CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 22052209162947463

Job options:

ID        	=	 22052209162947463
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 on
DORMSD    	=	 on

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 svg0
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   22-JAN-22 1MOD    1       01:25
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.954
REMARK   3  GMQE    0.61
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.58
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2022-01-14
REMARK   3  SMTLE   template_upload.1.B
REMARK   3  SMTLV   2022-01-19
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.49
REMARK   3  SIM     0.61
REMARK   3  SID     99.77
REMARK   3  OSTAT   homo-dimer
REMARK   3  ALN B TRG MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN B TRG AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN B TRG TDDFAAQRNAAFEQARP-GGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVS
REMARK   3  ALN B TRG PRILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEP
REMARK   3  ALN B TRG EVIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREA
REMARK   3  ALN B TRG HALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQA
REMARK   3  ALN B TRG FAEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLG
REMARK   3  ALN B TRG EARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN B TPL MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN B TPL AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN B TPL TDDFAAQRNAAFEQA-RPGGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVS
REMARK   3  ALN B TPL PRILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEP
REMARK   3  ALN B TPL EVIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREA
REMARK   3  ALN B TPL HALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQA
REMARK   3  ALN B TPL FAEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLG
REMARK   3  ALN B TPL EARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN B OFF 0
ATOM      1  N   MET A   1     -21.221   8.654  18.067  1.00  0.69           N  
ATOM      2  CA  MET A   1     -21.067   9.110  16.638  1.00  0.69           C  
ATOM      3  C   MET A   1     -20.243   8.117  15.824  1.00  0.69           C  
ATOM      4  O   MET A   1     -19.428   7.407  16.403  1.00  0.69           O  
ATOM      5  CB  MET A   1     -20.382  10.504  16.681  1.00  0.69           C  
ATOM      6  CG  MET A   1     -20.193  11.177  15.309  1.00  0.69           C  
ATOM      7  SD  MET A   1     -19.314  12.768  15.300  1.00  0.69           S  
ATOM      8  CE  MET A   1     -20.407  13.603  16.460  1.00  0.69           C  
ATOM      9  N   LYS A   2     -20.427   8.019  14.491  1.00  0.69           N  
ATOM     10  CA  LYS A   2     -19.653   7.169  13.613  1.00  0.69           C  
ATOM     11  C   LYS A   2     -18.419   7.880  13.081  1.00  0.69           C  
ATOM     12  O   LYS A   2     -18.330   9.107  13.043  1.00  0.69           O  
ATOM     13  CB  LYS A   2     -20.505   6.644  12.420  1.00  0.69           C  
ATOM     14  CG  LYS A   2     -21.760   5.845  12.827  1.00  0.69           C  
ATOM     15  CD  LYS A   2     -21.360   4.586  13.605  1.00  0.69           C  
ATOM     16  CE  LYS A   2     -22.482   3.667  14.085  1.00  0.69           C  
ATOM     17  NZ  LYS A   2     -21.869   2.624  14.910  1.00  0.69           N  
ATOM     18  N   PHE A   3     -17.394   7.113  12.655  1.00  0.71           N  
ATOM     19  CA  PHE A   3     -16.178   7.657  12.067  1.00  0.71           C  
ATOM     20  C   PHE A   3     -16.440   8.430  10.776  1.00  0.71           C  
ATOM     21  O   PHE A   3     -15.839   9.476  10.536  1.00  0.71           O  
ATOM     22  CB  PHE A   3     -15.103   6.549  11.881  1.00  0.71           C  
ATOM     23  CG  PHE A   3     -13.787   7.045  11.315  1.00  0.71           C  
ATOM     24  CD1 PHE A   3     -13.181   6.363  10.245  1.00  0.71           C  
ATOM     25  CD2 PHE A   3     -13.155   8.195  11.819  1.00  0.71           C  
ATOM     26  CE1 PHE A   3     -11.989   6.829   9.675  1.00  0.71           C  
ATOM     27  CE2 PHE A   3     -11.977   8.677  11.234  1.00  0.71           C  
ATOM     28  CZ  PHE A   3     -11.390   7.995  10.164  1.00  0.71           C  
ATOM     29  N   SER A   4     -17.389   7.967   9.938  1.00  0.77           N  
ATOM     30  CA  SER A   4     -17.845   8.708   8.769  1.00  0.77           C  
ATOM     31  C   SER A   4     -18.394  10.087   9.096  1.00  0.77           C  
ATOM     32  O   SER A   4     -17.964  11.072   8.502  1.00  0.77           O  
ATOM     33  CB  SER A   4     -18.947   7.933   8.004  1.00  0.77           C  
ATOM     34  OG  SER A   4     -19.924   7.398   8.900  1.00  0.77           O  
ATOM     35  N   ASP A   5     -19.265  10.205  10.121  1.00  0.78           N  
ATOM     36  CA  ASP A   5     -19.779  11.475  10.600  1.00  0.78           C  
ATOM     37  C   ASP A   5     -18.669  12.450  11.020  1.00  0.78           C  
ATOM     38  O   ASP A   5     -18.718  13.650  10.745  1.00  0.78           O  
ATOM     39  CB  ASP A   5     -20.658  11.312  11.867  1.00  0.78           C  
ATOM     40  CG  ASP A   5     -21.736  10.238  11.846  1.00  0.78           C  
ATOM     41  OD1 ASP A   5     -22.442  10.074  10.827  1.00  0.78           O  
ATOM     42  OD2 ASP A   5     -21.885   9.587  12.920  1.00  0.78           O  
ATOM     43  N   VAL A   6     -17.624  11.942  11.717  1.00  0.81           N  
ATOM     44  CA  VAL A   6     -16.456  12.716  12.124  1.00  0.81           C  
ATOM     45  C   VAL A   6     -15.690  13.271  10.932  1.00  0.81           C  
ATOM     46  O   VAL A   6     -15.309  14.443  10.916  1.00  0.81           O  
ATOM     47  CB  VAL A   6     -15.500  11.900  13.000  1.00  0.81           C  
ATOM     48  CG1 VAL A   6     -14.227  12.688  13.365  1.00  0.81           C  
ATOM     49  CG2 VAL A   6     -16.187  11.503  14.313  1.00  0.81           C  
ATOM     50  N   LEU A   7     -15.465  12.451   9.885  1.00  0.76           N  
ATOM     51  CA  LEU A   7     -14.814  12.892   8.664  1.00  0.76           C  
ATOM     52  C   LEU A   7     -15.620  13.942   7.916  1.00  0.76           C  
ATOM     53  O   LEU A   7     -15.081  14.980   7.536  1.00  0.76           O  
ATOM     54  CB  LEU A   7     -14.496  11.701   7.730  1.00  0.76           C  
ATOM     55  CG  LEU A   7     -13.443  10.707   8.270  1.00  0.76           C  
ATOM     56  CD1 LEU A   7     -13.303   9.529   7.294  1.00  0.76           C  
ATOM     57  CD2 LEU A   7     -12.071  11.364   8.497  1.00  0.76           C  
ATOM     58  N   ASP A   8     -16.944  13.743   7.766  1.00  0.75           N  
ATOM     59  CA  ASP A   8     -17.839  14.689   7.129  1.00  0.75           C  
ATOM     60  C   ASP A   8     -17.843  16.041   7.831  1.00  0.75           C  
ATOM     61  O   ASP A   8     -17.742  17.087   7.196  1.00  0.75           O  
ATOM     62  CB  ASP A   8     -19.272  14.105   7.071  1.00  0.75           C  
ATOM     63  CG  ASP A   8     -19.397  12.975   6.051  1.00  0.75           C  
ATOM     64  OD1 ASP A   8     -18.425  12.714   5.298  1.00  0.75           O  
ATOM     65  OD2 ASP A   8     -20.504  12.381   6.002  1.00  0.75           O  
ATOM     66  N   GLN A   9     -17.882  16.065   9.178  1.00  0.71           N  
ATOM     67  CA  GLN A   9     -17.726  17.293   9.939  1.00  0.71           C  
ATOM     68  C   GLN A   9     -16.357  17.963   9.805  1.00  0.71           C  
ATOM     69  O   GLN A   9     -16.277  19.179   9.658  1.00  0.71           O  
ATOM     70  CB  GLN A   9     -18.127  17.093  11.417  1.00  0.71           C  
ATOM     71  CG  GLN A   9     -19.638  16.794  11.560  1.00  0.71           C  
ATOM     72  CD  GLN A   9     -20.104  16.771  13.015  1.00  0.71           C  
ATOM     73  OE1 GLN A   9     -20.026  17.743  13.764  1.00  0.71           O  
ATOM     74  NE2 GLN A   9     -20.655  15.617  13.451  1.00  0.71           N  
ATOM     75  N   ALA A  10     -15.246  17.197   9.788  1.00  0.81           N  
ATOM     76  CA  ALA A  10     -13.916  17.726   9.534  1.00  0.81           C  
ATOM     77  C   ALA A  10     -13.775  18.372   8.157  1.00  0.81           C  
ATOM     78  O   ALA A  10     -13.191  19.444   7.990  1.00  0.81           O  
ATOM     79  CB  ALA A  10     -12.876  16.600   9.703  1.00  0.81           C  
ATOM     80  N   TRP A  11     -14.357  17.760   7.111  1.00  0.60           N  
ATOM     81  CA  TRP A  11     -14.383  18.329   5.779  1.00  0.60           C  
ATOM     82  C   TRP A  11     -15.354  19.499   5.641  1.00  0.60           C  
ATOM     83  O   TRP A  11     -15.174  20.324   4.755  1.00  0.60           O  
ATOM     84  CB  TRP A  11     -14.657  17.227   4.724  1.00  0.60           C  
ATOM     85  CG  TRP A  11     -13.446  16.340   4.432  1.00  0.60           C  
ATOM     86  CD1 TRP A  11     -13.026  15.178   5.025  1.00  0.60           C  
ATOM     87  CD2 TRP A  11     -12.497  16.611   3.385  1.00  0.60           C  
ATOM     88  NE1 TRP A  11     -11.861  14.728   4.440  1.00  0.60           N  
ATOM     89  CE2 TRP A  11     -11.530  15.586   3.425  1.00  0.60           C  
ATOM     90  CE3 TRP A  11     -12.422  17.633   2.442  1.00  0.60           C  
ATOM     91  CZ2 TRP A  11     -10.478  15.561   2.524  1.00  0.60           C  
ATOM     92  CZ3 TRP A  11     -11.364  17.600   1.524  1.00  0.60           C  
ATOM     93  CH2 TRP A  11     -10.404  16.580   1.564  1.00  0.60           C  
ATOM     94  N   ALA A  12     -16.339  19.648   6.550  1.00  0.68           N  
ATOM     95  CA  ALA A  12     -17.317  20.717   6.510  1.00  0.68           C  
ATOM     96  C   ALA A  12     -16.978  21.935   7.381  1.00  0.68           C  
ATOM     97  O   ALA A  12     -17.774  22.867   7.496  1.00  0.68           O  
ATOM     98  CB  ALA A  12     -18.684  20.135   6.928  1.00  0.68           C  
ATOM     99  N   GLU A  13     -15.783  22.003   8.013  1.00  0.57           N  
ATOM    100  CA  GLU A  13     -15.288  23.210   8.668  1.00  0.57           C  
ATOM    101  C   GLU A  13     -14.917  24.274   7.622  1.00  0.57           C  
ATOM    102  O   GLU A  13     -13.743  24.452   7.288  1.00  0.57           O  
ATOM    103  CB  GLU A  13     -14.055  22.971   9.603  1.00  0.57           C  
ATOM    104  CG  GLU A  13     -14.237  21.999  10.801  1.00  0.57           C  
ATOM    105  CD  GLU A  13     -12.959  21.845  11.619  1.00  0.57           C  
ATOM    106  OE1 GLU A  13     -13.067  21.651  12.849  1.00  0.57           O  
ATOM    107  OE2 GLU A  13     -11.840  21.924  11.051  1.00  0.57           O  
ATOM    108  N   ASP A  14     -15.918  24.971   7.052  1.00  0.50           N  
ATOM    109  CA  ASP A  14     -15.735  25.980   6.029  1.00  0.50           C  
ATOM    110  C   ASP A  14     -15.729  27.397   6.602  1.00  0.50           C  
ATOM    111  O   ASP A  14     -15.344  28.362   5.942  1.00  0.50           O  
ATOM    112  CB  ASP A  14     -16.893  25.840   5.002  1.00  0.50           C  
ATOM    113  CG  ASP A  14     -16.719  24.601   4.132  1.00  0.50           C  
ATOM    114  OD1 ASP A  14     -15.572  24.099   4.024  1.00  0.50           O  
ATOM    115  OD2 ASP A  14     -17.745  24.162   3.553  1.00  0.50           O  
ATOM    116  N   SER A  15     -16.105  27.586   7.880  1.00  0.53           N  
ATOM    117  CA  SER A  15     -16.175  28.892   8.518  1.00  0.53           C  
ATOM    118  C   SER A  15     -14.895  29.215   9.270  1.00  0.53           C  
ATOM    119  O   SER A  15     -14.821  29.139  10.493  1.00  0.53           O  
ATOM    120  CB  SER A  15     -17.421  29.036   9.454  1.00  0.53           C  
ATOM    121  OG  SER A  15     -17.958  27.762   9.824  1.00  0.53           O  
ATOM    122  N   GLY A  16     -13.839  29.633   8.537  1.00  0.58           N  
ATOM    123  CA  GLY A  16     -12.573  30.065   9.120  1.00  0.58           C  
ATOM    124  C   GLY A  16     -11.450  29.077   8.885  1.00  0.58           C  
ATOM    125  O   GLY A  16     -11.590  28.150   8.086  1.00  0.58           O  
ATOM    126  N   PRO A  17     -10.284  29.253   9.503  1.00  0.55           N  
ATOM    127  CA  PRO A  17      -9.255  28.221   9.551  1.00  0.55           C  
ATOM    128  C   PRO A  17      -9.753  26.943  10.225  1.00  0.55           C  
ATOM    129  O   PRO A  17     -10.401  27.074  11.265  1.00  0.55           O  
ATOM    130  CB  PRO A  17      -8.081  28.887  10.285  1.00  0.55           C  
ATOM    131  CG  PRO A  17      -8.711  29.983  11.155  1.00  0.55           C  
ATOM    132  CD  PRO A  17     -10.005  30.358  10.424  1.00  0.55           C  
ATOM    133  N   PRO A  18      -9.539  25.736   9.687  1.00  0.65           N  
ATOM    134  CA  PRO A  18     -10.001  24.506  10.311  1.00  0.65           C  
ATOM    135  C   PRO A  18      -9.400  24.297  11.680  1.00  0.65           C  
ATOM    136  O   PRO A  18      -8.351  24.859  12.002  1.00  0.65           O  
ATOM    137  CB  PRO A  18      -9.571  23.402   9.332  1.00  0.65           C  
ATOM    138  CG  PRO A  18      -8.335  23.971   8.636  1.00  0.65           C  
ATOM    139  CD  PRO A  18      -8.642  25.469   8.563  1.00  0.65           C  
ATOM    140  N   THR A  19     -10.042  23.472  12.512  1.00  0.72           N  
ATOM    141  CA  THR A  19      -9.505  23.090  13.799  1.00  0.72           C  
ATOM    142  C   THR A  19      -8.303  22.197  13.595  1.00  0.72           C  
ATOM    143  O   THR A  19      -8.152  21.590  12.538  1.00  0.72           O  
ATOM    144  CB  THR A  19     -10.509  22.403  14.712  1.00  0.72           C  
ATOM    145  OG1 THR A  19     -10.959  21.166  14.200  1.00  0.72           O  
ATOM    146  CG2 THR A  19     -11.733  23.298  14.972  1.00  0.72           C  
ATOM    147  N   THR A  20      -7.377  22.082  14.576  1.00  0.74           N  
ATOM    148  CA  THR A  20      -6.189  21.226  14.436  1.00  0.74           C  
ATOM    149  C   THR A  20      -6.561  19.792  14.121  1.00  0.74           C  
ATOM    150  O   THR A  20      -6.020  19.176  13.215  1.00  0.74           O  
ATOM    151  CB  THR A  20      -5.298  21.224  15.678  1.00  0.74           C  
ATOM    152  OG1 THR A  20      -5.039  22.558  16.089  1.00  0.74           O  
ATOM    153  CG2 THR A  20      -3.937  20.579  15.388  1.00  0.74           C  
ATOM    154  N   LEU A  21      -7.586  19.247  14.803  1.00  0.77           N  
ATOM    155  CA  LEU A  21      -8.129  17.944  14.477  1.00  0.77           C  
ATOM    156  C   LEU A  21      -8.756  17.874  13.090  1.00  0.77           C  
ATOM    157  O   LEU A  21      -8.511  16.936  12.335  1.00  0.77           O  
ATOM    158  CB  LEU A  21      -9.188  17.554  15.529  1.00  0.77           C  
ATOM    159  CG  LEU A  21      -9.819  16.161  15.333  1.00  0.77           C  
ATOM    160  CD1 LEU A  21      -8.775  15.035  15.369  1.00  0.77           C  
ATOM    161  CD2 LEU A  21     -10.893  15.919  16.393  1.00  0.77           C  
ATOM    162  N   GLY A  22      -9.569  18.883  12.709  1.00  0.82           N  
ATOM    163  CA  GLY A  22     -10.122  19.047  11.369  1.00  0.82           C  
ATOM    164  C   GLY A  22      -9.130  18.999  10.251  1.00  0.82           C  
ATOM    165  O   GLY A  22      -9.294  18.260   9.284  1.00  0.82           O  
ATOM    166  N   ARG A  23      -8.040  19.771  10.372  1.00  0.64           N  
ATOM    167  CA  ARG A  23      -6.954  19.798   9.419  1.00  0.64           C  
ATOM    168  C   ARG A  23      -6.283  18.448   9.253  1.00  0.64           C  
ATOM    169  O   ARG A  23      -6.094  17.956   8.140  1.00  0.64           O  
ATOM    170  CB  ARG A  23      -5.889  20.798   9.924  1.00  0.64           C  
ATOM    171  CG  ARG A  23      -4.657  20.932   9.007  1.00  0.64           C  
ATOM    172  CD  ARG A  23      -3.562  21.821   9.588  1.00  0.64           C  
ATOM    173  NE  ARG A  23      -2.962  21.087  10.736  1.00  0.64           N  
ATOM    174  CZ  ARG A  23      -2.042  21.586  11.564  1.00  0.64           C  
ATOM    175  NH1 ARG A  23      -1.484  22.777  11.350  1.00  0.64           N  
ATOM    176  NH2 ARG A  23      -1.678  20.849  12.607  1.00  0.64           N  
ATOM    177  N   ASP A  24      -5.939  17.819  10.382  1.00  0.80           N  
ATOM    178  CA  ASP A  24      -5.191  16.595  10.453  1.00  0.80           C  
ATOM    179  C   ASP A  24      -6.044  15.387   9.975  1.00  0.80           C  
ATOM    180  O   ASP A  24      -5.549  14.475   9.313  1.00  0.80           O  
ATOM    181  CB  ASP A  24      -4.565  16.512  11.884  1.00  0.80           C  
ATOM    182  CG  ASP A  24      -3.680  17.706  12.317  1.00  0.80           C  
ATOM    183  OD1 ASP A  24      -3.437  18.673  11.541  1.00  0.80           O  
ATOM    184  OD2 ASP A  24      -3.200  17.671  13.478  1.00  0.80           O  
ATOM    185  N   LEU A  25      -7.381  15.382  10.219  1.00  0.80           N  
ATOM    186  CA  LEU A  25      -8.320  14.411   9.652  1.00  0.80           C  
ATOM    187  C   LEU A  25      -8.619  14.585   8.165  1.00  0.80           C  
ATOM    188  O   LEU A  25      -8.982  13.623   7.494  1.00  0.80           O  
ATOM    189  CB  LEU A  25      -9.682  14.419  10.390  1.00  0.80           C  
ATOM    190  CG  LEU A  25      -9.665  13.802  11.801  1.00  0.80           C  
ATOM    191  CD1 LEU A  25     -11.009  14.086  12.483  1.00  0.80           C  
ATOM    192  CD2 LEU A  25      -9.389  12.288  11.779  1.00  0.80           C  
ATOM    193  N   ARG A  26      -8.425  15.784   7.575  1.00  0.64           N  
ATOM    194  CA  ARG A  26      -8.588  16.005   6.138  1.00  0.64           C  
ATOM    195  C   ARG A  26      -7.486  15.346   5.326  1.00  0.64           C  
ATOM    196  O   ARG A  26      -7.577  15.210   4.108  1.00  0.64           O  
ATOM    197  CB  ARG A  26      -8.604  17.509   5.777  1.00  0.64           C  
ATOM    198  CG  ARG A  26      -9.925  18.226   6.114  1.00  0.64           C  
ATOM    199  CD  ARG A  26      -9.803  19.746   5.968  1.00  0.64           C  
ATOM    200  NE  ARG A  26     -11.077  20.364   6.435  1.00  0.64           N  
ATOM    201  CZ  ARG A  26     -11.417  21.652   6.279  1.00  0.64           C  
ATOM    202  NH1 ARG A  26     -10.561  22.570   5.848  1.00  0.64           N  
ATOM    203  NH2 ARG A  26     -12.650  22.021   6.587  1.00  0.64           N  
ATOM    204  N   LEU A  27      -6.415  14.881   5.996  1.00  0.78           N  
ATOM    205  CA  LEU A  27      -5.412  14.049   5.375  1.00  0.78           C  
ATOM    206  C   LEU A  27      -5.929  12.656   5.068  1.00  0.78           C  
ATOM    207  O   LEU A  27      -5.364  11.960   4.230  1.00  0.78           O  
ATOM    208  CB  LEU A  27      -4.169  13.930   6.279  1.00  0.78           C  
ATOM    209  CG  LEU A  27      -3.468  15.273   6.540  1.00  0.78           C  
ATOM    210  CD1 LEU A  27      -2.397  15.117   7.628  1.00  0.78           C  
ATOM    211  CD2 LEU A  27      -2.851  15.813   5.246  1.00  0.78           C  
ATOM    212  N   VAL A  28      -7.032  12.213   5.705  1.00  0.76           N  
ATOM    213  CA  VAL A  28      -7.712  10.983   5.342  1.00  0.76           C  
ATOM    214  C   VAL A  28      -8.454  11.139   4.019  1.00  0.76           C  
ATOM    215  O   VAL A  28      -9.367  11.951   3.873  1.00  0.76           O  
ATOM    216  CB  VAL A  28      -8.666  10.514   6.433  1.00  0.76           C  
ATOM    217  CG1 VAL A  28      -9.384   9.219   6.003  1.00  0.76           C  
ATOM    218  CG2 VAL A  28      -7.872  10.287   7.737  1.00  0.76           C  
ATOM    219  N   ARG A  29      -8.058  10.348   3.001  1.00  0.51           N  
ATOM    220  CA  ARG A  29      -8.597  10.446   1.658  1.00  0.51           C  
ATOM    221  C   ARG A  29      -9.664   9.403   1.414  1.00  0.51           C  
ATOM    222  O   ARG A  29     -10.625   9.636   0.685  1.00  0.51           O  
ATOM    223  CB  ARG A  29      -7.467  10.195   0.626  1.00  0.51           C  
ATOM    224  CG  ARG A  29      -6.415  11.322   0.563  1.00  0.51           C  
ATOM    225  CD  ARG A  29      -6.903  12.631  -0.072  1.00  0.51           C  
ATOM    226  NE  ARG A  29      -7.207  12.306  -1.502  1.00  0.51           N  
ATOM    227  CZ  ARG A  29      -7.662  13.181  -2.406  1.00  0.51           C  
ATOM    228  NH1 ARG A  29      -7.871  14.457  -2.103  1.00  0.51           N  
ATOM    229  NH2 ARG A  29      -7.912  12.758  -3.645  1.00  0.51           N  
ATOM    230  N   ALA A  30      -9.506   8.234   2.048  1.00  0.65           N  
ATOM    231  CA  ALA A  30     -10.432   7.143   1.952  1.00  0.65           C  
ATOM    232  C   ALA A  30     -10.228   6.276   3.174  1.00  0.65           C  
ATOM    233  O   ALA A  30      -9.174   6.295   3.808  1.00  0.65           O  
ATOM    234  CB  ALA A  30     -10.218   6.320   0.663  1.00  0.65           C  
ATOM    235  N   ALA A  31     -11.250   5.498   3.549  1.00  0.74           N  
ATOM    236  CA  ALA A  31     -11.163   4.578   4.649  1.00  0.74           C  
ATOM    237  C   ALA A  31     -12.098   3.443   4.330  1.00  0.74           C  
ATOM    238  O   ALA A  31     -13.119   3.636   3.673  1.00  0.74           O  
ATOM    239  CB  ALA A  31     -11.562   5.234   5.987  1.00  0.74           C  
ATOM    240  N   ALA A  32     -11.746   2.221   4.757  1.00  0.80           N  
ATOM    241  CA  ALA A  32     -12.561   1.047   4.553  1.00  0.80           C  
ATOM    242  C   ALA A  32     -13.962   1.139   5.190  1.00  0.80           C  
ATOM    243  O   ALA A  32     -14.082   1.748   6.261  1.00  0.80           O  
ATOM    244  CB  ALA A  32     -11.775  -0.163   5.077  1.00  0.80           C  
ATOM    245  N   PRO A  33     -15.043   0.600   4.602  1.00  0.74           N  
ATOM    246  CA  PRO A  33     -16.407   0.715   5.122  1.00  0.74           C  
ATOM    247  C   PRO A  33     -16.575   0.294   6.566  1.00  0.74           C  
ATOM    248  O   PRO A  33     -17.362   0.903   7.290  1.00  0.74           O  
ATOM    249  CB  PRO A  33     -17.255  -0.146   4.171  1.00  0.74           C  
ATOM    250  CG  PRO A  33     -16.488  -0.089   2.849  1.00  0.74           C  
ATOM    251  CD  PRO A  33     -15.027  -0.078   3.303  1.00  0.74           C  
ATOM    252  N   GLU A  34     -15.839  -0.735   7.007  1.00  0.69           N  
ATOM    253  CA  GLU A  34     -15.832  -1.260   8.348  1.00  0.69           C  
ATOM    254  C   GLU A  34     -15.361  -0.226   9.360  1.00  0.69           C  
ATOM    255  O   GLU A  34     -15.962  -0.051  10.416  1.00  0.69           O  
ATOM    256  CB  GLU A  34     -14.927  -2.522   8.417  1.00  0.69           C  
ATOM    257  CG  GLU A  34     -15.262  -3.639   7.382  1.00  0.69           C  
ATOM    258  CD  GLU A  34     -14.773  -3.389   5.950  1.00  0.69           C  
ATOM    259  OE1 GLU A  34     -15.081  -4.234   5.076  1.00  0.69           O  
ATOM    260  OE2 GLU A  34     -14.118  -2.341   5.712  1.00  0.69           O  
ATOM    261  N   LEU A  35     -14.289   0.529   9.031  1.00  0.73           N  
ATOM    262  CA  LEU A  35     -13.789   1.624   9.846  1.00  0.73           C  
ATOM    263  C   LEU A  35     -14.748   2.788   9.918  1.00  0.73           C  
ATOM    264  O   LEU A  35     -14.958   3.359  10.983  1.00  0.73           O  
ATOM    265  CB  LEU A  35     -12.423   2.155   9.357  1.00  0.73           C  
ATOM    266  CG  LEU A  35     -11.290   1.121   9.440  1.00  0.73           C  
ATOM    267  CD1 LEU A  35     -10.015   1.652   8.778  1.00  0.73           C  
ATOM    268  CD2 LEU A  35     -10.990   0.689  10.883  1.00  0.73           C  
ATOM    269  N   LEU A  36     -15.384   3.147   8.784  1.00  0.68           N  
ATOM    270  CA  LEU A  36     -16.366   4.213   8.696  1.00  0.68           C  
ATOM    271  C   LEU A  36     -17.553   3.982   9.622  1.00  0.68           C  
ATOM    272  O   LEU A  36     -18.082   4.916  10.220  1.00  0.68           O  
ATOM    273  CB  LEU A  36     -16.826   4.402   7.228  1.00  0.68           C  
ATOM    274  CG  LEU A  36     -15.736   4.952   6.278  1.00  0.68           C  
ATOM    275  CD1 LEU A  36     -16.244   4.988   4.828  1.00  0.68           C  
ATOM    276  CD2 LEU A  36     -15.251   6.354   6.683  1.00  0.68           C  
ATOM    277  N   ALA A  37     -17.949   2.711   9.812  1.00  0.73           N  
ATOM    278  CA  ALA A  37     -19.066   2.327  10.638  1.00  0.73           C  
ATOM    279  C   ALA A  37     -18.733   2.152  12.123  1.00  0.73           C  
ATOM    280  O   ALA A  37     -19.628   1.921  12.944  1.00  0.73           O  
ATOM    281  CB  ALA A  37     -19.614   1.006  10.070  1.00  0.73           C  
ATOM    282  N   LEU A  38     -17.450   2.274  12.524  1.00  0.67           N  
ATOM    283  CA  LEU A  38     -17.048   2.268  13.920  1.00  0.67           C  
ATOM    284  C   LEU A  38     -17.513   3.487  14.697  1.00  0.67           C  
ATOM    285  O   LEU A  38     -17.521   4.615  14.202  1.00  0.67           O  
ATOM    286  CB  LEU A  38     -15.515   2.141  14.107  1.00  0.67           C  
ATOM    287  CG  LEU A  38     -14.915   0.807  13.623  1.00  0.67           C  
ATOM    288  CD1 LEU A  38     -13.383   0.816  13.745  1.00  0.67           C  
ATOM    289  CD2 LEU A  38     -15.491  -0.399  14.381  1.00  0.67           C  
ATOM    290  N   ASP A  39     -17.905   3.272  15.964  1.00  0.69           N  
ATOM    291  CA  ASP A  39     -18.219   4.329  16.896  1.00  0.69           C  
ATOM    292  C   ASP A  39     -16.963   4.984  17.447  1.00  0.69           C  
ATOM    293  O   ASP A  39     -16.007   4.321  17.846  1.00  0.69           O  
ATOM    294  CB  ASP A  39     -19.114   3.785  18.030  1.00  0.69           C  
ATOM    295  CG  ASP A  39     -20.392   3.346  17.372  1.00  0.69           C  
ATOM    296  OD1 ASP A  39     -21.243   4.216  17.035  1.00  0.69           O  
ATOM    297  OD2 ASP A  39     -20.547   2.126  17.041  1.00  0.69           O  
ATOM    298  N   VAL A  40     -16.926   6.328  17.459  1.00  0.79           N  
ATOM    299  CA  VAL A  40     -15.808   7.090  17.994  1.00  0.79           C  
ATOM    300  C   VAL A  40     -16.065   7.417  19.460  1.00  0.79           C  
ATOM    301  O   VAL A  40     -17.230   7.396  19.867  1.00  0.79           O  
ATOM    302  CB  VAL A  40     -15.541   8.372  17.209  1.00  0.79           C  
ATOM    303  CG1 VAL A  40     -15.232   7.998  15.747  1.00  0.79           C  
ATOM    304  CG2 VAL A  40     -16.733   9.344  17.297  1.00  0.79           C  
ATOM    305  N   PRO A  41     -15.092   7.746  20.318  1.00  0.79           N  
ATOM    306  CA  PRO A  41     -15.353   7.823  21.757  1.00  0.79           C  
ATOM    307  C   PRO A  41     -15.805   9.227  22.140  1.00  0.79           C  
ATOM    308  O   PRO A  41     -15.233   9.839  23.039  1.00  0.79           O  
ATOM    309  CB  PRO A  41     -13.978   7.487  22.368  1.00  0.79           C  
ATOM    310  CG  PRO A  41     -12.981   8.035  21.349  1.00  0.79           C  
ATOM    311  CD  PRO A  41     -13.653   7.670  20.027  1.00  0.79           C  
ATOM    312  N   ALA A  42     -16.848   9.737  21.470  1.00  0.78           N  
ATOM    313  CA  ALA A  42     -17.459  11.005  21.774  1.00  0.78           C  
ATOM    314  C   ALA A  42     -18.828  11.072  21.131  1.00  0.78           C  
ATOM    315  O   ALA A  42     -19.084  10.436  20.098  1.00  0.78           O  
ATOM    316  CB  ALA A  42     -16.618  12.171  21.226  1.00  0.78           C  
ATOM    317  N   ASP A  43     -19.729  11.888  21.709  1.00  0.63           N  
ATOM    318  CA  ASP A  43     -21.065  12.047  21.188  1.00  0.63           C  
ATOM    319  C   ASP A  43     -21.135  13.246  20.269  1.00  0.63           C  
ATOM    320  O   ASP A  43     -21.986  13.316  19.379  1.00  0.63           O  
ATOM    321  CB  ASP A  43     -22.074  12.154  22.350  1.00  0.63           C  
ATOM    322  CG  ASP A  43     -22.253  10.774  22.968  1.00  0.63           C  
ATOM    323  OD1 ASP A  43     -22.326   9.789  22.175  1.00  0.63           O  
ATOM    324  OD2 ASP A  43     -22.345  10.682  24.217  1.00  0.63           O  
ATOM    325  N   ALA A  44     -20.167  14.174  20.376  1.00  0.75           N  
ATOM    326  CA  ALA A  44     -20.122  15.321  19.510  1.00  0.75           C  
ATOM    327  C   ALA A  44     -18.729  15.602  18.973  1.00  0.75           C  
ATOM    328  O   ALA A  44     -17.701  15.355  19.597  1.00  0.75           O  
ATOM    329  CB  ALA A  44     -20.683  16.539  20.254  1.00  0.75           C  
ATOM    330  N   TYR A  45     -18.651  16.159  17.745  1.00  0.70           N  
ATOM    331  CA  TYR A  45     -17.393  16.494  17.098  1.00  0.70           C  
ATOM    332  C   TYR A  45     -16.594  17.544  17.874  1.00  0.70           C  
ATOM    333  O   TYR A  45     -15.380  17.436  18.023  1.00  0.70           O  
ATOM    334  CB  TYR A  45     -17.665  16.917  15.630  1.00  0.70           C  
ATOM    335  CG  TYR A  45     -16.410  17.250  14.869  1.00  0.70           C  
ATOM    336  CD1 TYR A  45     -16.140  18.574  14.489  1.00  0.70           C  
ATOM    337  CD2 TYR A  45     -15.480  16.249  14.555  1.00  0.70           C  
ATOM    338  CE1 TYR A  45     -14.960  18.896  13.808  1.00  0.70           C  
ATOM    339  CE2 TYR A  45     -14.291  16.569  13.883  1.00  0.70           C  
ATOM    340  CZ  TYR A  45     -14.039  17.891  13.507  1.00  0.70           C  
ATOM    341  OH  TYR A  45     -12.877  18.234  12.809  1.00  0.70           O  
ATOM    342  N   GLY A  46     -17.270  18.565  18.449  1.00  0.76           N  
ATOM    343  CA  GLY A  46     -16.630  19.584  19.282  1.00  0.76           C  
ATOM    344  C   GLY A  46     -15.948  19.064  20.526  1.00  0.76           C  
ATOM    345  O   GLY A  46     -14.957  19.630  20.980  1.00  0.76           O  
ATOM    346  N   GLU A  47     -16.436  17.944  21.096  1.00  0.68           N  
ATOM    347  CA  GLU A  47     -15.769  17.242  22.175  1.00  0.68           C  
ATOM    348  C   GLU A  47     -14.457  16.628  21.727  1.00  0.68           C  
ATOM    349  O   GLU A  47     -13.436  16.780  22.392  1.00  0.68           O  
ATOM    350  CB  GLU A  47     -16.665  16.120  22.737  1.00  0.68           C  
ATOM    351  CG  GLU A  47     -18.002  16.614  23.333  1.00  0.68           C  
ATOM    352  CD  GLU A  47     -19.009  15.486  23.586  1.00  0.68           C  
ATOM    353  OE1 GLU A  47     -20.017  15.790  24.267  1.00  0.68           O  
ATOM    354  OE2 GLU A  47     -18.815  14.350  23.048  1.00  0.68           O  
ATOM    355  N   LEU A  48     -14.436  15.971  20.542  1.00  0.75           N  
ATOM    356  CA  LEU A  48     -13.220  15.441  19.945  1.00  0.75           C  
ATOM    357  C   LEU A  48     -12.209  16.530  19.648  1.00  0.75           C  
ATOM    358  O   LEU A  48     -11.028  16.381  19.942  1.00  0.75           O  
ATOM    359  CB  LEU A  48     -13.475  14.667  18.627  1.00  0.75           C  
ATOM    360  CG  LEU A  48     -14.244  13.344  18.774  1.00  0.75           C  
ATOM    361  CD1 LEU A  48     -14.676  12.823  17.395  1.00  0.75           C  
ATOM    362  CD2 LEU A  48     -13.412  12.271  19.495  1.00  0.75           C  
ATOM    363  N   VAL A  49     -12.652  17.676  19.096  1.00  0.77           N  
ATOM    364  CA  VAL A  49     -11.807  18.841  18.884  1.00  0.77           C  
ATOM    365  C   VAL A  49     -11.235  19.385  20.187  1.00  0.77           C  
ATOM    366  O   VAL A  49     -10.037  19.637  20.302  1.00  0.77           O  
ATOM    367  CB  VAL A  49     -12.598  19.937  18.179  1.00  0.77           C  
ATOM    368  CG1 VAL A  49     -11.803  21.255  18.090  1.00  0.77           C  
ATOM    369  CG2 VAL A  49     -12.966  19.475  16.755  1.00  0.77           C  
ATOM    370  N   GLY A  50     -12.078  19.532  21.230  1.00  0.80           N  
ATOM    371  CA  GLY A  50     -11.665  20.051  22.529  1.00  0.80           C  
ATOM    372  C   GLY A  50     -10.726  19.164  23.304  1.00  0.80           C  
ATOM    373  O   GLY A  50      -9.903  19.642  24.089  1.00  0.80           O  
ATOM    374  N   SER A  51     -10.795  17.837  23.097  1.00  0.78           N  
ATOM    375  CA  SER A  51      -9.927  16.890  23.774  1.00  0.78           C  
ATOM    376  C   SER A  51      -8.704  16.518  22.966  1.00  0.78           C  
ATOM    377  O   SER A  51      -7.774  15.918  23.501  1.00  0.78           O  
ATOM    378  CB  SER A  51     -10.676  15.583  24.146  1.00  0.78           C  
ATOM    379  OG  SER A  51     -11.130  14.863  22.997  1.00  0.78           O  
ATOM    380  N   TYR A  52      -8.634  16.906  21.675  1.00  0.34           N  
ATOM    381  CA  TYR A  52      -7.486  16.638  20.828  1.00  0.34           C  
ATOM    382  C   TYR A  52      -6.214  17.320  21.319  1.00  0.34           C  
ATOM    383  O   TYR A  52      -6.175  18.516  21.608  1.00  0.34           O  
ATOM    384  CB  TYR A  52      -7.777  16.990  19.337  1.00  0.34           C  
ATOM    385  CG  TYR A  52      -6.709  16.492  18.386  1.00  0.34           C  
ATOM    386  CD1 TYR A  52      -6.054  17.363  17.499  1.00  0.34           C  
ATOM    387  CD2 TYR A  52      -6.353  15.136  18.373  1.00  0.34           C  
ATOM    388  CE1 TYR A  52      -5.046  16.895  16.644  1.00  0.34           C  
ATOM    389  CE2 TYR A  52      -5.360  14.659  17.508  1.00  0.34           C  
ATOM    390  CZ  TYR A  52      -4.697  15.543  16.651  1.00  0.34           C  
ATOM    391  OH  TYR A  52      -3.683  15.084  15.793  1.00  0.34           O  
ATOM    392  N   ARG A  53      -5.127  16.549  21.442  1.00  0.30           N  
ATOM    393  CA  ARG A  53      -3.840  17.056  21.856  1.00  0.30           C  
ATOM    394  C   ARG A  53      -2.776  16.550  20.891  1.00  0.30           C  
ATOM    395  O   ARG A  53      -2.404  15.377  20.969  1.00  0.30           O  
ATOM    396  CB  ARG A  53      -3.510  16.614  23.304  1.00  0.30           C  
ATOM    397  CG  ARG A  53      -4.439  17.230  24.375  1.00  0.30           C  
ATOM    398  CD  ARG A  53      -4.374  18.764  24.462  1.00  0.30           C  
ATOM    399  NE  ARG A  53      -5.401  19.216  25.461  1.00  0.30           N  
ATOM    400  CZ  ARG A  53      -6.671  19.520  25.158  1.00  0.30           C  
ATOM    401  NH1 ARG A  53      -7.156  19.479  23.926  1.00  0.30           N  
ATOM    402  NH2 ARG A  53      -7.509  19.890  26.125  1.00  0.30           N  
ATOM    403  N   PRO A  54      -2.249  17.360  19.969  1.00  0.40           N  
ATOM    404  CA  PRO A  54      -1.342  16.875  18.933  1.00  0.40           C  
ATOM    405  C   PRO A  54       0.057  16.681  19.472  1.00  0.40           C  
ATOM    406  O   PRO A  54       0.875  16.023  18.831  1.00  0.40           O  
ATOM    407  CB  PRO A  54      -1.390  17.974  17.856  1.00  0.40           C  
ATOM    408  CG  PRO A  54      -1.799  19.235  18.619  1.00  0.40           C  
ATOM    409  CD  PRO A  54      -2.784  18.681  19.638  1.00  0.40           C  
ATOM    410  N   ASP A  55       0.344  17.264  20.642  1.00  0.40           N  
ATOM    411  CA  ASP A  55       1.562  17.157  21.397  1.00  0.40           C  
ATOM    412  C   ASP A  55       1.704  15.798  22.082  1.00  0.40           C  
ATOM    413  O   ASP A  55       2.805  15.295  22.293  1.00  0.40           O  
ATOM    414  CB  ASP A  55       1.557  18.327  22.424  1.00  0.40           C  
ATOM    415  CG  ASP A  55       0.301  18.316  23.297  1.00  0.40           C  
ATOM    416  OD1 ASP A  55      -0.810  18.547  22.743  1.00  0.40           O  
ATOM    417  OD2 ASP A  55       0.424  18.032  24.520  1.00  0.40           O  
ATOM    418  N   ARG A  56       0.566  15.141  22.388  1.00  0.39           N  
ATOM    419  CA  ARG A  56       0.512  13.838  23.022  1.00  0.39           C  
ATOM    420  C   ARG A  56       0.402  12.701  22.023  1.00  0.39           C  
ATOM    421  O   ARG A  56      -0.261  11.695  22.268  1.00  0.39           O  
ATOM    422  CB  ARG A  56      -0.661  13.744  24.022  1.00  0.39           C  
ATOM    423  CG  ARG A  56      -0.522  14.695  25.221  1.00  0.39           C  
ATOM    424  CD  ARG A  56      -1.544  14.358  26.302  1.00  0.39           C  
ATOM    425  NE  ARG A  56      -1.311  15.289  27.444  1.00  0.39           N  
ATOM    426  CZ  ARG A  56      -1.938  15.185  28.623  1.00  0.39           C  
ATOM    427  NH1 ARG A  56      -2.860  14.248  28.835  1.00  0.39           N  
ATOM    428  NH2 ARG A  56      -1.640  16.032  29.604  1.00  0.39           N  
ATOM    429  N   ALA A  57       1.056  12.838  20.860  1.00  0.53           N  
ATOM    430  CA  ALA A  57       1.143  11.813  19.847  1.00  0.53           C  
ATOM    431  C   ALA A  57       1.773  10.503  20.310  1.00  0.53           C  
ATOM    432  O   ALA A  57       2.746  10.490  21.063  1.00  0.53           O  
ATOM    433  CB  ALA A  57       1.955  12.370  18.664  1.00  0.53           C  
ATOM    434  N   GLY A  58       1.231   9.349  19.856  1.00  0.54           N  
ATOM    435  CA  GLY A  58       1.909   8.062  19.989  1.00  0.54           C  
ATOM    436  C   GLY A  58       3.224   8.016  19.246  1.00  0.54           C  
ATOM    437  O   GLY A  58       3.409   8.687  18.233  1.00  0.54           O  
ATOM    438  N   ALA A  59       4.185   7.207  19.733  1.00  0.66           N  
ATOM    439  CA  ALA A  59       5.488   7.085  19.109  1.00  0.66           C  
ATOM    440  C   ALA A  59       5.451   6.505  17.699  1.00  0.66           C  
ATOM    441  O   ALA A  59       4.839   5.469  17.452  1.00  0.66           O  
ATOM    442  CB  ALA A  59       6.435   6.243  19.991  1.00  0.66           C  
ATOM    443  N   VAL A  60       6.141   7.141  16.740  1.00  0.66           N  
ATOM    444  CA  VAL A  60       6.209   6.674  15.370  1.00  0.66           C  
ATOM    445  C   VAL A  60       7.615   6.181  15.088  1.00  0.66           C  
ATOM    446  O   VAL A  60       8.598   6.923  15.111  1.00  0.66           O  
ATOM    447  CB  VAL A  60       5.805   7.733  14.349  1.00  0.66           C  
ATOM    448  CG1 VAL A  60       5.823   7.143  12.922  1.00  0.66           C  
ATOM    449  CG2 VAL A  60       4.394   8.264  14.674  1.00  0.66           C  
ATOM    450  N   THR A  61       7.744   4.876  14.799  1.00  0.68           N  
ATOM    451  CA  THR A  61       9.012   4.264  14.441  1.00  0.68           C  
ATOM    452  C   THR A  61       9.006   4.023  12.959  1.00  0.68           C  
ATOM    453  O   THR A  61       8.177   3.281  12.433  1.00  0.68           O  
ATOM    454  CB  THR A  61       9.266   2.919  15.110  1.00  0.68           C  
ATOM    455  OG1 THR A  61       9.389   3.083  16.516  1.00  0.68           O  
ATOM    456  CG2 THR A  61      10.580   2.267  14.640  1.00  0.68           C  
ATOM    457  N   ALA A  62       9.957   4.626  12.227  1.00  0.69           N  
ATOM    458  CA  ALA A  62      10.181   4.265  10.849  1.00  0.69           C  
ATOM    459  C   ALA A  62      11.013   3.005  10.770  1.00  0.69           C  
ATOM    460  O   ALA A  62      12.051   2.882  11.421  1.00  0.69           O  
ATOM    461  CB  ALA A  62      10.876   5.375  10.054  1.00  0.69           C  
ATOM    462  N   VAL A  63      10.552   2.034   9.974  1.00  0.71           N  
ATOM    463  CA  VAL A  63      11.232   0.778   9.772  1.00  0.71           C  
ATOM    464  C   VAL A  63      11.714   0.770   8.348  1.00  0.71           C  
ATOM    465  O   VAL A  63      10.923   0.778   7.404  1.00  0.71           O  
ATOM    466  CB  VAL A  63      10.334  -0.424  10.008  1.00  0.71           C  
ATOM    467  CG1 VAL A  63      11.124  -1.729   9.772  1.00  0.71           C  
ATOM    468  CG2 VAL A  63       9.785  -0.356  11.448  1.00  0.71           C  
ATOM    469  N   VAL A  64      13.044   0.762   8.166  1.00  0.71           N  
ATOM    470  CA  VAL A  64      13.647   0.800   6.853  1.00  0.71           C  
ATOM    471  C   VAL A  64      14.379  -0.501   6.631  1.00  0.71           C  
ATOM    472  O   VAL A  64      15.354  -0.824   7.308  1.00  0.71           O  
ATOM    473  CB  VAL A  64      14.592   1.981   6.663  1.00  0.71           C  
ATOM    474  CG1 VAL A  64      15.087   2.029   5.203  1.00  0.71           C  
ATOM    475  CG2 VAL A  64      13.840   3.286   6.998  1.00  0.71           C  
ATOM    476  N   LEU A  65      13.918  -1.311   5.662  1.00  0.67           N  
ATOM    477  CA  LEU A  65      14.646  -2.495   5.241  1.00  0.67           C  
ATOM    478  C   LEU A  65      15.744  -2.063   4.290  1.00  0.67           C  
ATOM    479  O   LEU A  65      15.535  -1.190   3.451  1.00  0.67           O  
ATOM    480  CB  LEU A  65      13.743  -3.543   4.544  1.00  0.67           C  
ATOM    481  CG  LEU A  65      13.057  -4.557   5.486  1.00  0.67           C  
ATOM    482  CD1 LEU A  65      12.149  -3.907   6.541  1.00  0.67           C  
ATOM    483  CD2 LEU A  65      12.258  -5.569   4.652  1.00  0.67           C  
ATOM    484  N   THR A  66      16.954  -2.641   4.411  1.00  0.64           N  
ATOM    485  CA  THR A  66      18.082  -2.149   3.632  1.00  0.64           C  
ATOM    486  C   THR A  66      19.067  -3.257   3.288  1.00  0.64           C  
ATOM    487  O   THR A  66      19.194  -4.246   4.010  1.00  0.64           O  
ATOM    488  CB  THR A  66      18.768  -0.960   4.311  1.00  0.64           C  
ATOM    489  OG1 THR A  66      19.588  -0.246   3.407  1.00  0.64           O  
ATOM    490  CG2 THR A  66      19.617  -1.374   5.516  1.00  0.64           C  
ATOM    491  N   HIS A  67      19.751  -3.118   2.133  1.00  0.52           N  
ATOM    492  CA  HIS A  67      20.736  -4.057   1.612  1.00  0.52           C  
ATOM    493  C   HIS A  67      21.481  -3.385   0.472  1.00  0.52           C  
ATOM    494  O   HIS A  67      20.971  -3.318  -0.644  1.00  0.52           O  
ATOM    495  CB  HIS A  67      20.122  -5.368   1.036  1.00  0.52           C  
ATOM    496  CG  HIS A  67      21.164  -6.330   0.546  1.00  0.52           C  
ATOM    497  ND1 HIS A  67      21.916  -6.988   1.490  1.00  0.52           N  
ATOM    498  CD2 HIS A  67      21.745  -6.437  -0.677  1.00  0.52           C  
ATOM    499  CE1 HIS A  67      22.956  -7.471   0.834  1.00  0.52           C  
ATOM    500  NE2 HIS A  67      22.901  -7.160  -0.483  1.00  0.52           N  
ATOM    501  N   ASP A  68      22.693  -2.862   0.734  1.00  0.54           N  
ATOM    502  CA  ASP A  68      23.524  -2.178  -0.245  1.00  0.54           C  
ATOM    503  C   ASP A  68      22.885  -0.923  -0.860  1.00  0.54           C  
ATOM    504  O   ASP A  68      22.735  -0.790  -2.074  1.00  0.54           O  
ATOM    505  CB  ASP A  68      24.102  -3.137  -1.316  1.00  0.54           C  
ATOM    506  CG  ASP A  68      24.867  -4.295  -0.696  1.00  0.54           C  
ATOM    507  OD1 ASP A  68      25.527  -4.111   0.363  1.00  0.54           O  
ATOM    508  OD2 ASP A  68      24.823  -5.399  -1.309  1.00  0.54           O  
ATOM    509  N   GLU A  69      22.477   0.036  -0.003  1.00  0.59           N  
ATOM    510  CA  GLU A  69      21.689   1.205  -0.351  1.00  0.59           C  
ATOM    511  C   GLU A  69      22.414   2.512  -0.038  1.00  0.59           C  
ATOM    512  O   GLU A  69      21.783   3.549   0.200  1.00  0.59           O  
ATOM    513  CB  GLU A  69      20.326   1.202   0.386  1.00  0.59           C  
ATOM    514  CG  GLU A  69      19.399   0.023  -0.008  1.00  0.59           C  
ATOM    515  CD  GLU A  69      18.751   0.155  -1.387  1.00  0.59           C  
ATOM    516  OE1 GLU A  69      17.961  -0.767  -1.722  1.00  0.59           O  
ATOM    517  OE2 GLU A  69      18.999   1.172  -2.085  1.00  0.59           O  
ATOM    518  N   GLU A  70      23.770   2.527  -0.028  1.00  0.55           N  
ATOM    519  CA  GLU A  70      24.599   3.651   0.393  1.00  0.55           C  
ATOM    520  C   GLU A  70      24.253   4.985  -0.259  1.00  0.55           C  
ATOM    521  O   GLU A  70      24.277   6.034   0.382  1.00  0.55           O  
ATOM    522  CB  GLU A  70      26.107   3.311   0.214  1.00  0.55           C  
ATOM    523  CG  GLU A  70      26.591   3.134  -1.247  1.00  0.55           C  
ATOM    524  CD  GLU A  70      28.087   2.827  -1.369  1.00  0.55           C  
ATOM    525  OE1 GLU A  70      28.558   2.878  -2.536  1.00  0.55           O  
ATOM    526  OE2 GLU A  70      28.771   2.591  -0.328  1.00  0.55           O  
ATOM    527  N   GLN A  71      23.867   4.968  -1.545  1.00  0.54           N  
ATOM    528  CA  GLN A  71      23.467   6.116  -2.326  1.00  0.54           C  
ATOM    529  C   GLN A  71      22.147   6.768  -1.924  1.00  0.54           C  
ATOM    530  O   GLN A  71      22.004   7.989  -1.988  1.00  0.54           O  
ATOM    531  CB  GLN A  71      23.531   5.758  -3.829  1.00  0.54           C  
ATOM    532  CG  GLN A  71      24.953   5.256  -4.182  1.00  0.54           C  
ATOM    533  CD  GLN A  71      25.295   5.319  -5.670  1.00  0.54           C  
ATOM    534  OE1 GLN A  71      24.709   6.085  -6.439  1.00  0.54           O  
ATOM    535  NE2 GLN A  71      26.235   4.454  -6.084  1.00  0.54           N  
ATOM    536  N   VAL A  72      21.134   5.989  -1.496  1.00  0.65           N  
ATOM    537  CA  VAL A  72      19.800   6.533  -1.282  1.00  0.65           C  
ATOM    538  C   VAL A  72      19.414   6.626   0.185  1.00  0.65           C  
ATOM    539  O   VAL A  72      18.603   7.472   0.570  1.00  0.65           O  
ATOM    540  CB  VAL A  72      18.744   5.748  -2.049  1.00  0.65           C  
ATOM    541  CG1 VAL A  72      19.001   5.909  -3.561  1.00  0.65           C  
ATOM    542  CG2 VAL A  72      18.761   4.264  -1.650  1.00  0.65           C  
ATOM    543  N   ILE A  73      20.044   5.827   1.075  1.00  0.65           N  
ATOM    544  CA  ILE A  73      19.661   5.707   2.480  1.00  0.65           C  
ATOM    545  C   ILE A  73      19.711   7.009   3.263  1.00  0.65           C  
ATOM    546  O   ILE A  73      18.843   7.304   4.084  1.00  0.65           O  
ATOM    547  CB  ILE A  73      20.463   4.607   3.187  1.00  0.65           C  
ATOM    548  CG1 ILE A  73      19.890   4.217   4.570  1.00  0.65           C  
ATOM    549  CG2 ILE A  73      21.955   4.985   3.326  1.00  0.65           C  
ATOM    550  CD1 ILE A  73      18.488   3.603   4.505  1.00  0.65           C  
ATOM    551  N   GLY A  74      20.711   7.881   3.002  1.00  0.65           N  
ATOM    552  CA  GLY A  74      20.795   9.156   3.696  1.00  0.65           C  
ATOM    553  C   GLY A  74      19.697  10.134   3.371  1.00  0.65           C  
ATOM    554  O   GLY A  74      19.299  10.924   4.220  1.00  0.65           O  
ATOM    555  N   ALA A  75      19.163  10.119   2.139  1.00  0.68           N  
ATOM    556  CA  ALA A  75      18.032  10.944   1.774  1.00  0.68           C  
ATOM    557  C   ALA A  75      16.733  10.461   2.401  1.00  0.68           C  
ATOM    558  O   ALA A  75      15.963  11.262   2.928  1.00  0.68           O  
ATOM    559  CB  ALA A  75      17.935  11.050   0.244  1.00  0.68           C  
ATOM    560  N   CYS A  76      16.508   9.131   2.413  1.00  0.67           N  
ATOM    561  CA  CYS A  76      15.366   8.500   3.055  1.00  0.67           C  
ATOM    562  C   CYS A  76      15.269   8.825   4.539  1.00  0.67           C  
ATOM    563  O   CYS A  76      14.249   9.318   5.015  1.00  0.67           O  
ATOM    564  CB  CYS A  76      15.481   6.963   2.833  1.00  0.67           C  
ATOM    565  SG  CYS A  76      14.284   5.910   3.742  1.00  0.67           S  
ATOM    566  N   LEU A  77      16.363   8.631   5.303  1.00  0.67           N  
ATOM    567  CA  LEU A  77      16.384   8.898   6.729  1.00  0.67           C  
ATOM    568  C   LEU A  77      16.180  10.361   7.089  1.00  0.67           C  
ATOM    569  O   LEU A  77      15.413  10.680   7.994  1.00  0.67           O  
ATOM    570  CB  LEU A  77      17.687   8.362   7.360  1.00  0.67           C  
ATOM    571  CG  LEU A  77      17.887   6.837   7.232  1.00  0.67           C  
ATOM    572  CD1 LEU A  77      19.238   6.451   7.848  1.00  0.67           C  
ATOM    573  CD2 LEU A  77      16.753   6.024   7.873  1.00  0.67           C  
ATOM    574  N   ARG A  78      16.812  11.302   6.354  1.00  0.63           N  
ATOM    575  CA  ARG A  78      16.629  12.729   6.562  1.00  0.63           C  
ATOM    576  C   ARG A  78      15.206  13.213   6.339  1.00  0.63           C  
ATOM    577  O   ARG A  78      14.775  14.185   6.945  1.00  0.63           O  
ATOM    578  CB  ARG A  78      17.567  13.560   5.658  1.00  0.63           C  
ATOM    579  CG  ARG A  78      19.032  13.575   6.128  1.00  0.63           C  
ATOM    580  CD  ARG A  78      19.908  14.571   5.360  1.00  0.63           C  
ATOM    581  NE  ARG A  78      20.073  14.079   3.949  1.00  0.63           N  
ATOM    582  CZ  ARG A  78      21.146  13.417   3.496  1.00  0.63           C  
ATOM    583  NH1 ARG A  78      22.141  13.078   4.307  1.00  0.63           N  
ATOM    584  NH2 ARG A  78      21.220  13.088   2.207  1.00  0.63           N  
ATOM    585  N   ALA A  79      14.436  12.556   5.457  1.00  0.68           N  
ATOM    586  CA  ALA A  79      13.071  12.937   5.192  1.00  0.68           C  
ATOM    587  C   ALA A  79      12.090  12.454   6.256  1.00  0.68           C  
ATOM    588  O   ALA A  79      10.963  12.930   6.338  1.00  0.68           O  
ATOM    589  CB  ALA A  79      12.701  12.402   3.803  1.00  0.68           C  
ATOM    590  N   LEU A  80      12.506  11.509   7.120  1.00  0.65           N  
ATOM    591  CA  LEU A  80      11.641  10.926   8.125  1.00  0.65           C  
ATOM    592  C   LEU A  80      11.842  11.521   9.514  1.00  0.65           C  
ATOM    593  O   LEU A  80      11.103  11.195  10.440  1.00  0.65           O  
ATOM    594  CB  LEU A  80      11.931   9.407   8.213  1.00  0.65           C  
ATOM    595  CG  LEU A  80      11.575   8.615   6.940  1.00  0.65           C  
ATOM    596  CD1 LEU A  80      12.191   7.209   6.997  1.00  0.65           C  
ATOM    597  CD2 LEU A  80      10.057   8.541   6.728  1.00  0.65           C  
ATOM    598  N   THR A  81      12.824  12.422   9.708  1.00  0.62           N  
ATOM    599  CA  THR A  81      13.195  12.970  11.012  1.00  0.62           C  
ATOM    600  C   THR A  81      12.100  13.791  11.662  1.00  0.62           C  
ATOM    601  O   THR A  81      11.847  13.652  12.855  1.00  0.62           O  
ATOM    602  CB  THR A  81      14.479  13.798  10.966  1.00  0.62           C  
ATOM    603  OG1 THR A  81      14.443  14.735   9.901  1.00  0.62           O  
ATOM    604  CG2 THR A  81      15.662  12.859  10.688  1.00  0.62           C  
ATOM    605  N   ASP A  82      11.391  14.643  10.899  1.00  0.52           N  
ATOM    606  CA  ASP A  82      10.307  15.468  11.395  1.00  0.52           C  
ATOM    607  C   ASP A  82       9.067  14.668  11.813  1.00  0.52           C  
ATOM    608  O   ASP A  82       8.321  15.049  12.718  1.00  0.52           O  
ATOM    609  CB  ASP A  82       9.923  16.532  10.334  1.00  0.52           C  
ATOM    610  CG  ASP A  82      11.075  17.484  10.031  1.00  0.52           C  
ATOM    611  OD1 ASP A  82      11.713  17.984  10.990  1.00  0.52           O  
ATOM    612  OD2 ASP A  82      11.298  17.762   8.819  1.00  0.52           O  
ATOM    613  N   ASP A  83       8.813  13.511  11.169  1.00  0.57           N  
ATOM    614  CA  ASP A  83       7.609  12.750  11.402  1.00  0.57           C  
ATOM    615  C   ASP A  83       7.802  11.567  12.340  1.00  0.57           C  
ATOM    616  O   ASP A  83       6.849  11.124  12.978  1.00  0.57           O  
ATOM    617  CB  ASP A  83       7.059  12.256  10.048  1.00  0.57           C  
ATOM    618  CG  ASP A  83       6.263  13.373   9.413  1.00  0.57           C  
ATOM    619  OD1 ASP A  83       5.051  13.481   9.746  1.00  0.57           O  
ATOM    620  OD2 ASP A  83       6.828  14.134   8.593  1.00  0.57           O  
ATOM    621  N   CYS A  84       9.028  11.053  12.529  1.00  0.62           N  
ATOM    622  CA  CYS A  84       9.247   9.807  13.247  1.00  0.62           C  
ATOM    623  C   CYS A  84      10.206   9.959  14.412  1.00  0.62           C  
ATOM    624  O   CYS A  84      11.318  10.459  14.273  1.00  0.62           O  
ATOM    625  CB  CYS A  84       9.809   8.722  12.300  1.00  0.62           C  
ATOM    626  SG  CYS A  84       8.657   8.369  10.928  1.00  0.62           S  
ATOM    627  N   ASP A  85       9.790   9.500  15.610  1.00  0.62           N  
ATOM    628  CA  ASP A  85      10.544   9.541  16.848  1.00  0.62           C  
ATOM    629  C   ASP A  85      11.768   8.644  16.801  1.00  0.62           C  
ATOM    630  O   ASP A  85      12.809   8.924  17.393  1.00  0.62           O  
ATOM    631  CB  ASP A  85       9.655   9.107  18.043  1.00  0.62           C  
ATOM    632  CG  ASP A  85       8.380   9.912  18.045  1.00  0.62           C  
ATOM    633  OD1 ASP A  85       8.325  11.038  18.588  1.00  0.62           O  
ATOM    634  OD2 ASP A  85       7.413   9.446  17.382  1.00  0.62           O  
ATOM    635  N   ARG A  86      11.640   7.507  16.091  1.00  0.62           N  
ATOM    636  CA  ARG A  86      12.679   6.516  16.027  1.00  0.62           C  
ATOM    637  C   ARG A  86      12.881   6.041  14.604  1.00  0.62           C  
ATOM    638  O   ARG A  86      11.934   5.858  13.838  1.00  0.62           O  
ATOM    639  CB  ARG A  86      12.330   5.332  16.956  1.00  0.62           C  
ATOM    640  CG  ARG A  86      13.552   4.541  17.456  1.00  0.62           C  
ATOM    641  CD  ARG A  86      13.205   3.472  18.497  1.00  0.62           C  
ATOM    642  NE  ARG A  86      12.530   2.366  17.761  1.00  0.62           N  
ATOM    643  CZ  ARG A  86      11.979   1.295  18.325  1.00  0.62           C  
ATOM    644  NH1 ARG A  86      11.836   1.174  19.634  1.00  0.62           N  
ATOM    645  NH2 ARG A  86      11.565   0.296  17.554  1.00  0.62           N  
ATOM    646  N   LEU A  87      14.148   5.833  14.213  1.00  0.71           N  
ATOM    647  CA  LEU A  87      14.505   5.325  12.908  1.00  0.71           C  
ATOM    648  C   LEU A  87      15.198   3.990  13.109  1.00  0.71           C  
ATOM    649  O   LEU A  87      16.265   3.917  13.717  1.00  0.71           O  
ATOM    650  CB  LEU A  87      15.460   6.289  12.155  1.00  0.71           C  
ATOM    651  CG  LEU A  87      14.928   7.724  11.943  1.00  0.71           C  
ATOM    652  CD1 LEU A  87      15.998   8.599  11.273  1.00  0.71           C  
ATOM    653  CD2 LEU A  87      13.631   7.769  11.124  1.00  0.71           C  
ATOM    654  N   LEU A  88      14.587   2.897  12.617  1.00  0.70           N  
ATOM    655  CA  LEU A  88      15.083   1.549  12.797  1.00  0.70           C  
ATOM    656  C   LEU A  88      15.436   0.966  11.448  1.00  0.70           C  
ATOM    657  O   LEU A  88      14.589   0.794  10.571  1.00  0.70           O  
ATOM    658  CB  LEU A  88      14.006   0.649  13.463  1.00  0.70           C  
ATOM    659  CG  LEU A  88      14.367  -0.848  13.611  1.00  0.70           C  
ATOM    660  CD1 LEU A  88      15.587  -1.060  14.519  1.00  0.70           C  
ATOM    661  CD2 LEU A  88      13.170  -1.661  14.131  1.00  0.70           C  
ATOM    662  N   LEU A  89      16.718   0.626  11.248  1.00  0.70           N  
ATOM    663  CA  LEU A  89      17.149  -0.057  10.049  1.00  0.70           C  
ATOM    664  C   LEU A  89      17.170  -1.545  10.305  1.00  0.70           C  
ATOM    665  O   LEU A  89      17.767  -2.032  11.264  1.00  0.70           O  
ATOM    666  CB  LEU A  89      18.540   0.387   9.531  1.00  0.70           C  
ATOM    667  CG  LEU A  89      18.515   1.661   8.664  1.00  0.70           C  
ATOM    668  CD1 LEU A  89      17.875   2.850   9.391  1.00  0.70           C  
ATOM    669  CD2 LEU A  89      19.922   2.008   8.157  1.00  0.70           C  
ATOM    670  N   VAL A  90      16.515  -2.310   9.421  1.00  0.68           N  
ATOM    671  CA  VAL A  90      16.655  -3.750   9.380  1.00  0.68           C  
ATOM    672  C   VAL A  90      17.603  -4.040   8.235  1.00  0.68           C  
ATOM    673  O   VAL A  90      17.238  -3.973   7.060  1.00  0.68           O  
ATOM    674  CB  VAL A  90      15.326  -4.472   9.209  1.00  0.68           C  
ATOM    675  CG1 VAL A  90      15.540  -5.999   9.254  1.00  0.68           C  
ATOM    676  CG2 VAL A  90      14.370  -4.039  10.341  1.00  0.68           C  
ATOM    677  N   ASP A  91      18.872  -4.328   8.569  1.00  0.59           N  
ATOM    678  CA  ASP A  91      19.934  -4.490   7.615  1.00  0.59           C  
ATOM    679  C   ASP A  91      20.056  -5.958   7.284  1.00  0.59           C  
ATOM    680  O   ASP A  91      20.201  -6.802   8.168  1.00  0.59           O  
ATOM    681  CB  ASP A  91      21.253  -3.948   8.222  1.00  0.59           C  
ATOM    682  CG  ASP A  91      22.377  -4.075   7.232  1.00  0.59           C  
ATOM    683  OD1 ASP A  91      22.276  -3.238   6.308  1.00  0.59           O  
ATOM    684  OD2 ASP A  91      23.278  -4.942   7.310  1.00  0.59           O  
ATOM    685  N   ALA A  92      19.999  -6.289   5.985  1.00  0.59           N  
ATOM    686  CA  ALA A  92      20.047  -7.652   5.518  1.00  0.59           C  
ATOM    687  C   ALA A  92      21.466  -8.098   5.186  1.00  0.59           C  
ATOM    688  O   ALA A  92      21.666  -8.904   4.279  1.00  0.59           O  
ATOM    689  CB  ALA A  92      19.114  -7.806   4.303  1.00  0.59           C  
ATOM    690  N   GLU A  93      22.457  -7.553   5.925  1.00  0.48           N  
ATOM    691  CA  GLU A  93      23.876  -7.810   5.785  1.00  0.48           C  
ATOM    692  C   GLU A  93      24.513  -7.003   4.663  1.00  0.48           C  
ATOM    693  O   GLU A  93      25.148  -7.547   3.763  1.00  0.48           O  
ATOM    694  CB  GLU A  93      24.286  -9.311   5.786  1.00  0.48           C  
ATOM    695  CG  GLU A  93      23.811 -10.086   7.044  1.00  0.48           C  
ATOM    696  CD  GLU A  93      24.058 -11.592   6.963  1.00  0.48           C  
ATOM    697  OE1 GLU A  93      24.785 -12.109   7.851  1.00  0.48           O  
ATOM    698  OE2 GLU A  93      23.469 -12.253   6.066  1.00  0.48           O  
ATOM    699  N   SER A  94      24.379  -5.660   4.710  1.00  0.56           N  
ATOM    700  CA  SER A  94      25.006  -4.768   3.735  1.00  0.56           C  
ATOM    701  C   SER A  94      26.515  -4.861   3.675  1.00  0.56           C  
ATOM    702  O   SER A  94      27.193  -4.870   4.703  1.00  0.56           O  
ATOM    703  CB  SER A  94      24.671  -3.298   3.988  1.00  0.56           C  
ATOM    704  OG  SER A  94      23.304  -3.109   3.890  1.00  0.56           O  
ATOM    705  N   GLU A  95      27.090  -4.922   2.461  1.00  0.49           N  
ATOM    706  CA  GLU A  95      28.522  -5.104   2.286  1.00  0.49           C  
ATOM    707  C   GLU A  95      29.203  -3.787   1.926  1.00  0.49           C  
ATOM    708  O   GLU A  95      30.430  -3.671   1.965  1.00  0.49           O  
ATOM    709  CB  GLU A  95      28.822  -6.150   1.177  1.00  0.49           C  
ATOM    710  CG  GLU A  95      28.364  -7.600   1.502  1.00  0.49           C  
ATOM    711  CD  GLU A  95      28.812  -8.630   0.458  1.00  0.49           C  
ATOM    712  OE1 GLU A  95      28.399  -9.812   0.593  1.00  0.49           O  
ATOM    713  OE2 GLU A  95      29.596  -8.270  -0.460  1.00  0.49           O  
ATOM    714  N   ASP A  96      28.412  -2.745   1.593  1.00  0.50           N  
ATOM    715  CA  ASP A  96      28.888  -1.430   1.209  1.00  0.50           C  
ATOM    716  C   ASP A  96      29.119  -0.471   2.391  1.00  0.50           C  
ATOM    717  O   ASP A  96      29.462  -0.892   3.499  1.00  0.50           O  
ATOM    718  CB  ASP A  96      27.944  -0.846   0.115  1.00  0.50           C  
ATOM    719  CG  ASP A  96      26.579  -0.415   0.599  1.00  0.50           C  
ATOM    720  OD1 ASP A  96      26.313  -0.576   1.817  1.00  0.50           O  
ATOM    721  OD2 ASP A  96      25.769   0.134  -0.184  1.00  0.50           O  
ATOM    722  N   THR A  97      28.927   0.866   2.205  1.00  0.62           N  
ATOM    723  CA  THR A  97      28.976   1.831   3.302  1.00  0.62           C  
ATOM    724  C   THR A  97      27.620   2.236   3.856  1.00  0.62           C  
ATOM    725  O   THR A  97      27.541   3.145   4.678  1.00  0.62           O  
ATOM    726  CB  THR A  97      29.891   3.071   3.105  1.00  0.62           C  
ATOM    727  OG1 THR A  97      29.509   4.009   2.150  1.00  0.62           O  
ATOM    728  CG2 THR A  97      31.259   2.629   2.630  1.00  0.62           C  
ATOM    729  N   THR A  98      26.505   1.530   3.526  1.00  0.61           N  
ATOM    730  CA  THR A  98      25.112   1.828   3.916  1.00  0.61           C  
ATOM    731  C   THR A  98      24.914   2.191   5.372  1.00  0.61           C  
ATOM    732  O   THR A  98      24.357   3.238   5.699  1.00  0.61           O  
ATOM    733  CB  THR A  98      24.148   0.669   3.624  1.00  0.61           C  
ATOM    734  OG1 THR A  98      24.026   0.430   2.238  1.00  0.61           O  
ATOM    735  CG2 THR A  98      22.704   0.966   4.064  1.00  0.61           C  
ATOM    736  N   LEU A  99      25.409   1.358   6.304  1.00  0.58           N  
ATOM    737  CA  LEU A  99      25.346   1.622   7.729  1.00  0.58           C  
ATOM    738  C   LEU A  99      26.129   2.857   8.149  1.00  0.58           C  
ATOM    739  O   LEU A  99      25.705   3.610   9.023  1.00  0.58           O  
ATOM    740  CB  LEU A  99      25.823   0.397   8.543  1.00  0.58           C  
ATOM    741  CG  LEU A  99      24.962  -0.872   8.368  1.00  0.58           C  
ATOM    742  CD1 LEU A  99      25.513  -2.010   9.241  1.00  0.58           C  
ATOM    743  CD2 LEU A  99      23.481  -0.633   8.704  1.00  0.58           C  
ATOM    744  N   GLY A 100      27.285   3.125   7.509  1.00  0.62           N  
ATOM    745  CA  GLY A 100      28.072   4.325   7.767  1.00  0.62           C  
ATOM    746  C   GLY A 100      27.399   5.576   7.273  1.00  0.62           C  
ATOM    747  O   GLY A 100      27.319   6.573   7.985  1.00  0.62           O  
ATOM    748  N   THR A 101      26.834   5.526   6.055  1.00  0.63           N  
ATOM    749  CA  THR A 101      26.033   6.598   5.474  1.00  0.63           C  
ATOM    750  C   THR A 101      24.797   6.897   6.285  1.00  0.63           C  
ATOM    751  O   THR A 101      24.459   8.053   6.518  1.00  0.63           O  
ATOM    752  CB  THR A 101      25.618   6.294   4.045  1.00  0.63           C  
ATOM    753  OG1 THR A 101      26.787   6.164   3.255  1.00  0.63           O  
ATOM    754  CG2 THR A 101      24.804   7.446   3.437  1.00  0.63           C  
ATOM    755  N   ALA A 102      24.093   5.858   6.775  1.00  0.65           N  
ATOM    756  CA  ALA A 102      22.935   6.019   7.622  1.00  0.65           C  
ATOM    757  C   ALA A 102      23.218   6.744   8.934  1.00  0.65           C  
ATOM    758  O   ALA A 102      22.509   7.681   9.293  1.00  0.65           O  
ATOM    759  CB  ALA A 102      22.334   4.630   7.906  1.00  0.65           C  
ATOM    760  N   ARG A 103      24.302   6.361   9.641  1.00  0.56           N  
ATOM    761  CA  ARG A 103      24.744   7.002  10.869  1.00  0.56           C  
ATOM    762  C   ARG A 103      25.151   8.450  10.684  1.00  0.56           C  
ATOM    763  O   ARG A 103      24.824   9.306  11.495  1.00  0.56           O  
ATOM    764  CB  ARG A 103      25.933   6.232  11.483  1.00  0.56           C  
ATOM    765  CG  ARG A 103      25.563   4.835  12.014  1.00  0.56           C  
ATOM    766  CD  ARG A 103      26.799   4.060  12.468  1.00  0.56           C  
ATOM    767  NE  ARG A 103      26.352   2.683  12.845  1.00  0.56           N  
ATOM    768  CZ  ARG A 103      27.187   1.652  13.017  1.00  0.56           C  
ATOM    769  NH1 ARG A 103      28.509   1.812  12.958  1.00  0.56           N  
ATOM    770  NH2 ARG A 103      26.684   0.441  13.248  1.00  0.56           N  
ATOM    771  N   SER A 104      25.864   8.768   9.591  1.00  0.63           N  
ATOM    772  CA  SER A 104      26.304  10.129   9.321  1.00  0.63           C  
ATOM    773  C   SER A 104      25.204  11.027   8.780  1.00  0.63           C  
ATOM    774  O   SER A 104      25.353  12.245   8.728  1.00  0.63           O  
ATOM    775  CB  SER A 104      27.459  10.162   8.291  1.00  0.63           C  
ATOM    776  OG  SER A 104      28.603   9.469   8.793  1.00  0.63           O  
ATOM    777  N   ALA A 105      24.069  10.459   8.329  1.00  0.61           N  
ATOM    778  CA  ALA A 105      22.995  11.215   7.725  1.00  0.61           C  
ATOM    779  C   ALA A 105      22.037  11.884   8.698  1.00  0.61           C  
ATOM    780  O   ALA A 105      21.406  12.884   8.346  1.00  0.61           O  
ATOM    781  CB  ALA A 105      22.177  10.274   6.821  1.00  0.61           C  
ATOM    782  N   VAL A 106      21.899  11.347   9.924  1.00  0.56           N  
ATOM    783  CA  VAL A 106      20.930  11.801  10.905  1.00  0.56           C  
ATOM    784  C   VAL A 106      21.539  11.700  12.292  1.00  0.56           C  
ATOM    785  O   VAL A 106      22.511  10.991  12.514  1.00  0.56           O  
ATOM    786  CB  VAL A 106      19.613  11.010  10.901  1.00  0.56           C  
ATOM    787  CG1 VAL A 106      18.832  11.263   9.597  1.00  0.56           C  
ATOM    788  CG2 VAL A 106      19.877   9.502  11.085  1.00  0.56           C  
ATOM    789  N   ALA A 107      20.984  12.431  13.283  1.00  0.37           N  
ATOM    790  CA  ALA A 107      21.502  12.465  14.641  1.00  0.37           C  
ATOM    791  C   ALA A 107      21.459  11.145  15.411  1.00  0.37           C  
ATOM    792  O   ALA A 107      22.352  10.843  16.197  1.00  0.37           O  
ATOM    793  CB  ALA A 107      20.741  13.529  15.456  1.00  0.37           C  
ATOM    794  N   HIS A 108      20.393  10.344  15.226  1.00  0.49           N  
ATOM    795  CA  HIS A 108      20.254   9.064  15.890  1.00  0.49           C  
ATOM    796  C   HIS A 108      19.581   8.110  14.931  1.00  0.49           C  
ATOM    797  O   HIS A 108      18.612   8.461  14.258  1.00  0.49           O  
ATOM    798  CB  HIS A 108      19.447   9.155  17.216  1.00  0.49           C  
ATOM    799  CG  HIS A 108      19.299   7.852  17.957  1.00  0.49           C  
ATOM    800  ND1 HIS A 108      20.386   7.009  18.056  1.00  0.49           N  
ATOM    801  CD2 HIS A 108      18.207   7.279  18.534  1.00  0.49           C  
ATOM    802  CE1 HIS A 108      19.937   5.938  18.684  1.00  0.49           C  
ATOM    803  NE2 HIS A 108      18.623   6.048  18.996  1.00  0.49           N  
ATOM    804  N   VAL A 109      20.110   6.883  14.827  1.00  0.67           N  
ATOM    805  CA  VAL A 109      19.534   5.832  14.021  1.00  0.67           C  
ATOM    806  C   VAL A 109      19.904   4.514  14.667  1.00  0.67           C  
ATOM    807  O   VAL A 109      21.042   4.299  15.085  1.00  0.67           O  
ATOM    808  CB  VAL A 109      19.946   5.905  12.546  1.00  0.67           C  
ATOM    809  CG1 VAL A 109      21.471   5.796  12.360  1.00  0.67           C  
ATOM    810  CG2 VAL A 109      19.202   4.859  11.701  1.00  0.67           C  
ATOM    811  N   GLU A 110      18.935   3.593  14.786  1.00  0.68           N  
ATOM    812  CA  GLU A 110      19.140   2.284  15.363  1.00  0.68           C  
ATOM    813  C   GLU A 110      19.218   1.291  14.221  1.00  0.68           C  
ATOM    814  O   GLU A 110      18.587   1.460  13.176  1.00  0.68           O  
ATOM    815  CB  GLU A 110      17.995   1.912  16.341  1.00  0.68           C  
ATOM    816  CG  GLU A 110      17.870   2.905  17.529  1.00  0.68           C  
ATOM    817  CD  GLU A 110      16.605   2.760  18.366  1.00  0.68           C  
ATOM    818  OE1 GLU A 110      16.476   3.548  19.346  1.00  0.68           O  
ATOM    819  OE2 GLU A 110      15.732   1.911  18.025  1.00  0.68           O  
ATOM    820  N   HIS A 111      20.019   0.220  14.358  1.00  0.68           N  
ATOM    821  CA  HIS A 111      20.121  -0.779  13.315  1.00  0.68           C  
ATOM    822  C   HIS A 111      20.116  -2.157  13.929  1.00  0.68           C  
ATOM    823  O   HIS A 111      20.736  -2.403  14.960  1.00  0.68           O  
ATOM    824  CB  HIS A 111      21.360  -0.602  12.377  1.00  0.68           C  
ATOM    825  CG  HIS A 111      22.682  -1.072  12.925  1.00  0.68           C  
ATOM    826  ND1 HIS A 111      23.474  -0.262  13.730  1.00  0.68           N  
ATOM    827  CD2 HIS A 111      23.134  -2.349  12.962  1.00  0.68           C  
ATOM    828  CE1 HIS A 111      24.359  -1.081  14.262  1.00  0.68           C  
ATOM    829  NE2 HIS A 111      24.202  -2.349  13.826  1.00  0.68           N  
ATOM    830  N   VAL A 112      19.403  -3.100  13.294  1.00  0.69           N  
ATOM    831  CA  VAL A 112      19.469  -4.505  13.639  1.00  0.69           C  
ATOM    832  C   VAL A 112      19.927  -5.232  12.392  1.00  0.69           C  
ATOM    833  O   VAL A 112      19.334  -5.107  11.321  1.00  0.69           O  
ATOM    834  CB  VAL A 112      18.138  -5.073  14.126  1.00  0.69           C  
ATOM    835  CG1 VAL A 112      18.230  -6.593  14.371  1.00  0.69           C  
ATOM    836  CG2 VAL A 112      17.729  -4.380  15.440  1.00  0.69           C  
ATOM    837  N   THR A 113      21.026  -6.002  12.504  1.00  0.61           N  
ATOM    838  CA  THR A 113      21.562  -6.803  11.410  1.00  0.61           C  
ATOM    839  C   THR A 113      20.932  -8.172  11.450  1.00  0.61           C  
ATOM    840  O   THR A 113      20.919  -8.829  12.489  1.00  0.61           O  
ATOM    841  CB  THR A 113      23.077  -6.999  11.456  1.00  0.61           C  
ATOM    842  OG1 THR A 113      23.739  -5.754  11.548  1.00  0.61           O  
ATOM    843  CG2 THR A 113      23.602  -7.656  10.173  1.00  0.61           C  
ATOM    844  N   ARG A 114      20.369  -8.642  10.325  1.00  0.49           N  
ATOM    845  CA  ARG A 114      19.778  -9.961  10.252  1.00  0.49           C  
ATOM    846  C   ARG A 114      20.057 -10.587   8.913  1.00  0.49           C  
ATOM    847  O   ARG A 114      19.872  -9.961   7.878  1.00  0.49           O  
ATOM    848  CB  ARG A 114      18.236  -9.937  10.378  1.00  0.49           C  
ATOM    849  CG  ARG A 114      17.740  -9.599  11.790  1.00  0.49           C  
ATOM    850  CD  ARG A 114      16.222  -9.660  11.939  1.00  0.49           C  
ATOM    851  NE  ARG A 114      15.801 -11.098  11.849  1.00  0.49           N  
ATOM    852  CZ  ARG A 114      14.941 -11.583  10.947  1.00  0.49           C  
ATOM    853  NH1 ARG A 114      14.593 -10.932   9.849  1.00  0.49           N  
ATOM    854  NH2 ARG A 114      14.398 -12.780  11.155  1.00  0.49           N  
ATOM    855  N   ALA A 115      20.461 -11.869   8.895  1.00  0.53           N  
ATOM    856  CA  ALA A 115      20.700 -12.585   7.664  1.00  0.53           C  
ATOM    857  C   ALA A 115      19.517 -12.677   6.713  1.00  0.53           C  
ATOM    858  O   ALA A 115      18.364 -12.838   7.120  1.00  0.53           O  
ATOM    859  CB  ALA A 115      21.231 -14.001   7.956  1.00  0.53           C  
