 3173 3175 3187 3180
CONECT 3175 3174 3188 3189 3181
CONECT 3176 3177 3183 3182
CONECT 3177 3176 3190 3191 3192
CONECT 3178 3172 3193
CONECT 3179 3173 3197
CONECT 3180 3170 3174
CONECT 3181 3175 3194
CONECT 3182 3176
CONECT 3183 3171 3176 3195
CONECT 3184 3171
CONECT 3185 3172
CONECT 3186 3173
CONECT 3187 3174
CONECT 3188 3175
CONECT 3189 3175
CONECT 3190 3177
CONECT 3191 3177
CONECT 3192 3177
CONECT 3193 3178
CONECT 3194 3181
CONECT 3195 3183
CONECT 3196 3170
CONECT 3197 3179 3198 3205 3214
CONECT 3198 3197 3199 3203 3215
CONECT 3199 3198 3200 3204 3216
CONECT 3200 3199 3209 3201 3217
CONECT 3201 3200 3205 3202 3211
CONECT 3202 3201 3212 3213 3206
CONECT 3203 3198 3207
CONECT 3204 3199 3218
CONECT 3205 3197 3201
CONECT 3206 3202 3208
CONECT 3207 3203
CONECT 3208 3206
CONECT 3209 3200 3210
CONECT 3210 3209
CONECT 3211 3201
CONECT 3212 3202
CONECT 3213 3202
CONECT 3214 3197
CONECT 3215 3198
CONECT 3216 3199
CONECT 3217 3200
CONECT 3218 3204 3219 3226 3235
CONECT 3219 3218 3220 3224 3236
CONECT 3220 3219 3221 3225 3237
CONECT 3221 3220 3230 3222 3238
CONECT 3222 3221 3226 3223 3232
CONECT 3223 3222 3233 3234 3227
CONECT 3224 3219 3228
CONECT 3225 3220 3239
CONECT 3226 3218 3222
CONECT 3227 3223 3229
CONECT 3228 3224
CONECT 3229 3227
CONECT 3230 3221 3231
CONECT 3231 3230
CONECT 3232 3222
CONECT 3233 3223
CONECT 3234 3223
CONECT 3235 3218
CONECT 3236 3219
CONECT 3237 3220
CONECT 3238 3221
CONECT 3239 3225 3240 3246 3254
CONECT 3240 3239 3241 3255 3258
CONECT 3241 3240 3242 3245 3256
CONECT 3242 3241 3249 3243 3257
CONECT 3243 3242 3246 3244 3251
CONECT 3244 3243 3252 3253 3247
CONECT 3245 3241 3266
CONECT 3246 3239 3243
CONECT 3247 3244 3248
CONECT 3248 3247
CONECT 3249 3242 3250
CONECT 3250 3249
CONECT 3251 3243
CONECT 3252 3244
CONECT 3253 3244
CONECT 3254 3239
CONECT 3255 3240
CONECT 3256 3241
CONECT 3257 3242
CONECT 3258 3240 3259 3262
CONECT 3259 3258 3260 3261
CONECT 3260 3259 3263 3264 3265
CONECT 3261 3259
CONECT 3262 3258
CONECT 3263 3260
CONECT 3264 3260
CONECT 3265 3260
CONECT 3266 3245 3267 3272 3277
CONECT 3267 3266 3268 3273 3278
CONECT 3268 3267 3269 3274 3280
CONECT 3269 3268 3270 3275 3282
CONECT 3270 3269 3271 3272 3276
CONECT 3271 3270 3284 3285 3286
CONECT 3272 3266 3270
CONECT 3273 3267 3279
CONECT 3274 3268 3281
CONECT 3275 3269 3283
CONECT 3276 3270
CONECT 3277 3266
CONECT 3278 3267
CONECT 3279 3273
CONECT 3280 3268
CONECT 3281 3274
CONECT 3282 3269
CONECT 3283 3275
CONECT 3284 3271
CONECT 3285 3271
CONECT 3286 3271
CONECT 3287 3022 3288 3295 3302
CONECT 3288 3287 3289 3298 3303
CONECT 3289 3288 3290 3293 3304
CONECT 3290 3289 3294 3291 3305
CONECT 3291 3290 3295 3292 3299
CONECT 3292 3291 3300 3301 3296
CONECT 3293 3289 3297