ATOM    860  N   TRP A 116      19.777 -12.562   5.396  1.00  0.38           N  
ATOM    861  CA  TRP A 116      18.759 -12.763   4.379  1.00  0.38           C  
ATOM    862  C   TRP A 116      18.363 -14.234   4.244  1.00  0.38           C  
ATOM    863  O   TRP A 116      19.155 -15.092   3.867  1.00  0.38           O  
ATOM    864  CB  TRP A 116      19.181 -12.155   3.012  1.00  0.38           C  
ATOM    865  CG  TRP A 116      18.243 -12.427   1.837  1.00  0.38           C  
ATOM    866  CD1 TRP A 116      18.427 -13.320   0.818  1.00  0.38           C  
ATOM    867  CD2 TRP A 116      16.908 -11.930   1.703  1.00  0.38           C  
ATOM    868  NE1 TRP A 116      17.296 -13.395   0.042  1.00  0.38           N  
ATOM    869  CE2 TRP A 116      16.353 -12.543   0.545  1.00  0.38           C  
ATOM    870  CE3 TRP A 116      16.161 -11.014   2.440  1.00  0.38           C  
ATOM    871  CZ2 TRP A 116      15.066 -12.269   0.143  1.00  0.38           C  
ATOM    872  CZ3 TRP A 116      14.839 -10.776   2.052  1.00  0.38           C  
ATOM    873  CH2 TRP A 116      14.305 -11.380   0.906  1.00  0.38           C  
ATOM    874  N   THR A 117      17.090 -14.559   4.539  1.00  0.44           N  
ATOM    875  CA  THR A 117      16.619 -15.936   4.640  1.00  0.44           C  
ATOM    876  C   THR A 117      15.677 -16.326   3.517  1.00  0.44           C  
ATOM    877  O   THR A 117      14.948 -17.315   3.624  1.00  0.44           O  
ATOM    878  CB  THR A 117      15.891 -16.199   5.955  1.00  0.44           C  
ATOM    879  OG1 THR A 117      14.889 -15.218   6.211  1.00  0.44           O  
ATOM    880  CG2 THR A 117      16.904 -16.140   7.106  1.00  0.44           C  
ATOM    881  N   ASP A 118      15.672 -15.560   2.405  1.00  0.39           N  
ATOM    882  CA  ASP A 118      14.724 -15.698   1.313  1.00  0.39           C  
ATOM    883  C   ASP A 118      13.285 -15.439   1.731  1.00  0.39           C  
ATOM    884  O   ASP A 118      12.357 -16.214   1.473  1.00  0.39           O  
ATOM    885  CB  ASP A 118      14.921 -17.012   0.511  1.00  0.39           C  
ATOM    886  CG  ASP A 118      16.026 -16.929  -0.532  1.00  0.39           C  
ATOM    887  OD1 ASP A 118      16.384 -15.812  -0.990  1.00  0.39           O  
ATOM    888  OD2 ASP A 118      16.464 -18.013  -1.005  1.00  0.39           O  
ATOM    889  N   ASP A 119      13.081 -14.285   2.391  1.00  0.40           N  
ATOM    890  CA  ASP A 119      11.801 -13.933   2.939  1.00  0.40           C  
ATOM    891  C   ASP A 119      11.738 -12.444   3.283  1.00  0.40           C  
ATOM    892  O   ASP A 119      12.345 -11.961   4.243  1.00  0.40           O  
ATOM    893  CB  ASP A 119      11.584 -14.820   4.183  1.00  0.40           C  
ATOM    894  CG  ASP A 119      10.148 -14.854   4.645  1.00  0.40           C  
ATOM    895  OD1 ASP A 119       9.456 -13.812   4.544  1.00  0.40           O  
ATOM    896  OD2 ASP A 119       9.737 -15.934   5.131  1.00  0.40           O  
ATOM    897  N   PHE A 120      10.992 -11.664   2.469  1.00  0.37           N  
ATOM    898  CA  PHE A 120      10.738 -10.256   2.711  1.00  0.37           C  
ATOM    899  C   PHE A 120       9.862 -10.031   3.937  1.00  0.37           C  
ATOM    900  O   PHE A 120      10.110  -9.127   4.739  1.00  0.37           O  
ATOM    901  CB  PHE A 120      10.132  -9.557   1.464  1.00  0.37           C  
ATOM    902  CG  PHE A 120      11.165  -9.324   0.389  1.00  0.37           C  
ATOM    903  CD1 PHE A 120      12.101  -8.287   0.534  1.00  0.37           C  
ATOM    904  CD2 PHE A 120      11.198 -10.095  -0.786  1.00  0.37           C  
ATOM    905  CE1 PHE A 120      13.065  -8.042  -0.454  1.00  0.37           C  
ATOM    906  CE2 PHE A 120      12.162  -9.857  -1.776  1.00  0.37           C  
ATOM    907  CZ  PHE A 120      13.100  -8.833  -1.607  1.00  0.37           C  
ATOM    908  N   ALA A 121       8.841 -10.887   4.145  1.00  0.56           N  
ATOM    909  CA  ALA A 121       7.962 -10.839   5.289  1.00  0.56           C  
ATOM    910  C   ALA A 121       8.687 -11.069   6.604  1.00  0.56           C  
ATOM    911  O   ALA A 121       8.499 -10.331   7.568  1.00  0.56           O  
ATOM    912  CB  ALA A 121       6.834 -11.867   5.113  1.00  0.56           C  
ATOM    913  N   ALA A 122       9.597 -12.053   6.662  1.00  0.59           N  
ATOM    914  CA  ALA A 122      10.453 -12.298   7.802  1.00  0.59           C  
ATOM    915  C   ALA A 122      11.377 -11.139   8.152  1.00  0.59           C  
ATOM    916  O   ALA A 122      11.685 -10.901   9.320  1.00  0.59           O  
ATOM    917  CB  ALA A 122      11.287 -13.564   7.574  1.00  0.59           C  
ATOM    918  N   GLN A 123      11.876 -10.383   7.156  1.00  0.59           N  
ATOM    919  CA  GLN A 123      12.594  -9.149   7.422  1.00  0.59           C  
ATOM    920  C   GLN A 123      11.722  -8.044   7.991  1.00  0.59           C  
ATOM    921  O   GLN A 123      12.072  -7.420   8.991  1.00  0.59           O  
ATOM    922  CB  GLN A 123      13.362  -8.657   6.177  1.00  0.59           C  
ATOM    923  CG  GLN A 123      14.510  -9.592   5.722  1.00  0.59           C  
ATOM    924  CD  GLN A 123      15.640  -9.743   6.748  1.00  0.59           C  
ATOM    925  OE1 GLN A 123      15.626  -9.246   7.876  1.00  0.59           O  
ATOM    926  NE2 GLN A 123      16.670 -10.515   6.338  1.00  0.59           N  
ATOM    927  N   ARG A 124      10.527  -7.812   7.416  1.00  0.57           N  
ATOM    928  CA  ARG A 124       9.578  -6.841   7.931  1.00  0.57           C  
ATOM    929  C   ARG A 124       9.044  -7.174   9.319  1.00  0.57           C  
ATOM    930  O   ARG A 124       8.914  -6.299  10.175  1.00  0.57           O  
ATOM    931  CB  ARG A 124       8.406  -6.638   6.948  1.00  0.57           C  
ATOM    932  CG  ARG A 124       8.815  -5.998   5.608  1.00  0.57           C  
ATOM    933  CD  ARG A 124       7.608  -5.594   4.756  1.00  0.57           C  
ATOM    934  NE  ARG A 124       8.077  -5.025   3.462  1.00  0.57           N  
ATOM    935  CZ  ARG A 124       8.512  -3.778   3.249  1.00  0.57           C  
ATOM    936  NH1 ARG A 124       8.697  -2.896   4.224  1.00  0.57           N  
ATOM    937  NH2 ARG A 124       8.775  -3.409   2.002  1.00  0.57           N  
ATOM    938  N   ASN A 125       8.753  -8.461   9.591  1.00  0.64           N  
ATOM    939  CA  ASN A 125       8.244  -8.928  10.868  1.00  0.64           C  
ATOM    940  C   ASN A 125       9.221  -8.764  12.035  1.00  0.64           C  
ATOM    941  O   ASN A 125       8.799  -8.596  13.176  1.00  0.64           O  
ATOM    942  CB  ASN A 125       7.736 -10.391  10.772  1.00  0.64           C  
ATOM    943  CG  ASN A 125       6.424 -10.435   9.989  1.00  0.64           C  
ATOM    944  OD1 ASN A 125       5.600  -9.517  10.045  1.00  0.64           O  
ATOM    945  ND2 ASN A 125       6.182 -11.556   9.271  1.00  0.64           N  
ATOM    946  N   ALA A 126      10.546  -8.739  11.780  1.00  0.69           N  
ATOM    947  CA  ALA A 126      11.574  -8.527  12.784  1.00  0.69           C  
ATOM    948  C   ALA A 126      11.486  -7.181  13.498  1.00  0.69           C  
ATOM    949  O   ALA A 126      11.883  -7.011  14.649  1.00  0.69           O  
ATOM    950  CB  ALA A 126      12.940  -8.646  12.095  1.00  0.69           C  
ATOM    951  N   ALA A 127      10.924  -6.167  12.820  1.00  0.67           N  
ATOM    952  CA  ALA A 127      10.715  -4.857  13.379  1.00  0.67           C  
ATOM    953  C   ALA A 127       9.710  -4.813  14.523  1.00  0.67           C  
ATOM    954  O   ALA A 127       9.807  -3.966  15.410  1.00  0.67           O  
ATOM    955  CB  ALA A 127      10.284  -3.929  12.244  1.00  0.67           C  
ATOM    956  N   PHE A 128       8.742  -5.752  14.554  1.00  0.51           N  
ATOM    957  CA  PHE A 128       7.771  -5.886  15.625  1.00  0.51           C  
ATOM    958  C   PHE A 128       8.415  -6.235  16.961  1.00  0.51           C  
ATOM    959  O   PHE A 128       8.006  -5.728  18.000  1.00  0.51           O  
ATOM    960  CB  PHE A 128       6.675  -6.925  15.284  1.00  0.51           C  
ATOM    961  CG  PHE A 128       5.717  -6.406  14.243  1.00  0.51           C  
ATOM    962  CD1 PHE A 128       4.497  -5.818  14.619  1.00  0.51           C  
ATOM    963  CD2 PHE A 128       5.999  -6.545  12.876  1.00  0.51           C  
ATOM    964  CE1 PHE A 128       3.567  -5.413  13.652  1.00  0.51           C  
ATOM    965  CE2 PHE A 128       5.073  -6.150  11.904  1.00  0.51           C  
ATOM    966  CZ  PHE A 128       3.852  -5.590  12.293  1.00  0.51           C  
ATOM    967  N   GLU A 129       9.478  -7.067  16.964  1.00  0.62           N  
ATOM    968  CA  GLU A 129      10.222  -7.456  18.151  1.00  0.62           C  
ATOM    969  C   GLU A 129      10.979  -6.295  18.777  1.00  0.62           C  
ATOM    970  O   GLU A 129      11.279  -6.280  19.967  1.00  0.62           O  
ATOM    971  CB  GLU A 129      11.246  -8.550  17.777  1.00  0.62           C  
ATOM    972  CG  GLU A 129      10.610  -9.856  17.239  1.00  0.62           C  
ATOM    973  CD  GLU A 129      11.645 -10.811  16.637  1.00  0.62           C  
ATOM    974  OE1 GLU A 129      11.216 -11.903  16.185  1.00  0.62           O  
ATOM    975  OE2 GLU A 129      12.852 -10.453  16.585  1.00  0.62           O  
ATOM    976  N   GLN A 130      11.288  -5.267  17.964  1.00  0.67           N  
ATOM    977  CA  GLN A 130      12.010  -4.097  18.406  1.00  0.67           C  
ATOM    978  C   GLN A 130      11.073  -2.943  18.686  1.00  0.67           C  
ATOM    979  O   GLN A 130      11.476  -1.864  19.126  1.00  0.67           O  
ATOM    980  CB  GLN A 130      12.961  -3.633  17.279  1.00  0.67           C  
ATOM    981  CG  GLN A 130      13.915  -4.735  16.768  1.00  0.67           C  
ATOM    982  CD  GLN A 130      14.815  -5.254  17.888  1.00  0.67           C  
ATOM    983  OE1 GLN A 130      15.410  -4.487  18.644  1.00  0.67           O  
ATOM    984  NE2 GLN A 130      14.941  -6.597  17.993  1.00  0.67           N  
ATOM    985  N   ALA A 131       9.780  -3.112  18.388  1.00  0.64           N  
ATOM    986  CA  ALA A 131       8.777  -2.093  18.513  1.00  0.64           C  
ATOM    987  C   ALA A 131       8.497  -1.662  19.945  1.00  0.64           C  
ATOM    988  O   ALA A 131       8.630  -2.424  20.896  1.00  0.64           O  
ATOM    989  CB  ALA A 131       7.503  -2.550  17.801  1.00  0.64           C  
ATOM    990  N   ARG A 132       8.105  -0.389  20.140  1.00  0.56           N  
ATOM    991  CA  ARG A 132       7.736   0.114  21.446  1.00  0.56           C  
ATOM    992  C   ARG A 132       6.212   0.077  21.542  1.00  0.56           C  
ATOM    993  O   ARG A 132       5.579   0.753  20.726  1.00  0.56           O  
ATOM    994  CB  ARG A 132       8.282   1.556  21.623  1.00  0.56           C  
ATOM    995  CG  ARG A 132       8.131   2.178  23.032  1.00  0.56           C  
ATOM    996  CD  ARG A 132       8.857   3.529  23.167  1.00  0.56           C  
ATOM    997  NE  ARG A 132       8.632   4.037  24.563  1.00  0.56           N  
ATOM    998  CZ  ARG A 132       9.134   5.186  25.044  1.00  0.56           C  
ATOM    999  NH1 ARG A 132       8.863   5.543  26.299  1.00  0.56           N  
ATOM   1000  NH2 ARG A 132       9.903   5.984  24.308  1.00  0.56           N  
ATOM   1001  N   PRO A 133       5.574  -0.696  22.431  1.00  0.47           N  
ATOM   1002  CA  PRO A 133       4.124  -0.716  22.630  1.00  0.47           C  
ATOM   1003  C   PRO A 133       3.430   0.634  22.686  1.00  0.47           C  
ATOM   1004  O   PRO A 133       3.974   1.570  23.271  1.00  0.47           O  
ATOM   1005  CB  PRO A 133       3.934  -1.540  23.912  1.00  0.47           C  
ATOM   1006  CG  PRO A 133       5.101  -2.530  23.889  1.00  0.47           C  
ATOM   1007  CD  PRO A 133       6.232  -1.737  23.229  1.00  0.47           C  
ATOM   1008  N   GLY A 134       2.230   0.753  22.078  1.00  0.36           N  
ATOM   1009  CA  GLY A 134       1.457   1.990  22.088  1.00  0.36           C  
ATOM   1010  C   GLY A 134       1.858   2.985  21.033  1.00  0.36           C  
ATOM   1011  O   GLY A 134       1.589   4.176  21.164  1.00  0.36           O  
ATOM   1012  N   GLY A 135       2.543   2.534  19.967  1.00  0.69           N  
ATOM   1013  CA  GLY A 135       2.989   3.400  18.889  1.00  0.69           C  
ATOM   1014  C   GLY A 135       2.676   2.834  17.537  1.00  0.69           C  
ATOM   1015  O   GLY A 135       1.899   1.896  17.379  1.00  0.69           O  
ATOM   1016  N   TRP A 136       3.312   3.402  16.505  1.00  0.62           N  
ATOM   1017  CA  TRP A 136       3.127   3.025  15.126  1.00  0.62           C  
ATOM   1018  C   TRP A 136       4.433   2.573  14.511  1.00  0.62           C  
ATOM   1019  O   TRP A 136       5.508   3.113  14.775  1.00  0.62           O  
ATOM   1020  CB  TRP A 136       2.587   4.199  14.278  1.00  0.62           C  
ATOM   1021  CG  TRP A 136       1.194   4.640  14.658  1.00  0.62           C  
ATOM   1022  CD1 TRP A 136       0.799   5.567  15.579  1.00  0.62           C  
ATOM   1023  CD2 TRP A 136      -0.011   4.134  14.059  1.00  0.62           C  
ATOM   1024  NE1 TRP A 136      -0.570   5.693  15.574  1.00  0.62           N  
ATOM   1025  CE2 TRP A 136      -1.082   4.823  14.641  1.00  0.62           C  
ATOM   1026  CE3 TRP A 136      -0.219   3.161  13.086  1.00  0.62           C  
ATOM   1027  CZ2 TRP A 136      -2.390   4.587  14.241  1.00  0.62           C  
ATOM   1028  CZ3 TRP A 136      -1.541   2.885  12.714  1.00  0.62           C  
ATOM   1029  CH2 TRP A 136      -2.610   3.593  13.275  1.00  0.62           C  
ATOM   1030  N   LEU A 137       4.355   1.555  13.641  1.00  0.65           N  
ATOM   1031  CA  LEU A 137       5.458   1.117  12.822  1.00  0.65           C  
ATOM   1032  C   LEU A 137       5.177   1.525  11.398  1.00  0.65           C  
ATOM   1033  O   LEU A 137       4.234   1.040  10.777  1.00  0.65           O  
ATOM   1034  CB  LEU A 137       5.631  -0.419  12.842  1.00  0.65           C  
ATOM   1035  CG  LEU A 137       5.971  -0.999  14.224  1.00  0.65           C  
ATOM   1036  CD1 LEU A 137       6.056  -2.527  14.147  1.00  0.65           C  
ATOM   1037  CD2 LEU A 137       7.273  -0.405  14.774  1.00  0.65           C  
ATOM   1038  N   ALA A 138       5.994   2.437  10.846  1.00  0.69           N  
ATOM   1039  CA  ALA A 138       5.861   2.881   9.481  1.00  0.69           C  
ATOM   1040  C   ALA A 138       6.933   2.244   8.619  1.00  0.69           C  
ATOM   1041  O   ALA A 138       8.114   2.571   8.712  1.00  0.69           O  
ATOM   1042  CB  ALA A 138       5.942   4.419   9.404  1.00  0.69           C  
ATOM   1043  N   HIS A 139       6.539   1.295   7.750  1.00  0.68           N  
ATOM   1044  CA  HIS A 139       7.465   0.590   6.883  1.00  0.68           C  
ATOM   1045  C   HIS A 139       7.759   1.397   5.632  1.00  0.68           C  
ATOM   1046  O   HIS A 139       6.864   1.709   4.848  1.00  0.68           O  
ATOM   1047  CB  HIS A 139       6.926  -0.803   6.485  1.00  0.68           C  
ATOM   1048  CG  HIS A 139       6.971  -1.790   7.611  1.00  0.68           C  
ATOM   1049  ND1 HIS A 139       7.907  -2.810   7.575  1.00  0.68           N  
ATOM   1050  CD2 HIS A 139       6.269  -1.830   8.776  1.00  0.68           C  
ATOM   1051  CE1 HIS A 139       7.760  -3.442   8.727  1.00  0.68           C  
ATOM   1052  NE2 HIS A 139       6.784  -2.890   9.489  1.00  0.68           N  
ATOM   1053  N   VAL A 140       9.037   1.758   5.431  1.00  0.69           N  
ATOM   1054  CA  VAL A 140       9.483   2.605   4.339  1.00  0.69           C  
ATOM   1055  C   VAL A 140      10.590   1.862   3.615  1.00  0.69           C  
ATOM   1056  O   VAL A 140      11.463   1.264   4.248  1.00  0.69           O  
ATOM   1057  CB  VAL A 140       9.981   3.961   4.849  1.00  0.69           C  
ATOM   1058  CG1 VAL A 140      10.380   4.885   3.683  1.00  0.69           C  
ATOM   1059  CG2 VAL A 140       8.878   4.637   5.690  1.00  0.69           C  
ATOM   1060  N   ASP A 141      10.570   1.829   2.269  1.00  0.70           N  
ATOM   1061  CA  ASP A 141      11.604   1.157   1.503  1.00  0.70           C  
ATOM   1062  C   ASP A 141      12.800   2.121   1.350  1.00  0.70           C  
ATOM   1063  O   ASP A 141      12.662   3.335   1.486  1.00  0.70           O  
ATOM   1064  CB  ASP A 141      11.022   0.575   0.179  1.00  0.70           C  
ATOM   1065  CG  ASP A 141       9.945  -0.485   0.402  1.00  0.70           C  
ATOM   1066  OD1 ASP A 141       9.912  -1.105   1.503  1.00  0.70           O  
ATOM   1067  OD2 ASP A 141       9.138  -0.741  -0.537  1.00  0.70           O  
ATOM   1068  N   ALA A 142      14.050   1.638   1.159  1.00  0.73           N  
ATOM   1069  CA  ALA A 142      15.238   2.475   1.334  1.00  0.73           C  
ATOM   1070  C   ALA A 142      15.450   3.522   0.250  1.00  0.73           C  
ATOM   1071  O   ALA A 142      16.124   4.532   0.465  1.00  0.73           O  
ATOM   1072  CB  ALA A 142      16.502   1.606   1.454  1.00  0.73           C  
ATOM   1073  N   ASP A 143      14.827   3.325  -0.916  1.00  0.63           N  
ATOM   1074  CA  ASP A 143      14.859   4.205  -2.046  1.00  0.63           C  
ATOM   1075  C   ASP A 143      13.641   5.130  -2.086  1.00  0.63           C  
ATOM   1076  O   ASP A 143      13.459   5.918  -3.020  1.00  0.63           O  
ATOM   1077  CB  ASP A 143      15.019   3.341  -3.329  1.00  0.63           C  
ATOM   1078  CG  ASP A 143      14.013   2.210  -3.533  1.00  0.63           C  
ATOM   1079  OD1 ASP A 143      13.407   1.696  -2.556  1.00  0.63           O  
ATOM   1080  OD2 ASP A 143      13.852   1.835  -4.728  1.00  0.63           O  
ATOM   1081  N   GLU A 144      12.809   5.109  -1.025  1.00  0.63           N  
ATOM   1082  CA  GLU A 144      11.695   6.013  -0.846  1.00  0.63           C  
ATOM   1083  C   GLU A 144      12.020   7.207   0.036  1.00  0.63           C  
ATOM   1084  O   GLU A 144      12.556   7.093   1.135  1.00  0.63           O  
ATOM   1085  CB  GLU A 144      10.490   5.299  -0.213  1.00  0.63           C  
ATOM   1086  CG  GLU A 144       9.887   4.249  -1.159  1.00  0.63           C  
ATOM   1087  CD  GLU A 144       8.791   3.439  -0.510  1.00  0.63           C  
ATOM   1088  OE1 GLU A 144       8.088   2.730  -1.275  1.00  0.63           O  
ATOM   1089  OE2 GLU A 144       8.623   3.459   0.742  1.00  0.63           O  
ATOM   1090  N   THR A 145      11.649   8.416  -0.420  1.00  0.64           N  
ATOM   1091  CA  THR A 145      11.873   9.656   0.321  1.00  0.64           C  
ATOM   1092  C   THR A 145      10.538  10.333   0.571  1.00  0.64           C  
ATOM   1093  O   THR A 145       9.771  10.558  -0.364  1.00  0.64           O  
ATOM   1094  CB  THR A 145      12.762  10.640  -0.438  1.00  0.64           C  
ATOM   1095  OG1 THR A 145      14.018  10.049  -0.735  1.00  0.64           O  
ATOM   1096  CG2 THR A 145      13.088  11.887   0.391  1.00  0.64           C  
ATOM   1097  N   LEU A 146      10.193  10.686   1.836  1.00  0.63           N  
ATOM   1098  CA  LEU A 146       8.988  11.456   2.153  1.00  0.63           C  
ATOM   1099  C   LEU A 146       8.987  12.822   1.469  1.00  0.63           C  
ATOM   1100  O   LEU A 146       9.996  13.528   1.466  1.00  0.63           O  
ATOM   1101  CB  LEU A 146       8.827  11.637   3.689  1.00  0.63           C  
ATOM   1102  CG  LEU A 146       7.525  12.322   4.165  1.00  0.63           C  
ATOM   1103  CD1 LEU A 146       6.291  11.453   3.903  1.00  0.63           C  
ATOM   1104  CD2 LEU A 146       7.583  12.670   5.660  1.00  0.63           C  
ATOM   1105  N   SER A 147       7.871  13.222   0.822  1.00  0.62           N  
ATOM   1106  CA  SER A 147       7.808  14.500   0.128  1.00  0.62           C  
ATOM   1107  C   SER A 147       7.890  15.712   1.033  1.00  0.62           C  
ATOM   1108  O   SER A 147       7.479  15.677   2.192  1.00  0.62           O  
ATOM   1109  CB  SER A 147       6.636  14.652  -0.880  1.00  0.62           C  
ATOM   1110  OG  SER A 147       5.364  14.953  -0.299  1.00  0.62           O  
ATOM   1111  N   ALA A 148       8.432  16.840   0.526  1.00  0.55           N  
ATOM   1112  CA  ALA A 148       8.578  18.066   1.287  1.00  0.55           C  
ATOM   1113  C   ALA A 148       7.235  18.631   1.739  1.00  0.55           C  
ATOM   1114  O   ALA A 148       7.074  19.084   2.870  1.00  0.55           O  
ATOM   1115  CB  ALA A 148       9.381  19.098   0.470  1.00  0.55           C  
ATOM   1116  N   GLU A 149       6.219  18.518   0.868  1.00  0.34           N  
ATOM   1117  CA  GLU A 149       4.830  18.832   1.101  1.00  0.34           C  
ATOM   1118  C   GLU A 149       4.196  17.934   2.161  1.00  0.34           C  
ATOM   1119  O   GLU A 149       3.230  18.311   2.822  1.00  0.34           O  
ATOM   1120  CB  GLU A 149       4.029  18.695  -0.227  1.00  0.34           C  
ATOM   1121  CG  GLU A 149       4.624  19.447  -1.457  1.00  0.34           C  
ATOM   1122  CD  GLU A 149       5.799  18.748  -2.152  1.00  0.34           C  
ATOM   1123  OE1 GLU A 149       6.313  19.310  -3.145  1.00  0.34           O  
ATOM   1124  OE2 GLU A 149       6.202  17.648  -1.686  1.00  0.34           O  
ATOM   1125  N   SER A 150       4.736  16.716   2.366  1.00  0.60           N  
ATOM   1126  CA  SER A 150       4.188  15.759   3.316  1.00  0.60           C  
ATOM   1127  C   SER A 150       4.862  15.800   4.670  1.00  0.60           C  
ATOM   1128  O   SER A 150       4.505  15.047   5.574  1.00  0.60           O  
ATOM   1129  CB  SER A 150       4.259  14.301   2.809  1.00  0.60           C  
ATOM   1130  OG  SER A 150       3.581  14.143   1.564  1.00  0.60           O  
ATOM   1131  N   ARG A 151       5.821  16.717   4.871  1.00  0.33           N  
ATOM   1132  CA  ARG A 151       6.499  16.915   6.137  1.00  0.33           C  
ATOM   1133  C   ARG A 151       5.550  17.270   7.283  1.00  0.33           C  
ATOM   1134  O   ARG A 151       4.828  18.265   7.242  1.00  0.33           O  
ATOM   1135  CB  ARG A 151       7.545  18.040   5.973  1.00  0.33           C  
ATOM   1136  CG  ARG A 151       8.415  18.278   7.219  1.00  0.33           C  
ATOM   1137  CD  ARG A 151       9.357  19.478   7.104  1.00  0.33           C  
ATOM   1138  NE  ARG A 151      10.361  19.130   6.058  1.00  0.33           N  
ATOM   1139  CZ  ARG A 151      11.364  19.934   5.691  1.00  0.33           C  
ATOM   1140  NH1 ARG A 151      11.498  21.154   6.201  1.00  0.33           N  
ATOM   1141  NH2 ARG A 151      12.241  19.506   4.786  1.00  0.33           N  
ATOM   1142  N   GLY A 152       5.503  16.429   8.330  1.00  0.59           N  
ATOM   1143  CA  GLY A 152       4.674  16.584   9.518  1.00  0.59           C  
ATOM   1144  C   GLY A 152       3.271  16.073   9.343  1.00  0.59           C  
ATOM   1145  O   GLY A 152       2.507  15.963  10.302  1.00  0.59           O  
ATOM   1146  N   ARG A 153       2.893  15.709   8.102  1.00  0.50           N  
ATOM   1147  CA  ARG A 153       1.590  15.166   7.790  1.00  0.50           C  
ATOM   1148  C   ARG A 153       1.436  13.745   8.274  1.00  0.50           C  
ATOM   1149  O   ARG A 153       0.351  13.344   8.696  1.00  0.50           O  
ATOM   1150  CB  ARG A 153       1.269  15.180   6.277  1.00  0.50           C  
ATOM   1151  CG  ARG A 153       1.077  16.579   5.665  1.00  0.50           C  
ATOM   1152  CD  ARG A 153       0.537  16.488   4.233  1.00  0.50           C  
ATOM   1153  NE  ARG A 153       0.322  17.871   3.727  1.00  0.50           N  
ATOM   1154  CZ  ARG A 153      -0.171  18.131   2.507  1.00  0.50           C  
ATOM   1155  NH1 ARG A 153      -0.553  17.155   1.690  1.00  0.50           N  
ATOM   1156  NH2 ARG A 153      -0.287  19.400   2.119  1.00  0.50           N  
ATOM   1157  N   LEU A 154       2.515  12.934   8.209  1.00  0.58           N  
ATOM   1158  CA  LEU A 154       2.467  11.550   8.630  1.00  0.58           C  
ATOM   1159  C   LEU A 154       2.210  11.451  10.115  1.00  0.58           C  
ATOM   1160  O   LEU A 154       1.316  10.732  10.555  1.00  0.58           O  
ATOM   1161  CB  LEU A 154       3.759  10.790   8.239  1.00  0.58           C  
ATOM   1162  CG  LEU A 154       3.849   9.339   8.748  1.00  0.58           C  
ATOM   1163  CD1 LEU A 154       2.729   8.473   8.168  1.00  0.58           C  
ATOM   1164  CD2 LEU A 154       5.225   8.724   8.446  1.00  0.58           C  
ATOM   1165  N   ARG A 155       2.928  12.250  10.922  1.00  0.55           N  
ATOM   1166  CA  ARG A 155       2.687  12.338  12.343  1.00  0.55           C  
ATOM   1167  C   ARG A 155       1.296  12.848  12.677  1.00  0.55           C  
ATOM   1168  O   ARG A 155       0.593  12.264  13.498  1.00  0.55           O  
ATOM   1169  CB  ARG A 155       3.759  13.231  13.004  1.00  0.55           C  
ATOM   1170  CG  ARG A 155       3.545  13.452  14.518  1.00  0.55           C  
ATOM   1171  CD  ARG A 155       4.708  14.154  15.220  1.00  0.55           C  
ATOM   1172  NE  ARG A 155       5.878  13.242  15.127  1.00  0.55           N  
ATOM   1173  CZ  ARG A 155       6.261  12.344  16.042  1.00  0.55           C  
ATOM   1174  NH1 ARG A 155       5.645  12.141  17.199  1.00  0.55           N  
ATOM   1175  NH2 ARG A 155       7.308  11.585  15.769  1.00  0.55           N  
ATOM   1176  N   ALA A 156       0.841  13.924  12.007  1.00  0.57           N  
ATOM   1177  CA  ALA A 156      -0.456  14.513  12.246  1.00  0.57           C  
ATOM   1178  C   ALA A 156      -1.631  13.573  11.996  1.00  0.57           C  
ATOM   1179  O   ALA A 156      -2.522  13.427  12.835  1.00  0.57           O  
ATOM   1180  CB  ALA A 156      -0.574  15.759  11.354  1.00  0.57           C  
ATOM   1181  N   VAL A 157      -1.633  12.850  10.855  1.00  0.56           N  
ATOM   1182  CA  VAL A 157      -2.692  11.905  10.553  1.00  0.56           C  
ATOM   1183  C   VAL A 157      -2.737  10.709  11.495  1.00  0.56           C  
ATOM   1184  O   VAL A 157      -3.811  10.307  11.936  1.00  0.56           O  
ATOM   1185  CB  VAL A 157      -2.721  11.504   9.082  1.00  0.56           C  
ATOM   1186  CG1 VAL A 157      -1.581  10.540   8.712  1.00  0.56           C  
ATOM   1187  CG2 VAL A 157      -4.101  10.919   8.727  1.00  0.56           C  
ATOM   1188  N   LEU A 158      -1.580  10.127  11.884  1.00  0.54           N  
ATOM   1189  CA  LEU A 158      -1.544   9.028  12.838  1.00  0.54           C  
ATOM   1190  C   LEU A 158      -2.060   9.424  14.220  1.00  0.54           C  
ATOM   1191  O   LEU A 158      -2.904   8.738  14.794  1.00  0.54           O  
ATOM   1192  CB  LEU A 158      -0.123   8.423  12.932  1.00  0.54           C  
ATOM   1193  CG  LEU A 158       0.413   7.807  11.618  1.00  0.54           C  
ATOM   1194  CD1 LEU A 158       1.862   7.332  11.809  1.00  0.54           C  
ATOM   1195  CD2 LEU A 158      -0.457   6.656  11.093  1.00  0.54           C  
ATOM   1196  N   THR A 159      -1.651  10.603  14.743  1.00  0.55           N  
ATOM   1197  CA  THR A 159      -2.158  11.177  15.993  1.00  0.55           C  
ATOM   1198  C   THR A 159      -3.654  11.418  15.962  1.00  0.55           C  
ATOM   1199  O   THR A 159      -4.383  11.136  16.913  1.00  0.55           O  
ATOM   1200  CB  THR A 159      -1.500  12.510  16.321  1.00  0.55           C  
ATOM   1201  OG1 THR A 159      -0.092  12.375  16.329  1.00  0.55           O  
ATOM   1202  CG2 THR A 159      -1.871  13.019  17.719  1.00  0.55           C  
ATOM   1203  N   ALA A 160      -4.180  11.937  14.832  1.00  0.53           N  
ATOM   1204  CA  ALA A 160      -5.604  12.090  14.636  1.00  0.53           C  
ATOM   1205  C   ALA A 160      -6.362  10.764  14.627  1.00  0.53           C  
ATOM   1206  O   ALA A 160      -7.391  10.637  15.286  1.00  0.53           O  
ATOM   1207  CB  ALA A 160      -5.869  12.899  13.356  1.00  0.53           C  
ATOM   1208  N   LEU A 161      -5.840   9.727  13.936  1.00  0.83           N  
ATOM   1209  CA  LEU A 161      -6.391   8.382  13.936  1.00  0.83           C  
ATOM   1210  C   LEU A 161      -6.399   7.718  15.310  1.00  0.83           C  
ATOM   1211  O   LEU A 161      -7.384   7.084  15.678  1.00  0.83           O  
ATOM   1212  CB  LEU A 161      -5.681   7.470  12.903  1.00  0.83           C  
ATOM   1213  CG  LEU A 161      -5.917   7.847  11.420  1.00  0.83           C  
ATOM   1214  CD1 LEU A 161      -5.013   7.006  10.504  1.00  0.83           C  
ATOM   1215  CD2 LEU A 161      -7.384   7.691  10.986  1.00  0.83           C  
ATOM   1216  N   ASP A 162      -5.338   7.877  16.127  1.00  0.83           N  
ATOM   1217  CA  ASP A 162      -5.294   7.413  17.505  1.00  0.83           C  
ATOM   1218  C   ASP A 162      -6.365   8.025  18.377  1.00  0.83           C  
ATOM   1219  O   ASP A 162      -7.030   7.340  19.149  1.00  0.83           O  
ATOM   1220  CB  ASP A 162      -3.908   7.734  18.111  1.00  0.83           C  
ATOM   1221  CG  ASP A 162      -2.884   6.756  17.605  1.00  0.83           C  
ATOM   1222  OD1 ASP A 162      -3.294   5.695  17.074  1.00  0.83           O  
ATOM   1223  OD2 ASP A 162      -1.667   7.011  17.770  1.00  0.83           O  
ATOM   1224  N   HIS A 163      -6.575   9.338  18.235  1.00  0.81           N  
ATOM   1225  CA  HIS A 163      -7.621  10.047  18.934  1.00  0.81           C  
ATOM   1226  C   HIS A 163      -9.040   9.625  18.567  1.00  0.81           C  
ATOM   1227  O   HIS A 163      -9.879   9.396  19.435  1.00  0.81           O  
ATOM   1228  CB  HIS A 163      -7.436  11.548  18.657  1.00  0.81           C  
ATOM   1229  CG  HIS A 163      -8.339  12.431  19.443  1.00  0.81           C  
ATOM   1230  ND1 HIS A 163      -8.177  12.496  20.809  1.00  0.81           N  
ATOM   1231  CD2 HIS A 163      -9.326  13.269  19.038  1.00  0.81           C  
ATOM   1232  CE1 HIS A 163      -9.074  13.367  21.217  1.00  0.81           C  
ATOM   1233  NE2 HIS A 163      -9.792  13.869  20.185  1.00  0.81           N  
ATOM   1234  N   VAL A 164      -9.361   9.486  17.262  1.00  0.85           N  
ATOM   1235  CA  VAL A 164     -10.727   9.182  16.857  1.00  0.85           C  
ATOM   1236  C   VAL A 164     -11.043   7.695  16.802  1.00  0.85           C  
ATOM   1237  O   VAL A 164     -12.196   7.300  16.958  1.00  0.85           O  
ATOM   1238  CB  VAL A 164     -11.111   9.850  15.540  1.00  0.85           C  
ATOM   1239  CG1 VAL A 164     -10.951  11.377  15.685  1.00  0.85           C  
ATOM   1240  CG2 VAL A 164     -10.266   9.318  14.369  1.00  0.85           C  
ATOM   1241  N   LEU A 165     -10.031   6.819  16.645  1.00  0.79           N  
ATOM   1242  CA  LEU A 165     -10.226   5.378  16.580  1.00  0.79           C  
ATOM   1243  C   LEU A 165      -9.256   4.648  17.521  1.00  0.79           C  
ATOM   1244  O   LEU A 165      -8.454   3.818  17.066  1.00  0.79           O  
ATOM   1245  CB  LEU A 165     -10.019   4.857  15.131  1.00  0.79           C  
ATOM   1246  CG  LEU A 165     -11.084   5.295  14.105  1.00  0.79           C  
ATOM   1247  CD1 LEU A 165     -10.615   4.958  12.683  1.00  0.79           C  
ATOM   1248  CD2 LEU A 165     -12.457   4.659  14.368  1.00  0.79           C  
ATOM   1249  N   PRO A 166      -9.252   4.926  18.831  1.00  0.84           N  
ATOM   1250  CA  PRO A 166      -8.336   4.293  19.776  1.00  0.84           C  
ATOM   1251  C   PRO A 166      -8.458   2.777  19.808  1.00  0.84           C  
ATOM   1252  O   PRO A 166      -9.542   2.246  20.034  1.00  0.84           O  
ATOM   1253  CB  PRO A 166      -8.690   4.947  21.120  1.00  0.84           C  
ATOM   1254  CG  PRO A 166     -10.188   5.234  21.003  1.00  0.84           C  
ATOM   1255  CD  PRO A 166     -10.335   5.632  19.533  1.00  0.84           C  
ATOM   1256  N   GLY A 167      -7.358   2.035  19.572  1.00  0.85           N  
ATOM   1257  CA  GLY A 167      -7.385   0.575  19.636  1.00  0.85           C  
ATOM   1258  C   GLY A 167      -7.980  -0.130  18.445  1.00  0.85           C  
ATOM   1259  O   GLY A 167      -8.032  -1.354  18.417  1.00  0.85           O  
ATOM   1260  N   ALA A 168      -8.430   0.593  17.401  1.00  0.86           N  
ATOM   1261  CA  ALA A 168      -8.819  -0.048  16.162  1.00  0.86           C  
ATOM   1262  C   ALA A 168      -7.614  -0.677  15.457  1.00  0.86           C  
ATOM   1263  O   ALA A 168      -6.582  -0.016  15.294  1.00  0.86           O  
ATOM   1264  CB  ALA A 168      -9.541   0.949  15.234  1.00  0.86           C  
ATOM   1265  N   ASP A 169      -7.716  -1.962  15.030  1.00  0.75           N  
ATOM   1266  CA  ASP A 169      -6.677  -2.624  14.260  1.00  0.75           C  
ATOM   1267  C   ASP A 169      -6.893  -2.242  12.803  1.00  0.75           C  
ATOM   1268  O   ASP A 169      -7.857  -2.644  12.148  1.00  0.75           O  
ATOM   1269  CB  ASP A 169      -6.675  -4.169  14.498  1.00  0.75           C  
ATOM   1270  CG  ASP A 169      -5.325  -4.835  14.281  1.00  0.75           C  
ATOM   1271  OD1 ASP A 169      -4.345  -4.081  14.067  1.00  0.75           O  
ATOM   1272  OD2 ASP A 169      -5.237  -6.082  14.399  1.00  0.75           O  
ATOM   1273  N   LEU A 170      -6.018  -1.361  12.297  1.00  0.81           N  
ATOM   1274  CA  LEU A 170      -6.150  -0.771  10.995  1.00  0.81           C  
ATOM   1275  C   LEU A 170      -4.773  -0.605  10.435  1.00  0.81           C  
ATOM   1276  O   LEU A 170      -3.782  -0.541  11.166  1.00  0.81           O  
ATOM   1277  CB  LEU A 170      -6.914   0.590  11.002  1.00  0.81           C  
ATOM   1278  CG  LEU A 170      -6.233   1.791  11.705  1.00  0.81           C  
ATOM   1279  CD1 LEU A 170      -5.288   2.561  10.769  1.00  0.81           C  
ATOM   1280  CD2 LEU A 170      -7.275   2.783  12.244  1.00  0.81           C  
ATOM   1281  N   VAL A 171      -4.682  -0.516   9.101  1.00  0.83           N  
ATOM   1282  CA  VAL A 171      -3.434  -0.220   8.436  1.00  0.83           C  
ATOM   1283  C   VAL A 171      -3.575   1.091   7.708  1.00  0.83           C  
ATOM   1284  O   VAL A 171      -4.622   1.429   7.156  1.00  0.83           O  
ATOM   1285  CB  VAL A 171      -2.952  -1.313   7.492  1.00  0.83           C  
ATOM   1286  CG1 VAL A 171      -2.576  -2.540   8.338  1.00  0.83           C  
ATOM   1287  CG2 VAL A 171      -4.024  -1.662   6.443  1.00  0.83           C  
ATOM   1288  N   VAL A 172      -2.508   1.900   7.715  1.00  0.84           N  
ATOM   1289  CA  VAL A 172      -2.508   3.184   7.051  1.00  0.84           C  
ATOM   1290  C   VAL A 172      -1.699   3.061   5.782  1.00  0.84           C  
ATOM   1291  O   VAL A 172      -0.591   2.518   5.760  1.00  0.84           O  
ATOM   1292  CB  VAL A 172      -2.018   4.335   7.920  1.00  0.84           C  
ATOM   1293  CG1 VAL A 172      -2.098   5.669   7.161  1.00  0.84           C  
ATOM   1294  CG2 VAL A 172      -2.886   4.412   9.183  1.00  0.84           C  
ATOM   1295  N   SER A 173      -2.270   3.554   4.673  1.00  0.82           N  
ATOM   1296  CA  SER A 173      -1.656   3.508   3.365  1.00  0.82           C  
ATOM   1297  C   SER A 173      -1.268   4.903   2.912  1.00  0.82           C  
ATOM   1298  O   SER A 173      -2.130   5.672   2.479  1.00  0.82           O  
ATOM   1299  CB  SER A 173      -2.624   2.951   2.291  1.00  0.82           C  
ATOM   1300  OG  SER A 173      -2.948   1.580   2.532  1.00  0.82           O  
ATOM   1301  N   PRO A 174      -0.000   5.301   2.960  1.00  0.83           N  
ATOM   1302  CA  PRO A 174       0.495   6.442   2.211  1.00  0.83           C  
ATOM   1303  C   PRO A 174       0.540   6.200   0.726  1.00  0.83           C  
ATOM   1304  O   PRO A 174       0.511   5.053   0.278  1.00  0.83           O  
ATOM   1305  CB  PRO A 174       1.926   6.670   2.723  1.00  0.83           C  
ATOM   1306  CG  PRO A 174       1.980   5.936   4.057  1.00  0.83           C  
ATOM   1307  CD  PRO A 174       1.016   4.768   3.862  1.00  0.83           C  
ATOM   1308  N   ARG A 175       0.660   7.293  -0.033  1.00  0.69           N  
ATOM   1309  CA  ARG A 175       0.803   7.296  -1.463  1.00  0.69           C  
ATOM   1310  C   ARG A 175       2.268   7.198  -1.845  1.00  0.69           C  
ATOM   1311  O   ARG A 175       3.121   7.890  -1.293  1.00  0.69           O  
ATOM   1312  CB  ARG A 175       0.231   8.612  -2.044  1.00  0.69           C  
ATOM   1313  CG  ARG A 175      -1.272   8.805  -1.752  1.00  0.69           C  
ATOM   1314  CD  ARG A 175      -1.844  10.181  -2.119  1.00  0.69           C  
ATOM   1315  NE  ARG A 175      -1.676  10.361  -3.592  1.00  0.69           N  
ATOM   1316  CZ  ARG A 175      -1.710  11.553  -4.202  1.00  0.69           C  
ATOM   1317  NH1 ARG A 175      -1.912  12.691  -3.542  1.00  0.69           N  
ATOM   1318  NH2 ARG A 175      -1.534  11.596  -5.525  1.00  0.69           N  
ATOM   1319  N   ILE A 176       2.596   6.343  -2.824  1.00  0.74           N  
ATOM   1320  CA  ILE A 176       3.950   6.232  -3.339  1.00  0.74           C  
ATOM   1321  C   ILE A 176       3.917   6.650  -4.789  1.00  0.74           C  
ATOM   1322  O   ILE A 176       3.240   6.039  -5.614  1.00  0.74           O  
ATOM   1323  CB  ILE A 176       4.531   4.829  -3.211  1.00  0.74           C  
ATOM   1324  CG1 ILE A 176       4.569   4.406  -1.727  1.00  0.74           C  
ATOM   1325  CG2 ILE A 176       5.948   4.761  -3.825  1.00  0.74           C  
ATOM   1326  CD1 ILE A 176       4.820   2.908  -1.541  1.00  0.74           C  
ATOM   1327  N   LEU A 177       4.646   7.728  -5.122  1.00  0.67           N  
ATOM   1328  CA  LEU A 177       4.812   8.208  -6.476  1.00  0.67           C  
ATOM   1329  C   LEU A 177       6.121   7.676  -7.000  1.00  0.67           C  
ATOM   1330  O   LEU A 177       7.159   7.845  -6.363  1.00  0.67           O  
ATOM   1331  CB  LEU A 177       4.884   9.756  -6.542  1.00  0.67           C  
ATOM   1332  CG  LEU A 177       3.529  10.470  -6.392  1.00  0.67           C  
ATOM   1333  CD1 LEU A 177       3.732  11.974  -6.156  1.00  0.67           C  
ATOM   1334  CD2 LEU A 177       2.651  10.250  -7.631  1.00  0.67           C  
ATOM   1335  N   ASP A 178       6.123   7.002  -8.160  1.00  0.58           N  
ATOM   1336  CA  ASP A 178       7.347   6.525  -8.761  1.00  0.58           C  
ATOM   1337  C   ASP A 178       7.899   7.488  -9.792  1.00  0.58           C  
ATOM   1338  O   ASP A 178       7.413   8.602  -9.993  1.00  0.58           O  
ATOM   1339  CB  ASP A 178       7.196   5.067  -9.283  1.00  0.58           C  
ATOM   1340  CG  ASP A 178       6.391   4.905 -10.574  1.00  0.58           C  
ATOM   1341  OD1 ASP A 178       6.036   5.918 -11.230  1.00  0.58           O  
ATOM   1342  OD2 ASP A 178       6.191   3.740 -10.975  1.00  0.58           O  
ATOM   1343  N   THR A 179       8.949   7.054 -10.504  1.00  0.53           N  
ATOM   1344  CA  THR A 179       9.597   7.842 -11.531  1.00  0.53           C  
ATOM   1345  C   THR A 179       8.818   7.922 -12.828  1.00  0.53           C  
ATOM   1346  O   THR A 179       9.144   8.751 -13.678  1.00  0.53           O  
ATOM   1347  CB  THR A 179      10.997   7.341 -11.855  1.00  0.53           C  
ATOM   1348  OG1 THR A 179      11.000   5.954 -12.161  1.00  0.53           O  
ATOM   1349  CG2 THR A 179      11.890   7.524 -10.624  1.00  0.53           C  
ATOM   1350  N   SER A 180       7.766   7.095 -13.026  1.00  0.49           N  
ATOM   1351  CA  SER A 180       6.964   7.142 -14.232  1.00  0.49           C  
ATOM   1352  C   SER A 180       5.792   8.075 -14.070  1.00  0.49           C  
ATOM   1353  O   SER A 180       5.198   8.546 -15.041  1.00  0.49           O  
ATOM   1354  CB  SER A 180       6.544   5.719 -14.751  1.00  0.49           C  
ATOM   1355  OG  SER A 180       5.472   5.098 -14.107  1.00  0.49           O  
ATOM   1356  N   ARG A 181       5.532   8.442 -12.805  1.00  0.45           N  
ATOM   1357  CA  ARG A 181       4.495   9.296 -12.278  1.00  0.45           C  
ATOM   1358  C   ARG A 181       3.285   8.458 -11.945  1.00  0.45           C  
ATOM   1359  O   ARG A 181       2.183   8.983 -11.786  1.00  0.45           O  
ATOM   1360  CB  ARG A 181       4.095  10.540 -13.129  1.00  0.45           C  
ATOM   1361  CG  ARG A 181       5.226  11.560 -13.377  1.00  0.45           C  
ATOM   1362  CD  ARG A 181       4.744  12.751 -14.214  1.00  0.45           C  
ATOM   1363  NE  ARG A 181       5.856  13.758 -14.305  1.00  0.45           N  
ATOM   1364  CZ  ARG A 181       5.701  14.994 -14.802  1.00  0.45           C  
ATOM   1365  NH1 ARG A 181       4.525  15.413 -15.263  1.00  0.45           N  
ATOM   1366  NH2 ARG A 181       6.736  15.831 -14.839  1.00  0.45           N  
ATOM   1367  N   GLU A 182       3.460   7.130 -11.781  1.00  0.50           N  
ATOM   1368  CA  GLU A 182       2.397   6.265 -11.327  1.00  0.50           C  
ATOM   1369  C   GLU A 182       2.245   6.411  -9.823  1.00  0.50           C  
ATOM   1370  O   GLU A 182       3.210   6.669  -9.101  1.00  0.50           O  
ATOM   1371  CB  GLU A 182       2.616   4.798 -11.761  1.00  0.50           C  
ATOM   1372  CG  GLU A 182       1.394   3.872 -11.515  1.00  0.50           C  
ATOM   1373  CD  GLU A 182       1.555   2.448 -12.055  1.00  0.50           C  
ATOM   1374  OE1 GLU A 182       0.612   1.649 -11.813  1.00  0.50           O  
ATOM   1375  OE2 GLU A 182       2.585   2.138 -12.698  1.00  0.50           O  
ATOM   1376  N   CYS A 183       1.002   6.322  -9.304  1.00  0.66           N  
ATOM   1377  CA  CYS A 183       0.736   6.565  -7.900  1.00  0.66           C  
ATOM   1378  C   CYS A 183       0.097   5.359  -7.251  1.00  0.66           C  
ATOM   1379  O   CYS A 183      -1.062   5.029  -7.489  1.00  0.66           O  
ATOM   1380  CB  CYS A 183      -0.159   7.813  -7.683  1.00  0.66           C  
ATOM   1381  SG  CYS A 183      -0.279   8.347  -5.938  1.00  0.66           S  
ATOM   1382  N   HIS A 184       0.847   4.702  -6.355  1.00  0.64           N  
ATOM   1383  CA  HIS A 184       0.388   3.539  -5.628  1.00  0.64           C  
ATOM   1384  C   HIS A 184      -0.282   3.964  -4.335  1.00  0.64           C  
ATOM   1385  O   HIS A 184       0.358   4.564  -3.471  1.00  0.64           O  
ATOM   1386  CB  HIS A 184       1.567   2.598  -5.300  1.00  0.64           C  
ATOM   1387  CG  HIS A 184       2.302   2.203  -6.542  1.00  0.64           C  
ATOM   1388  ND1 HIS A 184       1.778   1.192  -7.317  1.00  0.64           N  
ATOM   1389  CD2 HIS A 184       3.331   2.815  -7.187  1.00  0.64           C  
ATOM   1390  CE1 HIS A 184       2.493   1.212  -8.432  1.00  0.64           C  
ATOM   1391  NE2 HIS A 184       3.448   2.175  -8.402  1.00  0.64           N  
ATOM   1392  N   THR A 185      -1.594   3.688  -4.171  1.00  0.74           N  
ATOM   1393  CA  THR A 185      -2.372   4.193  -3.043  1.00  0.74           C  
ATOM   1394  C   THR A 185      -2.716   3.158  -1.982  1.00  0.74           C  
ATOM   1395  O   THR A 185      -2.819   3.508  -0.813  1.00  0.74           O  
ATOM   1396  CB  THR A 185      -3.678   4.839  -3.492  1.00  0.74           C  
ATOM   1397  OG1 THR A 185      -4.445   3.979  -4.323  1.00  0.74           O  
ATOM   1398  CG2 THR A 185      -3.336   6.094  -4.315  1.00  0.74           C  
ATOM   1399  N   ASP A 186      -2.822   1.849  -2.308  1.00  0.70           N  
ATOM   1400  CA  ASP A 186      -3.115   0.795  -1.338  1.00  0.70           C  
ATOM   1401  C   ASP A 186      -1.822   0.113  -0.893  1.00  0.70           C  
ATOM   1402  O   ASP A 186      -1.552  -1.060  -1.154  1.00  0.70           O  
ATOM   1403  CB  ASP A 186      -4.149  -0.230  -1.890  1.00  0.70           C  
ATOM   1404  CG  ASP A 186      -4.631  -1.198  -0.815  1.00  0.70           C  
ATOM   1405  OD1 ASP A 186      -4.791  -0.781   0.363  1.00  0.70           O  
ATOM   1406  OD2 ASP A 186      -4.844  -2.405  -1.118  1.00  0.70           O  
ATOM   1407  N   THR A 187      -0.944   0.882  -0.227  1.00  0.73           N  
ATOM   1408  CA  THR A 187       0.360   0.419   0.225  1.00  0.73           C  
ATOM   1409  C   THR A 187       0.346  -0.429   1.486  1.00  0.73           C  
ATOM   1410  O   THR A 187       1.098  -1.397   1.595  1.00  0.73           O  
ATOM   1411  CB  THR A 187       1.365   1.558   0.372  1.00  0.73           C  
ATOM   1412  OG1 THR A 187       0.991   2.501   1.351  1.00  0.73           O  
ATOM   1413  CG2 THR A 187       1.474   2.327  -0.945  1.00  0.73           C  
ATOM   1414  N   ARG A 188      -0.505  -0.082   2.476  1.00  0.67           N  
ATOM   1415  CA  ARG A 188      -0.701  -0.785   3.736  1.00  0.67           C  
ATOM   1416  C   ARG A 188       0.560  -1.011   4.549  1.00  0.67           C  
ATOM   1417  O   ARG A 188       0.813  -2.098   5.063  1.00  0.67           O  
ATOM   1418  CB  ARG A 188      -1.440  -2.124   3.549  1.00  0.67           C  
ATOM   1419  CG  ARG A 188      -2.769  -1.973   2.800  1.00  0.67           C  
ATOM   1420  CD  ARG A 188      -3.488  -3.303   2.617  1.00  0.67           C  
ATOM   1421  NE  ARG A 188      -4.759  -2.971   1.929  1.00  0.67           N  
ATOM   1422  CZ  ARG A 188      -5.930  -3.588   2.097  1.00  0.67           C  
ATOM   1423  NH1 ARG A 188      -6.155  -4.402   3.121  1.00  0.67           N  
ATOM   1424  NH2 ARG A 188      -6.884  -3.363   1.199  1.00  0.67           N  
ATOM   1425  N   ARG A 189       1.391   0.032   4.690  1.00  0.69           N  
ATOM   1426  CA  ARG A 189       2.722  -0.130   5.234  1.00  0.69           C  
ATOM   1427  C   ARG A 189       2.861   0.383   6.648  1.00  0.69           C  
ATOM   1428  O   ARG A 189       3.923   0.279   7.259  1.00  0.69           O  
ATOM   1429  CB  ARG A 189       3.715   0.635   4.347  1.00  0.69           C  
ATOM   1430  CG  ARG A 189       3.915  -0.030   2.978  1.00  0.69           C  
ATOM   1431  CD  ARG A 189       5.025   0.653   2.197  1.00  0.69           C  
ATOM   1432  NE  ARG A 189       5.175  -0.060   0.896  1.00  0.69           N  
ATOM   1433  CZ  ARG A 189       6.250   0.179   0.139  1.00  0.69           C  
ATOM   1434  NH1 ARG A 189       7.116   1.109   0.490  1.00  0.69           N  
ATOM   1435  NH2 ARG A 189       6.522  -0.516  -0.958  1.00  0.69           N  
ATOM   1436  N   ILE A 190       1.792   0.951   7.219  1.00  0.82           N  
ATOM   1437  CA  ILE A 190       1.858   1.529   8.543  1.00  0.82           C  
ATOM   1438  C   ILE A 190       0.844   0.832   9.415  1.00  0.82           C  
ATOM   1439  O   ILE A 190      -0.328   0.715   9.063  1.00  0.82           O  
ATOM   1440  CB  ILE A 190       1.593   3.023   8.542  1.00  0.82           C  
ATOM   1441  CG1 ILE A 190       2.502   3.773   7.546  1.00  0.82           C  
ATOM   1442  CG2 ILE A 190       1.728   3.585   9.978  1.00  0.82           C  
ATOM   1443  CD1 ILE A 190       2.063   5.222   7.356  1.00  0.82           C  
ATOM   1444  N   VAL A 191       1.281   0.347  10.585  1.00  0.85           N  
ATOM   1445  CA  VAL A 191       0.479  -0.490  11.450  1.00  0.85           C  
ATOM   1446  C   VAL A 191       0.845  -0.168  12.884  1.00  0.85           C  
ATOM   1447  O   VAL A 191       1.937   0.327  13.159  1.00  0.85           O  
ATOM   1448  CB  VAL A 191       0.723  -1.962  11.128  1.00  0.85           C  
ATOM   1449  CG1 VAL A 191       2.203  -2.341  11.340  1.00  0.85           C  
ATOM   1450  CG2 VAL A 191      -0.211  -2.888  11.928  1.00  0.85           C  
ATOM   1451  N   ARG A 192      -0.070  -0.380  13.852  1.00  0.75           N  
ATOM   1452  CA  ARG A 192       0.230  -0.240  15.265  1.00  0.75           C  
ATOM   1453  C   ARG A 192       1.301  -1.222  15.751  1.00  0.75           C  
ATOM   1454  O   ARG A 192       1.406  -2.345  15.260  1.00  0.75           O  
ATOM   1455  CB  ARG A 192      -1.034  -0.417  16.138  1.00  0.75           C  
ATOM   1456  CG  ARG A 192      -2.163   0.600  15.891  1.00  0.75           C  
ATOM   1457  CD  ARG A 192      -3.340   0.416  16.874  1.00  0.75           C  
ATOM   1458  NE  ARG A 192      -4.372   1.467  16.622  1.00  0.75           N  
ATOM   1459  CZ  ARG A 192      -4.160   2.756  16.890  1.00  0.75           C  
ATOM   1460  NH1 ARG A 192      -3.079   3.173  17.533  1.00  0.75           N  
ATOM   1461  NH2 ARG A 192      -5.002   3.697  16.497  1.00  0.75           N  
ATOM   1462  N   SER A 193       2.139  -0.827  16.731  1.00  0.81           N  
ATOM   1463  CA  SER A 193       3.219  -1.661  17.248  1.00  0.81           C  
ATOM   1464  C   SER A 193       2.776  -2.888  18.014  1.00  0.81           C  
ATOM   1465  O   SER A 193       3.477  -3.898  18.043  1.00  0.81           O  
ATOM   1466  CB  SER A 193       4.224  -0.880  18.138  1.00  0.81           C  
ATOM   1467  OG  SER A 193       3.606  -0.204  19.232  1.00  0.81           O  
ATOM   1468  N   ASP A 194       1.592  -2.832  18.634  1.00  0.71           N  
ATOM   1469  CA  ASP A 194       1.018  -3.856  19.465  1.00  0.71           C  
ATOM   1470  C   ASP A 194       0.049  -4.744  18.692  1.00  0.71           C  
ATOM   1471  O   ASP A 194      -0.504  -5.703  19.228  1.00  0.71           O  
ATOM   1472  CB  ASP A 194       0.311  -3.161  20.670  1.00  0.71           C  
ATOM   1473  CG  ASP A 194      -0.616  -1.993  20.320  1.00  0.71           C  
ATOM   1474  OD1 ASP A 194      -0.758  -1.635  19.122  1.00  0.71           O  
ATOM   1475  OD2 ASP A 194      -1.152  -1.399  21.289  1.00  0.71           O  
ATOM   1476  N   SER A 195      -0.140  -4.461  17.391  1.00  0.72           N  
ATOM   1477  CA  SER A 195      -1.000  -5.231  16.510  1.00  0.72           C  
ATOM   1478  C   SER A 195      -0.584  -6.681  16.325  1.00  0.72           C  
ATOM   1479  O   SER A 195       0.597  -7.040  16.332  1.00  0.72           O  
ATOM   1480  CB  SER A 195      -1.158  -4.580  15.122  1.00  0.72           C  
ATOM   1481  OG  SER A 195      -2.082  -5.266  14.318  1.00  0.72           O  
ATOM   1482  N   ALA A 196      -1.581  -7.571  16.140  1.00  0.63           N  
ATOM   1483  CA  ALA A 196      -1.366  -8.982  15.919  1.00  0.63           C  
ATOM   1484  C   ALA A 196      -1.118  -9.284  14.453  1.00  0.63           C  
ATOM   1485  O   ALA A 196      -0.671 -10.375  14.102  1.00  0.63           O  
ATOM   1486  CB  ALA A 196      -2.577  -9.773  16.440  1.00  0.63           C  
ATOM   1487  N   LEU A 197      -1.348  -8.294  13.567  1.00  0.66           N  
ATOM   1488  CA  LEU A 197      -1.061  -8.387  12.154  1.00  0.66           C  
ATOM   1489  C   LEU A 197       0.405  -8.644  11.848  1.00  0.66           C  
ATOM   1490  O   LEU A 197       1.312  -8.119  12.494  1.00  0.66           O  
ATOM   1491  CB  LEU A 197      -1.457  -7.093  11.413  1.00  0.66           C  
ATOM   1492  CG  LEU A 197      -2.939  -6.692  11.508  1.00  0.66           C  
ATOM   1493  CD1 LEU A 197      -3.103  -5.247  11.021  1.00  0.66           C  
ATOM   1494  CD2 LEU A 197      -3.858  -7.642  10.735  1.00  0.66           C  
ATOM   1495  N   ARG A 198       0.686  -9.460  10.827  1.00  0.62           N  
ATOM   1496  CA  ARG A 198       2.039  -9.787  10.452  1.00  0.62           C  
ATOM   1497  C   ARG A 198       2.106  -9.841   8.952  1.00  0.62           C  
ATOM   1498  O   ARG A 198       1.121 -10.114   8.267  1.00  0.62           O  
ATOM   1499  CB  ARG A 198       2.499 -11.148  11.038  1.00  0.62           C  
ATOM   1500  CG  ARG A 198       2.733 -11.138  12.566  1.00  0.62           C  
ATOM   1501  CD  ARG A 198       3.850 -10.188  13.023  1.00  0.62           C  
ATOM   1502  NE  ARG A 198       3.949 -10.257  14.521  1.00  0.62           N  
ATOM   1503  CZ  ARG A 198       3.267  -9.451  15.350  1.00  0.62           C  
ATOM   1504  NH1 ARG A 198       2.394  -8.555  14.916  1.00  0.62           N  
ATOM   1505  NH2 ARG A 198       3.467  -9.536  16.664  1.00  0.62           N  
ATOM   1506  N   PHE A 199       3.286  -9.528   8.387  1.00  0.70           N  
ATOM   1507  CA  PHE A 199       3.524  -9.662   6.967  1.00  0.70           C  
ATOM   1508  C   PHE A 199       3.500 -11.126   6.556  1.00  0.70           C  
ATOM   1509  O   PHE A 199       4.071 -11.977   7.238  1.00  0.70           O  
ATOM   1510  CB  PHE A 199       4.849  -8.990   6.528  1.00  0.70           C  
ATOM   1511  CG  PHE A 199       4.709  -7.493   6.561  1.00  0.70           C  
ATOM   1512  CD1 PHE A 199       4.261  -6.808   5.420  1.00  0.70           C  
ATOM   1513  CD2 PHE A 199       5.020  -6.753   7.715  1.00  0.70           C  
ATOM   1514  CE1 PHE A 199       4.124  -5.415   5.429  1.00  0.70           C  
ATOM   1515  CE2 PHE A 199       4.891  -5.358   7.724  1.00  0.70           C  
ATOM   1516  CZ  PHE A 199       4.439  -4.688   6.582  1.00  0.70           C  
ATOM   1517  N   ARG A 200       2.821 -11.456   5.440  1.00  0.67           N  
ATOM   1518  CA  ARG A 200       2.706 -12.826   4.985  1.00  0.67           C  
ATOM   1519  C   ARG A 200       2.946 -12.942   3.494  1.00  0.67           C  
ATOM   1520  O   ARG A 200       2.391 -12.196   2.682  1.00  0.67           O  
ATOM   1521  CB  ARG A 200       1.338 -13.437   5.365  1.00  0.67           C  
ATOM   1522  CG  ARG A 200       1.231 -14.958   5.147  1.00  0.67           C  
ATOM   1523  CD  ARG A 200      -0.132 -15.524   5.553  1.00  0.67           C  
ATOM   1524  NE  ARG A 200      -0.120 -16.982   5.206  1.00  0.67           N  
ATOM   1525  CZ  ARG A 200      -1.144 -17.817   5.424  1.00  0.67           C  
ATOM   1526  NH1 ARG A 200      -2.211 -17.439   6.128  1.00  0.67           N  
ATOM   1527  NH2 ARG A 200      -1.092 -19.046   4.909  1.00  0.67           N  
ATOM   1528  N   GLY A 201       3.802 -13.916   3.117  1.00  0.84           N  
ATOM   1529  CA  GLY A 201       4.305 -14.121   1.771  1.00  0.84           C  
ATOM   1530  C   GLY A 201       5.749 -13.759   1.703  1.00  0.84           C  
ATOM   1531  O   GLY A 201       6.133 -12.646   2.021  1.00  0.84           O  
ATOM   1532  N   ARG A 202       6.611 -14.683   1.241  1.00  0.76           N  
ATOM   1533  CA  ARG A 202       8.041 -14.432   1.144  1.00  0.76           C  
ATOM   1534  C   ARG A 202       8.399 -13.323   0.164  1.00  0.76           C  
ATOM   1535  O   ARG A 202       9.448 -12.695   0.276  1.00  0.76           O  
ATOM   1536  CB  ARG A 202       8.797 -15.686   0.663  1.00  0.76           C  
ATOM   1537  CG  ARG A 202       8.732 -16.898   1.604  1.00  0.76           C  
ATOM   1538  CD  ARG A 202       9.490 -18.073   0.979  1.00  0.76           C  
ATOM   1539  NE  ARG A 202       9.578 -19.183   1.956  1.00  0.76           N  
ATOM   1540  CZ  ARG A 202      10.377 -19.223   3.025  1.00  0.76           C  
ATOM   1541  NH1 ARG A 202      11.302 -18.307   3.272  1.00  0.76           N  
ATOM   1542  NH2 ARG A 202      10.230 -20.255   3.849  1.00  0.76           N  
ATOM   1543  N   LEU A 203       7.515 -13.101  -0.823  1.00  0.81           N  
ATOM   1544  CA  LEU A 203       7.615 -12.110  -1.863  1.00  0.81           C  
ATOM   1545  C   LEU A 203       6.206 -11.589  -2.086  1.00  0.81           C  
ATOM   1546  O   LEU A 203       5.242 -12.355  -2.039  1.00  0.81           O  
ATOM   1547  CB  LEU A 203       8.129 -12.760  -3.176  1.00  0.81           C  
ATOM   1548  CG  LEU A 203       8.339 -11.797  -4.360  1.00  0.81           C  
ATOM   1549  CD1 LEU A 203       9.500 -10.828  -4.126  1.00  0.81           C  
ATOM   1550  CD2 LEU A 203       8.543 -12.563  -5.675  1.00  0.81           C  
ATOM   1551  N   HIS A 204       6.031 -10.271  -2.300  1.00  0.72           N  
ATOM   1552  CA  HIS A 204       4.722  -9.643  -2.416  1.00  0.72           C  
ATOM   1553  C   HIS A 204       3.929  -9.779  -1.120  1.00  0.72           C  
ATOM   1554  O   HIS A 204       2.772 -10.223  -1.073  1.00  0.72           O  
ATOM   1555  CB  HIS A 204       3.901 -10.109  -3.652  1.00  0.72           C  
ATOM   1556  CG  HIS A 204       4.637 -10.100  -4.942  1.00  0.72           C  
ATOM   1557  ND1 HIS A 204       5.049  -8.891  -5.474  1.00  0.72           N  
ATOM   1558  CD2 HIS A 204       5.198 -11.125  -5.618  1.00  0.72           C  
ATOM   1559  CE1 HIS A 204       5.878  -9.195  -6.443  1.00  0.72           C  
ATOM   1560  NE2 HIS A 204       5.990 -10.529  -6.563  1.00  0.72           N  
ATOM   1561  N   GLU A 205       4.618  -9.433  -0.023  1.00  0.70           N  
ATOM   1562  CA  GLU A 205       4.171  -9.477   1.334  1.00  0.70           C  
ATOM   1563  C   GLU A 205       3.221  -8.348   1.665  1.00  0.70           C  
ATOM   1564  O   GLU A 205       3.344  -7.216   1.203  1.00  0.70           O  
ATOM   1565  CB  GLU A 205       5.386  -9.520   2.298  1.00  0.70           C  
ATOM   1566  CG  GLU A 205       6.239  -8.228   2.449  1.00  0.70           C  
ATOM   1567  CD  GLU A 205       7.078  -7.767   1.250  1.00  0.70           C  
ATOM   1568  OE1 GLU A 205       7.724  -6.693   1.415  1.00  0.70           O  
ATOM   1569  OE2 GLU A 205       7.107  -8.453   0.196  1.00  0.70           O  
ATOM   1570  N   ARG A 206       2.209  -8.645   2.494  1.00  0.63           N  
ATOM   1571  CA  ARG A 206       1.267  -7.657   2.968  1.00  0.63           C  
ATOM   1572  C   ARG A 206       0.906  -8.062   4.372  1.00  0.63           C  
ATOM   1573  O   ARG A 206       1.119  -9.211   4.753  1.00  0.63           O  
ATOM   1574  CB  ARG A 206      -0.037  -7.574   2.131  1.00  0.63           C  
ATOM   1575  CG  ARG A 206       0.156  -7.075   0.686  1.00  0.63           C  
ATOM   1576  CD  ARG A 206      -1.171  -6.915  -0.064  1.00  0.63           C  
ATOM   1577  NE  ARG A 206      -0.877  -6.278  -1.390  1.00  0.63           N  
ATOM   1578  CZ  ARG A 206      -1.812  -5.685  -2.150  1.00  0.63           C  
ATOM   1579  NH1 ARG A 206      -3.106  -5.789  -1.864  1.00  0.63           N  
ATOM   1580  NH2 ARG A 206      -1.448  -4.937  -3.195  1.00  0.63           N  
ATOM   1581  N   LEU A 207       0.385  -7.121   5.180  1.00  0.74           N  
ATOM   1582  CA  LEU A 207      -0.153  -7.392   6.496  1.00  0.74           C  
ATOM   1583  C   LEU A 207      -1.442  -8.198   6.478  1.00  0.74           C  
ATOM   1584  O   LEU A 207      -2.395  -7.865   5.773  1.00  0.74           O  
ATOM   1585  CB  LEU A 207      -0.388  -6.072   7.259  1.00  0.74           C  
ATOM   1586  CG  LEU A 207       0.921  -5.368   7.657  1.00  0.74           C  
ATOM   1587  CD1 LEU A 207       0.655  -3.897   7.973  1.00  0.74           C  
ATOM   1588  CD2 LEU A 207       1.578  -6.048   8.866  1.00  0.74           C  
ATOM   1589  N   TYR A 208      -1.489  -9.266   7.292  1.00  0.67           N  
ATOM   1590  CA  TYR A 208      -2.653 -10.108   7.465  1.00  0.67           C  
ATOM   1591  C   TYR A 208      -2.771 -10.453   8.933  1.00  0.67           C  
ATOM   1592  O   TYR A 208      -1.786 -10.396   9.671  1.00  0.67           O  
ATOM   1593  CB  TYR A 208      -2.530 -11.459   6.709  1.00  0.67           C  
ATOM   1594  CG  TYR A 208      -2.521 -11.251   5.222  1.00  0.67           C  
ATOM   1595  CD1 TYR A 208      -3.721 -11.207   4.511  1.00  0.67           C  
ATOM   1596  CD2 TYR A 208      -1.325 -11.076   4.519  1.00  0.67           C  
ATOM   1597  CE1 TYR A 208      -3.733 -10.928   3.141  1.00  0.67           C  
ATOM   1598  CE2 TYR A 208      -1.330 -10.784   3.151  1.00  0.67           C  
ATOM   1599  CZ  TYR A 208      -2.538 -10.649   2.465  1.00  0.67           C  
ATOM   1600  OH  TYR A 208      -2.602 -10.206   1.139  1.00  0.67           O  
ATOM   1601  N   ASP A 209      -3.977 -10.835   9.397  1.00  0.64           N  
ATOM   1602  CA  ASP A 209      -4.152 -11.483  10.679  1.00  0.64           C  
ATOM   1603  C   ASP A 209      -3.635 -12.925  10.671  1.00  0.64           C  
ATOM   1604  O   ASP A 209      -3.126 -13.444   9.674  1.00  0.64           O  
ATOM   1605  CB  ASP A 209      -5.602 -11.327  11.242  1.00  0.64           C  
ATOM   1606  CG  ASP A 209      -6.646 -12.262  10.641  1.00  0.64           C  
ATOM   1607  OD1 ASP A 209      -6.303 -13.047   9.723  1.00  0.64           O  
ATOM   1608  OD2 ASP A 209      -7.795 -12.259  11.144  1.00  0.64           O  
ATOM   1609  N   ALA A 210      -3.779 -13.623  11.813  1.00  0.58           N  
ATOM   1610  CA  ALA A 210      -3.417 -15.016  11.960  1.00  0.58           C  
ATOM   1611  C   ALA A 210      -4.174 -15.968  11.032  1.00  0.58           C  
ATOM   1612  O   ALA A 210      -3.667 -17.025  10.659  1.00  0.58           O  
ATOM   1613  CB  ALA A 210      -3.629 -15.431  13.429  1.00  0.58           C  
ATOM   1614  N   HIS A 211      -5.395 -15.594  10.605  1.00  0.60           N  
ATOM   1615  CA  HIS A 211      -6.237 -16.434   9.782  1.00  0.60           C  
ATOM   1616  C   HIS A 211      -6.069 -16.104   8.311  1.00  0.60           C  
ATOM   1617  O   HIS A 211      -6.608 -16.778   7.436  1.00  0.60           O  
ATOM   1618  CB  HIS A 211      -7.713 -16.219  10.169  1.00  0.60           C  
ATOM   1619  CG  HIS A 211      -7.957 -16.600  11.592  1.00  0.60           C  
ATOM   1620  ND1 HIS A 211      -7.732 -17.907  11.981  1.00  0.60           N  
ATOM   1621  CD2 HIS A 211      -8.308 -15.843  12.664  1.00  0.60           C  
ATOM   1622  CE1 HIS A 211      -7.946 -17.921  13.278  1.00  0.60           C  
ATOM   1623  NE2 HIS A 211      -8.298 -16.699  13.746  1.00  0.60           N  
ATOM   1624  N   GLY A 212      -5.263 -15.072   7.991  1.00  0.80           N  
ATOM   1625  CA  GLY A 212      -5.013 -14.629   6.632  1.00  0.80           C  
ATOM   1626  C   GLY A 212      -6.005 -13.628   6.126  1.00  0.80           C  
ATOM   1627  O   GLY A 212      -6.082 -13.399   4.920  1.00  0.80           O  
ATOM   1628  N   ALA A 213      -6.784 -12.993   7.014  1.00  0.83           N  
ATOM   1629  CA  ALA A 213      -7.664 -11.918   6.627  1.00  0.83           C  
ATOM   1630  C   ALA A 213      -6.918 -10.601   6.511  1.00  0.83           C  
ATOM   1631  O   ALA A 213      -5.913 -10.363   7.185  1.00  0.83           O  
ATOM   1632  CB  ALA A 213      -8.835 -11.779   7.609  1.00  0.83           C  
ATOM   1633  N   GLN A 214      -7.373  -9.708   5.614  1.00  0.74           N  
ATOM   1634  CA  GLN A 214      -6.752  -8.418   5.414  1.00  0.74           C  
ATOM   1635  C   GLN A 214      -7.318  -7.409   6.398  1.00  0.74           C  
ATOM   1636  O   GLN A 214      -8.532  -7.339   6.585  1.00  0.74           O  
ATOM   1637  CB  GLN A 214      -6.903  -7.858   3.974  1.00  0.74           C  
ATOM   1638  CG  GLN A 214      -5.832  -8.419   3.016  1.00  0.74           C  
ATOM   1639  CD  GLN A 214      -5.854  -7.835   1.605  1.00  0.74           C  
ATOM   1640  OE1 GLN A 214      -6.493  -6.829   1.293  1.00  0.74           O  
ATOM   1641  NE2 GLN A 214      -5.091  -8.485   0.689  1.00  0.74           N  
ATOM   1642  N   PRO A 215      -6.512  -6.587   7.055  1.00  0.83           N  
ATOM   1643  CA  PRO A 215      -7.038  -5.568   7.942  1.00  0.83           C  
ATOM   1644  C   PRO A 215      -7.680  -4.435   7.159  1.00  0.83           C  
ATOM   1645  O   PRO A 215      -7.271  -4.203   6.013  1.00  0.83           O  
ATOM   1646  CB  PRO A 215      -5.795  -5.084   8.688  1.00  0.83           C  
ATOM   1647  CG  PRO A 215      -4.669  -5.246   7.664  1.00  0.83           C  
ATOM   1648  CD  PRO A 215      -5.052  -6.535   6.949  1.00  0.83           C  
ATOM   1649  N   PRO A 216      -8.662  -3.725   7.701  1.00  0.82           N  
ATOM   1650  CA  PRO A 216      -9.226  -2.557   7.048  1.00  0.82           C  
ATOM   1651  C   PRO A 216      -8.205  -1.429   6.938  1.00  0.82           C  
ATOM   1652  O   PRO A 216      -7.353  -1.266   7.814  1.00  0.82           O  
ATOM   1653  CB  PRO A 216     -10.416  -2.197   7.946  1.00  0.82           C  
ATOM   1654  CG  PRO A 216     -10.003  -2.666   9.342  1.00  0.82           C  
ATOM   1655  CD  PRO A 216      -9.221  -3.942   9.042  1.00  0.82           C  
ATOM   1656  N   SER A 217      -8.241  -0.660   5.835  1.00  0.81           N  
ATOM   1657  CA  SER A 217      -7.214   0.313   5.514  1.00  0.81           C  
ATOM   1658  C   SER A 217      -7.720   1.741   5.521  1.00  0.81           C  
ATOM   1659  O   SER A 217      -8.897   2.023   5.295  1.00  0.81           O  
ATOM   1660  CB  SER A 217      -6.526   0.032   4.147  1.00  0.81           C  
ATOM   1661  OG  SER A 217      -7.461   0.001   3.067  1.00  0.81           O  
ATOM   1662  N   VAL A 218      -6.810   2.691   5.818  1.00  0.78           N  
ATOM   1663  CA  VAL A 218      -7.051   4.121   5.702  1.00  0.78           C  
ATOM   1664  C   VAL A 218      -6.036   4.687   4.728  1.00  0.78           C  
ATOM   1665  O   VAL A 218      -4.829   4.574   4.938  1.00  0.78           O  
ATOM   1666  CB  VAL A 218      -6.925   4.862   7.036  1.00  0.78           C  
ATOM   1667  CG1 VAL A 218      -7.162   6.374   6.857  1.00  0.78           C  
ATOM   1668  CG2 VAL A 218      -7.960   4.308   8.028  1.00  0.78           C  
ATOM   1669  N   GLU A 219      -6.492   5.317   3.629  1.00  0.70           N  
ATOM   1670  CA  GLU A 219      -5.618   5.956   2.663  1.00  0.70           C  
ATOM   1671  C   GLU A 219      -5.408   7.406   3.045  1.00  0.70           C  
ATOM   1672  O   GLU A 219      -6.360   8.137   3.327  1.00  0.70           O  
ATOM   1673  CB  GLU A 219      -6.160   5.926   1.219  1.00  0.70           C  
ATOM   1674  CG  GLU A 219      -6.314   4.514   0.603  1.00  0.70           C  
ATOM   1675  CD  GLU A 219      -6.759   4.579  -0.860  1.00  0.70           C  
ATOM   1676  OE1 GLU A 219      -7.226   3.534  -1.375  1.00  0.70           O  
ATOM   1677  OE2 GLU A 219      -6.617   5.665  -1.487  1.00  0.70           O  
ATOM   1678  N   VAL A 220      -4.141   7.861   3.088  1.00  0.81           N  
ATOM   1679  CA  VAL A 220      -3.803   9.182   3.590  1.00  0.81           C  
ATOM   1680  C   VAL A 220      -3.051  10.012   2.564  1.00  0.81           C  
ATOM   1681  O   VAL A 220      -2.278   9.499   1.754  1.00  0.81           O  
ATOM   1682  CB  VAL A 220      -3.033   9.152   4.910  1.00  0.81           C  
ATOM   1683  CG1 VAL A 220      -3.919   8.497   5.986  1.00  0.81           C  
ATOM   1684  CG2 VAL A 220      -1.702   8.392   4.766  1.00  0.81           C  
ATOM   1685  N   ASP A 221      -3.249  11.352   2.573  1.00  0.83           N  
ATOM   1686  CA  ASP A 221      -2.486  12.290   1.765  1.00  0.83           C  
ATOM   1687  C   ASP A 221      -1.104  12.557   2.364  1.00  0.83           C  
ATOM   1688  O   ASP A 221      -0.741  13.656   2.788  1.00  0.83           O  
ATOM   1689  CB  ASP A 221      -3.264  13.602   1.482  1.00  0.83           C  
ATOM   1690  CG  ASP A 221      -2.713  14.271   0.220  1.00  0.83           C  
ATOM   1691  OD1 ASP A 221      -2.755  13.606  -0.867  1.00  0.83           O  
ATOM   1692  OD2 ASP A 221      -2.232  15.443   0.318  1.00  0.83           O  
ATOM   1693  N   VAL A 222      -0.303  11.483   2.403  1.00  0.86           N  
ATOM   1694  CA  VAL A 222       1.093  11.477   2.763  1.00  0.86           C  
ATOM   1695  C   VAL A 222       1.783  10.840   1.584  1.00  0.86           C  
ATOM   1696  O   VAL A 222       1.416   9.745   1.162  1.00  0.86           O  
ATOM   1697  CB  VAL A 222       1.360  10.658   4.019  1.00  0.86           C  
ATOM   1698  CG1 VAL A 222       2.868  10.584   4.317  1.00  0.86           C  
ATOM   1699  CG2 VAL A 222       0.626  11.308   5.206  1.00  0.86           C  
ATOM   1700  N   VAL A 223       2.763  11.526   0.983  1.00  0.84           N  
ATOM   1701  CA  VAL A 223       3.333  11.131  -0.284  1.00  0.84           C  
ATOM   1702  C   VAL A 223       4.797  10.800  -0.106  1.00  0.84           C  
ATOM   1703  O   VAL A 223       5.585  11.558   0.458  1.00  0.84           O  
ATOM   1704  CB  VAL A 223       3.173  12.230  -1.330  1.00  0.84           C  
ATOM   1705  CG1 VAL A 223       3.829  11.854  -2.676  1.00  0.84           C  
ATOM   1706  CG2 VAL A 223       1.673  12.546  -1.516  1.00  0.84           C  
ATOM   1707  N   PHE A 224       5.203   9.631  -0.618  1.00  0.77           N  
ATOM   1708  CA  PHE A 224       6.580   9.218  -0.701  1.00  0.77           C  
ATOM   1709  C   PHE A 224       6.970   9.204  -2.161  1.00  0.77           C  
ATOM   1710  O   PHE A 224       6.220   8.757  -3.027  1.00  0.77           O  
ATOM   1711  CB  PHE A 224       6.802   7.798  -0.125  1.00  0.77           C  
ATOM   1712  CG  PHE A 224       6.760   7.820   1.376  1.00  0.77           C  
ATOM   1713  CD1 PHE A 224       7.954   7.850   2.112  1.00  0.77           C  
ATOM   1714  CD2 PHE A 224       5.537   7.799   2.068  1.00  0.77           C  
ATOM   1715  CE1 PHE A 224       7.929   7.875   3.510  1.00  0.77           C  
ATOM   1716  CE2 PHE A 224       5.510   7.827   3.469  1.00  0.77           C  
ATOM   1717  CZ  PHE A 224       6.708   7.864   4.192  1.00  0.77           C  
ATOM   1718  N   HIS A 225       8.174   9.706  -2.473  1.00  0.73           N  
ATOM   1719  CA  HIS A 225       8.731   9.601  -3.802  1.00  0.73           C  
ATOM   1720  C   HIS A 225       9.634   8.391  -3.864  1.00  0.73           C  
ATOM   1721  O   HIS A 225      10.603   8.285  -3.115  1.00  0.73           O  
ATOM   1722  CB  HIS A 225       9.547  10.840  -4.213  1.00  0.73           C  
ATOM   1723  CG  HIS A 225       8.704  12.070  -4.325  1.00  0.73           C  
ATOM   1724  ND1 HIS A 225       7.794  12.166  -5.356  1.00  0.73           N  
ATOM   1725  CD2 HIS A 225       8.685  13.202  -3.573  1.00  0.73           C  
ATOM   1726  CE1 HIS A 225       7.239  13.351  -5.218  1.00  0.73           C  
ATOM   1727  NE2 HIS A 225       7.741  14.023  -4.154  1.00  0.73           N  
ATOM   1728  N   HIS A 226       9.327   7.456  -4.770  1.00  0.68           N  
ATOM   1729  CA  HIS A 226      10.114   6.277  -5.030  1.00  0.68           C  
ATOM   1730  C   HIS A 226      11.111   6.580  -6.120  1.00  0.68           C  
ATOM   1731  O   HIS A 226      10.739   6.847  -7.263  1.00  0.68           O  
ATOM   1732  CB  HIS A 226       9.216   5.108  -5.491  1.00  0.68           C  
ATOM   1733  CG  HIS A 226       9.953   3.836  -5.669  1.00  0.68           C  
ATOM   1734  ND1 HIS A 226      10.631   3.380  -4.576  1.00  0.68           N  
ATOM   1735  CD2 HIS A 226      10.115   2.995  -6.723  1.00  0.68           C  
ATOM   1736  CE1 HIS A 226      11.198   2.259  -4.959  1.00  0.68           C  
ATOM   1737  NE2 HIS A 226      10.921   1.978  -6.258  1.00  0.68           N  
ATOM   1738  N   THR A 227      12.423   6.565  -5.808  1.00  0.65           N  
ATOM   1739  CA  THR A 227      13.431   6.932  -6.797  1.00  0.65           C  
ATOM   1740  C   THR A 227      13.674   5.833  -7.801  1.00  0.65           C  
ATOM   1741  O   THR A 227      14.151   6.093  -8.903  1.00  0.65           O  
ATOM   1742  CB  THR A 227      14.785   7.353  -6.224  1.00  0.65           C  
ATOM   1743  OG1 THR A 227      15.415   6.314  -5.494  1.00  0.65           O  
ATOM   1744  CG2 THR A 227      14.613   8.546  -5.276  1.00  0.65           C  
ATOM   1745  N   GLY A 228      13.332   4.567  -7.458  1.00  0.64           N  
ATOM   1746  CA  GLY A 228      13.505   3.430  -8.354  1.00  0.64           C  
ATOM   1747  C   GLY A 228      14.934   3.183  -8.712  1.00  0.64           C  
ATOM   1748  O   GLY A 228      15.251   2.799  -9.836  1.00  0.64           O  
ATOM   1749  N   TYR A 229      15.843   3.464  -7.766  1.00  0.52           N  
ATOM   1750  CA  TYR A 229      17.265   3.372  -7.965  1.00  0.52           C  
ATOM   1751  C   TYR A 229      17.714   1.932  -8.172  1.00  0.52           C  
ATOM   1752  O   TYR A 229      18.056   1.206  -7.246  1.00  0.52           O  
ATOM   1753  CB  TYR A 229      17.974   4.077  -6.780  1.00  0.52           C  
ATOM   1754  CG  TYR A 229      19.469   4.101  -6.885  1.00  0.52           C  
ATOM   1755  CD1 TYR A 229      20.227   3.240  -6.077  1.00  0.52           C  
ATOM   1756  CD2 TYR A 229      20.125   4.969  -7.772  1.00  0.52           C  
ATOM   1757  CE1 TYR A 229      21.619   3.215  -6.186  1.00  0.52           C  
ATOM   1758  CE2 TYR A 229      21.522   4.954  -7.872  1.00  0.52           C  
ATOM   1759  CZ  TYR A 229      22.254   4.041  -7.112  1.00  0.52           C  
ATOM   1760  OH  TYR A 229      23.595   3.785  -7.429  1.00  0.52           O  
ATOM   1761  N   GLU A 230      17.727   1.487  -9.435  1.00  0.51           N  
ATOM   1762  CA  GLU A 230      18.340   0.251  -9.831  1.00  0.51           C  
ATOM   1763  C   GLU A 230      19.442   0.561 -10.818  1.00  0.51           C  
ATOM   1764  O   GLU A 230      19.150   0.854 -11.982  1.00  0.51           O  
ATOM   1765  CB  GLU A 230      17.288  -0.688 -10.452  1.00  0.51           C  
ATOM   1766  CG  GLU A 230      16.784  -1.713  -9.416  1.00  0.51           C  
ATOM   1767  CD  GLU A 230      15.608  -2.526  -9.928  1.00  0.51           C  
ATOM   1768  OE1 GLU A 230      14.713  -2.816  -9.087  1.00  0.51           O  
ATOM   1769  OE2 GLU A 230      15.559  -2.895 -11.136  1.00  0.51           O  
ATOM   1770  N   PRO A 231      20.713   0.499 -10.456  1.00  0.48           N  
ATOM   1771  CA  PRO A 231      21.760   0.814 -11.391  1.00  0.48           C  
ATOM   1772  C   PRO A 231      22.160  -0.488 -12.023  1.00  0.48           C  
ATOM   1773  O   PRO A 231      22.542  -1.419 -11.326  1.00  0.48           O  
ATOM   1774  CB  PRO A 231      22.873   1.480 -10.571  1.00  0.48           C  
ATOM   1775  CG  PRO A 231      22.526   1.194  -9.108  1.00  0.48           C  
ATOM   1776  CD  PRO A 231      21.228   0.399  -9.092  1.00  0.48           C  
ATOM   1777  N   GLU A 232      22.090  -0.554 -13.354  1.00  0.46           N  
ATOM   1778  CA  GLU A 232      22.759  -1.557 -14.145  1.00  0.46           C  
ATOM   1779  C   GLU A 232      21.854  -2.704 -14.492  1.00  0.46           C  
ATOM   1780  O   GLU A 232      20.979  -3.152 -13.753  1.00  0.46           O  
ATOM   1781  CB  GLU A 232      24.142  -2.046 -13.659  1.00  0.46           C  
ATOM   1782  CG  GLU A 232      25.145  -0.899 -13.410  1.00  0.46           C  
ATOM   1783  CD  GLU A 232      26.448  -1.417 -12.813  1.00  0.46           C  
ATOM   1784  OE1 GLU A 232      27.285  -0.555 -12.443  1.00  0.46           O  
ATOM   1785  OE2 GLU A 232      26.617  -2.663 -12.736  1.00  0.46           O  
ATOM   1786  N   VAL A 233      22.058  -3.219 -15.708  1.00  0.37           N  
ATOM   1787  CA  VAL A 233      21.352  -4.335 -16.285  1.00  0.37           C  
ATOM   1788  C   VAL A 233      21.565  -5.588 -15.448  1.00  0.37           C  
ATOM   1789  O   VAL A 233      20.650  -6.382 -15.237  1.00  0.37           O  
ATOM   1790  CB  VAL A 233      21.826  -4.487 -17.723  1.00  0.37           C  
ATOM   1791  CG1 VAL A 233      21.267  -5.771 -18.357  1.00  0.37           C  
ATOM   1792  CG2 VAL A 233      21.382  -3.246 -18.532  1.00  0.37           C  
ATOM   1793  N   ILE A 234      22.788  -5.749 -14.903  1.00  0.41           N  
ATOM   1794  CA  ILE A 234      23.180  -6.818 -14.004  1.00  0.41           C  
ATOM   1795  C   ILE A 234      22.400  -6.829 -12.692  1.00  0.41           C  
ATOM   1796  O   ILE A 234      21.896  -7.873 -12.278  1.00  0.41           O  
ATOM   1797  CB  ILE A 234      24.685  -6.741 -13.751  1.00  0.41           C  
ATOM   1798  CG1 ILE A 234      25.461  -6.893 -15.087  1.00  0.41           C  
ATOM   1799  CG2 ILE A 234      25.110  -7.824 -12.731  1.00  0.41           C  
ATOM   1800  CD1 ILE A 234      26.964  -6.615 -14.960  1.00  0.41           C  
ATOM   1801  N   ALA A 235      22.223  -5.668 -12.023  1.00  0.44           N  
ATOM   1802  CA  ALA A 235      21.438  -5.569 -10.806  1.00  0.44           C  
ATOM   1803  C   ALA A 235      19.971  -5.915 -11.016  1.00  0.44           C  
ATOM   1804  O   ALA A 235      19.370  -6.672 -10.251  1.00  0.44           O  
ATOM   1805  CB  ALA A 235      21.563  -4.152 -10.230  1.00  0.44           C  
ATOM   1806  N   ARG A 236      19.382  -5.413 -12.118  1.00  0.43           N  
ATOM   1807  CA  ARG A 236      18.042  -5.760 -12.538  1.00  0.43           C  
ATOM   1808  C   ARG A 236      17.867  -7.244 -12.847  1.00  0.43           C  
ATOM   1809  O   ARG A 236      16.873  -7.864 -12.471  1.00  0.43           O  
ATOM   1810  CB  ARG A 236      17.672  -4.929 -13.783  1.00  0.43           C  
ATOM   1811  CG  ARG A 236      16.176  -4.995 -14.151  1.00  0.43           C  
ATOM   1812  CD  ARG A 236      15.819  -4.209 -15.414  1.00  0.43           C  
ATOM   1813  NE  ARG A 236      16.046  -2.769 -15.098  1.00  0.43           N  
ATOM   1814  CZ  ARG A 236      16.210  -1.795 -16.002  1.00  0.43           C  
ATOM   1815  NH1 ARG A 236      16.203  -2.037 -17.311  1.00  0.43           N  
ATOM   1816  NH2 ARG A 236      16.389  -0.546 -15.579  1.00  0.43           N  
ATOM   1817  N   LYS A 237      18.847  -7.864 -13.536  1.00  0.54           N  
ATOM   1818  CA  LYS A 237      18.846  -9.287 -13.820  1.00  0.54           C  
ATOM   1819  C   LYS A 237      18.913 -10.146 -12.565  1.00  0.54           C  
ATOM   1820  O   LYS A 237      18.101 -11.052 -12.385  1.00  0.54           O  
ATOM   1821  CB  LYS A 237      20.014  -9.638 -14.775  1.00  0.54           C  
ATOM   1822  CG  LYS A 237      19.986 -11.080 -15.306  1.00  0.54           C  
ATOM   1823  CD  LYS A 237      21.129 -11.372 -16.295  1.00  0.54           C  
ATOM   1824  CE  LYS A 237      21.135 -12.841 -16.736  1.00  0.54           C  
ATOM   1825  NZ  LYS A 237      22.268 -13.144 -17.634  1.00  0.54           N  
ATOM   1826  N   GLY A 238      19.825  -9.820 -11.622  1.00  0.59           N  
ATOM   1827  CA  GLY A 238      19.950 -10.541 -10.356  1.00  0.59           C  
ATOM   1828  C   GLY A 238      18.754 -10.409  -9.444  1.00  0.59           C  
ATOM   1829  O   GLY A 238      18.430 -11.307  -8.667  1.00  0.59           O  
ATOM   1830  N   LYS A 239      18.028  -9.276  -9.525  1.00  0.59           N  
ATOM   1831  CA  LYS A 239      16.739  -9.120  -8.882  1.00  0.59           C  
ATOM   1832  C   LYS A 239      15.676 -10.041  -9.457  1.00  0.59           C  
ATOM   1833  O   LYS A 239      14.938 -10.685  -8.712  1.00  0.59           O  
ATOM   1834  CB  LYS A 239      16.264  -7.651  -8.963  1.00  0.59           C  
ATOM   1835  CG  LYS A 239      14.946  -7.356  -8.223  1.00  0.59           C  
ATOM   1836  CD  LYS A 239      14.610  -5.857  -8.238  1.00  0.59           C  
ATOM   1837  CE  LYS A 239      13.346  -5.477  -7.456  1.00  0.59           C  
ATOM   1838  NZ  LYS A 239      13.171  -4.018  -7.497  1.00  0.59           N  
ATOM   1839  N   ARG A 240      15.595 -10.160 -10.799  1.00  0.54           N  
ATOM   1840  CA  ARG A 240      14.663 -11.053 -11.465  1.00  0.54           C  
ATOM   1841  C   ARG A 240      14.918 -12.522 -11.154  1.00  0.54           C  
ATOM   1842  O   ARG A 240      13.992 -13.266 -10.835  1.00  0.54           O  
ATOM   1843  CB  ARG A 240      14.706 -10.857 -12.999  1.00  0.54           C  
ATOM   1844  CG  ARG A 240      14.120  -9.519 -13.497  1.00  0.54           C  
ATOM   1845  CD  ARG A 240      14.288  -9.366 -15.013  1.00  0.54           C  
ATOM   1846  NE  ARG A 240      13.716  -8.045 -15.431  1.00  0.54           N  
ATOM   1847  CZ  ARG A 240      13.700  -7.613 -16.700  1.00  0.54           C  
ATOM   1848  NH1 ARG A 240      14.248  -8.318 -17.684  1.00  0.54           N  
ATOM   1849  NH2 ARG A 240      13.138  -6.440 -16.990  1.00  0.54           N  
ATOM   1850  N   GLU A 241      16.194 -12.959 -11.186  1.00  0.60           N  
ATOM   1851  CA  GLU A 241      16.607 -14.303 -10.826  1.00  0.60           C  
ATOM   1852  C   GLU A 241      16.285 -14.641  -9.378  1.00  0.60           C  
ATOM   1853  O   GLU A 241      15.782 -15.721  -9.064  1.00  0.60           O  
ATOM   1854  CB  GLU A 241      18.116 -14.478 -11.101  1.00  0.60           C  
ATOM   1855  CG  GLU A 241      18.463 -14.455 -12.611  1.00  0.60           C  
ATOM   1856  CD  GLU A 241      19.965 -14.433 -12.891  1.00  0.60           C  
ATOM   1857  OE1 GLU A 241      20.305 -14.396 -14.104  1.00  0.60           O  
ATOM   1858  OE2 GLU A 241      20.778 -14.437 -11.935  1.00  0.60           O  
ATOM   1859  N   ARG A 242      16.505 -13.686  -8.447  1.00  0.52           N  
ATOM   1860  CA  ARG A 242      16.067 -13.820  -7.072  1.00  0.52           C  
ATOM   1861  C   ARG A 242      14.561 -13.950  -6.924  1.00  0.52           C  
ATOM   1862  O   ARG A 242      14.080 -14.823  -6.209  1.00  0.52           O  
ATOM   1863  CB  ARG A 242      16.546 -12.607  -6.234  1.00  0.52           C  
ATOM   1864  CG  ARG A 242      16.169 -12.654  -4.734  1.00  0.52           C  
ATOM   1865  CD  ARG A 242      16.786 -11.526  -3.892  1.00  0.52           C  
ATOM   1866  NE  ARG A 242      16.169 -10.233  -4.345  1.00  0.52           N  
ATOM   1867  CZ  ARG A 242      16.754  -9.029  -4.260  1.00  0.52           C  
ATOM   1868  NH1 ARG A 242      17.985  -8.868  -3.786  1.00  0.52           N  
ATOM   1869  NH2 ARG A 242      16.082  -7.951  -4.662  1.00  0.52           N  
ATOM   1870  N   TYR A 243      13.769 -13.106  -7.613  1.00  0.56           N  
ATOM   1871  CA  TYR A 243      12.317 -13.157  -7.537  1.00  0.56           C  
ATOM   1872  C   TYR A 243      11.748 -14.456  -8.081  1.00  0.56           C  
ATOM   1873  O   TYR A 243      10.875 -15.056  -7.459  1.00  0.56           O  
ATOM   1874  CB  TYR A 243      11.656 -11.939  -8.237  1.00  0.56           C  
ATOM   1875  CG  TYR A 243      11.675 -10.653  -7.434  1.00  0.56           C  
ATOM   1876  CD1 TYR A 243      12.513 -10.411  -6.325  1.00  0.56           C  
ATOM   1877  CD2 TYR A 243      10.779  -9.642  -7.819  1.00  0.56           C  
ATOM   1878  CE1 TYR A 243      12.441  -9.198  -5.624  1.00  0.56           C  
ATOM   1879  CE2 TYR A 243      10.694  -8.437  -7.111  1.00  0.56           C  
ATOM   1880  CZ  TYR A 243      11.520  -8.218  -6.008  1.00  0.56           C  
ATOM   1881  OH  TYR A 243      11.415  -7.032  -5.262  1.00  0.56           O  
ATOM   1882  N   ALA A 244      12.278 -14.960  -9.213  1.00  0.71           N  
ATOM   1883  CA  ALA A 244      11.903 -16.243  -9.771  1.00  0.71           C  
ATOM   1884  C   ALA A 244      12.140 -17.408  -8.809  1.00  0.71           C  
ATOM   1885  O   ALA A 244      11.236 -18.200  -8.547  1.00  0.71           O  
ATOM   1886  CB  ALA A 244      12.694 -16.443 -11.078  1.00  0.71           C  
ATOM   1887  N   ARG A 245      13.328 -17.460  -8.168  1.00  0.66           N  
ATOM   1888  CA  ARG A 245      13.650 -18.434  -7.138  1.00  0.66           C  
ATOM   1889  C   ARG A 245      12.725 -18.360  -5.927  1.00  0.66           C  
ATOM   1890  O   ARG A 245      12.280 -19.376  -5.390  1.00  0.66           O  
ATOM   1891  CB  ARG A 245      15.113 -18.224  -6.666  1.00  0.66           C  
ATOM   1892  CG  ARG A 245      15.613 -19.282  -5.657  1.00  0.66           C  
ATOM   1893  CD  ARG A 245      17.005 -19.017  -5.064  1.00  0.66           C  
ATOM   1894  NE  ARG A 245      16.944 -17.801  -4.166  1.00  0.66           N  
ATOM   1895  CZ  ARG A 245      17.819 -16.789  -4.179  1.00  0.66           C  
ATOM   1896  NH1 ARG A 245      18.769 -16.683  -5.099  1.00  0.66           N  
ATOM   1897  NH2 ARG A 245      17.761 -15.848  -3.244  1.00  0.66           N  
ATOM   1898  N   LEU A 246      12.383 -17.140  -5.461  1.00  0.71           N  
ATOM   1899  CA  LEU A 246      11.430 -16.953  -4.382  1.00  0.71           C  
ATOM   1900  C   LEU A 246      10.037 -17.458  -4.725  1.00  0.71           C  
ATOM   1901  O   LEU A 246       9.411 -18.153  -3.927  1.00  0.71           O  
ATOM   1902  CB  LEU A 246      11.348 -15.469  -3.949  1.00  0.71           C  
ATOM   1903  CG  LEU A 246      12.609 -14.930  -3.243  1.00  0.71           C  
ATOM   1904  CD1 LEU A 246      12.490 -13.421  -2.979  1.00  0.71           C  
ATOM   1905  CD2 LEU A 246      12.899 -15.668  -1.934  1.00  0.71           C  
ATOM   1906  N   VAL A 247       9.534 -17.169  -5.941  1.00  0.74           N  
ATOM   1907  CA  VAL A 247       8.256 -17.669  -6.425  1.00  0.74           C  
ATOM   1908  C   VAL A 247       8.214 -19.191  -6.516  1.00  0.74           C  
ATOM   1909  O   VAL A 247       7.242 -19.815  -6.087  1.00  0.74           O  
ATOM   1910  CB  VAL A 247       7.889 -17.037  -7.760  1.00  0.74           C  
ATOM   1911  CG1 VAL A 247       6.628 -17.678  -8.360  1.00  0.74           C  
ATOM   1912  CG2 VAL A 247       7.628 -15.531  -7.572  1.00  0.74           C  
ATOM   1913  N   GLU A 248       9.291 -19.839  -7.014  1.00  0.73           N  
ATOM   1914  CA  GLU A 248       9.432 -21.288  -7.022  1.00  0.73           C  
ATOM   1915  C   GLU A 248       9.390 -21.902  -5.633  1.00  0.73           C  
ATOM   1916  O   GLU A 248       8.703 -22.891  -5.386  1.00  0.73           O  
ATOM   1917  CB  GLU A 248      10.761 -21.699  -7.690  1.00  0.73           C  
ATOM   1918  CG  GLU A 248      10.792 -21.473  -9.219  1.00  0.73           C  
ATOM   1919  CD  GLU A 248      12.150 -21.809  -9.839  1.00  0.73           C  
ATOM   1920  OE1 GLU A 248      12.213 -21.805 -11.096  1.00  0.73           O  
ATOM   1921  OE2 GLU A 248      13.121 -22.062  -9.079  1.00  0.73           O  
ATOM   1922  N   ARG A 249      10.086 -21.289  -4.658  1.00  0.71           N  
ATOM   1923  CA  ARG A 249      10.037 -21.710  -3.275  1.00  0.71           C  
ATOM   1924  C   ARG A 249       8.650 -21.609  -2.666  1.00  0.71           C  
ATOM   1925  O   ARG A 249       8.176 -22.537  -2.016  1.00  0.71           O  
ATOM   1926  CB  ARG A 249      11.034 -20.873  -2.453  1.00  0.71           C  
ATOM   1927  CG  ARG A 249      11.227 -21.366  -1.010  1.00  0.71           C  
ATOM   1928  CD  ARG A 249      12.371 -20.642  -0.308  1.00  0.71           C  
ATOM   1929  NE  ARG A 249      12.452 -21.195   1.072  1.00  0.71           N  
ATOM   1930  CZ  ARG A 249      13.525 -21.025   1.856  1.00  0.71           C  
ATOM   1931  NH1 ARG A 249      14.589 -20.330   1.456  1.00  0.71           N  
ATOM   1932  NH2 ARG A 249      13.556 -21.592   3.058  1.00  0.71           N  
ATOM   1933  N   CYS A 250       7.939 -20.496  -2.919  1.00  0.73           N  
ATOM   1934  CA  CYS A 250       6.560 -20.318  -2.507  1.00  0.73           C  
ATOM   1935  C   CYS A 250       5.602 -21.330  -3.108  1.00  0.73           C  
ATOM   1936  O   CYS A 250       4.729 -21.843  -2.420  1.00  0.73           O  
ATOM   1937  CB  CYS A 250       6.047 -18.917  -2.869  1.00  0.73           C  
ATOM   1938  SG  CYS A 250       6.949 -17.589  -2.014  1.00  0.73           S  
ATOM   1939  N   LEU A 251       5.759 -21.671  -4.402  1.00  0.73           N  
ATOM   1940  CA  LEU A 251       5.016 -22.742  -5.043  1.00  0.73           C  
ATOM   1941  C   LEU A 251       5.263 -24.102  -4.406  1.00  0.73           C  
ATOM   1942  O   LEU A 251       4.334 -24.877  -4.213  1.00  0.73           O  
ATOM   1943  CB  LEU A 251       5.363 -22.824  -6.549  1.00  0.73           C  
ATOM   1944  CG  LEU A 251       4.701 -21.753  -7.437  1.00  0.73           C  
ATOM   1945  CD1 LEU A 251       5.395 -21.701  -8.806  1.00  0.73           C  
ATOM   1946  CD2 LEU A 251       3.201 -22.027  -7.624  1.00  0.73           C  
ATOM   1947  N   THR A 252       6.519 -24.427  -4.044  1.00  0.72           N  
ATOM   1948  CA  THR A 252       6.844 -25.641  -3.295  1.00  0.72           C  
ATOM   1949  C   THR A 252       6.220 -25.677  -1.912  1.00  0.72           C  
ATOM   1950  O   THR A 252       5.633 -26.680  -1.512  1.00  0.72           O  
ATOM   1951  CB  THR A 252       8.349 -25.822  -3.149  1.00  0.72           C  
ATOM   1952  OG1 THR A 252       8.941 -25.918  -4.436  1.00  0.72           O  
ATOM   1953  CG2 THR A 252       8.726 -27.113  -2.406  1.00  0.72           C  
ATOM   1954  N   GLU A 253       6.317 -24.575  -1.143  1.00  0.71           N  
ATOM   1955  CA  GLU A 253       5.744 -24.466   0.187  1.00  0.71           C  
ATOM   1956  C   GLU A 253       4.211 -24.419   0.208  1.00  0.71           C  
ATOM   1957  O   GLU A 253       3.571 -25.108   1.002  1.00  0.71           O  
ATOM   1958  CB  GLU A 253       6.390 -23.268   0.941  1.00  0.71           C  
ATOM   1959  CG  GLU A 253       7.915 -23.493   1.210  1.00  0.71           C  
ATOM   1960  CD  GLU A 253       8.681 -22.333   1.849  1.00  0.71           C  
ATOM   1961  OE1 GLU A 253       9.948 -22.370   1.900  1.00  0.71           O  
ATOM   1962  OE2 GLU A 253       8.057 -21.347   2.315  1.00  0.71           O  
ATOM   1963  N   GLU A 254       3.574 -23.644  -0.693  1.00  0.62           N  
ATOM   1964  CA  GLU A 254       2.129 -23.494  -0.758  1.00  0.62           C  
ATOM   1965  C   GLU A 254       1.551 -23.837  -2.153  1.00  0.62           C  
ATOM   1966  O   GLU A 254       1.058 -22.939  -2.844  1.00  0.62           O  
ATOM   1967  CB  GLU A 254       1.711 -22.042  -0.381  1.00  0.62           C  
ATOM   1968  CG  GLU A 254       1.990 -21.579   1.080  1.00  0.62           C  
ATOM   1969  CD  GLU A 254       1.318 -20.242   1.409  1.00  0.62           C  
ATOM   1970  OE1 GLU A 254       0.976 -19.985   2.603  1.00  0.62           O  
ATOM   1971  OE2 GLU A 254       1.135 -19.444   0.459  1.00  0.62           O  
ATOM   1972  N   PRO A 255       1.529 -25.088  -2.640  1.00  0.70           N  
ATOM   1973  CA  PRO A 255       1.238 -25.416  -4.044  1.00  0.70           C  
ATOM   1974  C   PRO A 255      -0.204 -25.200  -4.441  1.00  0.70           C  
ATOM   1975  O   PRO A 255      -0.499 -25.056  -5.629  1.00  0.70           O  
ATOM   1976  CB  PRO A 255       1.619 -26.903  -4.165  1.00  0.70           C  
ATOM   1977  CG  PRO A 255       1.498 -27.440  -2.737  1.00  0.70           C  
ATOM   1978  CD  PRO A 255       1.998 -26.261  -1.906  1.00  0.70           C  
ATOM   1979  N   SER A 256      -1.121 -25.194  -3.466  1.00  0.63           N  
ATOM   1980  CA  SER A 256      -2.539 -24.992  -3.661  1.00  0.63           C  
ATOM   1981  C   SER A 256      -2.928 -23.539  -3.487  1.00  0.63           C  
ATOM   1982  O   SER A 256      -4.099 -23.193  -3.590  1.00  0.63           O  
ATOM   1983  CB  SER A 256      -3.346 -25.806  -2.618  1.00  0.63           C  
ATOM   1984  OG  SER A 256      -2.809 -25.626  -1.302  1.00  0.63           O  
ATOM   1985  N   ASN A 257      -1.966 -22.626  -3.251  1.00  0.57           N  
ATOM   1986  CA  ASN A 257      -2.260 -21.211  -3.158  1.00  0.57           C  
ATOM   1987  C   ASN A 257      -2.225 -20.583  -4.560  1.00  0.57           C  
ATOM   1988  O   ASN A 257      -1.153 -20.530  -5.173  1.00  0.57           O  
ATOM   1989  CB  ASN A 257      -1.250 -20.538  -2.193  1.00  0.57           C  
ATOM   1990  CG  ASN A 257      -1.600 -19.089  -1.882  1.00  0.57           C  
ATOM   1991  OD1 ASN A 257      -2.436 -18.462  -2.539  1.00  0.57           O  
ATOM   1992  ND2 ASN A 257      -0.943 -18.511  -0.858  1.00  0.57           N  
ATOM   1993  N   PRO A 258      -3.322 -20.073  -5.130  1.00  0.60           N  
ATOM   1994  CA  PRO A 258      -3.351 -19.631  -6.520  1.00  0.60           C  
ATOM   1995  C   PRO A 258      -2.583 -18.340  -6.744  1.00  0.60           C  
ATOM   1996  O   PRO A 258      -2.242 -18.027  -7.888  1.00  0.60           O  
ATOM   1997  CB  PRO A 258      -4.842 -19.487  -6.829  1.00  0.60           C  
ATOM   1998  CG  PRO A 258      -5.493 -19.231  -5.469  1.00  0.60           C  
ATOM   1999  CD  PRO A 258      -4.659 -20.084  -4.529  1.00  0.60           C  
ATOM   2000  N   LYS A 259      -2.267 -17.599  -5.664  1.00  0.55           N  
ATOM   2001  CA  LYS A 259      -1.490 -16.374  -5.664  1.00  0.55           C  
ATOM   2002  C   LYS A 259      -0.107 -16.572  -6.280  1.00  0.55           C  
ATOM   2003  O   LYS A 259       0.357 -15.773  -7.094  1.00  0.55           O  
ATOM   2004  CB  LYS A 259      -1.390 -15.872  -4.187  1.00  0.55           C  
ATOM   2005  CG  LYS A 259      -0.540 -14.609  -3.941  1.00  0.55           C  
ATOM   2006  CD  LYS A 259      -0.452 -14.131  -2.466  1.00  0.55           C  
ATOM   2007  CE  LYS A 259       0.500 -12.926  -2.313  1.00  0.55           C  
ATOM   2008  NZ  LYS A 259       0.507 -12.265  -0.995  1.00  0.55           N  
ATOM   2009  N   TRP A 260       0.581 -17.680  -5.942  1.00  0.65           N  
ATOM   2010  CA  TRP A 260       1.913 -17.972  -6.438  1.00  0.65           C  
ATOM   2011  C   TRP A 260       1.966 -18.401  -7.894  1.00  0.65           C  
ATOM   2012  O   TRP A 260       2.905 -18.075  -8.615  1.00  0.65           O  
ATOM   2013  CB  TRP A 260       2.625 -18.989  -5.524  1.00  0.65           C  
ATOM   2014  CG  TRP A 260       2.661 -18.548  -4.035  1.00  0.65           C  
ATOM   2015  CD1 TRP A 260       2.168 -19.232  -2.954  1.00  0.65           C  
ATOM   2016  CD2 TRP A 260       3.255 -17.358  -3.622  1.00  0.65           C  
ATOM   2017  NE1 TRP A 260       2.428 -18.476  -1.866  1.00  0.65           N  
ATOM   2018  CE2 TRP A 260       3.081 -17.337  -2.111  1.00  0.65           C  
ATOM   2019  CE3 TRP A 260       3.950 -16.320  -4.198  1.00  0.65           C  
ATOM   2020  CZ2 TRP A 260       3.660 -16.342  -1.427  1.00  0.65           C  
ATOM   2021  CZ3 TRP A 260       4.490 -15.299  -3.447  1.00  0.65           C  
ATOM   2022  CH2 TRP A 260       4.353 -15.319  -2.037  1.00  0.65           C  
ATOM   2023  N   HIS A 261       0.930 -19.106  -8.385  1.00  0.63           N  
ATOM   2024  CA  HIS A 261       0.785 -19.427  -9.797  1.00  0.63           C  
ATOM   2025  C   HIS A 261       0.623 -18.192 -10.665  1.00  0.63           C  
ATOM   2026  O   HIS A 261       1.219 -18.095 -11.736  1.00  0.63           O  
ATOM   2027  CB  HIS A 261      -0.397 -20.375 -10.030  1.00  0.63           C  
ATOM   2028  CG  HIS A 261      -0.212 -21.711  -9.379  1.00  0.63           C  
ATOM   2029  ND1 HIS A 261       0.527 -22.690 -10.021  1.00  0.63           N  
ATOM   2030  CD2 HIS A 261      -0.692 -22.179  -8.196  1.00  0.63           C  
ATOM   2031  CE1 HIS A 261       0.470 -23.736  -9.211  1.00  0.63           C  
ATOM   2032  NE2 HIS A 261      -0.250 -23.477  -8.093  1.00  0.63           N  
ATOM   2033  N   PHE A 262      -0.146 -17.187 -10.186  1.00  0.60           N  
ATOM   2034  CA  PHE A 262      -0.210 -15.876 -10.804  1.00  0.60           C  
ATOM   2035  C   PHE A 262       1.153 -15.194 -10.879  1.00  0.60           C  
ATOM   2036  O   PHE A 262       1.560 -14.732 -11.943  1.00  0.60           O  
ATOM   2037  CB  PHE A 262      -1.240 -15.000 -10.026  1.00  0.60           C  
ATOM   2038  CG  PHE A 262      -1.200 -13.547 -10.423  1.00  0.60           C  
ATOM   2039  CD1 PHE A 262      -0.458 -12.626  -9.664  1.00  0.60           C  
ATOM   2040  CD2 PHE A 262      -1.814 -13.115 -11.602  1.00  0.60           C  
ATOM   2041  CE1 PHE A 262      -0.344 -11.294 -10.075  1.00  0.60           C  
ATOM   2042  CE2 PHE A 262      -1.721 -11.777 -12.003  1.00  0.60           C  
ATOM   2043  CZ  PHE A 262      -0.985 -10.865 -11.239  1.00  0.60           C  
ATOM   2044  N   TYR A 263       1.911 -15.145  -9.766  1.00  0.63           N  
ATOM   2045  CA  TYR A 263       3.226 -14.527  -9.762  1.00  0.63           C  
ATOM   2046  C   TYR A 263       4.237 -15.240 -10.647  1.00  0.63           C  
ATOM   2047  O   TYR A 263       5.014 -14.605 -11.349  1.00  0.63           O  
ATOM   2048  CB  TYR A 263       3.759 -14.340  -8.323  1.00  0.63           C  
ATOM   2049  CG  TYR A 263       3.005 -13.247  -7.606  1.00  0.63           C  
ATOM   2050  CD1 TYR A 263       2.863 -11.967  -8.159  1.00  0.63           C  
ATOM   2051  CD2 TYR A 263       2.451 -13.476  -6.345  1.00  0.63           C  
ATOM   2052  CE1 TYR A 263       2.116 -10.982  -7.505  1.00  0.63           C  
ATOM   2053  CE2 TYR A 263       1.759 -12.467  -5.667  1.00  0.63           C  
ATOM   2054  CZ  TYR A 263       1.564 -11.221  -6.253  1.00  0.63           C  
ATOM   2055  OH  TYR A 263       0.848 -10.193  -5.613  1.00  0.63           O  
ATOM   2056  N   ALA A 264       4.211 -16.582 -10.700  1.00  0.68           N  
ATOM   2057  CA  ALA A 264       5.056 -17.361 -11.581  1.00  0.68           C  
ATOM   2058  C   ALA A 264       4.886 -17.039 -13.057  1.00  0.68           C  
ATOM   2059  O   ALA A 264       5.859 -16.954 -13.803  1.00  0.68           O  
ATOM   2060  CB  ALA A 264       4.765 -18.851 -11.333  1.00  0.68           C  
ATOM   2061  N   VAL A 265       3.636 -16.832 -13.512  1.00  0.66           N  
ATOM   2062  CA  VAL A 265       3.386 -16.335 -14.852  1.00  0.66           C  
ATOM   2063  C   VAL A 265       3.759 -14.864 -15.005  1.00  0.66           C  
ATOM   2064  O   VAL A 265       4.493 -14.505 -15.920  1.00  0.66           O  
ATOM   2065  CB  VAL A 265       1.939 -16.577 -15.266  1.00  0.66           C  
ATOM   2066  CG1 VAL A 265       1.684 -16.080 -16.703  1.00  0.66           C  
ATOM   2067  CG2 VAL A 265       1.630 -18.088 -15.187  1.00  0.66           C  
ATOM   2068  N   ARG A 266       3.319 -13.968 -14.090  1.00  0.59           N  
ATOM   2069  CA  ARG A 266       3.549 -12.535 -14.217  1.00  0.59           C  
ATOM   2070  C   ARG A 266       5.014 -12.141 -14.173  1.00  0.59           C  
ATOM   2071  O   ARG A 266       5.490 -11.367 -15.003  1.00  0.59           O  
ATOM   2072  CB  ARG A 266       2.798 -11.749 -13.107  1.00  0.59           C  
ATOM   2073  CG  ARG A 266       2.805 -10.209 -13.283  1.00  0.59           C  
ATOM   2074  CD  ARG A 266       2.533  -9.391 -12.008  1.00  0.59           C  
ATOM   2075  NE  ARG A 266       3.704  -9.511 -11.099  1.00  0.59           N  
ATOM   2076  CZ  ARG A 266       3.824  -9.028  -9.864  1.00  0.59           C  
ATOM   2077  NH1 ARG A 266       2.954  -8.229  -9.275  1.00  0.59           N  
ATOM   2078  NH2 ARG A 266       4.875  -9.433  -9.176  1.00  0.59           N  
ATOM   2079  N   ASP A 267       5.790 -12.696 -13.227  1.00  0.65           N  
ATOM   2080  CA  ASP A 267       7.160 -12.289 -13.008  1.00  0.65           C  
ATOM   2081  C   ASP A 267       8.085 -12.887 -14.068  1.00  0.65           C  
ATOM   2082  O   ASP A 267       9.152 -12.353 -14.369  1.00  0.65           O  
ATOM   2083  CB  ASP A 267       7.582 -12.618 -11.543  1.00  0.65           C  
ATOM   2084  CG  ASP A 267       6.827 -11.762 -10.535  1.00  0.65           C  
ATOM   2085  OD1 ASP A 267       6.012 -10.907 -10.973  1.00  0.65           O  
ATOM   2086  OD2 ASP A 267       7.030 -11.891  -9.298  1.00  0.65           O  
ATOM   2087  N   GLY A 268       7.640 -13.966 -14.753  1.00  0.66           N  
ATOM   2088  CA  GLY A 268       8.329 -14.526 -15.908  1.00  0.66           C  
ATOM   2089  C   GLY A 268       8.087 -13.776 -17.189  1.00  0.66           C  
ATOM   2090  O   GLY A 268       8.700 -14.088 -18.209  1.00  0.66           O  
ATOM   2091  N   LEU A 269       7.201 -12.764 -17.177  1.00  0.57           N  
ATOM   2092  CA  LEU A 269       6.926 -11.908 -18.313  1.00  0.57           C  
ATOM   2093  C   LEU A 269       7.486 -10.500 -18.130  1.00  0.57           C  
ATOM   2094  O   LEU A 269       7.418  -9.672 -19.036  1.00  0.57           O  
ATOM   2095  CB  LEU A 269       5.396 -11.809 -18.540  1.00  0.57           C  
ATOM   2096  CG  LEU A 269       4.724 -13.138 -18.942  1.00  0.57           C  
ATOM   2097  CD1 LEU A 269       3.198 -12.974 -19.004  1.00  0.57           C  
ATOM   2098  CD2 LEU A 269       5.284 -13.709 -20.255  1.00  0.57           C  
ATOM   2099  N   VAL A 270       8.096 -10.164 -16.973  1.00  0.49           N  
ATOM   2100  CA  VAL A 270       8.599  -8.815 -16.727  1.00  0.49           C  
ATOM   2101  C   VAL A 270       9.722  -8.410 -17.680  1.00  0.49           C  
ATOM   2102  O   VAL A 270      10.840  -8.928 -17.649  1.00  0.49           O  
ATOM   2103  CB  VAL A 270       8.994  -8.573 -15.270  1.00  0.49           C  
ATOM   2104  CG1 VAL A 270       9.650  -7.187 -15.066  1.00  0.49           C  
ATOM   2105  CG2 VAL A 270       7.726  -8.656 -14.398  1.00  0.49           C  
ATOM   2106  N   GLY A 271       9.440  -7.425 -18.564  1.00  0.34           N  
ATOM   2107  CA  GLY A 271      10.393  -6.939 -19.552  1.00  0.34           C  
ATOM   2108  C   GLY A 271      10.430  -7.710 -20.838  1.00  0.34           C  
ATOM   2109  O   GLY A 271      11.379  -7.562 -21.600  1.00  0.34           O  
ATOM   2110  N   ARG A 272       9.416  -8.545 -21.121  1.00  0.32           N  
ATOM   2111  CA  ARG A 272       9.361  -9.249 -22.382  1.00  0.32           C  
ATOM   2112  C   ARG A 272       7.929  -9.534 -22.767  1.00  0.32           C  
ATOM   2113  O   ARG A 272       7.004  -9.345 -21.983  1.00  0.32           O  
ATOM   2114  CB  ARG A 272      10.194 -10.560 -22.369  1.00  0.32           C  
ATOM   2115  CG  ARG A 272       9.665 -11.668 -21.435  1.00  0.32           C  
ATOM   2116  CD  ARG A 272      10.544 -12.921 -21.429  1.00  0.32           C  
ATOM   2117  NE  ARG A 272       9.775 -13.991 -20.734  1.00  0.32           N  
ATOM   2118  CZ  ARG A 272       9.170 -15.032 -21.320  1.00  0.32           C  
ATOM   2119  NH1 ARG A 272       9.121 -15.203 -22.635  1.00  0.32           N  
ATOM   2120  NH2 ARG A 272       8.578 -15.926 -20.538  1.00  0.32           N  
ATOM   2121  N   LYS A 273       7.699  -9.981 -24.016  1.00  0.40           N  
ATOM   2122  CA  LYS A 273       6.396 -10.432 -24.459  1.00  0.40           C  
ATOM   2123  C   LYS A 273       6.541 -11.879 -24.914  1.00  0.40           C  
ATOM   2124  O   LYS A 273       7.529 -12.193 -25.583  1.00  0.40           O  
ATOM   2125  CB  LYS A 273       5.804  -9.552 -25.591  1.00  0.40           C  
ATOM   2126  CG  LYS A 273       5.345  -8.169 -25.089  1.00  0.40           C  
ATOM   2127  CD  LYS A 273       4.691  -7.304 -26.184  1.00  0.40           C  
ATOM   2128  CE  LYS A 273       4.197  -5.945 -25.666  1.00  0.40           C  
ATOM   2129  NZ  LYS A 273       3.562  -5.166 -26.757  1.00  0.40           N  
ATOM   2130  N   PRO A 274       5.652 -12.801 -24.550  1.00  0.53           N  
ATOM   2131  CA  PRO A 274       5.737 -14.180 -24.995  1.00  0.53           C  
ATOM   2132  C   PRO A 274       5.240 -14.338 -26.422  1.00  0.53           C  
ATOM   2133  O   PRO A 274       4.372 -13.585 -26.864  1.00  0.53           O  
ATOM   2134  CB  PRO A 274       4.833 -14.913 -23.997  1.00  0.53           C  
ATOM   2135  CG  PRO A 274       3.727 -13.911 -23.659  1.00  0.53           C  
ATOM   2136  CD  PRO A 274       4.418 -12.550 -23.795  1.00  0.53           C  
ATOM   2137  N   GLY A 275       5.795 -15.297 -27.196  1.00  0.57           N  
ATOM   2138  CA  GLY A 275       5.217 -15.656 -28.495  1.00  0.57           C  
ATOM   2139  C   GLY A 275       3.888 -16.384 -28.373  1.00  0.57           C  
ATOM   2140  O   GLY A 275       3.562 -16.839 -27.275  1.00  0.57           O  
ATOM   2141  N   PRO A 276       3.111 -16.569 -29.447  1.00  0.58           N  
ATOM   2142  CA  PRO A 276       1.767 -17.151 -29.390  1.00  0.58           C  
ATOM   2143  C   PRO A 276       1.647 -18.475 -28.655  1.00  0.58           C  
ATOM   2144  O   PRO A 276       0.813 -18.593 -27.758  1.00  0.58           O  
ATOM   2145  CB  PRO A 276       1.326 -17.234 -30.860  1.00  0.58           C  
ATOM   2146  CG  PRO A 276       2.058 -16.063 -31.522  1.00  0.58           C  
ATOM   2147  CD  PRO A 276       3.397 -16.015 -30.776  1.00  0.58           C  
ATOM   2148  N   ASP A 277       2.497 -19.467 -28.978  1.00  0.58           N  
ATOM   2149  CA  ASP A 277       2.533 -20.769 -28.340  1.00  0.58           C  
ATOM   2150  C   ASP A 277       2.839 -20.703 -26.846  1.00  0.58           C  
ATOM   2151  O   ASP A 277       2.198 -21.357 -26.020  1.00  0.58           O  
ATOM   2152  CB  ASP A 277       3.606 -21.629 -29.047  1.00  0.58           C  
ATOM   2153  CG  ASP A 277       3.287 -21.786 -30.528  1.00  0.58           C  
ATOM   2154  OD1 ASP A 277       2.085 -21.789 -30.888  1.00  0.58           O  
ATOM   2155  OD2 ASP A 277       4.267 -21.860 -31.312  1.00  0.58           O  
ATOM   2156  N   GLU A 278       3.816 -19.854 -26.456  1.00  0.54           N  
ATOM   2157  CA  GLU A 278       4.156 -19.599 -25.068  1.00  0.54           C  
ATOM   2158  C   GLU A 278       3.008 -18.947 -24.312  1.00  0.54           C  
ATOM   2159  O   GLU A 278       2.650 -19.364 -23.210  1.00  0.54           O  
ATOM   2160  CB  GLU A 278       5.441 -18.739 -24.940  1.00  0.54           C  
ATOM   2161  CG  GLU A 278       5.919 -18.603 -23.471  1.00  0.54           C  
ATOM   2162  CD  GLU A 278       7.108 -17.685 -23.234  1.00  0.54           C  
ATOM   2163  OE1 GLU A 278       7.671 -17.771 -22.112  1.00  0.54           O  
ATOM   2164  OE2 GLU A 278       7.471 -16.841 -24.092  1.00  0.54           O  
ATOM   2165  N   ALA A 279       2.342 -17.949 -24.928  1.00  0.58           N  
ATOM   2166  CA  ALA A 279       1.178 -17.292 -24.376  1.00  0.58           C  
ATOM   2167  C   ALA A 279       0.014 -18.249 -24.121  1.00  0.58           C  
ATOM   2168  O   ALA A 279      -0.614 -18.215 -23.063  1.00  0.58           O  
ATOM   2169  CB  ALA A 279       0.765 -16.143 -25.317  1.00  0.58           C  
ATOM   2170  N   LEU A 280      -0.262 -19.174 -25.062  1.00  0.54           N  
ATOM   2171  CA  LEU A 280      -1.249 -20.226 -24.900  1.00  0.54           C  
ATOM   2172  C   LEU A 280      -0.919 -21.204 -23.781  1.00  0.54           C  
ATOM   2173  O   LEU A 280      -1.775 -21.570 -22.974  1.00  0.54           O  
ATOM   2174  CB  LEU A 280      -1.433 -20.973 -26.241  1.00  0.54           C  
ATOM   2175  CG  LEU A 280      -2.482 -22.106 -26.251  1.00  0.54           C  
ATOM   2176  CD1 LEU A 280      -3.887 -21.597 -25.900  1.00  0.54           C  
ATOM   2177  CD2 LEU A 280      -2.497 -22.786 -27.628  1.00  0.54           C  
ATOM   2178  N   ALA A 281       0.352 -21.635 -23.671  1.00  0.63           N  
ATOM   2179  CA  ALA A 281       0.803 -22.497 -22.601  1.00  0.63           C  
ATOM   2180  C   ALA A 281       0.682 -21.868 -21.214  1.00  0.63           C  
ATOM   2181  O   ALA A 281       0.179 -22.483 -20.271  1.00  0.63           O  
ATOM   2182  CB  ALA A 281       2.253 -22.919 -22.892  1.00  0.63           C  
ATOM   2183  N   LEU A 282       1.083 -20.590 -21.078  1.00  0.63           N  
ATOM   2184  CA  LEU A 282       0.909 -19.810 -19.868  1.00  0.63           C  
ATOM   2185  C   LEU A 282      -0.550 -19.589 -19.506  1.00  0.63           C  
ATOM   2186  O   LEU A 282      -0.933 -19.707 -18.342  1.00  0.63           O  
ATOM   2187  CB  LEU A 282       1.630 -18.451 -19.996  1.00  0.63           C  
ATOM   2188  CG  LEU A 282       3.169 -18.548 -20.050  1.00  0.63           C  
ATOM   2189  CD1 LEU A 282       3.775 -17.182 -20.396  1.00  0.63           C  
ATOM   2190  CD2 LEU A 282       3.776 -19.077 -18.740  1.00  0.63           C  
ATOM   2191  N   PHE A 283      -1.412 -19.309 -20.506  1.00  0.51           N  
ATOM   2192  CA  PHE A 283      -2.844 -19.168 -20.328  1.00  0.51           C  
ATOM   2193  C   PHE A 283      -3.495 -20.419 -19.759  1.00  0.51           C  
ATOM   2194  O   PHE A 283      -4.266 -20.341 -18.807  1.00  0.51           O  
ATOM   2195  CB  PHE A 283      -3.480 -18.806 -21.699  1.00  0.51           C  
ATOM   2196  CG  PHE A 283      -4.983 -18.758 -21.675  1.00  0.51           C  
ATOM   2197  CD1 PHE A 283      -5.740 -19.900 -21.992  1.00  0.51           C  
ATOM   2198  CD2 PHE A 283      -5.644 -17.588 -21.294  1.00  0.51           C  
ATOM   2199  CE1 PHE A 283      -7.133 -19.888 -21.856  1.00  0.51           C  
ATOM   2200  CE2 PHE A 283      -7.038 -17.565 -21.186  1.00  0.51           C  
ATOM   2201  CZ  PHE A 283      -7.783 -18.723 -21.434  1.00  0.51           C  
ATOM   2202  N   ARG A 284      -3.178 -21.609 -20.304  1.00  0.57           N  
ATOM   2203  CA  ARG A 284      -3.725 -22.863 -19.822  1.00  0.57           C  
ATOM   2204  C   ARG A 284      -3.333 -23.158 -18.386  1.00  0.57           C  
ATOM   2205  O   ARG A 284      -4.177 -23.502 -17.562  1.00  0.57           O  
ATOM   2206  CB  ARG A 284      -3.262 -24.021 -20.729  1.00  0.57           C  
ATOM   2207  CG  ARG A 284      -3.936 -24.028 -22.116  1.00  0.57           C  
ATOM   2208  CD  ARG A 284      -3.375 -25.136 -23.009  1.00  0.57           C  
ATOM   2209  NE  ARG A 284      -4.125 -25.110 -24.307  1.00  0.57           N  
ATOM   2210  CZ  ARG A 284      -3.718 -25.733 -25.422  1.00  0.57           C  
ATOM   2211  NH1 ARG A 284      -2.555 -26.376 -25.477  1.00  0.57           N  
ATOM   2212  NH2 ARG A 284      -4.491 -25.711 -26.505  1.00  0.57           N  
ATOM   2213  N   ARG A 285      -2.046 -22.946 -18.048  1.00  0.61           N  
ATOM   2214  CA  ARG A 285      -1.534 -23.089 -16.700  1.00  0.61           C  
ATOM   2215  C   ARG A 285      -2.198 -22.138 -15.716  1.00  0.61           C  
ATOM   2216  O   ARG A 285      -2.595 -22.517 -14.616  1.00  0.61           O  
ATOM   2217  CB  ARG A 285      -0.011 -22.812 -16.719  1.00  0.61           C  
ATOM   2218  CG  ARG A 285       0.689 -22.940 -15.350  1.00  0.61           C  
ATOM   2219  CD  ARG A 285       2.183 -22.614 -15.416  1.00  0.61           C  
ATOM   2220  NE  ARG A 285       2.703 -22.678 -14.013  1.00  0.61           N  
ATOM   2221  CZ  ARG A 285       3.974 -22.438 -13.664  1.00  0.61           C  
ATOM   2222  NH1 ARG A 285       4.899 -22.122 -14.565  1.00  0.61           N  
ATOM   2223  NH2 ARG A 285       4.323 -22.523 -12.381  1.00  0.61           N  
ATOM   2224  N   LEU A 286      -2.360 -20.858 -16.102  1.00  0.60           N  
ATOM   2225  CA  LEU A 286      -3.045 -19.878 -15.290  1.00  0.60           C  
ATOM   2226  C   LEU A 286      -4.529 -20.173 -15.140  1.00  0.60           C  
ATOM   2227  O   LEU A 286      -5.097 -20.017 -14.064  1.00  0.60           O  
ATOM   2228  CB  LEU A 286      -2.778 -18.451 -15.819  1.00  0.60           C  
ATOM   2229  CG  LEU A 286      -3.101 -17.317 -14.826  1.00  0.60           C  
ATOM   2230  CD1 LEU A 286      -2.294 -17.427 -13.521  1.00  0.60           C  
ATOM   2231  CD2 LEU A 286      -2.839 -15.950 -15.471  1.00  0.60           C  
ATOM   2232  N   ARG A 287      -5.197 -20.657 -16.207  1.00  0.49           N  
ATOM   2233  CA  ARG A 287      -6.578 -21.097 -16.165  1.00  0.49           C  
ATOM   2234  C   ARG A 287      -6.812 -22.273 -15.228  1.00  0.49           C  
ATOM   2235  O   ARG A 287      -7.763 -22.260 -14.448  1.00  0.49           O  
ATOM   2236  CB  ARG A 287      -7.093 -21.445 -17.589  1.00  0.49           C  
ATOM   2237  CG  ARG A 287      -8.614 -21.698 -17.696  1.00  0.49           C  
ATOM   2238  CD  ARG A 287      -9.425 -20.434 -17.405  1.00  0.49           C  
ATOM   2239  NE  ARG A 287     -10.877 -20.793 -17.330  1.00  0.49           N  
ATOM   2240  CZ  ARG A 287     -11.775 -20.011 -16.716  1.00  0.49           C  
ATOM   2241  NH1 ARG A 287     -11.426 -18.828 -16.216  1.00  0.49           N  
ATOM   2242  NH2 ARG A 287     -13.035 -20.422 -16.594  1.00  0.49           N  
ATOM   2243  N   GLU A 288      -5.927 -23.292 -15.252  1.00  0.60           N  
ATOM   2244  CA  GLU A 288      -5.955 -24.414 -14.331  1.00  0.60           C  
ATOM   2245  C   GLU A 288      -5.746 -23.990 -12.887  1.00  0.60           C  
ATOM   2246  O   GLU A 288      -6.526 -24.323 -11.997  1.00  0.60           O  
ATOM   2247  CB  GLU A 288      -4.873 -25.431 -14.751  1.00  0.60           C  
ATOM   2248  CG  GLU A 288      -4.866 -26.757 -13.953  1.00  0.60           C  
ATOM   2249  CD  GLU A 288      -3.780 -27.720 -14.440  1.00  0.60           C  
ATOM   2250  OE1 GLU A 288      -3.773 -28.873 -13.938  1.00  0.60           O  
ATOM   2251  OE2 GLU A 288      -2.955 -27.318 -15.302  1.00  0.60           O  
ATOM   2252  N   ALA A 289      -4.737 -23.138 -12.628  1.00  0.65           N  
ATOM   2253  CA  ALA A 289      -4.489 -22.572 -11.321  1.00  0.65           C  
ATOM   2254  C   ALA A 289      -5.608 -21.672 -10.815  1.00  0.65           C  
ATOM   2255  O   ALA A 289      -5.875 -21.586  -9.620  1.00  0.65           O  
ATOM   2256  CB  ALA A 289      -3.164 -21.806 -11.353  1.00  0.65           C  
ATOM   2257  N   HIS A 290      -6.325 -20.990 -11.725  1.00  0.48           N  
ATOM   2258  CA  HIS A 290      -7.474 -20.172 -11.399  1.00  0.48           C  
ATOM   2259  C   HIS A 290      -8.634 -20.962 -10.810  1.00  0.48           C  
ATOM   2260  O   HIS A 290      -9.404 -20.432 -10.019  1.00  0.48           O  
ATOM   2261  CB  HIS A 290      -7.946 -19.355 -12.619  1.00  0.48           C  
ATOM   2262  CG  HIS A 290      -8.833 -18.213 -12.243  1.00  0.48           C  
ATOM   2263  ND1 HIS A 290      -8.264 -16.983 -11.962  1.00  0.48           N  
ATOM   2264  CD2 HIS A 290     -10.164 -18.193 -11.982  1.00  0.48           C  
ATOM   2265  CE1 HIS A 290      -9.267 -16.240 -11.528  1.00  0.48           C  
ATOM   2266  NE2 HIS A 290     -10.435 -16.926 -11.520  1.00  0.48           N  
ATOM   2267  N   ALA A 291      -8.754 -22.270 -11.125  1.00  0.50           N  
ATOM   2268  CA  ALA A 291      -9.784 -23.133 -10.578  1.00  0.50           C  
ATOM   2269  C   ALA A 291      -9.620 -23.370  -9.078  1.00  0.50           C  
ATOM   2270  O   ALA A 291     -10.571 -23.681  -8.368  1.00  0.50           O  
ATOM   2271  CB  ALA A 291      -9.779 -24.469 -11.342  1.00  0.50           C  
ATOM   2272  N   LEU A 292      -8.410 -23.114  -8.534  1.00  0.36           N  
ATOM   2273  CA  LEU A 292      -8.161 -23.122  -7.106  1.00  0.36           C  
ATOM   2274  C   LEU A 292      -8.853 -21.961  -6.381  1.00  0.36           C  
ATOM   2275  O   LEU A 292      -8.993 -21.974  -5.163  1.00  0.36           O  
ATOM   2276  CB  LEU A 292      -6.645 -23.041  -6.809  1.00  0.36           C  
ATOM   2277  CG  LEU A 292      -5.763 -24.164  -7.394  1.00  0.36           C  
ATOM   2278  CD1 LEU A 292      -4.282 -23.755  -7.312  1.00  0.36           C  
ATOM   2279  CD2 LEU A 292      -5.984 -25.501  -6.675  1.00  0.36           C  
ATOM   2280  N   TYR A 293      -9.352 -20.923  -7.100  1.00  0.32           N  
ATOM   2281  CA  TYR A 293     -10.151 -19.868  -6.498  1.00  0.32           C  
ATOM   2282  C   TYR A 293     -11.569 -20.320  -6.186  1.00  0.32           C  
ATOM   2283  O   TYR A 293     -12.251 -19.684  -5.383  1.00  0.32           O  
ATOM   2284  CB  TYR A 293     -10.200 -18.578  -7.363  1.00  0.32           C  
ATOM   2285  CG  TYR A 293      -8.887 -17.835  -7.358  1.00  0.32           C  
ATOM   2286  CD1 TYR A 293      -8.418 -17.220  -6.185  1.00  0.32           C  
ATOM   2287  CD2 TYR A 293      -8.129 -17.699  -8.531  1.00  0.32           C  
ATOM   2288  CE1 TYR A 293      -7.207 -16.513  -6.182  1.00  0.32           C  
ATOM   2289  CE2 TYR A 293      -6.904 -17.018  -8.526  1.00  0.32           C  
ATOM   2290  CZ  TYR A 293      -6.436 -16.438  -7.343  1.00  0.32           C  
ATOM   2291  OH  TYR A 293      -5.200 -15.763  -7.320  1.00  0.32           O  
ATOM   2292  N   ASP A 294     -12.014 -21.453  -6.768  1.00  0.36           N  
ATOM   2293  CA  ASP A 294     -13.337 -21.988  -6.558  1.00  0.36           C  
ATOM   2294  C   ASP A 294     -13.314 -23.068  -5.454  1.00  0.36           C  
ATOM   2295  O   ASP A 294     -14.351 -23.619  -5.081  1.00  0.36           O  
ATOM   2296  CB  ASP A 294     -13.887 -22.521  -7.916  1.00  0.36           C  
ATOM   2297  CG  ASP A 294     -13.899 -21.423  -8.982  1.00  0.36           C  
ATOM   2298  OD1 ASP A 294     -14.453 -20.328  -8.707  1.00  0.36           O  
ATOM   2299  OD2 ASP A 294     -13.367 -21.678 -10.099  1.00  0.36           O  
ATOM   2300  N   GLU A 295     -12.130 -23.371  -4.857  1.00  0.32           N  
ATOM   2301  CA  GLU A 295     -11.965 -24.396  -3.826  1.00  0.32           C  
ATOM   2302  C   GLU A 295     -12.007 -23.921  -2.355  1.00  0.32           C  
ATOM   2303  O   GLU A 295     -11.113 -23.243  -1.848  1.00  0.32           O  
ATOM   2304  CB  GLU A 295     -10.668 -25.222  -4.016  1.00  0.32           C  
ATOM   2305  CG  GLU A 295     -10.494 -26.027  -5.334  1.00  0.32           C  
ATOM   2306  CD  GLU A 295      -9.204 -26.859  -5.303  1.00  0.32           C  
ATOM   2307  OE1 GLU A 295      -8.943 -27.566  -6.310  1.00  0.32           O  
ATOM   2308  OE2 GLU A 295      -8.475 -26.810  -4.278  1.00  0.32           O  
ATOM   2309  N   ALA A 296     -13.050 -24.312  -1.587  1.00  0.31           N  
ATOM   2310  CA  ALA A 296     -13.287 -23.934  -0.199  1.00  0.31           C  
ATOM   2311  C   ALA A 296     -13.421 -22.422   0.067  1.00  0.31           C  
ATOM   2312  O   ALA A 296     -13.330 -21.630  -0.879  1.00  0.31           O  
ATOM   2313  CB  ALA A 296     -12.243 -24.682   0.656  1.00  0.31           C  
ATOM   2314  N   PRO A 297     -13.733 -21.903   1.261  1.00  0.27           N  
ATOM   2315  CA  PRO A 297     -13.519 -20.496   1.559  1.00  0.27           C  
ATOM   2316  C   PRO A 297     -12.036 -20.209   1.685  1.00  0.27           C  
ATOM   2317  O   PRO A 297     -11.391 -20.704   2.607  1.00  0.27           O  
ATOM   2318  CB  PRO A 297     -14.322 -20.226   2.844  1.00  0.27           C  
ATOM   2319  CG  PRO A 297     -14.541 -21.594   3.507  1.00  0.27           C  
ATOM   2320  CD  PRO A 297     -14.303 -22.629   2.396  1.00  0.27           C  
ATOM   2321  N   LEU A 298     -11.496 -19.390   0.771  1.00  0.31           N  
ATOM   2322  CA  LEU A 298     -10.135 -18.906   0.822  1.00  0.31           C  
ATOM   2323  C   LEU A 298      -9.954 -17.749   1.795  1.00  0.31           C  
ATOM   2324  O   LEU A 298     -10.885 -16.995   2.082  1.00  0.31           O  
ATOM   2325  CB  LEU A 298      -9.695 -18.431  -0.581  1.00  0.31           C  
ATOM   2326  CG  LEU A 298      -9.612 -19.545  -1.639  1.00  0.31           C  
ATOM   2327  CD1 LEU A 298      -9.306 -18.937  -3.009  1.00  0.31           C  
ATOM   2328  CD2 LEU A 298      -8.551 -20.596  -1.288  1.00  0.31           C  
ATOM   2329  N   SER A 299      -8.730 -17.564   2.330  1.00  0.32           N  
ATOM   2330  CA  SER A 299      -8.357 -16.368   3.063  1.00  0.32           C  
ATOM   2331  C   SER A 299      -8.051 -15.238   2.111  1.00  0.32           C  
ATOM   2332  O   SER A 299      -7.773 -15.465   0.935  1.00  0.32           O  
ATOM   2333  CB  SER A 299      -7.216 -16.597   4.128  1.00  0.32           C  
ATOM   2334  OG  SER A 299      -5.918 -16.817   3.636  1.00  0.32           O  
ATOM   2335  N   ASP A 300      -8.103 -13.965   2.564  1.00  0.33           N  
ATOM   2336  CA  ASP A 300      -7.791 -12.790   1.758  1.00  0.33           C  
ATOM   2337  C   ASP A 300      -6.383 -12.860   1.179  1.00  0.33           C  
ATOM   2338  O   ASP A 300      -6.104 -12.381   0.083  1.00  0.33           O  
ATOM   2339  CB  ASP A 300      -7.925 -11.497   2.594  1.00  0.33           C  
ATOM   2340  CG  ASP A 300      -9.336 -11.289   3.120  1.00  0.33           C  
ATOM   2341  OD1 ASP A 300     -10.282 -11.915   2.588  1.00  0.33           O  
ATOM   2342  OD2 ASP A 300      -9.460 -10.495   4.086  1.00  0.33           O  
ATOM   2343  N   TYR A 301      -5.455 -13.510   1.911  1.00  0.29           N  
ATOM   2344  CA  TYR A 301      -4.123 -13.828   1.447  1.00  0.29           C  
ATOM   2345  C   TYR A 301      -4.112 -14.722   0.212  1.00  0.29           C  
ATOM   2346  O   TYR A 301      -3.422 -14.436  -0.764  1.00  0.29           O  
ATOM   2347  CB  TYR A 301      -3.368 -14.497   2.630  1.00  0.29           C  
ATOM   2348  CG  TYR A 301      -2.004 -15.004   2.265  1.00  0.29           C  
ATOM   2349  CD1 TYR A 301      -1.718 -16.378   2.273  1.00  0.29           C  
ATOM   2350  CD2 TYR A 301      -1.002 -14.098   1.908  1.00  0.29           C  
ATOM   2351  CE1 TYR A 301      -0.424 -16.832   1.986  1.00  0.29           C  
ATOM   2352  CE2 TYR A 301       0.283 -14.547   1.615  1.00  0.29           C  
ATOM   2353  CZ  TYR A 301       0.580 -15.902   1.671  1.00  0.29           C  
ATOM   2354  OH  TYR A 301       1.895 -16.274   1.448  1.00  0.29           O  
ATOM   2355  N   GLU A 302      -4.900 -15.807   0.222  1.00  0.70           N  
ATOM   2356  CA  GLU A 302      -5.028 -16.732  -0.887  1.00  0.70           C  
ATOM   2357  C   GLU A 302      -5.798 -16.119  -2.047  1.00  0.70           C  
ATOM   2358  O   GLU A 302      -5.474 -16.305  -3.217  1.00  0.70           O  
ATOM   2359  CB  GLU A 302      -5.687 -18.034  -0.385  1.00  0.70           C  
ATOM   2360  CG  GLU A 302      -4.831 -18.744   0.696  1.00  0.70           C  
ATOM   2361  CD  GLU A 302      -5.628 -19.719   1.555  1.00  0.70           C  
ATOM   2362  OE1 GLU A 302      -5.204 -20.888   1.699  1.00  0.70           O  
ATOM   2363  OE2 GLU A 302      -6.626 -19.234   2.164  1.00  0.70           O  
ATOM   2364  N   ALA A 303      -6.822 -15.299  -1.743  1.00  0.77           N  
ATOM   2365  CA  ALA A 303      -7.703 -14.712  -2.723  1.00  0.77           C  
ATOM   2366  C   ALA A 303      -7.197 -13.398  -3.329  1.00  0.77           C  
ATOM   2367  O   ALA A 303      -7.805 -12.863  -4.259  1.00  0.77           O  
ATOM   2368  CB  ALA A 303      -9.064 -14.478  -2.044  1.00  0.77           C  
ATOM   2369  N   GLU A 304      -6.033 -12.890  -2.868  1.00  0.36           N  
ATOM   2370  CA  GLU A 304      -5.458 -11.588  -3.178  1.00  0.36           C  
ATOM   2371  C   GLU A 304      -5.351 -11.283  -4.670  1.00  0.36           C  
ATOM   2372  O   GLU A 304      -5.604 -10.163  -5.109  1.00  0.36           O  
ATOM   2373  CB  GLU A 304      -4.047 -11.521  -2.523  1.00  0.36           C  
ATOM   2374  CG  GLU A 304      -3.367 -10.132  -2.515  1.00  0.36           C  
ATOM   2375  CD  GLU A 304      -1.875 -10.236  -2.337  1.00  0.36           C  
ATOM   2376  OE1 GLU A 304      -1.107  -9.800  -3.235  1.00  0.36           O  
ATOM   2377  OE2 GLU A 304      -1.494 -10.746  -1.258  1.00  0.36           O  
ATOM   2378  N   ARG A 305      -5.001 -12.292  -5.495  1.00  0.38           N  
ATOM   2379  CA  ARG A 305      -4.746 -12.102  -6.911  1.00  0.38           C  
ATOM   2380  C   ARG A 305      -5.820 -12.680  -7.826  1.00  0.38           C  
ATOM   2381  O   ARG A 305      -5.595 -12.852  -9.025  1.00  0.38           O  
ATOM   2382  CB  ARG A 305      -3.372 -12.709  -7.285  1.00  0.38           C  
ATOM   2383  CG  ARG A 305      -2.179 -11.970  -6.648  1.00  0.38           C  
ATOM   2384  CD  ARG A 305      -1.986 -10.540  -7.171  1.00  0.38           C  
ATOM   2385  NE  ARG A 305      -2.143  -9.597  -6.022  1.00  0.38           N  
ATOM   2386  CZ  ARG A 305      -1.992  -8.276  -6.095  1.00  0.38           C  
ATOM   2387  NH1 ARG A 305      -2.110  -7.576  -7.209  1.00  0.38           N  
ATOM   2388  NH2 ARG A 305      -1.684  -7.629  -4.986  1.00  0.38           N  
ATOM   2389  N   CYS A 306      -7.038 -12.979  -7.318  1.00  0.43           N  
ATOM   2390  CA  CYS A 306      -8.107 -13.576  -8.118  1.00  0.43           C  
ATOM   2391  C   CYS A 306      -8.511 -12.737  -9.315  1.00  0.43           C  
ATOM   2392  O   CYS A 306      -8.629 -13.219 -10.441  1.00  0.43           O  
ATOM   2393  CB  CYS A 306      -9.358 -13.832  -7.227  1.00  0.43           C  
ATOM   2394  SG  CYS A 306     -10.743 -14.683  -8.082  1.00  0.43           S  
ATOM   2395  N   THR A 307      -8.697 -11.430  -9.088  1.00  0.47           N  
ATOM   2396  CA  THR A 307      -9.011 -10.478 -10.138  1.00  0.47           C  
ATOM   2397  C   THR A 307      -7.874 -10.248 -11.113  1.00  0.47           C  
ATOM   2398  O   THR A 307      -8.079 -10.306 -12.326  1.00  0.47           O  
ATOM   2399  CB  THR A 307      -9.471  -9.161  -9.548  1.00  0.47           C  
ATOM   2400  OG1 THR A 307     -10.734  -9.332  -8.902  1.00  0.47           O  
ATOM   2401  CG2 THR A 307      -9.643  -8.107 -10.642  1.00  0.47           C  
ATOM   2402  N   ASP A 308      -6.637 -10.047 -10.615  1.00  0.49           N  
ATOM   2403  CA  ASP A 308      -5.466  -9.836 -11.450  1.00  0.49           C  
ATOM   2404  C   ASP A 308      -5.169 -11.006 -12.363  1.00  0.49           C  
ATOM   2405  O   ASP A 308      -4.776 -10.844 -13.516  1.00  0.49           O  
ATOM   2406  CB  ASP A 308      -4.221  -9.593 -10.606  1.00  0.49           C  
ATOM   2407  CG  ASP A 308      -4.429  -8.320  -9.806  1.00  0.49           C  
ATOM   2408  OD1 ASP A 308      -4.919  -7.282 -10.281  1.00  0.49           O  
ATOM   2409  OD2 ASP A 308      -4.107  -8.460  -8.609  1.00  0.49           O  
ATOM   2410  N   SER A 309      -5.395 -12.239 -11.868  1.00  0.56           N  
ATOM   2411  CA  SER A 309      -5.268 -13.466 -12.643  1.00  0.56           C  
ATOM   2412  C   SER A 309      -6.151 -13.502 -13.877  1.00  0.56           C  
ATOM   2413  O   SER A 309      -5.713 -13.881 -14.960  1.00  0.56           O  
ATOM   2414  CB  SER A 309      -5.599 -14.695 -11.759  1.00  0.56           C  
ATOM   2415  OG  SER A 309      -5.361 -15.941 -12.418  1.00  0.56           O  
ATOM   2416  N   LEU A 310      -7.417 -13.058 -13.766  1.00  0.55           N  
ATOM   2417  CA  LEU A 310      -8.311 -12.919 -14.900  1.00  0.55           C  
ATOM   2418  C   LEU A 310      -7.839 -11.886 -15.919  1.00  0.55           C  
ATOM   2419  O   LEU A 310      -7.916 -12.120 -17.124  1.00  0.55           O  
ATOM   2420  CB  LEU A 310      -9.741 -12.558 -14.444  1.00  0.55           C  
ATOM   2421  CG  LEU A 310     -10.463 -13.626 -13.600  1.00  0.55           C  
ATOM   2422  CD1 LEU A 310     -11.777 -13.054 -13.050  1.00  0.55           C  
ATOM   2423  CD2 LEU A 310     -10.749 -14.900 -14.407  1.00  0.55           C  
ATOM   2424  N   VAL A 311      -7.304 -10.728 -15.463  1.00  0.57           N  
ATOM   2425  CA  VAL A 311      -6.725  -9.712 -16.341  1.00  0.57           C  
ATOM   2426  C   VAL A 311      -5.545 -10.263 -17.131  1.00  0.57           C  
ATOM   2427  O   VAL A 311      -5.493 -10.151 -18.354  1.00  0.57           O  
ATOM   2428  CB  VAL A 311      -6.296  -8.472 -15.554  1.00  0.57           C  
ATOM   2429  CG1 VAL A 311      -5.570  -7.438 -16.444  1.00  0.57           C  
ATOM   2430  CG2 VAL A 311      -7.534  -7.821 -14.904  1.00  0.57           C  
ATOM   2431  N   LEU A 312      -4.623 -10.969 -16.449  1.00  0.60           N  
ATOM   2432  CA  LEU A 312      -3.486 -11.630 -17.062  1.00  0.60           C  
ATOM   2433  C   LEU A 312      -3.882 -12.730 -18.043  1.00  0.60           C  
ATOM   2434  O   LEU A 312      -3.305 -12.861 -19.121  1.00  0.60           O  
ATOM   2435  CB  LEU A 312      -2.546 -12.155 -15.953  1.00  0.60           C  
ATOM   2436  CG  LEU A 312      -1.202 -12.751 -16.423  1.00  0.60           C  
ATOM   2437  CD1 LEU A 312      -0.389 -11.756 -17.265  1.00  0.60           C  
ATOM   2438  CD2 LEU A 312      -0.369 -13.202 -15.213  1.00  0.60           C  
ATOM   2439  N   GLN A 313      -4.931 -13.530 -17.739  1.00  0.60           N  
ATOM   2440  CA  GLN A 313      -5.499 -14.474 -18.692  1.00  0.60           C  
ATOM   2441  C   GLN A 313      -6.011 -13.800 -19.969  1.00  0.60           C  
ATOM   2442  O   GLN A 313      -5.760 -14.286 -21.070  1.00  0.60           O  
ATOM   2443  CB  GLN A 313      -6.635 -15.326 -18.063  1.00  0.60           C  
ATOM   2444  CG  GLN A 313      -6.173 -16.364 -17.015  1.00  0.60           C  
ATOM   2445  CD  GLN A 313      -7.354 -16.987 -16.261  1.00  0.60           C  
ATOM   2446  OE1 GLN A 313      -8.276 -17.598 -16.810  1.00  0.60           O  
ATOM   2447  NE2 GLN A 313      -7.331 -16.834 -14.919  1.00  0.60           N  
ATOM   2448  N   CYS A 314      -6.695 -12.640 -19.878  1.00  0.63           N  
ATOM   2449  CA  CYS A 314      -7.075 -11.859 -21.050  1.00  0.63           C  
ATOM   2450  C   CYS A 314      -5.899 -11.335 -21.858  1.00  0.63           C  
ATOM   2451  O   CYS A 314      -5.898 -11.423 -23.085  1.00  0.63           O  
ATOM   2452  CB  CYS A 314      -7.988 -10.668 -20.685  1.00  0.63           C  
ATOM   2453  SG  CYS A 314      -9.626 -11.247 -20.142  1.00  0.63           S  
ATOM   2454  N   GLU A 315      -4.848 -10.813 -21.194  1.00  0.54           N  
ATOM   2455  CA  GLU A 315      -3.629 -10.367 -21.850  1.00  0.54           C  
ATOM   2456  C   GLU A 315      -2.911 -11.485 -22.597  1.00  0.54           C  
ATOM   2457  O   GLU A 315      -2.506 -11.335 -23.750  1.00  0.54           O  
ATOM   2458  CB  GLU A 315      -2.661  -9.745 -20.820  1.00  0.54           C  
ATOM   2459  CG  GLU A 315      -3.154  -8.411 -20.206  1.00  0.54           C  
ATOM   2460  CD  GLU A 315      -2.205  -7.870 -19.134  1.00  0.54           C  
ATOM   2461  OE1 GLU A 315      -2.464  -6.731 -18.667  1.00  0.54           O  
ATOM   2462  OE2 GLU A 315      -1.233  -8.581 -18.770  1.00  0.54           O  
ATOM   2463  N   LEU A 316      -2.795 -12.675 -21.977  1.00  0.55           N  
ATOM   2464  CA  LEU A 316      -2.274 -13.869 -22.620  1.00  0.55           C  
ATOM   2465  C   LEU A 316      -3.124 -14.342 -23.789  1.00  0.55           C  
ATOM   2466  O   LEU A 316      -2.596 -14.702 -24.838  1.00  0.55           O  
ATOM   2467  CB  LEU A 316      -2.115 -15.016 -21.599  1.00  0.55           C  
ATOM   2468  CG  LEU A 316      -1.030 -14.763 -20.535  1.00  0.55           C  
ATOM   2469  CD1 LEU A 316      -1.160 -15.764 -19.380  1.00  0.55           C  
ATOM   2470  CD2 LEU A 316       0.381 -14.835 -21.136  1.00  0.55           C  
ATOM   2471  N   ALA A 317      -4.464 -14.300 -23.654  1.00  0.58           N  
ATOM   2472  CA  ALA A 317      -5.404 -14.621 -24.705  1.00  0.58           C  
ATOM   2473  C   ALA A 317      -5.260 -13.737 -25.936  1.00  0.58           C  
ATOM   2474  O   ALA A 317      -5.264 -14.221 -27.065  1.00  0.58           O  
ATOM   2475  CB  ALA A 317      -6.829 -14.612 -24.133  1.00  0.58           C  
ATOM   2476  N   LEU A 318      -5.023 -12.420 -25.760  1.00  0.43           N  
ATOM   2477  CA  LEU A 318      -4.671 -11.528 -26.857  1.00  0.43           C  
ATOM   2478  C   LEU A 318      -3.411 -11.963 -27.597  1.00  0.43           C  
ATOM   2479  O   LEU A 318      -3.358 -11.915 -28.824  1.00  0.43           O  
ATOM   2480  CB  LEU A 318      -4.479 -10.069 -26.374  1.00  0.43           C  
ATOM   2481  CG  LEU A 318      -5.768  -9.354 -25.920  1.00  0.43           C  
ATOM   2482  CD1 LEU A 318      -5.443  -8.022 -25.224  1.00  0.43           C  
ATOM   2483  CD2 LEU A 318      -6.734  -9.108 -27.090  1.00  0.43           C  
ATOM   2484  N   GLY A 319      -2.383 -12.452 -26.873  1.00  0.48           N  
ATOM   2485  CA  GLY A 319      -1.125 -12.905 -27.460  1.00  0.48           C  
ATOM   2486  C   GLY A 319      -1.203 -14.088 -28.396  1.00  0.48           C  
ATOM   2487  O   GLY A 319      -0.326 -14.258 -29.238  1.00  0.48           O  
ATOM   2488  N   PHE A 320      -2.244 -14.938 -28.285  1.00  0.36           N  
ATOM   2489  CA  PHE A 320      -2.441 -16.037 -29.219  1.00  0.36           C  
ATOM   2490  C   PHE A 320      -3.703 -15.913 -30.052  1.00  0.36           C  
ATOM   2491  O   PHE A 320      -4.045 -16.817 -30.810  1.00  0.36           O  
ATOM   2492  CB  PHE A 320      -2.378 -17.425 -28.528  1.00  0.36           C  
ATOM   2493  CG  PHE A 320      -3.420 -17.654 -27.473  1.00  0.36           C  
ATOM   2494  CD1 PHE A 320      -3.099 -17.452 -26.128  1.00  0.36           C  
ATOM   2495  CD2 PHE A 320      -4.696 -18.140 -27.801  1.00  0.36           C  
ATOM   2496  CE1 PHE A 320      -4.018 -17.759 -25.123  1.00  0.36           C  
ATOM   2497  CE2 PHE A 320      -5.621 -18.447 -26.796  1.00  0.36           C  
ATOM   2498  CZ  PHE A 320      -5.283 -18.255 -25.453  1.00  0.36           C  
ATOM   2499  N   GLY A 321      -4.425 -14.777 -29.968  1.00  0.49           N  
ATOM   2500  CA  GLY A 321      -5.636 -14.583 -30.758  1.00  0.49           C  
ATOM   2501  C   GLY A 321      -6.883 -15.206 -30.181  1.00  0.49           C  
ATOM   2502  O   GLY A 321      -7.868 -15.413 -30.887  1.00  0.49           O  
ATOM   2503  N   GLY A 322      -6.887 -15.517 -28.872  1.00  0.51           N  
ATOM   2504  CA  GLY A 322      -7.970 -16.203 -28.177  1.00  0.51           C  
ATOM   2505  C   GLY A 322      -9.177 -15.350 -27.896  1.00  0.51           C  
ATOM   2506  O   GLY A 322      -9.464 -14.967 -26.764  1.00  0.51           O  
ATOM   2507  N   GLY A 323      -9.952 -15.043 -28.954  1.00  0.50           N  
ATOM   2508  CA  GLY A 323     -11.170 -14.245 -28.869  1.00  0.50           C  
ATOM   2509  C   GLY A 323     -12.306 -14.913 -28.148  1.00  0.50           C  
ATOM   2510  O   GLY A 323     -13.149 -14.251 -27.548  1.00  0.50           O  
ATOM   2511  N   ARG A 324     -12.362 -16.257 -28.178  1.00  0.41           N  
ATOM   2512  CA  ARG A 324     -13.352 -17.013 -27.439  1.00  0.41           C  
ATOM   2513  C   ARG A 324     -13.079 -16.964 -25.947  1.00  0.41           C  
ATOM   2514  O   ARG A 324     -13.960 -16.667 -25.148  1.00  0.41           O  
ATOM   2515  CB  ARG A 324     -13.388 -18.485 -27.914  1.00  0.41           C  
ATOM   2516  CG  ARG A 324     -13.968 -18.670 -29.333  1.00  0.41           C  
ATOM   2517  CD  ARG A 324     -14.062 -20.148 -29.730  1.00  0.41           C  
ATOM   2518  NE  ARG A 324     -14.688 -20.232 -31.096  1.00  0.41           N  
ATOM   2519  CZ  ARG A 324     -15.110 -21.374 -31.658  1.00  0.41           C  
ATOM   2520  NH1 ARG A 324     -15.032 -22.536 -31.017  1.00  0.41           N  
ATOM   2521  NH2 ARG A 324     -15.625 -21.357 -32.887  1.00  0.41           N  
ATOM   2522  N   GLU A 325     -11.813 -17.172 -25.556  1.00  0.51           N  
ATOM   2523  CA  GLU A 325     -11.327 -17.141 -24.199  1.00  0.51           C  
ATOM   2524  C   GLU A 325     -11.555 -15.787 -23.541  1.00  0.51           C  
ATOM   2525  O   GLU A 325     -11.989 -15.692 -22.396  1.00  0.51           O  
ATOM   2526  CB  GLU A 325      -9.815 -17.496 -24.188  1.00  0.51           C  
ATOM   2527  CG  GLU A 325      -9.451 -18.945 -24.638  1.00  0.51           C  
ATOM   2528  CD  GLU A 325      -9.479 -19.253 -26.143  1.00  0.51           C  
ATOM   2529  OE1 GLU A 325      -9.053 -20.384 -26.487  1.00  0.51           O  
ATOM   2530  OE2 GLU A 325      -9.905 -18.394 -26.962  1.00  0.51           O  
ATOM   2531  N   ILE A 326     -11.320 -14.684 -24.278  1.00  0.47           N  
ATOM   2532  CA  ILE A 326     -11.667 -13.333 -23.848  1.00  0.47           C  
ATOM   2533  C   ILE A 326     -13.164 -13.140 -23.643  1.00  0.47           C  
ATOM   2534  O   ILE A 326     -13.586 -12.508 -22.674  1.00  0.47           O  
ATOM   2535  CB  ILE A 326     -11.109 -12.287 -24.811  1.00  0.47           C  
ATOM   2536  CG1 ILE A 326      -9.566 -12.336 -24.770  1.00  0.47           C  
ATOM   2537  CG2 ILE A 326     -11.613 -10.865 -24.464  1.00  0.47           C  
ATOM   2538  CD1 ILE A 326      -8.893 -11.570 -25.910  1.00  0.47           C  
ATOM   2539  N   ALA A 327     -14.014 -13.697 -24.529  1.00  0.48           N  
ATOM   2540  CA  ALA A 327     -15.453 -13.634 -24.404  1.00  0.48           C  
ATOM   2541  C   ALA A 327     -15.972 -14.297 -23.136  1.00  0.48           C  
ATOM   2542  O   ALA A 327     -16.803 -13.719 -22.444  1.00  0.48           O  
ATOM   2543  CB  ALA A 327     -16.111 -14.248 -25.653  1.00  0.48           C  
ATOM   2544  N   ASP A 328     -15.454 -15.482 -22.768  1.00  0.48           N  
ATOM   2545  CA  ASP A 328     -15.714 -16.128 -21.496  1.00  0.48           C  
ATOM   2546  C   ASP A 328     -15.209 -15.335 -20.280  1.00  0.48           C  
ATOM   2547  O   ASP A 328     -15.900 -15.181 -19.271  1.00  0.48           O  
ATOM   2548  CB  ASP A 328     -15.042 -17.525 -21.491  1.00  0.48           C  
ATOM   2549  CG  ASP A 328     -15.674 -18.493 -22.485  1.00  0.48           C  
ATOM   2550  OD1 ASP A 328     -16.769 -18.200 -23.026  1.00  0.48           O  
ATOM   2551  OD2 ASP A 328     -15.057 -19.574 -22.672  1.00  0.48           O  
ATOM   2552  N   LEU A 329     -13.973 -14.799 -20.328  1.00  0.51           N  
ATOM   2553  CA  LEU A 329     -13.371 -14.043 -19.241  1.00  0.51           C  
ATOM   2554  C   LEU A 329     -13.947 -12.654 -18.978  1.00  0.51           C  
ATOM   2555  O   LEU A 329     -14.040 -12.222 -17.831  1.00  0.51           O  
ATOM   2556  CB  LEU A 329     -11.844 -13.935 -19.431  1.00  0.51           C  
ATOM   2557  CG  LEU A 329     -11.091 -15.276 -19.368  1.00  0.51           C  
ATOM   2558  CD1 LEU A 329      -9.670 -15.078 -19.900  1.00  0.51           C  
ATOM   2559  CD2 LEU A 329     -11.032 -15.874 -17.956  1.00  0.51           C  
ATOM   2560  N   ALA A 330     -14.342 -11.889 -20.008  1.00  0.47           N  
ATOM   2561  CA  ALA A 330     -14.822 -10.526 -19.871  1.00  0.47           C  
ATOM   2562  C   ALA A 330     -16.071 -10.320 -18.990  1.00  0.47           C  
ATOM   2563  O   ALA A 330     -16.069  -9.360 -18.212  1.00  0.47           O  
ATOM   2564  CB  ALA A 330     -14.965  -9.905 -21.276  1.00  0.47           C  
ATOM   2565  N   PRO A 331     -17.122 -11.144 -18.984  1.00  0.37           N  
ATOM   2566  CA  PRO A 331     -18.184 -11.084 -17.989  1.00  0.37           C  
ATOM   2567  C   PRO A 331     -17.701 -11.392 -16.595  1.00  0.37           C  
ATOM   2568  O   PRO A 331     -18.212 -10.798 -15.654  1.00  0.37           O  
ATOM   2569  CB  PRO A 331     -19.223 -12.121 -18.454  1.00  0.37           C  
ATOM   2570  CG  PRO A 331     -18.939 -12.301 -19.945  1.00  0.37           C  
ATOM   2571  CD  PRO A 331     -17.430 -12.115 -20.022  1.00  0.37           C  
ATOM   2572  N   LEU A 332     -16.733 -12.316 -16.419  1.00  0.45           N  
ATOM   2573  CA  LEU A 332     -16.138 -12.583 -15.123  1.00  0.45           C  
ATOM   2574  C   LEU A 332     -15.364 -11.400 -14.573  1.00  0.45           C  
ATOM   2575  O   LEU A 332     -15.401 -11.135 -13.367  1.00  0.45           O  
ATOM   2576  CB  LEU A 332     -15.212 -13.824 -15.133  1.00  0.45           C  
ATOM   2577  CG  LEU A 332     -15.860 -15.182 -15.484  1.00  0.45           C  
ATOM   2578  CD1 LEU A 332     -14.750 -16.248 -15.497  1.00  0.45           C  
ATOM   2579  CD2 LEU A 332     -16.975 -15.572 -14.499  1.00  0.45           C  
ATOM   2580  N   LEU A 333     -14.635 -10.675 -15.463  1.00  0.41           N  
ATOM   2581  CA  LEU A 333     -14.066  -9.399 -15.206  1.00  0.41           C  
ATOM   2582  C   LEU A 333     -15.149  -8.437 -14.868  1.00  0.41           C  
ATOM   2583  O   LEU A 333     -15.206  -8.146 -13.701  1.00  0.41           O  
ATOM   2584  CB  LEU A 333     -13.137  -8.857 -16.293  1.00  0.41           C  
ATOM   2585  CG  LEU A 333     -11.769  -9.541 -16.354  1.00  0.41           C  
ATOM   2586  CD1 LEU A 333     -10.981  -9.083 -17.584  1.00  0.41           C  
ATOM   2587  CD2 LEU A 333     -10.941  -9.235 -15.101  1.00  0.41           C  
ATOM   2588  N   HIS A 334     -16.070  -7.954 -15.731  1.00  0.28           N  
ATOM   2589  CA  HIS A 334     -17.077  -6.936 -15.344  1.00  0.28           C  
ATOM   2590  C   HIS A 334     -17.725  -7.049 -13.952  1.00  0.28           C  
ATOM   2591  O   HIS A 334     -18.505  -7.966 -13.712  1.00  0.28           O  
ATOM   2592  CB  HIS A 334     -18.216  -7.050 -16.371  1.00  0.28           C  
ATOM   2593  CG  HIS A 334     -19.258  -5.967 -16.311  1.00  0.28           C  
ATOM   2594  ND1 HIS A 334     -18.881  -4.657 -16.542  1.00  0.28           N  
ATOM   2595  CD2 HIS A 334     -20.586  -6.028 -16.019  1.00  0.28           C  
ATOM   2596  CE1 HIS A 334     -19.982  -3.952 -16.385  1.00  0.28           C  
ATOM   2597  NE2 HIS A 334     -21.042  -4.729 -16.065  1.00  0.28           N  
ATOM   2598  N   ALA A 335     -17.483  -6.167 -12.953  1.00  0.36           N  
ATOM   2599  CA  ALA A 335     -16.857  -4.840 -12.945  1.00  0.36           C  
ATOM   2600  C   ALA A 335     -15.476  -4.718 -12.278  1.00  0.36           C  
ATOM   2601  O   ALA A 335     -15.048  -3.617 -11.823  1.00  0.36           O  
ATOM   2602  CB  ALA A 335     -17.779  -3.937 -12.126  1.00  0.36           C  
ATOM   2603  N   ARG A 336     -14.702  -5.810 -12.248  1.00  0.30           N  
ATOM   2604  CA  ARG A 336     -13.335  -5.968 -11.797  1.00  0.30           C  
ATOM   2605  C   ARG A 336     -12.389  -5.181 -12.648  1.00  0.30           C  
ATOM   2606  O   ARG A 336     -11.445  -4.589 -12.156  1.00  0.30           O  
ATOM   2607  CB  ARG A 336     -12.829  -7.419 -11.988  1.00  0.30           C  
ATOM   2608  CG  ARG A 336     -13.460  -8.447 -11.060  1.00  0.30           C  
ATOM   2609  CD  ARG A 336     -12.924  -9.842 -11.364  1.00  0.30           C  
ATOM   2610  NE  ARG A 336     -13.954 -10.833 -10.976  1.00  0.30           N  
ATOM   2611  CZ  ARG A 336     -14.038 -11.434  -9.787  1.00  0.30           C  
ATOM   2612  NH1 ARG A 336     -15.037 -12.290  -9.585  1.00  0.30           N  
ATOM   2613  NH2 ARG A 336     -13.146 -11.222  -8.825  1.00  0.30           N  
ATOM   2614  N   GLY A 337     -12.615  -5.231 -13.981  1.00  0.36           N  
ATOM   2615  CA  GLY A 337     -11.894  -4.411 -14.927  1.00  0.36           C  
ATOM   2616  C   GLY A 337     -12.904  -3.479 -15.502  1.00  0.36           C  
ATOM   2617  O   GLY A 337     -14.099  -3.604 -15.243  1.00  0.36           O  
ATOM   2618  N   ARG A 338     -12.463  -2.537 -16.339  1.00  0.27           N  
ATOM   2619  CA  ARG A 338     -13.326  -1.524 -16.877  1.00  0.27           C  
ATOM   2620  C   ARG A 338     -12.955  -1.358 -18.341  1.00  0.27           C  
ATOM   2621  O   ARG A 338     -11.756  -1.300 -18.643  1.00  0.27           O  
ATOM   2622  CB  ARG A 338     -13.071  -0.232 -16.094  1.00  0.27           C  
ATOM   2623  CG  ARG A 338     -13.889   1.021 -16.434  1.00  0.27           C  
ATOM   2624  CD  ARG A 338     -14.977   1.334 -15.415  1.00  0.27           C  
ATOM   2625  NE  ARG A 338     -14.244   1.775 -14.200  1.00  0.27           N  
ATOM   2626  CZ  ARG A 338     -14.809   2.270 -13.092  1.00  0.27           C  
ATOM   2627  NH1 ARG A 338     -14.026   2.789 -12.158  1.00  0.27           N  
ATOM   2628  NH2 ARG A 338     -16.128   2.263 -12.916  1.00  0.27           N  