CONECT 3294 3290 3423
CONECT 3295 3287 3291
CONECT 3296 3292 3540
CONECT 3297 3293
CONECT 3298 3288 3306
CONECT 3299 3291
CONECT 3300 3292
CONECT 3301 3292
CONECT 3302 3287
CONECT 3303 3288
CONECT 3304 3289
CONECT 3305 3290
CONECT 3306 3298 3307 3332 3316
CONECT 3307 3306 3308 3320 3319
CONECT 3308 3307 3309 3321 3314
CONECT 3309 3308 3310 3322 3315
CONECT 3310 3309 3311 3323 3316
CONECT 3311 3310 3324 3325 3317
CONECT 3312 3313 3319 3318
CONECT 3313 3312 3326 3327 3328
CONECT 3314 3308 3329
CONECT 3315 3309 3333
CONECT 3316 3306 3310
CONECT 3317 3311 3330
CONECT 3318 3312
CONECT 3319 3307 3312 3331
CONECT 3320 3307
CONECT 3321 3308
CONECT 3322 3309
CONECT 3323 3310
CONECT 3324 3311
CONECT 3325 3311
CONECT 3326 3313
CONECT 3327 3313
CONECT 3328 3313
CONECT 3329 3314
CONECT 3330 3317
CONECT 3331 3319
CONECT 3332 3306
CONECT 3333 3315 3334 3341 3350
CONECT 3334 3333 3335 3339 3351
CONECT 3335 3334 3336 3340 3352
CONECT 3336 3335 3345 3337 3353
CONECT 3337 3336 3341 3338 3347
CONECT 3338 3337 3348 3349 3342
CONECT 3339 3334 3343
CONECT 3340 3335 3354
CONECT 3341 3333 3337
CONECT 3342 3338 3344
CONECT 3343 3339
CONECT 3344 3342
CONECT 3345 3336 3346
CONECT 3346 3345
CONECT 3347 3337
CONECT 3348 3338
CONECT 3349 3338
CONECT 3350 3333
CONECT 3351 3334
CONECT 3352 3335
CONECT 3353 3336
CONECT 3354 3340 3355 3362 3371
CONECT 3355 3354 3356 3360 3372
CONECT 3356 3355 3357 3361 3373
CONECT 3357 3356 3366 3358 3374
CONECT 3358 3357 3362 3359 3368
CONECT 3359 3358 3369 3370 3363
CONECT 3360 3355 3364
CONECT 3361 3356 3375
CONECT 3362 3354 3358
CONECT 3363 3359 3365
CONECT 3364 3360
CONECT 3365 3363
CONECT 3366 3357 3367
CONECT 3367 3366
CONECT 3368 3358
CONECT 3369 3359
CONECT 3370 3359
CONECT 3371 3354
CONECT 3372 3355
CONECT 3373 3356
CONECT 3374 3357
CONECT 3375 3361 3376 3382 3390
CONECT 3376 3375 3377 3391 3394
CONECT 3377 3376 3378 3381 3392
CONECT 3378 3377 3385 3379 3393
CONECT 3379 3378 3382 3380 3387
CONECT 3380 3379 3388 3389 3383
CONECT 3381 3377 3402
CONECT 3382 3375 3379
CONECT 3383 3380 3384
CONECT 3384 3383
CONECT 3385 3378 3386
CONECT 3386 3385
CONECT 3387 3379
CONECT 3388 3380
CONECT 3389 3380
CONECT 3390 3375
CONECT 3391 3376
CONECT 3392 3377
CONECT 3393 3378
CONECT 3394 3376 3395 3398
CONECT 3395 3394 3396 3397
CONECT 3396 3395 3399 3400 3401
CONECT 3397 3395
CONECT 3398 3394
CONECT 3399 3396
CONECT 3400 3396
CONECT 3401 3396
CONECT 3402 3381 3403 3408 3413
CONECT 3403 3402 3404 3409 3414
CONECT 3404 3403 3405 3410 3416
CONECT 3405 3404 3406 3411 3418
CONECT 3406 3405 3407 3408 3412
CONECT 3407 3406 3420 3421 3422
CONECT 3408 3402 3406
CONECT 3409 3403 3415
CONECT 3410 3404 3417
CONECT 3411 3405 3419
CONECT 3412 3406
CONECT 3413 3402
CONECT 3414 3403
CONECT 3415 3409
CONECT 3416 3404
CONECT 3417 3410
CONECT 3418 3405
CONECT 3419 3411
CONECT 3420 3407
CONECT 3421 3407
CONECT 3422 3407
CONECT 3423 3294 3424 3449 3433
CONECT 3424 3423 3425 3437 3436
CONECT 3425 3424 3426 3438 3431
CONECT 3426 3425 3427 3439 3432
CONECT 3427 3426 3428 3440 3433
CONECT 3428 3427 3441 3442 3434
CONECT 3429 3430 3436 3435
CONECT 3430 3429 3443 3444 3445
CONECT 3431 3425 3446
CONECT 3432 3426 3450
CONECT 3433 3423 3427
CONECT 3434 3428 3447
CONECT 3435 3429
CONECT 3436 3424 3429 3448
CONECT 3437 3424
CONECT 3438 3425
CONECT 3439 3426
CONECT 3440 3427
CONECT 3441 3428
CONECT 3442 3428
CONECT 3443 3430
CONECT 3444 3430
CONECT 3445 3430
CONECT 3446 3431
CONECT 3447 3434
CONECT 3448 3436
CONECT 3449 3423
CONECT 3450 3432 3451 3458 3467
CONECT 3451 3450 3452 3456 3468
CONECT 3452 3451 3453 3457 3469
CONECT 3453 3452 3462 3454 3470
CONECT 3454 3453 3458 3455 3464
CONECT 3455 3454 3465 3466 3459
CONECT 3456 3451 3460
CONECT 3457 3452 3471
CONECT 3458 3450 3454
CONECT 3459 3455 3461
CONECT 3460 3456
CONECT 3461 3459
CONECT 3462 3453 3463
CONECT 3463 3462
CONECT 3464 3454
CONECT 3465 3455
CONECT 3466 3455
CONECT 3467 3450
CONECT 3468 3451
CONECT 3469 3452
CONECT 3470 3453
CONECT 3471 3457 3472 3479 3488
CONECT 3472 3471 3473 3477 3489
CONECT 3473 3472 3474 3478 3490
CONECT 3474 3473 3483 3475 3491
CONECT 3475 3474 3479 3476 3485
CONECT 3476 3475 3486 3487 3480
CONECT 3477 3472 3481
CONECT 3478 3473 3492
CONECT 3479 3471 3475
CONECT 3480 3476 3482
CONECT 3481 3477
CONECT 3482 3480
CONECT 3483 3474 3484
CONECT 3484 3483
CONECT 3485 3475
CONECT 3486 3476
CONECT 3487 3476
CONECT 3488 3471
CONECT 3489 3472
CONECT 3490 3473
CONECT 3491 3474
CONECT 3492 3478 3493 3499 3507
CONECT 3493 3492 3494 3508 3511
CONECT 3494 3493 3495 3498 3509
CONECT 3495 3494 3502 3496 3510
CONECT 3496 3495 3499 3497 3504
CONECT 3497 3496 3505 3506 3500
CONECT 3498 3494 3519
CONECT 3499 3492 3496
CONECT 3500 3497 3501
CONECT 3501 3500
CONECT 3502 3495 3503
CONECT 3503 3502
CONECT 3504 3496
CONECT 3505 3497
CONECT 3506 3497
CONECT 3507 3492
CONECT 3508 3493
CONECT 3509 3494
CONECT 3510 3495
CONECT 3511 3493 3512 3515
CONECT 3512 3511 3513 3514
CONECT 3513 3512 3516 3517 3518
CONECT 3514 3512
CONECT 3515 3511
CONECT 3516 3513
CONECT 3517 3513
CONECT 3518 3513
CONECT 3519 3498 3520 3525 3530
CONECT 3520 3519 3521 3526 3531
CONECT 3521 3520 3522 3527 3533
CONECT 3522 3521 3523 3528 3535
CONECT 3523 3522 3524 3525 3529
CONECT 3524 3523 3537 3538 3539
CONECT 3525 3519 3523
CONECT 3526 3520 3532
CONECT 3527 3521 3534
CONECT 3528 3522 3536
CONECT 3529 3523
CONECT 3530 3519
CONECT 3531 3520
CONECT 3532 3526
CONECT 3533 3521
CONECT 3534 3527