ATOM   2629  N   PRO A 339     -13.895  -1.255 -19.296  1.00  0.31           N  
ATOM   2630  CA  PRO A 339     -13.571  -1.030 -20.701  1.00  0.31           C  
ATOM   2631  C   PRO A 339     -12.787   0.245 -20.910  1.00  0.31           C  
ATOM   2632  O   PRO A 339     -12.086   0.381 -21.901  1.00  0.31           O  
ATOM   2633  CB  PRO A 339     -14.920  -0.962 -21.429  1.00  0.31           C  
ATOM   2634  CG  PRO A 339     -15.891  -1.735 -20.531  1.00  0.31           C  
ATOM   2635  CD  PRO A 339     -15.313  -1.592 -19.118  1.00  0.31           C  
ATOM   2636  N   LEU A 340     -12.936   1.210 -19.993  1.00  0.28           N  
ATOM   2637  CA  LEU A 340     -12.252   2.483 -20.014  1.00  0.28           C  
ATOM   2638  C   LEU A 340     -10.795   2.405 -19.737  1.00  0.28           C  
ATOM   2639  O   LEU A 340      -9.977   2.894 -20.514  1.00  0.28           O  
ATOM   2640  CB  LEU A 340     -12.885   3.363 -18.929  1.00  0.28           C  
ATOM   2641  CG  LEU A 340     -12.344   4.781 -18.805  1.00  0.28           C  
ATOM   2642  CD1 LEU A 340     -12.413   5.442 -20.163  1.00  0.28           C  
ATOM   2643  CD2 LEU A 340     -13.038   5.511 -17.656  1.00  0.28           C  
ATOM   2644  N   GLU A 341     -10.439   1.728 -18.638  1.00  0.35           N  
ATOM   2645  CA  GLU A 341      -9.071   1.466 -18.262  1.00  0.35           C  
ATOM   2646  C   GLU A 341      -8.403   0.643 -19.372  1.00  0.35           C  
ATOM   2647  O   GLU A 341      -7.309   0.967 -19.825  1.00  0.35           O  
ATOM   2648  CB  GLU A 341      -9.016   0.782 -16.861  1.00  0.35           C  
ATOM   2649  CG  GLU A 341      -9.274   1.691 -15.611  1.00  0.35           C  
ATOM   2650  CD  GLU A 341     -10.664   2.283 -15.442  1.00  0.35           C  
ATOM   2651  OE1 GLU A 341     -11.456   1.826 -14.572  1.00  0.35           O  
ATOM   2652  OE2 GLU A 341     -10.921   3.297 -16.145  1.00  0.35           O  
ATOM   2653  N   ALA A 342      -9.104  -0.372 -19.925  1.00  0.40           N  
ATOM   2654  CA  ALA A 342      -8.675  -1.104 -21.105  1.00  0.40           C  
ATOM   2655  C   ALA A 342      -8.419  -0.254 -22.359  1.00  0.40           C  
ATOM   2656  O   ALA A 342      -7.320  -0.291 -22.914  1.00  0.40           O  
ATOM   2657  CB  ALA A 342      -9.740  -2.178 -21.417  1.00  0.40           C  
ATOM   2658  N   SER A 343      -9.383   0.590 -22.798  1.00  0.28           N  
ATOM   2659  CA  SER A 343      -9.213   1.483 -23.943  1.00  0.28           C  
ATOM   2660  C   SER A 343      -8.100   2.489 -23.758  1.00  0.28           C  
ATOM   2661  O   SER A 343      -7.302   2.722 -24.662  1.00  0.28           O  
ATOM   2662  CB  SER A 343     -10.504   2.268 -24.287  1.00  0.28           C  
ATOM   2663  OG  SER A 343     -11.509   1.377 -24.769  1.00  0.28           O  
ATOM   2664  N   TYR A 344      -7.991   3.093 -22.557  1.00  0.24           N  
ATOM   2665  CA  TYR A 344      -6.927   4.016 -22.216  1.00  0.24           C  
ATOM   2666  C   TYR A 344      -5.537   3.382 -22.311  1.00  0.24           C  
ATOM   2667  O   TYR A 344      -4.655   3.909 -22.989  1.00  0.24           O  
ATOM   2668  CB  TYR A 344      -7.214   4.560 -20.781  1.00  0.24           C  
ATOM   2669  CG  TYR A 344      -6.097   5.394 -20.206  1.00  0.24           C  
ATOM   2670  CD1 TYR A 344      -5.176   4.794 -19.332  1.00  0.24           C  
ATOM   2671  CD2 TYR A 344      -5.916   6.738 -20.568  1.00  0.24           C  
ATOM   2672  CE1 TYR A 344      -4.073   5.511 -18.858  1.00  0.24           C  
ATOM   2673  CE2 TYR A 344      -4.811   7.459 -20.086  1.00  0.24           C  
ATOM   2674  CZ  TYR A 344      -3.882   6.838 -19.244  1.00  0.24           C  
ATOM   2675  OH  TYR A 344      -2.746   7.531 -18.785  1.00  0.24           O  
ATOM   2676  N   TYR A 345      -5.319   2.212 -21.672  1.00  0.29           N  
ATOM   2677  CA  TYR A 345      -4.021   1.556 -21.680  1.00  0.29           C  
ATOM   2678  C   TYR A 345      -3.599   1.047 -23.047  1.00  0.29           C  
ATOM   2679  O   TYR A 345      -2.447   1.220 -23.448  1.00  0.29           O  
ATOM   2680  CB  TYR A 345      -3.963   0.373 -20.678  1.00  0.29           C  
ATOM   2681  CG  TYR A 345      -3.967   0.838 -19.244  1.00  0.29           C  
ATOM   2682  CD1 TYR A 345      -3.030   1.774 -18.772  1.00  0.29           C  
ATOM   2683  CD2 TYR A 345      -4.896   0.308 -18.335  1.00  0.29           C  
ATOM   2684  CE1 TYR A 345      -3.081   2.228 -17.447  1.00  0.29           C  
ATOM   2685  CE2 TYR A 345      -4.962   0.772 -17.016  1.00  0.29           C  
ATOM   2686  CZ  TYR A 345      -4.063   1.747 -16.578  1.00  0.29           C  
ATOM   2687  OH  TYR A 345      -4.138   2.240 -15.264  1.00  0.29           O  
ATOM   2688  N   GLN A 346      -4.528   0.435 -23.818  1.00  0.37           N  
ATOM   2689  CA  GLN A 346      -4.245  -0.069 -25.152  1.00  0.37           C  
ATOM   2690  C   GLN A 346      -3.801   1.037 -26.087  1.00  0.37           C  
ATOM   2691  O   GLN A 346      -2.811   0.943 -26.811  1.00  0.37           O  
ATOM   2692  CB  GLN A 346      -5.521  -0.726 -25.745  1.00  0.37           C  
ATOM   2693  CG  GLN A 346      -5.330  -1.319 -27.164  1.00  0.37           C  
ATOM   2694  CD  GLN A 346      -6.580  -2.033 -27.683  1.00  0.37           C  
ATOM   2695  OE1 GLN A 346      -7.567  -2.262 -26.988  1.00  0.37           O  
ATOM   2696  NE2 GLN A 346      -6.529  -2.412 -28.983  1.00  0.37           N  
ATOM   2697  N   ALA A 347      -4.532   2.150 -26.042  1.00  0.42           N  
ATOM   2698  CA  ALA A 347      -4.278   3.312 -26.832  1.00  0.42           C  
ATOM   2699  C   ALA A 347      -2.992   4.045 -26.525  1.00  0.42           C  
ATOM   2700  O   ALA A 347      -2.265   4.461 -27.424  1.00  0.42           O  
ATOM   2701  CB  ALA A 347      -5.428   4.237 -26.557  1.00  0.42           C  
ATOM   2702  N   PHE A 348      -2.669   4.203 -25.226  1.00  0.34           N  
ATOM   2703  CA  PHE A 348      -1.423   4.779 -24.769  1.00  0.34           C  
ATOM   2704  C   PHE A 348      -0.230   3.945 -25.229  1.00  0.34           C  
ATOM   2705  O   PHE A 348       0.781   4.467 -25.700  1.00  0.34           O  
ATOM   2706  CB  PHE A 348      -1.483   4.923 -23.223  1.00  0.34           C  
ATOM   2707  CG  PHE A 348      -0.324   5.714 -22.680  1.00  0.34           C  
ATOM   2708  CD1 PHE A 348       0.891   5.078 -22.378  1.00  0.34           C  
ATOM   2709  CD2 PHE A 348      -0.426   7.101 -22.492  1.00  0.34           C  
ATOM   2710  CE1 PHE A 348       2.004   5.821 -21.971  1.00  0.34           C  
ATOM   2711  CE2 PHE A 348       0.685   7.847 -22.076  1.00  0.34           C  
ATOM   2712  CZ  PHE A 348       1.908   7.210 -21.837  1.00  0.34           C  
ATOM   2713  N   ALA A 349      -0.352   2.607 -25.148  1.00  0.52           N  
ATOM   2714  CA  ALA A 349       0.631   1.684 -25.657  1.00  0.52           C  
ATOM   2715  C   ALA A 349       0.843   1.763 -27.167  1.00  0.52           C  
ATOM   2716  O   ALA A 349       1.986   1.835 -27.622  1.00  0.52           O  
ATOM   2717  CB  ALA A 349       0.200   0.267 -25.244  1.00  0.52           C  
ATOM   2718  N   GLU A 350      -0.243   1.814 -27.975  1.00  0.43           N  
ATOM   2719  CA  GLU A 350      -0.148   2.034 -29.411  1.00  0.43           C  
ATOM   2720  C   GLU A 350       0.457   3.400 -29.733  1.00  0.43           C  
ATOM   2721  O   GLU A 350       1.404   3.493 -30.502  1.00  0.43           O  
ATOM   2722  CB  GLU A 350      -1.522   1.886 -30.117  1.00  0.43           C  
ATOM   2723  CG  GLU A 350      -2.086   0.433 -30.219  1.00  0.43           C  
ATOM   2724  CD  GLU A 350      -1.513  -0.454 -31.340  1.00  0.43           C  
ATOM   2725  OE1 GLU A 350      -1.977  -1.625 -31.465  1.00  0.43           O  
ATOM   2726  OE2 GLU A 350      -0.655   0.012 -32.130  1.00  0.43           O  
ATOM   2727  N   PHE A 351       0.011   4.499 -29.079  1.00  0.35           N  
ATOM   2728  CA  PHE A 351       0.552   5.846 -29.261  1.00  0.35           C  
ATOM   2729  C   PHE A 351       2.051   5.938 -28.972  1.00  0.35           C  
ATOM   2730  O   PHE A 351       2.818   6.506 -29.748  1.00  0.35           O  
ATOM   2731  CB  PHE A 351      -0.263   6.848 -28.384  1.00  0.35           C  
ATOM   2732  CG  PHE A 351       0.229   8.274 -28.445  1.00  0.35           C  
ATOM   2733  CD1 PHE A 351       0.876   8.845 -27.335  1.00  0.35           C  
ATOM   2734  CD2 PHE A 351       0.077   9.046 -29.607  1.00  0.35           C  
ATOM   2735  CE1 PHE A 351       1.386  10.147 -27.394  1.00  0.35           C  
ATOM   2736  CE2 PHE A 351       0.599  10.346 -29.670  1.00  0.35           C  
ATOM   2737  CZ  PHE A 351       1.259  10.895 -28.568  1.00  0.35           C  
ATOM   2738  N   SER A 352       2.515   5.318 -27.875  1.00  0.49           N  
ATOM   2739  CA  SER A 352       3.929   5.187 -27.551  1.00  0.49           C  
ATOM   2740  C   SER A 352       4.723   4.400 -28.593  1.00  0.49           C  
ATOM   2741  O   SER A 352       5.813   4.791 -29.014  1.00  0.49           O  
ATOM   2742  CB  SER A 352       4.056   4.515 -26.165  1.00  0.49           C  
ATOM   2743  OG  SER A 352       5.397   4.519 -25.678  1.00  0.49           O  
ATOM   2744  N   ALA A 353       4.160   3.281 -29.094  1.00  0.51           N  
ATOM   2745  CA  ALA A 353       4.730   2.500 -30.172  1.00  0.51           C  
ATOM   2746  C   ALA A 353       4.850   3.272 -31.485  1.00  0.51           C  
ATOM   2747  O   ALA A 353       5.870   3.197 -32.178  1.00  0.51           O  
ATOM   2748  CB  ALA A 353       3.900   1.217 -30.362  1.00  0.51           C  
ATOM   2749  N   LEU A 354       3.822   4.072 -31.838  1.00  0.45           N  
ATOM   2750  CA  LEU A 354       3.838   4.957 -32.987  1.00  0.45           C  
ATOM   2751  C   LEU A 354       4.934   6.017 -32.893  1.00  0.45           C  
ATOM   2752  O   LEU A 354       5.693   6.223 -33.842  1.00  0.45           O  
ATOM   2753  CB  LEU A 354       2.479   5.676 -33.157  1.00  0.45           C  
ATOM   2754  CG  LEU A 354       1.254   4.788 -33.460  1.00  0.45           C  
ATOM   2755  CD1 LEU A 354      -0.006   5.652 -33.378  1.00  0.45           C  
ATOM   2756  CD2 LEU A 354       1.334   3.968 -34.749  1.00  0.45           C  
ATOM   2757  N   LEU A 355       5.084   6.679 -31.722  1.00  0.46           N  
ATOM   2758  CA  LEU A 355       6.136   7.652 -31.476  1.00  0.46           C  
ATOM   2759  C   LEU A 355       7.535   7.057 -31.546  1.00  0.46           C  
ATOM   2760  O   LEU A 355       8.412   7.587 -32.231  1.00  0.46           O  
ATOM   2761  CB  LEU A 355       5.969   8.318 -30.088  1.00  0.46           C  
ATOM   2762  CG  LEU A 355       4.792   9.307 -29.946  1.00  0.46           C  
ATOM   2763  CD1 LEU A 355       4.691   9.773 -28.486  1.00  0.46           C  
ATOM   2764  CD2 LEU A 355       4.915  10.532 -30.862  1.00  0.46           C  
ATOM   2765  N   SER A 356       7.765   5.899 -30.894  1.00  0.47           N  
ATOM   2766  CA  SER A 356       9.029   5.173 -30.938  1.00  0.47           C  
ATOM   2767  C   SER A 356       9.408   4.716 -32.329  1.00  0.47           C  
ATOM   2768  O   SER A 356      10.570   4.774 -32.728  1.00  0.47           O  
ATOM   2769  CB  SER A 356       9.017   3.930 -30.016  1.00  0.47           C  
ATOM   2770  OG  SER A 356       9.063   4.330 -28.652  1.00  0.47           O  
ATOM   2771  N   ARG A 357       8.442   4.241 -33.142  1.00  0.49           N  
ATOM   2772  CA  ARG A 357       8.706   3.941 -34.537  1.00  0.49           C  
ATOM   2773  C   ARG A 357       9.035   5.177 -35.358  1.00  0.49           C  
ATOM   2774  O   ARG A 357      10.059   5.188 -36.032  1.00  0.49           O  
ATOM   2775  CB  ARG A 357       7.558   3.110 -35.153  1.00  0.49           C  
ATOM   2776  CG  ARG A 357       7.869   2.410 -36.504  1.00  0.49           C  
ATOM   2777  CD  ARG A 357       6.671   1.574 -36.973  1.00  0.49           C  
ATOM   2778  NE  ARG A 357       6.916   0.750 -38.204  1.00  0.49           N  
ATOM   2779  CZ  ARG A 357       5.974  -0.081 -38.673  1.00  0.49           C  
ATOM   2780  NH1 ARG A 357       4.734  -0.072 -38.229  1.00  0.49           N  
ATOM   2781  NH2 ARG A 357       6.196  -0.995 -39.597  1.00  0.49           N  
ATOM   2782  N   SER A 358       8.266   6.282 -35.245  1.00  0.57           N  
ATOM   2783  CA  SER A 358       8.556   7.537 -35.942  1.00  0.57           C  
ATOM   2784  C   SER A 358       9.912   8.116 -35.598  1.00  0.57           C  
ATOM   2785  O   SER A 358      10.641   8.606 -36.459  1.00  0.57           O  
ATOM   2786  CB  SER A 358       7.491   8.619 -35.649  1.00  0.57           C  
ATOM   2787  OG  SER A 358       6.251   8.261 -36.258  1.00  0.57           O  
ATOM   2788  N   SER A 359      10.307   8.037 -34.314  1.00  0.56           N  
ATOM   2789  CA  SER A 359      11.640   8.420 -33.878  1.00  0.56           C  
ATOM   2790  C   SER A 359      12.763   7.579 -34.478  1.00  0.56           C  
ATOM   2791  O   SER A 359      13.733   8.119 -34.998  1.00  0.56           O  
ATOM   2792  CB  SER A 359      11.751   8.408 -32.338  1.00  0.56           C  
ATOM   2793  OG  SER A 359      12.819   9.253 -31.905  1.00  0.56           O  
ATOM   2794  N   ARG A 360      12.618   6.232 -34.510  1.00  0.49           N  
ATOM   2795  CA  ARG A 360      13.589   5.335 -35.132  1.00  0.49           C  
ATOM   2796  C   ARG A 360      13.770   5.580 -36.616  1.00  0.49           C  
ATOM   2797  O   ARG A 360      14.882   5.544 -37.138  1.00  0.49           O  
ATOM   2798  CB  ARG A 360      13.186   3.846 -34.965  1.00  0.49           C  
ATOM   2799  CG  ARG A 360      13.480   3.282 -33.563  1.00  0.49           C  
ATOM   2800  CD  ARG A 360      13.336   1.759 -33.449  1.00  0.49           C  
ATOM   2801  NE  ARG A 360      11.883   1.432 -33.585  1.00  0.49           N  
ATOM   2802  CZ  ARG A 360      11.390   0.185 -33.587  1.00  0.49           C  
ATOM   2803  NH1 ARG A 360      12.182  -0.880 -33.497  1.00  0.49           N  
ATOM   2804  NH2 ARG A 360      10.075  -0.001 -33.679  1.00  0.49           N  
ATOM   2805  N   LEU A 361      12.663   5.842 -37.333  1.00  0.54           N  
ATOM   2806  CA  LEU A 361      12.678   6.174 -38.740  1.00  0.54           C  
ATOM   2807  C   LEU A 361      13.472   7.436 -39.027  1.00  0.54           C  
ATOM   2808  O   LEU A 361      14.289   7.481 -39.942  1.00  0.54           O  
ATOM   2809  CB  LEU A 361      11.234   6.365 -39.247  1.00  0.54           C  
ATOM   2810  CG  LEU A 361      10.385   5.080 -39.246  1.00  0.54           C  
ATOM   2811  CD1 LEU A 361       8.938   5.389 -39.645  1.00  0.54           C  
ATOM   2812  CD2 LEU A 361      10.978   3.991 -40.143  1.00  0.54           C  
ATOM   2813  N   LEU A 362      13.296   8.480 -38.199  1.00  0.52           N  
ATOM   2814  CA  LEU A 362      14.079   9.696 -38.251  1.00  0.52           C  
ATOM   2815  C   LEU A 362      15.564   9.466 -38.021  1.00  0.52           C  
ATOM   2816  O   LEU A 362      16.398   9.993 -38.754  1.00  0.52           O  
ATOM   2817  CB  LEU A 362      13.523  10.689 -37.215  1.00  0.52           C  
ATOM   2818  CG  LEU A 362      14.304  12.001 -37.047  1.00  0.52           C  
ATOM   2819  CD1 LEU A 362      14.415  12.777 -38.360  1.00  0.52           C  
ATOM   2820  CD2 LEU A 362      13.602  12.847 -35.991  1.00  0.52           C  
ATOM   2821  N   ASP A 363      15.943   8.624 -37.046  1.00  0.47           N  
ATOM   2822  CA  ASP A 363      17.329   8.245 -36.838  1.00  0.47           C  
ATOM   2823  C   ASP A 363      17.937   7.508 -38.031  1.00  0.47           C  
ATOM   2824  O   ASP A 363      19.039   7.825 -38.473  1.00  0.47           O  
ATOM   2825  CB  ASP A 363      17.468   7.402 -35.551  1.00  0.47           C  
ATOM   2826  CG  ASP A 363      17.200   8.243 -34.314  1.00  0.47           C  
ATOM   2827  OD1 ASP A 363      17.517   9.466 -34.326  1.00  0.47           O  
ATOM   2828  OD2 ASP A 363      16.640   7.695 -33.332  1.00  0.47           O  
ATOM   2829  N   GLN A 364      17.199   6.555 -38.643  1.00  0.47           N  
ATOM   2830  CA  GLN A 364      17.608   5.876 -39.863  1.00  0.47           C  
ATOM   2831  C   GLN A 364      17.819   6.826 -41.042  1.00  0.47           C  
ATOM   2832  O   GLN A 364      18.773   6.689 -41.812  1.00  0.47           O  
ATOM   2833  CB  GLN A 364      16.567   4.793 -40.249  1.00  0.47           C  
ATOM   2834  CG  GLN A 364      16.534   3.594 -39.270  1.00  0.47           C  
ATOM   2835  CD  GLN A 364      15.371   2.644 -39.566  1.00  0.47           C  
ATOM   2836  OE1 GLN A 364      14.411   2.944 -40.273  1.00  0.47           O  
ATOM   2837  NE2 GLN A 364      15.446   1.427 -38.975  1.00  0.47           N  
ATOM   2838  N   LEU A 365      16.938   7.833 -41.204  1.00  0.41           N  
ATOM   2839  CA  LEU A 365      17.094   8.888 -42.188  1.00  0.41           C  
ATOM   2840  C   LEU A 365      18.283   9.787 -41.950  1.00  0.41           C  
ATOM   2841  O   LEU A 365      19.096  10.013 -42.846  1.00  0.41           O  
ATOM   2842  CB  LEU A 365      15.860   9.812 -42.179  1.00  0.41           C  
ATOM   2843  CG  LEU A 365      14.588   9.206 -42.754  1.00  0.41           C  
ATOM   2844  CD1 LEU A 365      13.414  10.170 -42.627  1.00  0.41           C  
ATOM   2845  CD2 LEU A 365      14.784   8.854 -44.202  1.00  0.41           C  
ATOM   2846  N   SER A 366      18.426  10.292 -40.712  1.00  0.52           N  
ATOM   2847  CA  SER A 366      19.491  11.185 -40.300  1.00  0.52           C  
ATOM   2848  C   SER A 366      20.838  10.542 -40.459  1.00  0.52           C  
ATOM   2849  O   SER A 366      21.770  11.182 -40.934  1.00  0.52           O  
ATOM   2850  CB  SER A 366      19.325  11.649 -38.834  1.00  0.52           C  
ATOM   2851  OG  SER A 366      18.214  12.532 -38.730  1.00  0.52           O  
ATOM   2852  N   GLU A 367      20.963   9.245 -40.120  1.00  0.39           N  
ATOM   2853  CA  GLU A 367      22.172   8.488 -40.359  1.00  0.39           C  
ATOM   2854  C   GLU A 367      22.530   8.350 -41.829  1.00  0.39           C  
ATOM   2855  O   GLU A 367      23.639   8.660 -42.247  1.00  0.39           O  
ATOM   2856  CB  GLU A 367      22.067   7.094 -39.706  1.00  0.39           C  
ATOM   2857  CG  GLU A 367      23.434   6.386 -39.539  1.00  0.39           C  
ATOM   2858  CD  GLU A 367      24.420   7.099 -38.603  1.00  0.39           C  
ATOM   2859  OE1 GLU A 367      25.528   6.525 -38.431  1.00  0.39           O  
ATOM   2860  OE2 GLU A 367      24.123   8.201 -38.066  1.00  0.39           O  
ATOM   2861  N   GLY A 368      21.563   7.993 -42.706  1.00  0.37           N  
ATOM   2862  CA  GLY A 368      21.818   7.900 -44.143  1.00  0.37           C  
ATOM   2863  C   GLY A 368      22.254   9.191 -44.789  1.00  0.37           C  
ATOM   2864  O   GLY A 368      23.032   9.183 -45.739  1.00  0.37           O  
ATOM   2865  N   SER A 369      21.802  10.349 -44.266  1.00  0.38           N  
ATOM   2866  CA  SER A 369      22.196  11.642 -44.808  1.00  0.38           C  
ATOM   2867  C   SER A 369      23.627  11.999 -44.461  1.00  0.38           C  
ATOM   2868  O   SER A 369      24.266  12.778 -45.164  1.00  0.38           O  
ATOM   2869  CB  SER A 369      21.346  12.836 -44.276  1.00  0.38           C  
ATOM   2870  OG  SER A 369      20.029  12.875 -44.814  1.00  0.38           O  
ATOM   2871  N   ARG A 370      24.170  11.447 -43.357  1.00  0.27           N  
ATOM   2872  CA  ARG A 370      25.513  11.741 -42.889  1.00  0.27           C  
ATOM   2873  C   ARG A 370      26.588  11.036 -43.690  1.00  0.27           C  
ATOM   2874  O   ARG A 370      27.686  11.560 -43.875  1.00  0.27           O  
ATOM   2875  CB  ARG A 370      25.675  11.368 -41.397  1.00  0.27           C  
ATOM   2876  CG  ARG A 370      24.846  12.255 -40.451  1.00  0.27           C  
ATOM   2877  CD  ARG A 370      24.983  11.823 -38.991  1.00  0.27           C  
ATOM   2878  NE  ARG A 370      24.094  12.717 -38.179  1.00  0.27           N  
ATOM   2879  CZ  ARG A 370      24.206  12.862 -36.853  1.00  0.27           C  
ATOM   2880  NH1 ARG A 370      25.187  12.270 -36.180  1.00  0.27           N  
ATOM   2881  NH2 ARG A 370      23.327  13.616 -36.194  1.00  0.27           N  
ATOM   2882  N   HIS A 371      26.297   9.821 -44.186  1.00  0.23           N  
ATOM   2883  CA  HIS A 371      27.304   8.990 -44.816  1.00  0.23           C  
ATOM   2884  C   HIS A 371      27.399   9.170 -46.318  1.00  0.23           C  
ATOM   2885  O   HIS A 371      28.437   8.875 -46.905  1.00  0.23           O  
ATOM   2886  CB  HIS A 371      27.034   7.496 -44.531  1.00  0.23           C  
ATOM   2887  CG  HIS A 371      27.251   7.127 -43.099  1.00  0.23           C  
ATOM   2888  ND1 HIS A 371      26.344   7.524 -42.152  1.00  0.23           N  
ATOM   2889  CD2 HIS A 371      28.267   6.443 -42.516  1.00  0.23           C  
ATOM   2890  CE1 HIS A 371      26.818   7.080 -41.010  1.00  0.23           C  
ATOM   2891  NE2 HIS A 371      27.984   6.416 -41.171  1.00  0.23           N  
ATOM   2892  N   GLN A 372      26.362   9.709 -46.983  1.00  0.26           N  
ATOM   2893  CA  GLN A 372      26.436   9.928 -48.412  1.00  0.26           C  
ATOM   2894  C   GLN A 372      25.277  10.781 -48.866  1.00  0.26           C  
ATOM   2895  O   GLN A 372      24.139  10.333 -48.972  1.00  0.26           O  
ATOM   2896  CB  GLN A 372      26.416   8.597 -49.211  1.00  0.26           C  
ATOM   2897  CG  GLN A 372      26.959   8.731 -50.648  1.00  0.26           C  
ATOM   2898  CD  GLN A 372      27.120   7.352 -51.283  1.00  0.26           C  
ATOM   2899  OE1 GLN A 372      26.764   6.312 -50.731  1.00  0.26           O  
ATOM   2900  NE2 GLN A 372      27.709   7.334 -52.501  1.00  0.26           N  
ATOM   2901  N   LEU A 373      25.524  12.075 -49.150  1.00  0.26           N  
ATOM   2902  CA  LEU A 373      24.522  12.890 -49.810  1.00  0.26           C  
ATOM   2903  C   LEU A 373      24.271  12.391 -51.227  1.00  0.26           C  
ATOM   2904  O   LEU A 373      25.215  11.934 -51.878  1.00  0.26           O  
ATOM   2905  CB  LEU A 373      24.878  14.396 -49.792  1.00  0.26           C  
ATOM   2906  CG  LEU A 373      24.746  15.007 -48.382  1.00  0.26           C  
ATOM   2907  CD1 LEU A 373      25.611  16.265 -48.232  1.00  0.26           C  
ATOM   2908  CD2 LEU A 373      23.281  15.323 -48.029  1.00  0.26           C  
ATOM   2909  N   PRO A 374      23.062  12.410 -51.759  1.00  0.28           N  
ATOM   2910  CA  PRO A 374      22.829  12.026 -53.135  1.00  0.28           C  
ATOM   2911  C   PRO A 374      23.387  13.052 -54.100  1.00  0.28           C  
ATOM   2912  O   PRO A 374      23.537  14.216 -53.737  1.00  0.28           O  
ATOM   2913  CB  PRO A 374      21.301  11.905 -53.265  1.00  0.28           C  
ATOM   2914  CG  PRO A 374      20.670  12.269 -51.918  1.00  0.28           C  
ATOM   2915  CD  PRO A 374      21.838  12.581 -50.994  1.00  0.28           C  
ATOM   2916  N   GLY A 375      23.667  12.682 -55.368  1.00  0.27           N  
ATOM   2917  CA  GLY A 375      24.033  13.682 -56.374  1.00  0.27           C  
ATOM   2918  C   GLY A 375      22.829  14.441 -56.863  1.00  0.27           C  
ATOM   2919  O   GLY A 375      22.960  15.490 -57.473  1.00  0.27           O  
ATOM   2920  N   ASN A 376      21.624  13.930 -56.539  1.00  0.29           N  
ATOM   2921  CA  ASN A 376      20.354  14.596 -56.728  1.00  0.29           C  
ATOM   2922  C   ASN A 376      20.059  15.516 -55.546  1.00  0.29           C  
ATOM   2923  O   ASN A 376      19.744  15.084 -54.432  1.00  0.29           O  
ATOM   2924  CB  ASN A 376      19.244  13.518 -56.891  1.00  0.29           C  
ATOM   2925  CG  ASN A 376      17.874  14.088 -57.257  1.00  0.29           C  
ATOM   2926  OD1 ASN A 376      17.412  15.101 -56.728  1.00  0.29           O  
ATOM   2927  ND2 ASN A 376      17.154  13.380 -58.156  1.00  0.29           N  
ATOM   2928  N   ARG A 377      20.130  16.834 -55.795  1.00  0.36           N  
ATOM   2929  CA  ARG A 377      19.874  17.863 -54.813  1.00  0.36           C  
ATOM   2930  C   ARG A 377      18.442  17.907 -54.298  1.00  0.36           C  
ATOM   2931  O   ARG A 377      18.192  18.100 -53.103  1.00  0.36           O  
ATOM   2932  CB  ARG A 377      20.237  19.214 -55.450  1.00  0.36           C  
ATOM   2933  CG  ARG A 377      20.111  20.426 -54.515  1.00  0.36           C  
ATOM   2934  CD  ARG A 377      20.554  21.702 -55.222  1.00  0.36           C  
ATOM   2935  NE  ARG A 377      20.373  22.827 -54.249  1.00  0.36           N  
ATOM   2936  CZ  ARG A 377      20.976  24.011 -54.388  1.00  0.36           C  
ATOM   2937  NH1 ARG A 377      21.869  24.208 -55.344  1.00  0.36           N  
ATOM   2938  NH2 ARG A 377      20.699  25.010 -53.555  1.00  0.36           N  
ATOM   2939  N   GLN A 378      17.463  17.719 -55.205  1.00  0.42           N  
ATOM   2940  CA  GLN A 378      16.043  17.748 -54.914  1.00  0.42           C  
ATOM   2941  C   GLN A 378      15.621  16.651 -53.942  1.00  0.42           C  
ATOM   2942  O   GLN A 378      14.861  16.877 -52.998  1.00  0.42           O  
ATOM   2943  CB  GLN A 378      15.236  17.635 -56.235  1.00  0.42           C  
ATOM   2944  CG  GLN A 378      13.716  17.847 -56.043  1.00  0.42           C  
ATOM   2945  CD  GLN A 378      12.929  17.807 -57.349  1.00  0.42           C  
ATOM   2946  OE1 GLN A 378      13.304  17.218 -58.363  1.00  0.42           O  
ATOM   2947  NE2 GLN A 378      11.731  18.445 -57.337  1.00  0.42           N  
ATOM   2948  N   LEU A 379      16.148  15.426 -54.134  1.00  0.39           N  
ATOM   2949  CA  LEU A 379      15.925  14.284 -53.266  1.00  0.39           C  
ATOM   2950  C   LEU A 379      16.460  14.493 -51.860  1.00  0.39           C  
ATOM   2951  O   LEU A 379      15.793  14.198 -50.869  1.00  0.39           O  
ATOM   2952  CB  LEU A 379      16.543  13.026 -53.909  1.00  0.39           C  
ATOM   2953  CG  LEU A 379      16.281  11.686 -53.196  1.00  0.39           C  
ATOM   2954  CD1 LEU A 379      14.786  11.410 -52.985  1.00  0.39           C  
ATOM   2955  CD2 LEU A 379      16.925  10.572 -54.023  1.00  0.39           C  
ATOM   2956  N   ALA A 380      17.663  15.090 -51.735  1.00  0.42           N  
ATOM   2957  CA  ALA A 380      18.224  15.481 -50.459  1.00  0.42           C  
ATOM   2958  C   ALA A 380      17.354  16.492 -49.716  1.00  0.42           C  
ATOM   2959  O   ALA A 380      17.100  16.357 -48.521  1.00  0.42           O  
ATOM   2960  CB  ALA A 380      19.635  16.053 -50.685  1.00  0.42           C  
ATOM   2961  N   GLY A 381      16.827  17.509 -50.436  1.00  0.52           N  
ATOM   2962  CA  GLY A 381      15.806  18.431 -49.934  1.00  0.52           C  
ATOM   2963  C   GLY A 381      14.557  17.781 -49.389  1.00  0.52           C  
ATOM   2964  O   GLY A 381      14.132  18.070 -48.273  1.00  0.52           O  
ATOM   2965  N   ARG A 382      13.947  16.860 -50.163  1.00  0.42           N  
ATOM   2966  CA  ARG A 382      12.793  16.072 -49.749  1.00  0.42           C  
ATOM   2967  C   ARG A 382      13.071  15.199 -48.532  1.00  0.42           C  
ATOM   2968  O   ARG A 382      12.224  15.035 -47.655  1.00  0.42           O  
ATOM   2969  CB  ARG A 382      12.289  15.157 -50.895  1.00  0.42           C  
ATOM   2970  CG  ARG A 382      11.648  15.893 -52.090  1.00  0.42           C  
ATOM   2971  CD  ARG A 382      11.156  14.903 -53.158  1.00  0.42           C  
ATOM   2972  NE  ARG A 382      10.548  15.678 -54.289  1.00  0.42           N  
ATOM   2973  CZ  ARG A 382      10.119  15.117 -55.431  1.00  0.42           C  
ATOM   2974  NH1 ARG A 382      10.157  13.805 -55.632  1.00  0.42           N  
ATOM   2975  NH2 ARG A 382       9.646  15.900 -56.401  1.00  0.42           N  
ATOM   2976  N   SER A 383      14.282  14.618 -48.440  1.00  0.49           N  
ATOM   2977  CA  SER A 383      14.701  13.870 -47.263  1.00  0.49           C  
ATOM   2978  C   SER A 383      14.747  14.704 -45.997  1.00  0.49           C  
ATOM   2979  O   SER A 383      14.205  14.313 -44.965  1.00  0.49           O  
ATOM   2980  CB  SER A 383      16.050  13.146 -47.487  1.00  0.49           C  
ATOM   2981  OG  SER A 383      16.333  12.240 -46.418  1.00  0.49           O  
ATOM   2982  N   TYR A 384      15.318  15.921 -46.060  1.00  0.52           N  
ATOM   2983  CA  TYR A 384      15.289  16.864 -44.954  1.00  0.52           C  
ATOM   2984  C   TYR A 384      13.880  17.316 -44.560  1.00  0.52           C  
ATOM   2985  O   TYR A 384      13.581  17.429 -43.371  1.00  0.52           O  
ATOM   2986  CB  TYR A 384      16.198  18.087 -45.232  1.00  0.52           C  
ATOM   2987  CG  TYR A 384      17.658  17.723 -45.153  1.00  0.52           C  
ATOM   2988  CD1 TYR A 384      18.190  17.220 -43.955  1.00  0.52           C  
ATOM   2989  CD2 TYR A 384      18.521  17.911 -46.246  1.00  0.52           C  
ATOM   2990  CE1 TYR A 384      19.542  16.867 -43.864  1.00  0.52           C  
ATOM   2991  CE2 TYR A 384      19.878  17.568 -46.155  1.00  0.52           C  
ATOM   2992  CZ  TYR A 384      20.386  17.041 -44.962  1.00  0.52           C  
ATOM   2993  OH  TYR A 384      21.744  16.697 -44.852  1.00  0.52           O  
ATOM   2994  N   ASP A 385      12.965  17.542 -45.535  1.00  0.56           N  
ATOM   2995  CA  ASP A 385      11.561  17.856 -45.276  1.00  0.56           C  
ATOM   2996  C   ASP A 385      10.843  16.733 -44.519  1.00  0.56           C  
ATOM   2997  O   ASP A 385      10.173  16.933 -43.513  1.00  0.56           O  
ATOM   2998  CB  ASP A 385      10.846  18.139 -46.631  1.00  0.56           C  
ATOM   2999  CG  ASP A 385       9.466  18.799 -46.533  1.00  0.56           C  
ATOM   3000  OD1 ASP A 385       8.890  18.991 -45.433  1.00  0.56           O  
ATOM   3001  OD2 ASP A 385       8.962  19.178 -47.624  1.00  0.56           O  
ATOM   3002  N   LEU A 386      11.025  15.469 -44.928  1.00  0.55           N  
ATOM   3003  CA  LEU A 386      10.464  14.335 -44.210  1.00  0.55           C  
ATOM   3004  C   LEU A 386      11.019  14.162 -42.806  1.00  0.55           C  
ATOM   3005  O   LEU A 386      10.284  13.890 -41.856  1.00  0.55           O  
ATOM   3006  CB  LEU A 386      10.707  13.044 -45.009  1.00  0.55           C  
ATOM   3007  CG  LEU A 386      10.187  11.746 -44.357  1.00  0.55           C  
ATOM   3008  CD1 LEU A 386       8.668  11.774 -44.137  1.00  0.55           C  
ATOM   3009  CD2 LEU A 386      10.584  10.533 -45.200  1.00  0.55           C  
ATOM   3010  N   GLN A 387      12.343  14.349 -42.633  1.00  0.63           N  
ATOM   3011  CA  GLN A 387      12.987  14.327 -41.333  1.00  0.63           C  
ATOM   3012  C   GLN A 387      12.423  15.386 -40.402  1.00  0.63           C  
ATOM   3013  O   GLN A 387      12.127  15.115 -39.241  1.00  0.63           O  
ATOM   3014  CB  GLN A 387      14.517  14.529 -41.470  1.00  0.63           C  
ATOM   3015  CG  GLN A 387      15.233  13.317 -42.099  1.00  0.63           C  
ATOM   3016  CD  GLN A 387      16.718  13.555 -42.397  1.00  0.63           C  
ATOM   3017  OE1 GLN A 387      17.446  14.248 -41.691  1.00  0.63           O  
ATOM   3018  NE2 GLN A 387      17.210  12.920 -43.489  1.00  0.63           N  
ATOM   3019  N   ALA A 388      12.197  16.610 -40.917  1.00  0.66           N  
ATOM   3020  CA  ALA A 388      11.545  17.675 -40.193  1.00  0.66           C  
ATOM   3021  C   ALA A 388      10.118  17.338 -39.761  1.00  0.66           C  
ATOM   3022  O   ALA A 388       9.738  17.563 -38.613  1.00  0.66           O  
ATOM   3023  CB  ALA A 388      11.563  18.947 -41.058  1.00  0.66           C  
ATOM   3024  N   LEU A 389       9.309  16.727 -40.651  1.00  0.59           N  
ATOM   3025  CA  LEU A 389       7.989  16.222 -40.311  1.00  0.59           C  
ATOM   3026  C   LEU A 389       7.995  15.121 -39.254  1.00  0.59           C  
ATOM   3027  O   LEU A 389       7.203  15.136 -38.315  1.00  0.59           O  
ATOM   3028  CB  LEU A 389       7.249  15.718 -41.574  1.00  0.59           C  
ATOM   3029  CG  LEU A 389       5.783  15.290 -41.336  1.00  0.59           C  
ATOM   3030  CD1 LEU A 389       4.911  16.440 -40.809  1.00  0.59           C  
ATOM   3031  CD2 LEU A 389       5.165  14.714 -42.612  1.00  0.59           C  
ATOM   3032  N   LEU A 390       8.911  14.140 -39.348  1.00  0.57           N  
ATOM   3033  CA  LEU A 390       9.068  13.097 -38.347  1.00  0.57           C  
ATOM   3034  C   LEU A 390       9.495  13.634 -37.002  1.00  0.57           C  
ATOM   3035  O   LEU A 390       8.962  13.227 -35.975  1.00  0.57           O  
ATOM   3036  CB  LEU A 390      10.079  12.028 -38.799  1.00  0.57           C  
ATOM   3037  CG  LEU A 390       9.528  11.069 -39.864  1.00  0.57           C  
ATOM   3038  CD1 LEU A 390      10.675  10.278 -40.490  1.00  0.57           C  
ATOM   3039  CD2 LEU A 390       8.505  10.103 -39.259  1.00  0.57           C  
ATOM   3040  N   ALA A 391      10.432  14.599 -36.991  1.00  0.61           N  
ATOM   3041  CA  ALA A 391      10.874  15.301 -35.812  1.00  0.61           C  
ATOM   3042  C   ALA A 391       9.747  16.063 -35.135  1.00  0.61           C  
ATOM   3043  O   ALA A 391       9.584  15.993 -33.918  1.00  0.61           O  
ATOM   3044  CB  ALA A 391      12.035  16.230 -36.207  1.00  0.61           C  
ATOM   3045  N   LEU A 392       8.891  16.744 -35.926  1.00  0.56           N  
ATOM   3046  CA  LEU A 392       7.661  17.350 -35.452  1.00  0.56           C  
ATOM   3047  C   LEU A 392       6.673  16.340 -34.875  1.00  0.56           C  
ATOM   3048  O   LEU A 392       6.186  16.505 -33.764  1.00  0.56           O  
ATOM   3049  CB  LEU A 392       7.012  18.141 -36.616  1.00  0.56           C  
ATOM   3050  CG  LEU A 392       5.741  18.947 -36.280  1.00  0.56           C  
ATOM   3051  CD1 LEU A 392       6.035  20.131 -35.352  1.00  0.56           C  
ATOM   3052  CD2 LEU A 392       5.098  19.467 -37.570  1.00  0.56           C  
ATOM   3053  N   THR A 393       6.397  15.224 -35.573  1.00  0.55           N  
ATOM   3054  CA  THR A 393       5.505  14.171 -35.081  1.00  0.55           C  
ATOM   3055  C   THR A 393       6.002  13.477 -33.816  1.00  0.55           C  
ATOM   3056  O   THR A 393       5.221  13.177 -32.916  1.00  0.55           O  
ATOM   3057  CB  THR A 393       5.159  13.130 -36.146  1.00  0.55           C  
ATOM   3058  OG1 THR A 393       4.642  13.776 -37.303  1.00  0.55           O  
ATOM   3059  CG2 THR A 393       4.046  12.191 -35.652  1.00  0.55           C  
ATOM   3060  N   CYS A 394       7.315  13.193 -33.674  1.00  0.53           N  
ATOM   3061  CA  CYS A 394       7.810  12.436 -32.528  1.00  0.53           C  
ATOM   3062  C   CYS A 394       8.341  13.288 -31.383  1.00  0.53           C  
ATOM   3063  O   CYS A 394       8.783  12.775 -30.357  1.00  0.53           O  
ATOM   3064  CB  CYS A 394       8.889  11.405 -32.953  1.00  0.53           C  
ATOM   3065  SG  CYS A 394      10.466  12.143 -33.514  1.00  0.53           S  
ATOM   3066  N   GLY A 395       8.286  14.619 -31.504  1.00  0.62           N  
ATOM   3067  CA  GLY A 395       8.600  15.514 -30.414  1.00  0.62           C  
ATOM   3068  C   GLY A 395      10.001  16.012 -30.236  1.00  0.62           C  
ATOM   3069  O   GLY A 395      10.339  16.529 -29.170  1.00  0.62           O  
ATOM   3070  N   ARG A 396      10.816  15.939 -31.292  1.00  0.59           N  
ATOM   3071  CA  ARG A 396      12.164  16.471 -31.413  1.00  0.59           C  
ATOM   3072  C   ARG A 396      12.115  17.815 -32.139  1.00  0.59           C  
ATOM   3073  O   ARG A 396      12.618  17.995 -33.247  1.00  0.59           O  
ATOM   3074  CB  ARG A 396      13.059  15.456 -32.173  1.00  0.59           C  
ATOM   3075  CG  ARG A 396      13.173  14.094 -31.453  1.00  0.59           C  
ATOM   3076  CD  ARG A 396      13.782  12.973 -32.301  1.00  0.59           C  
ATOM   3077  NE  ARG A 396      15.227  13.220 -32.458  1.00  0.59           N  
ATOM   3078  CZ  ARG A 396      16.088  12.416 -33.087  1.00  0.59           C  
ATOM   3079  NH1 ARG A 396      15.720  11.256 -33.594  1.00  0.59           N  
ATOM   3080  NH2 ARG A 396      17.334  12.831 -33.233  1.00  0.59           N  
ATOM   3081  N   TYR A 397      11.447  18.807 -31.517  1.00  0.56           N  
ATOM   3082  CA  TYR A 397      11.104  20.094 -32.108  1.00  0.56           C  
ATOM   3083  C   TYR A 397      12.298  21.019 -32.264  1.00  0.56           C  
ATOM   3084  O   TYR A 397      12.284  21.935 -33.079  1.00  0.56           O  
ATOM   3085  CB  TYR A 397      10.005  20.858 -31.323  1.00  0.56           C  
ATOM   3086  CG  TYR A 397       8.862  19.979 -31.002  1.00  0.56           C  
ATOM   3087  CD1 TYR A 397       7.953  19.682 -32.001  1.00  0.56           C  
ATOM   3088  CD2 TYR A 397       8.703  19.342 -29.781  1.00  0.56           C  
ATOM   3089  CE1 TYR A 397       6.836  18.899 -31.767  1.00  0.56           C  
ATOM   3090  CE2 TYR A 397       7.659  18.491 -29.620  1.00  0.56           C  
ATOM   3091  CZ  TYR A 397       6.684  18.263 -30.545  1.00  0.56           C  
ATOM   3092  OH  TYR A 397       5.788  17.217 -30.351  1.00  0.56           O  
ATOM   3093  N   ASP A 398      13.380  20.767 -31.516  1.00  0.62           N  
ATOM   3094  CA  ASP A 398      14.660  21.426 -31.572  1.00  0.62           C  
ATOM   3095  C   ASP A 398      15.346  21.194 -32.918  1.00  0.62           C  
ATOM   3096  O   ASP A 398      15.944  22.093 -33.512  1.00  0.62           O  
ATOM   3097  CB  ASP A 398      15.495  20.954 -30.346  1.00  0.62           C  
ATOM   3098  CG  ASP A 398      15.507  19.440 -30.152  1.00  0.62           C  
ATOM   3099  OD1 ASP A 398      14.402  18.848 -29.987  1.00  0.62           O  
ATOM   3100  OD2 ASP A 398      16.624  18.877 -30.152  1.00  0.62           O  
ATOM   3101  N   GLU A 399      15.196  19.971 -33.454  1.00  0.65           N  
ATOM   3102  CA  GLU A 399      15.662  19.564 -34.760  1.00  0.65           C  
ATOM   3103  C   GLU A 399      14.815  20.090 -35.929  1.00  0.65           C  
ATOM   3104  O   GLU A 399      15.316  20.247 -37.043  1.00  0.65           O  
ATOM   3105  CB  GLU A 399      15.765  18.022 -34.783  1.00  0.65           C  
ATOM   3106  CG  GLU A 399      16.728  17.475 -33.701  1.00  0.65           C  
ATOM   3107  CD  GLU A 399      16.869  15.971 -33.737  1.00  0.65           C  
ATOM   3108  OE1 GLU A 399      16.803  15.369 -32.633  1.00  0.65           O  
ATOM   3109  OE2 GLU A 399      17.067  15.353 -34.813  1.00  0.65           O  
ATOM   3110  N   VAL A 400      13.520  20.443 -35.717  1.00  0.68           N  
ATOM   3111  CA  VAL A 400      12.612  20.941 -36.763  1.00  0.68           C  
ATOM   3112  C   VAL A 400      13.090  22.211 -37.480  1.00  0.68           C  
ATOM   3113  O   VAL A 400      13.051  22.202 -38.714  1.00  0.68           O  
ATOM   3114  CB  VAL A 400      11.160  21.095 -36.277  1.00  0.68           C  
ATOM   3115  CG1 VAL A 400      10.205  21.616 -37.377  1.00  0.68           C  
ATOM   3116  CG2 VAL A 400      10.634  19.724 -35.821  1.00  0.68           C  
ATOM   3117  N   PRO A 401      13.594  23.300 -36.880  1.00  0.63           N  
ATOM   3118  CA  PRO A 401      14.112  24.438 -37.633  1.00  0.63           C  
ATOM   3119  C   PRO A 401      15.317  24.120 -38.482  1.00  0.63           C  
ATOM   3120  O   PRO A 401      15.404  24.617 -39.604  1.00  0.63           O  
ATOM   3121  CB  PRO A 401      14.430  25.504 -36.563  1.00  0.63           C  
ATOM   3122  CG  PRO A 401      13.513  25.146 -35.392  1.00  0.63           C  
ATOM   3123  CD  PRO A 401      13.443  23.623 -35.464  1.00  0.63           C  
ATOM   3124  N   LEU A 402      16.259  23.305 -37.971  1.00  0.59           N  
ATOM   3125  CA  LEU A 402      17.467  22.945 -38.686  1.00  0.59           C  
ATOM   3126  C   LEU A 402      17.188  22.102 -39.920  1.00  0.59           C  
ATOM   3127  O   LEU A 402      17.623  22.419 -41.026  1.00  0.59           O  
ATOM   3128  CB  LEU A 402      18.407  22.165 -37.735  1.00  0.59           C  
ATOM   3129  CG  LEU A 402      18.936  22.986 -36.540  1.00  0.59           C  
ATOM   3130  CD1 LEU A 402      19.633  22.064 -35.528  1.00  0.59           C  
ATOM   3131  CD2 LEU A 402      19.898  24.098 -36.984  1.00  0.59           C  
ATOM   3132  N   LEU A 403      16.377  21.037 -39.763  1.00  0.62           N  
ATOM   3133  CA  LEU A 403      15.978  20.162 -40.847  1.00  0.62           C  
ATOM   3134  C   LEU A 403      15.137  20.876 -41.897  1.00  0.62           C  
ATOM   3135  O   LEU A 403      15.349  20.729 -43.099  1.00  0.62           O  
ATOM   3136  CB  LEU A 403      15.211  18.950 -40.273  1.00  0.62           C  
ATOM   3137  CG  LEU A 403      16.059  18.026 -39.372  1.00  0.62           C  
ATOM   3138  CD1 LEU A 403      15.159  17.069 -38.576  1.00  0.62           C  
ATOM   3139  CD2 LEU A 403      17.085  17.227 -40.186  1.00  0.62           C  
ATOM   3140  N   LEU A 404      14.176  21.722 -41.470  1.00  0.63           N  
ATOM   3141  CA  LEU A 404      13.384  22.522 -42.383  1.00  0.63           C  
ATOM   3142  C   LEU A 404      14.203  23.557 -43.154  1.00  0.63           C  
ATOM   3143  O   LEU A 404      13.999  23.756 -44.350  1.00  0.63           O  
ATOM   3144  CB  LEU A 404      12.196  23.164 -41.632  1.00  0.63           C  
ATOM   3145  CG  LEU A 404      11.140  23.856 -42.514  1.00  0.63           C  
ATOM   3146  CD1 LEU A 404      10.539  22.899 -43.551  1.00  0.63           C  
ATOM   3147  CD2 LEU A 404      10.023  24.437 -41.637  1.00  0.63           C  
ATOM   3148  N   GLY A 405      15.179  24.228 -42.500  1.00  0.65           N  
ATOM   3149  CA  GLY A 405      16.195  25.062 -43.152  1.00  0.65           C  
ATOM   3150  C   GLY A 405      16.926  24.397 -44.287  1.00  0.65           C  
ATOM   3151  O   GLY A 405      16.960  24.910 -45.405  1.00  0.65           O  
ATOM   3152  N   GLU A 406      17.490  23.204 -44.029  1.00  0.59           N  
ATOM   3153  CA  GLU A 406      18.168  22.387 -45.015  1.00  0.59           C  
ATOM   3154  C   GLU A 406      17.269  21.948 -46.165  1.00  0.59           C  
ATOM   3155  O   GLU A 406      17.697  21.872 -47.319  1.00  0.59           O  
ATOM   3156  CB  GLU A 406      18.800  21.144 -44.348  1.00  0.59           C  
ATOM   3157  CG  GLU A 406      20.024  21.437 -43.439  1.00  0.59           C  
ATOM   3158  CD  GLU A 406      21.209  22.048 -44.186  1.00  0.59           C  
ATOM   3159  OE1 GLU A 406      21.791  23.032 -43.670  1.00  0.59           O  
ATOM   3160  OE2 GLU A 406      21.542  21.553 -45.303  1.00  0.59           O  
ATOM   3161  N   ALA A 407      15.983  21.643 -45.897  1.00  0.60           N  
ATOM   3162  CA  ALA A 407      15.016  21.377 -46.939  1.00  0.60           C  
ATOM   3163  C   ALA A 407      14.758  22.575 -47.849  1.00  0.60           C  
ATOM   3164  O   ALA A 407      14.809  22.478 -49.075  1.00  0.60           O  
ATOM   3165  CB  ALA A 407      13.703  20.913 -46.288  1.00  0.60           C  
ATOM   3166  N   ARG A 408      14.551  23.762 -47.254  1.00  0.55           N  
ATOM   3167  CA  ARG A 408      14.316  25.015 -47.946  1.00  0.55           C  
ATOM   3168  C   ARG A 408      15.479  25.485 -48.809  1.00  0.55           C  
ATOM   3169  O   ARG A 408      15.280  25.989 -49.912  1.00  0.55           O  
ATOM   3170  CB  ARG A 408      13.896  26.100 -46.930  1.00  0.55           C  
ATOM   3171  CG  ARG A 408      12.486  25.861 -46.339  1.00  0.55           C  
ATOM   3172  CD  ARG A 408      12.159  26.821 -45.195  1.00  0.55           C  
ATOM   3173  NE  ARG A 408      10.722  26.647 -44.795  1.00  0.55           N  
ATOM   3174  CZ  ARG A 408      10.147  27.288 -43.775  1.00  0.55           C  
ATOM   3175  NH1 ARG A 408      10.864  27.954 -42.888  1.00  0.55           N  
ATOM   3176  NH2 ARG A 408       8.838  27.248 -43.617  1.00  0.55           N  
ATOM   3177  N   SER A 409      16.741  25.277 -48.378  1.00  0.59           N  
ATOM   3178  CA  SER A 409      17.930  25.663 -49.135  1.00  0.59           C  
ATOM   3179  C   SER A 409      18.108  24.856 -50.423  1.00  0.59           C  
ATOM   3180  O   SER A 409      18.887  25.181 -51.326  1.00  0.59           O  
ATOM   3181  CB  SER A 409      19.203  25.570 -48.250  1.00  0.59           C  
ATOM   3182  OG  SER A 409      19.565  24.219 -47.964  1.00  0.59           O  
ATOM   3183  N   ARG A 410      17.330  23.767 -50.533  1.00  0.52           N  
ATOM   3184  CA  ARG A 410      17.272  22.877 -51.663  1.00  0.52           C  
ATOM   3185  C   ARG A 410      15.909  22.892 -52.345  1.00  0.52           C  
ATOM   3186  O   ARG A 410      15.621  22.011 -53.150  1.00  0.52           O  
ATOM   3187  CB  ARG A 410      17.596  21.453 -51.168  1.00  0.52           C  
ATOM   3188  CG  ARG A 410      19.035  21.322 -50.637  1.00  0.52           C  
ATOM   3189  CD  ARG A 410      19.286  19.989 -49.935  1.00  0.52           C  
ATOM   3190  NE  ARG A 410      20.727  19.950 -49.523  1.00  0.52           N  
ATOM   3191  CZ  ARG A 410      21.173  20.500 -48.386  1.00  0.52           C  
ATOM   3192  NH1 ARG A 410      20.403  21.216 -47.588  1.00  0.52           N  
ATOM   3193  NH2 ARG A 410      22.432  20.327 -47.989  1.00  0.52           N  
ATOM   3194  N   GLN A 411      15.057  23.901 -52.051  1.00  0.45           N  
ATOM   3195  CA  GLN A 411      13.760  24.121 -52.682  1.00  0.45           C  
ATOM   3196  C   GLN A 411      12.721  23.049 -52.363  1.00  0.45           C  
ATOM   3197  O   GLN A 411      11.865  22.707 -53.176  1.00  0.45           O  
ATOM   3198  CB  GLN A 411      13.861  24.386 -54.209  1.00  0.45           C  
ATOM   3199  CG  GLN A 411      14.764  25.587 -54.572  1.00  0.45           C  
ATOM   3200  CD  GLN A 411      14.886  25.748 -56.086  1.00  0.45           C  
ATOM   3201  OE1 GLN A 411      14.351  24.989 -56.891  1.00  0.45           O  
ATOM   3202  NE2 GLN A 411      15.636  26.795 -56.504  1.00  0.45           N  
ATOM   3203  N   ALA A 412      12.753  22.538 -51.120  1.00  0.45           N  
ATOM   3204  CA  ALA A 412      11.776  21.643 -50.542  1.00  0.45           C  
ATOM   3205  C   ALA A 412      11.239  22.250 -49.245  1.00  0.45           C  
ATOM   3206  O   ALA A 412      11.436  23.432 -48.976  1.00  0.45           O  
ATOM   3207  CB  ALA A 412      12.418  20.268 -50.307  1.00  0.45           C  
ATOM   3208  N   GLY A 413      10.502  21.494 -48.401  1.00  0.48           N  
ATOM   3209  CA  GLY A 413       9.975  22.055 -47.162  1.00  0.48           C  
ATOM   3210  C   GLY A 413       8.538  22.444 -47.255  1.00  0.48           C  
ATOM   3211  O   GLY A 413       8.030  23.119 -46.369  1.00  0.48           O  
ATOM   3212  N   SER A 414       7.820  22.039 -48.311  1.00  0.56           N  
ATOM   3213  CA  SER A 414       6.391  22.241 -48.434  1.00  0.56           C  
ATOM   3214  C   SER A 414       5.580  21.355 -47.511  1.00  0.56           C  
ATOM   3215  O   SER A 414       4.609  21.820 -46.918  1.00  0.56           O  
ATOM   3216  CB  SER A 414       5.847  22.133 -49.885  1.00  0.56           C  
ATOM   3217  OG  SER A 414       6.116  20.867 -50.492  1.00  0.56           O  
ATOM   3218  N   LEU A 415       5.957  20.067 -47.345  1.00  0.50           N  
ATOM   3219  CA  LEU A 415       5.207  19.115 -46.545  1.00  0.50           C  
ATOM   3220  C   LEU A 415       5.177  19.474 -45.072  1.00  0.50           C  
ATOM   3221  O   LEU A 415       4.119  19.573 -44.448  1.00  0.50           O  
ATOM   3222  CB  LEU A 415       5.843  17.718 -46.725  1.00  0.50           C  
ATOM   3223  CG  LEU A 415       5.188  16.551 -45.964  1.00  0.50           C  
ATOM   3224  CD1 LEU A 415       3.811  16.172 -46.526  1.00  0.50           C  
ATOM   3225  CD2 LEU A 415       6.134  15.341 -45.985  1.00  0.50           C  
ATOM   3226  N   THR A 416       6.349  19.757 -44.479  1.00  0.56           N  
ATOM   3227  CA  THR A 416       6.423  20.217 -43.095  1.00  0.56           C  
ATOM   3228  C   THR A 416       5.789  21.571 -42.888  1.00  0.56           C  
ATOM   3229  O   THR A 416       5.020  21.754 -41.949  1.00  0.56           O  
ATOM   3230  CB  THR A 416       7.850  20.237 -42.595  1.00  0.56           C  
ATOM   3231  OG1 THR A 416       8.393  19.000 -42.756  1.00  0.56           O  
ATOM   3232  CG2 THR A 416       7.878  20.577 -41.068  1.00  0.56           C  
ATOM   3233  N   THR A 417       6.034  22.552 -43.794  1.00  0.58           N  
ATOM   3234  CA  THR A 417       5.431  23.896 -43.717  1.00  0.58           C  
ATOM   3235  C   THR A 417       3.906  23.825 -43.704  1.00  0.58           C  
ATOM   3236  O   THR A 417       3.264  24.386 -42.823  1.00  0.58           O  
ATOM   3237  CB  THR A 417       5.890  24.839 -44.858  1.00  0.58           C  
ATOM   3238  OG1 THR A 417       7.280  25.029 -44.859  1.00  0.58           O  
ATOM   3239  CG2 THR A 417       5.186  26.210 -44.730  1.00  0.58           C  
ATOM   3240  N   ALA A 418       3.286  23.038 -44.607  1.00  0.59           N  
ATOM   3241  CA  ALA A 418       1.845  22.873 -44.674  1.00  0.59           C  
ATOM   3242  C   ALA A 418       1.206  22.245 -43.440  1.00  0.59           C  
ATOM   3243  O   ALA A 418       0.175  22.701 -42.947  1.00  0.59           O  
ATOM   3244  CB  ALA A 418       1.506  22.012 -45.903  1.00  0.59           C  
ATOM   3245  N   THR A 419       1.825  21.187 -42.870  1.00  0.58           N  
ATOM   3246  CA  THR A 419       1.397  20.592 -41.605  1.00  0.58           C  
ATOM   3247  C   THR A 419       1.451  21.593 -40.464  1.00  0.58           C  
ATOM   3248  O   THR A 419       0.521  21.704 -39.666  1.00  0.58           O  
ATOM   3249  CB  THR A 419       2.263  19.397 -41.223  1.00  0.58           C  
ATOM   3250  OG1 THR A 419       2.149  18.382 -42.207  1.00  0.58           O  
ATOM   3251  CG2 THR A 419       1.821  18.753 -39.903  1.00  0.58           C  
ATOM   3252  N   VAL A 420       2.545  22.376 -40.387  1.00  0.65           N  
ATOM   3253  CA  VAL A 420       2.766  23.424 -39.401  1.00  0.65           C  
ATOM   3254  C   VAL A 420       1.765  24.567 -39.505  1.00  0.65           C  
ATOM   3255  O   VAL A 420       1.214  25.009 -38.497  1.00  0.65           O  
ATOM   3256  CB  VAL A 420       4.214  23.907 -39.463  1.00  0.65           C  
ATOM   3257  CG1 VAL A 420       4.446  25.220 -38.689  1.00  0.65           C  
ATOM   3258  CG2 VAL A 420       5.107  22.769 -38.928  1.00  0.65           C  
ATOM   3259  N   GLU A 421       1.453  25.043 -40.727  1.00  0.52           N  
ATOM   3260  CA  GLU A 421       0.405  26.025 -40.962  1.00  0.52           C  
ATOM   3261  C   GLU A 421      -0.987  25.512 -40.587  1.00  0.52           C  
ATOM   3262  O   GLU A 421      -1.730  26.159 -39.854  1.00  0.52           O  
ATOM   3263  CB  GLU A 421       0.447  26.492 -42.436  1.00  0.52           C  
ATOM   3264  CG  GLU A 421       1.700  27.349 -42.764  1.00  0.52           C  
ATOM   3265  CD  GLU A 421       1.961  27.555 -44.258  1.00  0.52           C  
ATOM   3266  OE1 GLU A 421       2.891  28.350 -44.559  1.00  0.52           O  
ATOM   3267  OE2 GLU A 421       1.297  26.899 -45.100  1.00  0.52           O  
ATOM   3268  N   SER A 422      -1.330  24.269 -40.992  1.00  0.52           N  
ATOM   3269  CA  SER A 422      -2.582  23.591 -40.648  1.00  0.52           C  
ATOM   3270  C   SER A 422      -2.786  23.417 -39.155  1.00  0.52           C  
ATOM   3271  O   SER A 422      -3.893  23.560 -38.638  1.00  0.52           O  
ATOM   3272  CB  SER A 422      -2.657  22.188 -41.321  1.00  0.52           C  
ATOM   3273  OG  SER A 422      -3.870  21.483 -41.050  1.00  0.52           O  
ATOM   3274  N   LEU A 423      -1.707  23.121 -38.403  1.00  0.50           N  
ATOM   3275  CA  LEU A 423      -1.740  23.139 -36.954  1.00  0.50           C  
ATOM   3276  C   LEU A 423      -2.048  24.515 -36.395  1.00  0.50           C  
ATOM   3277  O   LEU A 423      -2.916  24.654 -35.543  1.00  0.50           O  
ATOM   3278  CB  LEU A 423      -0.383  22.671 -36.377  1.00  0.50           C  
ATOM   3279  CG  LEU A 423      -0.192  21.146 -36.334  1.00  0.50           C  
ATOM   3280  CD1 LEU A 423       1.289  20.794 -36.115  1.00  0.50           C  
ATOM   3281  CD2 LEU A 423      -1.080  20.517 -35.252  1.00  0.50           C  
ATOM   3282  N   ALA A 424      -1.384  25.575 -36.888  1.00  0.50           N  
ATOM   3283  CA  ALA A 424      -1.549  26.928 -36.403  1.00  0.50           C  
ATOM   3284  C   ALA A 424      -2.953  27.492 -36.555  1.00  0.50           C  
ATOM   3285  O   ALA A 424      -3.524  28.010 -35.595  1.00  0.50           O  
ATOM   3286  CB  ALA A 424      -0.541  27.815 -37.131  1.00  0.50           C  
ATOM   3287  N   ASP A 425      -3.570  27.298 -37.735  1.00  0.45           N  
ATOM   3288  CA  ASP A 425      -4.936  27.656 -38.073  1.00  0.45           C  
ATOM   3289  C   ASP A 425      -5.977  26.975 -37.187  1.00  0.45           C  
ATOM   3290  O   ASP A 425      -7.095  27.451 -36.999  1.00  0.45           O  
ATOM   3291  CB  ASP A 425      -5.189  27.244 -39.544  1.00  0.45           C  
ATOM   3292  CG  ASP A 425      -4.496  28.178 -40.528  1.00  0.45           C  
ATOM   3293  OD1 ASP A 425      -3.903  29.199 -40.095  1.00  0.45           O  
ATOM   3294  OD2 ASP A 425      -4.600  27.876 -41.744  1.00  0.45           O  
ATOM   3295  N   ARG A 426      -5.628  25.818 -36.606  1.00  0.31           N  
ATOM   3296  CA  ARG A 426      -6.510  25.015 -35.799  1.00  0.31           C  
ATOM   3297  C   ARG A 426      -6.072  25.037 -34.317  1.00  0.31           C  
ATOM   3298  O   ARG A 426      -6.731  24.447 -33.462  1.00  0.31           O  
ATOM   3299  CB  ARG A 426      -6.584  23.590 -36.408  1.00  0.31           C  
ATOM   3300  CG  ARG A 426      -7.094  23.540 -37.874  1.00  0.31           C  
ATOM   3301  CD  ARG A 426      -6.930  22.147 -38.423  1.00  0.31           C  
ATOM   3302  NE  ARG A 426      -7.497  21.985 -39.781  1.00  0.31           N  
ATOM   3303  CZ  ARG A 426      -7.594  20.746 -40.287  1.00  0.31           C  
ATOM   3304  NH1 ARG A 426      -7.096  19.736 -39.616  1.00  0.31           N  
ATOM   3305  NH2 ARG A 426      -8.304  20.478 -41.374  1.00  0.31           N  
ATOM   3306  N   LEU A 427      -5.004  25.805 -33.964  1.00  0.30           N  
ATOM   3307  CA  LEU A 427      -4.579  26.172 -32.610  1.00  0.30           C  
ATOM   3308  C   LEU A 427      -4.886  27.630 -32.150  1.00  0.30           C  
ATOM   3309  O   LEU A 427      -4.243  28.050 -31.178  1.00  0.30           O  
ATOM   3310  CB  LEU A 427      -3.037  25.962 -32.425  1.00  0.30           C  
ATOM   3311  CG  LEU A 427      -2.552  24.499 -32.359  1.00  0.30           C  
ATOM   3312  CD1 LEU A 427      -1.041  24.407 -32.641  1.00  0.30           C  
ATOM   3313  CD2 LEU A 427      -2.865  23.842 -31.003  1.00  0.30           C  
ATOM   3314  N   PRO A 428      -5.790  28.492 -32.667  1.00  0.27           N  
ATOM   3315  CA  PRO A 428      -5.890  29.880 -32.230  1.00  0.27           C  
ATOM   3316  C   PRO A 428      -6.257  30.066 -30.768  1.00  0.27           C  
ATOM   3317  O   PRO A 428      -6.071  31.165 -30.258  1.00  0.27           O  
ATOM   3318  CB  PRO A 428      -6.904  30.567 -33.177  1.00  0.27           C  
ATOM   3319  CG  PRO A 428      -7.424  29.499 -34.144  1.00  0.27           C  
ATOM   3320  CD  PRO A 428      -6.706  28.211 -33.765  1.00  0.27           C  
ATOM   3321  N   SER A 429      -6.790  29.057 -30.069  1.00  0.27           N  
ATOM   3322  CA  SER A 429      -7.261  29.172 -28.704  1.00  0.27           C  
ATOM   3323  C   SER A 429      -6.318  28.572 -27.677  1.00  0.27           C  
ATOM   3324  O   SER A 429      -6.671  28.435 -26.509  1.00  0.27           O  
ATOM   3325  CB  SER A 429      -8.611  28.435 -28.577  1.00  0.27           C  
ATOM   3326  OG  SER A 429      -8.515  27.070 -29.012  1.00  0.27           O  
ATOM   3327  N   TRP A 430      -5.071  28.198 -28.048  1.00  0.24           N  
ATOM   3328  CA  TRP A 430      -4.134  27.605 -27.097  1.00  0.24           C  
ATOM   3329  C   TRP A 430      -3.760  28.517 -25.929  1.00  0.24           C  
ATOM   3330  O   TRP A 430      -3.550  28.071 -24.807  1.00  0.24           O  
ATOM   3331  CB  TRP A 430      -2.855  27.013 -27.767  1.00  0.24           C  
ATOM   3332  CG  TRP A 430      -1.653  27.928 -27.929  1.00  0.24           C  
ATOM   3333  CD1 TRP A 430      -1.400  28.900 -28.846  1.00  0.24           C  
ATOM   3334  CD2 TRP A 430      -0.507  27.923 -27.052  1.00  0.24           C  
ATOM   3335  NE1 TRP A 430      -0.207  29.519 -28.609  1.00  0.24           N  
ATOM   3336  CE2 TRP A 430       0.364  28.924 -27.498  1.00  0.24           C  
ATOM   3337  CE3 TRP A 430      -0.193  27.137 -25.946  1.00  0.24           C  
ATOM   3338  CZ2 TRP A 430       1.600  29.109 -26.900  1.00  0.24           C  
ATOM   3339  CZ3 TRP A 430       1.057  27.327 -25.343  1.00  0.24           C  
ATOM   3340  CH2 TRP A 430       1.954  28.278 -25.828  1.00  0.24           C  
ATOM   3341  N   ARG A 431      -3.691  29.838 -26.182  1.00  0.25           N  
ATOM   3342  CA  ARG A 431      -3.414  30.843 -25.175  1.00  0.25           C  
ATOM   3343  C   ARG A 431      -4.574  31.067 -24.214  1.00  0.25           C  
ATOM   3344  O   ARG A 431      -4.367  31.524 -23.092  1.00  0.25           O  
ATOM   3345  CB  ARG A 431      -3.080  32.185 -25.864  1.00  0.25           C  
ATOM   3346  CG  ARG A 431      -1.727  32.146 -26.597  1.00  0.25           C  
ATOM   3347  CD  ARG A 431      -1.381  33.475 -27.265  1.00  0.25           C  
ATOM   3348  NE  ARG A 431       0.020  33.342 -27.782  1.00  0.25           N  
ATOM   3349  CZ  ARG A 431       0.683  34.299 -28.439  1.00  0.25           C  
ATOM   3350  NH1 ARG A 431       0.071  35.386 -28.888  1.00  0.25           N  
ATOM   3351  NH2 ARG A 431       1.989  34.177 -28.664  1.00  0.25           N  
ATOM   3352  N   ASP A 432      -5.794  30.685 -24.632  1.00  0.35           N  
ATOM   3353  CA  ASP A 432      -7.022  30.834 -23.886  1.00  0.35           C  
ATOM   3354  C   ASP A 432      -7.368  29.546 -23.143  1.00  0.35           C  
ATOM   3355  O   ASP A 432      -8.414  29.427 -22.504  1.00  0.35           O  
ATOM   3356  CB  ASP A 432      -8.187  31.183 -24.848  1.00  0.35           C  
ATOM   3357  CG  ASP A 432      -7.961  32.502 -25.574  1.00  0.35           C  
ATOM   3358  OD1 ASP A 432      -7.377  33.437 -24.972  1.00  0.35           O  
ATOM   3359  OD2 ASP A 432      -8.386  32.573 -26.758  1.00  0.35           O  
ATOM   3360  N   LEU A 433      -6.479  28.525 -23.168  1.00  0.34           N  
ATOM   3361  CA  LEU A 433      -6.564  27.381 -22.277  1.00  0.34           C  
ATOM   3362  C   LEU A 433      -6.408  27.841 -20.836  1.00  0.34           C  
ATOM   3363  O   LEU A 433      -5.562  28.702 -20.596  1.00  0.34           O  
ATOM   3364  CB  LEU A 433      -5.484  26.319 -22.620  1.00  0.34           C  
ATOM   3365  CG  LEU A 433      -5.802  25.506 -23.888  1.00  0.34           C  
ATOM   3366  CD1 LEU A 433      -4.586  24.680 -24.336  1.00  0.34           C  
ATOM   3367  CD2 LEU A 433      -7.014  24.595 -23.658  1.00  0.34           C  
ATOM   3368  N   PRO A 434      -7.183  27.383 -19.846  1.00  0.45           N  
ATOM   3369  CA  PRO A 434      -6.912  27.687 -18.449  1.00  0.45           C  
ATOM   3370  C   PRO A 434      -5.474  27.393 -18.074  1.00  0.45           C  
ATOM   3371  O   PRO A 434      -5.103  26.226 -17.993  1.00  0.45           O  
ATOM   3372  CB  PRO A 434      -7.966  26.892 -17.644  1.00  0.45           C  
ATOM   3373  CG  PRO A 434      -8.708  25.971 -18.632  1.00  0.45           C  
ATOM   3374  CD  PRO A 434      -8.181  26.333 -20.020  1.00  0.45           C  
ATOM   3375  N   GLN A 435      -4.655  28.423 -17.805  1.00  0.42           N  
ATOM   3376  CA  GLN A 435      -3.330  28.224 -17.267  1.00  0.42           C  
ATOM   3377  C   GLN A 435      -3.446  27.691 -15.858  1.00  0.42           C  
ATOM   3378  O   GLN A 435      -4.005  28.344 -14.983  1.00  0.42           O  
ATOM   3379  CB  GLN A 435      -2.479  29.517 -17.307  1.00  0.42           C  
ATOM   3380  CG  GLN A 435      -2.213  29.990 -18.756  1.00  0.42           C  
ATOM   3381  CD  GLN A 435      -0.803  30.551 -18.942  1.00  0.42           C  
ATOM   3382  OE1 GLN A 435      -0.015  30.729 -18.015  1.00  0.42           O  
ATOM   3383  NE2 GLN A 435      -0.448  30.826 -20.219  1.00  0.42           N  
ATOM   3384  N   THR A 436      -2.990  26.459 -15.618  1.00  0.47           N  
ATOM   3385  CA  THR A 436      -3.086  25.785 -14.342  1.00  0.47           C  
ATOM   3386  C   THR A 436      -2.295  26.493 -13.263  1.00  0.47           C  
ATOM   3387  O   THR A 436      -1.067  26.508 -13.286  1.00  0.47           O  
ATOM   3388  CB  THR A 436      -2.667  24.322 -14.453  1.00  0.47           C  
ATOM   3389  OG1 THR A 436      -1.624  24.161 -15.413  1.00  0.47           O  
ATOM   3390  CG2 THR A 436      -3.876  23.515 -14.959  1.00  0.47           C  
ATOM   3391  N   SER A 437      -2.990  27.112 -12.297  1.00  0.48           N  
ATOM   3392  CA  SER A 437      -2.426  27.591 -11.059  1.00  0.48           C  
ATOM   3393  C   SER A 437      -2.355  26.483  -9.985  1.00  0.48           C  
ATOM   3394  O   SER A 437      -2.812  25.335 -10.243  1.00  0.48           O  
ATOM   3395  CB  SER A 437      -3.274  28.774 -10.508  1.00  0.48           C  
ATOM   3396  OG  SER A 437      -4.686  28.602 -10.686  1.00  0.48           O  
ATOM   3397  OXT SER A 437      -1.824  26.790  -8.882  1.00  0.48           O  
TER    3398      SER A 437                                                      
ATOM   3399  N   MET B   1      56.105   4.354 -61.069  1.00  0.69           N  
ATOM   3400  CA  MET B   1      55.172   4.997 -60.074  1.00  0.69           C  
ATOM   3401  C   MET B   1      53.722   4.917 -60.539  1.00  0.69           C  
ATOM   3402  O   MET B   1      53.487   4.841 -61.741  1.00  0.69           O  
ATOM   3403  CB  MET B   1      55.630   6.475 -59.918  1.00  0.69           C  
ATOM   3404  CG  MET B   1      54.836   7.294 -58.884  1.00  0.69           C  
ATOM   3405  SD  MET B   1      55.273   9.052 -58.732  1.00  0.69           S  
ATOM   3406  CE  MET B   1      57.018   8.790 -58.381  1.00  0.69           C  
ATOM   3407  N   LYS B   2      52.721   4.914 -59.635  1.00  0.69           N  
ATOM   3408  CA  LYS B   2      51.313   4.916 -59.965  1.00  0.69           C  
ATOM   3409  C   LYS B   2      50.767   6.329 -60.108  1.00  0.69           C  
ATOM   3410  O   LYS B   2      51.316   7.303 -59.594  1.00  0.69           O  
ATOM   3411  CB  LYS B   2      50.472   4.140 -58.909  1.00  0.69           C  
ATOM   3412  CG  LYS B   2      50.885   2.666 -58.714  1.00  0.69           C  
ATOM   3413  CD  LYS B   2      50.697   1.883 -60.018  1.00  0.69           C  
ATOM   3414  CE  LYS B   2      51.052   0.397 -60.006  1.00  0.69           C  
ATOM   3415  NZ  LYS B   2      50.922  -0.093 -61.380  1.00  0.69           N  
ATOM   3416  N   PHE B   3      49.648   6.491 -60.843  1.00  0.71           N  
ATOM   3417  CA  PHE B   3      48.983   7.775 -61.015  1.00  0.71           C  
ATOM   3418  C   PHE B   3      48.481   8.361 -59.698  1.00  0.71           C  
ATOM   3419  O   PHE B   3      48.579   9.566 -59.467  1.00  0.71           O  
ATOM   3420  CB  PHE B   3      47.858   7.683 -62.085  1.00  0.71           C  
ATOM   3421  CG  PHE B   3      47.146   8.994 -62.356  1.00  0.71           C  
ATOM   3422  CD1 PHE B   3      45.741   9.038 -62.383  1.00  0.71           C  
ATOM   3423  CD2 PHE B   3      47.856  10.189 -62.562  1.00  0.71           C  
ATOM   3424  CE1 PHE B   3      45.061  10.246 -62.585  1.00  0.71           C  
ATOM   3425  CE2 PHE B   3      47.178  11.402 -62.739  1.00  0.71           C  
ATOM   3426  CZ  PHE B   3      45.781  11.433 -62.754  1.00  0.71           C  
ATOM   3427  N   SER B   4      47.983   7.517 -58.773  1.00  0.77           N  
ATOM   3428  CA  SER B   4      47.636   7.935 -57.421  1.00  0.77           C  
ATOM   3429  C   SER B   4      48.795   8.552 -56.656  1.00  0.77           C  
ATOM   3430  O   SER B   4      48.660   9.649 -56.122  1.00  0.77           O  
ATOM   3431  CB  SER B   4      47.099   6.748 -56.583  1.00  0.77           C  
ATOM   3432  OG  SER B   4      47.910   5.583 -56.752  1.00  0.77           O  
ATOM   3433  N   ASP B   5      49.990   7.923 -56.682  1.00  0.78           N  
ATOM   3434  CA  ASP B   5      51.197   8.460 -56.083  1.00  0.78           C  
ATOM   3435  C   ASP B   5      51.566   9.851 -56.622  1.00  0.78           C  
ATOM   3436  O   ASP B   5      51.972  10.749 -55.883  1.00  0.78           O  
ATOM   3437  CB  ASP B   5      52.440   7.582 -56.381  1.00  0.78           C  
ATOM   3438  CG  ASP B   5      52.317   6.082 -56.156  1.00  0.78           C  
ATOM   3439  OD1 ASP B   5      51.733   5.644 -55.141  1.00  0.78           O  
ATOM   3440  OD2 ASP B   5      52.877   5.348 -57.020  1.00  0.78           O  
ATOM   3441  N   VAL B   6      51.431  10.058 -57.955  1.00  0.81           N  
ATOM   3442  CA  VAL B   6      51.666  11.339 -58.613  1.00  0.81           C  
ATOM   3443  C   VAL B   6      50.721  12.423 -58.114  1.00  0.81           C  
ATOM   3444  O   VAL B   6      51.142  13.545 -57.826  1.00  0.81           O  
ATOM   3445  CB  VAL B   6      51.551  11.234 -60.137  1.00  0.81           C  
ATOM   3446  CG1 VAL B   6      51.717  12.601 -60.830  1.00  0.81           C  
ATOM   3447  CG2 VAL B   6      52.636  10.302 -60.690  1.00  0.81           C  
ATOM   3448  N   LEU B   7      49.416  12.112 -57.973  1.00  0.76           N  
ATOM   3449  CA  LEU B   7      48.438  13.040 -57.434  1.00  0.76           C  
ATOM   3450  C   LEU B   7      48.709  13.398 -55.981  1.00  0.76           C  
ATOM   3451  O   LEU B   7      48.721  14.576 -55.626  1.00  0.76           O  
ATOM   3452  CB  LEU B   7      46.998  12.497 -57.588  1.00  0.76           C  
ATOM   3453  CG  LEU B   7      46.497  12.373 -59.044  1.00  0.76           C  
ATOM   3454  CD1 LEU B   7      45.102  11.730 -59.053  1.00  0.76           C  
ATOM   3455  CD2 LEU B   7      46.453  13.727 -59.773  1.00  0.76           C  
ATOM   3456  N   ASP B   8      49.022  12.405 -55.126  1.00  0.74           N  
ATOM   3457  CA  ASP B   8      49.361  12.611 -53.732  1.00  0.74           C  
ATOM   3458  C   ASP B   8      50.578  13.512 -53.562  1.00  0.74           C  
ATOM   3459  O   ASP B   8      50.573  14.446 -52.764  1.00  0.74           O  
ATOM   3460  CB  ASP B   8      49.596  11.248 -53.036  1.00  0.74           C  
ATOM   3461  CG  ASP B   8      48.297  10.474 -52.825  1.00  0.74           C  
ATOM   3462  OD1 ASP B   8      47.200  11.025 -53.096  1.00  0.74           O  
ATOM   3463  OD2 ASP B   8      48.403   9.315 -52.349  1.00  0.74           O  
ATOM   3464  N   GLN B   9      51.641  13.312 -54.366  1.00  0.71           N  
ATOM   3465  CA  GLN B   9      52.778  14.217 -54.392  1.00  0.71           C  
ATOM   3466  C   GLN B   9      52.465  15.629 -54.888  1.00  0.71           C  
ATOM   3467  O   GLN B   9      52.928  16.606 -54.304  1.00  0.71           O  
ATOM   3468  CB  GLN B   9      53.975  13.594 -55.145  1.00  0.71           C  
ATOM   3469  CG  GLN B   9      54.537  12.362 -54.397  1.00  0.71           C  
ATOM   3470  CD  GLN B   9      55.832  11.832 -55.014  1.00  0.71           C  
ATOM   3471  OE1 GLN B   9      56.862  12.498 -55.097  1.00  0.71           O  
ATOM   3472  NE2 GLN B   9      55.810  10.552 -55.446  1.00  0.71           N  
ATOM   3473  N   ALA B  10      51.626  15.791 -55.934  1.00  0.81           N  
ATOM   3474  CA  ALA B  10      51.165  17.091 -56.392  1.00  0.81           C  
ATOM   3475  C   ALA B  10      50.372  17.859 -55.336  1.00  0.81           C  
ATOM   3476  O   ALA B  10      50.547  19.061 -55.129  1.00  0.81           O  
ATOM   3477  CB  ALA B  10      50.318  16.912 -57.668  1.00  0.81           C  
ATOM   3478  N   TRP B  11      49.494  17.173 -54.584  1.00  0.60           N  
ATOM   3479  CA  TRP B  11      48.764  17.769 -53.483  1.00  0.60           C  
ATOM   3480  C   TRP B  11      49.630  18.021 -52.252  1.00  0.60           C  
ATOM   3481  O   TRP B  11      49.290  18.877 -51.447  1.00  0.60           O  
ATOM   3482  CB  TRP B  11      47.512  16.922 -53.143  1.00  0.60           C  
ATOM   3483  CG  TRP B  11      46.361  17.099 -54.135  1.00  0.60           C  
ATOM   3484  CD1 TRP B  11      46.070  16.427 -55.293  1.00  0.60           C  
ATOM   3485  CD2 TRP B  11      45.314  18.072 -53.971  1.00  0.60           C  
ATOM   3486  NE1 TRP B  11      44.931  16.940 -55.878  1.00  0.60           N  
ATOM   3487  CE2 TRP B  11      44.446  17.938 -55.075  1.00  0.60           C  
ATOM   3488  CE3 TRP B  11      45.069  19.013 -52.976  1.00  0.60           C  
ATOM   3489  CZ2 TRP B  11      43.322  18.738 -55.201  1.00  0.60           C  
ATOM   3490  CZ3 TRP B  11      43.925  19.814 -53.097  1.00  0.60           C  
ATOM   3491  CH2 TRP B  11      43.064  19.680 -54.195  1.00  0.60           C  
ATOM   3492  N   ALA B  12      50.796  17.356 -52.119  1.00  0.67           N  
ATOM   3493  CA  ALA B  12      51.689  17.516 -50.989  1.00  0.67           C  
ATOM   3494  C   ALA B  12      52.833  18.516 -51.205  1.00  0.67           C  
ATOM   3495  O   ALA B  12      53.704  18.671 -50.349  1.00  0.67           O  
ATOM   3496  CB  ALA B  12      52.265  16.129 -50.631  1.00  0.67           C  
ATOM   3497  N   GLU B  13      52.876  19.259 -52.336  1.00  0.57           N  
ATOM   3498  CA  GLU B  13      53.786  20.386 -52.523  1.00  0.57           C  
ATOM   3499  C   GLU B  13      53.366  21.568 -51.634  1.00  0.57           C  
ATOM   3500  O   GLU B  13      52.730  22.516 -52.100  1.00  0.57           O  
ATOM   3501  CB  GLU B  13      53.894  20.882 -54.003  1.00  0.57           C  
ATOM   3502  CG  GLU B  13      54.403  19.870 -55.067  1.00  0.57           C  
ATOM   3503  CD  GLU B  13      54.445  20.476 -56.466  1.00  0.57           C  
ATOM   3504  OE1 GLU B  13      55.337  20.086 -57.250  1.00  0.57           O  
ATOM   3505  OE2 GLU B  13      53.602  21.349 -56.796  1.00  0.57           O  
ATOM   3506  N   ASP B  14      53.675  21.511 -50.324  1.00  0.50           N  
ATOM   3507  CA  ASP B  14      53.319  22.526 -49.354  1.00  0.50           C  
ATOM   3508  C   ASP B  14      54.466  23.500 -49.082  1.00  0.50           C  
ATOM   3509  O   ASP B  14      54.287  24.562 -48.487  1.00  0.50           O  
ATOM   3510  CB  ASP B  14      52.921  21.810 -48.033  1.00  0.50           C  
ATOM   3511  CG  ASP B  14      51.563  21.129 -48.156  1.00  0.50           C  
ATOM   3512  OD1 ASP B  14      50.772  21.522 -49.051  1.00  0.50           O  