CONECT 3535 3522
CONECT 3536 3528
CONECT 3537 3524
CONECT 3538 3524
CONECT 3539 3524
CONECT 3540 3296 3541 3566 3550
CONECT 3541 3540 3542 3554 3553
CONECT 3542 3541 3543 3555 3548
CONECT 3543 3542 3544 3556 3549
CONECT 3544 3543 3545 3557 3550
CONECT 3545 3544 3558 3559 3551
CONECT 3546 3547 3553 3552
CONECT 3547 3546 3560 3561 3562
CONECT 3548 3542 3563
CONECT 3549 3543 3567
CONECT 3550 3540 3544
CONECT 3551 3545 3564
CONECT 3552 3546
CONECT 3553 3541 3546 3565
CONECT 3554 3541
CONECT 3555 3542
CONECT 3556 3543
CONECT 3557 3544
CONECT 3558 3545
CONECT 3559 3545
CONECT 3560 3547
CONECT 3561 3547
CONECT 3562 3547
CONECT 3563 3548
CONECT 3564 3551
CONECT 3565 3553
CONECT 3566 3540
CONECT 3567 3549 3568 3575 3584
CONECT 3568 3567 3569 3573 3585
CONECT 3569 3568 3570 3574 3586
CONECT 3570 3569 3579 3571 3587
CONECT 3571 3570 3575 3572 3581
CONECT 3572 3571 3582 3583 3576
CONECT 3573 3568 3577
CONECT 3574 3569 3588
CONECT 3575 3567 3571
CONECT 3576 3572 3578
CONECT 3577 3573
CONECT 3578 3576
CONECT 3579 3570 3580
CONECT 3580 3579
CONECT 3581 3571
CONECT 3582 3572
CONECT 3583 3572
CONECT 3584 3567
CONECT 3585 3568
CONECT 3586 3569
CONECT 3587 3570
CONECT 3588 3574 3589 3596 3605
CONECT 3589 3588 3590 3594 3606
CONECT 3590 3589 3591 3595 3607
CONECT 3591 3590 3600 3592 3608
CONECT 3592 3591 3596 3593 3602
CONECT 3593 3592 3603 3604 3597
CONECT 3594 3589 3598
CONECT 3595 3590 3609
CONECT 3596 3588 3592
CONECT 3597 3593 3599
CONECT 3598 3594
CONECT 3599 3597
CONECT 3600 3591 3601
CONECT 3601 3600
CONECT 3602 3592
CONECT 3603 3593
CONECT 3604 3593
CONECT 3605 3588
CONECT 3606 3589
CONECT 3607 3590
CONECT 3608 3591
CONECT 3609 3595 3610 3616 3624
CONECT 3610 3609 3611 3625 3628
CONECT 3611 3610 3612 3615 3626
CONECT 3612 3611 3619 3613 3627
CONECT 3613 3612 3616 3614 3621
CONECT 3614 3613 3622 3623 3617
CONECT 3615 3611 3636
CONECT 3616 3609 3613
CONECT 3617 3614 3618
CONECT 3618 3617
CONECT 3619 3612 3620
CONECT 3620 3619
CONECT 3621 3613
CONECT 3622 3614
CONECT 3623 3614
CONECT 3624 3609
CONECT 3625 3610
CONECT 3626 3611
CONECT 3627 3612
CONECT 3628 3610 3629 3632
CONECT 3629 3628 3630 3631
CONECT 3630 3629 3633 3634 3635
CONECT 3631 3629
CONECT 3632 3628
CONECT 3633 3630
CONECT 3634 3630
CONECT 3635 3630
CONECT 3636 3615 3637 3642 3647
CONECT 3637 3636 3638 3643 3648
CONECT 3638 3637 3639 3644 3650
CONECT 3639 3638 3640 3645 3652
CONECT 3640 3639 3641 3642 3646
CONECT 3641 3640 3654 3655 3656
CONECT 3642 3636 3640
CONECT 3643 3637 3649
CONECT 3644 3638 3651
CONECT 3645 3639 3653
CONECT 3646 3640
CONECT 3647 3636
CONECT 3648 3637
CONECT 3649 3643
CONECT 3650 3638
CONECT 3651 3644
CONECT 3652 3639
CONECT 3653 3645
CONECT 3654 3641
CONECT 3655 3641
CONECT 3656 3641
CONECT 3657 3658 3682 3667  712
CONECT 3658 3657 3659 3671 3670
CONECT 3659 3658 3660 3672 3665
CONECT 3660 3659 3661 3673 3666
CONECT 3661 3660 3662 3674 3667
CONECT 3662 3661 3675 3676 3668
CONECT 3663 3664 3670 3669
CONECT 3664 3663 3677 3678 3679
CONECT 3665 3659 3680
CONECT 3666 3660 3683
CONECT 3667 3657 3661
CONECT 3668 3662 4114
CONECT 3669 3663
CONECT 3670 3658 3663 3681
CONECT 3671 3658
CONECT 3672 3659
CONECT 3673 3660
CONECT 3674 3661
CONECT 3675 3662
CONECT 3676 3662
CONECT 3677 3664
CONECT 3678 3664
CONECT 3679 3664
CONECT 3680 3665
CONECT 3681 3670
CONECT 3682 3657
CONECT 3683 3666 3684 3709 3693
CONECT 3684 3683 3685 3697 3696
CONECT 3685 3684 3686 3698 3691
CONECT 3686 3685 3687 3699 3692
CONECT 3687 3686 3688 3700 3693
CONECT 3688 3687 3701 3702 3694
CONECT 3689 3690 3696 3695
CONECT 3690 3689 3703 3704 3705
CONECT 3691 3685 3706
CONECT 3692 3686 3710
CONECT 3693 3683 3687
CONECT 3694 3688 3707
CONECT 3695 3689
CONECT 3696 3684 3689 3708
CONECT 3697 3684
CONECT 3698 3685
CONECT 3699 3686
CONECT 3700 3687
CONECT 3701 3688
CONECT 3702 3688
CONECT 3703 3690
CONECT 3704 3690
CONECT 3705 3690
CONECT 3706 3691
CONECT 3707 3694
CONECT 3708 3696
CONECT 3709 3683
CONECT 3710 3692 3711 3718 3728
CONECT 3711 3710 3712 3721 3726
CONECT 3712 3711 3713 3716 3727
CONECT 3713 3712 3717 3714 3729
CONECT 3714 3713 3718 3715 3723
CONECT 3715 3714 3724 3725 3719
CONECT 3716 3712 3730
CONECT 3717 3713 3720
CONECT 3718 3710 3714
CONECT 3719 3715 3922
CONECT 3720 3717
CONECT 3721 3711 3722
CONECT 3722 3721
CONECT 3723 3714
CONECT 3724 3715
CONECT 3725 3715
CONECT 3726 3711
CONECT 3727 3712
CONECT 3728 3710
CONECT 3729 3713
CONECT 3730 3716 3731 3738 3746
CONECT 3731 3730 3732 3742 3747
CONECT 3732 3731 3733 3736 3748
CONECT 3733 3732 3737 3734 3749
CONECT 3734 3733 3738 3735 3743
CONECT 3735 3734 3744 3745 3739
CONECT 3736 3732 3740
CONECT 3737 3733 3836
CONECT 3738 3730 3734
CONECT 3739 3735 3741
CONECT 3740 3736
CONECT 3741 3739
CONECT 3742 3731 3750
CONECT 3743 3734
CONECT 3744 3735
CONECT 3745 3735
CONECT 3746 3730
CONECT 3747 3731
CONECT 3748 3732
CONECT 3749 3733
CONECT 3750 3742 3751 3776 3760
CONECT 3751 3750 3752 3764 3763
CONECT 3752 3751 3753 3765 3758
CONECT 3753 3752 3754 3766 3759
CONECT 3754 3753 3755 3767 3760
CONECT 3755 3754 3768 3769 3761
CONECT 3756 3757 3763 3762
CONECT 3757 3756 3770 3771 3772
CONECT 3758 3752 3773
CONECT 3759 3753 3777
CONECT 3760 3750 3754
CONECT 3761 3755 3774
CONECT 3762 3756
CONECT 3763 3751 3756 3775
CONECT 3764 3751
CONECT 3765 3752
CONECT 3766 3753
CONECT 3767 3754
CONECT 3768 3755
CONECT 3769 3755
CONECT 3770 3757
CONECT 3771 3757
CONECT 3772 3757
CONECT 3773 3758
CONECT 3774 3761