ATOM   3513  OD2 ASP B  14      51.307  20.216 -47.331  1.00  0.50           O  
ATOM   3514  N   SER B  15      55.693  23.210 -49.552  1.00  0.53           N  
ATOM   3515  CA  SER B  15      56.865  24.042 -49.321  1.00  0.53           C  
ATOM   3516  C   SER B  15      57.094  25.014 -50.467  1.00  0.53           C  
ATOM   3517  O   SER B  15      57.967  24.831 -51.310  1.00  0.53           O  
ATOM   3518  CB  SER B  15      58.152  23.200 -49.039  1.00  0.53           C  
ATOM   3519  OG  SER B  15      58.015  21.850 -49.494  1.00  0.53           O  
ATOM   3520  N   GLY B  16      56.318  26.120 -50.502  1.00  0.58           N  
ATOM   3521  CA  GLY B  16      56.478  27.186 -51.484  1.00  0.58           C  
ATOM   3522  C   GLY B  16      55.356  27.222 -52.501  1.00  0.58           C  
ATOM   3523  O   GLY B  16      54.335  26.556 -52.327  1.00  0.58           O  
ATOM   3524  N   PRO B  17      55.455  28.027 -53.556  1.00  0.55           N  
ATOM   3525  CA  PRO B  17      54.566  27.929 -54.707  1.00  0.55           C  
ATOM   3526  C   PRO B  17      54.644  26.557 -55.379  1.00  0.55           C  
ATOM   3527  O   PRO B  17      55.768  26.082 -55.552  1.00  0.55           O  
ATOM   3528  CB  PRO B  17      54.996  29.087 -55.622  1.00  0.55           C  
ATOM   3529  CG  PRO B  17      56.464  29.363 -55.269  1.00  0.55           C  
ATOM   3530  CD  PRO B  17      56.605  28.898 -53.816  1.00  0.55           C  
ATOM   3531  N   PRO B  18      53.542  25.880 -55.720  1.00  0.65           N  
ATOM   3532  CA  PRO B  18      53.591  24.575 -56.362  1.00  0.65           C  
ATOM   3533  C   PRO B  18      54.300  24.618 -57.695  1.00  0.65           C  
ATOM   3534  O   PRO B  18      54.411  25.676 -58.318  1.00  0.65           O  
ATOM   3535  CB  PRO B  18      52.114  24.178 -56.521  1.00  0.65           C  
ATOM   3536  CG  PRO B  18      51.371  25.509 -56.627  1.00  0.65           C  
ATOM   3537  CD  PRO B  18      52.186  26.430 -55.716  1.00  0.65           C  
ATOM   3538  N   THR B  19      54.783  23.466 -58.169  1.00  0.71           N  
ATOM   3539  CA  THR B  19      55.368  23.350 -59.486  1.00  0.71           C  
ATOM   3540  C   THR B  19      54.287  23.504 -60.530  1.00  0.71           C  
ATOM   3541  O   THR B  19      53.110  23.304 -60.239  1.00  0.71           O  
ATOM   3542  CB  THR B  19      56.128  22.053 -59.716  1.00  0.71           C  
ATOM   3543  OG1 THR B  19      55.295  20.913 -59.661  1.00  0.71           O  
ATOM   3544  CG2 THR B  19      57.262  21.878 -58.693  1.00  0.71           C  
ATOM   3545  N   THR B  20      54.614  23.884 -61.787  1.00  0.74           N  
ATOM   3546  CA  THR B  20      53.606  24.047 -62.845  1.00  0.74           C  
ATOM   3547  C   THR B  20      52.795  22.784 -63.050  1.00  0.74           C  
ATOM   3548  O   THR B  20      51.575  22.811 -63.108  1.00  0.74           O  
ATOM   3549  CB  THR B  20      54.205  24.452 -64.192  1.00  0.74           C  
ATOM   3550  OG1 THR B  20      55.085  25.552 -64.018  1.00  0.74           O  
ATOM   3551  CG2 THR B  20      53.117  24.906 -65.173  1.00  0.74           C  
ATOM   3552  N   LEU B  21      53.456  21.612 -63.061  1.00  0.77           N  
ATOM   3553  CA  LEU B  21      52.770  20.335 -63.090  1.00  0.77           C  
ATOM   3554  C   LEU B  21      51.918  20.072 -61.855  1.00  0.77           C  
ATOM   3555  O   LEU B  21      50.771  19.643 -61.961  1.00  0.77           O  
ATOM   3556  CB  LEU B  21      53.806  19.202 -63.240  1.00  0.77           C  
ATOM   3557  CG  LEU B  21      53.210  17.784 -63.335  1.00  0.77           C  
ATOM   3558  CD1 LEU B  21      52.259  17.626 -64.531  1.00  0.77           C  
ATOM   3559  CD2 LEU B  21      54.333  16.748 -63.413  1.00  0.77           C  
ATOM   3560  N   GLY B  22      52.453  20.342 -60.646  1.00  0.82           N  
ATOM   3561  CA  GLY B  22      51.725  20.293 -59.382  1.00  0.82           C  
ATOM   3562  C   GLY B  22      50.446  21.067 -59.343  1.00  0.82           C  
ATOM   3563  O   GLY B  22      49.399  20.550 -58.966  1.00  0.82           O  
ATOM   3564  N   ARG B  23      50.491  22.337 -59.774  1.00  0.64           N  
ATOM   3565  CA  ARG B  23      49.338  23.204 -59.866  1.00  0.64           C  
ATOM   3566  C   ARG B  23      48.268  22.666 -60.796  1.00  0.64           C  
ATOM   3567  O   ARG B  23      47.092  22.583 -60.444  1.00  0.64           O  
ATOM   3568  CB  ARG B  23      49.802  24.571 -60.418  1.00  0.64           C  
ATOM   3569  CG  ARG B  23      48.673  25.608 -60.578  1.00  0.64           C  
ATOM   3570  CD  ARG B  23      49.128  26.903 -61.246  1.00  0.64           C  
ATOM   3571  NE  ARG B  23      49.404  26.587 -62.675  1.00  0.64           N  
ATOM   3572  CZ  ARG B  23      49.924  27.441 -63.558  1.00  0.64           C  
ATOM   3573  NH1 ARG B  23      50.132  28.721 -63.251  1.00  0.64           N  
ATOM   3574  NH2 ARG B  23      50.212  26.983 -64.771  1.00  0.64           N  
ATOM   3575  N   ASP B  24      48.685  22.262 -62.002  1.00  0.80           N  
ATOM   3576  CA  ASP B  24      47.830  21.834 -63.073  1.00  0.80           C  
ATOM   3577  C   ASP B  24      47.199  20.447 -62.767  1.00  0.80           C  
ATOM   3578  O   ASP B  24      46.037  20.189 -63.080  1.00  0.80           O  
ATOM   3579  CB  ASP B  24      48.640  21.978 -64.405  1.00  0.80           C  
ATOM   3580  CG  ASP B  24      49.217  23.382 -64.707  1.00  0.80           C  
ATOM   3581  OD1 ASP B  24      49.006  24.369 -63.948  1.00  0.80           O  
ATOM   3582  OD2 ASP B  24      49.901  23.505 -65.755  1.00  0.80           O  
ATOM   3583  N   LEU B  25      47.917  19.533 -62.063  1.00  0.80           N  
ATOM   3584  CA  LEU B  25      47.369  18.278 -61.540  1.00  0.80           C  
ATOM   3585  C   LEU B  25      46.432  18.424 -60.344  1.00  0.80           C  
ATOM   3586  O   LEU B  25      45.579  17.569 -60.123  1.00  0.80           O  
ATOM   3587  CB  LEU B  25      48.484  17.287 -61.122  1.00  0.80           C  
ATOM   3588  CG  LEU B  25      49.254  16.638 -62.287  1.00  0.80           C  
ATOM   3589  CD1 LEU B  25      50.456  15.872 -61.722  1.00  0.80           C  
ATOM   3590  CD2 LEU B  25      48.370  15.698 -63.127  1.00  0.80           C  
ATOM   3591  N   ARG B  26      46.500  19.525 -59.565  1.00  0.64           N  
ATOM   3592  CA  ARG B  26      45.570  19.787 -58.467  1.00  0.64           C  
ATOM   3593  C   ARG B  26      44.178  20.137 -58.964  1.00  0.64           C  
ATOM   3594  O   ARG B  26      43.209  20.151 -58.207  1.00  0.64           O  
ATOM   3595  CB  ARG B  26      46.051  20.945 -57.560  1.00  0.64           C  
ATOM   3596  CG  ARG B  26      47.195  20.564 -56.601  1.00  0.64           C  
ATOM   3597  CD  ARG B  26      47.793  21.793 -55.909  1.00  0.64           C  
ATOM   3598  NE  ARG B  26      48.969  21.350 -55.105  1.00  0.64           N  
ATOM   3599  CZ  ARG B  26      49.628  22.106 -54.216  1.00  0.64           C  
ATOM   3600  NH1 ARG B  26      49.414  23.410 -54.087  1.00  0.64           N  
ATOM   3601  NH2 ARG B  26      50.540  21.528 -53.450  1.00  0.64           N  
ATOM   3602  N   LEU B  27      44.033  20.398 -60.276  1.00  0.78           N  
ATOM   3603  CA  LEU B  27      42.741  20.526 -60.905  1.00  0.78           C  
ATOM   3604  C   LEU B  27      42.014  19.197 -61.005  1.00  0.78           C  
ATOM   3605  O   LEU B  27      40.797  19.171 -61.157  1.00  0.78           O  
ATOM   3606  CB  LEU B  27      42.881  21.122 -62.320  1.00  0.78           C  
ATOM   3607  CG  LEU B  27      43.474  22.541 -62.332  1.00  0.78           C  
ATOM   3608  CD1 LEU B  27      43.806  22.971 -63.767  1.00  0.78           C  
ATOM   3609  CD2 LEU B  27      42.502  23.531 -61.681  1.00  0.78           C  
ATOM   3610  N   VAL B  28      42.722  18.055 -60.890  1.00  0.76           N  
ATOM   3611  CA  VAL B  28      42.100  16.749 -60.778  1.00  0.76           C  
ATOM   3612  C   VAL B  28      41.455  16.567 -59.407  1.00  0.76           C  
ATOM   3613  O   VAL B  28      42.113  16.594 -58.367  1.00  0.76           O  
ATOM   3614  CB  VAL B  28      43.084  15.620 -61.054  1.00  0.76           C  
ATOM   3615  CG1 VAL B  28      42.393  14.250 -60.902  1.00  0.76           C  
ATOM   3616  CG2 VAL B  28      43.656  15.785 -62.478  1.00  0.76           C  
ATOM   3617  N   ARG B  29      40.120  16.386 -59.380  1.00  0.51           N  
ATOM   3618  CA  ARG B  29      39.350  16.297 -58.154  1.00  0.51           C  
ATOM   3619  C   ARG B  29      39.066  14.860 -57.783  1.00  0.51           C  
ATOM   3620  O   ARG B  29      39.005  14.508 -56.607  1.00  0.51           O  
ATOM   3621  CB  ARG B  29      37.981  16.999 -58.349  1.00  0.51           C  
ATOM   3622  CG  ARG B  29      38.077  18.533 -58.481  1.00  0.51           C  
ATOM   3623  CD  ARG B  29      38.437  19.275 -57.188  1.00  0.51           C  
ATOM   3624  NE  ARG B  29      37.296  19.040 -56.247  1.00  0.51           N  
ATOM   3625  CZ  ARG B  29      37.219  19.520 -55.000  1.00  0.51           C  
ATOM   3626  NH1 ARG B  29      38.174  20.287 -54.485  1.00  0.51           N  
ATOM   3627  NH2 ARG B  29      36.155  19.220 -54.257  1.00  0.51           N  
ATOM   3628  N   ALA B  30      38.906  14.005 -58.801  1.00  0.64           N  
ATOM   3629  CA  ALA B  30      38.657  12.602 -58.634  1.00  0.64           C  
ATOM   3630  C   ALA B  30      39.082  11.918 -59.913  1.00  0.64           C  
ATOM   3631  O   ALA B  30      39.159  12.532 -60.977  1.00  0.64           O  
ATOM   3632  CB  ALA B  30      37.170  12.316 -58.335  1.00  0.64           C  
ATOM   3633  N   ALA B  31      39.389  10.618 -59.838  1.00  0.74           N  
ATOM   3634  CA  ALA B  31      39.740   9.834 -60.989  1.00  0.74           C  
ATOM   3635  C   ALA B  31      39.300   8.426 -60.698  1.00  0.74           C  
ATOM   3636  O   ALA B  31      39.298   7.994 -59.546  1.00  0.74           O  
ATOM   3637  CB  ALA B  31      41.256   9.869 -61.274  1.00  0.74           C  
ATOM   3638  N   ALA B  32      38.878   7.688 -61.736  1.00  0.80           N  
ATOM   3639  CA  ALA B  32      38.459   6.313 -61.610  1.00  0.80           C  
ATOM   3640  C   ALA B  32      39.553   5.373 -61.066  1.00  0.80           C  
ATOM   3641  O   ALA B  32      40.729   5.592 -61.385  1.00  0.80           O  
ATOM   3642  CB  ALA B  32      37.944   5.854 -62.981  1.00  0.80           C  
ATOM   3643  N   PRO B  33      39.262   4.348 -60.247  1.00  0.74           N  
ATOM   3644  CA  PRO B  33      40.263   3.466 -59.643  1.00  0.74           C  
ATOM   3645  C   PRO B  33      41.231   2.837 -60.622  1.00  0.74           C  
ATOM   3646  O   PRO B  33      42.405   2.670 -60.296  1.00  0.74           O  
ATOM   3647  CB  PRO B  33      39.439   2.408 -58.891  1.00  0.74           C  
ATOM   3648  CG  PRO B  33      38.145   3.141 -58.534  1.00  0.74           C  
ATOM   3649  CD  PRO B  33      37.917   4.041 -59.750  1.00  0.74           C  
ATOM   3650  N   GLU B  34      40.761   2.492 -61.830  1.00  0.68           N  
ATOM   3651  CA  GLU B  34      41.529   1.916 -62.904  1.00  0.68           C  
ATOM   3652  C   GLU B  34      42.636   2.846 -63.375  1.00  0.68           C  
ATOM   3653  O   GLU B  34      43.775   2.432 -63.569  1.00  0.68           O  
ATOM   3654  CB  GLU B  34      40.590   1.562 -64.092  1.00  0.68           C  
ATOM   3655  CG  GLU B  34      39.370   0.662 -63.731  1.00  0.68           C  
ATOM   3656  CD  GLU B  34      38.198   1.373 -63.041  1.00  0.68           C  
ATOM   3657  OE1 GLU B  34      37.226   0.669 -62.677  1.00  0.68           O  
ATOM   3658  OE2 GLU B  34      38.278   2.614 -62.846  1.00  0.68           O  
ATOM   3659  N   LEU B  35      42.333   4.156 -63.521  1.00  0.73           N  
ATOM   3660  CA  LEU B  35      43.308   5.180 -63.860  1.00  0.73           C  
ATOM   3661  C   LEU B  35      44.327   5.405 -62.770  1.00  0.73           C  
ATOM   3662  O   LEU B  35      45.516   5.539 -63.043  1.00  0.73           O  
ATOM   3663  CB  LEU B  35      42.653   6.538 -64.196  1.00  0.73           C  
ATOM   3664  CG  LEU B  35      41.749   6.501 -65.438  1.00  0.73           C  
ATOM   3665  CD1 LEU B  35      40.997   7.825 -65.606  1.00  0.73           C  
ATOM   3666  CD2 LEU B  35      42.523   6.171 -66.722  1.00  0.73           C  
ATOM   3667  N   LEU B  36      43.887   5.417 -61.495  1.00  0.68           N  
ATOM   3668  CA  LEU B  36      44.744   5.578 -60.332  1.00  0.68           C  
ATOM   3669  C   LEU B  36      45.814   4.497 -60.250  1.00  0.68           C  
ATOM   3670  O   LEU B  36      46.951   4.758 -59.866  1.00  0.68           O  
ATOM   3671  CB  LEU B  36      43.892   5.627 -59.039  1.00  0.68           C  
ATOM   3672  CG  LEU B  36      43.002   6.885 -58.901  1.00  0.68           C  
ATOM   3673  CD1 LEU B  36      42.107   6.787 -57.656  1.00  0.68           C  
ATOM   3674  CD2 LEU B  36      43.821   8.184 -58.839  1.00  0.68           C  
ATOM   3675  N   ALA B  37      45.482   3.267 -60.683  1.00  0.73           N  
ATOM   3676  CA  ALA B  37      46.372   2.133 -60.651  1.00  0.73           C  
ATOM   3677  C   ALA B  37      47.293   2.009 -61.868  1.00  0.73           C  
ATOM   3678  O   ALA B  37      48.165   1.134 -61.909  1.00  0.73           O  
ATOM   3679  CB  ALA B  37      45.493   0.875 -60.535  1.00  0.73           C  
ATOM   3680  N   LEU B  38      47.151   2.882 -62.887  1.00  0.67           N  
ATOM   3681  CA  LEU B  38      48.062   2.942 -64.018  1.00  0.67           C  
ATOM   3682  C   LEU B  38      49.454   3.430 -63.659  1.00  0.67           C  
ATOM   3683  O   LEU B  38      49.640   4.333 -62.842  1.00  0.67           O  
ATOM   3684  CB  LEU B  38      47.531   3.825 -65.176  1.00  0.67           C  
ATOM   3685  CG  LEU B  38      46.253   3.296 -65.856  1.00  0.67           C  
ATOM   3686  CD1 LEU B  38      45.741   4.288 -66.911  1.00  0.67           C  
ATOM   3687  CD2 LEU B  38      46.464   1.916 -66.496  1.00  0.67           C  
ATOM   3688  N   ASP B  39      50.477   2.833 -64.293  1.00  0.69           N  
ATOM   3689  CA  ASP B  39      51.847   3.278 -64.200  1.00  0.69           C  
ATOM   3690  C   ASP B  39      52.098   4.508 -65.056  1.00  0.69           C  
ATOM   3691  O   ASP B  39      51.693   4.585 -66.215  1.00  0.69           O  
ATOM   3692  CB  ASP B  39      52.804   2.127 -64.575  1.00  0.69           C  
ATOM   3693  CG  ASP B  39      52.588   1.058 -63.539  1.00  0.69           C  
ATOM   3694  OD1 ASP B  39      53.103   1.194 -62.394  1.00  0.69           O  
ATOM   3695  OD2 ASP B  39      51.784   0.099 -63.778  1.00  0.69           O  
ATOM   3696  N   VAL B  40      52.764   5.528 -64.487  1.00  0.79           N  
ATOM   3697  CA  VAL B  40      53.110   6.749 -65.199  1.00  0.79           C  
ATOM   3698  C   VAL B  40      54.503   6.615 -65.801  1.00  0.79           C  
ATOM   3699  O   VAL B  40      55.270   5.778 -65.316  1.00  0.79           O  
ATOM   3700  CB  VAL B  40      53.041   7.988 -64.308  1.00  0.79           C  
ATOM   3701  CG1 VAL B  40      51.607   8.121 -63.763  1.00  0.79           C  
ATOM   3702  CG2 VAL B  40      54.070   7.916 -63.163  1.00  0.79           C  
ATOM   3703  N   PRO B  41      54.940   7.372 -66.813  1.00  0.79           N  
ATOM   3704  CA  PRO B  41      56.189   7.054 -67.507  1.00  0.79           C  
ATOM   3705  C   PRO B  41      57.366   7.745 -66.829  1.00  0.79           C  
ATOM   3706  O   PRO B  41      58.136   8.445 -67.483  1.00  0.79           O  
ATOM   3707  CB  PRO B  41      55.944   7.618 -68.921  1.00  0.79           C  
ATOM   3708  CG  PRO B  41      55.036   8.823 -68.682  1.00  0.79           C  
ATOM   3709  CD  PRO B  41      54.106   8.301 -67.590  1.00  0.79           C  
ATOM   3710  N   ALA B  42      57.521   7.536 -65.514  1.00  0.78           N  
ATOM   3711  CA  ALA B  42      58.632   8.034 -64.744  1.00  0.78           C  
ATOM   3712  C   ALA B  42      58.717   7.279 -63.434  1.00  0.78           C  
ATOM   3713  O   ALA B  42      57.706   6.786 -62.911  1.00  0.78           O  
ATOM   3714  CB  ALA B  42      58.458   9.528 -64.422  1.00  0.78           C  
ATOM   3715  N   ASP B  43      59.928   7.212 -62.851  1.00  0.63           N  
ATOM   3716  CA  ASP B  43      60.139   6.529 -61.598  1.00  0.63           C  
ATOM   3717  C   ASP B  43      60.059   7.505 -60.445  1.00  0.63           C  
ATOM   3718  O   ASP B  43      59.749   7.126 -59.313  1.00  0.63           O  
ATOM   3719  CB  ASP B  43      61.488   5.781 -61.626  1.00  0.63           C  
ATOM   3720  CG  ASP B  43      61.345   4.552 -62.514  1.00  0.63           C  
ATOM   3721  OD1 ASP B  43      60.272   3.886 -62.412  1.00  0.63           O  
ATOM   3722  OD2 ASP B  43      62.297   4.245 -63.273  1.00  0.63           O  
ATOM   3723  N   ALA B  44      60.219   8.812 -60.719  1.00  0.75           N  
ATOM   3724  CA  ALA B  44      60.109   9.817 -59.696  1.00  0.75           C  
ATOM   3725  C   ALA B  44      59.281  11.014 -60.131  1.00  0.75           C  
ATOM   3726  O   ALA B  44      59.227  11.414 -61.290  1.00  0.75           O  
ATOM   3727  CB  ALA B  44      61.513  10.247 -59.256  1.00  0.75           C  
ATOM   3728  N   TYR B  45      58.584  11.654 -59.167  1.00  0.70           N  
ATOM   3729  CA  TYR B  45      57.752  12.818 -59.421  1.00  0.70           C  
ATOM   3730  C   TYR B  45      58.556  14.010 -59.949  1.00  0.70           C  
ATOM   3731  O   TYR B  45      58.133  14.703 -60.870  1.00  0.70           O  
ATOM   3732  CB  TYR B  45      56.943  13.164 -58.144  1.00  0.70           C  
ATOM   3733  CG  TYR B  45      56.024  14.342 -58.327  1.00  0.70           C  
ATOM   3734  CD1 TYR B  45      56.286  15.556 -57.672  1.00  0.70           C  
ATOM   3735  CD2 TYR B  45      54.911  14.253 -59.176  1.00  0.70           C  
ATOM   3736  CE1 TYR B  45      55.452  16.665 -57.862  1.00  0.70           C  
ATOM   3737  CE2 TYR B  45      54.081  15.364 -59.378  1.00  0.70           C  
ATOM   3738  CZ  TYR B  45      54.352  16.565 -58.714  1.00  0.70           C  
ATOM   3739  OH  TYR B  45      53.524  17.680 -58.873  1.00  0.70           O  
ATOM   3740  N   GLY B  46      59.777  14.243 -59.418  1.00  0.76           N  
ATOM   3741  CA  GLY B  46      60.673  15.299 -59.893  1.00  0.76           C  
ATOM   3742  C   GLY B  46      61.097  15.182 -61.338  1.00  0.76           C  
ATOM   3743  O   GLY B  46      61.334  16.185 -62.004  1.00  0.76           O  
ATOM   3744  N   GLU B  47      61.170  13.950 -61.880  1.00  0.68           N  
ATOM   3745  CA  GLU B  47      61.384  13.711 -63.294  1.00  0.68           C  
ATOM   3746  C   GLU B  47      60.209  14.178 -64.131  1.00  0.68           C  
ATOM   3747  O   GLU B  47      60.390  14.865 -65.133  1.00  0.68           O  
ATOM   3748  CB  GLU B  47      61.612  12.212 -63.569  1.00  0.68           C  
ATOM   3749  CG  GLU B  47      62.851  11.618 -62.862  1.00  0.68           C  
ATOM   3750  CD  GLU B  47      62.883  10.085 -62.876  1.00  0.68           C  
ATOM   3751  OE1 GLU B  47      63.960   9.552 -62.516  1.00  0.68           O  
ATOM   3752  OE2 GLU B  47      61.824   9.445 -63.172  1.00  0.68           O  
ATOM   3753  N   LEU B  48      58.961  13.874 -63.700  1.00  0.75           N  
ATOM   3754  CA  LEU B  48      57.753  14.363 -64.346  1.00  0.75           C  
ATOM   3755  C   LEU B  48      57.666  15.875 -64.323  1.00  0.75           C  
ATOM   3756  O   LEU B  48      57.348  16.496 -65.332  1.00  0.75           O  
ATOM   3757  CB  LEU B  48      56.454  13.809 -63.706  1.00  0.75           C  
ATOM   3758  CG  LEU B  48      56.212  12.303 -63.895  1.00  0.75           C  
ATOM   3759  CD1 LEU B  48      55.064  11.831 -62.992  1.00  0.75           C  
ATOM   3760  CD2 LEU B  48      55.899  11.948 -65.358  1.00  0.75           C  
ATOM   3761  N   VAL B  49      57.990  16.515 -63.183  1.00  0.77           N  
ATOM   3762  CA  VAL B  49      58.073  17.963 -63.073  1.00  0.77           C  
ATOM   3763  C   VAL B  49      59.119  18.555 -64.009  1.00  0.77           C  
ATOM   3764  O   VAL B  49      58.856  19.510 -64.738  1.00  0.77           O  
ATOM   3765  CB  VAL B  49      58.393  18.359 -61.636  1.00  0.77           C  
ATOM   3766  CG1 VAL B  49      58.667  19.870 -61.503  1.00  0.77           C  
ATOM   3767  CG2 VAL B  49      57.214  17.978 -60.720  1.00  0.77           C  
ATOM   3768  N   GLY B  50      60.331  17.963 -64.052  1.00  0.80           N  
ATOM   3769  CA  GLY B  50      61.425  18.433 -64.894  1.00  0.80           C  
ATOM   3770  C   GLY B  50      61.203  18.279 -66.377  1.00  0.80           C  
ATOM   3771  O   GLY B  50      61.718  19.061 -67.180  1.00  0.80           O  
ATOM   3772  N   SER B  51      60.408  17.279 -66.796  1.00  0.79           N  
ATOM   3773  CA  SER B  51      60.110  17.048 -68.198  1.00  0.79           C  
ATOM   3774  C   SER B  51      58.815  17.688 -68.646  1.00  0.79           C  
ATOM   3775  O   SER B  51      58.557  17.775 -69.845  1.00  0.79           O  
ATOM   3776  CB  SER B  51      60.042  15.534 -68.533  1.00  0.79           C  
ATOM   3777  OG  SER B  51      58.978  14.866 -67.847  1.00  0.79           O  
ATOM   3778  N   TYR B  52      57.988  18.206 -67.714  1.00  0.34           N  
ATOM   3779  CA  TYR B  52      56.746  18.880 -68.043  1.00  0.34           C  
ATOM   3780  C   TYR B  52      56.958  20.148 -68.861  1.00  0.34           C  
ATOM   3781  O   TYR B  52      57.762  21.021 -68.532  1.00  0.34           O  
ATOM   3782  CB  TYR B  52      55.891  19.164 -66.770  1.00  0.34           C  
ATOM   3783  CG  TYR B  52      54.485  19.629 -67.086  1.00  0.34           C  
ATOM   3784  CD1 TYR B  52      53.978  20.831 -66.565  1.00  0.34           C  
ATOM   3785  CD2 TYR B  52      53.655  18.858 -67.912  1.00  0.34           C  
ATOM   3786  CE1 TYR B  52      52.684  21.266 -66.889  1.00  0.34           C  
ATOM   3787  CE2 TYR B  52      52.356  19.278 -68.223  1.00  0.34           C  
ATOM   3788  CZ  TYR B  52      51.874  20.490 -67.721  1.00  0.34           C  
ATOM   3789  OH  TYR B  52      50.581  20.937 -68.043  1.00  0.34           O  
ATOM   3790  N   ARG B  53      56.233  20.271 -69.980  1.00  0.30           N  
ATOM   3791  CA  ARG B  53      56.293  21.431 -70.838  1.00  0.30           C  
ATOM   3792  C   ARG B  53      54.874  21.890 -71.146  1.00  0.30           C  
ATOM   3793  O   ARG B  53      54.199  21.252 -71.957  1.00  0.30           O  
ATOM   3794  CB  ARG B  53      57.053  21.112 -72.150  1.00  0.30           C  
ATOM   3795  CG  ARG B  53      58.556  20.807 -71.945  1.00  0.30           C  
ATOM   3796  CD  ARG B  53      59.363  21.976 -71.355  1.00  0.30           C  
ATOM   3797  NE  ARG B  53      60.767  21.496 -71.117  1.00  0.30           N  
ATOM   3798  CZ  ARG B  53      61.191  20.934 -69.976  1.00  0.30           C  
ATOM   3799  NH1 ARG B  53      60.416  20.762 -68.916  1.00  0.30           N  
ATOM   3800  NH2 ARG B  53      62.454  20.521 -69.875  1.00  0.30           N  
ATOM   3801  N   PRO B  54      54.359  22.967 -70.548  1.00  0.40           N  
ATOM   3802  CA  PRO B  54      52.958  23.350 -70.703  1.00  0.40           C  
ATOM   3803  C   PRO B  54      52.719  24.045 -72.023  1.00  0.40           C  
ATOM   3804  O   PRO B  54      51.571  24.183 -72.443  1.00  0.40           O  
ATOM   3805  CB  PRO B  54      52.699  24.288 -69.510  1.00  0.40           C  
ATOM   3806  CG  PRO B  54      54.078  24.846 -69.159  1.00  0.40           C  
ATOM   3807  CD  PRO B  54      54.978  23.645 -69.409  1.00  0.40           C  
ATOM   3808  N   ASP B  55      53.795  24.498 -72.676  1.00  0.40           N  
ATOM   3809  CA  ASP B  55      53.838  25.109 -73.976  1.00  0.40           C  
ATOM   3810  C   ASP B  55      53.629  24.096 -75.101  1.00  0.40           C  
ATOM   3811  O   ASP B  55      53.101  24.413 -76.165  1.00  0.40           O  
ATOM   3812  CB  ASP B  55      55.214  25.828 -74.090  1.00  0.40           C  
ATOM   3813  CG  ASP B  55      56.380  24.873 -73.832  1.00  0.40           C  
ATOM   3814  OD1 ASP B  55      56.512  24.394 -72.671  1.00  0.40           O  
ATOM   3815  OD2 ASP B  55      57.130  24.568 -74.800  1.00  0.40           O  
ATOM   3816  N   ARG B  56      53.989  22.819 -74.855  1.00  0.38           N  
ATOM   3817  CA  ARG B  56      53.847  21.726 -75.797  1.00  0.38           C  
ATOM   3818  C   ARG B  56      52.554  20.953 -75.612  1.00  0.38           C  
ATOM   3819  O   ARG B  56      52.504  19.737 -75.788  1.00  0.38           O  
ATOM   3820  CB  ARG B  56      55.036  20.745 -75.708  1.00  0.38           C  
ATOM   3821  CG  ARG B  56      56.378  21.371 -76.120  1.00  0.38           C  
ATOM   3822  CD  ARG B  56      57.448  20.296 -76.287  1.00  0.38           C  
ATOM   3823  NE  ARG B  56      58.699  20.976 -76.732  1.00  0.38           N  
ATOM   3824  CZ  ARG B  56      59.803  20.320 -77.111  1.00  0.38           C  
ATOM   3825  NH1 ARG B  56      59.866  18.990 -77.069  1.00  0.38           N  
ATOM   3826  NH2 ARG B  56      60.862  21.003 -77.536  1.00  0.38           N  
ATOM   3827  N   ALA B  57      51.468  21.649 -75.246  1.00  0.53           N  
ATOM   3828  CA  ALA B  57      50.141  21.090 -75.128  1.00  0.53           C  
ATOM   3829  C   ALA B  57      49.592  20.465 -76.407  1.00  0.53           C  
ATOM   3830  O   ALA B  57      49.777  20.984 -77.506  1.00  0.53           O  
ATOM   3831  CB  ALA B  57      49.187  22.204 -74.664  1.00  0.53           C  
ATOM   3832  N   GLY B  58      48.882  19.318 -76.291  1.00  0.54           N  
ATOM   3833  CA  GLY B  58      48.071  18.788 -77.384  1.00  0.54           C  
ATOM   3834  C   GLY B  58      46.953  19.721 -77.787  1.00  0.54           C  
ATOM   3835  O   GLY B  58      46.435  20.485 -76.975  1.00  0.54           O  
ATOM   3836  N   ALA B  59      46.540  19.680 -79.069  1.00  0.65           N  
ATOM   3837  CA  ALA B  59      45.480  20.533 -79.571  1.00  0.65           C  
ATOM   3838  C   ALA B  59      44.120  20.279 -78.929  1.00  0.65           C  
ATOM   3839  O   ALA B  59      43.656  19.145 -78.844  1.00  0.65           O  
ATOM   3840  CB  ALA B  59      45.360  20.402 -81.105  1.00  0.65           C  
ATOM   3841  N   VAL B  60      43.426  21.340 -78.490  1.00  0.66           N  
ATOM   3842  CA  VAL B  60      42.112  21.234 -77.889  1.00  0.66           C  
ATOM   3843  C   VAL B  60      41.088  21.829 -78.836  1.00  0.66           C  
ATOM   3844  O   VAL B  60      41.085  23.020 -79.150  1.00  0.66           O  
ATOM   3845  CB  VAL B  60      42.017  21.901 -76.520  1.00  0.66           C  
ATOM   3846  CG1 VAL B  60      40.617  21.680 -75.906  1.00  0.66           C  
ATOM   3847  CG2 VAL B  60      43.094  21.324 -75.579  1.00  0.66           C  
ATOM   3848  N   THR B  61      40.162  20.987 -79.321  1.00  0.68           N  
ATOM   3849  CA  THR B  61      39.076  21.414 -80.187  1.00  0.68           C  
ATOM   3850  C   THR B  61      37.818  21.443 -79.367  1.00  0.68           C  
ATOM   3851  O   THR B  61      37.373  20.425 -78.838  1.00  0.68           O  
ATOM   3852  CB  THR B  61      38.817  20.487 -81.367  1.00  0.68           C  
ATOM   3853  OG1 THR B  61      39.931  20.487 -82.249  1.00  0.68           O  
ATOM   3854  CG2 THR B  61      37.606  20.930 -82.209  1.00  0.68           C  
ATOM   3855  N   ALA B  62      37.177  22.617 -79.252  1.00  0.69           N  
ATOM   3856  CA  ALA B  62      35.848  22.693 -78.699  1.00  0.69           C  
ATOM   3857  C   ALA B  62      34.826  22.315 -79.747  1.00  0.69           C  
ATOM   3858  O   ALA B  62      34.851  22.810 -80.874  1.00  0.69           O  
ATOM   3859  CB  ALA B  62      35.515  24.086 -78.155  1.00  0.69           C  
ATOM   3860  N   VAL B  63      33.913  21.405 -79.389  1.00  0.71           N  
ATOM   3861  CA  VAL B  63      32.858  20.948 -80.260  1.00  0.71           C  
ATOM   3862  C   VAL B  63      31.567  21.461 -79.687  1.00  0.71           C  
ATOM   3863  O   VAL B  63      31.160  21.084 -78.587  1.00  0.71           O  
ATOM   3864  CB  VAL B  63      32.797  19.434 -80.367  1.00  0.71           C  
ATOM   3865  CG1 VAL B  63      31.649  19.016 -81.310  1.00  0.71           C  
ATOM   3866  CG2 VAL B  63      34.157  18.919 -80.882  1.00  0.71           C  
ATOM   3867  N   VAL B  64      30.893  22.352 -80.431  1.00  0.71           N  
ATOM   3868  CA  VAL B  64      29.662  22.963 -79.983  1.00  0.71           C  
ATOM   3869  C   VAL B  64      28.550  22.508 -80.896  1.00  0.71           C  
ATOM   3870  O   VAL B  64      28.520  22.811 -82.089  1.00  0.71           O  
ATOM   3871  CB  VAL B  64      29.730  24.485 -79.944  1.00  0.71           C  
ATOM   3872  CG1 VAL B  64      28.434  25.054 -79.331  1.00  0.71           C  
ATOM   3873  CG2 VAL B  64      30.939  24.913 -79.087  1.00  0.71           C  
ATOM   3874  N   LEU B  65      27.583  21.744 -80.359  1.00  0.67           N  
ATOM   3875  CA  LEU B  65      26.378  21.403 -81.092  1.00  0.67           C  
ATOM   3876  C   LEU B  65      25.425  22.579 -81.013  1.00  0.67           C  
ATOM   3877  O   LEU B  65      25.300  23.210 -79.966  1.00  0.67           O  
ATOM   3878  CB  LEU B  65      25.678  20.132 -80.547  1.00  0.67           C  
ATOM   3879  CG  LEU B  65      26.169  18.797 -81.146  1.00  0.67           C  
ATOM   3880  CD1 LEU B  65      27.667  18.533 -80.929  1.00  0.67           C  
ATOM   3881  CD2 LEU B  65      25.340  17.642 -80.565  1.00  0.67           C  
ATOM   3882  N   THR B  66      24.747  22.924 -82.123  1.00  0.64           N  
ATOM   3883  CA  THR B  66      23.944  24.139 -82.142  1.00  0.64           C  
ATOM   3884  C   THR B  66      22.733  24.011 -83.055  1.00  0.64           C  
ATOM   3885  O   THR B  66      22.744  23.258 -84.029  1.00  0.64           O  
ATOM   3886  CB  THR B  66      24.787  25.374 -82.474  1.00  0.64           C  
ATOM   3887  OG1 THR B  66      24.122  26.569 -82.118  1.00  0.64           O  
ATOM   3888  CG2 THR B  66      25.168  25.451 -83.956  1.00  0.64           C  
ATOM   3889  N   HIS B  67      21.642  24.727 -82.712  1.00  0.52           N  
ATOM   3890  CA  HIS B  67      20.380  24.750 -83.440  1.00  0.52           C  
ATOM   3891  C   HIS B  67      19.541  25.900 -82.908  1.00  0.52           C  
ATOM   3892  O   HIS B  67      18.919  25.775 -81.856  1.00  0.52           O  
ATOM   3893  CB  HIS B  67      19.526  23.457 -83.273  1.00  0.52           C  
ATOM   3894  CG  HIS B  67      18.253  23.496 -84.067  1.00  0.52           C  
ATOM   3895  ND1 HIS B  67      18.351  23.366 -85.432  1.00  0.52           N  
ATOM   3896  CD2 HIS B  67      17.027  23.971 -83.726  1.00  0.52           C  
ATOM   3897  CE1 HIS B  67      17.191  23.782 -85.906  1.00  0.52           C  
ATOM   3898  NE2 HIS B  67      16.355  24.164 -84.912  1.00  0.52           N  
ATOM   3899  N   ASP B  68      19.521  27.044 -83.616  1.00  0.54           N  
ATOM   3900  CA  ASP B  68      18.779  28.235 -83.234  1.00  0.54           C  
ATOM   3901  C   ASP B  68      19.188  28.836 -81.880  1.00  0.54           C  
ATOM   3902  O   ASP B  68      18.380  29.011 -80.969  1.00  0.54           O  
ATOM   3903  CB  ASP B  68      17.246  28.055 -83.367  1.00  0.54           C  
ATOM   3904  CG  ASP B  68      16.839  27.608 -84.762  1.00  0.54           C  
ATOM   3905  OD1 ASP B  68      17.482  28.026 -85.763  1.00  0.54           O  
ATOM   3906  OD2 ASP B  68      15.834  26.848 -84.844  1.00  0.54           O  
ATOM   3907  N   GLU B  69      20.489  29.158 -81.724  1.00  0.59           N  
ATOM   3908  CA  GLU B  69      21.120  29.560 -80.479  1.00  0.59           C  
ATOM   3909  C   GLU B  69      21.725  30.960 -80.556  1.00  0.59           C  
ATOM   3910  O   GLU B  69      22.677  31.282 -79.836  1.00  0.59           O  
ATOM   3911  CB  GLU B  69      22.228  28.560 -80.063  1.00  0.59           C  
ATOM   3912  CG  GLU B  69      21.706  27.134 -79.750  1.00  0.59           C  
ATOM   3913  CD  GLU B  69      20.969  27.005 -78.415  1.00  0.59           C  
ATOM   3914  OE1 GLU B  69      20.565  25.851 -78.112  1.00  0.59           O  
ATOM   3915  OE2 GLU B  69      20.841  28.021 -77.687  1.00  0.59           O  
ATOM   3916  N   GLU B  70      21.199  31.858 -81.426  1.00  0.55           N  
ATOM   3917  CA  GLU B  70      21.755  33.174 -81.719  1.00  0.55           C  
ATOM   3918  C   GLU B  70      22.059  34.031 -80.494  1.00  0.55           C  
ATOM   3919  O   GLU B  70      23.066  34.733 -80.440  1.00  0.55           O  
ATOM   3920  CB  GLU B  70      20.847  33.935 -82.727  1.00  0.55           C  
ATOM   3921  CG  GLU B  70      19.442  34.330 -82.207  1.00  0.55           C  
ATOM   3922  CD  GLU B  70      18.599  35.099 -83.229  1.00  0.55           C  
ATOM   3923  OE1 GLU B  70      17.539  35.612 -82.782  1.00  0.55           O  
ATOM   3924  OE2 GLU B  70      19.008  35.224 -84.422  1.00  0.55           O  
ATOM   3925  N   GLN B  71      21.214  33.950 -79.453  1.00  0.54           N  
ATOM   3926  CA  GLN B  71      21.347  34.651 -78.196  1.00  0.54           C  
ATOM   3927  C   GLN B  71      22.508  34.213 -77.309  1.00  0.54           C  
ATOM   3928  O   GLN B  71      23.128  35.034 -76.633  1.00  0.54           O  
ATOM   3929  CB  GLN B  71      19.987  34.642 -77.461  1.00  0.54           C  
ATOM   3930  CG  GLN B  71      18.897  35.251 -78.378  1.00  0.54           C  
ATOM   3931  CD  GLN B  71      17.648  35.734 -77.642  1.00  0.54           C  
ATOM   3932  OE1 GLN B  71      17.673  36.029 -76.445  1.00  0.54           O  
ATOM   3933  NE2 GLN B  71      16.523  35.768 -78.375  1.00  0.54           N  
ATOM   3934  N   VAL B  72      22.851  32.910 -77.272  1.00  0.65           N  
ATOM   3935  CA  VAL B  72      23.819  32.410 -76.306  1.00  0.65           C  
ATOM   3936  C   VAL B  72      25.148  32.016 -76.930  1.00  0.65           C  
ATOM   3937  O   VAL B  72      26.190  32.058 -76.271  1.00  0.65           O  
ATOM   3938  CB  VAL B  72      23.258  31.245 -75.501  1.00  0.65           C  
ATOM   3939  CG1 VAL B  72      22.073  31.749 -74.651  1.00  0.65           C  
ATOM   3940  CG2 VAL B  72      22.817  30.098 -76.423  1.00  0.65           C  
ATOM   3941  N   ILE B  73      25.182  31.709 -78.247  1.00  0.65           N  
ATOM   3942  CA  ILE B  73      26.355  31.168 -78.929  1.00  0.65           C  
ATOM   3943  C   ILE B  73      27.588  32.056 -78.868  1.00  0.65           C  
ATOM   3944  O   ILE B  73      28.713  31.589 -78.691  1.00  0.65           O  
ATOM   3945  CB  ILE B  73      26.030  30.776 -80.376  1.00  0.65           C  
ATOM   3946  CG1 ILE B  73      27.126  29.913 -81.043  1.00  0.65           C  
ATOM   3947  CG2 ILE B  73      25.731  32.014 -81.252  1.00  0.65           C  
ATOM   3948  CD1 ILE B  73      27.328  28.549 -80.378  1.00  0.65           C  
ATOM   3949  N   GLY B  74      27.425  33.395 -78.958  1.00  0.65           N  
ATOM   3950  CA  GLY B  74      28.561  34.297 -78.874  1.00  0.65           C  
ATOM   3951  C   GLY B  74      29.238  34.349 -77.530  1.00  0.65           C  
ATOM   3952  O   GLY B  74      30.445  34.554 -77.450  1.00  0.65           O  
ATOM   3953  N   ALA B  75      28.496  34.165 -76.426  1.00  0.67           N  
ATOM   3954  CA  ALA B  75      29.078  34.088 -75.104  1.00  0.67           C  
ATOM   3955  C   ALA B  75      29.837  32.789 -74.876  1.00  0.67           C  
ATOM   3956  O   ALA B  75      30.949  32.804 -74.352  1.00  0.67           O  
ATOM   3957  CB  ALA B  75      27.993  34.322 -74.041  1.00  0.67           C  
ATOM   3958  N   CYS B  76      29.271  31.653 -75.334  1.00  0.67           N  
ATOM   3959  CA  CYS B  76      29.903  30.345 -75.282  1.00  0.67           C  
ATOM   3960  C   CYS B  76      31.247  30.311 -75.999  1.00  0.67           C  
ATOM   3961  O   CYS B  76      32.265  29.941 -75.419  1.00  0.67           O  
ATOM   3962  CB  CYS B  76      28.920  29.312 -75.904  1.00  0.67           C  
ATOM   3963  SG  CYS B  76      29.570  27.616 -76.171  1.00  0.67           S  
ATOM   3964  N   LEU B  77      31.301  30.775 -77.264  1.00  0.67           N  
ATOM   3965  CA  LEU B  77      32.523  30.783 -78.046  1.00  0.67           C  
ATOM   3966  C   LEU B  77      33.613  31.683 -77.486  1.00  0.67           C  
ATOM   3967  O   LEU B  77      34.773  31.288 -77.415  1.00  0.67           O  
ATOM   3968  CB  LEU B  77      32.221  31.148 -79.516  1.00  0.67           C  
ATOM   3969  CG  LEU B  77      31.281  30.166 -80.246  1.00  0.67           C  
ATOM   3970  CD1 LEU B  77      31.024  30.676 -81.669  1.00  0.67           C  
ATOM   3971  CD2 LEU B  77      31.820  28.728 -80.280  1.00  0.67           C  
ATOM   3972  N   ARG B  78      33.265  32.900 -77.014  1.00  0.62           N  
ATOM   3973  CA  ARG B  78      34.212  33.810 -76.388  1.00  0.62           C  
ATOM   3974  C   ARG B  78      34.849  33.269 -75.119  1.00  0.62           C  
ATOM   3975  O   ARG B  78      35.973  33.621 -74.786  1.00  0.62           O  
ATOM   3976  CB  ARG B  78      33.558  35.170 -76.055  1.00  0.62           C  
ATOM   3977  CG  ARG B  78      33.343  36.073 -77.283  1.00  0.62           C  
ATOM   3978  CD  ARG B  78      32.901  37.496 -76.922  1.00  0.62           C  
ATOM   3979  NE  ARG B  78      31.505  37.441 -76.369  1.00  0.62           N  
ATOM   3980  CZ  ARG B  78      30.398  37.717 -77.072  1.00  0.62           C  
ATOM   3981  NH1 ARG B  78      30.456  38.000 -78.367  1.00  0.62           N  
ATOM   3982  NH2 ARG B  78      29.212  37.706 -76.463  1.00  0.62           N  
ATOM   3983  N   ALA B  79      34.149  32.403 -74.369  1.00  0.67           N  
ATOM   3984  CA  ALA B  79      34.680  31.830 -73.157  1.00  0.67           C  
ATOM   3985  C   ALA B  79      35.647  30.677 -73.406  1.00  0.67           C  
ATOM   3986  O   ALA B  79      36.398  30.280 -72.520  1.00  0.67           O  
ATOM   3987  CB  ALA B  79      33.491  31.388 -72.293  1.00  0.67           C  
ATOM   3988  N   LEU B  80      35.674  30.125 -74.633  1.00  0.65           N  
ATOM   3989  CA  LEU B  80      36.501  28.982 -74.964  1.00  0.65           C  
ATOM   3990  C   LEU B  80      37.786  29.356 -75.692  1.00  0.65           C  
ATOM   3991  O   LEU B  80      38.629  28.498 -75.941  1.00  0.65           O  
ATOM   3992  CB  LEU B  80      35.693  28.032 -75.883  1.00  0.65           C  
ATOM   3993  CG  LEU B  80      34.460  27.393 -75.216  1.00  0.65           C  
ATOM   3994  CD1 LEU B  80      33.556  26.745 -76.276  1.00  0.65           C  
ATOM   3995  CD2 LEU B  80      34.865  26.374 -74.141  1.00  0.65           C  
ATOM   3996  N   THR B  81      37.994  30.640 -76.042  1.00  0.62           N  
ATOM   3997  CA  THR B  81      39.123  31.104 -76.847  1.00  0.62           C  
ATOM   3998  C   THR B  81      40.469  30.903 -76.183  1.00  0.62           C  
ATOM   3999  O   THR B  81      41.419  30.464 -76.825  1.00  0.62           O  
ATOM   4000  CB  THR B  81      38.990  32.566 -77.273  1.00  0.62           C  
ATOM   4001  OG1 THR B  81      38.653  33.390 -76.168  1.00  0.62           O  
ATOM   4002  CG2 THR B  81      37.835  32.684 -78.280  1.00  0.62           C  
ATOM   4003  N   ASP B  82      40.591  31.180 -74.871  1.00  0.52           N  
ATOM   4004  CA  ASP B  82      41.817  31.012 -74.116  1.00  0.52           C  
ATOM   4005  C   ASP B  82      42.232  29.546 -73.938  1.00  0.52           C  
ATOM   4006  O   ASP B  82      43.417  29.211 -73.851  1.00  0.52           O  
ATOM   4007  CB  ASP B  82      41.685  31.702 -72.732  1.00  0.52           C  
ATOM   4008  CG  ASP B  82      41.469  33.206 -72.858  1.00  0.52           C  
ATOM   4009  OD1 ASP B  82      42.202  33.857 -73.642  1.00  0.52           O  
ATOM   4010  OD2 ASP B  82      40.588  33.732 -72.122  1.00  0.52           O  
ATOM   4011  N   ASP B  83      41.260  28.613 -73.890  1.00  0.57           N  
ATOM   4012  CA  ASP B  83      41.539  27.227 -73.601  1.00  0.57           C  
ATOM   4013  C   ASP B  83      41.592  26.342 -74.838  1.00  0.57           C  
ATOM   4014  O   ASP B  83      42.241  25.298 -74.821  1.00  0.57           O  
ATOM   4015  CB  ASP B  83      40.470  26.693 -72.626  1.00  0.57           C  
ATOM   4016  CG  ASP B  83      40.856  27.092 -71.220  1.00  0.57           C  
ATOM   4017  OD1 ASP B  83      41.649  26.331 -70.600  1.00  0.57           O  
ATOM   4018  OD2 ASP B  83      40.380  28.144 -70.732  1.00  0.57           O  
ATOM   4019  N   CYS B  84      40.992  26.736 -75.973  1.00  0.62           N  
ATOM   4020  CA  CYS B  84      40.834  25.852 -77.117  1.00  0.62           C  
ATOM   4021  C   CYS B  84      41.424  26.426 -78.391  1.00  0.62           C  
ATOM   4022  O   CYS B  84      41.124  27.545 -78.795  1.00  0.62           O  
ATOM   4023  CB  CYS B  84      39.340  25.550 -77.373  1.00  0.62           C  
ATOM   4024  SG  CYS B  84      38.567  24.729 -75.936  1.00  0.62           S  
ATOM   4025  N   ASP B  85      42.282  25.641 -79.075  1.00  0.62           N  
ATOM   4026  CA  ASP B  85      42.954  25.989 -80.313  1.00  0.62           C  
ATOM   4027  C   ASP B  85      41.982  26.131 -81.470  1.00  0.62           C  
ATOM   4028  O   ASP B  85      42.163  26.935 -82.383  1.00  0.62           O  
ATOM   4029  CB  ASP B  85      44.010  24.914 -80.680  1.00  0.62           C  
ATOM   4030  CG  ASP B  85      44.922  24.677 -79.503  1.00  0.62           C  
ATOM   4031  OD1 ASP B  85      45.924  25.399 -79.302  1.00  0.62           O  
ATOM   4032  OD2 ASP B  85      44.566  23.792 -78.677  1.00  0.62           O  
ATOM   4033  N   ARG B  86      40.918  25.306 -81.453  1.00  0.61           N  
ATOM   4034  CA  ARG B  86      39.960  25.260 -82.523  1.00  0.61           C  
ATOM   4035  C   ARG B  86      38.548  25.243 -81.978  1.00  0.61           C  
ATOM   4036  O   ARG B  86      38.244  24.597 -80.975  1.00  0.61           O  
ATOM   4037  CB  ARG B  86      40.222  24.020 -83.406  1.00  0.61           C  
ATOM   4038  CG  ARG B  86      39.724  24.161 -84.856  1.00  0.61           C  
ATOM   4039  CD  ARG B  86      40.128  22.992 -85.759  1.00  0.61           C  
ATOM   4040  NE  ARG B  86      39.279  21.835 -85.361  1.00  0.61           N  
ATOM   4041  CZ  ARG B  86      39.397  20.599 -85.837  1.00  0.61           C  
ATOM   4042  NH1 ARG B  86      40.401  20.228 -86.614  1.00  0.61           N  
ATOM   4043  NH2 ARG B  86      38.471  19.696 -85.538  1.00  0.61           N  
ATOM   4044  N   LEU B  87      37.638  25.975 -82.642  1.00  0.71           N  
ATOM   4045  CA  LEU B  87      36.238  26.018 -82.285  1.00  0.71           C  
ATOM   4046  C   LEU B  87      35.450  25.452 -83.451  1.00  0.71           C  
ATOM   4047  O   LEU B  87      35.456  26.009 -84.548  1.00  0.71           O  
ATOM   4048  CB  LEU B  87      35.760  27.466 -81.999  1.00  0.71           C  
ATOM   4049  CG  LEU B  87      36.527  28.213 -80.884  1.00  0.71           C  
ATOM   4050  CD1 LEU B  87      36.022  29.659 -80.763  1.00  0.71           C  
ATOM   4051  CD2 LEU B  87      36.435  27.514 -79.521  1.00  0.71           C  
ATOM   4052  N   LEU B  88      34.768  24.311 -83.241  1.00  0.70           N  
ATOM   4053  CA  LEU B  88      34.036  23.609 -84.274  1.00  0.70           C  
ATOM   4054  C   LEU B  88      32.566  23.601 -83.921  1.00  0.70           C  
ATOM   4055  O   LEU B  88      32.143  23.044 -82.907  1.00  0.70           O  
ATOM   4056  CB  LEU B  88      34.528  22.142 -84.399  1.00  0.70           C  
ATOM   4057  CG  LEU B  88      33.748  21.245 -85.392  1.00  0.70           C  
ATOM   4058  CD1 LEU B  88      33.855  21.757 -86.836  1.00  0.70           C  
ATOM   4059  CD2 LEU B  88      34.219  19.784 -85.310  1.00  0.70           C  
ATOM   4060  N   LEU B  89      31.732  24.217 -84.771  1.00  0.70           N  
ATOM   4061  CA  LEU B  89      30.296  24.163 -84.606  1.00  0.70           C  
ATOM   4062  C   LEU B  89      29.742  23.036 -85.443  1.00  0.70           C  
ATOM   4063  O   LEU B  89      29.998  22.929 -86.642  1.00  0.70           O  
ATOM   4064  CB  LEU B  89      29.566  25.478 -84.978  1.00  0.70           C  
ATOM   4065  CG  LEU B  89      29.546  26.532 -83.853  1.00  0.70           C  
ATOM   4066  CD1 LEU B  89      30.954  26.890 -83.364  1.00  0.70           C  
ATOM   4067  CD2 LEU B  89      28.769  27.783 -84.286  1.00  0.70           C  
ATOM   4068  N   VAL B  90      28.940  22.167 -84.814  1.00  0.68           N  
ATOM   4069  CA  VAL B  90      28.134  21.196 -85.522  1.00  0.68           C  
ATOM   4070  C   VAL B  90      26.730  21.765 -85.547  1.00  0.68           C  
ATOM   4071  O   VAL B  90      26.006  21.743 -84.550  1.00  0.68           O  
ATOM   4072  CB  VAL B  90      28.171  19.814 -84.883  1.00  0.68           C  
ATOM   4073  CG1 VAL B  90      27.356  18.814 -85.731  1.00  0.68           C  
ATOM   4074  CG2 VAL B  90      29.639  19.347 -84.782  1.00  0.68           C  
ATOM   4075  N   ASP B  91      26.337  22.334 -86.699  1.00  0.59           N  
ATOM   4076  CA  ASP B  91      25.099  23.046 -86.859  1.00  0.59           C  
ATOM   4077  C   ASP B  91      24.063  22.083 -87.386  1.00  0.59           C  
ATOM   4078  O   ASP B  91      24.264  21.426 -88.407  1.00  0.59           O  
ATOM   4079  CB  ASP B  91      25.312  24.225 -87.842  1.00  0.59           C  
ATOM   4080  CG  ASP B  91      24.039  25.008 -88.004  1.00  0.59           C  
ATOM   4081  OD1 ASP B  91      23.787  25.695 -86.989  1.00  0.59           O  
ATOM   4082  OD2 ASP B  91      23.307  24.943 -89.018  1.00  0.59           O  
ATOM   4083  N   ALA B  92      22.921  21.986 -86.689  1.00  0.59           N  
ATOM   4084  CA  ALA B  92      21.861  21.073 -87.037  1.00  0.59           C  
ATOM   4085  C   ALA B  92      20.818  21.718 -87.941  1.00  0.59           C  
ATOM   4086  O   ALA B  92      19.638  21.381 -87.864  1.00  0.59           O  
ATOM   4087  CB  ALA B  92      21.222  20.521 -85.750  1.00  0.59           C  
ATOM   4088  N   GLU B  93      21.264  22.666 -88.794  1.00  0.48           N  
ATOM   4089  CA  GLU B  93      20.462  23.425 -89.732  1.00  0.48           C  
ATOM   4090  C   GLU B  93      19.748  24.601 -89.082  1.00  0.48           C  
ATOM   4091  O   GLU B  93      18.532  24.742 -89.173  1.00  0.48           O  
ATOM   4092  CB  GLU B  93      19.550  22.580 -90.668  1.00  0.48           C  
ATOM   4093  CG  GLU B  93      20.319  21.514 -91.491  1.00  0.48           C  
ATOM   4094  CD  GLU B  93      19.406  20.569 -92.273  1.00  0.48           C  
ATOM   4095  OE1 GLU B  93      19.541  20.534 -93.524  1.00  0.48           O  
ATOM   4096  OE2 GLU B  93      18.621  19.822 -91.631  1.00  0.48           O  
ATOM   4097  N   SER B  94      20.510  25.504 -88.425  1.00  0.56           N  
ATOM   4098  CA  SER B  94      19.956  26.716 -87.822  1.00  0.56           C  
ATOM   4099  C   SER B  94      19.262  27.643 -88.796  1.00  0.56           C  
ATOM   4100  O   SER B  94      19.778  27.934 -89.875  1.00  0.56           O  
ATOM   4101  CB  SER B  94      21.019  27.551 -87.108  1.00  0.56           C  
ATOM   4102  OG  SER B  94      21.581  26.809 -86.085  1.00  0.56           O  
ATOM   4103  N   GLU B  95      18.069  28.148 -88.436  1.00  0.49           N  
ATOM   4104  CA  GLU B  95      17.273  28.975 -89.328  1.00  0.49           C  
ATOM   4105  C   GLU B  95      17.382  30.450 -88.952  1.00  0.49           C  
ATOM   4106  O   GLU B  95      16.981  31.334 -89.713  1.00  0.49           O  
ATOM   4107  CB  GLU B  95      15.778  28.554 -89.297  1.00  0.49           C  
ATOM   4108  CG  GLU B  95      15.485  27.132 -89.852  1.00  0.49           C  
ATOM   4109  CD  GLU B  95      13.989  26.810 -89.951  1.00  0.49           C  
ATOM   4110  OE1 GLU B  95      13.667  25.642 -90.297  1.00  0.49           O  
ATOM   4111  OE2 GLU B  95      13.151  27.721 -89.721  1.00  0.49           O  
ATOM   4112  N   ASP B  96      17.962  30.754 -87.772  1.00  0.50           N  
ATOM   4113  CA  ASP B  96      18.135  32.095 -87.251  1.00  0.50           C  
ATOM   4114  C   ASP B  96      19.430  32.790 -87.707  1.00  0.50           C  
ATOM   4115  O   ASP B  96      19.936  32.543 -88.805  1.00  0.50           O  
ATOM   4116  CB  ASP B  96      17.961  32.067 -85.702  1.00  0.50           C  
ATOM   4117  CG  ASP B  96      19.092  31.424 -84.935  1.00  0.50           C  
ATOM   4118  OD1 ASP B  96      20.055  30.956 -85.595  1.00  0.50           O  
ATOM   4119  OD2 ASP B  96      19.087  31.413 -83.681  1.00  0.50           O  
ATOM   4120  N   THR B  97      20.032  33.682 -86.871  1.00  0.62           N  
ATOM   4121  CA  THR B  97      21.338  34.274 -87.154  1.00  0.62           C  
ATOM   4122  C   THR B  97      22.507  33.607 -86.448  1.00  0.62           C  
ATOM   4123  O   THR B  97      23.625  34.113 -86.503  1.00  0.62           O  
ATOM   4124  CB  THR B  97      21.442  35.821 -87.065  1.00  0.62           C  
ATOM   4125  OG1 THR B  97      21.328  36.404 -85.806  1.00  0.62           O  
ATOM   4126  CG2 THR B  97      20.311  36.458 -87.845  1.00  0.62           C  
ATOM   4127  N   THR B  98      22.346  32.401 -85.841  1.00  0.61           N  
ATOM   4128  CA  THR B  98      23.349  31.654 -85.056  1.00  0.61           C  
ATOM   4129  C   THR B  98      24.729  31.586 -85.674  1.00  0.61           C  
ATOM   4130  O   THR B  98      25.726  31.951 -85.053  1.00  0.61           O  
ATOM   4131  CB  THR B  98      22.929  30.204 -84.773  1.00  0.61           C  
ATOM   4132  OG1 THR B  98      21.792  30.145 -83.939  1.00  0.61           O  
ATOM   4133  CG2 THR B  98      23.992  29.416 -83.987  1.00  0.61           C  
ATOM   4134  N   LEU B  99      24.832  31.158 -86.945  1.00  0.58           N  
ATOM   4135  CA  LEU B  99      26.085  31.109 -87.674  1.00  0.58           C  
ATOM   4136  C   LEU B  99      26.714  32.478 -87.887  1.00  0.58           C  
ATOM   4137  O   LEU B  99      27.931  32.634 -87.824  1.00  0.58           O  
ATOM   4138  CB  LEU B  99      25.909  30.396 -89.034  1.00  0.58           C  
ATOM   4139  CG  LEU B  99      25.483  28.915 -88.939  1.00  0.58           C  
ATOM   4140  CD1 LEU B  99      25.366  28.306 -90.345  1.00  0.58           C  
ATOM   4141  CD2 LEU B  99      26.451  28.075 -88.091  1.00  0.58           C  
ATOM   4142  N   GLY B 100      25.894  33.526 -88.111  1.00  0.61           N  
ATOM   4143  CA  GLY B 100      26.380  34.895 -88.241  1.00  0.61           C  
ATOM   4144  C   GLY B 100      26.893  35.454 -86.943  1.00  0.61           C  
ATOM   4145  O   GLY B 100      27.969  36.041 -86.889  1.00  0.61           O  
ATOM   4146  N   THR B 101      26.156  35.221 -85.844  1.00  0.63           N  
ATOM   4147  CA  THR B 101      26.564  35.574 -84.488  1.00  0.63           C  
ATOM   4148  C   THR B 101      27.830  34.870 -84.066  1.00  0.63           C  
ATOM   4149  O   THR B 101      28.722  35.474 -83.478  1.00  0.63           O  
ATOM   4150  CB  THR B 101      25.479  35.281 -83.467  1.00  0.63           C  
ATOM   4151  OG1 THR B 101      24.340  36.063 -83.784  1.00  0.63           O  
ATOM   4152  CG2 THR B 101      25.911  35.690 -82.051  1.00  0.63           C  
ATOM   4153  N   ALA B 102      27.968  33.569 -84.384  1.00  0.65           N  
ATOM   4154  CA  ALA B 102      29.161  32.809 -84.096  1.00  0.65           C  
ATOM   4155  C   ALA B 102      30.419  33.344 -84.771  1.00  0.65           C  
ATOM   4156  O   ALA B 102      31.446  33.524 -84.121  1.00  0.65           O  
ATOM   4157  CB  ALA B 102      28.925  31.343 -84.508  1.00  0.65           C  
ATOM   4158  N   ARG B 103      30.340  33.669 -86.078  1.00  0.56           N  
ATOM   4159  CA  ARG B 103      31.429  34.259 -86.841  1.00  0.56           C  
ATOM   4160  C   ARG B 103      31.848  35.626 -86.340  1.00  0.56           C  
ATOM   4161  O   ARG B 103      33.030  35.932 -86.253  1.00  0.56           O  
ATOM   4162  CB  ARG B 103      31.042  34.379 -88.331  1.00  0.56           C  
ATOM   4163  CG  ARG B 103      30.900  33.023 -89.048  1.00  0.56           C  
ATOM   4164  CD  ARG B 103      30.370  33.192 -90.471  1.00  0.56           C  
ATOM   4165  NE  ARG B 103      30.149  31.823 -91.034  1.00  0.56           N  
ATOM   4166  CZ  ARG B 103      29.434  31.581 -92.138  1.00  0.56           C  
ATOM   4167  NH1 ARG B 103      28.941  32.574 -92.878  1.00  0.56           N  
ATOM   4168  NH2 ARG B 103      29.207  30.320 -92.500  1.00  0.56           N  
ATOM   4169  N   SER B 104      30.882  36.486 -85.975  1.00  0.63           N  
ATOM   4170  CA  SER B 104      31.179  37.822 -85.481  1.00  0.63           C  
ATOM   4171  C   SER B 104      31.651  37.846 -84.037  1.00  0.63           C  
ATOM   4172  O   SER B 104      32.160  38.855 -83.556  1.00  0.63           O  
ATOM   4173  CB  SER B 104      29.944  38.751 -85.567  1.00  0.63           C  
ATOM   4174  OG  SER B 104      29.527  38.914 -86.924  1.00  0.63           O  
ATOM   4175  N   ALA B 105      31.472  36.745 -83.280  1.00  0.60           N  
ATOM   4176  CA  ALA B 105      31.813  36.689 -81.877  1.00  0.60           C  
ATOM   4177  C   ALA B 105      33.278  36.420 -81.569  1.00  0.60           C  
ATOM   4178  O   ALA B 105      33.758  36.799 -80.498  1.00  0.60           O  
ATOM   4179  CB  ALA B 105      30.974  35.584 -81.209  1.00  0.60           C  
ATOM   4180  N   VAL B 106      34.007  35.755 -82.485  1.00  0.56           N  
ATOM   4181  CA  VAL B 106      35.375  35.317 -82.270  1.00  0.56           C  
ATOM   4182  C   VAL B 106      36.148  35.443 -83.571  1.00  0.56           C  
ATOM   4183  O   VAL B 106      35.577  35.521 -84.650  1.00  0.56           O  
ATOM   4184  CB  VAL B 106      35.500  33.868 -81.775  1.00  0.56           C  
ATOM   4185  CG1 VAL B 106      34.936  33.731 -80.348  1.00  0.56           C  
ATOM   4186  CG2 VAL B 106      34.783  32.896 -82.733  1.00  0.56           C  
ATOM   4187  N   ALA B 107      37.496  35.480 -83.505  1.00  0.36           N  
ATOM   4188  CA  ALA B 107      38.352  35.650 -84.669  1.00  0.36           C  
ATOM   4189  C   ALA B 107      38.302  34.532 -85.710  1.00  0.36           C  
ATOM   4190  O   ALA B 107      38.399  34.780 -86.908  1.00  0.36           O  
ATOM   4191  CB  ALA B 107      39.813  35.825 -84.213  1.00  0.36           C  
ATOM   4192  N   HIS B 108      38.183  33.267 -85.268  1.00  0.49           N  
ATOM   4193  CA  HIS B 108      38.110  32.131 -86.165  1.00  0.49           C  
ATOM   4194  C   HIS B 108      37.164  31.119 -85.561  1.00  0.49           C  
ATOM   4195  O   HIS B 108      37.207  30.841 -84.363  1.00  0.49           O  
ATOM   4196  CB  HIS B 108      39.497  31.480 -86.432  1.00  0.49           C  
ATOM   4197  CG  HIS B 108      39.475  30.310 -87.380  1.00  0.49           C  
ATOM   4198  ND1 HIS B 108      38.696  30.382 -88.516  1.00  0.49           N  
ATOM   4199  CD2 HIS B 108      40.068  29.088 -87.294  1.00  0.49           C  
ATOM   4200  CE1 HIS B 108      38.823  29.204 -89.097  1.00  0.49           C  
ATOM   4201  NE2 HIS B 108      39.642  28.380 -88.399  1.00  0.49           N  
ATOM   4202  N   VAL B 109      36.259  30.570 -86.384  1.00  0.67           N  
ATOM   4203  CA  VAL B 109      35.344  29.528 -85.981  1.00  0.67           C  
ATOM   4204  C   VAL B 109      35.034  28.700 -87.210  1.00  0.67           C  
ATOM   4205  O   VAL B 109      34.795  29.226 -88.298  1.00  0.67           O  
ATOM   4206  CB  VAL B 109      34.081  30.063 -85.294  1.00  0.67           C  
ATOM   4207  CG1 VAL B 109      33.277  31.007 -86.207  1.00  0.67           C  
ATOM   4208  CG2 VAL B 109      33.205  28.920 -84.758  1.00  0.67           C  
ATOM   4209  N   GLU B 110      35.053  27.365 -87.073  1.00  0.68           N  
ATOM   4210  CA  GLU B 110      34.759  26.445 -88.149  1.00  0.68           C  
ATOM   4211  C   GLU B 110      33.354  25.923 -87.931  1.00  0.68           C  
ATOM   4212  O   GLU B 110      32.887  25.784 -86.800  1.00  0.68           O  
ATOM   4213  CB  GLU B 110      35.782  25.279 -88.190  1.00  0.68           C  
ATOM   4214  CG  GLU B 110      37.242  25.764 -88.406  1.00  0.68           C  
ATOM   4215  CD  GLU B 110      38.318  24.709 -88.179  1.00  0.68           C  
ATOM   4216  OE1 GLU B 110      39.516  25.070 -88.354  1.00  0.68           O  
ATOM   4217  OE2 GLU B 110      37.979  23.556 -87.786  1.00  0.68           O  
ATOM   4218  N   HIS B 111      32.605  25.632 -89.009  1.00  0.68           N  
ATOM   4219  CA  HIS B 111      31.264  25.107 -88.872  1.00  0.68           C  
ATOM   4220  C   HIS B 111      31.049  23.994 -89.867  1.00  0.68           C  
ATOM   4221  O   HIS B 111      31.472  24.070 -91.017  1.00  0.68           O  
ATOM   4222  CB  HIS B 111      30.137  26.184 -89.004  1.00  0.68           C  
ATOM   4223  CG  HIS B 111      29.797  26.623 -90.404  1.00  0.68           C  
ATOM   4224  ND1 HIS B 111      30.505  27.627 -91.053  1.00  0.68           N  
ATOM   4225  CD2 HIS B 111      29.007  25.966 -91.289  1.00  0.68           C  
ATOM   4226  CE1 HIS B 111      30.153  27.523 -92.319  1.00  0.68           C  
ATOM   4227  NE2 HIS B 111      29.246  26.542 -92.512  1.00  0.68           N  
ATOM   4228  N   VAL B 112      30.374  22.917 -89.434  1.00  0.69           N  
ATOM   4229  CA  VAL B 112      29.910  21.869 -90.319  1.00  0.69           C  
ATOM   4230  C   VAL B 112      28.406  21.808 -90.161  1.00  0.69           C  
ATOM   4231  O   VAL B 112      27.881  21.665 -89.057  1.00  0.69           O  
ATOM   4232  CB  VAL B 112      30.532  20.506 -90.021  1.00  0.69           C  
ATOM   4233  CG1 VAL B 112      29.923  19.403 -90.912  1.00  0.69           C  
ATOM   4234  CG2 VAL B 112      32.051  20.564 -90.268  1.00  0.69           C  
ATOM   4235  N   THR B 113      27.668  21.940 -91.281  1.00  0.61           N  
ATOM   4236  CA  THR B 113      26.214  21.853 -91.301  1.00  0.61           C  
ATOM   4237  C   THR B 113      25.811  20.418 -91.533  1.00  0.61           C  
ATOM   4238  O   THR B 113      26.287  19.774 -92.466  1.00  0.61           O  
ATOM   4239  CB  THR B 113      25.547  22.692 -92.390  1.00  0.61           C  
ATOM   4240  OG1 THR B 113      25.977  24.037 -92.317  1.00  0.61           O  
ATOM   4241  CG2 THR B 113      24.023  22.732 -92.222  1.00  0.61           C  
ATOM   4242  N   ARG B 114      24.935  19.862 -90.681  1.00  0.49           N  
ATOM   4243  CA  ARG B 114      24.455  18.506 -90.845  1.00  0.49           C  
ATOM   4244  C   ARG B 114      23.002  18.416 -90.470  1.00  0.49           C  
ATOM   4245  O   ARG B 114      22.592  18.907 -89.426  1.00  0.49           O  
ATOM   4246  CB  ARG B 114      25.179  17.496 -89.922  1.00  0.49           C  
ATOM   4247  CG  ARG B 114      26.632  17.221 -90.332  1.00  0.49           C  
ATOM   4248  CD  ARG B 114      27.320  16.161 -89.477  1.00  0.49           C  
ATOM   4249  NE  ARG B 114      26.701  14.830 -89.793  1.00  0.49           N  
ATOM   4250  CZ  ARG B 114      26.107  14.036 -88.897  1.00  0.49           C  
ATOM   4251  NH1 ARG B 114      25.726  14.448 -87.698  1.00  0.49           N  
ATOM   4252  NH2 ARG B 114      25.885  12.762 -89.212  1.00  0.49           N  
ATOM   4253  N   ALA B 115      22.186  17.732 -91.290  1.00  0.53           N  
ATOM   4254  CA  ALA B 115      20.786  17.533 -90.997  1.00  0.53           C  
ATOM   4255  C   ALA B 115      20.480  16.826 -89.686  1.00  0.53           C  
ATOM   4256  O   ALA B 115      21.172  15.893 -89.271  1.00  0.53           O  
ATOM   4257  CB  ALA B 115      20.092  16.789 -92.152  1.00  0.53           C  
ATOM   4258  N   TRP B 116      19.422  17.270 -88.980  1.00  0.38           N  
ATOM   4259  CA  TRP B 116      18.944  16.599 -87.784  1.00  0.38           C  
ATOM   4260  C   TRP B 116      18.263  15.268 -88.102  1.00  0.38           C  
ATOM   4261  O   TRP B 116      17.229  15.203 -88.759  1.00  0.38           O  
ATOM   4262  CB  TRP B 116      18.029  17.522 -86.931  1.00  0.38           C  
ATOM   4263  CG  TRP B 116      17.363  16.873 -85.718  1.00  0.38           C  
ATOM   4264  CD1 TRP B 116      16.059  16.477 -85.601  1.00  0.38           C  
ATOM   4265  CD2 TRP B 116      18.041  16.387 -84.556  1.00  0.38           C  
ATOM   4266  NE1 TRP B 116      15.876  15.792 -84.425  1.00  0.38           N  
ATOM   4267  CE2 TRP B 116      17.064  15.734 -83.752  1.00  0.38           C  
ATOM   4268  CE3 TRP B 116      19.362  16.473 -84.125  1.00  0.38           C  
ATOM   4269  CZ2 TRP B 116      17.406  15.153 -82.553  1.00  0.38           C  
ATOM   4270  CZ3 TRP B 116      19.709  15.839 -82.929  1.00  0.38           C  
ATOM   4271  CH2 TRP B 116      18.739  15.205 -82.141  1.00  0.38           C  
ATOM   4272  N   THR B 117      18.835  14.150 -87.614  1.00  0.44           N  
ATOM   4273  CA  THR B 117      18.412  12.806 -87.989  1.00  0.44           C  
ATOM   4274  C   THR B 117      17.729  12.060 -86.859  1.00  0.44           C  
ATOM   4275  O   THR B 117      17.607  10.833 -86.899  1.00  0.44           O  
ATOM   4276  CB  THR B 117      19.583  11.946 -88.459  1.00  0.44           C  
ATOM   4277  OG1 THR B 117      20.669  11.981 -87.537  1.00  0.44           O  
ATOM   4278  CG2 THR B 117      20.093  12.489 -89.799  1.00  0.44           C  
ATOM   4279  N   ASP B 118      17.259  12.784 -85.820  1.00  0.39           N  
ATOM   4280  CA  ASP B 118      16.728  12.217 -84.594  1.00  0.39           C  
ATOM   4281  C   ASP B 118      17.752  11.407 -83.813  1.00  0.39           C  
ATOM   4282  O   ASP B 118      17.536  10.261 -83.404  1.00  0.39           O  
ATOM   4283  CB  ASP B 118      15.376  11.486 -84.807  1.00  0.39           C  
ATOM   4284  CG  ASP B 118      14.174  12.420 -84.829  1.00  0.39           C  
ATOM   4285  OD1 ASP B 118      14.238  13.548 -84.275  1.00  0.39           O  
ATOM   4286  OD2 ASP B 118      13.094  11.970 -85.299  1.00  0.39           O  
ATOM   4287  N   ASP B 119      18.917  12.035 -83.578  1.00  0.40           N  
ATOM   4288  CA  ASP B 119      20.024  11.380 -82.940  1.00  0.40           C  
ATOM   4289  C   ASP B 119      21.059  12.395 -82.450  1.00  0.40           C  
ATOM   4290  O   ASP B 119      21.796  13.014 -83.222  1.00  0.40           O  
ATOM   4291  CB  ASP B 119      20.624  10.401 -83.973  1.00  0.40           C  
ATOM   4292  CG  ASP B 119      21.536   9.371 -83.353  1.00  0.40           C  
ATOM   4293  OD1 ASP B 119      22.254   9.705 -82.379  1.00  0.40           O  
ATOM   4294  OD2 ASP B 119      21.534   8.230 -83.875  1.00  0.40           O  
ATOM   4295  N   PHE B 120      21.120  12.601 -81.115  1.00  0.37           N  
ATOM   4296  CA  PHE B 120      22.110  13.446 -80.473  1.00  0.37           C  
ATOM   4297  C   PHE B 120      23.515  12.863 -80.574  1.00  0.37           C  
ATOM   4298  O   PHE B 120      24.484  13.582 -80.829  1.00  0.37           O  
ATOM   4299  CB  PHE B 120      21.742  13.745 -78.995  1.00  0.37           C  
ATOM   4300  CG  PHE B 120      20.620  14.748 -78.885  1.00  0.37           C  
ATOM   4301  CD1 PHE B 120      20.877  16.110 -79.113  1.00  0.37           C  
ATOM   4302  CD2 PHE B 120      19.318  14.366 -78.518  1.00  0.37           C  
ATOM   4303  CE1 PHE B 120      19.856  17.064 -79.007  1.00  0.37           C  
ATOM   4304  CE2 PHE B 120      18.292  15.315 -78.414  1.00  0.37           C  
ATOM   4305  CZ  PHE B 120      18.559  16.666 -78.664  1.00  0.37           C  
ATOM   4306  N   ALA B 121      23.654  11.530 -80.430  1.00  0.56           N  
ATOM   4307  CA  ALA B 121      24.908  10.826 -80.557  1.00  0.56           C  
ATOM   4308  C   ALA B 121      25.516  10.942 -81.944  1.00  0.56           C  
ATOM   4309  O   ALA B 121      26.702  11.228 -82.094  1.00  0.56           O  
ATOM   4310  CB  ALA B 121      24.708   9.350 -80.182  1.00  0.56           C  
ATOM   4311  N   ALA B 122      24.706  10.799 -83.005  1.00  0.59           N  
ATOM   4312  CA  ALA B 122      25.120  11.015 -84.374  1.00  0.59           C  
ATOM   4313  C   ALA B 122      25.599  12.430 -84.667  1.00  0.59           C  
ATOM   4314  O   ALA B 122      26.495  12.641 -85.486  1.00  0.59           O  
ATOM   4315  CB  ALA B 122      23.979  10.654 -85.333  1.00  0.59           C  
ATOM   4316  N   GLN B 123      25.012  13.461 -84.030  1.00  0.59           N  
ATOM   4317  CA  GLN B 123      25.547  14.808 -84.105  1.00  0.59           C  
ATOM   4318  C   GLN B 123      26.885  14.976 -83.406  1.00  0.59           C  
ATOM   4319  O   GLN B 123      27.826  15.525 -83.976  1.00  0.59           O  
ATOM   4320  CB  GLN B 123      24.530  15.854 -83.603  1.00  0.59           C  
ATOM   4321  CG  GLN B 123      23.255  15.977 -84.475  1.00  0.59           C  
ATOM   4322  CD  GLN B 123      23.518  16.459 -85.907  1.00  0.59           C  
ATOM   4323  OE1 GLN B 123      24.640  16.658 -86.379  1.00  0.59           O  
ATOM   4324  NE2 GLN B 123      22.407  16.620 -86.658  1.00  0.59           N  
ATOM   4325  N   ARG B 124      27.035  14.448 -82.177  1.00  0.57           N  
ATOM   4326  CA  ARG B 124      28.294  14.474 -81.455  1.00  0.57           C  
ATOM   4327  C   ARG B 124      29.408  13.678 -82.125  1.00  0.57           C  
ATOM   4328  O   ARG B 124      30.556  14.120 -82.184  1.00  0.57           O  
ATOM   4329  CB  ARG B 124      28.107  13.998 -79.999  1.00  0.57           C  
ATOM   4330  CG  ARG B 124      27.233  14.933 -79.141  1.00  0.57           C  
ATOM   4331  CD  ARG B 124      27.260  14.564 -77.655  1.00  0.57           C  
ATOM   4332  NE  ARG B 124      26.363  15.478 -76.896  1.00  0.57           N  
ATOM   4333  CZ  ARG B 124      26.648  16.719 -76.486  1.00  0.57           C  
ATOM   4334  NH1 ARG B 124      27.766  17.355 -76.818  1.00  0.57           N  
ATOM   4335  NH2 ARG B 124      25.769  17.342 -75.713  1.00  0.57           N  
ATOM   4336  N   ASN B 125      29.090  12.494 -82.682  1.00  0.64           N  
ATOM   4337  CA  ASN B 125      30.041  11.631 -83.359  1.00  0.64           C  
ATOM   4338  C   ASN B 125      30.631  12.226 -84.641  1.00  0.64           C  
ATOM   4339  O   ASN B 125      31.761  11.912 -85.006  1.00  0.64           O  
ATOM   4340  CB  ASN B 125      29.439  10.227 -83.627  1.00  0.64           C  
ATOM   4341  CG  ASN B 125      29.338   9.446 -82.317  1.00  0.64           C  
ATOM   4342  OD1 ASN B 125      30.167   9.581 -81.413  1.00  0.64           O  
ATOM   4343  ND2 ASN B 125      28.322   8.559 -82.215  1.00  0.64           N  
ATOM   4344  N   ALA B 126      29.920  13.149 -85.321  1.00  0.69           N  
ATOM   4345  CA  ALA B 126      30.389  13.836 -86.513  1.00  0.69           C  
ATOM   4346  C   ALA B 126      31.646  14.675 -86.300  1.00  0.69           C  
ATOM   4347  O   ALA B 126      32.457  14.897 -87.196  1.00  0.69           O  
ATOM   4348  CB  ALA B 126      29.255  14.741 -87.014  1.00  0.69           C  
ATOM   4349  N   ALA B 127      31.855  15.156 -85.064  1.00  0.67           N  
ATOM   4350  CA  ALA B 127      33.022  15.912 -84.693  1.00  0.67           C  
ATOM   4351  C   ALA B 127      34.325  15.123 -84.740  1.00  0.67           C  
ATOM   4352  O   ALA B 127      35.392  15.689 -84.975  1.00  0.67           O  
ATOM   4353  CB  ALA B 127      32.785  16.481 -83.295  1.00  0.67           C  
ATOM   4354  N   PHE B 128      34.265  13.787 -84.557  1.00  0.51           N  
ATOM   4355  CA  PHE B 128      35.409  12.899 -84.661  1.00  0.51           C  
ATOM   4356  C   PHE B 128      36.005  12.871 -86.063  1.00  0.51           C  
ATOM   4357  O   PHE B 128      37.221  12.831 -86.220  1.00  0.51           O  
ATOM   4358  CB  PHE B 128      35.064  11.459 -84.209  1.00  0.51           C  
ATOM   4359  CG  PHE B 128      34.904  11.366 -82.713  1.00  0.51           C  
ATOM   4360  CD1 PHE B 128      35.974  10.949 -81.901  1.00  0.51           C  
ATOM   4361  CD2 PHE B 128      33.671  11.643 -82.105  1.00  0.51           C  
ATOM   4362  CE1 PHE B 128      35.803  10.779 -80.520  1.00  0.51           C  
ATOM   4363  CE2 PHE B 128      33.490  11.469 -80.728  1.00  0.51           C  
ATOM   4364  CZ  PHE B 128      34.556  11.029 -79.936  1.00  0.51           C  
ATOM   4365  N   GLU B 129      35.168  12.949 -87.119  1.00  0.62           N  
ATOM   4366  CA  GLU B 129      35.590  12.978 -88.510  1.00  0.62           C  
ATOM   4367  C   GLU B 129      36.350  14.246 -88.867  1.00  0.62           C  
ATOM   4368  O   GLU B 129      37.154  14.284 -89.794  1.00  0.62           O  
ATOM   4369  CB  GLU B 129      34.348  12.890 -89.423  1.00  0.62           C  
ATOM   4370  CG  GLU B 129      33.535  11.582 -89.263  1.00  0.62           C  
ATOM   4371  CD  GLU B 129      32.182  11.637 -89.979  1.00  0.62           C  
ATOM   4372  OE1 GLU B 129      31.460  10.610 -89.909  1.00  0.62           O  
ATOM   4373  OE2 GLU B 129      31.840  12.700 -90.561  1.00  0.62           O  
ATOM   4374  N   GLN B 130      36.115  15.327 -88.100  1.00  0.67           N  
ATOM   4375  CA  GLN B 130      36.752  16.606 -88.316  1.00  0.67           C  
ATOM   4376  C   GLN B 130      37.917  16.809 -87.374  1.00  0.67           C  
ATOM   4377  O   GLN B 130      38.634  17.810 -87.424  1.00  0.67           O  
ATOM   4378  CB  GLN B 130      35.739  17.734 -88.018  1.00  0.67           C  
ATOM   4379  CG  GLN B 130      34.414  17.614 -88.804  1.00  0.67           C  
ATOM   4380  CD  GLN B 130      34.657  17.658 -90.311  1.00  0.67           C  
ATOM   4381  OE1 GLN B 130      35.386  18.509 -90.821  1.00  0.67           O  
ATOM   4382  NE2 GLN B 130      34.017  16.729 -91.057  1.00  0.67           N  
ATOM   4383  N   ALA B 131      38.119  15.879 -86.433  1.00  0.64           N  
ATOM   4384  CA  ALA B 131      39.124  15.960 -85.412  1.00  0.64           C  
ATOM   4385  C   ALA B 131      40.553  15.891 -85.932  1.00  0.64           C  
ATOM   4386  O   ALA B 131      40.850  15.278 -86.951  1.00  0.64           O  
ATOM   4387  CB  ALA B 131      38.857  14.888 -84.355  1.00  0.64           C  
ATOM   4388  N   ARG B 132      41.495  16.550 -85.232  1.00  0.56           N  
ATOM   4389  CA  ARG B 132      42.898  16.495 -85.584  1.00  0.56           C  
ATOM   4390  C   ARG B 132      43.560  15.456 -84.682  1.00  0.56           C  
ATOM   4391  O   ARG B 132      43.524  15.661 -83.465  1.00  0.56           O  
ATOM   4392  CB  ARG B 132      43.537  17.898 -85.401  1.00  0.56           C  
ATOM   4393  CG  ARG B 132      44.991  18.059 -85.904  1.00  0.56           C  
ATOM   4394  CD  ARG B 132      45.482  19.518 -85.851  1.00  0.56           C  
ATOM   4395  NE  ARG B 132      46.899  19.549 -86.350  1.00  0.56           N  
ATOM   4396  CZ  ARG B 132      47.643  20.661 -86.458  1.00  0.56           C  