CONECT 3775 3763
CONECT 3776 3750
CONECT 3777 3759 3778 3785 3794
CONECT 3778 3777 3779 3783 3795
CONECT 3779 3778 3780 3784 3796
CONECT 3780 3779 3789 3781 3797
CONECT 3781 3780 3785 3782 3791
CONECT 3782 3781 3792 3793 3786
CONECT 3783 3778 3787
CONECT 3784 3779 3788
CONECT 3785 3777 3781
CONECT 3786 3782 3799
CONECT 3787 3783
CONECT 3788 3784
CONECT 3789 3780 3790
CONECT 3790 3789
CONECT 3791 3781
CONECT 3792 3782
CONECT 3793 3782
CONECT 3794 3777
CONECT 3795 3778
CONECT 3796 3779
CONECT 3797 3780
CONECT 3798 3799 3808 3809
CONECT 3799 3786 3798 3800 3807
CONECT 3800 3799 3801 3815 3816
CONECT 3801 3800 3802 3810 3817
CONECT 3802 3801 3803 3827 3828
CONECT 3803 3802 3804 3807 3814
CONECT 3804 3803 3805 3811 3825
CONECT 3805 3804 3806 3812 3824
CONECT 3806 3805 3813 3822 3823
CONECT 3807 3799 3803
CONECT 3808 3798
CONECT 3809 3798 3826
CONECT 3810 3801 3820
CONECT 3811 3804 3818
CONECT 3812 3805 3819
CONECT 3813 3806 3821
CONECT 3814 3803
CONECT 3815 3800
CONECT 3816 3800
CONECT 3817 3801
CONECT 3818 3811
CONECT 3819 3812
CONECT 3820 3810
CONECT 3821 3813
CONECT 3822 3806
CONECT 3823 3806
CONECT 3824 3805
CONECT 3825 3804
CONECT 3826 3809
CONECT 3827 3802
CONECT 3828 3802 3829 3832
CONECT 3829 3828 3830 3831
CONECT 3830 3829 3833 3834 3835
CONECT 3831 3829
CONECT 3832 3828
CONECT 3833 3830
CONECT 3834 3830
CONECT 3835 3830
CONECT 3836 3737 3837 3862 3846
CONECT 3837 3836 3838 3850 3849
CONECT 3838 3837 3839 3851 3844
CONECT 3839 3838 3840 3852 3845
CONECT 3840 3839 3841 3853 3846
CONECT 3841 3840 3854 3855 3847
CONECT 3842 3843 3849 3848
CONECT 3843 3842 3856 3857 3858
CONECT 3844 3838 3859
CONECT 3845 3839 3863
CONECT 3846 3836 3840
CONECT 3847 3841 3860
CONECT 3848 3842
CONECT 3849 3837 3842 3861
CONECT 3850 3837
CONECT 3851 3838
CONECT 3852 3839
CONECT 3853 3840
CONECT 3854 3841
CONECT 3855 3841
CONECT 3856 3843
CONECT 3857 3843
CONECT 3858 3843
CONECT 3859 3844
CONECT 3860 3847
CONECT 3861 3849
CONECT 3862 3836
CONECT 3863 3845 3864 3871 3880
CONECT 3864 3863 3865 3869 3881
CONECT 3865 3864 3866 3870 3882
CONECT 3866 3865 3875 3867 3883
CONECT 3867 3866 3871 3868 3877
CONECT 3868 3867 3878 3879 3872
CONECT 3869 3864 3873
CONECT 3870 3865 3885
CONECT 3871 3863 3867
CONECT 3872 3868 3874
CONECT 3873 3869
CONECT 3874 3872
CONECT 3875 3866 3876
CONECT 3876 3875
CONECT 3877 3867
CONECT 3878 3868
CONECT 3879 3868
CONECT 3880 3863
CONECT 3881 3864
CONECT 3882 3865
CONECT 3883 3866
CONECT 3884 3885 3894 3895
CONECT 3885 3870 3884 3886 3893
CONECT 3886 3885 3887 3901 3902
CONECT 3887 3886 3888 3896 3903
CONECT 3888 3887 3889 3913 3914
CONECT 3889 3888 3890 3893 3900
CONECT 3890 3889 3891 3897 3911
CONECT 3891 3890 3892 3898 3910
CONECT 3892 3891 3899 3908 3909
CONECT 3893 3885 3889
CONECT 3894 3884
CONECT 3895 3884 3912
CONECT 3896 3887 3906
CONECT 3897 3890 3904
CONECT 3898 3891 3905
CONECT 3899 3892 3907
CONECT 3900 3889
CONECT 3901 3886
CONECT 3902 3886
CONECT 3903 3887
CONECT 3904 3897
CONECT 3905 3898
CONECT 3906 3896
CONECT 3907 3899
CONECT 3908 3892
CONECT 3909 3892
CONECT 3910 3891
CONECT 3911 3890
CONECT 3912 3895
CONECT 3913 3888
CONECT 3914 3888 3915 3918
CONECT 3915 3914 3916 3917
CONECT 3916 3915 3919 3920 3921
CONECT 3917 3915
CONECT 3918 3914
CONECT 3919 3916
CONECT 3920 3916
CONECT 3921 3916
CONECT 3922 3719 3923 3930 3938
CONECT 3923 3922 3924 3934 3939
CONECT 3924 3923 3925 3928 3940
CONECT 3925 3924 3929 3926 3941
CONECT 3926 3925 3930 3927 3935
CONECT 3927 3926 3936 3937 3931
CONECT 3928 3924 3932
CONECT 3929 3925 3933
CONECT 3930 3922 3926
CONECT 3931 3927 4028
CONECT 3932 3928
CONECT 3933 3929
CONECT 3934 3923 3942
CONECT 3935 3926
CONECT 3936 3927
CONECT 3937 3927
CONECT 3938 3922
CONECT 3939 3923
CONECT 3940 3924
CONECT 3941 3925
CONECT 3942 3934 3943 3968 3952
CONECT 3943 3942 3944 3956 3955
CONECT 3944 3943 3945 3957 3950
CONECT 3945 3944 3946 3958 3951
CONECT 3946 3945 3947 3959 3952
CONECT 3947 3946 3960 3961 3953
CONECT 3948 3949 3955 3954
CONECT 3949 3948 3962 3963 3964
CONECT 3950 3944 3965
CONECT 3951 3945 3969
CONECT 3952 3942 3946
CONECT 3953 3947 3966
CONECT 3954 3948
CONECT 3955 3943 3948 3967
CONECT 3956 3943
CONECT 3957 3944
CONECT 3958 3945
CONECT 3959 3946
CONECT 3960 3947
CONECT 3961 3947
CONECT 3962 3949
CONECT 3963 3949
CONECT 3964 3949
CONECT 3965 3950
CONECT 3966 3953
CONECT 3967 3955
CONECT 3968 3942
CONECT 3969 3951 3970 3977 3986
CONECT 3970 3969 3971 3975 3987
CONECT 3971 3970 3972 3976 3988
CONECT 3972 3971 3981 3973 3989
CONECT 3973 3972 3977 3974 3983
CONECT 3974 3973 3984 3985 3978
CONECT 3975 3970 3979
CONECT 3976 3971 3980
CONECT 3977 3969 3973
CONECT 3978 3974 3991
CONECT 3979 3975
CONECT 3980 3976
CONECT 3981 3972 3982
CONECT 3982 3981
CONECT 3983 3973
CONECT 3984 3974
CONECT 3985 3974
CONECT 3986 3969
CONECT 3987 3970
CONECT 3988 3971
CONECT 3989 3972
CONECT 3990 3991 4000 4001
CONECT 3991 3978 3990 3992 3999
CONECT 3992 3991 3993 4007 4008
CONECT 3993 3992 3994 4002 4009
CONECT 3994 3993 3995 4019 4020
CONECT 3995 3994 3996 3999 4006
CONECT 3996 3995 3997 4003 4017
CONECT 3997 3996 3998 4004 4016
CONECT 3998 3997 4005 4014 4015
CONECT 3999 3991 3995
CONECT 4000 3990
CONECT 4001 3990 4018
CONECT 4002 3993 4012
CONECT 4003 3996 4010
CONECT 4004 3997 4011
CONECT 4005 3998 4013
CONECT 4006 3995
CONECT 4007 3992
CONECT 4008 3992
CONECT 4009 3993
CONECT 4010 4003
CONECT 4011 4004
CONECT 4012 4002
CONECT 4013 4005
CONECT 4014 3998
CONECT 4015 3998