ATOM   4397  NH1 ARG B 132      48.894  20.569 -86.907  1.00  0.56           N  
ATOM   4398  NH2 ARG B 132      47.169  21.862 -86.137  1.00  0.56           N  
ATOM   4399  N   PRO B 133      44.110  14.337 -85.171  1.00  0.46           N  
ATOM   4400  CA  PRO B 133      44.831  13.343 -84.373  1.00  0.46           C  
ATOM   4401  C   PRO B 133      45.828  13.883 -83.362  1.00  0.46           C  
ATOM   4402  O   PRO B 133      46.530  14.849 -83.660  1.00  0.46           O  
ATOM   4403  CB  PRO B 133      45.478  12.423 -85.418  1.00  0.46           C  
ATOM   4404  CG  PRO B 133      44.499  12.456 -86.594  1.00  0.46           C  
ATOM   4405  CD  PRO B 133      43.939  13.879 -86.556  1.00  0.46           C  
ATOM   4406  N   GLY B 134      45.897  13.275 -82.158  1.00  0.36           N  
ATOM   4407  CA  GLY B 134      46.831  13.686 -81.116  1.00  0.36           C  
ATOM   4408  C   GLY B 134      46.357  14.838 -80.271  1.00  0.36           C  
ATOM   4409  O   GLY B 134      47.160  15.528 -79.648  1.00  0.36           O  
ATOM   4410  N   GLY B 135      45.039  15.104 -80.247  1.00  0.69           N  
ATOM   4411  CA  GLY B 135      44.465  16.193 -79.475  1.00  0.69           C  
ATOM   4412  C   GLY B 135      43.267  15.761 -78.685  1.00  0.69           C  
ATOM   4413  O   GLY B 135      42.986  14.578 -78.507  1.00  0.69           O  
ATOM   4414  N   TRP B 136      42.504  16.746 -78.197  1.00  0.61           N  
ATOM   4415  CA  TRP B 136      41.328  16.543 -77.387  1.00  0.61           C  
ATOM   4416  C   TRP B 136      40.110  17.150 -78.045  1.00  0.61           C  
ATOM   4417  O   TRP B 136      40.154  18.216 -78.659  1.00  0.61           O  
ATOM   4418  CB  TRP B 136      41.479  17.182 -75.988  1.00  0.61           C  
ATOM   4419  CG  TRP B 136      42.545  16.542 -75.134  1.00  0.61           C  
ATOM   4420  CD1 TRP B 136      43.874  16.839 -75.039  1.00  0.61           C  
ATOM   4421  CD2 TRP B 136      42.312  15.464 -74.212  1.00  0.61           C  
ATOM   4422  NE1 TRP B 136      44.480  16.037 -74.101  1.00  0.61           N  
ATOM   4423  CE2 TRP B 136      43.531  15.190 -73.580  1.00  0.61           C  
ATOM   4424  CE3 TRP B 136      41.161  14.744 -73.907  1.00  0.61           C  
ATOM   4425  CZ2 TRP B 136      43.627  14.215 -72.595  1.00  0.61           C  
ATOM   4426  CZ3 TRP B 136      41.263  13.726 -72.949  1.00  0.61           C  
ATOM   4427  CH2 TRP B 136      42.475  13.472 -72.297  1.00  0.61           C  
ATOM   4428  N   LEU B 137      38.963  16.468 -77.908  1.00  0.65           N  
ATOM   4429  CA  LEU B 137      37.674  16.983 -78.301  1.00  0.65           C  
ATOM   4430  C   LEU B 137      36.895  17.305 -77.052  1.00  0.65           C  
ATOM   4431  O   LEU B 137      36.551  16.416 -76.276  1.00  0.65           O  
ATOM   4432  CB  LEU B 137      36.853  15.953 -79.111  1.00  0.65           C  
ATOM   4433  CG  LEU B 137      37.491  15.548 -80.449  1.00  0.65           C  
ATOM   4434  CD1 LEU B 137      36.634  14.480 -81.138  1.00  0.65           C  
ATOM   4435  CD2 LEU B 137      37.693  16.763 -81.363  1.00  0.65           C  
ATOM   4436  N   ALA B 138      36.600  18.595 -76.824  1.00  0.69           N  
ATOM   4437  CA  ALA B 138      35.825  19.033 -75.691  1.00  0.69           C  
ATOM   4438  C   ALA B 138      34.417  19.386 -76.127  1.00  0.69           C  
ATOM   4439  O   ALA B 138      34.182  20.388 -76.797  1.00  0.69           O  
ATOM   4440  CB  ALA B 138      36.503  20.239 -75.008  1.00  0.69           C  
ATOM   4441  N   HIS B 139      33.431  18.547 -75.757  1.00  0.68           N  
ATOM   4442  CA  HIS B 139      32.043  18.755 -76.126  1.00  0.68           C  
ATOM   4443  C   HIS B 139      31.367  19.725 -75.174  1.00  0.68           C  
ATOM   4444  O   HIS B 139      31.277  19.483 -73.972  1.00  0.68           O  
ATOM   4445  CB  HIS B 139      31.256  17.425 -76.154  1.00  0.68           C  
ATOM   4446  CG  HIS B 139      31.611  16.561 -77.325  1.00  0.68           C  
ATOM   4447  ND1 HIS B 139      30.700  16.423 -78.360  1.00  0.68           N  
ATOM   4448  CD2 HIS B 139      32.766  15.905 -77.618  1.00  0.68           C  
ATOM   4449  CE1 HIS B 139      31.329  15.693 -79.266  1.00  0.68           C  
ATOM   4450  NE2 HIS B 139      32.579  15.354 -78.867  1.00  0.68           N  
ATOM   4451  N   VAL B 140      30.884  20.858 -75.709  1.00  0.69           N  
ATOM   4452  CA  VAL B 140      30.290  21.935 -74.937  1.00  0.69           C  
ATOM   4453  C   VAL B 140      28.921  22.212 -75.529  1.00  0.69           C  
ATOM   4454  O   VAL B 140      28.760  22.249 -76.750  1.00  0.69           O  
ATOM   4455  CB  VAL B 140      31.161  23.195 -74.969  1.00  0.69           C  
ATOM   4456  CG1 VAL B 140      30.568  24.308 -74.085  1.00  0.69           C  
ATOM   4457  CG2 VAL B 140      32.586  22.854 -74.482  1.00  0.69           C  
ATOM   4458  N   ASP B 141      27.877  22.367 -74.692  1.00  0.70           N  
ATOM   4459  CA  ASP B 141      26.541  22.655 -75.179  1.00  0.70           C  
ATOM   4460  C   ASP B 141      26.428  24.176 -75.421  1.00  0.70           C  
ATOM   4461  O   ASP B 141      27.194  24.967 -74.875  1.00  0.70           O  
ATOM   4462  CB  ASP B 141      25.463  22.031 -74.240  1.00  0.70           C  
ATOM   4463  CG  ASP B 141      25.534  20.507 -74.161  1.00  0.70           C  
ATOM   4464  OD1 ASP B 141      26.084  19.868 -75.103  1.00  0.70           O  
ATOM   4465  OD2 ASP B 141      25.005  19.923 -73.173  1.00  0.70           O  
ATOM   4466  N   ALA B 142      25.541  24.663 -76.321  1.00  0.73           N  
ATOM   4467  CA  ALA B 142      25.620  26.037 -76.818  1.00  0.73           C  
ATOM   4468  C   ALA B 142      25.225  27.108 -75.812  1.00  0.73           C  
ATOM   4469  O   ALA B 142      25.628  28.268 -75.927  1.00  0.73           O  
ATOM   4470  CB  ALA B 142      24.775  26.203 -78.093  1.00  0.73           C  
ATOM   4471  N   ASP B 143      24.478  26.720 -74.773  1.00  0.63           N  
ATOM   4472  CA  ASP B 143      24.036  27.556 -73.697  1.00  0.63           C  
ATOM   4473  C   ASP B 143      24.954  27.450 -72.476  1.00  0.63           C  
ATOM   4474  O   ASP B 143      24.701  28.049 -71.426  1.00  0.63           O  
ATOM   4475  CB  ASP B 143      22.555  27.203 -73.386  1.00  0.63           C  
ATOM   4476  CG  ASP B 143      22.233  25.734 -73.118  1.00  0.63           C  
ATOM   4477  OD1 ASP B 143      22.970  24.816 -73.567  1.00  0.63           O  
ATOM   4478  OD2 ASP B 143      21.191  25.521 -72.437  1.00  0.63           O  
ATOM   4479  N   GLU B 144      26.091  26.739 -72.613  1.00  0.63           N  
ATOM   4480  CA  GLU B 144      27.124  26.654 -71.605  1.00  0.63           C  
ATOM   4481  C   GLU B 144      28.269  27.627 -71.830  1.00  0.63           C  
ATOM   4482  O   GLU B 144      28.845  27.736 -72.909  1.00  0.63           O  
ATOM   4483  CB  GLU B 144      27.734  25.244 -71.544  1.00  0.63           C  
ATOM   4484  CG  GLU B 144      26.722  24.206 -71.036  1.00  0.63           C  
ATOM   4485  CD  GLU B 144      27.253  22.794 -71.099  1.00  0.63           C  
ATOM   4486  OE1 GLU B 144      26.590  21.917 -70.488  1.00  0.63           O  
ATOM   4487  OE2 GLU B 144      28.292  22.520 -71.762  1.00  0.63           O  
ATOM   4488  N   THR B 145      28.670  28.346 -70.767  1.00  0.64           N  
ATOM   4489  CA  THR B 145      29.771  29.307 -70.818  1.00  0.64           C  
ATOM   4490  C   THR B 145      30.834  28.900 -69.814  1.00  0.64           C  
ATOM   4491  O   THR B 145      30.533  28.698 -68.639  1.00  0.64           O  
ATOM   4492  CB  THR B 145      29.326  30.728 -70.477  1.00  0.64           C  
ATOM   4493  OG1 THR B 145      28.300  31.154 -71.362  1.00  0.64           O  
ATOM   4494  CG2 THR B 145      30.456  31.748 -70.646  1.00  0.64           C  
ATOM   4495  N   LEU B 146      32.121  28.755 -70.223  1.00  0.63           N  
ATOM   4496  CA  LEU B 146      33.229  28.491 -69.303  1.00  0.63           C  
ATOM   4497  C   LEU B 146      33.386  29.602 -68.267  1.00  0.63           C  
ATOM   4498  O   LEU B 146      33.334  30.787 -68.597  1.00  0.63           O  
ATOM   4499  CB  LEU B 146      34.565  28.301 -70.076  1.00  0.63           C  
ATOM   4500  CG  LEU B 146      35.792  27.888 -69.230  1.00  0.63           C  
ATOM   4501  CD1 LEU B 146      35.647  26.473 -68.663  1.00  0.63           C  
ATOM   4502  CD2 LEU B 146      37.093  27.971 -70.043  1.00  0.63           C  
ATOM   4503  N   SER B 147      33.534  29.261 -66.968  1.00  0.63           N  
ATOM   4504  CA  SER B 147      33.664  30.268 -65.925  1.00  0.63           C  
ATOM   4505  C   SER B 147      34.933  31.091 -66.000  1.00  0.63           C  
ATOM   4506  O   SER B 147      35.970  30.631 -66.473  1.00  0.63           O  
ATOM   4507  CB  SER B 147      33.431  29.757 -64.476  1.00  0.63           C  
ATOM   4508  OG  SER B 147      34.535  29.064 -63.887  1.00  0.63           O  
ATOM   4509  N   ALA B 148      34.891  32.356 -65.528  1.00  0.55           N  
ATOM   4510  CA  ALA B 148      36.031  33.252 -65.548  1.00  0.55           C  
ATOM   4511  C   ALA B 148      37.195  32.727 -64.715  1.00  0.55           C  
ATOM   4512  O   ALA B 148      38.355  32.797 -65.113  1.00  0.55           O  
ATOM   4513  CB  ALA B 148      35.598  34.660 -65.094  1.00  0.55           C  
ATOM   4514  N   GLU B 149      36.874  32.102 -63.570  1.00  0.34           N  
ATOM   4515  CA  GLU B 149      37.763  31.393 -62.683  1.00  0.34           C  
ATOM   4516  C   GLU B 149      38.382  30.160 -63.337  1.00  0.34           C  
ATOM   4517  O   GLU B 149      39.463  29.712 -62.960  1.00  0.34           O  
ATOM   4518  CB  GLU B 149      36.992  30.957 -61.402  1.00  0.34           C  
ATOM   4519  CG  GLU B 149      36.185  32.081 -60.683  1.00  0.34           C  
ATOM   4520  CD  GLU B 149      34.834  32.430 -61.316  1.00  0.34           C  
ATOM   4521  OE1 GLU B 149      34.145  33.326 -60.777  1.00  0.34           O  
ATOM   4522  OE2 GLU B 149      34.482  31.811 -62.356  1.00  0.34           O  
ATOM   4523  N   SER B 150      37.715  29.580 -64.356  1.00  0.60           N  
ATOM   4524  CA  SER B 150      38.186  28.375 -65.023  1.00  0.60           C  
ATOM   4525  C   SER B 150      38.980  28.653 -66.282  1.00  0.60           C  
ATOM   4526  O   SER B 150      39.441  27.732 -66.952  1.00  0.60           O  
ATOM   4527  CB  SER B 150      37.040  27.412 -65.404  1.00  0.60           C  
ATOM   4528  OG  SER B 150      36.274  27.028 -64.264  1.00  0.60           O  
ATOM   4529  N   ARG B 151      39.210  29.933 -66.613  1.00  0.33           N  
ATOM   4530  CA  ARG B 151      40.013  30.344 -67.748  1.00  0.33           C  
ATOM   4531  C   ARG B 151      41.450  29.821 -67.694  1.00  0.33           C  
ATOM   4532  O   ARG B 151      42.204  30.093 -66.761  1.00  0.33           O  
ATOM   4533  CB  ARG B 151      40.032  31.887 -67.815  1.00  0.33           C  
ATOM   4534  CG  ARG B 151      40.764  32.455 -69.044  1.00  0.33           C  
ATOM   4535  CD  ARG B 151      40.899  33.979 -69.041  1.00  0.33           C  
ATOM   4536  NE  ARG B 151      39.520  34.528 -69.190  1.00  0.33           N  
ATOM   4537  CZ  ARG B 151      39.240  35.833 -69.246  1.00  0.33           C  
ATOM   4538  NH1 ARG B 151      40.188  36.754 -69.105  1.00  0.33           N  
ATOM   4539  NH2 ARG B 151      37.980  36.218 -69.436  1.00  0.33           N  
ATOM   4540  N   GLY B 152      41.854  29.017 -68.693  1.00  0.59           N  
ATOM   4541  CA  GLY B 152      43.175  28.419 -68.831  1.00  0.59           C  
ATOM   4542  C   GLY B 152      43.344  27.147 -68.048  1.00  0.59           C  
ATOM   4543  O   GLY B 152      44.332  26.428 -68.204  1.00  0.59           O  
ATOM   4544  N   ARG B 153      42.358  26.806 -67.196  1.00  0.50           N  
ATOM   4545  CA  ARG B 153      42.366  25.595 -66.407  1.00  0.50           C  
ATOM   4546  C   ARG B 153      42.090  24.369 -67.244  1.00  0.50           C  
ATOM   4547  O   ARG B 153      42.646  23.302 -66.989  1.00  0.50           O  
ATOM   4548  CB  ARG B 153      41.337  25.611 -65.252  1.00  0.50           C  
ATOM   4549  CG  ARG B 153      41.643  26.611 -64.123  1.00  0.50           C  
ATOM   4550  CD  ARG B 153      40.711  26.394 -62.924  1.00  0.50           C  
ATOM   4551  NE  ARG B 153      41.099  27.352 -61.853  1.00  0.50           N  
ATOM   4552  CZ  ARG B 153      40.487  27.397 -60.661  1.00  0.50           C  
ATOM   4553  NH1 ARG B 153      39.522  26.540 -60.343  1.00  0.50           N  
ATOM   4554  NH2 ARG B 153      40.868  28.317 -59.777  1.00  0.50           N  
ATOM   4555  N   LEU B 154      41.205  24.484 -68.259  1.00  0.58           N  
ATOM   4556  CA  LEU B 154      40.855  23.365 -69.109  1.00  0.58           C  
ATOM   4557  C   LEU B 154      42.051  22.911 -69.913  1.00  0.58           C  
ATOM   4558  O   LEU B 154      42.386  21.730 -69.934  1.00  0.58           O  
ATOM   4559  CB  LEU B 154      39.660  23.703 -70.034  1.00  0.58           C  
ATOM   4560  CG  LEU B 154      39.291  22.612 -71.057  1.00  0.58           C  
ATOM   4561  CD1 LEU B 154      38.858  21.319 -70.363  1.00  0.58           C  
ATOM   4562  CD2 LEU B 154      38.203  23.100 -72.027  1.00  0.58           C  
ATOM   4563  N   ARG B 155      42.785  23.859 -70.520  1.00  0.55           N  
ATOM   4564  CA  ARG B 155      44.018  23.563 -71.211  1.00  0.55           C  
ATOM   4565  C   ARG B 155      45.084  22.984 -70.298  1.00  0.55           C  
ATOM   4566  O   ARG B 155      45.704  21.972 -70.618  1.00  0.55           O  
ATOM   4567  CB  ARG B 155      44.546  24.834 -71.912  1.00  0.55           C  
ATOM   4568  CG  ARG B 155      45.905  24.641 -72.619  1.00  0.55           C  
ATOM   4569  CD  ARG B 155      46.332  25.824 -73.490  1.00  0.55           C  
ATOM   4570  NE  ARG B 155      45.339  25.927 -74.591  1.00  0.55           N  
ATOM   4571  CZ  ARG B 155      45.442  25.380 -75.807  1.00  0.55           C  
ATOM   4572  NH1 ARG B 155      46.475  24.660 -76.223  1.00  0.55           N  
ATOM   4573  NH2 ARG B 155      44.436  25.541 -76.649  1.00  0.55           N  
ATOM   4574  N   ALA B 156      45.287  23.580 -69.107  1.00  0.57           N  
ATOM   4575  CA  ALA B 156      46.283  23.133 -68.160  1.00  0.57           C  
ATOM   4576  C   ALA B 156      46.088  21.702 -67.670  1.00  0.57           C  
ATOM   4577  O   ALA B 156      47.015  20.890 -67.686  1.00  0.57           O  
ATOM   4578  CB  ALA B 156      46.266  24.108 -66.972  1.00  0.57           C  
ATOM   4579  N   VAL B 157      44.851  21.327 -67.281  1.00  0.56           N  
ATOM   4580  CA  VAL B 157      44.567  19.975 -66.835  1.00  0.56           C  
ATOM   4581  C   VAL B 157      44.712  18.924 -67.927  1.00  0.56           C  
ATOM   4582  O   VAL B 157      45.279  17.859 -67.692  1.00  0.56           O  
ATOM   4583  CB  VAL B 157      43.248  19.869 -66.079  1.00  0.56           C  
ATOM   4584  CG1 VAL B 157      42.027  19.953 -67.011  1.00  0.56           C  
ATOM   4585  CG2 VAL B 157      43.232  18.581 -65.233  1.00  0.56           C  
ATOM   4586  N   LEU B 158      44.260  19.194 -69.173  1.00  0.54           N  
ATOM   4587  CA  LEU B 158      44.430  18.266 -70.281  1.00  0.54           C  
ATOM   4588  C   LEU B 158      45.897  18.024 -70.633  1.00  0.54           C  
ATOM   4589  O   LEU B 158      46.331  16.880 -70.755  1.00  0.54           O  
ATOM   4590  CB  LEU B 158      43.634  18.733 -71.522  1.00  0.54           C  
ATOM   4591  CG  LEU B 158      42.102  18.815 -71.323  1.00  0.54           C  
ATOM   4592  CD1 LEU B 158      41.434  19.384 -72.585  1.00  0.54           C  
ATOM   4593  CD2 LEU B 158      41.469  17.467 -70.951  1.00  0.54           C  
ATOM   4594  N   THR B 159      46.724  19.092 -70.695  1.00  0.55           N  
ATOM   4595  CA  THR B 159      48.175  19.007 -70.892  1.00  0.55           C  
ATOM   4596  C   THR B 159      48.867  18.211 -69.804  1.00  0.55           C  
ATOM   4597  O   THR B 159      49.748  17.388 -70.054  1.00  0.55           O  
ATOM   4598  CB  THR B 159      48.831  20.380 -70.924  1.00  0.55           C  
ATOM   4599  OG1 THR B 159      48.208  21.201 -71.893  1.00  0.55           O  
ATOM   4600  CG2 THR B 159      50.309  20.316 -71.329  1.00  0.55           C  
ATOM   4601  N   ALA B 160      48.468  18.413 -68.531  1.00  0.53           N  
ATOM   4602  CA  ALA B 160      48.961  17.622 -67.426  1.00  0.53           C  
ATOM   4603  C   ALA B 160      48.593  16.143 -67.526  1.00  0.53           C  
ATOM   4604  O   ALA B 160      49.447  15.281 -67.332  1.00  0.53           O  
ATOM   4605  CB  ALA B 160      48.486  18.232 -66.096  1.00  0.53           C  
ATOM   4606  N   LEU B 161      47.336  15.814 -67.894  1.00  0.83           N  
ATOM   4607  CA  LEU B 161      46.883  14.455 -68.141  1.00  0.83           C  
ATOM   4608  C   LEU B 161      47.612  13.761 -69.288  1.00  0.83           C  
ATOM   4609  O   LEU B 161      47.970  12.592 -69.168  1.00  0.83           O  
ATOM   4610  CB  LEU B 161      45.350  14.391 -68.361  1.00  0.83           C  
ATOM   4611  CG  LEU B 161      44.492  14.728 -67.118  1.00  0.83           C  
ATOM   4612  CD1 LEU B 161      43.007  14.827 -67.503  1.00  0.83           C  
ATOM   4613  CD2 LEU B 161      44.665  13.714 -65.974  1.00  0.83           C  
ATOM   4614  N   ASP B 162      47.897  14.457 -70.407  1.00  0.83           N  
ATOM   4615  CA  ASP B 162      48.706  13.944 -71.501  1.00  0.83           C  
ATOM   4616  C   ASP B 162      50.109  13.573 -71.084  1.00  0.83           C  
ATOM   4617  O   ASP B 162      50.626  12.518 -71.443  1.00  0.83           O  
ATOM   4618  CB  ASP B 162      48.780  15.004 -72.626  1.00  0.83           C  
ATOM   4619  CG  ASP B 162      47.495  15.021 -73.405  1.00  0.83           C  
ATOM   4620  OD1 ASP B 162      46.720  14.041 -73.286  1.00  0.83           O  
ATOM   4621  OD2 ASP B 162      47.264  15.984 -74.175  1.00  0.83           O  
ATOM   4622  N   HIS B 163      50.740  14.430 -70.274  1.00  0.80           N  
ATOM   4623  CA  HIS B 163      52.049  14.171 -69.721  1.00  0.80           C  
ATOM   4624  C   HIS B 163      52.121  12.981 -68.769  1.00  0.80           C  
ATOM   4625  O   HIS B 163      53.009  12.137 -68.874  1.00  0.80           O  
ATOM   4626  CB  HIS B 163      52.513  15.445 -68.996  1.00  0.80           C  
ATOM   4627  CG  HIS B 163      53.918  15.397 -68.512  1.00  0.80           C  
ATOM   4628  ND1 HIS B 163      54.936  15.356 -69.438  1.00  0.80           N  
ATOM   4629  CD2 HIS B 163      54.419  15.431 -67.251  1.00  0.80           C  
ATOM   4630  CE1 HIS B 163      56.043  15.357 -68.727  1.00  0.80           C  
ATOM   4631  NE2 HIS B 163      55.786  15.407 -67.399  1.00  0.80           N  
ATOM   4632  N   VAL B 164      51.176  12.854 -67.812  1.00  0.85           N  
ATOM   4633  CA  VAL B 164      51.257  11.792 -66.818  1.00  0.85           C  
ATOM   4634  C   VAL B 164      50.597  10.489 -67.246  1.00  0.85           C  
ATOM   4635  O   VAL B 164      50.979   9.420 -66.779  1.00  0.85           O  
ATOM   4636  CB  VAL B 164      50.730  12.224 -65.453  1.00  0.85           C  
ATOM   4637  CG1 VAL B 164      51.541  13.442 -64.964  1.00  0.85           C  
ATOM   4638  CG2 VAL B 164      49.228  12.550 -65.504  1.00  0.85           C  
ATOM   4639  N   LEU B 165      49.635  10.524 -68.189  1.00  0.79           N  
ATOM   4640  CA  LEU B 165      48.943   9.337 -68.666  1.00  0.79           C  
ATOM   4641  C   LEU B 165      48.916   9.295 -70.202  1.00  0.79           C  
ATOM   4642  O   LEU B 165      47.831   9.269 -70.804  1.00  0.79           O  
ATOM   4643  CB  LEU B 165      47.486   9.293 -68.130  1.00  0.79           C  
ATOM   4644  CG  LEU B 165      47.341   9.067 -66.611  1.00  0.79           C  
ATOM   4645  CD1 LEU B 165      45.892   9.327 -66.176  1.00  0.79           C  
ATOM   4646  CD2 LEU B 165      47.772   7.658 -66.178  1.00  0.79           C  
ATOM   4647  N   PRO B 166      50.061   9.317 -70.897  1.00  0.84           N  
ATOM   4648  CA  PRO B 166      50.106   9.312 -72.356  1.00  0.84           C  
ATOM   4649  C   PRO B 166      49.422   8.102 -72.975  1.00  0.84           C  
ATOM   4650  O   PRO B 166      49.762   6.967 -72.656  1.00  0.84           O  
ATOM   4651  CB  PRO B 166      51.608   9.374 -72.673  1.00  0.84           C  
ATOM   4652  CG  PRO B 166      52.258   8.622 -71.511  1.00  0.84           C  
ATOM   4653  CD  PRO B 166      51.385   9.031 -70.323  1.00  0.84           C  
ATOM   4654  N   GLY B 167      48.431   8.306 -73.866  1.00  0.85           N  
ATOM   4655  CA  GLY B 167      47.762   7.195 -74.540  1.00  0.85           C  
ATOM   4656  C   GLY B 167      46.731   6.453 -73.731  1.00  0.85           C  
ATOM   4657  O   GLY B 167      46.118   5.514 -74.227  1.00  0.85           O  
ATOM   4658  N   ALA B 168      46.468   6.845 -72.469  1.00  0.85           N  
ATOM   4659  CA  ALA B 168      45.349   6.291 -71.734  1.00  0.85           C  
ATOM   4660  C   ALA B 168      44.012   6.714 -72.349  1.00  0.85           C  
ATOM   4661  O   ALA B 168      43.807   7.904 -72.615  1.00  0.85           O  
ATOM   4662  CB  ALA B 168      45.422   6.691 -70.246  1.00  0.85           C  
ATOM   4663  N   ASP B 169      43.082   5.755 -72.592  1.00  0.75           N  
ATOM   4664  CA  ASP B 169      41.746   6.054 -73.075  1.00  0.75           C  
ATOM   4665  C   ASP B 169      40.902   6.404 -71.859  1.00  0.75           C  
ATOM   4666  O   ASP B 169      40.582   5.569 -71.011  1.00  0.75           O  
ATOM   4667  CB  ASP B 169      41.157   4.875 -73.915  1.00  0.75           C  
ATOM   4668  CG  ASP B 169      40.118   5.295 -74.944  1.00  0.75           C  
ATOM   4669  OD1 ASP B 169      39.940   6.527 -75.103  1.00  0.75           O  
ATOM   4670  OD2 ASP B 169      39.552   4.411 -75.632  1.00  0.75           O  
ATOM   4671  N   LEU B 170      40.605   7.703 -71.712  1.00  0.80           N  
ATOM   4672  CA  LEU B 170      39.951   8.241 -70.552  1.00  0.80           C  
ATOM   4673  C   LEU B 170      39.054   9.346 -71.013  1.00  0.80           C  
ATOM   4674  O   LEU B 170      39.254   9.938 -72.076  1.00  0.80           O  
ATOM   4675  CB  LEU B 170      40.941   8.750 -69.458  1.00  0.80           C  
ATOM   4676  CG  LEU B 170      41.810   9.987 -69.797  1.00  0.80           C  
ATOM   4677  CD1 LEU B 170      41.099  11.310 -69.477  1.00  0.80           C  
ATOM   4678  CD2 LEU B 170      43.136   9.963 -69.020  1.00  0.80           C  
ATOM   4679  N   VAL B 171      38.037   9.662 -70.201  1.00  0.83           N  
ATOM   4680  CA  VAL B 171      37.176  10.794 -70.456  1.00  0.83           C  
ATOM   4681  C   VAL B 171      37.327  11.779 -69.326  1.00  0.83           C  
ATOM   4682  O   VAL B 171      37.487  11.423 -68.159  1.00  0.83           O  
ATOM   4683  CB  VAL B 171      35.712  10.433 -70.665  1.00  0.83           C  
ATOM   4684  CG1 VAL B 171      35.599   9.649 -71.982  1.00  0.83           C  
ATOM   4685  CG2 VAL B 171      35.158   9.621 -69.480  1.00  0.83           C  
ATOM   4686  N   VAL B 172      37.313  13.077 -69.654  1.00  0.84           N  
ATOM   4687  CA  VAL B 172      37.443  14.125 -68.667  1.00  0.84           C  
ATOM   4688  C   VAL B 172      36.084  14.744 -68.452  1.00  0.84           C  
ATOM   4689  O   VAL B 172      35.353  15.070 -69.392  1.00  0.84           O  
ATOM   4690  CB  VAL B 172      38.491  15.175 -69.009  1.00  0.84           C  
ATOM   4691  CG1 VAL B 172      38.606  16.221 -67.888  1.00  0.84           C  
ATOM   4692  CG2 VAL B 172      39.847  14.484 -69.205  1.00  0.84           C  
ATOM   4693  N   SER B 173      35.704  14.896 -67.173  1.00  0.81           N  
ATOM   4694  CA  SER B 173      34.430  15.450 -66.774  1.00  0.81           C  
ATOM   4695  C   SER B 173      34.625  16.804 -66.117  1.00  0.81           C  
ATOM   4696  O   SER B 173      35.020  16.872 -64.950  1.00  0.81           O  
ATOM   4697  CB  SER B 173      33.712  14.557 -65.732  1.00  0.81           C  
ATOM   4698  OG  SER B 173      33.342  13.292 -66.286  1.00  0.81           O  
ATOM   4699  N   PRO B 174      34.356  17.923 -66.784  1.00  0.83           N  
ATOM   4700  CA  PRO B 174      34.152  19.201 -66.125  1.00  0.83           C  
ATOM   4701  C   PRO B 174      32.871  19.263 -65.337  1.00  0.83           C  
ATOM   4702  O   PRO B 174      31.964  18.457 -65.553  1.00  0.83           O  
ATOM   4703  CB  PRO B 174      34.090  20.234 -67.261  1.00  0.83           C  
ATOM   4704  CG  PRO B 174      34.727  19.534 -68.455  1.00  0.83           C  
ATOM   4705  CD  PRO B 174      34.377  18.064 -68.236  1.00  0.83           C  
ATOM   4706  N   ARG B 175      32.785  20.262 -64.453  1.00  0.68           N  
ATOM   4707  CA  ARG B 175      31.630  20.561 -63.652  1.00  0.68           C  
ATOM   4708  C   ARG B 175      30.703  21.503 -64.398  1.00  0.68           C  
ATOM   4709  O   ARG B 175      31.133  22.497 -64.980  1.00  0.68           O  
ATOM   4710  CB  ARG B 175      32.070  21.247 -62.335  1.00  0.68           C  
ATOM   4711  CG  ARG B 175      32.989  20.363 -61.466  1.00  0.68           C  
ATOM   4712  CD  ARG B 175      33.624  21.062 -60.256  1.00  0.68           C  
ATOM   4713  NE  ARG B 175      32.515  21.517 -59.365  1.00  0.68           N  
ATOM   4714  CZ  ARG B 175      32.656  22.467 -58.432  1.00  0.68           C  
ATOM   4715  NH1 ARG B 175      33.813  23.085 -58.205  1.00  0.68           N  
ATOM   4716  NH2 ARG B 175      31.591  22.804 -57.701  1.00  0.68           N  
ATOM   4717  N   ILE B 176      29.391  21.224 -64.381  1.00  0.74           N  
ATOM   4718  CA  ILE B 176      28.401  22.102 -64.981  1.00  0.74           C  
ATOM   4719  C   ILE B 176      27.505  22.603 -63.875  1.00  0.74           C  
ATOM   4720  O   ILE B 176      26.829  21.826 -63.201  1.00  0.74           O  
ATOM   4721  CB  ILE B 176      27.568  21.422 -66.061  1.00  0.74           C  
ATOM   4722  CG1 ILE B 176      28.482  20.920 -67.198  1.00  0.74           C  
ATOM   4723  CG2 ILE B 176      26.498  22.387 -66.619  1.00  0.74           C  
ATOM   4724  CD1 ILE B 176      27.777  19.947 -68.144  1.00  0.74           C  
ATOM   4725  N   LEU B 177      27.498  23.929 -63.656  1.00  0.66           N  
ATOM   4726  CA  LEU B 177      26.633  24.590 -62.703  1.00  0.66           C  
ATOM   4727  C   LEU B 177      25.430  25.124 -63.441  1.00  0.66           C  
ATOM   4728  O   LEU B 177      25.573  25.849 -64.423  1.00  0.66           O  
ATOM   4729  CB  LEU B 177      27.331  25.792 -62.015  1.00  0.66           C  
ATOM   4730  CG  LEU B 177      28.341  25.409 -60.918  1.00  0.66           C  
ATOM   4731  CD1 LEU B 177      29.194  26.622 -60.521  1.00  0.66           C  
ATOM   4732  CD2 LEU B 177      27.626  24.847 -59.680  1.00  0.66           C  
ATOM   4733  N   ASP B 178      24.208  24.772 -63.010  1.00  0.59           N  
ATOM   4734  CA  ASP B 178      23.001  25.296 -63.609  1.00  0.59           C  
ATOM   4735  C   ASP B 178      22.478  26.527 -62.895  1.00  0.59           C  
ATOM   4736  O   ASP B 178      23.060  27.044 -61.941  1.00  0.59           O  
ATOM   4737  CB  ASP B 178      21.921  24.193 -63.809  1.00  0.59           C  
ATOM   4738  CG  ASP B 178      21.155  23.758 -62.558  1.00  0.59           C  
ATOM   4739  OD1 ASP B 178      21.318  24.361 -61.466  1.00  0.59           O  
ATOM   4740  OD2 ASP B 178      20.331  22.834 -62.690  1.00  0.59           O  
ATOM   4741  N   THR B 179      21.312  27.016 -63.340  1.00  0.53           N  
ATOM   4742  CA  THR B 179      20.646  28.165 -62.762  1.00  0.53           C  
ATOM   4743  C   THR B 179      19.990  27.894 -61.422  1.00  0.53           C  
ATOM   4744  O   THR B 179      19.629  28.835 -60.716  1.00  0.53           O  
ATOM   4745  CB  THR B 179      19.594  28.754 -63.688  1.00  0.53           C  
ATOM   4746  OG1 THR B 179      18.666  27.768 -64.119  1.00  0.53           O  
ATOM   4747  CG2 THR B 179      20.278  29.293 -64.948  1.00  0.53           C  
ATOM   4748  N   SER B 180      19.838  26.620 -61.001  1.00  0.50           N  
ATOM   4749  CA  SER B 180      19.275  26.292 -59.704  1.00  0.50           C  
ATOM   4750  C   SER B 180      20.374  26.161 -58.667  1.00  0.50           C  
ATOM   4751  O   SER B 180      20.152  26.135 -57.453  1.00  0.50           O  
ATOM   4752  CB  SER B 180      18.354  25.027 -59.775  1.00  0.50           C  
ATOM   4753  OG  SER B 180      19.011  23.817 -59.743  1.00  0.50           O  
ATOM   4754  N   ARG B 181      21.623  26.162 -59.167  1.00  0.45           N  
ATOM   4755  CA  ARG B 181      22.884  26.059 -58.479  1.00  0.45           C  
ATOM   4756  C   ARG B 181      23.181  24.593 -58.254  1.00  0.45           C  
ATOM   4757  O   ARG B 181      23.937  24.243 -57.347  1.00  0.45           O  
ATOM   4758  CB  ARG B 181      23.045  26.878 -57.156  1.00  0.45           C  
ATOM   4759  CG  ARG B 181      22.906  28.411 -57.258  1.00  0.45           C  
ATOM   4760  CD  ARG B 181      23.031  29.074 -55.876  1.00  0.45           C  
ATOM   4761  NE  ARG B 181      22.990  30.562 -56.045  1.00  0.45           N  
ATOM   4762  CZ  ARG B 181      23.282  31.438 -55.072  1.00  0.45           C  
ATOM   4763  NH1 ARG B 181      23.613  31.040 -53.846  1.00  0.45           N  
ATOM   4764  NH2 ARG B 181      23.246  32.744 -55.327  1.00  0.45           N  
ATOM   4765  N   GLU B 182      22.581  23.679 -59.042  1.00  0.50           N  
ATOM   4766  CA  GLU B 182      22.922  22.273 -59.004  1.00  0.50           C  
ATOM   4767  C   GLU B 182      24.210  22.064 -59.778  1.00  0.50           C  
ATOM   4768  O   GLU B 182      24.525  22.813 -60.703  1.00  0.50           O  
ATOM   4769  CB  GLU B 182      21.768  21.361 -59.485  1.00  0.50           C  
ATOM   4770  CG  GLU B 182      21.972  19.849 -59.172  1.00  0.50           C  
ATOM   4771  CD  GLU B 182      20.684  19.009 -59.227  1.00  0.50           C  
ATOM   4772  OE1 GLU B 182      20.655  17.934 -58.546  1.00  0.50           O  
ATOM   4773  OE2 GLU B 182      19.710  19.452 -59.877  1.00  0.50           O  
ATOM   4774  N   CYS B 183      25.042  21.089 -59.361  1.00  0.63           N  
ATOM   4775  CA  CYS B 183      26.354  20.899 -59.944  1.00  0.63           C  
ATOM   4776  C   CYS B 183      26.499  19.493 -60.473  1.00  0.63           C  
ATOM   4777  O   CYS B 183      26.593  18.524 -59.723  1.00  0.63           O  
ATOM   4778  CB  CYS B 183      27.493  21.203 -58.938  1.00  0.63           C  
ATOM   4779  SG  CYS B 183      29.154  21.272 -59.700  1.00  0.63           S  
ATOM   4780  N   HIS B 184      26.572  19.365 -61.804  1.00  0.59           N  
ATOM   4781  CA  HIS B 184      26.721  18.092 -62.473  1.00  0.59           C  
ATOM   4782  C   HIS B 184      28.193  17.783 -62.663  1.00  0.59           C  
ATOM   4783  O   HIS B 184      28.900  18.521 -63.348  1.00  0.59           O  
ATOM   4784  CB  HIS B 184      26.026  18.116 -63.850  1.00  0.59           C  
ATOM   4785  CG  HIS B 184      24.582  18.486 -63.718  1.00  0.59           C  
ATOM   4786  ND1 HIS B 184      23.679  17.507 -63.362  1.00  0.59           N  
ATOM   4787  CD2 HIS B 184      23.985  19.709 -63.716  1.00  0.59           C  
ATOM   4788  CE1 HIS B 184      22.547  18.153 -63.140  1.00  0.59           C  
ATOM   4789  NE2 HIS B 184      22.677  19.488 -63.341  1.00  0.59           N  
ATOM   4790  N   THR B 185      28.704  16.698 -62.041  1.00  0.70           N  
ATOM   4791  CA  THR B 185      30.134  16.404 -62.017  1.00  0.70           C  
ATOM   4792  C   THR B 185      30.570  15.259 -62.918  1.00  0.70           C  
ATOM   4793  O   THR B 185      31.686  15.281 -63.422  1.00  0.70           O  
ATOM   4794  CB  THR B 185      30.629  16.092 -60.609  1.00  0.70           C  
ATOM   4795  OG1 THR B 185      29.866  15.068 -59.985  1.00  0.70           O  
ATOM   4796  CG2 THR B 185      30.483  17.364 -59.754  1.00  0.70           C  
ATOM   4797  N   ASP B 186      29.705  14.269 -63.235  1.00  0.67           N  
ATOM   4798  CA  ASP B 186      30.038  13.152 -64.117  1.00  0.67           C  
ATOM   4799  C   ASP B 186      29.526  13.427 -65.531  1.00  0.67           C  
ATOM   4800  O   ASP B 186      28.634  12.768 -66.067  1.00  0.67           O  
ATOM   4801  CB  ASP B 186      29.505  11.800 -63.559  1.00  0.67           C  
ATOM   4802  CG  ASP B 186      30.028  10.601 -64.342  1.00  0.67           C  
ATOM   4803  OD1 ASP B 186      31.198  10.632 -64.809  1.00  0.67           O  
ATOM   4804  OD2 ASP B 186      29.274   9.606 -64.526  1.00  0.67           O  
ATOM   4805  N   THR B 187      30.072  14.478 -66.166  1.00  0.72           N  
ATOM   4806  CA  THR B 187      29.669  14.925 -67.491  1.00  0.72           C  
ATOM   4807  C   THR B 187      30.220  14.107 -68.647  1.00  0.72           C  
ATOM   4808  O   THR B 187      29.520  13.866 -69.630  1.00  0.72           O  
ATOM   4809  CB  THR B 187      29.951  16.407 -67.719  1.00  0.72           C  
ATOM   4810  OG1 THR B 187      31.324  16.722 -67.667  1.00  0.72           O  
ATOM   4811  CG2 THR B 187      29.278  17.238 -66.627  1.00  0.72           C  
ATOM   4812  N   ARG B 188      31.494  13.666 -68.562  1.00  0.66           N  
ATOM   4813  CA  ARG B 188      32.190  12.836 -69.536  1.00  0.66           C  
ATOM   4814  C   ARG B 188      32.200  13.378 -70.952  1.00  0.66           C  
ATOM   4815  O   ARG B 188      31.951  12.664 -71.921  1.00  0.66           O  
ATOM   4816  CB  ARG B 188      31.671  11.385 -69.543  1.00  0.66           C  
ATOM   4817  CG  ARG B 188      31.701  10.733 -68.155  1.00  0.66           C  
ATOM   4818  CD  ARG B 188      31.182   9.302 -68.175  1.00  0.66           C  
ATOM   4819  NE  ARG B 188      31.323   8.814 -66.781  1.00  0.66           N  
ATOM   4820  CZ  ARG B 188      31.612   7.566 -66.409  1.00  0.66           C  
ATOM   4821  NH1 ARG B 188      32.082   6.668 -67.266  1.00  0.66           N  
ATOM   4822  NH2 ARG B 188      31.416   7.236 -65.136  1.00  0.66           N  
ATOM   4823  N   ARG B 189      32.498  14.676 -71.109  1.00  0.69           N  
ATOM   4824  CA  ARG B 189      32.305  15.349 -72.374  1.00  0.69           C  
ATOM   4825  C   ARG B 189      33.595  15.619 -73.115  1.00  0.69           C  
ATOM   4826  O   ARG B 189      33.589  16.150 -74.225  1.00  0.69           O  
ATOM   4827  CB  ARG B 189      31.610  16.695 -72.118  1.00  0.69           C  
ATOM   4828  CG  ARG B 189      30.145  16.528 -71.690  1.00  0.69           C  
ATOM   4829  CD  ARG B 189      29.443  17.873 -71.612  1.00  0.69           C  
ATOM   4830  NE  ARG B 189      28.026  17.628 -71.216  1.00  0.69           N  
ATOM   4831  CZ  ARG B 189      27.136  18.618 -71.327  1.00  0.69           C  
ATOM   4832  NH1 ARG B 189      27.525  19.826 -71.687  1.00  0.69           N  
ATOM   4833  NH2 ARG B 189      25.836  18.437 -71.130  1.00  0.69           N  
ATOM   4834  N   ILE B 190      34.743  15.260 -72.531  1.00  0.82           N  
ATOM   4835  CA  ILE B 190      36.024  15.543 -73.140  1.00  0.82           C  
ATOM   4836  C   ILE B 190      36.751  14.237 -73.343  1.00  0.82           C  
ATOM   4837  O   ILE B 190      36.888  13.433 -72.424  1.00  0.82           O  
ATOM   4838  CB  ILE B 190      36.875  16.477 -72.302  1.00  0.82           C  
ATOM   4839  CG1 ILE B 190      36.122  17.772 -71.930  1.00  0.82           C  
ATOM   4840  CG2 ILE B 190      38.207  16.778 -73.032  1.00  0.82           C  
ATOM   4841  CD1 ILE B 190      36.875  18.587 -70.882  1.00  0.82           C  
ATOM   4842  N   VAL B 191      37.233  13.995 -74.569  1.00  0.85           N  
ATOM   4843  CA  VAL B 191      37.800  12.725 -74.967  1.00  0.85           C  
ATOM   4844  C   VAL B 191      38.918  12.999 -75.952  1.00  0.85           C  
ATOM   4845  O   VAL B 191      38.941  14.042 -76.603  1.00  0.85           O  
ATOM   4846  CB  VAL B 191      36.720  11.839 -75.581  1.00  0.85           C  
ATOM   4847  CG1 VAL B 191      36.103  12.497 -76.832  1.00  0.85           C  
ATOM   4848  CG2 VAL B 191      37.244  10.426 -75.892  1.00  0.85           C  
ATOM   4849  N   ARG B 192      39.920  12.104 -76.062  1.00  0.75           N  
ATOM   4850  CA  ARG B 192      40.959  12.202 -77.072  1.00  0.75           C  
ATOM   4851  C   ARG B 192      40.414  12.106 -78.501  1.00  0.75           C  
ATOM   4852  O   ARG B 192      39.434  11.411 -78.765  1.00  0.75           O  
ATOM   4853  CB  ARG B 192      42.045  11.119 -76.884  1.00  0.75           C  
ATOM   4854  CG  ARG B 192      42.813  11.169 -75.550  1.00  0.75           C  
ATOM   4855  CD  ARG B 192      43.945  10.121 -75.489  1.00  0.75           C  
ATOM   4856  NE  ARG B 192      44.688  10.262 -74.200  1.00  0.75           N  
ATOM   4857  CZ  ARG B 192      45.454  11.318 -73.927  1.00  0.75           C  
ATOM   4858  NH1 ARG B 192      45.727  12.245 -74.836  1.00  0.75           N  
ATOM   4859  NH2 ARG B 192      45.958  11.522 -72.721  1.00  0.75           N  
ATOM   4860  N   SER B 193      41.032  12.807 -79.473  1.00  0.81           N  
ATOM   4861  CA  SER B 193      40.583  12.822 -80.862  1.00  0.81           C  
ATOM   4862  C   SER B 193      40.734  11.512 -81.602  1.00  0.81           C  
ATOM   4863  O   SER B 193      39.973  11.217 -82.522  1.00  0.81           O  
ATOM   4864  CB  SER B 193      41.257  13.933 -81.713  1.00  0.81           C  
ATOM   4865  OG  SER B 193      42.683  13.873 -81.695  1.00  0.81           O  
ATOM   4866  N   ASP B 194      41.711  10.689 -81.203  1.00  0.70           N  
ATOM   4867  CA  ASP B 194      42.067   9.434 -81.809  1.00  0.70           C  
ATOM   4868  C   ASP B 194      41.415   8.252 -81.103  1.00  0.70           C  
ATOM   4869  O   ASP B 194      41.569   7.101 -81.510  1.00  0.70           O  
ATOM   4870  CB  ASP B 194      43.623   9.314 -81.796  1.00  0.70           C  
ATOM   4871  CG  ASP B 194      44.307   9.625 -80.461  1.00  0.70           C  
ATOM   4872  OD1 ASP B 194      43.621   9.969 -79.464  1.00  0.70           O  
ATOM   4873  OD2 ASP B 194      45.562   9.576 -80.454  1.00  0.70           O  
ATOM   4874  N   SER B 195      40.632   8.523 -80.044  1.00  0.72           N  
ATOM   4875  CA  SER B 195      39.912   7.515 -79.287  1.00  0.72           C  
ATOM   4876  C   SER B 195      38.879   6.738 -80.086  1.00  0.72           C  
ATOM   4877  O   SER B 195      38.234   7.244 -81.009  1.00  0.72           O  
ATOM   4878  CB  SER B 195      39.232   8.093 -78.030  1.00  0.72           C  
ATOM   4879  OG  SER B 195      38.639   7.094 -77.243  1.00  0.72           O  
ATOM   4880  N   ALA B 196      38.689   5.451 -79.729  1.00  0.63           N  
ATOM   4881  CA  ALA B 196      37.728   4.577 -80.360  1.00  0.63           C  
ATOM   4882  C   ALA B 196      36.351   4.725 -79.740  1.00  0.63           C  
ATOM   4883  O   ALA B 196      35.357   4.258 -80.295  1.00  0.63           O  
ATOM   4884  CB  ALA B 196      38.216   3.122 -80.260  1.00  0.63           C  
ATOM   4885  N   LEU B 197      36.256   5.434 -78.598  1.00  0.66           N  
ATOM   4886  CA  LEU B 197      35.008   5.756 -77.945  1.00  0.66           C  
ATOM   4887  C   LEU B 197      34.061   6.569 -78.809  1.00  0.66           C  
ATOM   4888  O   LEU B 197      34.458   7.460 -79.560  1.00  0.66           O  
ATOM   4889  CB  LEU B 197      35.243   6.563 -76.650  1.00  0.66           C  
ATOM   4890  CG  LEU B 197      36.107   5.876 -75.579  1.00  0.66           C  
ATOM   4891  CD1 LEU B 197      36.520   6.910 -74.524  1.00  0.66           C  
ATOM   4892  CD2 LEU B 197      35.404   4.679 -74.931  1.00  0.66           C  
ATOM   4893  N   ARG B 198      32.756   6.294 -78.719  1.00  0.62           N  
ATOM   4894  CA  ARG B 198      31.764   6.990 -79.500  1.00  0.62           C  
ATOM   4895  C   ARG B 198      30.557   7.208 -78.632  1.00  0.62           C  
ATOM   4896  O   ARG B 198      30.286   6.459 -77.695  1.00  0.62           O  
ATOM   4897  CB  ARG B 198      31.352   6.197 -80.768  1.00  0.62           C  
ATOM   4898  CG  ARG B 198      32.439   6.139 -81.866  1.00  0.62           C  
ATOM   4899  CD  ARG B 198      32.821   7.511 -82.444  1.00  0.62           C  
ATOM   4900  NE  ARG B 198      33.898   7.310 -83.471  1.00  0.62           N  
ATOM   4901  CZ  ARG B 198      35.210   7.343 -83.189  1.00  0.62           C  
ATOM   4902  NH1 ARG B 198      35.672   7.499 -81.958  1.00  0.62           N  
ATOM   4903  NH2 ARG B 198      36.099   7.223 -84.175  1.00  0.62           N  
ATOM   4904  N   PHE B 199      29.809   8.294 -78.898  1.00  0.70           N  
ATOM   4905  CA  PHE B 199      28.555   8.554 -78.228  1.00  0.70           C  
ATOM   4906  C   PHE B 199      27.517   7.510 -78.609  1.00  0.70           C  
ATOM   4907  O   PHE B 199      27.389   7.155 -79.781  1.00  0.70           O  
ATOM   4908  CB  PHE B 199      28.026   9.982 -78.504  1.00  0.70           C  
ATOM   4909  CG  PHE B 199      28.854  10.998 -77.766  1.00  0.70           C  
ATOM   4910  CD1 PHE B 199      28.498  11.375 -76.462  1.00  0.70           C  
ATOM   4911  CD2 PHE B 199      29.987  11.585 -78.355  1.00  0.70           C  
ATOM   4912  CE1 PHE B 199      29.256  12.318 -75.757  1.00  0.70           C  
ATOM   4913  CE2 PHE B 199      30.744  12.534 -77.654  1.00  0.70           C  
ATOM   4914  CZ  PHE B 199      30.380  12.899 -76.353  1.00  0.70           C  
ATOM   4915  N   ARG B 200      26.765   6.980 -77.626  1.00  0.67           N  
ATOM   4916  CA  ARG B 200      25.775   5.954 -77.881  1.00  0.67           C  
ATOM   4917  C   ARG B 200      24.475   6.238 -77.157  1.00  0.67           C  
ATOM   4918  O   ARG B 200      24.444   6.544 -75.962  1.00  0.67           O  
ATOM   4919  CB  ARG B 200      26.307   4.550 -77.511  1.00  0.67           C  
ATOM   4920  CG  ARG B 200      25.422   3.382 -77.986  1.00  0.67           C  
ATOM   4921  CD  ARG B 200      25.995   2.011 -77.616  1.00  0.67           C  
ATOM   4922  NE  ARG B 200      24.996   0.987 -78.059  1.00  0.67           N  
ATOM   4923  CZ  ARG B 200      25.153  -0.335 -77.910  1.00  0.67           C  
ATOM   4924  NH1 ARG B 200      26.309  -0.853 -77.495  1.00  0.67           N  
ATOM   4925  NH2 ARG B 200      24.123  -1.140 -78.172  1.00  0.67           N  
ATOM   4926  N   GLY B 201      23.357   6.129 -77.907  1.00  0.85           N  
ATOM   4927  CA  GLY B 201      22.019   6.498 -77.483  1.00  0.85           C  
ATOM   4928  C   GLY B 201      21.573   7.723 -78.207  1.00  0.85           C  
ATOM   4929  O   GLY B 201      22.220   8.755 -78.153  1.00  0.85           O  
ATOM   4930  N   ARG B 202      20.412   7.667 -78.885  1.00  0.76           N  
ATOM   4931  CA  ARG B 202      19.893   8.804 -79.631  1.00  0.76           C  
ATOM   4932  C   ARG B 202      19.551  10.002 -78.755  1.00  0.76           C  
ATOM   4933  O   ARG B 202      19.533  11.138 -79.217  1.00  0.76           O  
ATOM   4934  CB  ARG B 202      18.595   8.437 -80.377  1.00  0.76           C  
ATOM   4935  CG  ARG B 202      18.739   7.361 -81.463  1.00  0.76           C  
ATOM   4936  CD  ARG B 202      17.369   7.074 -82.085  1.00  0.76           C  
ATOM   4937  NE  ARG B 202      17.531   6.169 -83.246  1.00  0.76           N  
ATOM   4938  CZ  ARG B 202      18.015   6.510 -84.443  1.00  0.76           C  
ATOM   4939  NH1 ARG B 202      18.293   7.759 -84.781  1.00  0.76           N  
ATOM   4940  NH2 ARG B 202      18.191   5.530 -85.322  1.00  0.76           N  
ATOM   4941  N   LEU B 203      19.255   9.728 -77.473  1.00  0.81           N  
ATOM   4942  CA  LEU B 203      18.910  10.678 -76.447  1.00  0.81           C  
ATOM   4943  C   LEU B 203      19.562  10.174 -75.170  1.00  0.81           C  
ATOM   4944  O   LEU B 203      19.599   8.968 -74.922  1.00  0.81           O  
ATOM   4945  CB  LEU B 203      17.371  10.720 -76.249  1.00  0.81           C  
ATOM   4946  CG  LEU B 203      16.858  11.741 -75.215  1.00  0.81           C  
ATOM   4947  CD1 LEU B 203      17.060  13.188 -75.673  1.00  0.81           C  
ATOM   4948  CD2 LEU B 203      15.383  11.494 -74.869  1.00  0.81           C  
ATOM   4949  N   HIS B 204      20.126  11.068 -74.336  1.00  0.73           N  
ATOM   4950  CA  HIS B 204      20.871  10.693 -73.142  1.00  0.73           C  
ATOM   4951  C   HIS B 204      22.116   9.888 -73.501  1.00  0.73           C  
ATOM   4952  O   HIS B 204      22.392   8.795 -72.985  1.00  0.73           O  
ATOM   4953  CB  HIS B 204      20.015   9.986 -72.053  1.00  0.73           C  
ATOM   4954  CG  HIS B 204      18.734  10.657 -71.717  1.00  0.73           C  
ATOM   4955  ND1 HIS B 204      18.764  11.901 -71.110  1.00  0.73           N  
ATOM   4956  CD2 HIS B 204      17.479  10.362 -72.117  1.00  0.73           C  
ATOM   4957  CE1 HIS B 204      17.537  12.358 -71.178  1.00  0.73           C  
ATOM   4958  NE2 HIS B 204      16.736  11.459 -71.773  1.00  0.73           N  
ATOM   4959  N   GLU B 205      22.857  10.439 -74.473  1.00  0.70           N  
ATOM   4960  CA  GLU B 205      24.057   9.920 -75.051  1.00  0.70           C  
ATOM   4961  C   GLU B 205      25.255  10.088 -74.144  1.00  0.70           C  
ATOM   4962  O   GLU B 205      25.416  11.074 -73.427  1.00  0.70           O  
ATOM   4963  CB  GLU B 205      24.294  10.545 -76.451  1.00  0.70           C  
ATOM   4964  CG  GLU B 205      24.716  12.041 -76.515  1.00  0.70           C  
ATOM   4965  CD  GLU B 205      23.689  13.104 -76.101  1.00  0.70           C  
ATOM   4966  OE1 GLU B 205      24.096  14.301 -76.139  1.00  0.70           O  
ATOM   4967  OE2 GLU B 205      22.525  12.765 -75.770  1.00  0.70           O  
ATOM   4968  N   ARG B 206      26.148   9.087 -74.143  1.00  0.63           N  
ATOM   4969  CA  ARG B 206      27.382   9.136 -73.393  1.00  0.63           C  
ATOM   4970  C   ARG B 206      28.403   8.397 -74.216  1.00  0.63           C  
ATOM   4971  O   ARG B 206      28.037   7.629 -75.104  1.00  0.63           O  
ATOM   4972  CB  ARG B 206      27.300   8.462 -71.998  1.00  0.63           C  
ATOM   4973  CG  ARG B 206      26.359   9.165 -71.000  1.00  0.63           C  
ATOM   4974  CD  ARG B 206      26.390   8.522 -69.610  1.00  0.63           C  
ATOM   4975  NE  ARG B 206      25.569   9.376 -68.692  1.00  0.63           N  
ATOM   4976  CZ  ARG B 206      25.656   9.316 -67.353  1.00  0.63           C  
ATOM   4977  NH1 ARG B 206      26.340   8.352 -66.746  1.00  0.63           N  
ATOM   4978  NH2 ARG B 206      25.083  10.261 -66.603  1.00  0.63           N  
ATOM   4979  N   LEU B 207      29.702   8.639 -73.964  1.00  0.75           N  
ATOM   4980  CA  LEU B 207      30.793   7.897 -74.559  1.00  0.75           C  
ATOM   4981  C   LEU B 207      30.890   6.458 -74.079  1.00  0.75           C  
ATOM   4982  O   LEU B 207      30.894   6.182 -72.879  1.00  0.75           O  
ATOM   4983  CB  LEU B 207      32.134   8.615 -74.293  1.00  0.75           C  
ATOM   4984  CG  LEU B 207      32.270   9.937 -75.068  1.00  0.75           C  
ATOM   4985  CD1 LEU B 207      33.353  10.810 -74.436  1.00  0.75           C  
ATOM   4986  CD2 LEU B 207      32.597   9.690 -76.547  1.00  0.75           C  
ATOM   4987  N   TYR B 208      31.001   5.518 -75.034  1.00  0.67           N  
ATOM   4988  CA  TYR B 208      31.176   4.107 -74.769  1.00  0.67           C  
ATOM   4989  C   TYR B 208      32.180   3.563 -75.762  1.00  0.67           C  
ATOM   4990  O   TYR B 208      32.384   4.145 -76.829  1.00  0.67           O  
ATOM   4991  CB  TYR B 208      29.870   3.293 -74.981  1.00  0.67           C  
ATOM   4992  CG  TYR B 208      28.828   3.665 -73.967  1.00  0.67           C  
ATOM   4993  CD1 TYR B 208      28.781   3.014 -72.734  1.00  0.67           C  
ATOM   4994  CD2 TYR B 208      27.898   4.678 -74.219  1.00  0.67           C  
ATOM   4995  CE1 TYR B 208      27.872   3.408 -71.749  1.00  0.67           C  
ATOM   4996  CE2 TYR B 208      26.993   5.087 -73.234  1.00  0.67           C  
ATOM   4997  CZ  TYR B 208      27.014   4.495 -71.971  1.00  0.67           C  
ATOM   4998  OH  TYR B 208      26.241   4.971 -70.906  1.00  0.67           O  
ATOM   4999  N   ASP B 209      32.827   2.423 -75.448  1.00  0.64           N  
ATOM   5000  CA  ASP B 209      33.558   1.645 -76.424  1.00  0.64           C  
ATOM   5001  C   ASP B 209      32.626   0.914 -77.395  1.00  0.64           C  
ATOM   5002  O   ASP B 209      31.397   1.005 -77.332  1.00  0.64           O  
ATOM   5003  CB  ASP B 209      34.647   0.731 -75.773  1.00  0.64           C  
ATOM   5004  CG  ASP B 209      34.134  -0.561 -75.146  1.00  0.64           C  
ATOM   5005  OD1 ASP B 209      32.899  -0.788 -75.145  1.00  0.64           O  
ATOM   5006  OD2 ASP B 209      34.979  -1.382 -74.719  1.00  0.64           O  
ATOM   5007  N   ALA B 210      33.212   0.139 -78.325  1.00  0.58           N  
ATOM   5008  CA  ALA B 210      32.485  -0.679 -79.272  1.00  0.58           C  
ATOM   5009  C   ALA B 210      31.597  -1.748 -78.632  1.00  0.58           C  
ATOM   5010  O   ALA B 210      30.580  -2.147 -79.197  1.00  0.58           O  
ATOM   5011  CB  ALA B 210      33.491  -1.336 -80.236  1.00  0.58           C  
ATOM   5012  N   HIS B 211      31.942  -2.209 -77.415  1.00  0.61           N  
ATOM   5013  CA  HIS B 211      31.225  -3.267 -76.737  1.00  0.61           C  
ATOM   5014  C   HIS B 211      30.191  -2.701 -75.781  1.00  0.61           C  
ATOM   5015  O   HIS B 211      29.396  -3.429 -75.191  1.00  0.61           O  
ATOM   5016  CB  HIS B 211      32.218  -4.129 -75.934  1.00  0.61           C  
ATOM   5017  CG  HIS B 211      33.220  -4.775 -76.835  1.00  0.61           C  
ATOM   5018  ND1 HIS B 211      32.776  -5.653 -77.805  1.00  0.61           N  
ATOM   5019  CD2 HIS B 211      34.562  -4.595 -76.939  1.00  0.61           C  
ATOM   5020  CE1 HIS B 211      33.852  -5.989 -78.482  1.00  0.61           C  
ATOM   5021  NE2 HIS B 211      34.962  -5.379 -78.001  1.00  0.61           N  
ATOM   5022  N   GLY B 212      30.140  -1.362 -75.639  1.00  0.80           N  
ATOM   5023  CA  GLY B 212      29.217  -0.675 -74.754  1.00  0.80           C  
ATOM   5024  C   GLY B 212      29.723  -0.509 -73.355  1.00  0.80           C  
ATOM   5025  O   GLY B 212      28.940  -0.217 -72.452  1.00  0.80           O  
ATOM   5026  N   ALA B 213      31.033  -0.675 -73.124  1.00  0.83           N  
ATOM   5027  CA  ALA B 213      31.623  -0.399 -71.838  1.00  0.83           C  
ATOM   5028  C   ALA B 213      31.895   1.083 -71.656  1.00  0.83           C  
ATOM   5029  O   ALA B 213      32.132   1.822 -72.615  1.00  0.83           O  
ATOM   5030  CB  ALA B 213      32.915  -1.203 -71.635  1.00  0.83           C  
ATOM   5031  N   GLN B 214      31.833   1.576 -70.406  1.00  0.74           N  
ATOM   5032  CA  GLN B 214      32.077   2.969 -70.104  1.00  0.74           C  
ATOM   5033  C   GLN B 214      33.563   3.206 -69.903  1.00  0.74           C  
ATOM   5034  O   GLN B 214      34.227   2.437 -69.209  1.00  0.74           O  
ATOM   5035  CB  GLN B 214      31.309   3.491 -68.860  1.00  0.74           C  
ATOM   5036  CG  GLN B 214      29.866   3.914 -69.203  1.00  0.74           C  
ATOM   5037  CD  GLN B 214      29.080   4.534 -68.048  1.00  0.74           C  
ATOM   5038  OE1 GLN B 214      29.598   4.908 -66.995  1.00  0.74           O  
ATOM   5039  NE2 GLN B 214      27.747   4.682 -68.258  1.00  0.74           N  
ATOM   5040  N   PRO B 215      34.158   4.251 -70.462  1.00  0.83           N  
ATOM   5041  CA  PRO B 215      35.559   4.536 -70.223  1.00  0.83           C  
ATOM   5042  C   PRO B 215      35.780   5.068 -68.816  1.00  0.83           C  
ATOM   5043  O   PRO B 215      34.851   5.672 -68.262  1.00  0.83           O  
ATOM   5044  CB  PRO B 215      35.879   5.603 -71.269  1.00  0.83           C  
ATOM   5045  CG  PRO B 215      34.563   6.366 -71.426  1.00  0.83           C  
ATOM   5046  CD  PRO B 215      33.520   5.261 -71.311  1.00  0.83           C  
ATOM   5047  N   PRO B 216      36.942   4.875 -68.206  1.00  0.82           N  
ATOM   5048  CA  PRO B 216      37.249   5.465 -66.916  1.00  0.82           C  
ATOM   5049  C   PRO B 216      37.321   6.986 -66.999  1.00  0.82           C  
ATOM   5050  O   PRO B 216      37.736   7.540 -68.019  1.00  0.82           O  
ATOM   5051  CB  PRO B 216      38.593   4.824 -66.550  1.00  0.82           C  
ATOM   5052  CG  PRO B 216      39.268   4.547 -67.894  1.00  0.82           C  
ATOM   5053  CD  PRO B 216      38.087   4.155 -68.779  1.00  0.82           C  
ATOM   5054  N   SER B 217      36.871   7.691 -65.946  1.00  0.81           N  
ATOM   5055  CA  SER B 217      36.702   9.132 -65.970  1.00  0.81           C  
ATOM   5056  C   SER B 217      37.622   9.860 -65.011  1.00  0.81           C  
ATOM   5057  O   SER B 217      38.058   9.330 -63.989  1.00  0.81           O  
ATOM   5058  CB  SER B 217      35.236   9.570 -65.686  1.00  0.81           C  
ATOM   5059  OG  SER B 217      34.763   9.088 -64.427  1.00  0.81           O  
ATOM   5060  N   VAL B 218      37.962  11.118 -65.356  1.00  0.78           N  
ATOM   5061  CA  VAL B 218      38.684  12.038 -64.490  1.00  0.78           C  
ATOM   5062  C   VAL B 218      37.812  13.261 -64.283  1.00  0.78           C  
ATOM   5063  O   VAL B 218      37.437  13.938 -65.239  1.00  0.78           O  
ATOM   5064  CB  VAL B 218      40.029  12.479 -65.071  1.00  0.78           C  
ATOM   5065  CG1 VAL B 218      40.742  13.472 -64.132  1.00  0.78           C  
ATOM   5066  CG2 VAL B 218      40.929  11.249 -65.272  1.00  0.78           C  
ATOM   5067  N   GLU B 219      37.463  13.587 -63.023  1.00  0.69           N  
ATOM   5068  CA  GLU B 219      36.690  14.771 -62.697  1.00  0.69           C  
ATOM   5069  C   GLU B 219      37.625  15.930 -62.423  1.00  0.69           C  
ATOM   5070  O   GLU B 219      38.587  15.809 -61.660  1.00  0.69           O  
ATOM   5071  CB  GLU B 219      35.780  14.600 -61.463  1.00  0.69           C  
ATOM   5072  CG  GLU B 219      34.662  13.539 -61.610  1.00  0.69           C  
ATOM   5073  CD  GLU B 219      33.745  13.508 -60.384  1.00  0.69           C  
ATOM   5074  OE1 GLU B 219      33.008  12.503 -60.232  1.00  0.69           O  
ATOM   5075  OE2 GLU B 219      33.752  14.495 -59.599  1.00  0.69           O  
ATOM   5076  N   VAL B 220      37.381  17.092 -63.060  1.00  0.81           N  
ATOM   5077  CA  VAL B 220      38.294  18.222 -62.999  1.00  0.81           C  
ATOM   5078  C   VAL B 220      37.620  19.477 -62.473  1.00  0.81           C  
ATOM   5079  O   VAL B 220      36.433  19.719 -62.694  1.00  0.81           O  
ATOM   5080  CB  VAL B 220      38.987  18.515 -64.329  1.00  0.81           C  
ATOM   5081  CG1 VAL B 220      39.842  17.295 -64.723  1.00  0.81           C  
ATOM   5082  CG2 VAL B 220      37.967  18.844 -65.435  1.00  0.81           C  
ATOM   5083  N   ASP B 221      38.376  20.341 -61.753  1.00  0.83           N  
ATOM   5084  CA  ASP B 221      37.920  21.652 -61.321  1.00  0.83           C  
ATOM   5085  C   ASP B 221      37.962  22.670 -62.462  1.00  0.83           C  
ATOM   5086  O   ASP B 221      38.694  23.663 -62.469  1.00  0.83           O  
ATOM   5087  CB  ASP B 221      38.668  22.157 -60.059  1.00  0.83           C  
ATOM   5088  CG  ASP B 221      37.811  23.195 -59.328  1.00  0.83           C  
ATOM   5089  OD1 ASP B 221      36.659  22.829 -58.922  1.00  0.83           O  
ATOM   5090  OD2 ASP B 221      38.281  24.365 -59.173  1.00  0.83           O  
ATOM   5091  N   VAL B 222      37.137  22.392 -63.481  1.00  0.86           N  
ATOM   5092  CA  VAL B 222      36.855  23.250 -64.604  1.00  0.86           C  
ATOM   5093  C   VAL B 222      35.355  23.397 -64.597  1.00  0.86           C  
ATOM   5094  O   VAL B 222      34.629  22.405 -64.587  1.00  0.86           O  
ATOM   5095  CB  VAL B 222      37.304  22.638 -65.924  1.00  0.86           C  
ATOM   5096  CG1 VAL B 222      36.896  23.528 -67.111  1.00  0.86           C  
ATOM   5097  CG2 VAL B 222      38.834  22.469 -65.902  1.00  0.86           C  
ATOM   5098  N   VAL B 223      34.845  24.634 -64.545  1.00  0.84           N  
ATOM   5099  CA  VAL B 223      33.446  24.895 -64.299  1.00  0.84           C  
ATOM   5100  C   VAL B 223      32.834  25.584 -65.498  1.00  0.84           C  
ATOM   5101  O   VAL B 223      33.333  26.582 -66.017  1.00  0.84           O  
ATOM   5102  CB  VAL B 223      33.254  25.756 -63.054  1.00  0.84           C  
ATOM   5103  CG1 VAL B 223      31.770  26.099 -62.805  1.00  0.84           C  
ATOM   5104  CG2 VAL B 223      33.865  25.035 -61.833  1.00  0.84           C  
ATOM   5105  N   PHE B 224      31.694  25.055 -65.961  1.00  0.77           N  
ATOM   5106  CA  PHE B 224      30.875  25.663 -66.979  1.00  0.77           C  
ATOM   5107  C   PHE B 224      29.590  26.116 -66.327  1.00  0.77           C  
ATOM   5108  O   PHE B 224      29.000  25.417 -65.505  1.00  0.77           O  
ATOM   5109  CB  PHE B 224      30.520  24.672 -68.115  1.00  0.77           C  
ATOM   5110  CG  PHE B 224      31.702  24.445 -69.013  1.00  0.77           C  
ATOM   5111  CD1 PHE B 224      31.808  25.144 -70.225  1.00  0.77           C  
ATOM   5112  CD2 PHE B 224      32.711  23.530 -68.667  1.00  0.77           C  
ATOM   5113  CE1 PHE B 224      32.905  24.947 -71.068  1.00  0.77           C  
ATOM   5114  CE2 PHE B 224      33.813  23.333 -69.510  1.00  0.77           C  
ATOM   5115  CZ  PHE B 224      33.911  24.041 -70.713  1.00  0.77           C  
ATOM   5116  N   HIS B 225      29.121  27.322 -66.680  1.00  0.74           N  
ATOM   5117  CA  HIS B 225      27.824  27.797 -66.256  1.00  0.74           C  
ATOM   5118  C   HIS B 225      26.813  27.499 -67.337  1.00  0.74           C  
ATOM   5119  O   HIS B 225      26.949  27.947 -68.474  1.00  0.74           O  
ATOM   5120  CB  HIS B 225      27.802  29.310 -65.971  1.00  0.74           C  
ATOM   5121  CG  HIS B 225      28.667  29.687 -64.811  1.00  0.74           C  
ATOM   5122  ND1 HIS B 225      28.284  29.310 -63.541  1.00  0.74           N  
ATOM   5123  CD2 HIS B 225      29.818  30.407 -64.762  1.00  0.74           C  
ATOM   5124  CE1 HIS B 225      29.204  29.807 -62.741  1.00  0.74           C  
ATOM   5125  NE2 HIS B 225      30.159  30.481 -63.427  1.00  0.74           N  
ATOM   5126  N   HIS B 226      25.769  26.735 -66.992  1.00  0.69           N  
ATOM   5127  CA  HIS B 226      24.667  26.412 -67.862  1.00  0.69           C  
ATOM   5128  C   HIS B 226      23.583  27.446 -67.689  1.00  0.69           C  
ATOM   5129  O   HIS B 226      22.983  27.562 -66.620  1.00  0.69           O  
ATOM   5130  CB  HIS B 226      24.085  25.024 -67.518  1.00  0.69           C  
ATOM   5131  CG  HIS B 226      23.020  24.587 -68.450  1.00  0.69           C  
ATOM   5132  ND1 HIS B 226      23.364  24.536 -69.770  1.00  0.69           N  
ATOM   5133  CD2 HIS B 226      21.725  24.220 -68.275  1.00  0.69           C  
ATOM   5134  CE1 HIS B 226      22.283  24.131 -70.398  1.00  0.69           C  
ATOM   5135  NE2 HIS B 226      21.254  23.927 -69.537  1.00  0.69           N  
ATOM   5136  N   THR B 227      23.294  28.250 -68.733  1.00  0.66           N  
ATOM   5137  CA  THR B 227      22.315  29.324 -68.600  1.00  0.66           C  
ATOM   5138  C   THR B 227      20.897  28.809 -68.621  1.00  0.66           C  
ATOM   5139  O   THR B 227      19.989  29.469 -68.119  1.00  0.66           O  
ATOM   5140  CB  THR B 227      22.426  30.440 -69.639  1.00  0.66           C  
ATOM   5141  OG1 THR B 227      22.216  29.977 -70.963  1.00  0.66           O  
ATOM   5142  CG2 THR B 227      23.820  31.077 -69.587  1.00  0.66           C  
ATOM   5143  N   GLY B 228      20.664  27.599 -69.183  1.00  0.65           N  
ATOM   5144  CA  GLY B 228      19.338  26.996 -69.244  1.00  0.65           C  
ATOM   5145  C   GLY B 228      18.370  27.800 -70.048  1.00  0.65           C  
ATOM   5146  O   GLY B 228      17.187  27.883 -69.724  1.00  0.65           O  
ATOM   5147  N   TYR B 229      18.875  28.468 -71.097  1.00  0.52           N  
ATOM   5148  CA  TYR B 229      18.110  29.359 -71.926  1.00  0.52           C  
ATOM   5149  C   TYR B 229      17.052  28.613 -72.729  1.00  0.52           C  
ATOM   5150  O   TYR B 229      17.266  28.167 -73.850  1.00  0.52           O  
ATOM   5151  CB  TYR B 229      19.090  30.177 -72.805  1.00  0.52           C  
ATOM   5152  CG  TYR B 229      18.427  31.189 -73.690  1.00  0.52           C  
ATOM   5153  CD1 TYR B 229      18.315  30.931 -75.064  1.00  0.52           C  
ATOM   5154  CD2 TYR B 229      17.917  32.390 -73.170  1.00  0.52           C  
ATOM   5155  CE1 TYR B 229      17.664  31.840 -75.901  1.00  0.52           C  
ATOM   5156  CE2 TYR B 229      17.276  33.308 -74.012  1.00  0.52           C  
ATOM   5157  CZ  TYR B 229      17.112  33.001 -75.364  1.00  0.52           C  
ATOM   5158  OH  TYR B 229      16.206  33.734 -76.142  1.00  0.52           O  
ATOM   5159  N   GLU B 230      15.853  28.472 -72.149  1.00  0.51           N  
ATOM   5160  CA  GLU B 230      14.686  28.013 -72.849  1.00  0.51           C  
ATOM   5161  C   GLU B 230      13.643  29.106 -72.803  1.00  0.51           C  
ATOM   5162  O   GLU B 230      13.011  29.298 -71.759  1.00  0.51           O  
ATOM   5163  CB  GLU B 230      14.159  26.716 -72.206  1.00  0.51           C  
ATOM   5164  CG  GLU B 230      14.645  25.477 -72.985  1.00  0.51           C  
ATOM   5165  CD  GLU B 230      14.313  24.177 -72.274  1.00  0.51           C  
ATOM   5166  OE1 GLU B 230      15.171  23.256 -72.352  1.00  0.51           O  
ATOM   5167  OE2 GLU B 230      13.219  24.044 -71.655  1.00  0.51           O  
ATOM   5168  N   PRO B 231      13.384  29.841 -73.872  1.00  0.48           N  
ATOM   5169  CA  PRO B 231      12.406  30.894 -73.821  1.00  0.48           C  
ATOM   5170  C   PRO B 231      11.109  30.280 -74.266  1.00  0.48           C  
ATOM   5171  O   PRO B 231      11.028  29.740 -75.361  1.00  0.48           O  
ATOM   5172  CB  PRO B 231      12.925  32.000 -74.749  1.00  0.48           C  
ATOM   5173  CG  PRO B 231      14.046  31.352 -75.564  1.00  0.48           C  
ATOM   5174  CD  PRO B 231      14.178  29.910 -75.097  1.00  0.48           C  
ATOM   5175  N   GLU B 232      10.080  30.375 -73.422  1.00  0.46           N  
ATOM   5176  CA  GLU B 232       8.704  30.182 -73.806  1.00  0.46           C  
ATOM   5177  C   GLU B 232       8.224  28.788 -73.521  1.00  0.46           C  
ATOM   5178  O   GLU B 232       8.918  27.777 -73.620  1.00  0.46           O  
ATOM   5179  CB  GLU B 232       8.283  30.655 -75.216  1.00  0.46           C  
ATOM   5180  CG  GLU B 232       8.648  32.128 -75.502  1.00  0.46           C  
ATOM   5181  CD  GLU B 232       8.329  32.511 -76.943  1.00  0.46           C  
ATOM   5182  OE1 GLU B 232       8.710  33.646 -77.325  1.00  0.46           O  
ATOM   5183  OE2 GLU B 232       7.698  31.686 -77.655  1.00  0.46           O  
ATOM   5184  N   VAL B 233       6.951  28.713 -73.125  1.00  0.37           N  
ATOM   5185  CA  VAL B 233       6.231  27.505 -72.811  1.00  0.37           C  
ATOM   5186  C   VAL B 233       6.164  26.595 -74.029  1.00  0.37           C  
ATOM   5187  O   VAL B 233       6.294  25.377 -73.927  1.00  0.37           O  
ATOM   5188  CB  VAL B 233       4.860  27.908 -72.288  1.00  0.37           C  
ATOM   5189  CG1 VAL B 233       3.953  26.681 -72.107  1.00  0.37           C  
ATOM   5190  CG2 VAL B 233       5.034  28.654 -70.944  1.00  0.37           C  
ATOM   5191  N   ILE B 234       6.015  27.199 -75.225  1.00  0.41           N  
ATOM   5192  CA  ILE B 234       6.016  26.534 -76.514  1.00  0.41           C  
ATOM   5193  C   ILE B 234       7.330  25.827 -76.836  1.00  0.41           C  
ATOM   5194  O   ILE B 234       7.328  24.663 -77.237  1.00  0.41           O  
ATOM   5195  CB  ILE B 234       5.650  27.540 -77.604  1.00  0.41           C  
ATOM   5196  CG1 ILE B 234       4.237  28.126 -77.339  1.00  0.41           C  
ATOM   5197  CG2 ILE B 234       5.723  26.870 -78.996  1.00  0.41           C  
ATOM   5198  CD1 ILE B 234       3.874  29.299 -78.259  1.00  0.41           C  
ATOM   5199  N   ALA B 235       8.496  26.477 -76.620  1.00  0.44           N  
ATOM   5200  CA  ALA B 235       9.793  25.862 -76.831  1.00  0.44           C  
ATOM   5201  C   ALA B 235      10.044  24.675 -75.913  1.00  0.44           C  
ATOM   5202  O   ALA B 235      10.493  23.611 -76.341  1.00  0.44           O  
ATOM   5203  CB  ALA B 235      10.895  26.914 -76.637  1.00  0.44           C  
ATOM   5204  N   ARG B 236       9.682  24.819 -74.623  1.00  0.43           N  
ATOM   5205  CA  ARG B 236       9.719  23.744 -73.656  1.00  0.43           C  
ATOM   5206  C   ARG B 236       8.810  22.573 -74.014  1.00  0.43           C  
ATOM   5207  O   ARG B 236       9.186  21.408 -73.887  1.00  0.43           O  
ATOM   5208  CB  ARG B 236       9.324  24.297 -72.272  1.00  0.43           C  
ATOM   5209  CG  ARG B 236       9.604  23.321 -71.111  1.00  0.43           C  
ATOM   5210  CD  ARG B 236       9.168  23.851 -69.744  1.00  0.43           C  
ATOM   5211  NE  ARG B 236      10.040  25.023 -69.444  1.00  0.43           N  
ATOM   5212  CZ  ARG B 236       9.767  25.983 -68.551  1.00  0.43           C  
ATOM   5213  NH1 ARG B 236       8.642  25.985 -67.838  1.00  0.43           N  
ATOM   5214  NH2 ARG B 236      10.645  26.966 -68.372  1.00  0.43           N  
ATOM   5215  N   LYS B 237       7.579  22.853 -74.492  1.00  0.54           N  
ATOM   5216  CA  LYS B 237       6.650  21.837 -74.950  1.00  0.54           C  
ATOM   5217  C   LYS B 237       7.160  21.064 -76.158  1.00  0.54           C  
ATOM   5218  O   LYS B 237       7.169  19.834 -76.153  1.00  0.54           O  
ATOM   5219  CB  LYS B 237       5.275  22.477 -75.261  1.00  0.54           C  
ATOM   5220  CG  LYS B 237       4.157  21.465 -75.557  1.00  0.54           C  
ATOM   5221  CD  LYS B 237       2.795  22.138 -75.805  1.00  0.54           C  
ATOM   5222  CE  LYS B 237       1.720  21.116 -76.190  1.00  0.54           C  
ATOM   5223  NZ  LYS B 237       0.426  21.761 -76.493  1.00  0.54           N  
ATOM   5224  N   GLY B 238       7.685  21.768 -77.186  1.00  0.59           N  
ATOM   5225  CA  GLY B 238       8.248  21.134 -78.376  1.00  0.59           C  
ATOM   5226  C   GLY B 238       9.492  20.319 -78.118  1.00  0.59           C  
ATOM   5227  O   GLY B 238       9.770  19.328 -78.794  1.00  0.59           O  
ATOM   5228  N   LYS B 239      10.285  20.695 -77.095  1.00  0.59           N  
ATOM   5229  CA  LYS B 239      11.371  19.876 -76.598  1.00  0.59           C  
ATOM   5230  C   LYS B 239      10.892  18.577 -75.968  1.00  0.59           C  
ATOM   5231  O   LYS B 239      11.438  17.510 -76.246  1.00  0.59           O  
ATOM   5232  CB  LYS B 239      12.232  20.666 -75.586  1.00  0.59           C  
ATOM   5233  CG  LYS B 239      13.474  19.916 -75.069  1.00  0.59           C  
ATOM   5234  CD  LYS B 239      14.345  20.811 -74.174  1.00  0.59           C  
ATOM   5235  CE  LYS B 239      15.640  20.153 -73.679  1.00  0.59           C  
ATOM   5236  NZ  LYS B 239      16.407  21.127 -72.890  1.00  0.59           N  
ATOM   5237  N   ARG B 240       9.833  18.629 -75.133  1.00  0.54           N  
ATOM   5238  CA  ARG B 240       9.246  17.451 -74.519  1.00  0.54           C  
ATOM   5239  C   ARG B 240       8.650  16.483 -75.533  1.00  0.54           C  
ATOM   5240  O   ARG B 240       8.892  15.279 -75.469  1.00  0.54           O  
ATOM   5241  CB  ARG B 240       8.147  17.844 -73.503  1.00  0.54           C  
ATOM   5242  CG  ARG B 240       8.667  18.524 -72.219  1.00  0.54           C  
ATOM   5243  CD  ARG B 240       7.510  18.964 -71.314  1.00  0.54           C  
ATOM   5244  NE  ARG B 240       8.077  19.630 -70.097  1.00  0.54           N  
ATOM   5245  CZ  ARG B 240       7.323  20.122 -69.103  1.00  0.54           C  
ATOM   5246  NH1 ARG B 240       5.995  20.098 -69.156  1.00  0.54           N  
ATOM   5247  NH2 ARG B 240       7.909  20.665 -68.037  1.00  0.54           N  
ATOM   5248  N   GLU B 241       7.898  16.999 -76.527  1.00  0.60           N  
ATOM   5249  CA  GLU B 241       7.338  16.220 -77.617  1.00  0.60           C  
ATOM   5250  C   GLU B 241       8.411  15.551 -78.463  1.00  0.60           C  
ATOM   5251  O   GLU B 241       8.314  14.376 -78.818  1.00  0.60           O  
ATOM   5252  CB  GLU B 241       6.438  17.118 -78.493  1.00  0.60           C  
ATOM   5253  CG  GLU B 241       5.150  17.579 -77.765  1.00  0.60           C  
ATOM   5254  CD  GLU B 241       4.347  18.618 -78.545  1.00  0.60           C  
ATOM   5255  OE1 GLU B 241       3.298  19.042 -77.991  1.00  0.60           O  
ATOM   5256  OE2 GLU B 241       4.756  19.010 -79.665  1.00  0.60           O  
ATOM   5257  N   ARG B 242       9.517  16.272 -78.758  1.00  0.52           N  
ATOM   5258  CA  ARG B 242      10.682  15.688 -79.394  1.00  0.52           C  
ATOM   5259  C   ARG B 242      11.331  14.585 -78.577  1.00  0.52           C  
ATOM   5260  O   ARG B 242      11.637  13.519 -79.103  1.00  0.52           O  
ATOM   5261  CB  ARG B 242      11.742  16.782 -79.681  1.00  0.52           C  
ATOM   5262  CG  ARG B 242      13.023  16.287 -80.394  1.00  0.52           C  
ATOM   5263  CD  ARG B 242      13.988  17.407 -80.811  1.00  0.52           C  
ATOM   5264  NE  ARG B 242      14.532  18.028 -79.555  1.00  0.52           N  
ATOM   5265  CZ  ARG B 242      14.965  19.292 -79.446  1.00  0.52           C  
ATOM   5266  NH1 ARG B 242      14.919  20.149 -80.460  1.00  0.52           N  
ATOM   5267  NH2 ARG B 242      15.463  19.710 -78.282  1.00  0.52           N  
ATOM   5268  N   TYR B 243      11.539  14.791 -77.261  1.00  0.56           N  
ATOM   5269  CA  TYR B 243      12.151  13.792 -76.400  1.00  0.56           C  
ATOM   5270  C   TYR B 243      11.310  12.532 -76.275  1.00  0.56           C  
ATOM   5271  O   TYR B 243      11.836  11.426 -76.370  1.00  0.56           O  
ATOM   5272  CB  TYR B 243      12.483  14.363 -74.995  1.00  0.56           C  
ATOM   5273  CG  TYR B 243      13.736  15.215 -74.933  1.00  0.56           C  
ATOM   5274  CD1 TYR B 243      14.376  15.784 -76.053  1.00  0.56           C  
ATOM   5275  CD2 TYR B 243      14.303  15.432 -73.665  1.00  0.56           C  
ATOM   5276  CE1 TYR B 243      15.550  16.537 -75.902  1.00  0.56           C  
ATOM   5277  CE2 TYR B 243      15.483  16.170 -73.514  1.00  0.56           C  
ATOM   5278  CZ  TYR B 243      16.112  16.716 -74.634  1.00  0.56           C  
ATOM   5279  OH  TYR B 243      17.320  17.420 -74.501  1.00  0.56           O  
ATOM   5280  N   ALA B 244       9.976  12.668 -76.136  1.00  0.71           N  
ATOM   5281  CA  ALA B 244       9.055  11.550 -76.121  1.00  0.71           C  
ATOM   5282  C   ALA B 244       9.118  10.702 -77.392  1.00  0.71           C  
ATOM   5283  O   ALA B 244       9.284   9.486 -77.329  1.00  0.71           O  
ATOM   5284  CB  ALA B 244       7.634  12.106 -75.903  1.00  0.71           C  
ATOM   5285  N   ARG B 245       9.112  11.351 -78.578  1.00  0.66           N  
ATOM   5286  CA  ARG B 245       9.289  10.692 -79.861  1.00  0.66           C  
ATOM   5287  C   ARG B 245      10.625   9.967 -79.988  1.00  0.66           C  
ATOM   5288  O   ARG B 245      10.708   8.845 -80.491  1.00  0.66           O  
ATOM   5289  CB  ARG B 245       9.174  11.737 -81.001  1.00  0.66           C  
ATOM   5290  CG  ARG B 245       9.221  11.135 -82.423  1.00  0.66           C  
ATOM   5291  CD  ARG B 245       9.255  12.159 -83.568  1.00  0.66           C  
ATOM   5292  NE  ARG B 245      10.578  12.893 -83.545  1.00  0.66           N  
ATOM   5293  CZ  ARG B 245      10.725  14.219 -83.647  1.00  0.66           C  
ATOM   5294  NH1 ARG B 245       9.692  15.051 -83.636  1.00  0.66           N  
ATOM   5295  NH2 ARG B 245      11.937  14.746 -83.771  1.00  0.66           N  
ATOM   5296  N   LEU B 246      11.730  10.582 -79.514  1.00  0.71           N  
ATOM   5297  CA  LEU B 246      13.033   9.942 -79.491  1.00  0.71           C  
ATOM   5298  C   LEU B 246      13.072   8.704 -78.608  1.00  0.71           C  
ATOM   5299  O   LEU B 246      13.588   7.664 -79.013  1.00  0.71           O  
ATOM   5300  CB  LEU B 246      14.141  10.928 -79.045  1.00  0.71           C  
ATOM   5301  CG  LEU B 246      14.450  12.053 -80.054  1.00  0.71           C  
ATOM   5302  CD1 LEU B 246      15.455  13.056 -79.468  1.00  0.71           C  
ATOM   5303  CD2 LEU B 246      14.972  11.508 -81.385  1.00  0.71           C  
ATOM   5304  N   VAL B 247      12.482   8.763 -77.399  1.00  0.74           N  
ATOM   5305  CA  VAL B 247      12.369   7.625 -76.499  1.00  0.74           C  
ATOM   5306  C   VAL B 247      11.554   6.481 -77.096  1.00  0.74           C  
ATOM   5307  O   VAL B 247      11.960   5.320 -77.017  1.00  0.74           O  
ATOM   5308  CB  VAL B 247      11.804   8.044 -75.150  1.00  0.74           C  
ATOM   5309  CG1 VAL B 247      11.525   6.828 -74.252  1.00  0.74           C  
ATOM   5310  CG2 VAL B 247      12.805   8.963 -74.427  1.00  0.74           C  
ATOM   5311  N   GLU B 248      10.419   6.776 -77.767  1.00  0.72           N  
ATOM   5312  CA  GLU B 248       9.632   5.795 -78.499  1.00  0.72           C  
ATOM   5313  C   GLU B 248      10.410   5.113 -79.612  1.00  0.72           C  
ATOM   5314  O   GLU B 248      10.379   3.894 -79.767  1.00  0.72           O  
ATOM   5315  CB  GLU B 248       8.384   6.455 -79.121  1.00  0.72           C  
ATOM   5316  CG  GLU B 248       7.308   6.861 -78.087  1.00  0.72           C  
ATOM   5317  CD  GLU B 248       6.122   7.590 -78.723  1.00  0.72           C  
ATOM   5318  OE1 GLU B 248       5.132   7.814 -77.979  1.00  0.72           O  
ATOM   5319  OE2 GLU B 248       6.194   7.930 -79.933  1.00  0.72           O  
ATOM   5320  N   ARG B 249      11.189   5.884 -80.392  1.00  0.71           N  
ATOM   5321  CA  ARG B 249      12.062   5.342 -81.411  1.00  0.71           C  
ATOM   5322  C   ARG B 249      13.134   4.422 -80.854  1.00  0.71           C  
ATOM   5323  O   ARG B 249      13.358   3.330 -81.369  1.00  0.71           O  
ATOM   5324  CB  ARG B 249      12.715   6.499 -82.189  1.00  0.71           C  
ATOM   5325  CG  ARG B 249      13.502   6.053 -83.432  1.00  0.71           C  
ATOM   5326  CD  ARG B 249      13.947   7.239 -84.281  1.00  0.71           C  
ATOM   5327  NE  ARG B 249      14.700   6.684 -85.440  1.00  0.71           N  
ATOM   5328  CZ  ARG B 249      14.960   7.401 -86.541  1.00  0.71           C  
ATOM   5329  NH1 ARG B 249      14.576   8.671 -86.665  1.00  0.71           N  
ATOM   5330  NH2 ARG B 249      15.589   6.829 -87.563  1.00  0.71           N  
ATOM   5331  N   CYS B 250      13.779   4.818 -79.742  1.00  0.73           N  
ATOM   5332  CA  CYS B 250      14.734   3.988 -79.035  1.00  0.73           C  
ATOM   5333  C   CYS B 250      14.148   2.696 -78.497  1.00  0.73           C  
ATOM   5334  O   CYS B 250      14.768   1.645 -78.595  1.00  0.73           O  
ATOM   5335  CB  CYS B 250      15.360   4.744 -77.854  1.00  0.73           C  
ATOM   5336  SG  CYS B 250      16.322   6.197 -78.372  1.00  0.73           S  
ATOM   5337  N   LEU B 251      12.919   2.730 -77.944  1.00  0.72           N  
ATOM   5338  CA  LEU B 251      12.187   1.540 -77.546  1.00  0.72           C  
ATOM   5339  C   LEU B 251      11.899   0.602 -78.709  1.00  0.72           C  
ATOM   5340  O   LEU B 251      12.031  -0.609 -78.578  1.00  0.72           O  
ATOM   5341  CB  LEU B 251      10.849   1.922 -76.867  1.00  0.72           C  
ATOM   5342  CG  LEU B 251      10.965   2.411 -75.410  1.00  0.72           C  
ATOM   5343  CD1 LEU B 251       9.662   3.100 -74.980  1.00  0.72           C  
ATOM   5344  CD2 LEU B 251      11.282   1.251 -74.453  1.00  0.72           C  
ATOM   5345  N   THR B 252      11.515   1.131 -79.887  1.00  0.72           N  
ATOM   5346  CA  THR B 252      11.354   0.336 -81.103  1.00  0.72           C  
ATOM   5347  C   THR B 252      12.648  -0.297 -81.581  1.00  0.72           C  
ATOM   5348  O   THR B 252      12.689  -1.482 -81.901  1.00  0.72           O  
ATOM   5349  CB  THR B 252      10.777   1.167 -82.242  1.00  0.72           C  
ATOM   5350  OG1 THR B 252       9.502   1.667 -81.863  1.00  0.72           O  
ATOM   5351  CG2 THR B 252      10.552   0.350 -83.523  1.00  0.72           C  
ATOM   5352  N   GLU B 253      13.752   0.475 -81.629  1.00  0.71           N  
ATOM   5353  CA  GLU B 253      15.058  -0.010 -82.041  1.00  0.71           C  
ATOM   5354  C   GLU B 253      15.708  -0.981 -81.050  1.00  0.71           C  
ATOM   5355  O   GLU B 253      16.230  -2.025 -81.441  1.00  0.71           O  
ATOM   5356  CB  GLU B 253      15.979   1.195 -82.391  1.00  0.71           C  
ATOM   5357  CG  GLU B 253      15.466   1.988 -83.639  1.00  0.71           C  
ATOM   5358  CD  GLU B 253      16.232   3.259 -84.011  1.00  0.71           C  
ATOM   5359  OE1 GLU B 253      15.748   4.054 -84.872  1.00  0.71           O  
ATOM   5360  OE2 GLU B 253      17.332   3.516 -83.459  1.00  0.71           O  
ATOM   5361  N   GLU B 254      15.656  -0.695 -79.733  1.00  0.62           N  
ATOM   5362  CA  GLU B 254      16.257  -1.520 -78.697  1.00  0.62           C  
ATOM   5363  C   GLU B 254      15.243  -1.954 -77.611  1.00  0.62           C  
ATOM   5364  O   GLU B 254      15.356  -1.512 -76.462  1.00  0.62           O  
ATOM   5365  CB  GLU B 254      17.439  -0.771 -78.015  1.00  0.62           C  
ATOM   5366  CG  GLU B 254      18.683  -0.452 -78.898  1.00  0.62           C  
ATOM   5367  CD  GLU B 254      19.872   0.053 -78.073  1.00  0.62           C  
ATOM   5368  OE1 GLU B 254      21.055  -0.151 -78.483  1.00  0.62           O  
ATOM   5369  OE2 GLU B 254      19.613   0.661 -77.008  1.00  0.62           O  
ATOM   5370  N   PRO B 255      14.252  -2.828 -77.851  1.00  0.70           N  
ATOM   5371  CA  PRO B 255      13.125  -3.061 -76.936  1.00  0.70           C  
ATOM   5372  C   PRO B 255      13.502  -3.788 -75.666  1.00  0.70           C  
ATOM   5373  O   PRO B 255      12.778  -3.704 -74.673  1.00  0.70           O  
ATOM   5374  CB  PRO B 255      12.137  -3.898 -77.770  1.00  0.70           C  
ATOM   5375  CG  PRO B 255      13.015  -4.579 -78.822  1.00  0.70           C  
ATOM   5376  CD  PRO B 255      14.043  -3.495 -79.135  1.00  0.70           C  
ATOM   5377  N   SER B 256      14.620  -4.523 -75.683  1.00  0.63           N  
ATOM   5378  CA  SER B 256      15.136  -5.274 -74.561  1.00  0.63           C  
ATOM   5379  C   SER B 256      16.151  -4.476 -73.770  1.00  0.63           C  
ATOM   5380  O   SER B 256      16.711  -4.971 -72.800  1.00  0.63           O  
ATOM   5381  CB  SER B 256      15.853  -6.556 -75.056  1.00  0.63           C  
ATOM   5382  OG  SER B 256      16.742  -6.258 -76.140  1.00  0.63           O  
ATOM   5383  N   ASN B 257      16.405  -3.202 -74.126  1.00  0.57           N  
ATOM   5384  CA  ASN B 257      17.301  -2.357 -73.364  1.00  0.57           C  
ATOM   5385  C   ASN B 257      16.522  -1.667 -72.233  1.00  0.57           C  
ATOM   5386  O   ASN B 257      15.650  -0.838 -72.515  1.00  0.57           O  
ATOM   5387  CB  ASN B 257      17.977  -1.335 -74.313  1.00  0.57           C  
ATOM   5388  CG  ASN B 257      19.080  -0.533 -73.634  1.00  0.57           C  
ATOM   5389  OD1 ASN B 257      19.221  -0.520 -72.409  1.00  0.57           O  
ATOM   5390  ND2 ASN B 257      19.895   0.180 -74.436  1.00  0.57           N  
ATOM   5391  N   PRO B 258      16.776  -1.926 -70.946  1.00  0.60           N  
ATOM   5392  CA  PRO B 258      15.940  -1.418 -69.863  1.00  0.60           C  
ATOM   5393  C   PRO B 258      16.108   0.074 -69.638  1.00  0.60           C  
ATOM   5394  O   PRO B 258      15.252   0.693 -69.002  1.00  0.60           O  
ATOM   5395  CB  PRO B 258      16.368  -2.245 -68.649  1.00  0.60           C  
ATOM   5396  CG  PRO B 258      17.801  -2.676 -68.964  1.00  0.60           C  
ATOM   5397  CD  PRO B 258      17.766  -2.896 -70.467  1.00  0.60           C  
ATOM   5398  N   LYS B 259      17.183   0.678 -70.184  1.00  0.56           N  
ATOM   5399  CA  LYS B 259      17.485   2.095 -70.136  1.00  0.56           C  
ATOM   5400  C   LYS B 259      16.361   2.941 -70.730  1.00  0.56           C  
ATOM   5401  O   LYS B 259      15.949   3.954 -70.163  1.00  0.56           O  
ATOM   5402  CB  LYS B 259      18.831   2.322 -70.897  1.00  0.56           C  
ATOM   5403  CG  LYS B 259      19.313   3.781 -71.031  1.00  0.56           C  
ATOM   5404  CD  LYS B 259      20.651   3.983 -71.794  1.00  0.56           C  
ATOM   5405  CE  LYS B 259      20.992   5.478 -71.963  1.00  0.56           C  
ATOM   5406  NZ  LYS B 259      22.334   5.784 -72.491  1.00  0.56           N  
ATOM   5407  N   TRP B 260      15.792   2.522 -71.876  1.00  0.65           N  
ATOM   5408  CA  TRP B 260      14.735   3.248 -72.553  1.00  0.65           C  
ATOM   5409  C   TRP B 260      13.379   3.173 -71.872  1.00  0.65           C  
ATOM   5410  O   TRP B 260      12.614   4.133 -71.880  1.00  0.65           O  
ATOM   5411  CB  TRP B 260      14.646   2.828 -74.034  1.00  0.65           C  
ATOM   5412  CG  TRP B 260      15.997   2.967 -74.787  1.00  0.65           C  
ATOM   5413  CD1 TRP B 260      16.683   1.982 -75.451  1.00  0.65           C  
ATOM   5414  CD2 TRP B 260      16.674   4.180 -74.896  1.00  0.65           C  
ATOM   5415  NE1 TRP B 260      17.795   2.557 -75.958  1.00  0.65           N  
ATOM   5416  CE2 TRP B 260      17.913   3.866 -75.715  1.00  0.65           C  
ATOM   5417  CE3 TRP B 260      16.471   5.487 -74.519  1.00  0.65           C  
ATOM   5418  CZ2 TRP B 260      18.708   4.885 -76.069  1.00  0.65           C  
ATOM   5419  CZ3 TRP B 260      17.344   6.491 -74.878  1.00  0.65           C  
ATOM   5420  CH2 TRP B 260      18.473   6.186 -75.677  1.00  0.65           C  
ATOM   5421  N   HIS B 261      13.062   2.041 -71.216  1.00  0.63           N  
ATOM   5422  CA  HIS B 261      11.873   1.910 -70.387  1.00  0.63           C  
ATOM   5423  C   HIS B 261      11.888   2.844 -69.190  1.00  0.63           C  
ATOM   5424  O   HIS B 261      10.875   3.459 -68.862  1.00  0.63           O  
ATOM   5425  CB  HIS B 261      11.692   0.466 -69.906  1.00  0.63           C  
ATOM   5426  CG  HIS B 261      11.451  -0.499 -71.027  1.00  0.63           C  
ATOM   5427  ND1 HIS B 261      10.174  -0.649 -71.539  1.00  0.63           N  
ATOM   5428  CD2 HIS B 261      12.318  -1.329 -71.665  1.00  0.63           C  
ATOM   5429  CE1 HIS B 261      10.296  -1.578 -72.474  1.00  0.63           C  
ATOM   5430  NE2 HIS B 261      11.572  -2.018 -72.592  1.00  0.63           N  
ATOM   5431  N   PHE B 262      13.064   3.017 -68.546  1.00  0.60           N  
ATOM   5432  CA  PHE B 262      13.270   4.037 -67.534  1.00  0.60           C  
ATOM   5433  C   PHE B 262      13.010   5.447 -68.057  1.00  0.60           C  
ATOM   5434  O   PHE B 262      12.262   6.208 -67.448  1.00  0.60           O  
ATOM   5435  CB  PHE B 262      14.716   3.901 -66.965  1.00  0.60           C  
ATOM   5436  CG  PHE B 262      15.122   5.062 -66.094  1.00  0.60           C  
ATOM   5437  CD1 PHE B 262      15.870   6.122 -66.632  1.00  0.60           C  
ATOM   5438  CD2 PHE B 262      14.679   5.147 -64.771  1.00  0.60           C  
ATOM   5439  CE1 PHE B 262      16.178   7.243 -65.853  1.00  0.60           C  
ATOM   5440  CE2 PHE B 262      15.006   6.257 -63.982  1.00  0.60           C  
ATOM   5441  CZ  PHE B 262      15.757   7.306 -64.523  1.00  0.60           C  
ATOM   5442  N   TYR B 263      13.588   5.820 -69.216  1.00  0.63           N  
ATOM   5443  CA  TYR B 263      13.376   7.140 -69.787  1.00  0.63           C  
ATOM   5444  C   TYR B 263      11.937   7.398 -70.203  1.00  0.63           C  
ATOM   5445  O   TYR B 263      11.405   8.479 -69.982  1.00  0.63           O  
ATOM   5446  CB  TYR B 263      14.364   7.422 -70.942  1.00  0.63           C  
ATOM   5447  CG  TYR B 263      15.762   7.637 -70.416  1.00  0.63           C  
ATOM   5448  CD1 TYR B 263      16.033   8.572 -69.408  1.00  0.63           C  
ATOM   5449  CD2 TYR B 263      16.839   6.926 -70.949  1.00  0.63           C  
ATOM   5450  CE1 TYR B 263      17.326   8.719 -68.895  1.00  0.63           C  
ATOM   5451  CE2 TYR B 263      18.140   7.124 -70.477  1.00  0.63           C  
ATOM   5452  CZ  TYR B 263      18.389   8.001 -69.427  1.00  0.63           C  
ATOM   5453  OH  TYR B 263      19.680   8.201 -68.904  1.00  0.63           O  
ATOM   5454  N   ALA B 264      11.235   6.393 -70.754  1.00  0.68           N  
ATOM   5455  CA  ALA B 264       9.832   6.494 -71.095  1.00  0.68           C  
ATOM   5456  C   ALA B 264       8.926   6.832 -69.923  1.00  0.68           C  
ATOM   5457  O   ALA B 264       8.006   7.639 -70.045  1.00  0.68           O  
ATOM   5458  CB  ALA B 264       9.394   5.163 -71.729  1.00  0.68           C  
ATOM   5459  N   VAL B 265       9.178   6.233 -68.744  1.00  0.66           N  
ATOM   5460  CA  VAL B 265       8.495   6.629 -67.527  1.00  0.66           C  
ATOM   5461  C   VAL B 265       8.964   7.988 -67.014  1.00  0.66           C  
ATOM   5462  O   VAL B 265       8.147   8.865 -66.754  1.00  0.66           O  
ATOM   5463  CB  VAL B 265       8.633   5.562 -66.448  1.00  0.66           C  
ATOM   5464  CG1 VAL B 265       7.877   5.969 -65.167  1.00  0.66           C  
ATOM   5465  CG2 VAL B 265       8.061   4.227 -66.973  1.00  0.66           C  
ATOM   5466  N   ARG B 266      10.290   8.233 -66.902  1.00  0.59           N  
ATOM   5467  CA  ARG B 266      10.817   9.466 -66.330  1.00  0.59           C  
ATOM   5468  C   ARG B 266      10.463  10.711 -67.123  1.00  0.59           C  
ATOM   5469  O   ARG B 266      10.022  11.715 -66.566  1.00  0.59           O  
ATOM   5470  CB  ARG B 266      12.364   9.399 -66.190  1.00  0.59           C  
ATOM   5471  CG  ARG B 266      12.995  10.572 -65.398  1.00  0.59           C  
ATOM   5472  CD  ARG B 266      14.492  10.819 -65.652  1.00  0.59           C  
ATOM   5473  NE  ARG B 266      14.663  11.366 -67.024  1.00  0.59           N  
ATOM   5474  CZ  ARG B 266      15.806  11.628 -67.656  1.00  0.59           C  
ATOM   5475  NH1 ARG B 266      17.006  11.566 -67.111  1.00  0.59           N  
ATOM   5476  NH2 ARG B 266      15.712  11.919 -68.940  1.00  0.59           N  
ATOM   5477  N   ASP B 267      10.604  10.671 -68.458  1.00  0.65           N  
ATOM   5478  CA  ASP B 267      10.430  11.840 -69.293  1.00  0.65           C  
ATOM   5479  C   ASP B 267       8.948  12.154 -69.492  1.00  0.65           C  
ATOM   5480  O   ASP B 267       8.558  13.293 -69.751  1.00  0.65           O  
ATOM   5481  CB  ASP B 267      11.223  11.662 -70.624  1.00  0.65           C  
ATOM   5482  CG  ASP B 267      12.728  11.659 -70.383  1.00  0.65           C  
ATOM   5483  OD1 ASP B 267      13.141  11.825 -69.204  1.00  0.65           O  
ATOM   5484  OD2 ASP B 267      13.534  11.519 -71.340  1.00  0.65           O  
ATOM   5485  N   GLY B 268       8.059  11.160 -69.263  1.00  0.66           N  
ATOM   5486  CA  GLY B 268       6.617  11.361 -69.235  1.00  0.66           C  
ATOM   5487  C   GLY B 268       6.103  11.942 -67.946  1.00  0.66           C  
ATOM   5488  O   GLY B 268       4.918  12.258 -67.844  1.00  0.66           O  
ATOM   5489  N   LEU B 269       6.971  12.111 -66.933  1.00  0.57           N  
ATOM   5490  CA  LEU B 269       6.635  12.728 -65.666  1.00  0.57           C  
ATOM   5491  C   LEU B 269       7.255  14.113 -65.510  1.00  0.57           C  
ATOM   5492  O   LEU B 269       6.999  14.812 -64.532  1.00  0.57           O  
ATOM   5493  CB  LEU B 269       7.119  11.831 -64.499  1.00  0.57           C  
ATOM   5494  CG  LEU B 269       6.413  10.463 -64.410  1.00  0.57           C  
ATOM   5495  CD1 LEU B 269       7.056   9.593 -63.320  1.00  0.57           C  
ATOM   5496  CD2 LEU B 269       4.896  10.594 -64.206  1.00  0.57           C  
ATOM   5497  N   VAL B 270       8.070  14.597 -66.473  1.00  0.49           N  
ATOM   5498  CA  VAL B 270       8.733  15.892 -66.349  1.00  0.49           C  
ATOM   5499  C   VAL B 270       7.753  17.063 -66.298  1.00  0.49           C  
ATOM   5500  O   VAL B 270       7.069  17.402 -67.266  1.00  0.49           O  
ATOM   5501  CB  VAL B 270       9.817  16.122 -67.403  1.00  0.49           C  
ATOM   5502  CG1 VAL B 270      10.405  17.551 -67.332  1.00  0.49           C  
ATOM   5503  CG2 VAL B 270      10.951  15.105 -67.169  1.00  0.49           C  
ATOM   5504  N   GLY B 271       7.682  17.741 -65.129  1.00  0.34           N  
ATOM   5505  CA  GLY B 271       6.785  18.866 -64.909  1.00  0.34           C  
ATOM   5506  C   GLY B 271       5.398  18.501 -64.469  1.00  0.34           C  
ATOM   5507  O   GLY B 271       4.508  19.343 -64.528  1.00  0.34           O  
ATOM   5508  N   ARG B 272       5.168  17.258 -64.017  1.00  0.32           N  
ATOM   5509  CA  ARG B 272       3.870  16.879 -63.507  1.00  0.32           C  
ATOM   5510  C   ARG B 272       4.005  15.793 -62.467  1.00  0.32           C  
ATOM   5511  O   ARG B 272       5.079  15.240 -62.249  1.00  0.32           O  
ATOM   5512  CB  ARG B 272       2.890  16.445 -64.632  1.00  0.32           C  
ATOM   5513  CG  ARG B 272       3.265  15.143 -65.369  1.00  0.32           C  
ATOM   5514  CD  ARG B 272       2.292  14.790 -66.497  1.00  0.32           C  
ATOM   5515  NE  ARG B 272       2.597  13.393 -66.916  1.00  0.32           N  
ATOM   5516  CZ  ARG B 272       1.867  12.309 -66.629  1.00  0.32           C  
ATOM   5517  NH1 ARG B 272       0.790  12.338 -65.855  1.00  0.32           N  
ATOM   5518  NH2 ARG B 272       2.257  11.147 -67.136  1.00  0.32           N  
ATOM   5519  N   LYS B 273       2.904  15.475 -61.760  1.00  0.42           N  
ATOM   5520  CA  LYS B 273       2.856  14.350 -60.851  1.00  0.42           C  
ATOM   5521  C   LYS B 273       1.725  13.437 -61.306  1.00  0.42           C  
ATOM   5522  O   LYS B 273       0.660  13.948 -61.665  1.00  0.42           O  
ATOM   5523  CB  LYS B 273       2.657  14.776 -59.375  1.00  0.42           C  
ATOM   5524  CG  LYS B 273       3.912  15.432 -58.770  1.00  0.42           C  
ATOM   5525  CD  LYS B 273       3.732  15.799 -57.286  1.00  0.42           C  
ATOM   5526  CE  LYS B 273       4.977  16.429 -56.652  1.00  0.42           C  
ATOM   5527  NZ  LYS B 273       4.711  16.752 -55.230  1.00  0.42           N  
ATOM   5528  N   PRO B 274       1.898  12.120 -61.368  1.00  0.55           N  
ATOM   5529  CA  PRO B 274       0.832  11.216 -61.758  1.00  0.55           C  
ATOM   5530  C   PRO B 274      -0.146  10.979 -60.619  1.00  0.55           C  
ATOM   5531  O   PRO B 274       0.238  11.034 -59.451  1.00  0.55           O  
ATOM   5532  CB  PRO B 274       1.593   9.937 -62.125  1.00  0.55           C  
ATOM   5533  CG  PRO B 274       2.794   9.908 -61.177  1.00  0.55           C  
ATOM   5534  CD  PRO B 274       3.094  11.390 -60.929  1.00  0.55           C  
ATOM   5535  N   GLY B 275      -1.442  10.743 -60.920  1.00  0.58           N  
ATOM   5536  CA  GLY B 275      -2.389  10.283 -59.899  1.00  0.58           C  
ATOM   5537  C   GLY B 275      -2.129   8.855 -59.448  1.00  0.58           C  
ATOM   5538  O   GLY B 275      -1.381   8.147 -60.125  1.00  0.58           O  
ATOM   5539  N   PRO B 276      -2.739   8.362 -58.363  1.00  0.58           N  
ATOM   5540  CA  PRO B 276      -2.449   7.042 -57.794  1.00  0.58           C  
ATOM   5541  C   PRO B 276      -2.498   5.876 -58.768  1.00  0.58           C  
ATOM   5542  O   PRO B 276      -1.535   5.115 -58.844  1.00  0.58           O  
ATOM   5543  CB  PRO B 276      -3.446   6.902 -56.633  1.00  0.58           C  
ATOM   5544  CG  PRO B 276      -3.661   8.345 -56.168  1.00  0.58           C  
ATOM   5545  CD  PRO B 276      -3.598   9.150 -57.470  1.00  0.58           C  
ATOM   5546  N   ASP B 277      -3.580   5.743 -59.555  1.00  0.59           N  
ATOM   5547  CA  ASP B 277      -3.755   4.709 -60.557  1.00  0.59           C  
ATOM   5548  C   ASP B 277      -2.695   4.745 -61.655  1.00  0.59           C  
ATOM   5549  O   ASP B 277      -2.131   3.722 -62.050  1.00  0.59           O  
ATOM   5550  CB  ASP B 277      -5.156   4.874 -61.190  1.00  0.59           C  
ATOM   5551  CG  ASP B 277      -6.246   4.760 -60.132  1.00  0.59           C  
ATOM   5552  OD1 ASP B 277      -6.046   4.022 -59.138  1.00  0.59           O  
ATOM   5553  OD2 ASP B 277      -7.276   5.461 -60.306  1.00  0.59           O  
ATOM   5554  N   GLU B 278      -2.360   5.959 -62.146  1.00  0.54           N  
ATOM   5555  CA  GLU B 278      -1.301   6.172 -63.115  1.00  0.54           C  
ATOM   5556  C   GLU B 278       0.064   5.796 -62.558  1.00  0.54           C  
ATOM   5557  O   GLU B 278       0.846   5.095 -63.200  1.00  0.54           O  
ATOM   5558  CB  GLU B 278      -1.285   7.633 -63.636  1.00  0.54           C  
ATOM   5559  CG  GLU B 278      -0.278   7.837 -64.798  1.00  0.54           C  
ATOM   5560  CD  GLU B 278      -0.110   9.264 -65.299  1.00  0.54           C  
ATOM   5561  OE1 GLU B 278       0.487   9.408 -66.397  1.00  0.54           O  
ATOM   5562  OE2 GLU B 278      -0.493  10.250 -64.620  1.00  0.54           O  
ATOM   5563  N   ALA B 279       0.354   6.189 -61.300  1.00  0.59           N  
ATOM   5564  CA  ALA B 279       1.570   5.835 -60.603  1.00  0.59           C  
ATOM   5565  C   ALA B 279       1.753   4.326 -60.442  1.00  0.59           C  
ATOM   5566  O   ALA B 279       2.834   3.789 -60.683  1.00  0.59           O  
ATOM   5567  CB  ALA B 279       1.586   6.552 -59.238  1.00  0.59           C  
ATOM   5568  N   LEU B 280       0.676   3.594 -60.092  1.00  0.55           N  
ATOM   5569  CA  LEU B 280       0.668   2.143 -60.030  1.00  0.55           C  
ATOM   5570  C   LEU B 280       0.909   1.474 -61.375  1.00  0.55           C  
ATOM   5571  O   LEU B 280       1.689   0.526 -61.492  1.00  0.55           O  
ATOM   5572  CB  LEU B 280      -0.662   1.660 -59.409  1.00  0.55           C  
ATOM   5573  CG  LEU B 280      -0.819   0.134 -59.236  1.00  0.55           C  
ATOM   5574  CD1 LEU B 280       0.266  -0.459 -58.325  1.00  0.55           C  
ATOM   5575  CD2 LEU B 280      -2.211  -0.184 -58.672  1.00  0.55           C  
ATOM   5576  N   ALA B 281       0.272   1.971 -62.452  1.00  0.63           N  
ATOM   5577  CA  ALA B 281       0.485   1.473 -63.794  1.00  0.63           C  
ATOM   5578  C   ALA B 281       1.914   1.662 -64.298  1.00  0.63           C  
ATOM   5579  O   ALA B 281       2.532   0.742 -64.838  1.00  0.63           O  
ATOM   5580  CB  ALA B 281      -0.527   2.151 -64.732  1.00  0.63           C  
ATOM   5581  N   LEU B 282       2.498   2.854 -64.070  1.00  0.63           N  
ATOM   5582  CA  LEU B 282       3.887   3.146 -64.364  1.00  0.63           C  
ATOM   5583  C   LEU B 282       4.858   2.303 -63.554  1.00  0.63           C  
ATOM   5584  O   LEU B 282       5.847   1.798 -64.085  1.00  0.63           O  
ATOM   5585  CB  LEU B 282       4.180   4.644 -64.140  1.00  0.63           C  
ATOM   5586  CG  LEU B 282       3.477   5.588 -65.138  1.00  0.63           C  
ATOM   5587  CD1 LEU B 282       3.653   7.049 -64.701  1.00  0.63           C  
ATOM   5588  CD2 LEU B 282       3.978   5.407 -66.580  1.00  0.63           C  
ATOM   5589  N   PHE B 283       4.572   2.089 -62.252  1.00  0.52           N  
ATOM   5590  CA  PHE B 283       5.350   1.230 -61.380  1.00  0.52           C  
ATOM   5591  C   PHE B 283       5.422  -0.205 -61.876  1.00  0.52           C  
ATOM   5592  O   PHE B 283       6.500  -0.788 -61.939  1.00  0.52           O  
ATOM   5593  CB  PHE B 283       4.730   1.278 -59.957  1.00  0.52           C  
ATOM   5594  CG  PHE B 283       5.371   0.326 -58.984  1.00  0.52           C  
ATOM   5595  CD1 PHE B 283       4.858  -0.972 -58.810  1.00  0.52           C  
ATOM   5596  CD2 PHE B 283       6.512   0.706 -58.275  1.00  0.52           C  
ATOM   5597  CE1 PHE B 283       5.524  -1.895 -57.994  1.00  0.52           C  
ATOM   5598  CE2 PHE B 283       7.162  -0.205 -57.437  1.00  0.52           C  
ATOM   5599  CZ  PHE B 283       6.689  -1.516 -57.320  1.00  0.52           C  
ATOM   5600  N   ARG B 284       4.281  -0.803 -62.271  1.00  0.57           N  
ATOM   5601  CA  ARG B 284       4.244  -2.161 -62.780  1.00  0.57           C  
ATOM   5602  C   ARG B 284       5.045  -2.328 -64.059  1.00  0.57           C  
ATOM   5603  O   ARG B 284       5.843  -3.254 -64.184  1.00  0.57           O  
ATOM   5604  CB  ARG B 284       2.783  -2.587 -63.030  1.00  0.57           C  
ATOM   5605  CG  ARG B 284       1.982  -2.836 -61.736  1.00  0.57           C  
ATOM   5606  CD  ARG B 284       0.517  -3.164 -62.035  1.00  0.57           C  
ATOM   5607  NE  ARG B 284      -0.169  -3.449 -60.733  1.00  0.57           N  
ATOM   5608  CZ  ARG B 284      -1.500  -3.485 -60.578  1.00  0.57           C  
ATOM   5609  NH1 ARG B 284      -2.327  -3.194 -61.578  1.00  0.57           N  
ATOM   5610  NH2 ARG B 284      -2.015  -3.820 -59.396  1.00  0.57           N  
ATOM   5611  N   ARG B 285       4.897  -1.377 -65.001  1.00  0.61           N  
ATOM   5612  CA  ARG B 285       5.659  -1.340 -66.233  1.00  0.61           C  
ATOM   5613  C   ARG B 285       7.155  -1.210 -65.995  1.00  0.61           C  
ATOM   5614  O   ARG B 285       7.970  -1.908 -66.595  1.00  0.61           O  
ATOM   5615  CB  ARG B 285       5.176  -0.134 -67.076  1.00  0.61           C  
ATOM   5616  CG  ARG B 285       5.886   0.033 -68.435  1.00  0.61           C  
ATOM   5617  CD  ARG B 285       5.402   1.263 -69.207  1.00  0.61           C  
ATOM   5618  NE  ARG B 285       6.243   1.355 -70.444  1.00  0.61           N  
ATOM   5619  CZ  ARG B 285       6.125   2.316 -71.371  1.00  0.61           C  
ATOM   5620  NH1 ARG B 285       5.221   3.286 -71.262  1.00  0.61           N  
ATOM   5621  NH2 ARG B 285       6.930   2.298 -72.431  1.00  0.61           N  
ATOM   5622  N   LEU B 286       7.562  -0.310 -65.078  1.00  0.60           N  
ATOM   5623  CA  LEU B 286       8.950  -0.148 -64.707  1.00  0.60           C  
ATOM   5624  C   LEU B 286       9.509  -1.360 -63.979  1.00  0.60           C  
ATOM   5625  O   LEU B 286      10.641  -1.770 -64.214  1.00  0.60           O  
ATOM   5626  CB  LEU B 286       9.149   1.161 -63.912  1.00  0.60           C  
ATOM   5627  CG  LEU B 286      10.608   1.650 -63.815  1.00  0.60           C  
ATOM   5628  CD1 LEU B 286      11.236   1.910 -65.195  1.00  0.60           C  
ATOM   5629  CD2 LEU B 286      10.691   2.927 -62.971  1.00  0.60           C  
ATOM   5630  N   ARG B 287       8.713  -2.005 -63.101  1.00  0.50           N  
ATOM   5631  CA  ARG B 287       9.076  -3.241 -62.438  1.00  0.50           C  
ATOM   5632  C   ARG B 287       9.302  -4.402 -63.396  1.00  0.50           C  
ATOM   5633  O   ARG B 287      10.287  -5.126 -63.265  1.00  0.50           O  
ATOM   5634  CB  ARG B 287       8.011  -3.633 -61.375  1.00  0.50           C  
ATOM   5635  CG  ARG B 287       8.408  -4.802 -60.445  1.00  0.50           C  
ATOM   5636  CD  ARG B 287       9.586  -4.438 -59.541  1.00  0.50           C  
ATOM   5637  NE  ARG B 287      10.043  -5.666 -58.816  1.00  0.50           N  
ATOM   5638  CZ  ARG B 287      11.264  -5.760 -58.271  1.00  0.50           C  
ATOM   5639  NH1 ARG B 287      12.099  -4.724 -58.277  1.00  0.50           N  
ATOM   5640  NH2 ARG B 287      11.654  -6.907 -57.721  1.00  0.50           N  
ATOM   5641  N   GLU B 288       8.421  -4.574 -64.404  1.00  0.60           N  
ATOM   5642  CA  GLU B 288       8.579  -5.557 -65.462  1.00  0.60           C  
ATOM   5643  C   GLU B 288       9.819  -5.312 -66.306  1.00  0.60           C  
ATOM   5644  O   GLU B 288      10.647  -6.197 -66.508  1.00  0.60           O  
ATOM   5645  CB  GLU B 288       7.317  -5.543 -66.349  1.00  0.60           C  
ATOM   5646  CG  GLU B 288       7.265  -6.638 -67.442  1.00  0.60           C  
ATOM   5647  CD  GLU B 288       5.977  -6.570 -68.267  1.00  0.60           C  
ATOM   5648  OE1 GLU B 288       5.785  -7.494 -69.099  1.00  0.60           O  
ATOM   5649  OE2 GLU B 288       5.187  -5.608 -68.081  1.00  0.60           O  
ATOM   5650  N   ALA B 289      10.042  -4.055 -66.735  1.00  0.65           N  
ATOM   5651  CA  ALA B 289      11.231  -3.660 -67.455  1.00  0.65           C  
ATOM   5652  C   ALA B 289      12.516  -3.799 -66.651  1.00  0.65           C  
ATOM   5653  O   ALA B 289      13.584  -4.080 -67.186  1.00  0.65           O  
ATOM   5654  CB  ALA B 289      11.061  -2.219 -67.943  1.00  0.65           C  
ATOM   5655  N   HIS B 290      12.443  -3.633 -65.319  1.00  0.50           N  
ATOM   5656  CA  HIS B 290      13.561  -3.823 -64.420  1.00  0.50           C  
ATOM   5657  C   HIS B 290      14.080  -5.254 -64.391  1.00  0.50           C  
ATOM   5658  O   HIS B 290      15.259  -5.479 -64.148  1.00  0.50           O  
ATOM   5659  CB  HIS B 290      13.219  -3.349 -62.993  1.00  0.50           C  
ATOM   5660  CG  HIS B 290      14.430  -3.136 -62.146  1.00  0.50           C  
ATOM   5661  ND1 HIS B 290      15.035  -1.891 -62.133  1.00  0.50           N  
ATOM   5662  CD2 HIS B 290      15.166  -4.030 -61.439  1.00  0.50           C  
ATOM   5663  CE1 HIS B 290      16.134  -2.058 -61.420  1.00  0.50           C  
ATOM   5664  NE2 HIS B 290      16.259  -3.333 -60.980  1.00  0.50           N  
ATOM   5665  N   ALA B 291      13.232  -6.257 -64.706  1.00  0.50           N  
ATOM   5666  CA  ALA B 291      13.633  -7.650 -64.769  1.00  0.50           C  
ATOM   5667  C   ALA B 291      14.603  -7.934 -65.914  1.00  0.50           C  
ATOM   5668  O   ALA B 291      15.372  -8.890 -65.883  1.00  0.50           O  
ATOM   5669  CB  ALA B 291      12.375  -8.529 -64.893  1.00  0.50           C  
ATOM   5670  N   LEU B 292      14.668  -7.030 -66.916  1.00  0.36           N  
ATOM   5671  CA  LEU B 292      15.661  -7.079 -67.971  1.00  0.36           C  
ATOM   5672  C   LEU B 292      17.075  -6.777 -67.461  1.00  0.36           C  
ATOM   5673  O   LEU B 292      18.061  -7.052 -68.137  1.00  0.36           O  
ATOM   5674  CB  LEU B 292      15.327  -6.066 -69.092  1.00  0.36           C  
ATOM   5675  CG  LEU B 292      13.964  -6.238 -69.795  1.00  0.36           C  
ATOM   5676  CD1 LEU B 292      13.640  -4.976 -70.614  1.00  0.36           C  
ATOM   5677  CD2 LEU B 292      13.935  -7.477 -70.697  1.00  0.36           C  
ATOM   5678  N   TYR B 293      17.239  -6.233 -66.230  1.00  0.33           N  
ATOM   5679  CA  TYR B 293      18.546  -6.054 -65.621  1.00  0.33           C  
ATOM   5680  C   TYR B 293      19.130  -7.355 -65.095  1.00  0.33           C  
ATOM   5681  O   TYR B 293      20.334  -7.428 -64.847  1.00  0.33           O  
ATOM   5682  CB  TYR B 293      18.538  -5.000 -64.482  1.00  0.33           C  
ATOM   5683  CG  TYR B 293      18.387  -3.594 -65.005  1.00  0.33           C  
ATOM   5684  CD1 TYR B 293      19.412  -2.999 -65.759  1.00  0.33           C  
ATOM   5685  CD2 TYR B 293      17.254  -2.827 -64.694  1.00  0.33           C  
ATOM   5686  CE1 TYR B 293      19.292  -1.676 -66.210  1.00  0.33           C  
ATOM   5687  CE2 TYR B 293      17.118  -1.514 -65.167  1.00  0.33           C  
ATOM   5688  CZ  TYR B 293      18.135  -0.944 -65.939  1.00  0.33           C  
ATOM   5689  OH  TYR B 293      18.004   0.367 -66.432  1.00  0.33           O  
ATOM   5690  N   ASP B 294      18.300  -8.409 -64.965  1.00  0.36           N  
ATOM   5691  CA  ASP B 294      18.720  -9.700 -64.480  1.00  0.36           C  
ATOM   5692  C   ASP B 294      19.011 -10.650 -65.663  1.00  0.36           C  
ATOM   5693  O   ASP B 294      19.431 -11.792 -65.475  1.00  0.36           O  
ATOM   5694  CB  ASP B 294      17.636 -10.245 -63.501  1.00  0.36           C  
ATOM   5695  CG  ASP B 294      17.394  -9.272 -62.344  1.00  0.36           C  
ATOM   5696  OD1 ASP B 294      18.388  -8.835 -61.708  1.00  0.36           O  
ATOM   5697  OD2 ASP B 294      16.200  -8.965 -62.070  1.00  0.36           O  
ATOM   5698  N   GLU B 295      18.845 -10.185 -66.932  1.00  0.32           N  
ATOM   5699  CA  GLU B 295      19.061 -10.984 -68.139  1.00  0.32           C  
ATOM   5700  C   GLU B 295      20.447 -10.868 -68.814  1.00  0.32           C  
ATOM   5701  O   GLU B 295      20.820  -9.850 -69.398  1.00  0.32           O  
ATOM   5702  CB  GLU B 295      17.986 -10.720 -69.222  1.00  0.32           C  
ATOM   5703  CG  GLU B 295      16.502 -11.013 -68.872  1.00  0.32           C  
ATOM   5704  CD  GLU B 295      15.596 -10.789 -70.091  1.00  0.32           C  
ATOM   5705  OE1 GLU B 295      14.364 -10.998 -69.947  1.00  0.32           O  
ATOM   5706  OE2 GLU B 295      16.118 -10.422 -71.176  1.00  0.32           O  
ATOM   5707  N   ALA B 296      21.258 -11.951 -68.798  1.00  0.31           N  
ATOM   5708  CA  ALA B 296      22.610 -12.022 -69.341  1.00  0.31           C  
ATOM   5709  C   ALA B 296      23.623 -11.026 -68.745  1.00  0.31           C  
ATOM   5710  O   ALA B 296      23.256 -10.243 -67.859  1.00  0.31           O  
ATOM   5711  CB  ALA B 296      22.478 -12.016 -70.879  1.00  0.31           C  
ATOM   5712  N   PRO B 297      24.925 -11.014 -69.059  1.00  0.27           N  
ATOM   5713  CA  PRO B 297      25.772  -9.873 -68.753  1.00  0.27           C  
ATOM   5714  C   PRO B 297      25.423  -8.708 -69.656  1.00  0.27           C  
ATOM   5715  O   PRO B 297      25.629  -8.784 -70.866  1.00  0.27           O  
ATOM   5716  CB  PRO B 297      27.216 -10.383 -68.917  1.00  0.27           C  
ATOM   5717  CG  PRO B 297      27.129 -11.636 -69.801  1.00  0.27           C  
ATOM   5718  CD  PRO B 297      25.662 -12.090 -69.724  1.00  0.27           C  
ATOM   5719  N   LEU B 298      24.911  -7.617 -69.068  1.00  0.31           N  
ATOM   5720  CA  LEU B 298      24.651  -6.373 -69.757  1.00  0.31           C  
ATOM   5721  C   LEU B 298      25.905  -5.534 -69.960  1.00  0.31           C  
ATOM   5722  O   LEU B 298      26.871  -5.623 -69.201  1.00  0.31           O  
ATOM   5723  CB  LEU B 298      23.634  -5.532 -68.954  1.00  0.31           C  
ATOM   5724  CG  LEU B 298      22.231  -6.154 -68.845  1.00  0.31           C  
ATOM   5725  CD1 LEU B 298      21.359  -5.306 -67.917  1.00  0.31           C  
ATOM   5726  CD2 LEU B 298      21.553  -6.290 -70.215  1.00  0.31           C  
ATOM   5727  N   SER B 299      25.923  -4.673 -70.998  1.00  0.32           N  
ATOM   5728  CA  SER B 299      26.936  -3.646 -71.158  1.00  0.32           C  
ATOM   5729  C   SER B 299      26.647  -2.471 -70.256  1.00  0.32           C  
ATOM   5730  O   SER B 299      25.518  -2.291 -69.801  1.00  0.32           O  
ATOM   5731  CB  SER B 299      27.185  -3.220 -72.657  1.00  0.32           C  
ATOM   5732  OG  SER B 299      26.180  -2.460 -73.281  1.00  0.32           O  
ATOM   5733  N   ASP B 300      27.651  -1.624 -69.939  1.00  0.34           N  
ATOM   5734  CA  ASP B 300      27.494  -0.433 -69.112  1.00  0.34           C  
ATOM   5735  C   ASP B 300      26.451   0.519 -69.686  1.00  0.34           C  
ATOM   5736  O   ASP B 300      25.734   1.210 -68.967  1.00  0.34           O  
ATOM   5737  CB  ASP B 300      28.835   0.321 -68.969  1.00  0.34           C  
ATOM   5738  CG  ASP B 300      29.903  -0.523 -68.292  1.00  0.34           C  
ATOM   5739  OD1 ASP B 300      29.553  -1.517 -67.615  1.00  0.34           O  
ATOM   5740  OD2 ASP B 300      31.094  -0.165 -68.471  1.00  0.34           O  
ATOM   5741  N   TYR B 301      26.321   0.541 -71.028  1.00  0.29           N  
ATOM   5742  CA  TYR B 301      25.274   1.244 -71.737  1.00  0.29           C  
ATOM   5743  C   TYR B 301      23.872   0.764 -71.374  1.00  0.29           C  
ATOM   5744  O   TYR B 301      22.990   1.568 -71.082  1.00  0.29           O  
ATOM   5745  CB  TYR B 301      25.549   1.073 -73.258  1.00  0.29           C  
ATOM   5746  CG  TYR B 301      24.472   1.642 -74.133  1.00  0.29           C  
ATOM   5747  CD1 TYR B 301      23.678   0.808 -74.936  1.00  0.29           C  
ATOM   5748  CD2 TYR B 301      24.250   3.022 -74.150  1.00  0.29           C  
ATOM   5749  CE1 TYR B 301      22.714   1.359 -75.791  1.00  0.29           C  
ATOM   5750  CE2 TYR B 301      23.288   3.572 -74.994  1.00  0.29           C  
ATOM   5751  CZ  TYR B 301      22.536   2.752 -75.824  1.00  0.29           C  
ATOM   5752  OH  TYR B 301      21.655   3.369 -76.697  1.00  0.29           O  
ATOM   5753  N   GLU B 302      23.652  -0.558 -71.358  1.00  0.71           N  
ATOM   5754  CA  GLU B 302      22.389  -1.170 -70.998  1.00  0.71           C  
ATOM   5755  C   GLU B 302      22.111  -1.054 -69.506  1.00  0.71           C  
ATOM   5756  O   GLU B 302      20.989  -0.814 -69.068  1.00  0.71           O  
ATOM   5757  CB  GLU B 302      22.387  -2.639 -71.470  1.00  0.71           C  
ATOM   5758  CG  GLU B 302      22.523  -2.761 -73.009  1.00  0.71           C  
ATOM   5759  CD  GLU B 302      23.014  -4.128 -73.469  1.00  0.71           C  
ATOM   5760  OE1 GLU B 302      22.372  -4.739 -74.354  1.00  0.71           O  
ATOM   5761  OE2 GLU B 302      24.122  -4.510 -72.992  1.00  0.71           O  
ATOM   5762  N   ALA B 303      23.163  -1.158 -68.673  1.00  0.80           N  
ATOM   5763  CA  ALA B 303      23.053  -1.164 -67.233  1.00  0.80           C  
ATOM   5764  C   ALA B 303      23.043   0.226 -66.589  1.00  0.80           C  
ATOM   5765  O   ALA B 303      22.843   0.353 -65.378  1.00  0.80           O  
ATOM   5766  CB  ALA B 303      24.236  -1.980 -66.683  1.00  0.80           C  
ATOM   5767  N   GLU B 304      23.185   1.302 -67.395  1.00  0.38           N  
ATOM   5768  CA  GLU B 304      23.372   2.689 -66.990  1.00  0.38           C  
ATOM   5769  C   GLU B 304      22.337   3.200 -65.991  1.00  0.38           C  
ATOM   5770  O   GLU B 304      22.663   3.919 -65.048  1.00  0.38           O  
ATOM   5771  CB  GLU B 304      23.344   3.568 -68.275  1.00  0.38           C  
ATOM   5772  CG  GLU B 304      23.773   5.044 -68.101  1.00  0.38           C  
ATOM   5773  CD  GLU B 304      23.260   5.914 -69.217  1.00  0.38           C  
ATOM   5774  OE1 GLU B 304      22.477   6.866 -68.956  1.00  0.38           O  
ATOM   5775  OE2 GLU B 304      23.683   5.634 -70.364  1.00  0.38           O  
ATOM   5776  N   ARG B 305      21.055   2.812 -66.157  1.00  0.39           N  
ATOM   5777  CA  ARG B 305      19.964   3.338 -65.356  1.00  0.39           C  
ATOM   5778  C   ARG B 305      19.401   2.360 -64.332  1.00  0.39           C  
ATOM   5779  O   ARG B 305      18.312   2.571 -63.797  1.00  0.39           O  
ATOM   5780  CB  ARG B 305      18.822   3.827 -66.279  1.00  0.39           C  
ATOM   5781  CG  ARG B 305      19.201   5.069 -67.106  1.00  0.39           C  
ATOM   5782  CD  ARG B 305      19.441   6.325 -66.258  1.00  0.39           C  
ATOM   5783  NE  ARG B 305      20.859   6.742 -66.456  1.00  0.39           N  
ATOM   5784  CZ  ARG B 305      21.393   7.841 -65.932  1.00  0.39           C  
ATOM   5785  NH1 ARG B 305      20.914   8.452 -64.866  1.00  0.39           N  
ATOM   5786  NH2 ARG B 305      22.459   8.350 -66.525  1.00  0.39           N  
ATOM   5787  N   CYS B 306      20.114   1.265 -63.993  1.00  0.46           N  
ATOM   5788  CA  CYS B 306      19.591   0.249 -63.082  1.00  0.46           C  
ATOM   5789  C   CYS B 306      19.260   0.760 -61.687  1.00  0.46           C  
ATOM   5790  O   CYS B 306      18.194   0.492 -61.134  1.00  0.46           O  
ATOM   5791  CB  CYS B 306      20.588  -0.936 -62.969  1.00  0.46           C  
ATOM   5792  SG  CYS B 306      19.904  -2.372 -62.056  1.00  0.46           S  
ATOM   5793  N   THR B 307      20.175   1.539 -61.092  1.00  0.51           N  
ATOM   5794  CA  THR B 307      19.977   2.141 -59.779  1.00  0.51           C  
ATOM   5795  C   THR B 307      18.923   3.235 -59.791  1.00  0.51           C  
ATOM   5796  O   THR B 307      18.058   3.285 -58.918  1.00  0.51           O  
ATOM   5797  CB  THR B 307      21.284   2.640 -59.188  1.00  0.51           C  
ATOM   5798  OG1 THR B 307      22.229   1.573 -59.139  1.00  0.51           O  
ATOM   5799  CG2 THR B 307      21.096   3.121 -57.746  1.00  0.51           C  
ATOM   5800  N   ASP B 308      18.924   4.108 -60.821  1.00  0.50           N  
ATOM   5801  CA  ASP B 308      17.930   5.156 -60.991  1.00  0.50           C  
ATOM   5802  C   ASP B 308      16.518   4.624 -61.173  1.00  0.50           C  
ATOM   5803  O   ASP B 308      15.553   5.174 -60.647  1.00  0.50           O  
ATOM   5804  CB  ASP B 308      18.266   6.048 -62.186  1.00  0.50           C  
ATOM   5805  CG  ASP B 308      19.612   6.712 -61.963  1.00  0.50           C  
ATOM   5806  OD1 ASP B 308      20.076   7.007 -60.842  1.00  0.50           O  
ATOM   5807  OD2 ASP B 308      20.239   6.872 -63.020  1.00  0.50           O  
ATOM   5808  N   SER B 309      16.364   3.495 -61.896  1.00  0.59           N  
ATOM   5809  CA  SER B 309      15.097   2.785 -62.054  1.00  0.59           C  
ATOM   5810  C   SER B 309      14.475   2.354 -60.739  1.00  0.59           C  
ATOM   5811  O   SER B 309      13.279   2.522 -60.514  1.00  0.59           O  
ATOM   5812  CB  SER B 309      15.283   1.529 -62.946  1.00  0.59           C  
ATOM   5813  OG  SER B 309      14.053   0.860 -63.241  1.00  0.59           O  
ATOM   5814  N   LEU B 310      15.285   1.831 -59.800  1.00  0.61           N  
ATOM   5815  CA  LEU B 310      14.836   1.517 -58.456  1.00  0.61           C  
ATOM   5816  C   LEU B 310      14.377   2.743 -57.669  1.00  0.61           C  
ATOM   5817  O   LEU B 310      13.358   2.697 -56.981  1.00  0.61           O  
ATOM   5818  CB  LEU B 310      15.942   0.799 -57.657  1.00  0.61           C  
ATOM   5819  CG  LEU B 310      16.364  -0.586 -58.181  1.00  0.61           C  
ATOM   5820  CD1 LEU B 310      17.581  -1.073 -57.384  1.00  0.61           C  
ATOM   5821  CD2 LEU B 310      15.234  -1.619 -58.081  1.00  0.61           C  
ATOM   5822  N   VAL B 311      15.096   3.887 -57.777  1.00  0.59           N  
ATOM   5823  CA  VAL B 311      14.701   5.144 -57.145  1.00  0.59           C  
ATOM   5824  C   VAL B 311      13.352   5.629 -57.658  1.00  0.59           C  
ATOM   5825  O   VAL B 311      12.462   5.967 -56.879  1.00  0.59           O  
ATOM   5826  CB  VAL B 311      15.756   6.236 -57.347  1.00  0.59           C  
ATOM   5827  CG1 VAL B 311      15.304   7.605 -56.788  1.00  0.59           C  
ATOM   5828  CG2 VAL B 311      17.071   5.821 -56.661  1.00  0.59           C  
ATOM   5829  N   LEU B 312      13.148   5.593 -58.989  1.00  0.61           N  
ATOM   5830  CA  LEU B 312      11.893   5.933 -59.634  1.00  0.61           C  
ATOM   5831  C   LEU B 312      10.745   5.000 -59.263  1.00  0.61           C  
ATOM   5832  O   LEU B 312       9.626   5.442 -59.015  1.00  0.61           O  
ATOM   5833  CB  LEU B 312      12.106   6.002 -61.163  1.00  0.61           C  
ATOM   5834  CG  LEU B 312      10.909   6.511 -61.996  1.00  0.61           C  
ATOM   5835  CD1 LEU B 312      10.434   7.902 -61.550  1.00  0.61           C  
ATOM   5836  CD2 LEU B 312      11.280   6.547 -63.487  1.00  0.61           C  
ATOM   5837  N   GLN B 313      10.991   3.675 -59.147  1.00  0.64           N  
ATOM   5838  CA  GLN B 313      10.007   2.735 -58.625  1.00  0.64           C  
ATOM   5839  C   GLN B 313       9.563   3.078 -57.207  1.00  0.64           C  
ATOM   5840  O   GLN B 313       8.374   3.047 -56.898  1.00  0.64           O  
ATOM   5841  CB  GLN B 313      10.522   1.272 -58.654  1.00  0.64           C  
ATOM   5842  CG  GLN B 313      10.630   0.652 -60.064  1.00  0.64           C  
ATOM   5843  CD  GLN B 313      11.367  -0.690 -60.046  1.00  0.64           C  
ATOM   5844  OE1 GLN B 313      11.004  -1.668 -59.384  1.00  0.64           O  
ATOM   5845  NE2 GLN B 313      12.470  -0.756 -60.825  1.00  0.64           N  
ATOM   5846  N   CYS B 314      10.489   3.469 -56.311  1.00  0.65           N  
ATOM   5847  CA  CYS B 314      10.119   3.969 -55.000  1.00  0.65           C  
ATOM   5848  C   CYS B 314       9.302   5.253 -55.019  1.00  0.65           C  
ATOM   5849  O   CYS B 314       8.308   5.360 -54.304  1.00  0.65           O  
ATOM   5850  CB  CYS B 314      11.350   4.194 -54.112  1.00  0.65           C  
ATOM   5851  SG  CYS B 314      12.165   2.637 -53.646  1.00  0.65           S  
ATOM   5852  N   GLU B 315       9.663   6.241 -55.865  1.00  0.55           N  
ATOM   5853  CA  GLU B 315       8.893   7.465 -56.038  1.00  0.55           C  
ATOM   5854  C   GLU B 315       7.470   7.212 -56.528  1.00  0.55           C  
ATOM   5855  O   GLU B 315       6.501   7.774 -56.019  1.00  0.55           O  
ATOM   5856  CB  GLU B 315       9.589   8.438 -57.019  1.00  0.55           C  
ATOM   5857  CG  GLU B 315      10.908   9.048 -56.486  1.00  0.55           C  
ATOM   5858  CD  GLU B 315      11.471  10.144 -57.393  1.00  0.55           C  
ATOM   5859  OE1 GLU B 315      12.412  10.844 -56.933  1.00  0.55           O  
ATOM   5860  OE2 GLU B 315      10.945  10.333 -58.517  1.00  0.55           O  
ATOM   5861  N   LEU B 316       7.299   6.304 -57.507  1.00  0.59           N  
ATOM   5862  CA  LEU B 316       5.999   5.851 -57.963  1.00  0.59           C  
ATOM   5863  C   LEU B 316       5.203   5.109 -56.902  1.00  0.59           C  
ATOM   5864  O   LEU B 316       4.007   5.340 -56.745  1.00  0.59           O  
ATOM   5865  CB  LEU B 316       6.149   4.960 -59.212  1.00  0.59           C  
ATOM   5866  CG  LEU B 316       6.667   5.712 -60.452  1.00  0.59           C  
ATOM   5867  CD1 LEU B 316       7.110   4.723 -61.536  1.00  0.59           C  
ATOM   5868  CD2 LEU B 316       5.609   6.673 -61.013  1.00  0.59           C  
ATOM   5869  N   ALA B 317       5.862   4.238 -56.111  1.00  0.63           N  
ATOM   5870  CA  ALA B 317       5.269   3.527 -54.999  1.00  0.63           C  
ATOM   5871  C   ALA B 317       4.702   4.456 -53.937  1.00  0.63           C  
ATOM   5872  O   ALA B 317       3.597   4.257 -53.439  1.00  0.63           O  
ATOM   5873  CB  ALA B 317       6.290   2.533 -54.426  1.00  0.63           C  
ATOM   5874  N   LEU B 318       5.398   5.568 -53.632  1.00  0.50           N  
ATOM   5875  CA  LEU B 318       4.871   6.629 -52.792  1.00  0.50           C  
ATOM   5876  C   LEU B 318       3.573   7.227 -53.311  1.00  0.50           C  
ATOM   5877  O   LEU B 318       2.641   7.459 -52.545  1.00  0.50           O  
ATOM   5878  CB  LEU B 318       5.893   7.781 -52.634  1.00  0.50           C  
ATOM   5879  CG  LEU B 318       7.147   7.440 -51.812  1.00  0.50           C  
ATOM   5880  CD1 LEU B 318       8.096   8.646 -51.732  1.00  0.50           C  
ATOM   5881  CD2 LEU B 318       6.748   6.998 -50.407  1.00  0.50           C  
ATOM   5882  N   GLY B 319       3.463   7.443 -54.637  1.00  0.54           N  
ATOM   5883  CA  GLY B 319       2.281   8.027 -55.264  1.00  0.54           C  
ATOM   5884  C   GLY B 319       1.005   7.233 -55.145  1.00  0.54           C  
ATOM   5885  O   GLY B 319      -0.079   7.801 -55.239  1.00  0.54           O  
ATOM   5886  N   PHE B 320       1.088   5.904 -54.933  1.00  0.45           N  
ATOM   5887  CA  PHE B 320      -0.094   5.087 -54.706  1.00  0.45           C  
ATOM   5888  C   PHE B 320      -0.161   4.474 -53.320  1.00  0.45           C  
ATOM   5889  O   PHE B 320      -1.058   3.687 -53.026  1.00  0.45           O  
ATOM   5890  CB  PHE B 320      -0.278   3.998 -55.795  1.00  0.45           C  
ATOM   5891  CG  PHE B 320       0.836   2.995 -55.884  1.00  0.45           C  
ATOM   5892  CD1 PHE B 320       1.842   3.162 -56.841  1.00  0.45           C  
ATOM   5893  CD2 PHE B 320       0.850   1.847 -55.077  1.00  0.45           C  
ATOM   5894  CE1 PHE B 320       2.825   2.187 -57.017  1.00  0.45           C  
ATOM   5895  CE2 PHE B 320       1.839   0.869 -55.247  1.00  0.45           C  
ATOM   5896  CZ  PHE B 320       2.829   1.039 -56.219  1.00  0.45           C  
ATOM   5897  N   GLY B 321       0.761   4.834 -52.405  1.00  0.52           N  
ATOM   5898  CA  GLY B 321       0.732   4.303 -51.046  1.00  0.52           C  
ATOM   5899  C   GLY B 321       1.362   2.944 -50.876  1.00  0.52           C  
ATOM   5900  O   GLY B 321       1.122   2.262 -49.881  1.00  0.52           O  
ATOM   5901  N   GLY B 322       2.200   2.511 -51.834  1.00  0.52           N  
ATOM   5902  CA  GLY B 322       2.828   1.195 -51.873  1.00  0.52           C  
ATOM   5903  C   GLY B 322       3.951   1.004 -50.892  1.00  0.52           C  
ATOM   5904  O   GLY B 322       5.130   0.965 -51.238  1.00  0.52           O  
ATOM   5905  N   GLY B 323       3.598   0.859 -49.600  1.00  0.54           N  
ATOM   5906  CA  GLY B 323       4.552   0.647 -48.518  1.00  0.54           C  
ATOM   5907  C   GLY B 323       5.241  -0.687 -48.546  1.00  0.54           C  
ATOM   5908  O   GLY B 323       6.383  -0.816 -48.116  1.00  0.54           O  
ATOM   5909  N   ARG B 324       4.564  -1.724 -49.072  1.00  0.45           N  
ATOM   5910  CA  ARG B 324       5.150  -3.039 -49.236  1.00  0.45           C  
ATOM   5911  C   ARG B 324       6.210  -3.041 -50.322  1.00  0.45           C  
ATOM   5912  O   ARG B 324       7.324  -3.511 -50.120  1.00  0.45           O  
ATOM   5913  CB  ARG B 324       4.063  -4.084 -49.576  1.00  0.45           C  
ATOM   5914  CG  ARG B 324       3.108  -4.399 -48.405  1.00  0.45           C  
ATOM   5915  CD  ARG B 324       2.104  -5.502 -48.760  1.00  0.45           C  
ATOM   5916  NE  ARG B 324       1.263  -5.785 -47.545  1.00  0.45           N  
ATOM   5917  CZ  ARG B 324       0.429  -6.830 -47.439  1.00  0.45           C  
ATOM   5918  NH1 ARG B 324       0.306  -7.725 -48.413  1.00  0.45           N  
ATOM   5919  NH2 ARG B 324      -0.299  -6.986 -46.334  1.00  0.45           N  
ATOM   5920  N   GLU B 325       5.900  -2.427 -51.475  1.00  0.53           N  
ATOM   5921  CA  GLU B 325       6.759  -2.291 -52.625  1.00  0.53           C  
ATOM   5922  C   GLU B 325       8.036  -1.541 -52.291  1.00  0.53           C  
ATOM   5923  O   GLU B 325       9.136  -1.914 -52.689  1.00  0.53           O  
ATOM   5924  CB  GLU B 325       5.991  -1.551 -53.753  1.00  0.53           C  
ATOM   5925  CG  GLU B 325       4.773  -2.315 -54.356  1.00  0.53           C  
ATOM   5926  CD  GLU B 325       3.477  -2.345 -53.533  1.00  0.53           C  
ATOM   5927  OE1 GLU B 325       2.475  -2.857 -54.094  1.00  0.53           O  
ATOM   5928  OE2 GLU B 325       3.450  -1.867 -52.367  1.00  0.53           O  
ATOM   5929  N   ILE B 326       7.926  -0.469 -51.488  1.00  0.54           N  
ATOM   5930  CA  ILE B 326       9.068   0.237 -50.933  1.00  0.54           C  
ATOM   5931  C   ILE B 326       9.929  -0.614 -50.011  1.00  0.54           C  
ATOM   5932  O   ILE B 326      11.158  -0.552 -50.069  1.00  0.54           O  
ATOM   5933  CB  ILE B 326       8.607   1.495 -50.223  1.00  0.54           C  
ATOM   5934  CG1 ILE B 326       8.047   2.477 -51.272  1.00  0.54           C  
ATOM   5935  CG2 ILE B 326       9.772   2.135 -49.449  1.00  0.54           C  
ATOM   5936  CD1 ILE B 326       7.293   3.658 -50.669  1.00  0.54           C  
ATOM   5937  N   ALA B 327       9.314  -1.444 -49.146  1.00  0.55           N  
ATOM   5938  CA  ALA B 327      10.020  -2.343 -48.262  1.00  0.55           C  
ATOM   5939  C   ALA B 327      10.878  -3.349 -49.018  1.00  0.55           C  
ATOM   5940  O   ALA B 327      12.038  -3.546 -48.671  1.00  0.55           O  
ATOM   5941  CB  ALA B 327       9.010  -3.049 -47.339  1.00  0.55           C  
ATOM   5942  N   ASP B 328      10.359  -3.944 -50.107  1.00  0.54           N  
ATOM   5943  CA  ASP B 328      11.116  -4.767 -51.029  1.00  0.54           C  
ATOM   5944  C   ASP B 328      12.248  -4.021 -51.756  1.00  0.54           C  
ATOM   5945  O   ASP B 328      13.373  -4.507 -51.876  1.00  0.54           O  
ATOM   5946  CB  ASP B 328      10.149  -5.363 -52.087  1.00  0.54           C  
ATOM   5947  CG  ASP B 328       9.151  -6.353 -51.496  1.00  0.54           C  
ATOM   5948  OD1 ASP B 328       9.312  -6.773 -50.324  1.00  0.54           O  
ATOM   5949  OD2 ASP B 328       8.224  -6.727 -52.261  1.00  0.54           O  
ATOM   5950  N   LEU B 329      11.993  -2.802 -52.276  1.00  0.59           N  
ATOM   5951  CA  LEU B 329      12.964  -2.007 -53.013  1.00  0.59           C  
ATOM   5952  C   LEU B 329      14.097  -1.381 -52.205  1.00  0.59           C  
ATOM   5953  O   LEU B 329      15.230  -1.287 -52.679  1.00  0.59           O  
ATOM   5954  CB  LEU B 329      12.259  -0.901 -53.824  1.00  0.59           C  
ATOM   5955  CG  LEU B 329      11.333  -1.416 -54.940  1.00  0.59           C  
ATOM   5956  CD1 LEU B 329      10.452  -0.265 -55.430  1.00  0.59           C  
ATOM   5957  CD2 LEU B 329      12.094  -2.025 -56.125  1.00  0.59           C  
ATOM   5958  N   ALA B 330      13.848  -0.915 -50.969  1.00  0.53           N  
ATOM   5959  CA  ALA B 330      14.833  -0.226 -50.153  1.00  0.53           C  
ATOM   5960  C   ALA B 330      16.122  -1.015 -49.850  1.00  0.53           C  
ATOM   5961  O   ALA B 330      17.202  -0.428 -49.975  1.00  0.53           O  
ATOM   5962  CB  ALA B 330      14.145   0.319 -48.885  1.00  0.53           C  
ATOM   5963  N   PRO B 331      16.145  -2.313 -49.533  1.00  0.44           N  
ATOM   5964  CA  PRO B 331      17.381  -3.077 -49.422  1.00  0.44           C  
ATOM   5965  C   PRO B 331      18.180  -3.120 -50.710  1.00  0.44           C  
ATOM   5966  O   PRO B 331      19.409  -3.079 -50.657  1.00  0.44           O  
ATOM   5967  CB  PRO B 331      16.928  -4.483 -48.989  1.00  0.44           C  
ATOM   5968  CG  PRO B 331      15.588  -4.245 -48.292  1.00  0.44           C  
ATOM   5969  CD  PRO B 331      14.993  -3.095 -49.094  1.00  0.44           C  
ATOM   5970  N   LEU B 332      17.510  -3.194 -51.879  1.00  0.55           N  
ATOM   5971  CA  LEU B 332      18.158  -3.175 -53.177  1.00  0.55           C  
ATOM   5972  C   LEU B 332      18.870  -1.860 -53.463  1.00  0.55           C  
ATOM   5973  O   LEU B 332      19.980  -1.848 -53.987  1.00  0.55           O  
ATOM   5974  CB  LEU B 332      17.162  -3.471 -54.323  1.00  0.55           C  
ATOM   5975  CG  LEU B 332      16.422  -4.822 -54.234  1.00  0.55           C  
ATOM   5976  CD1 LEU B 332      15.396  -4.923 -55.374  1.00  0.55           C  
ATOM   5977  CD2 LEU B 332      17.374  -6.027 -54.282  1.00  0.55           C  
ATOM   5978  N   LEU B 333      18.257  -0.713 -53.104  1.00  0.49           N  
ATOM   5979  CA  LEU B 333      18.895   0.592 -53.177  1.00  0.49           C  
ATOM   5980  C   LEU B 333      20.107   0.707 -52.271  1.00  0.49           C  
ATOM   5981  O   LEU B 333      21.171   1.160 -52.692  1.00  0.49           O  
ATOM   5982  CB  LEU B 333      17.891   1.709 -52.814  1.00  0.49           C  
ATOM   5983  CG  LEU B 333      16.877   2.036 -53.923  1.00  0.49           C  
ATOM   5984  CD1 LEU B 333      15.805   3.001 -53.398  1.00  0.49           C  
ATOM   5985  CD2 LEU B 333      17.570   2.650 -55.147  1.00  0.49           C  
ATOM   5986  N   HIS B 334      19.992   0.227 -51.018  1.00  0.33           N  
ATOM   5987  CA  HIS B 334      21.081   0.232 -50.056  1.00  0.33           C  
ATOM   5988  C   HIS B 334      22.293  -0.562 -50.529  1.00  0.33           C  
ATOM   5989  O   HIS B 334      23.430  -0.100 -50.465  1.00  0.33           O  
ATOM   5990  CB  HIS B 334      20.584  -0.328 -48.706  1.00  0.33           C  
ATOM   5991  CG  HIS B 334      21.611  -0.279 -47.625  1.00  0.33           C  
ATOM   5992  ND1 HIS B 334      21.832   0.910 -46.966  1.00  0.33           N  
ATOM   5993  CD2 HIS B 334      22.484  -1.227 -47.199  1.00  0.33           C  
ATOM   5994  CE1 HIS B 334      22.834   0.668 -46.149  1.00  0.33           C  
ATOM   5995  NE2 HIS B 334      23.271  -0.611 -46.251  1.00  0.33           N  
ATOM   5996  N   ALA B 335      22.062  -1.758 -51.107  1.00  0.50           N  
ATOM   5997  CA  ALA B 335      23.099  -2.616 -51.636  1.00  0.50           C  
ATOM   5998  C   ALA B 335      23.800  -2.049 -52.870  1.00  0.50           C  
ATOM   5999  O   ALA B 335      24.912  -2.443 -53.209  1.00  0.50           O  
ATOM   6000  CB  ALA B 335      22.455  -3.975 -51.968  1.00  0.50           C  
ATOM   6001  N   ARG B 336      23.175  -1.074 -53.556  1.00  0.40           N  
ATOM   6002  CA  ARG B 336      23.744  -0.426 -54.720  1.00  0.40           C  
ATOM   6003  C   ARG B 336      24.347   0.930 -54.395  1.00  0.40           C  
ATOM   6004  O   ARG B 336      24.621   1.725 -55.294  1.00  0.40           O  
ATOM   6005  CB  ARG B 336      22.669  -0.256 -55.817  1.00  0.40           C  
ATOM   6006  CG  ARG B 336      22.212  -1.608 -56.391  1.00  0.40           C  
ATOM   6007  CD  ARG B 336      21.170  -1.480 -57.506  1.00  0.40           C  
ATOM   6008  NE  ARG B 336      21.864  -1.621 -58.827  1.00  0.40           N  
ATOM   6009  CZ  ARG B 336      22.180  -2.804 -59.376  1.00  0.40           C  
ATOM   6010  NH1 ARG B 336      21.829  -3.952 -58.801  1.00  0.40           N  
ATOM   6011  NH2 ARG B 336      22.864  -2.845 -60.516  1.00  0.40           N  
ATOM   6012  N   GLY B 337      24.582   1.236 -53.101  1.00  0.37           N  
ATOM   6013  CA  GLY B 337      25.281   2.456 -52.717  1.00  0.37           C  
ATOM   6014  C   GLY B 337      24.397   3.662 -52.668  1.00  0.37           C  
ATOM   6015  O   GLY B 337      24.842   4.789 -52.876  1.00  0.37           O  
ATOM   6016  N   ARG B 338      23.103   3.451 -52.387  1.00  0.28           N  
ATOM   6017  CA  ARG B 338      22.165   4.523 -52.141  1.00  0.28           C  
ATOM   6018  C   ARG B 338      21.521   4.374 -50.761  1.00  0.28           C  
ATOM   6019  O   ARG B 338      20.316   4.112 -50.669  1.00  0.28           O  
ATOM   6020  CB  ARG B 338      21.086   4.535 -53.256  1.00  0.28           C  
ATOM   6021  CG  ARG B 338      21.623   4.761 -54.689  1.00  0.28           C  
ATOM   6022  CD  ARG B 338      22.418   6.062 -54.838  1.00  0.28           C  
ATOM   6023  NE  ARG B 338      22.721   6.300 -56.291  1.00  0.28           N  
ATOM   6024  CZ  ARG B 338      23.745   7.052 -56.713  1.00  0.28           C  
ATOM   6025  NH1 ARG B 338      24.640   7.545 -55.860  1.00  0.28           N  
ATOM   6026  NH2 ARG B 338      23.877   7.317 -58.012  1.00  0.28           N  
ATOM   6027  N   PRO B 339      22.260   4.496 -49.644  1.00  0.35           N  
ATOM   6028  CA  PRO B 339      21.709   4.273 -48.315  1.00  0.35           C  
ATOM   6029  C   PRO B 339      20.739   5.359 -47.887  1.00  0.35           C  
ATOM   6030  O   PRO B 339      19.777   5.040 -47.192  1.00  0.35           O  
ATOM   6031  CB  PRO B 339      22.947   4.221 -47.402  1.00  0.35           C  
ATOM   6032  CG  PRO B 339      23.974   5.102 -48.114  1.00  0.35           C  
ATOM   6033  CD  PRO B 339      23.694   4.814 -49.588  1.00  0.35           C  
ATOM   6034  N   LEU B 340      20.945   6.648 -48.258  1.00  0.30           N  
ATOM   6035  CA  LEU B 340      20.020   7.712 -47.895  1.00  0.30           C  
ATOM   6036  C   LEU B 340      18.676   7.516 -48.551  1.00  0.30           C  
ATOM   6037  O   LEU B 340      17.632   7.600 -47.908  1.00  0.30           O  
ATOM   6038  CB  LEU B 340      20.523   9.145 -48.247  1.00  0.30           C  
ATOM   6039  CG  LEU B 340      19.535  10.291 -47.875  1.00  0.30           C  
ATOM   6040  CD1 LEU B 340      19.050  10.219 -46.415  1.00  0.30           C  
ATOM   6041  CD2 LEU B 340      20.048  11.697 -48.214  1.00  0.30           C  
ATOM   6042  N   GLU B 341      18.662   7.204 -49.853  1.00  0.34           N  
ATOM   6043  CA  GLU B 341      17.462   6.974 -50.613  1.00  0.34           C  
ATOM   6044  C   GLU B 341      16.672   5.793 -50.094  1.00  0.34           C  
ATOM   6045  O   GLU B 341      15.458   5.866 -49.914  1.00  0.34           O  
ATOM   6046  CB  GLU B 341      17.812   6.779 -52.100  1.00  0.34           C  
ATOM   6047  CG  GLU B 341      18.462   8.020 -52.744  1.00  0.34           C  
ATOM   6048  CD  GLU B 341      19.975   8.064 -52.657  1.00  0.34           C  
ATOM   6049  OE1 GLU B 341      20.569   8.649 -53.595  1.00  0.34           O  
ATOM   6050  OE2 GLU B 341      20.574   7.488 -51.713  1.00  0.34           O  
ATOM   6051  N   ALA B 342      17.362   4.689 -49.759  1.00  0.44           N  
ATOM   6052  CA  ALA B 342      16.768   3.533 -49.131  1.00  0.44           C  
ATOM   6053  C   ALA B 342      16.096   3.845 -47.793  1.00  0.44           C  
ATOM   6054  O   ALA B 342      14.928   3.512 -47.582  1.00  0.44           O  
ATOM   6055  CB  ALA B 342      17.888   2.495 -48.969  1.00  0.44           C  
ATOM   6056  N   SER B 343      16.787   4.586 -46.900  1.00  0.42           N  
ATOM   6057  CA  SER B 343      16.218   5.091 -45.658  1.00  0.42           C  
ATOM   6058  C   SER B 343      15.054   6.045 -45.872  1.00  0.42           C  
ATOM   6059  O   SER B 343      14.037   5.947 -45.186  1.00  0.42           O  
ATOM   6060  CB  SER B 343      17.263   5.815 -44.773  1.00  0.42           C  
ATOM   6061  OG  SER B 343      18.282   4.920 -44.331  1.00  0.42           O  
ATOM   6062  N   TYR B 344      15.161   6.989 -46.844  1.00  0.35           N  
ATOM   6063  CA  TYR B 344      14.133   7.959 -47.216  1.00  0.35           C  
ATOM   6064  C   TYR B 344      12.824   7.306 -47.543  1.00  0.35           C  
ATOM   6065  O   TYR B 344      11.788   7.591 -46.938  1.00  0.35           O  
ATOM   6066  CB  TYR B 344      14.622   8.900 -48.351  1.00  0.35           C  
ATOM   6067  CG  TYR B 344      13.543   9.866 -48.777  1.00  0.35           C  
ATOM   6068  CD1 TYR B 344      12.869   9.690 -49.995  1.00  0.35           C  
ATOM   6069  CD2 TYR B 344      13.111  10.876 -47.911  1.00  0.35           C  
ATOM   6070  CE1 TYR B 344      11.777  10.504 -50.332  1.00  0.35           C  
ATOM   6071  CE2 TYR B 344      12.027  11.697 -48.253  1.00  0.35           C  
ATOM   6072  CZ  TYR B 344      11.349  11.504 -49.457  1.00  0.35           C  
ATOM   6073  OH  TYR B 344      10.238  12.313 -49.771  1.00  0.35           O  
ATOM   6074  N   TYR B 345      12.863   6.362 -48.483  1.00  0.38           N  
ATOM   6075  CA  TYR B 345      11.664   5.685 -48.892  1.00  0.38           C  
ATOM   6076  C   TYR B 345      11.063   4.834 -47.784  1.00  0.38           C  
ATOM   6077  O   TYR B 345       9.855   4.887 -47.555  1.00  0.38           O  
ATOM   6078  CB  TYR B 345      11.912   4.892 -50.195  1.00  0.38           C  
ATOM   6079  CG  TYR B 345      12.232   5.852 -51.307  1.00  0.38           C  
ATOM   6080  CD1 TYR B 345      11.287   6.826 -51.663  1.00  0.38           C  
ATOM   6081  CD2 TYR B 345      13.444   5.802 -52.016  1.00  0.38           C  
ATOM   6082  CE1 TYR B 345      11.588   7.791 -52.627  1.00  0.38           C  
ATOM   6083  CE2 TYR B 345      13.752   6.777 -52.978  1.00  0.38           C  
ATOM   6084  CZ  TYR B 345      12.828   7.786 -53.263  1.00  0.38           C  
ATOM   6085  OH  TYR B 345      13.132   8.842 -54.136  1.00  0.38           O  
ATOM   6086  N   GLN B 346      11.888   4.075 -47.031  1.00  0.43           N  
ATOM   6087  CA  GLN B 346      11.417   3.230 -45.948  1.00  0.43           C  
ATOM   6088  C   GLN B 346      10.742   3.997 -44.819  1.00  0.43           C  
ATOM   6089  O   GLN B 346       9.637   3.665 -44.391  1.00  0.43           O  
ATOM   6090  CB  GLN B 346      12.608   2.421 -45.382  1.00  0.43           C  
ATOM   6091  CG  GLN B 346      12.197   1.338 -44.359  1.00  0.43           C  
ATOM   6092  CD  GLN B 346      13.386   0.487 -43.910  1.00  0.43           C  
ATOM   6093  OE1 GLN B 346      14.481   0.506 -44.468  1.00  0.43           O  
ATOM   6094  NE2 GLN B 346      13.147  -0.327 -42.855  1.00  0.43           N  
ATOM   6095  N   ALA B 347      11.368   5.099 -44.360  1.00  0.44           N  
ATOM   6096  CA  ALA B 347      10.825   5.965 -43.348  1.00  0.44           C  
ATOM   6097  C   ALA B 347       9.527   6.637 -43.766  1.00  0.44           C  
ATOM   6098  O   ALA B 347       8.581   6.716 -42.985  1.00  0.44           O  
ATOM   6099  CB  ALA B 347      11.877   6.995 -42.915  1.00  0.44           C  
ATOM   6100  N   PHE B 348       9.418   7.110 -45.029  1.00  0.39           N  
ATOM   6101  CA  PHE B 348       8.182   7.696 -45.529  1.00  0.39           C  
ATOM   6102  C   PHE B 348       7.051   6.682 -45.574  1.00  0.39           C  
ATOM   6103  O   PHE B 348       5.933   6.950 -45.132  1.00  0.39           O  
ATOM   6104  CB  PHE B 348       8.368   8.332 -46.936  1.00  0.39           C  
ATOM   6105  CG  PHE B 348       7.210   9.233 -47.320  1.00  0.39           C  
ATOM   6106  CD1 PHE B 348       5.986   8.696 -47.760  1.00  0.39           C  
ATOM   6107  CD2 PHE B 348       7.320  10.631 -47.238  1.00  0.39           C  
ATOM   6108  CE1 PHE B 348       4.911   9.516 -48.104  1.00  0.39           C  
ATOM   6109  CE2 PHE B 348       6.238  11.457 -47.565  1.00  0.39           C  
ATOM   6110  CZ  PHE B 348       5.032  10.899 -47.992  1.00  0.39           C  
ATOM   6111  N   ALA B 349       7.331   5.470 -46.086  1.00  0.51           N  
ATOM   6112  CA  ALA B 349       6.362   4.406 -46.180  1.00  0.51           C  
ATOM   6113  C   ALA B 349       5.792   3.971 -44.835  1.00  0.51           C  
ATOM   6114  O   ALA B 349       4.575   3.885 -44.660  1.00  0.51           O  
ATOM   6115  CB  ALA B 349       7.057   3.215 -46.858  1.00  0.51           C  
ATOM   6116  N   GLU B 350       6.670   3.760 -43.836  1.00  0.44           N  
ATOM   6117  CA  GLU B 350       6.298   3.429 -42.479  1.00  0.44           C  
ATOM   6118  C   GLU B 350       5.541   4.550 -41.791  1.00  0.44           C  
ATOM   6119  O   GLU B 350       4.524   4.310 -41.147  1.00  0.44           O  
ATOM   6120  CB  GLU B 350       7.546   3.063 -41.669  1.00  0.44           C  
ATOM   6121  CG  GLU B 350       8.263   1.802 -42.176  1.00  0.44           C  
ATOM   6122  CD  GLU B 350       7.634   0.554 -41.667  1.00  0.44           C  
ATOM   6123  OE1 GLU B 350       8.396  -0.169 -40.934  1.00  0.44           O  
ATOM   6124  OE2 GLU B 350       6.426   0.268 -41.880  1.00  0.44           O  
ATOM   6125  N   PHE B 351       5.968   5.825 -41.956  1.00  0.39           N  
ATOM   6126  CA  PHE B 351       5.262   6.991 -41.425  1.00  0.39           C  
ATOM   6127  C   PHE B 351       3.833   7.105 -41.958  1.00  0.39           C  
ATOM   6128  O   PHE B 351       2.879   7.298 -41.206  1.00  0.39           O  
ATOM   6129  CB  PHE B 351       6.077   8.277 -41.747  1.00  0.39           C  
ATOM   6130  CG  PHE B 351       5.420   9.556 -41.289  1.00  0.39           C  
ATOM   6131  CD1 PHE B 351       4.927  10.465 -42.238  1.00  0.39           C  
ATOM   6132  CD2 PHE B 351       5.241   9.842 -39.926  1.00  0.39           C  
ATOM   6133  CE1 PHE B 351       4.249  11.617 -41.834  1.00  0.39           C  
ATOM   6134  CE2 PHE B 351       4.588  11.013 -39.521  1.00  0.39           C  
ATOM   6135  CZ  PHE B 351       4.082  11.901 -40.474  1.00  0.39           C  
ATOM   6136  N   SER B 352       3.653   6.915 -43.274  1.00  0.52           N  
ATOM   6137  CA  SER B 352       2.353   6.858 -43.927  1.00  0.52           C  
ATOM   6138  C   SER B 352       1.471   5.718 -43.430  1.00  0.52           C  
ATOM   6139  O   SER B 352       0.286   5.889 -43.140  1.00  0.52           O  
ATOM   6140  CB  SER B 352       2.582   6.721 -45.448  1.00  0.52           C  
ATOM   6141  OG  SER B 352       1.376   6.867 -46.196  1.00  0.52           O  
ATOM   6142  N   ALA B 353       2.055   4.515 -43.245  1.00  0.52           N  
ATOM   6143  CA  ALA B 353       1.385   3.372 -42.661  1.00  0.52           C  
ATOM   6144  C   ALA B 353       0.905   3.628 -41.232  1.00  0.52           C  
ATOM   6145  O   ALA B 353      -0.213   3.259 -40.861  1.00  0.52           O  
ATOM   6146  CB  ALA B 353       2.328   2.152 -42.704  1.00  0.52           C  
ATOM   6147  N   LEU B 354       1.733   4.301 -40.401  1.00  0.44           N  
ATOM   6148  CA  LEU B 354       1.368   4.720 -39.056  1.00  0.44           C  
ATOM   6149  C   LEU B 354       0.222   5.709 -39.028  1.00  0.44           C  
ATOM   6150  O   LEU B 354      -0.734   5.534 -38.274  1.00  0.44           O  
ATOM   6151  CB  LEU B 354       2.557   5.350 -38.288  1.00  0.44           C  
ATOM   6152  CG  LEU B 354       3.700   4.375 -37.962  1.00  0.44           C  
ATOM   6153  CD1 LEU B 354       4.952   5.113 -37.489  1.00  0.44           C  
ATOM   6154  CD2 LEU B 354       3.332   3.161 -37.106  1.00  0.44           C  
ATOM   6155  N   LEU B 355       0.255   6.747 -39.889  1.00  0.49           N  
ATOM   6156  CA  LEU B 355      -0.822   7.714 -39.993  1.00  0.49           C  
ATOM   6157  C   LEU B 355      -2.138   7.080 -40.424  1.00  0.49           C  
ATOM   6158  O   LEU B 355      -3.182   7.302 -39.809  1.00  0.49           O  
ATOM   6159  CB  LEU B 355      -0.458   8.831 -40.997  1.00  0.49           C  
ATOM   6160  CG  LEU B 355       0.608   9.845 -40.530  1.00  0.49           C  
ATOM   6161  CD1 LEU B 355       0.927  10.797 -41.691  1.00  0.49           C  
ATOM   6162  CD2 LEU B 355       0.175  10.661 -39.304  1.00  0.49           C  
ATOM   6163  N   SER B 356      -2.104   6.206 -41.449  1.00  0.52           N  
ATOM   6164  CA  SER B 356      -3.256   5.443 -41.910  1.00  0.52           C  