CONECT 4016 3997
CONECT 4017 3996
CONECT 4018 4001
CONECT 4019 3994
CONECT 4020 3994 4021 4024
CONECT 4021 4020 4022 4023
CONECT 4022 4021 4025 4026 4027
CONECT 4023 4021
CONECT 4024 4020
CONECT 4025 4022
CONECT 4026 4022
CONECT 4027 4022
CONECT 4028 3931 4029 4054 4038
CONECT 4029 4028 4030 4042 4041
CONECT 4030 4029 4031 4043 4036
CONECT 4031 4030 4032 4044 4037
CONECT 4032 4031 4033 4045 4038
CONECT 4033 4032 4046 4047 4039
CONECT 4034 4035 4041 4040
CONECT 4035 4034 4048 4049 4050
CONECT 4036 4030 4051
CONECT 4037 4031 4055
CONECT 4038 4028 4032
CONECT 4039 4033 4052
CONECT 4040 4034
CONECT 4041 4029 4034 4053
CONECT 4042 4029
CONECT 4043 4030
CONECT 4044 4031
CONECT 4045 4032
CONECT 4046 4033
CONECT 4047 4033
CONECT 4048 4035
CONECT 4049 4035
CONECT 4050 4035
CONECT 4051 4036
CONECT 4052 4039
CONECT 4053 4041
CONECT 4054 4028
CONECT 4055 4037 4056 4063 4072
CONECT 4056 4055 4057 4061 4073
CONECT 4057 4056 4058 4062 4074
CONECT 4058 4057 4067 4059 4075
CONECT 4059 4058 4063 4060 4069
CONECT 4060 4059 4070 4071 4064
CONECT 4061 4056 4065
CONECT 4062 4057 4077
CONECT 4063 4055 4059
CONECT 4064 4060 4066
CONECT 4065 4061
CONECT 4066 4064
CONECT 4067 4058 4068
CONECT 4068 4067
CONECT 4069 4059
CONECT 4070 4060
CONECT 4071 4060
CONECT 4072 4055
CONECT 4073 4056
CONECT 4074 4057
CONECT 4075 4058
CONECT 4076 4077 4086 4087
CONECT 4077 4062 4076 4078 4085
CONECT 4078 4077 4079 4093 4094
CONECT 4079 4078 4080 4088 4095
CONECT 4080 4079 4081 4105 4106
CONECT 4081 4080 4082 4085 4092
CONECT 4082 4081 4083 4089 4103
CONECT 4083 4082 4084 4090 4102
CONECT 4084 4083 4091 4100 4101
CONECT 4085 4077 4081
CONECT 4086 4076
CONECT 4087 4076 4104
CONECT 4088 4079 4098
CONECT 4089 4082 4096
CONECT 4090 4083 4097
CONECT 4091 4084 4099
CONECT 4092 4081
CONECT 4093 4078
CONECT 4094 4078
CONECT 4095 4079
CONECT 4096 4089
CONECT 4097 4090
CONECT 4098 4088
CONECT 4099 4091
CONECT 4100 4084
CONECT 4101 4084
CONECT 4102 4083
CONECT 4103 4082
CONECT 4104 4087
CONECT 4105 4080
CONECT 4106 4080 4107 4110
CONECT 4107 4106 4108 4109
CONECT 4108 4107 4111 4112 4113
CONECT 4109 4107
CONECT 4110 4106
CONECT 4111 4108
CONECT 4112 4108
CONECT 4113 4108
CONECT 4114 3668 4115 4120 4125
CONECT 4115 4114 4116 4121 4126
CONECT 4116 4115 4117 4122 4128
CONECT 4117 4116 4118 4123 4130
CONECT 4118 4117 4119 4120 4124
CONECT 4119 4118 4132 4133 4134
CONECT 4120 4114 4118
CONECT 4121 4115 4127
CONECT 4122 4116 4129
CONECT 4123 4117 4131
CONECT 4124 4118
CONECT 4125 4114
CONECT 4126 4115
CONECT 4127 4121
CONECT 4128 4116
CONECT 4129 4122
CONECT 4130 4117
CONECT 4131 4123
CONECT 4132 4119
CONECT 4133 4119
CONECT 4134 4119
END



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.