ATOM   6165  C   SER B 356      -3.828   4.516 -40.854  1.00  0.52           C  
ATOM   6166  O   SER B 356      -5.041   4.373 -40.710  1.00  0.52           O  
ATOM   6167  CB  SER B 356      -2.921   4.606 -43.168  1.00  0.52           C  
ATOM   6168  OG  SER B 356      -2.743   5.462 -44.291  1.00  0.52           O  
ATOM   6169  N   ARG B 357      -2.973   3.846 -40.056  1.00  0.46           N  
ATOM   6170  CA  ARG B 357      -3.416   3.055 -38.922  1.00  0.46           C  
ATOM   6171  C   ARG B 357      -4.071   3.875 -37.816  1.00  0.46           C  
ATOM   6172  O   ARG B 357      -5.152   3.522 -37.352  1.00  0.46           O  
ATOM   6173  CB  ARG B 357      -2.250   2.199 -38.377  1.00  0.46           C  
ATOM   6174  CG  ARG B 357      -2.667   1.131 -37.340  1.00  0.46           C  
ATOM   6175  CD  ARG B 357      -1.494   0.254 -36.883  1.00  0.46           C  
ATOM   6176  NE  ARG B 357      -2.011  -0.755 -35.900  1.00  0.46           N  
ATOM   6177  CZ  ARG B 357      -1.241  -1.659 -35.274  1.00  0.46           C  
ATOM   6178  NH1 ARG B 357       0.043  -1.805 -35.586  1.00  0.46           N  
ATOM   6179  NH2 ARG B 357      -1.756  -2.431 -34.321  1.00  0.46           N  
ATOM   6180  N   SER B 358      -3.481   5.023 -37.425  1.00  0.56           N  
ATOM   6181  CA  SER B 358      -4.057   5.948 -36.452  1.00  0.56           C  
ATOM   6182  C   SER B 358      -5.388   6.511 -36.877  1.00  0.56           C  
ATOM   6183  O   SER B 358      -6.326   6.611 -36.088  1.00  0.56           O  
ATOM   6184  CB  SER B 358      -3.140   7.167 -36.216  1.00  0.56           C  
ATOM   6185  OG  SER B 358      -1.927   6.748 -35.607  1.00  0.56           O  
ATOM   6186  N   SER B 359      -5.507   6.880 -38.165  1.00  0.56           N  
ATOM   6187  CA  SER B 359      -6.755   7.355 -38.735  1.00  0.56           C  
ATOM   6188  C   SER B 359      -7.859   6.306 -38.700  1.00  0.56           C  
ATOM   6189  O   SER B 359      -8.970   6.580 -38.260  1.00  0.56           O  
ATOM   6190  CB  SER B 359      -6.553   7.880 -40.174  1.00  0.56           C  
ATOM   6191  OG  SER B 359      -7.604   8.780 -40.533  1.00  0.56           O  
ATOM   6192  N   ARG B 360      -7.545   5.039 -39.063  1.00  0.49           N  
ATOM   6193  CA  ARG B 360      -8.475   3.925 -38.938  1.00  0.49           C  
ATOM   6194  C   ARG B 360      -8.909   3.632 -37.507  1.00  0.49           C  
ATOM   6195  O   ARG B 360     -10.085   3.378 -37.254  1.00  0.49           O  
ATOM   6196  CB  ARG B 360      -7.896   2.619 -39.541  1.00  0.49           C  
ATOM   6197  CG  ARG B 360      -7.876   2.598 -41.084  1.00  0.49           C  
ATOM   6198  CD  ARG B 360      -7.546   1.228 -41.693  1.00  0.49           C  
ATOM   6199  NE  ARG B 360      -6.115   0.931 -41.375  1.00  0.49           N  
ATOM   6200  CZ  ARG B 360      -5.497  -0.221 -41.676  1.00  0.49           C  
ATOM   6201  NH1 ARG B 360      -6.134  -1.220 -42.282  1.00  0.49           N  
ATOM   6202  NH2 ARG B 360      -4.212  -0.374 -41.368  1.00  0.49           N  
ATOM   6203  N   LEU B 361      -7.980   3.675 -36.527  1.00  0.54           N  
ATOM   6204  CA  LEU B 361      -8.311   3.509 -35.118  1.00  0.54           C  
ATOM   6205  C   LEU B 361      -9.287   4.567 -34.619  1.00  0.54           C  
ATOM   6206  O   LEU B 361     -10.232   4.271 -33.889  1.00  0.54           O  
ATOM   6207  CB  LEU B 361      -7.042   3.538 -34.230  1.00  0.54           C  
ATOM   6208  CG  LEU B 361      -6.150   2.282 -34.327  1.00  0.54           C  
ATOM   6209  CD1 LEU B 361      -4.818   2.523 -33.598  1.00  0.54           C  
ATOM   6210  CD2 LEU B 361      -6.847   1.039 -33.750  1.00  0.54           C  
ATOM   6211  N   LEU B 362      -9.102   5.831 -35.047  1.00  0.52           N  
ATOM   6212  CA  LEU B 362     -10.028   6.909 -34.776  1.00  0.52           C  
ATOM   6213  C   LEU B 362     -11.409   6.684 -35.367  1.00  0.52           C  
ATOM   6214  O   LEU B 362     -12.408   6.835 -34.670  1.00  0.52           O  
ATOM   6215  CB  LEU B 362      -9.430   8.224 -35.308  1.00  0.52           C  
ATOM   6216  CG  LEU B 362     -10.321   9.473 -35.210  1.00  0.52           C  
ATOM   6217  CD1 LEU B 362     -10.774   9.748 -33.777  1.00  0.52           C  
ATOM   6218  CD2 LEU B 362      -9.539  10.668 -35.747  1.00  0.52           C  
ATOM   6219  N   ASP B 363     -11.512   6.251 -36.639  1.00  0.50           N  
ATOM   6220  CA  ASP B 363     -12.788   5.937 -37.260  1.00  0.50           C  
ATOM   6221  C   ASP B 363     -13.531   4.810 -36.545  1.00  0.50           C  
ATOM   6222  O   ASP B 363     -14.729   4.907 -36.286  1.00  0.50           O  
ATOM   6223  CB  ASP B 363     -12.594   5.589 -38.755  1.00  0.50           C  
ATOM   6224  CG  ASP B 363     -12.204   6.813 -39.568  1.00  0.50           C  
ATOM   6225  OD1 ASP B 363     -12.663   7.941 -39.232  1.00  0.50           O  
ATOM   6226  OD2 ASP B 363     -11.412   6.661 -40.531  1.00  0.50           O  
ATOM   6227  N   GLN B 364     -12.823   3.735 -36.142  1.00  0.50           N  
ATOM   6228  CA  GLN B 364     -13.387   2.656 -35.350  1.00  0.50           C  
ATOM   6229  C   GLN B 364     -13.918   3.100 -33.988  1.00  0.50           C  
ATOM   6230  O   GLN B 364     -15.030   2.742 -33.596  1.00  0.50           O  
ATOM   6231  CB  GLN B 364     -12.322   1.549 -35.157  1.00  0.50           C  
ATOM   6232  CG  GLN B 364     -11.983   0.787 -36.460  1.00  0.50           C  
ATOM   6233  CD  GLN B 364     -10.817  -0.180 -36.254  1.00  0.50           C  
ATOM   6234  OE1 GLN B 364     -10.076  -0.147 -35.273  1.00  0.50           O  
ATOM   6235  NE2 GLN B 364     -10.630  -1.098 -37.233  1.00  0.50           N  
ATOM   6236  N   LEU B 365     -13.155   3.929 -33.244  1.00  0.42           N  
ATOM   6237  CA  LEU B 365     -13.607   4.519 -31.995  1.00  0.42           C  
ATOM   6238  C   LEU B 365     -14.772   5.482 -32.160  1.00  0.42           C  
ATOM   6239  O   LEU B 365     -15.744   5.434 -31.408  1.00  0.42           O  
ATOM   6240  CB  LEU B 365     -12.452   5.268 -31.299  1.00  0.42           C  
ATOM   6241  CG  LEU B 365     -11.375   4.368 -30.668  1.00  0.42           C  
ATOM   6242  CD1 LEU B 365     -10.183   5.235 -30.250  1.00  0.42           C  
ATOM   6243  CD2 LEU B 365     -11.907   3.586 -29.457  1.00  0.42           C  
ATOM   6244  N   SER B 366     -14.717   6.365 -33.177  1.00  0.54           N  
ATOM   6245  CA  SER B 366     -15.784   7.299 -33.502  1.00  0.54           C  
ATOM   6246  C   SER B 366     -17.075   6.608 -33.860  1.00  0.54           C  
ATOM   6247  O   SER B 366     -18.136   7.020 -33.399  1.00  0.54           O  
ATOM   6248  CB  SER B 366     -15.424   8.232 -34.685  1.00  0.54           C  
ATOM   6249  OG  SER B 366     -14.434   9.177 -34.290  1.00  0.54           O  
ATOM   6250  N   GLU B 367     -17.025   5.526 -34.662  1.00  0.44           N  
ATOM   6251  CA  GLU B 367     -18.198   4.738 -34.987  1.00  0.44           C  
ATOM   6252  C   GLU B 367     -18.820   4.064 -33.773  1.00  0.44           C  
ATOM   6253  O   GLU B 367     -20.012   4.188 -33.513  1.00  0.44           O  
ATOM   6254  CB  GLU B 367     -17.852   3.680 -36.060  1.00  0.44           C  
ATOM   6255  CG  GLU B 367     -19.082   3.039 -36.753  1.00  0.44           C  
ATOM   6256  CD  GLU B 367     -19.930   3.998 -37.599  1.00  0.44           C  
ATOM   6257  OE1 GLU B 367     -20.896   3.479 -38.218  1.00  0.44           O  
ATOM   6258  OE2 GLU B 367     -19.664   5.230 -37.641  1.00  0.44           O  
ATOM   6259  N   GLY B 368     -18.006   3.412 -32.910  1.00  0.37           N  
ATOM   6260  CA  GLY B 368     -18.516   2.747 -31.708  1.00  0.37           C  
ATOM   6261  C   GLY B 368     -19.197   3.656 -30.713  1.00  0.37           C  
ATOM   6262  O   GLY B 368     -20.157   3.265 -30.056  1.00  0.37           O  
ATOM   6263  N   SER B 369     -18.751   4.923 -30.619  1.00  0.35           N  
ATOM   6264  CA  SER B 369     -19.395   5.933 -29.790  1.00  0.35           C  
ATOM   6265  C   SER B 369     -20.693   6.478 -30.374  1.00  0.35           C  
ATOM   6266  O   SER B 369     -21.500   7.051 -29.646  1.00  0.35           O  
ATOM   6267  CB  SER B 369     -18.466   7.153 -29.535  1.00  0.35           C  
ATOM   6268  OG  SER B 369     -17.366   6.818 -28.682  1.00  0.35           O  
ATOM   6269  N   ARG B 370     -20.953   6.320 -31.693  1.00  0.28           N  
ATOM   6270  CA  ARG B 370     -22.200   6.743 -32.314  1.00  0.28           C  
ATOM   6271  C   ARG B 370     -23.352   5.793 -32.045  1.00  0.28           C  
ATOM   6272  O   ARG B 370     -24.500   6.213 -31.903  1.00  0.28           O  
ATOM   6273  CB  ARG B 370     -22.068   6.922 -33.848  1.00  0.28           C  
ATOM   6274  CG  ARG B 370     -21.205   8.126 -34.264  1.00  0.28           C  
ATOM   6275  CD  ARG B 370     -21.072   8.228 -35.784  1.00  0.28           C  
ATOM   6276  NE  ARG B 370     -20.162   9.387 -36.064  1.00  0.28           N  
ATOM   6277  CZ  ARG B 370     -20.048   9.974 -37.261  1.00  0.28           C  
ATOM   6278  NH1 ARG B 370     -20.813   9.611 -38.285  1.00  0.28           N  
ATOM   6279  NH2 ARG B 370     -19.153  10.947 -37.430  1.00  0.28           N  
ATOM   6280  N   HIS B 371     -23.078   4.477 -31.990  1.00  0.21           N  
ATOM   6281  CA  HIS B 371     -24.126   3.471 -31.950  1.00  0.21           C  
ATOM   6282  C   HIS B 371     -24.567   3.101 -30.550  1.00  0.21           C  
ATOM   6283  O   HIS B 371     -25.675   2.606 -30.356  1.00  0.21           O  
ATOM   6284  CB  HIS B 371     -23.661   2.176 -32.648  1.00  0.21           C  
ATOM   6285  CG  HIS B 371     -23.551   2.324 -34.128  1.00  0.21           C  
ATOM   6286  ND1 HIS B 371     -22.534   3.068 -34.668  1.00  0.21           N  
ATOM   6287  CD2 HIS B 371     -24.351   1.841 -35.111  1.00  0.21           C  
ATOM   6288  CE1 HIS B 371     -22.729   3.027 -35.967  1.00  0.21           C  
ATOM   6289  NE2 HIS B 371     -23.818   2.297 -36.292  1.00  0.21           N  
ATOM   6290  N   GLN B 372     -23.747   3.380 -29.528  1.00  0.26           N  
ATOM   6291  CA  GLN B 372     -24.124   3.096 -28.164  1.00  0.26           C  
ATOM   6292  C   GLN B 372     -23.156   3.803 -27.257  1.00  0.26           C  
ATOM   6293  O   GLN B 372     -22.016   3.388 -27.067  1.00  0.26           O  
ATOM   6294  CB  GLN B 372     -24.117   1.575 -27.851  1.00  0.26           C  
ATOM   6295  CG  GLN B 372     -24.928   1.196 -26.593  1.00  0.26           C  
ATOM   6296  CD  GLN B 372     -25.051  -0.321 -26.462  1.00  0.26           C  
ATOM   6297  OE1 GLN B 372     -24.449  -1.115 -27.183  1.00  0.26           O  
ATOM   6298  NE2 GLN B 372     -25.888  -0.759 -25.492  1.00  0.26           N  
ATOM   6299  N   LEU B 373     -23.576   4.931 -26.654  1.00  0.29           N  
ATOM   6300  CA  LEU B 373     -22.794   5.519 -25.588  1.00  0.29           C  
ATOM   6301  C   LEU B 373     -22.770   4.582 -24.390  1.00  0.29           C  
ATOM   6302  O   LEU B 373     -23.825   4.070 -24.007  1.00  0.29           O  
ATOM   6303  CB  LEU B 373     -23.307   6.901 -25.137  1.00  0.29           C  
ATOM   6304  CG  LEU B 373     -23.000   8.005 -26.162  1.00  0.29           C  
ATOM   6305  CD1 LEU B 373     -23.985   9.169 -26.010  1.00  0.29           C  
ATOM   6306  CD2 LEU B 373     -21.547   8.496 -26.037  1.00  0.29           C  
ATOM   6307  N   PRO B 374     -21.629   4.291 -23.784  1.00  0.26           N  
ATOM   6308  CA  PRO B 374     -21.575   3.570 -22.530  1.00  0.26           C  
ATOM   6309  C   PRO B 374     -22.373   4.238 -21.433  1.00  0.26           C  
ATOM   6310  O   PRO B 374     -22.465   5.462 -21.387  1.00  0.26           O  
ATOM   6311  CB  PRO B 374     -20.078   3.422 -22.211  1.00  0.26           C  
ATOM   6312  CG  PRO B 374     -19.299   4.243 -23.252  1.00  0.26           C  
ATOM   6313  CD  PRO B 374     -20.330   4.772 -24.232  1.00  0.26           C  
ATOM   6314  N   GLY B 375     -22.946   3.450 -20.505  1.00  0.31           N  
ATOM   6315  CA  GLY B 375     -23.704   3.997 -19.382  1.00  0.31           C  
ATOM   6316  C   GLY B 375     -22.789   4.530 -18.313  1.00  0.31           C  
ATOM   6317  O   GLY B 375     -23.199   5.174 -17.354  1.00  0.31           O  
ATOM   6318  N   ASN B 376     -21.479   4.295 -18.499  1.00  0.27           N  
ATOM   6319  CA  ASN B 376     -20.419   4.922 -17.758  1.00  0.27           C  
ATOM   6320  C   ASN B 376     -19.984   6.214 -18.461  1.00  0.27           C  
ATOM   6321  O   ASN B 376     -19.378   6.217 -19.533  1.00  0.27           O  
ATOM   6322  CB  ASN B 376     -19.258   3.907 -17.610  1.00  0.27           C  
ATOM   6323  CG  ASN B 376     -18.213   4.384 -16.611  1.00  0.27           C  
ATOM   6324  OD1 ASN B 376     -17.825   5.549 -16.574  1.00  0.27           O  
ATOM   6325  ND2 ASN B 376     -17.720   3.458 -15.762  1.00  0.27           N  
ATOM   6326  N   ARG B 377     -20.269   7.357 -17.813  1.00  0.36           N  
ATOM   6327  CA  ARG B 377     -19.918   8.690 -18.257  1.00  0.36           C  
ATOM   6328  C   ARG B 377     -18.410   8.919 -18.394  1.00  0.36           C  
ATOM   6329  O   ARG B 377     -17.943   9.528 -19.359  1.00  0.36           O  
ATOM   6330  CB  ARG B 377     -20.555   9.692 -17.265  1.00  0.36           C  
ATOM   6331  CG  ARG B 377     -20.408  11.174 -17.650  1.00  0.36           C  
ATOM   6332  CD  ARG B 377     -21.151  12.089 -16.675  1.00  0.36           C  
ATOM   6333  NE  ARG B 377     -20.927  13.499 -17.129  1.00  0.36           N  
ATOM   6334  CZ  ARG B 377     -21.645  14.545 -16.700  1.00  0.36           C  
ATOM   6335  NH1 ARG B 377     -22.683  14.380 -15.883  1.00  0.36           N  
ATOM   6336  NH2 ARG B 377     -21.321  15.774 -17.096  1.00  0.36           N  
ATOM   6337  N   GLN B 378     -17.616   8.399 -17.436  1.00  0.43           N  
ATOM   6338  CA  GLN B 378     -16.166   8.448 -17.412  1.00  0.43           C  
ATOM   6339  C   GLN B 378     -15.529   7.667 -18.554  1.00  0.43           C  
ATOM   6340  O   GLN B 378     -14.519   8.085 -19.126  1.00  0.43           O  
ATOM   6341  CB  GLN B 378     -15.646   7.992 -16.027  1.00  0.43           C  
ATOM   6342  CG  GLN B 378     -14.206   8.453 -15.708  1.00  0.43           C  
ATOM   6343  CD  GLN B 378     -13.716   7.913 -14.365  1.00  0.43           C  
ATOM   6344  OE1 GLN B 378     -14.292   7.014 -13.749  1.00  0.43           O  
ATOM   6345  NE2 GLN B 378     -12.592   8.485 -13.871  1.00  0.43           N  
ATOM   6346  N   LEU B 379     -16.145   6.528 -18.957  1.00  0.37           N  
ATOM   6347  CA  LEU B 379     -15.759   5.770 -20.132  1.00  0.37           C  
ATOM   6348  C   LEU B 379     -15.874   6.553 -21.414  1.00  0.37           C  
ATOM   6349  O   LEU B 379     -14.932   6.648 -22.202  1.00  0.37           O  
ATOM   6350  CB  LEU B 379     -16.491   4.419 -20.189  1.00  0.37           C  
ATOM   6351  CG  LEU B 379     -16.303   3.504 -21.422  1.00  0.37           C  
ATOM   6352  CD1 LEU B 379     -14.902   3.355 -22.012  1.00  0.37           C  
ATOM   6353  CD2 LEU B 379     -16.961   2.140 -21.212  1.00  0.37           C  
ATOM   6354  N   ALA B 380     -17.020   7.222 -21.601  1.00  0.42           N  
ATOM   6355  CA  ALA B 380     -17.270   8.078 -22.735  1.00  0.42           C  
ATOM   6356  C   ALA B 380     -16.282   9.240 -22.824  1.00  0.42           C  
ATOM   6357  O   ALA B 380     -15.742   9.529 -23.888  1.00  0.42           O  
ATOM   6358  CB  ALA B 380     -18.725   8.583 -22.690  1.00  0.42           C  
ATOM   6359  N   GLY B 381     -15.984   9.898 -21.682  1.00  0.51           N  
ATOM   6360  CA  GLY B 381     -14.961  10.937 -21.558  1.00  0.51           C  
ATOM   6361  C   GLY B 381     -13.573  10.591 -22.042  1.00  0.51           C  
ATOM   6362  O   GLY B 381     -13.045  11.268 -22.924  1.00  0.51           O  
ATOM   6363  N   ARG B 382     -12.934   9.522 -21.505  1.00  0.41           N  
ATOM   6364  CA  ARG B 382     -11.592   9.185 -21.965  1.00  0.41           C  
ATOM   6365  C   ARG B 382     -11.580   8.605 -23.370  1.00  0.41           C  
ATOM   6366  O   ARG B 382     -10.563   8.684 -24.052  1.00  0.41           O  
ATOM   6367  CB  ARG B 382     -10.690   8.297 -21.076  1.00  0.41           C  
ATOM   6368  CG  ARG B 382     -10.558   8.615 -19.589  1.00  0.41           C  
ATOM   6369  CD  ARG B 382      -9.752   7.558 -18.857  1.00  0.41           C  
ATOM   6370  NE  ARG B 382      -9.884   7.715 -17.401  1.00  0.41           N  
ATOM   6371  CZ  ARG B 382      -9.787   6.721 -16.518  1.00  0.41           C  
ATOM   6372  NH1 ARG B 382      -9.522   5.498 -16.884  1.00  0.41           N  
ATOM   6373  NH2 ARG B 382      -9.856   6.932 -15.221  1.00  0.41           N  
ATOM   6374  N   SER B 383     -12.713   8.053 -23.867  1.00  0.48           N  
ATOM   6375  CA  SER B 383     -12.839   7.670 -25.274  1.00  0.48           C  
ATOM   6376  C   SER B 383     -12.753   8.869 -26.208  1.00  0.48           C  
ATOM   6377  O   SER B 383     -12.003   8.866 -27.181  1.00  0.48           O  
ATOM   6378  CB  SER B 383     -14.147   6.878 -25.552  1.00  0.48           C  
ATOM   6379  OG  SER B 383     -14.222   6.409 -26.905  1.00  0.48           O  
ATOM   6380  N   TYR B 384     -13.465   9.967 -25.889  1.00  0.51           N  
ATOM   6381  CA  TYR B 384     -13.351  11.233 -26.592  1.00  0.51           C  
ATOM   6382  C   TYR B 384     -11.970  11.882 -26.489  1.00  0.51           C  
ATOM   6383  O   TYR B 384     -11.460  12.400 -27.481  1.00  0.51           O  
ATOM   6384  CB  TYR B 384     -14.434  12.224 -26.102  1.00  0.51           C  
ATOM   6385  CG  TYR B 384     -15.799  11.861 -26.620  1.00  0.51           C  
ATOM   6386  CD1 TYR B 384     -16.031  11.792 -28.002  1.00  0.51           C  
ATOM   6387  CD2 TYR B 384     -16.876  11.643 -25.745  1.00  0.51           C  
ATOM   6388  CE1 TYR B 384     -17.299  11.475 -28.501  1.00  0.51           C  
ATOM   6389  CE2 TYR B 384     -18.150  11.325 -26.240  1.00  0.51           C  
ATOM   6390  CZ  TYR B 384     -18.357  11.240 -27.622  1.00  0.51           C  
ATOM   6391  OH  TYR B 384     -19.628  10.932 -28.138  1.00  0.51           O  
ATOM   6392  N   ASP B 385     -11.312  11.833 -25.301  1.00  0.55           N  
ATOM   6393  CA  ASP B 385      -9.939  12.301 -25.107  1.00  0.55           C  
ATOM   6394  C   ASP B 385      -8.970  11.550 -26.013  1.00  0.55           C  
ATOM   6395  O   ASP B 385      -8.141  12.109 -26.718  1.00  0.55           O  
ATOM   6396  CB  ASP B 385      -9.512  12.096 -23.620  1.00  0.55           C  
ATOM   6397  CG  ASP B 385      -8.207  12.774 -23.183  1.00  0.55           C  
ATOM   6398  OD1 ASP B 385      -7.450  13.364 -23.995  1.00  0.55           O  
ATOM   6399  OD2 ASP B 385      -7.963  12.742 -21.948  1.00  0.55           O  
ATOM   6400  N   LEU B 386      -9.099  10.224 -26.092  1.00  0.55           N  
ATOM   6401  CA  LEU B 386      -8.296   9.426 -26.987  1.00  0.55           C  
ATOM   6402  C   LEU B 386      -8.528   9.717 -28.459  1.00  0.55           C  
ATOM   6403  O   LEU B 386      -7.590   9.840 -29.248  1.00  0.55           O  
ATOM   6404  CB  LEU B 386      -8.580   7.942 -26.726  1.00  0.55           C  
ATOM   6405  CG  LEU B 386      -7.855   6.984 -27.680  1.00  0.55           C  
ATOM   6406  CD1 LEU B 386      -6.341   7.223 -27.665  1.00  0.55           C  
ATOM   6407  CD2 LEU B 386      -8.213   5.539 -27.333  1.00  0.55           C  
ATOM   6408  N   GLN B 387      -9.800   9.865 -28.868  1.00  0.62           N  
ATOM   6409  CA  GLN B 387     -10.151  10.235 -30.223  1.00  0.62           C  
ATOM   6410  C   GLN B 387      -9.551  11.579 -30.606  1.00  0.62           C  
ATOM   6411  O   GLN B 387      -9.010  11.739 -31.699  1.00  0.62           O  
ATOM   6412  CB  GLN B 387     -11.685  10.266 -30.398  1.00  0.62           C  
ATOM   6413  CG  GLN B 387     -12.351   8.874 -30.392  1.00  0.62           C  
ATOM   6414  CD  GLN B 387     -13.874   9.005 -30.356  1.00  0.62           C  
ATOM   6415  OE1 GLN B 387     -14.476   9.900 -30.946  1.00  0.62           O  
ATOM   6416  NE2 GLN B 387     -14.549   8.072 -29.648  1.00  0.62           N  
ATOM   6417  N   ALA B 388      -9.567  12.558 -29.681  1.00  0.66           N  
ATOM   6418  CA  ALA B 388      -8.888  13.823 -29.837  1.00  0.66           C  
ATOM   6419  C   ALA B 388      -7.374  13.695 -30.016  1.00  0.66           C  
ATOM   6420  O   ALA B 388      -6.795  14.312 -30.908  1.00  0.66           O  
ATOM   6421  CB  ALA B 388      -9.215  14.719 -28.629  1.00  0.66           C  
ATOM   6422  N   LEU B 389      -6.689  12.846 -29.222  1.00  0.60           N  
ATOM   6423  CA  LEU B 389      -5.278  12.547 -29.413  1.00  0.60           C  
ATOM   6424  C   LEU B 389      -4.959  11.884 -30.750  1.00  0.60           C  
ATOM   6425  O   LEU B 389      -4.016  12.268 -31.438  1.00  0.60           O  
ATOM   6426  CB  LEU B 389      -4.728  11.662 -28.265  1.00  0.60           C  
ATOM   6427  CG  LEU B 389      -3.205  11.390 -28.323  1.00  0.60           C  
ATOM   6428  CD1 LEU B 389      -2.382  12.684 -28.209  1.00  0.60           C  
ATOM   6429  CD2 LEU B 389      -2.765  10.379 -27.254  1.00  0.60           C  
ATOM   6430  N   LEU B 390      -5.751  10.885 -31.187  1.00  0.57           N  
ATOM   6431  CA  LEU B 390      -5.585  10.242 -32.481  1.00  0.57           C  
ATOM   6432  C   LEU B 390      -5.816  11.194 -33.632  1.00  0.57           C  
ATOM   6433  O   LEU B 390      -5.054  11.199 -34.594  1.00  0.57           O  
ATOM   6434  CB  LEU B 390      -6.512   9.019 -32.645  1.00  0.57           C  
ATOM   6435  CG  LEU B 390      -6.096   7.787 -31.820  1.00  0.57           C  
ATOM   6436  CD1 LEU B 390      -7.237   6.763 -31.813  1.00  0.57           C  
ATOM   6437  CD2 LEU B 390      -4.818   7.134 -32.371  1.00  0.57           C  
ATOM   6438  N   ALA B 391      -6.843  12.059 -33.524  1.00  0.62           N  
ATOM   6439  CA  ALA B 391      -7.121  13.124 -34.456  1.00  0.62           C  
ATOM   6440  C   ALA B 391      -5.982  14.123 -34.547  1.00  0.62           C  
ATOM   6441  O   ALA B 391      -5.579  14.514 -35.639  1.00  0.62           O  
ATOM   6442  CB  ALA B 391      -8.438  13.817 -34.061  1.00  0.62           C  
ATOM   6443  N   LEU B 392      -5.383  14.510 -33.402  1.00  0.56           N  
ATOM   6444  CA  LEU B 392      -4.173  15.307 -33.377  1.00  0.56           C  
ATOM   6445  C   LEU B 392      -2.992  14.614 -34.054  1.00  0.56           C  
ATOM   6446  O   LEU B 392      -2.365  15.164 -34.949  1.00  0.56           O  
ATOM   6447  CB  LEU B 392      -3.835  15.688 -31.915  1.00  0.56           C  
ATOM   6448  CG  LEU B 392      -2.626  16.620 -31.700  1.00  0.56           C  
ATOM   6449  CD1 LEU B 392      -2.850  18.038 -32.243  1.00  0.56           C  
ATOM   6450  CD2 LEU B 392      -2.312  16.694 -30.201  1.00  0.56           C  
ATOM   6451  N   THR B 393      -2.704  13.348 -33.721  1.00  0.54           N  
ATOM   6452  CA  THR B 393      -1.614  12.583 -34.329  1.00  0.54           C  
ATOM   6453  C   THR B 393      -1.757  12.371 -35.829  1.00  0.54           C  
ATOM   6454  O   THR B 393      -0.775  12.409 -36.567  1.00  0.54           O  
ATOM   6455  CB  THR B 393      -1.406  11.244 -33.636  1.00  0.54           C  
ATOM   6456  OG1 THR B 393      -1.233  11.468 -32.246  1.00  0.54           O  
ATOM   6457  CG2 THR B 393      -0.125  10.546 -34.118  1.00  0.54           C  
ATOM   6458  N   CYS B 394      -2.977  12.145 -36.354  1.00  0.51           N  
ATOM   6459  CA  CYS B 394      -3.154  11.845 -37.768  1.00  0.51           C  
ATOM   6460  C   CYS B 394      -3.529  13.029 -38.648  1.00  0.51           C  
ATOM   6461  O   CYS B 394      -3.854  12.850 -39.820  1.00  0.51           O  
ATOM   6462  CB  CYS B 394      -4.168  10.692 -37.983  1.00  0.51           C  
ATOM   6463  SG  CYS B 394      -5.895  11.106 -37.549  1.00  0.51           S  
ATOM   6464  N   GLY B 395      -3.489  14.275 -38.134  1.00  0.57           N  
ATOM   6465  CA  GLY B 395      -3.769  15.456 -38.948  1.00  0.57           C  
ATOM   6466  C   GLY B 395      -5.207  15.900 -39.045  1.00  0.57           C  
ATOM   6467  O   GLY B 395      -5.516  16.907 -39.678  1.00  0.57           O  
ATOM   6468  N   ARG B 396      -6.149  15.223 -38.373  1.00  0.56           N  
ATOM   6469  CA  ARG B 396      -7.559  15.584 -38.356  1.00  0.56           C  
ATOM   6470  C   ARG B 396      -7.839  16.591 -37.251  1.00  0.56           C  
ATOM   6471  O   ARG B 396      -8.795  16.509 -36.489  1.00  0.56           O  
ATOM   6472  CB  ARG B 396      -8.457  14.342 -38.188  1.00  0.56           C  
ATOM   6473  CG  ARG B 396      -8.323  13.385 -39.385  1.00  0.56           C  
ATOM   6474  CD  ARG B 396      -8.991  12.027 -39.190  1.00  0.56           C  
ATOM   6475  NE  ARG B 396     -10.455  12.189 -39.238  1.00  0.56           N  
ATOM   6476  CZ  ARG B 396     -11.345  11.203 -39.107  1.00  0.56           C  
ATOM   6477  NH1 ARG B 396     -10.972   9.948 -38.947  1.00  0.56           N  
ATOM   6478  NH2 ARG B 396     -12.628  11.516 -39.096  1.00  0.56           N  
ATOM   6479  N   TYR B 397      -6.972  17.613 -37.145  1.00  0.51           N  
ATOM   6480  CA  TYR B 397      -6.928  18.633 -36.131  1.00  0.51           C  
ATOM   6481  C   TYR B 397      -8.207  19.449 -35.993  1.00  0.51           C  
ATOM   6482  O   TYR B 397      -8.451  20.104 -34.989  1.00  0.51           O  
ATOM   6483  CB  TYR B 397      -5.775  19.638 -36.366  1.00  0.51           C  
ATOM   6484  CG  TYR B 397      -4.488  19.075 -36.870  1.00  0.51           C  
ATOM   6485  CD1 TYR B 397      -3.744  18.220 -36.054  1.00  0.51           C  
ATOM   6486  CD2 TYR B 397      -3.922  19.519 -38.078  1.00  0.51           C  
ATOM   6487  CE1 TYR B 397      -2.440  17.852 -36.404  1.00  0.51           C  
ATOM   6488  CE2 TYR B 397      -2.639  19.103 -38.448  1.00  0.51           C  
ATOM   6489  CZ  TYR B 397      -1.885  18.296 -37.601  1.00  0.51           C  
ATOM   6490  OH  TYR B 397      -0.559  17.968 -37.922  1.00  0.51           O  
ATOM   6491  N   ASP B 398      -9.043  19.453 -37.029  1.00  0.61           N  
ATOM   6492  CA  ASP B 398     -10.337  20.065 -37.067  1.00  0.61           C  
ATOM   6493  C   ASP B 398     -11.332  19.417 -36.105  1.00  0.61           C  
ATOM   6494  O   ASP B 398     -12.111  20.101 -35.446  1.00  0.61           O  
ATOM   6495  CB  ASP B 398     -10.829  20.115 -38.539  1.00  0.61           C  
ATOM   6496  CG  ASP B 398     -10.551  18.864 -39.372  1.00  0.61           C  
ATOM   6497  OD1 ASP B 398      -9.352  18.509 -39.556  1.00  0.61           O  
ATOM   6498  OD2 ASP B 398     -11.518  18.294 -39.905  1.00  0.61           O  
ATOM   6499  N   GLU B 399     -11.274  18.081 -35.956  1.00  0.64           N  
ATOM   6500  CA  GLU B 399     -12.075  17.310 -35.030  1.00  0.64           C  
ATOM   6501  C   GLU B 399     -11.578  17.419 -33.577  1.00  0.64           C  
ATOM   6502  O   GLU B 399     -12.324  17.181 -32.628  1.00  0.64           O  
ATOM   6503  CB  GLU B 399     -12.078  15.846 -35.537  1.00  0.64           C  
ATOM   6504  CG  GLU B 399     -12.689  15.697 -36.955  1.00  0.64           C  
ATOM   6505  CD  GLU B 399     -12.618  14.280 -37.482  1.00  0.64           C  
ATOM   6506  OE1 GLU B 399     -12.215  14.131 -38.666  1.00  0.64           O  
ATOM   6507  OE2 GLU B 399     -12.972  13.302 -36.777  1.00  0.64           O  
ATOM   6508  N   VAL B 400     -10.312  17.853 -33.352  1.00  0.66           N  
ATOM   6509  CA  VAL B 400      -9.689  17.996 -32.031  1.00  0.66           C  
ATOM   6510  C   VAL B 400     -10.407  18.960 -31.079  1.00  0.66           C  
ATOM   6511  O   VAL B 400     -10.621  18.539 -29.940  1.00  0.66           O  
ATOM   6512  CB  VAL B 400      -8.187  18.311 -32.115  1.00  0.66           C  
ATOM   6513  CG1 VAL B 400      -7.533  18.556 -30.738  1.00  0.66           C  
ATOM   6514  CG2 VAL B 400      -7.451  17.131 -32.771  1.00  0.66           C  
ATOM   6515  N   PRO B 401     -10.864  20.184 -31.385  1.00  0.61           N  
ATOM   6516  CA  PRO B 401     -11.638  20.992 -30.445  1.00  0.61           C  
ATOM   6517  C   PRO B 401     -12.950  20.351 -30.042  1.00  0.61           C  
ATOM   6518  O   PRO B 401     -13.315  20.418 -28.869  1.00  0.61           O  
ATOM   6519  CB  PRO B 401     -11.858  22.337 -31.168  1.00  0.61           C  
ATOM   6520  CG  PRO B 401     -10.698  22.420 -32.165  1.00  0.61           C  
ATOM   6521  CD  PRO B 401     -10.466  20.962 -32.556  1.00  0.61           C  
ATOM   6522  N   LEU B 402     -13.671  19.727 -30.995  1.00  0.59           N  
ATOM   6523  CA  LEU B 402     -14.944  19.079 -30.739  1.00  0.59           C  
ATOM   6524  C   LEU B 402     -14.818  17.863 -29.832  1.00  0.59           C  
ATOM   6525  O   LEU B 402     -15.496  17.750 -28.813  1.00  0.59           O  
ATOM   6526  CB  LEU B 402     -15.580  18.639 -32.082  1.00  0.59           C  
ATOM   6527  CG  LEU B 402     -15.972  19.795 -33.027  1.00  0.59           C  
ATOM   6528  CD1 LEU B 402     -16.357  19.245 -34.409  1.00  0.59           C  
ATOM   6529  CD2 LEU B 402     -17.130  20.633 -32.462  1.00  0.59           C  
ATOM   6530  N   LEU B 403     -13.881  16.948 -30.153  1.00  0.63           N  
ATOM   6531  CA  LEU B 403     -13.612  15.756 -29.371  1.00  0.63           C  
ATOM   6532  C   LEU B 403     -13.076  16.079 -27.981  1.00  0.63           C  
ATOM   6533  O   LEU B 403     -13.495  15.501 -26.980  1.00  0.63           O  
ATOM   6534  CB  LEU B 403     -12.623  14.845 -30.134  1.00  0.63           C  
ATOM   6535  CG  LEU B 403     -13.173  14.260 -31.454  1.00  0.63           C  
ATOM   6536  CD1 LEU B 403     -12.036  13.678 -32.306  1.00  0.63           C  
ATOM   6537  CD2 LEU B 403     -14.237  13.187 -31.199  1.00  0.63           C  
ATOM   6538  N   LEU B 404     -12.156  17.059 -27.873  1.00  0.62           N  
ATOM   6539  CA  LEU B 404     -11.648  17.524 -26.597  1.00  0.62           C  
ATOM   6540  C   LEU B 404     -12.713  18.186 -25.726  1.00  0.62           C  
ATOM   6541  O   LEU B 404     -12.768  17.957 -24.518  1.00  0.62           O  
ATOM   6542  CB  LEU B 404     -10.432  18.451 -26.820  1.00  0.62           C  
ATOM   6543  CG  LEU B 404      -9.654  18.865 -25.555  1.00  0.62           C  
ATOM   6544  CD1 LEU B 404      -9.124  17.642 -24.796  1.00  0.62           C  
ATOM   6545  CD2 LEU B 404      -8.487  19.787 -25.938  1.00  0.62           C  
ATOM   6546  N   GLY B 405     -13.615  19.003 -26.318  1.00  0.65           N  
ATOM   6547  CA  GLY B 405     -14.824  19.519 -25.668  1.00  0.65           C  
ATOM   6548  C   GLY B 405     -15.684  18.471 -25.014  1.00  0.65           C  
ATOM   6549  O   GLY B 405     -15.997  18.557 -23.827  1.00  0.65           O  
ATOM   6550  N   GLU B 406     -16.047  17.424 -25.775  1.00  0.60           N  
ATOM   6551  CA  GLU B 406     -16.805  16.287 -25.296  1.00  0.60           C  
ATOM   6552  C   GLU B 406     -16.099  15.509 -24.191  1.00  0.60           C  
ATOM   6553  O   GLU B 406     -16.728  15.015 -23.252  1.00  0.60           O  
ATOM   6554  CB  GLU B 406     -17.151  15.333 -26.461  1.00  0.60           C  
ATOM   6555  CG  GLU B 406     -18.202  15.878 -27.466  1.00  0.60           C  
ATOM   6556  CD  GLU B 406     -19.569  16.146 -26.838  1.00  0.60           C  
ATOM   6557  OE1 GLU B 406     -20.147  17.224 -27.114  1.00  0.60           O  
ATOM   6558  OE2 GLU B 406     -20.054  15.283 -26.049  1.00  0.60           O  
ATOM   6559  N   ALA B 407     -14.760  15.372 -24.257  1.00  0.62           N  
ATOM   6560  CA  ALA B 407     -13.983  14.804 -23.178  1.00  0.62           C  
ATOM   6561  C   ALA B 407     -14.039  15.620 -21.888  1.00  0.62           C  
ATOM   6562  O   ALA B 407     -14.309  15.094 -20.808  1.00  0.62           O  
ATOM   6563  CB  ALA B 407     -12.527  14.650 -23.646  1.00  0.62           C  
ATOM   6564  N   ARG B 408     -13.861  16.951 -21.991  1.00  0.57           N  
ATOM   6565  CA  ARG B 408     -13.922  17.889 -20.884  1.00  0.57           C  
ATOM   6566  C   ARG B 408     -15.268  17.954 -20.187  1.00  0.57           C  
ATOM   6567  O   ARG B 408     -15.340  18.030 -18.961  1.00  0.57           O  
ATOM   6568  CB  ARG B 408     -13.509  19.303 -21.352  1.00  0.57           C  
ATOM   6569  CG  ARG B 408     -11.995  19.409 -21.634  1.00  0.57           C  
ATOM   6570  CD  ARG B 408     -11.557  20.786 -22.144  1.00  0.57           C  
ATOM   6571  NE  ARG B 408     -10.062  20.761 -22.297  1.00  0.57           N  
ATOM   6572  CZ  ARG B 408      -9.333  21.775 -22.787  1.00  0.57           C  
ATOM   6573  NH1 ARG B 408      -9.907  22.906 -23.193  1.00  0.57           N  
ATOM   6574  NH2 ARG B 408      -8.008  21.655 -22.867  1.00  0.57           N  
ATOM   6575  N   SER B 409     -16.388  17.865 -20.931  1.00  0.61           N  
ATOM   6576  CA  SER B 409     -17.736  17.920 -20.372  1.00  0.61           C  
ATOM   6577  C   SER B 409     -18.071  16.706 -19.503  1.00  0.61           C  
ATOM   6578  O   SER B 409     -19.048  16.660 -18.744  1.00  0.61           O  
ATOM   6579  CB  SER B 409     -18.792  18.101 -21.497  1.00  0.61           C  
ATOM   6580  OG  SER B 409     -18.941  16.924 -22.292  1.00  0.61           O  
ATOM   6581  N   ARG B 410     -17.206  15.683 -19.589  1.00  0.55           N  
ATOM   6582  CA  ARG B 410     -17.266  14.459 -18.838  1.00  0.55           C  
ATOM   6583  C   ARG B 410     -16.075  14.288 -17.902  1.00  0.55           C  
ATOM   6584  O   ARG B 410     -15.867  13.197 -17.379  1.00  0.55           O  
ATOM   6585  CB  ARG B 410     -17.321  13.289 -19.841  1.00  0.55           C  
ATOM   6586  CG  ARG B 410     -18.607  13.300 -20.687  1.00  0.55           C  
ATOM   6587  CD  ARG B 410     -18.565  12.291 -21.832  1.00  0.55           C  
ATOM   6588  NE  ARG B 410     -19.888  12.336 -22.539  1.00  0.55           N  
ATOM   6589  CZ  ARG B 410     -20.168  13.232 -23.494  1.00  0.55           C  
ATOM   6590  NH1 ARG B 410     -19.348  14.214 -23.816  1.00  0.55           N  
ATOM   6591  NH2 ARG B 410     -21.296  13.154 -24.198  1.00  0.55           N  
ATOM   6592  N   GLN B 411     -15.293  15.365 -17.658  1.00  0.48           N  
ATOM   6593  CA  GLN B 411     -14.175  15.404 -16.720  1.00  0.48           C  
ATOM   6594  C   GLN B 411     -12.980  14.553 -17.140  1.00  0.48           C  
ATOM   6595  O   GLN B 411     -12.268  13.976 -16.321  1.00  0.48           O  
ATOM   6596  CB  GLN B 411     -14.596  15.118 -15.253  1.00  0.48           C  
ATOM   6597  CG  GLN B 411     -15.683  16.080 -14.724  1.00  0.48           C  
ATOM   6598  CD  GLN B 411     -16.137  15.682 -13.320  1.00  0.48           C  
ATOM   6599  OE1 GLN B 411     -15.744  14.670 -12.743  1.00  0.48           O  
ATOM   6600  NE2 GLN B 411     -17.029  16.516 -12.736  1.00  0.48           N  
ATOM   6601  N   ALA B 412     -12.710  14.516 -18.456  1.00  0.45           N  
ATOM   6602  CA  ALA B 412     -11.544  13.920 -19.067  1.00  0.45           C  
ATOM   6603  C   ALA B 412     -10.842  14.964 -19.936  1.00  0.45           C  
ATOM   6604  O   ALA B 412     -11.122  16.156 -19.837  1.00  0.45           O  
ATOM   6605  CB  ALA B 412     -11.968  12.687 -19.880  1.00  0.45           C  
ATOM   6606  N   GLY B 413      -9.871  14.581 -20.794  1.00  0.48           N  
ATOM   6607  CA  GLY B 413      -9.188  15.562 -21.629  1.00  0.48           C  
ATOM   6608  C   GLY B 413      -7.850  15.945 -21.102  1.00  0.48           C  
ATOM   6609  O   GLY B 413      -7.259  16.899 -21.587  1.00  0.48           O  
ATOM   6610  N   SER B 414      -7.306  15.232 -20.111  1.00  0.55           N  
ATOM   6611  CA  SER B 414      -5.958  15.426 -19.615  1.00  0.55           C  
ATOM   6612  C   SER B 414      -4.891  14.955 -20.584  1.00  0.55           C  
ATOM   6613  O   SER B 414      -3.885  15.639 -20.762  1.00  0.55           O  
ATOM   6614  CB  SER B 414      -5.706  14.814 -18.210  1.00  0.55           C  
ATOM   6615  OG  SER B 414      -5.967  13.408 -18.166  1.00  0.55           O  
ATOM   6616  N   LEU B 415      -5.081  13.795 -21.253  1.00  0.49           N  
ATOM   6617  CA  LEU B 415      -4.090  13.217 -22.144  1.00  0.49           C  
ATOM   6618  C   LEU B 415      -3.817  14.077 -23.366  1.00  0.49           C  
ATOM   6619  O   LEU B 415      -2.677  14.432 -23.666  1.00  0.49           O  
ATOM   6620  CB  LEU B 415      -4.584  11.817 -22.581  1.00  0.49           C  
ATOM   6621  CG  LEU B 415      -3.664  11.012 -23.520  1.00  0.49           C  
ATOM   6622  CD1 LEU B 415      -2.390  10.517 -22.822  1.00  0.49           C  
ATOM   6623  CD2 LEU B 415      -4.451   9.830 -24.107  1.00  0.49           C  
ATOM   6624  N   THR B 416      -4.874  14.506 -24.075  1.00  0.55           N  
ATOM   6625  CA  THR B 416      -4.736  15.418 -25.210  1.00  0.55           C  
ATOM   6626  C   THR B 416      -4.250  16.792 -24.819  1.00  0.55           C  
ATOM   6627  O   THR B 416      -3.377  17.355 -25.474  1.00  0.55           O  
ATOM   6628  CB  THR B 416      -6.032  15.542 -25.978  1.00  0.55           C  
ATOM   6629  OG1 THR B 416      -6.434  14.299 -26.363  1.00  0.55           O  
ATOM   6630  CG2 THR B 416      -5.813  16.389 -27.273  1.00  0.55           C  
ATOM   6631  N   THR B 417      -4.764  17.366 -23.704  1.00  0.58           N  
ATOM   6632  CA  THR B 417      -4.323  18.677 -23.196  1.00  0.58           C  
ATOM   6633  C   THR B 417      -2.829  18.686 -22.896  1.00  0.58           C  
ATOM   6634  O   THR B 417      -2.103  19.550 -23.376  1.00  0.58           O  
ATOM   6635  CB  THR B 417      -5.097  19.130 -21.937  1.00  0.58           C  
ATOM   6636  OG1 THR B 417      -6.470  19.247 -22.192  1.00  0.58           O  
ATOM   6637  CG2 THR B 417      -4.551  20.489 -21.444  1.00  0.58           C  
ATOM   6638  N   ALA B 418      -2.311  17.659 -22.191  1.00  0.59           N  
ATOM   6639  CA  ALA B 418      -0.902  17.534 -21.869  1.00  0.59           C  
ATOM   6640  C   ALA B 418       0.011  17.422 -23.084  1.00  0.59           C  
ATOM   6641  O   ALA B 418       1.070  18.047 -23.152  1.00  0.59           O  
ATOM   6642  CB  ALA B 418      -0.700  16.305 -20.965  1.00  0.59           C  
ATOM   6643  N   THR B 419      -0.391  16.641 -24.109  1.00  0.59           N  
ATOM   6644  CA  THR B 419       0.321  16.578 -25.381  1.00  0.59           C  
ATOM   6645  C   THR B 419       0.360  17.919 -26.089  1.00  0.59           C  
ATOM   6646  O   THR B 419       1.412  18.336 -26.563  1.00  0.59           O  
ATOM   6647  CB  THR B 419      -0.255  15.532 -26.322  1.00  0.59           C  
ATOM   6648  OG1 THR B 419      -0.176  14.254 -25.708  1.00  0.59           O  
ATOM   6649  CG2 THR B 419       0.541  15.427 -27.633  1.00  0.59           C  
ATOM   6650  N   VAL B 420      -0.764  18.667 -26.139  1.00  0.65           N  
ATOM   6651  CA  VAL B 420      -0.817  20.016 -26.704  1.00  0.65           C  
ATOM   6652  C   VAL B 420       0.054  21.024 -25.959  1.00  0.65           C  
ATOM   6653  O   VAL B 420       0.780  21.799 -26.582  1.00  0.65           O  
ATOM   6654  CB  VAL B 420      -2.251  20.528 -26.839  1.00  0.65           C  
ATOM   6655  CG1 VAL B 420      -2.293  21.990 -27.338  1.00  0.65           C  
ATOM   6656  CG2 VAL B 420      -3.015  19.645 -27.847  1.00  0.65           C  
ATOM   6657  N   GLU B 421       0.050  21.022 -24.612  1.00  0.53           N  
ATOM   6658  CA  GLU B 421       0.927  21.868 -23.816  1.00  0.53           C  
ATOM   6659  C   GLU B 421       2.408  21.553 -24.042  1.00  0.53           C  
ATOM   6660  O   GLU B 421       3.206  22.432 -24.355  1.00  0.53           O  
ATOM   6661  CB  GLU B 421       0.524  21.750 -22.326  1.00  0.53           C  
ATOM   6662  CG  GLU B 421      -0.871  22.372 -22.038  1.00  0.53           C  
ATOM   6663  CD  GLU B 421      -1.466  22.020 -20.672  1.00  0.53           C  
ATOM   6664  OE1 GLU B 421      -2.547  22.593 -20.371  1.00  0.53           O  
ATOM   6665  OE2 GLU B 421      -0.904  21.157 -19.952  1.00  0.53           O  
ATOM   6666  N   SER B 422       2.781  20.254 -24.027  1.00  0.52           N  
ATOM   6667  CA  SER B 422       4.120  19.763 -24.356  1.00  0.52           C  
ATOM   6668  C   SER B 422       4.572  20.087 -25.772  1.00  0.52           C  
ATOM   6669  O   SER B 422       5.736  20.413 -26.010  1.00  0.52           O  
ATOM   6670  CB  SER B 422       4.209  18.227 -24.162  1.00  0.52           C  
ATOM   6671  OG  SER B 422       5.530  17.699 -24.344  1.00  0.52           O  
ATOM   6672  N   LEU B 423       3.657  20.022 -26.768  1.00  0.52           N  
ATOM   6673  CA  LEU B 423       3.913  20.510 -28.113  1.00  0.52           C  
ATOM   6674  C   LEU B 423       4.257  21.996 -28.108  1.00  0.52           C  
ATOM   6675  O   LEU B 423       5.284  22.406 -28.633  1.00  0.52           O  
ATOM   6676  CB  LEU B 423       2.656  20.330 -29.023  1.00  0.52           C  
ATOM   6677  CG  LEU B 423       2.424  18.929 -29.615  1.00  0.52           C  
ATOM   6678  CD1 LEU B 423       0.990  18.722 -30.112  1.00  0.52           C  
ATOM   6679  CD2 LEU B 423       3.341  18.716 -30.803  1.00  0.52           C  
ATOM   6680  N   ALA B 424       3.412  22.828 -27.473  1.00  0.50           N  
ATOM   6681  CA  ALA B 424       3.494  24.270 -27.483  1.00  0.50           C  
ATOM   6682  C   ALA B 424       4.703  24.840 -26.753  1.00  0.50           C  
ATOM   6683  O   ALA B 424       5.397  25.694 -27.305  1.00  0.50           O  
ATOM   6684  CB  ALA B 424       2.158  24.809 -26.970  1.00  0.50           C  
ATOM   6685  N   ASP B 425       5.046  24.303 -25.559  1.00  0.43           N  
ATOM   6686  CA  ASP B 425       6.253  24.586 -24.799  1.00  0.43           C  
ATOM   6687  C   ASP B 425       7.517  24.331 -25.596  1.00  0.43           C  
ATOM   6688  O   ASP B 425       8.515  25.033 -25.443  1.00  0.43           O  
ATOM   6689  CB  ASP B 425       6.315  23.701 -23.524  1.00  0.43           C  
ATOM   6690  CG  ASP B 425       5.389  24.182 -22.414  1.00  0.43           C  
ATOM   6691  OD1 ASP B 425       4.788  25.278 -22.544  1.00  0.43           O  
ATOM   6692  OD2 ASP B 425       5.321  23.449 -21.393  1.00  0.43           O  
ATOM   6693  N   ARG B 426       7.520  23.327 -26.493  1.00  0.35           N  
ATOM   6694  CA  ARG B 426       8.682  23.037 -27.297  1.00  0.35           C  
ATOM   6695  C   ARG B 426       8.583  23.599 -28.726  1.00  0.35           C  
ATOM   6696  O   ARG B 426       9.542  23.499 -29.487  1.00  0.35           O  
ATOM   6697  CB  ARG B 426       8.915  21.520 -27.346  1.00  0.35           C  
ATOM   6698  CG  ARG B 426       9.127  20.774 -26.004  1.00  0.35           C  
ATOM   6699  CD  ARG B 426       9.148  19.274 -26.333  1.00  0.35           C  
ATOM   6700  NE  ARG B 426       9.448  18.385 -25.167  1.00  0.35           N  
ATOM   6701  CZ  ARG B 426       9.549  17.058 -25.318  1.00  0.35           C  
ATOM   6702  NH1 ARG B 426       9.566  16.475 -26.511  1.00  0.35           N  
ATOM   6703  NH2 ARG B 426       9.642  16.263 -24.255  1.00  0.35           N  
ATOM   6704  N   LEU B 427       7.475  24.288 -29.100  1.00  0.33           N  
ATOM   6705  CA  LEU B 427       7.323  25.063 -30.335  1.00  0.33           C  
ATOM   6706  C   LEU B 427       7.574  26.601 -30.246  1.00  0.33           C  
ATOM   6707  O   LEU B 427       7.117  27.284 -31.172  1.00  0.33           O  
ATOM   6708  CB  LEU B 427       5.895  24.858 -30.943  1.00  0.33           C  
ATOM   6709  CG  LEU B 427       5.617  23.491 -31.605  1.00  0.33           C  
ATOM   6710  CD1 LEU B 427       4.101  23.249 -31.729  1.00  0.33           C  
ATOM   6711  CD2 LEU B 427       6.262  23.375 -32.997  1.00  0.33           C  
ATOM   6712  N   PRO B 428       8.249  27.288 -29.295  1.00  0.29           N  
ATOM   6713  CA  PRO B 428       8.262  28.744 -29.238  1.00  0.29           C  
ATOM   6714  C   PRO B 428       8.876  29.435 -30.443  1.00  0.29           C  
ATOM   6715  O   PRO B 428       8.652  30.630 -30.601  1.00  0.29           O  
ATOM   6716  CB  PRO B 428       8.984  29.128 -27.922  1.00  0.29           C  
ATOM   6717  CG  PRO B 428       9.447  27.829 -27.257  1.00  0.29           C  
ATOM   6718  CD  PRO B 428       8.972  26.708 -28.173  1.00  0.29           C  
ATOM   6719  N   SER B 429       9.665  28.760 -31.287  1.00  0.29           N  
ATOM   6720  CA  SER B 429      10.375  29.360 -32.399  1.00  0.29           C  
ATOM   6721  C   SER B 429       9.693  29.128 -33.734  1.00  0.29           C  
ATOM   6722  O   SER B 429      10.249  29.420 -34.790  1.00  0.29           O  
ATOM   6723  CB  SER B 429      11.790  28.748 -32.481  1.00  0.29           C  
ATOM   6724  OG  SER B 429      11.741  27.315 -32.554  1.00  0.29           O  
ATOM   6725  N   TRP B 430       8.448  28.603 -33.750  1.00  0.25           N  
ATOM   6726  CA  TRP B 430       7.741  28.305 -34.988  1.00  0.25           C  
ATOM   6727  C   TRP B 430       7.489  29.531 -35.879  1.00  0.25           C  
ATOM   6728  O   TRP B 430       7.528  29.448 -37.104  1.00  0.25           O  
ATOM   6729  CB  TRP B 430       6.443  27.467 -34.750  1.00  0.25           C  
ATOM   6730  CG  TRP B 430       5.166  28.249 -34.552  1.00  0.25           C  
ATOM   6731  CD1 TRP B 430       4.708  28.928 -33.472  1.00  0.25           C  
ATOM   6732  CD2 TRP B 430       4.235  28.530 -35.609  1.00  0.25           C  
ATOM   6733  NE1 TRP B 430       3.573  29.623 -33.759  1.00  0.25           N  
ATOM   6734  CE2 TRP B 430       3.270  29.403 -35.086  1.00  0.25           C  
ATOM   6735  CE3 TRP B 430       4.185  28.092 -36.927  1.00  0.25           C  
ATOM   6736  CZ2 TRP B 430       2.233  29.858 -35.882  1.00  0.25           C  
ATOM   6737  CZ3 TRP B 430       3.118  28.520 -37.712  1.00  0.25           C  
ATOM   6738  CH2 TRP B 430       2.173  29.407 -37.207  1.00  0.25           C  
ATOM   6739  N   ARG B 431       7.252  30.710 -35.267  1.00  0.26           N  
ATOM   6740  CA  ARG B 431       7.082  31.980 -35.954  1.00  0.26           C  
ATOM   6741  C   ARG B 431       8.377  32.552 -36.516  1.00  0.26           C  
ATOM   6742  O   ARG B 431       8.343  33.349 -37.451  1.00  0.26           O  
ATOM   6743  CB  ARG B 431       6.466  33.017 -34.984  1.00  0.26           C  
ATOM   6744  CG  ARG B 431       5.008  32.680 -34.626  1.00  0.26           C  
ATOM   6745  CD  ARG B 431       4.381  33.687 -33.663  1.00  0.26           C  
ATOM   6746  NE  ARG B 431       2.955  33.273 -33.463  1.00  0.26           N  
ATOM   6747  CZ  ARG B 431       2.081  33.908 -32.672  1.00  0.26           C  
ATOM   6748  NH1 ARG B 431       2.431  34.991 -31.978  1.00  0.26           N  
ATOM   6749  NH2 ARG B 431       0.821  33.484 -32.602  1.00  0.26           N  
ATOM   6750  N   ASP B 432       9.533  32.106 -35.991  1.00  0.33           N  
ATOM   6751  CA  ASP B 432      10.850  32.572 -36.365  1.00  0.33           C  
ATOM   6752  C   ASP B 432      11.475  31.667 -37.423  1.00  0.33           C  
ATOM   6753  O   ASP B 432      12.593  31.888 -37.890  1.00  0.33           O  
ATOM   6754  CB  ASP B 432      11.772  32.597 -35.118  1.00  0.33           C  
ATOM   6755  CG  ASP B 432      11.272  33.562 -34.053  1.00  0.33           C  
ATOM   6756  OD1 ASP B 432      10.709  34.626 -34.411  1.00  0.33           O  
ATOM   6757  OD2 ASP B 432      11.461  33.225 -32.853  1.00  0.33           O  
ATOM   6758  N   LEU B 433      10.753  30.620 -37.885  1.00  0.36           N  
ATOM   6759  CA  LEU B 433      11.131  29.851 -39.057  1.00  0.36           C  
ATOM   6760  C   LEU B 433      11.133  30.738 -40.291  1.00  0.36           C  
ATOM   6761  O   LEU B 433      10.147  31.452 -40.466  1.00  0.36           O  
ATOM   6762  CB  LEU B 433      10.138  28.683 -39.300  1.00  0.36           C  
ATOM   6763  CG  LEU B 433      10.303  27.507 -38.328  1.00  0.36           C  
ATOM   6764  CD1 LEU B 433       9.128  26.526 -38.451  1.00  0.36           C  
ATOM   6765  CD2 LEU B 433      11.619  26.777 -38.601  1.00  0.36           C  
ATOM   6766  N   PRO B 434      12.137  30.743 -41.183  1.00  0.51           N  
ATOM   6767  CA  PRO B 434      12.165  31.615 -42.353  1.00  0.51           C  
ATOM   6768  C   PRO B 434      10.871  31.523 -43.132  1.00  0.51           C  
ATOM   6769  O   PRO B 434      10.554  30.449 -43.634  1.00  0.51           O  
ATOM   6770  CB  PRO B 434      13.440  31.199 -43.140  1.00  0.51           C  
ATOM   6771  CG  PRO B 434      14.101  30.037 -42.372  1.00  0.51           C  
ATOM   6772  CD  PRO B 434      13.321  29.898 -41.067  1.00  0.51           C  
ATOM   6773  N   GLN B 435      10.073  32.582 -43.286  1.00  0.44           N  
ATOM   6774  CA  GLN B 435       8.869  32.472 -44.079  1.00  0.44           C  
ATOM   6775  C   GLN B 435       9.279  32.395 -45.528  1.00  0.44           C  
ATOM   6776  O   GLN B 435       9.976  33.275 -46.024  1.00  0.44           O  
ATOM   6777  CB  GLN B 435       7.822  33.586 -43.808  1.00  0.44           C  
ATOM   6778  CG  GLN B 435       7.223  33.483 -42.383  1.00  0.44           C  
ATOM   6779  CD  GLN B 435       5.743  33.877 -42.319  1.00  0.44           C  
ATOM   6780  OE1 GLN B 435       5.129  34.363 -43.266  1.00  0.44           O  
ATOM   6781  NE2 GLN B 435       5.128  33.625 -41.139  1.00  0.44           N  
ATOM   6782  N   THR B 436       8.941  31.300 -46.229  1.00  0.42           N  
ATOM   6783  CA  THR B 436       9.377  31.077 -47.587  1.00  0.42           C  
ATOM   6784  C   THR B 436       8.740  32.048 -48.554  1.00  0.42           C  
ATOM   6785  O   THR B 436       7.549  31.939 -48.833  1.00  0.42           O  
ATOM   6786  CB  THR B 436       9.175  29.626 -48.075  1.00  0.42           C  
ATOM   6787  OG1 THR B 436       8.133  28.915 -47.428  1.00  0.42           O  
ATOM   6788  CG2 THR B 436      10.460  28.841 -47.770  1.00  0.42           C  
ATOM   6789  N   SER B 437       9.520  33.007 -49.078  1.00  0.50           N  
ATOM   6790  CA  SER B 437       9.184  33.838 -50.210  1.00  0.50           C  
ATOM   6791  C   SER B 437       9.475  33.151 -51.563  1.00  0.50           C  
ATOM   6792  O   SER B 437       9.980  31.995 -51.577  1.00  0.50           O  
ATOM   6793  CB  SER B 437       9.999  35.162 -50.137  1.00  0.50           C  
ATOM   6794  OG  SER B 437      11.352  34.975 -49.695  1.00  0.50           O  
ATOM   6795  OXT SER B 437       9.174  33.794 -52.607  1.00  0.50           O  
TER    6796      SER B 437                                                      
END   


A second structure was input as follows:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 svg2
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   22-JAN-22 1MOD    1       01:28
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.968
REMARK   3  GMQE    0.61
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.59
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2022-01-14
REMARK   3  SMTLE   template_upload.1.B
REMARK   3  SMTLV   2022-01-19
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.49
REMARK   3  SIM     0.61
REMARK   3  SID     99.77
REMARK   3  OSTAT   homo-dimer
REMARK   3  ALN B TRG MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN B TRG AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN B TRG TDDFAAQRNAAFEQARP-GGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVS
REMARK   3  ALN B TRG PRILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEP
REMARK   3  ALN B TRG EVIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREA
REMARK   3  ALN B TRG HALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQA
REMARK   3  ALN B TRG FAEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLG
REMARK   3  ALN B TRG EARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN B TPL MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN B TPL AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN B TPL TDDFAAQRNAAFEQA-RPGGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVS
REMARK   3  ALN B TPL PRILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEP
REMARK   3  ALN B TPL EVIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREA
REMARK   3  ALN B TPL HALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQA
REMARK   3  ALN B TPL FAEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLG
REMARK   3  ALN B TPL EARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN B OFF 0
ATOM      1  N   MET A   1     -34.416   2.396  16.871  1.00  0.73           N  
ATOM      2  CA  MET A   1     -33.865   3.324  15.829  1.00  0.73           C  
ATOM      3  C   MET A   1     -32.558   2.777  15.257  1.00  0.73           C  
ATOM      4  O   MET A   1     -31.955   1.914  15.885  1.00  0.73           O  
ATOM      5  CB  MET A   1     -33.703   4.706  16.532  1.00  0.73           C  
ATOM      6  CG  MET A   1     -33.060   5.825  15.699  1.00  0.73           C  
ATOM      7  SD  MET A   1     -32.839   7.405  16.573  1.00  0.73           S  
ATOM      8  CE  MET A   1     -34.571   7.921  16.460  1.00  0.73           C  
ATOM      9  N   LYS A   2     -32.075   3.208  14.068  1.00  0.74           N  
ATOM     10  CA  LYS A   2     -30.794   2.757  13.540  1.00  0.74           C  
ATOM     11  C   LYS A   2     -29.650   3.701  13.889  1.00  0.74           C  
ATOM     12  O   LYS A   2     -29.840   4.855  14.270  1.00  0.74           O  
ATOM     13  CB  LYS A   2     -30.826   2.605  12.000  1.00  0.74           C  
ATOM     14  CG  LYS A   2     -31.842   1.586  11.466  1.00  0.74           C  
ATOM     15  CD  LYS A   2     -31.488   0.171  11.931  1.00  0.74           C  
ATOM     16  CE  LYS A   2     -32.287  -0.948  11.265  1.00  0.74           C  
ATOM     17  NZ  LYS A   2     -31.808  -2.233  11.791  1.00  0.74           N  
ATOM     18  N   PHE A   3     -28.394   3.218  13.774  1.00  0.77           N  
ATOM     19  CA  PHE A   3     -27.194   4.011  14.001  1.00  0.77           C  
ATOM     20  C   PHE A   3     -27.033   5.162  13.008  1.00  0.77           C  
ATOM     21  O   PHE A   3     -26.595   6.251  13.381  1.00  0.77           O  
ATOM     22  CB  PHE A   3     -25.939   3.095  14.057  1.00  0.77           C  
ATOM     23  CG  PHE A   3     -24.653   3.815  14.414  1.00  0.77           C  
ATOM     24  CD1 PHE A   3     -23.482   3.562  13.678  1.00  0.77           C  
ATOM     25  CD2 PHE A   3     -24.591   4.746  15.468  1.00  0.77           C  
ATOM     26  CE1 PHE A   3     -22.285   4.228  13.970  1.00  0.77           C  
ATOM     27  CE2 PHE A   3     -23.402   5.432  15.748  1.00  0.77           C  
ATOM     28  CZ  PHE A   3     -22.247   5.169  15.004  1.00  0.77           C  
ATOM     29  N   SER A   4     -27.439   4.979  11.732  1.00  0.80           N  
ATOM     30  CA  SER A   4     -27.510   6.056  10.744  1.00  0.80           C  
ATOM     31  C   SER A   4     -28.347   7.235  11.198  1.00  0.80           C  
ATOM     32  O   SER A   4     -27.891   8.373  11.211  1.00  0.80           O  
ATOM     33  CB  SER A   4     -28.135   5.558   9.408  1.00  0.80           C  
ATOM     34  OG  SER A   4     -29.269   4.705   9.624  1.00  0.80           O  
ATOM     35  N   ASP A   5     -29.566   6.958  11.684  1.00  0.80           N  
ATOM     36  CA  ASP A   5     -30.556   7.911  12.123  1.00  0.80           C  
ATOM     37  C   ASP A   5     -30.035   8.753  13.283  1.00  0.80           C  
ATOM     38  O   ASP A   5     -30.250   9.961  13.369  1.00  0.80           O  
ATOM     39  CB  ASP A   5     -31.831   7.162  12.613  1.00  0.80           C  
ATOM     40  CG  ASP A   5     -32.262   5.946  11.800  1.00  0.80           C  
ATOM     41  OD1 ASP A   5     -31.737   5.700  10.685  1.00  0.80           O  
ATOM     42  OD2 ASP A   5     -33.082   5.179  12.377  1.00  0.80           O  
ATOM     43  N   VAL A   6     -29.322   8.093  14.218  1.00  0.83           N  
ATOM     44  CA  VAL A   6     -28.634   8.702  15.343  1.00  0.83           C  
ATOM     45  C   VAL A   6     -27.524   9.651  14.916  1.00  0.83           C  
ATOM     46  O   VAL A   6     -27.429  10.768  15.425  1.00  0.83           O  
ATOM     47  CB  VAL A   6     -28.080   7.611  16.255  1.00  0.83           C  
ATOM     48  CG1 VAL A   6     -27.175   8.162  17.371  1.00  0.83           C  
ATOM     49  CG2 VAL A   6     -29.263   6.878  16.900  1.00  0.83           C  
ATOM     50  N   LEU A   7     -26.670   9.260  13.946  1.00  0.80           N  
ATOM     51  CA  LEU A   7     -25.651  10.144  13.399  1.00  0.80           C  
ATOM     52  C   LEU A   7     -26.233  11.332  12.647  1.00  0.80           C  
ATOM     53  O   LEU A   7     -25.837  12.471  12.887  1.00  0.80           O  
ATOM     54  CB  LEU A   7     -24.670   9.390  12.468  1.00  0.80           C  
ATOM     55  CG  LEU A   7     -23.780   8.342  13.169  1.00  0.80           C  
ATOM     56  CD1 LEU A   7     -22.923   7.608  12.128  1.00  0.80           C  
ATOM     57  CD2 LEU A   7     -22.874   8.960  14.249  1.00  0.80           C  
ATOM     58  N   ASP A   8     -27.235  11.114  11.776  1.00  0.77           N  
ATOM     59  CA  ASP A   8     -27.892  12.165  11.020  1.00  0.77           C  
ATOM     60  C   ASP A   8     -28.575  13.194  11.921  1.00  0.77           C  
ATOM     61  O   ASP A   8     -28.442  14.400  11.733  1.00  0.77           O  
ATOM     62  CB  ASP A   8     -28.921  11.542  10.043  1.00  0.77           C  
ATOM     63  CG  ASP A   8     -28.242  10.774   8.915  1.00  0.77           C  
ATOM     64  OD1 ASP A   8     -26.994  10.842   8.791  1.00  0.77           O  
ATOM     65  OD2 ASP A   8     -28.996  10.128   8.145  1.00  0.77           O  
ATOM     66  N   GLN A   9     -29.282  12.746  12.980  1.00  0.75           N  
ATOM     67  CA  GLN A   9     -29.833  13.628  13.999  1.00  0.75           C  
ATOM     68  C   GLN A   9     -28.778  14.374  14.813  1.00  0.75           C  
ATOM     69  O   GLN A   9     -28.912  15.573  15.041  1.00  0.75           O  
ATOM     70  CB  GLN A   9     -30.829  12.869  14.906  1.00  0.75           C  
ATOM     71  CG  GLN A   9     -32.141  12.554  14.145  1.00  0.75           C  
ATOM     72  CD  GLN A   9     -33.040  11.564  14.886  1.00  0.75           C  
ATOM     73  OE1 GLN A   9     -33.897  11.915  15.697  1.00  0.75           O  
ATOM     74  NE2 GLN A   9     -32.844  10.260  14.588  1.00  0.75           N  
ATOM     75  N   ALA A  10     -27.667  13.717  15.211  1.00  0.83           N  
ATOM     76  CA  ALA A  10     -26.540  14.364  15.866  1.00  0.83           C  
ATOM     77  C   ALA A  10     -25.886  15.452  15.013  1.00  0.83           C  
ATOM     78  O   ALA A  10     -25.549  16.543  15.475  1.00  0.83           O  
ATOM     79  CB  ALA A  10     -25.477  13.303  16.220  1.00  0.83           C  
ATOM     80  N   TRP A  11     -25.727  15.204  13.703  1.00  0.68           N  
ATOM     81  CA  TRP A  11     -25.209  16.175  12.760  1.00  0.68           C  
ATOM     82  C   TRP A  11     -26.199  17.284  12.404  1.00  0.68           C  
ATOM     83  O   TRP A  11     -25.776  18.312  11.892  1.00  0.68           O  
ATOM     84  CB  TRP A  11     -24.683  15.472  11.481  1.00  0.68           C  
ATOM     85  CG  TRP A  11     -23.281  14.896  11.644  1.00  0.68           C  
ATOM     86  CD1 TRP A  11     -22.875  13.630  11.974  1.00  0.68           C  
ATOM     87  CD2 TRP A  11     -22.081  15.669  11.458  1.00  0.68           C  
ATOM     88  NE1 TRP A  11     -21.497  13.567  12.018  1.00  0.68           N  
ATOM     89  CE2 TRP A  11     -20.991  14.801  11.694  1.00  0.68           C  
ATOM     90  CE3 TRP A  11     -21.876  17.003  11.108  1.00  0.68           C  
ATOM     91  CZ2 TRP A  11     -19.685  15.251  11.578  1.00  0.68           C  
ATOM     92  CZ3 TRP A  11     -20.553  17.455  10.991  1.00  0.68           C  
ATOM     93  CH2 TRP A  11     -19.470  16.592  11.225  1.00  0.68           C  
ATOM     94  N   ALA A  12     -27.506  17.133  12.715  1.00  0.75           N  
ATOM     95  CA  ALA A  12     -28.544  18.116  12.430  1.00  0.75           C  
ATOM     96  C   ALA A  12     -29.000  18.940  13.644  1.00  0.75           C  
ATOM     97  O   ALA A  12     -29.955  19.715  13.574  1.00  0.75           O  
ATOM     98  CB  ALA A  12     -29.763  17.374  11.840  1.00  0.75           C  
ATOM     99  N   GLU A  13     -28.334  18.818  14.813  1.00  0.66           N  
ATOM    100  CA  GLU A  13     -28.532  19.724  15.943  1.00  0.66           C  
ATOM    101  C   GLU A  13     -27.982  21.141  15.725  1.00  0.66           C  
ATOM    102  O   GLU A  13     -26.966  21.530  16.298  1.00  0.66           O  
ATOM    103  CB  GLU A  13     -27.857  19.206  17.235  1.00  0.66           C  
ATOM    104  CG  GLU A  13     -28.364  17.852  17.770  1.00  0.66           C  
ATOM    105  CD  GLU A  13     -27.675  17.531  19.086  1.00  0.66           C  
ATOM    106  OE1 GLU A  13     -28.279  16.824  19.931  1.00  0.66           O  
ATOM    107  OE2 GLU A  13     -26.531  18.005  19.300  1.00  0.66           O  
ATOM    108  N   ASP A  14     -28.644  21.957  14.885  1.00  0.57           N  
ATOM    109  CA  ASP A  14     -28.117  23.257  14.493  1.00  0.57           C  
ATOM    110  C   ASP A  14     -28.875  24.418  15.134  1.00  0.57           C  
ATOM    111  O   ASP A  14     -28.584  25.593  14.920  1.00  0.57           O  
ATOM    112  CB  ASP A  14     -28.145  23.349  12.950  1.00  0.57           C  
ATOM    113  CG  ASP A  14     -27.305  22.204  12.398  1.00  0.57           C  
ATOM    114  OD1 ASP A  14     -26.176  21.975  12.924  1.00  0.57           O  
ATOM    115  OD2 ASP A  14     -27.811  21.513  11.481  1.00  0.57           O  
ATOM    116  N   SER A  15     -29.864  24.124  15.996  1.00  0.54           N  
ATOM    117  CA  SER A  15     -30.731  25.107  16.633  1.00  0.54           C  
ATOM    118  C   SER A  15     -30.209  25.617  17.972  1.00  0.54           C  
ATOM    119  O   SER A  15     -30.972  25.967  18.869  1.00  0.54           O  
ATOM    120  CB  SER A  15     -32.172  24.548  16.804  1.00  0.54           C  
ATOM    121  OG  SER A  15     -32.160  23.224  17.346  1.00  0.54           O  
ATOM    122  N   GLY A  16     -28.874  25.716  18.134  1.00  0.60           N  
ATOM    123  CA  GLY A  16     -28.262  26.188  19.366  1.00  0.60           C  
ATOM    124  C   GLY A  16     -26.866  25.647  19.478  1.00  0.60           C  
ATOM    125  O   GLY A  16     -26.263  25.326  18.454  1.00  0.60           O  
ATOM    126  N   PRO A  17     -26.285  25.510  20.664  1.00  0.63           N  
ATOM    127  CA  PRO A  17     -25.132  24.643  20.855  1.00  0.63           C  
ATOM    128  C   PRO A  17     -25.574  23.180  20.757  1.00  0.63           C  
ATOM    129  O   PRO A  17     -26.695  22.896  21.184  1.00  0.63           O  
ATOM    130  CB  PRO A  17     -24.640  25.018  22.265  1.00  0.63           C  
ATOM    131  CG  PRO A  17     -25.908  25.451  23.011  1.00  0.63           C  
ATOM    132  CD  PRO A  17     -26.758  26.107  21.917  1.00  0.63           C  
ATOM    133  N   PRO A  18     -24.810  22.251  20.188  1.00  0.75           N  
ATOM    134  CA  PRO A  18     -25.174  20.838  20.177  1.00  0.75           C  
ATOM    135  C   PRO A  18     -25.217  20.225  21.568  1.00  0.75           C  
ATOM    136  O   PRO A  18     -24.640  20.765  22.515  1.00  0.75           O  
ATOM    137  CB  PRO A  18     -24.073  20.209  19.310  1.00  0.75           C  
ATOM    138  CG  PRO A  18     -22.838  21.051  19.630  1.00  0.75           C  
ATOM    139  CD  PRO A  18     -23.421  22.460  19.771  1.00  0.75           C  
ATOM    140  N   THR A  19     -25.888  19.070  21.710  1.00  0.79           N  
ATOM    141  CA  THR A  19     -25.935  18.319  22.956  1.00  0.79           C  
ATOM    142  C   THR A  19     -24.605  17.640  23.207  1.00  0.79           C  
ATOM    143  O   THR A  19     -23.750  17.547  22.329  1.00  0.79           O  
ATOM    144  CB  THR A  19     -27.069  17.292  23.069  1.00  0.79           C  
ATOM    145  OG1 THR A  19     -26.965  16.200  22.166  1.00  0.79           O  
ATOM    146  CG2 THR A  19     -28.423  17.981  22.848  1.00  0.79           C  
ATOM    147  N   THR A  20     -24.349  17.138  24.434  1.00  0.82           N  
ATOM    148  CA  THR A  20     -23.109  16.414  24.719  1.00  0.82           C  
ATOM    149  C   THR A  20     -22.959  15.170  23.864  1.00  0.82           C  
ATOM    150  O   THR A  20     -21.920  14.929  23.262  1.00  0.82           O  
ATOM    151  CB  THR A  20     -22.981  15.996  26.178  1.00  0.82           C  
ATOM    152  OG1 THR A  20     -23.415  17.047  27.028  1.00  0.82           O  
ATOM    153  CG2 THR A  20     -21.510  15.730  26.515  1.00  0.82           C  
ATOM    154  N   LEU A  21     -24.041  14.377  23.720  1.00  0.83           N  
ATOM    155  CA  LEU A  21     -24.052  13.242  22.816  1.00  0.83           C  
ATOM    156  C   LEU A  21     -23.927  13.650  21.353  1.00  0.83           C  
ATOM    157  O   LEU A  21     -23.148  13.067  20.603  1.00  0.83           O  
ATOM    158  CB  LEU A  21     -25.339  12.409  23.021  1.00  0.83           C  
ATOM    159  CG  LEU A  21     -25.411  11.113  22.187  1.00  0.83           C  
ATOM    160  CD1 LEU A  21     -24.291  10.117  22.533  1.00  0.83           C  
ATOM    161  CD2 LEU A  21     -26.777  10.444  22.357  1.00  0.83           C  
ATOM    162  N   GLY A  22     -24.667  14.694  20.919  1.00  0.85           N  
ATOM    163  CA  GLY A  22     -24.551  15.318  19.603  1.00  0.85           C  
ATOM    164  C   GLY A  22     -23.163  15.721  19.207  1.00  0.85           C  
ATOM    165  O   GLY A  22     -22.666  15.348  18.148  1.00  0.85           O  
ATOM    166  N   ARG A  23     -22.474  16.469  20.085  1.00  0.74           N  
ATOM    167  CA  ARG A  23     -21.096  16.885  19.923  1.00  0.74           C  
ATOM    168  C   ARG A  23     -20.132  15.715  19.779  1.00  0.74           C  
ATOM    169  O   ARG A  23     -19.298  15.685  18.875  1.00  0.74           O  
ATOM    170  CB  ARG A  23     -20.684  17.702  21.175  1.00  0.74           C  
ATOM    171  CG  ARG A  23     -19.256  18.291  21.146  1.00  0.74           C  
ATOM    172  CD  ARG A  23     -18.785  18.835  22.502  1.00  0.74           C  
ATOM    173  NE  ARG A  23     -18.589  17.650  23.390  1.00  0.74           N  
ATOM    174  CZ  ARG A  23     -18.373  17.655  24.707  1.00  0.74           C  
ATOM    175  NH1 ARG A  23     -18.278  18.787  25.394  1.00  0.74           N  
ATOM    176  NH2 ARG A  23     -18.239  16.494  25.339  1.00  0.74           N  
ATOM    177  N   ASP A  24     -20.261  14.701  20.651  1.00  0.84           N  
ATOM    178  CA  ASP A  24     -19.302  13.621  20.738  1.00  0.84           C  
ATOM    179  C   ASP A  24     -19.554  12.539  19.684  1.00  0.84           C  
ATOM    180  O   ASP A  24     -18.657  11.784  19.309  1.00  0.84           O  
ATOM    181  CB  ASP A  24     -19.295  13.105  22.203  1.00  0.84           C  
ATOM    182  CG  ASP A  24     -18.813  14.213  23.125  1.00  0.84           C  
ATOM    183  OD1 ASP A  24     -18.172  15.181  22.638  1.00  0.84           O  
ATOM    184  OD2 ASP A  24     -19.038  14.149  24.360  1.00  0.84           O  
ATOM    185  N   LEU A  25     -20.768  12.494  19.092  1.00  0.84           N  
ATOM    186  CA  LEU A  25     -21.042  11.724  17.887  1.00  0.84           C  
ATOM    187  C   LEU A  25     -20.636  12.435  16.599  1.00  0.84           C  
ATOM    188  O   LEU A  25     -20.392  11.783  15.587  1.00  0.84           O  
ATOM    189  CB  LEU A  25     -22.541  11.368  17.771  1.00  0.84           C  
ATOM    190  CG  LEU A  25     -23.043  10.328  18.790  1.00  0.84           C  
ATOM    191  CD1 LEU A  25     -24.570  10.246  18.692  1.00  0.84           C  
ATOM    192  CD2 LEU A  25     -22.421   8.937  18.583  1.00  0.84           C  
ATOM    193  N   ARG A  26     -20.467  13.778  16.597  1.00  0.72           N  
ATOM    194  CA  ARG A  26     -19.963  14.523  15.441  1.00  0.72           C  
ATOM    195  C   ARG A  26     -18.472  14.273  15.216  1.00  0.72           C  
ATOM    196  O   ARG A  26     -17.902  14.614  14.183  1.00  0.72           O  
ATOM    197  CB  ARG A  26     -20.202  16.054  15.569  1.00  0.72           C  
ATOM    198  CG  ARG A  26     -21.659  16.501  15.316  1.00  0.72           C  
ATOM    199  CD  ARG A  26     -21.917  17.964  15.719  1.00  0.72           C  
ATOM    200  NE  ARG A  26     -23.376  18.249  15.516  1.00  0.72           N  
ATOM    201  CZ  ARG A  26     -23.919  19.421  15.151  1.00  0.72           C  
ATOM    202  NH1 ARG A  26     -23.245  20.562  15.139  1.00  0.72           N  
ATOM    203  NH2 ARG A  26     -25.194  19.454  14.787  1.00  0.72           N  
ATOM    204  N   LEU A  27     -17.803  13.626  16.188  1.00  0.83           N  
ATOM    205  CA  LEU A  27     -16.456  13.126  16.039  1.00  0.83           C  
ATOM    206  C   LEU A  27     -16.371  11.898  15.140  1.00  0.83           C  
ATOM    207  O   LEU A  27     -15.299  11.580  14.630  1.00  0.83           O  
ATOM    208  CB  LEU A  27     -15.876  12.772  17.428  1.00  0.83           C  
ATOM    209  CG  LEU A  27     -15.771  13.976  18.386  1.00  0.83           C  
ATOM    210  CD1 LEU A  27     -15.293  13.518  19.771  1.00  0.83           C  
ATOM    211  CD2 LEU A  27     -14.844  15.058  17.815  1.00  0.83           C  
ATOM    212  N   VAL A  28     -17.492  11.187  14.886  1.00  0.81           N  
ATOM    213  CA  VAL A  28     -17.553  10.118  13.899  1.00  0.81           C  
ATOM    214  C   VAL A  28     -17.522  10.694  12.487  1.00  0.81           C  
ATOM    215  O   VAL A  28     -18.367  11.495  12.090  1.00  0.81           O  
ATOM    216  CB  VAL A  28     -18.775   9.218  14.087  1.00  0.81           C  
ATOM    217  CG1 VAL A  28     -18.854   8.136  12.987  1.00  0.81           C  
ATOM    218  CG2 VAL A  28     -18.699   8.555  15.479  1.00  0.81           C  
ATOM    219  N   ARG A  29     -16.513  10.300  11.687  1.00  0.59           N  
ATOM    220  CA  ARG A  29     -16.315  10.798  10.340  1.00  0.59           C  
ATOM    221  C   ARG A  29     -16.843   9.828   9.306  1.00  0.59           C  
ATOM    222  O   ARG A  29     -17.299  10.231   8.238  1.00  0.59           O  
ATOM    223  CB  ARG A  29     -14.796  10.971  10.080  1.00  0.59           C  
ATOM    224  CG  ARG A  29     -14.150  12.116  10.889  1.00  0.59           C  
ATOM    225  CD  ARG A  29     -14.605  13.531  10.509  1.00  0.59           C  
ATOM    226  NE  ARG A  29     -14.258  13.707   9.064  1.00  0.59           N  
ATOM    227  CZ  ARG A  29     -14.467  14.829   8.366  1.00  0.59           C  
ATOM    228  NH1 ARG A  29     -14.939  15.927   8.945  1.00  0.59           N  
ATOM    229  NH2 ARG A  29     -14.197  14.846   7.063  1.00  0.59           N  
ATOM    230  N   ALA A  30     -16.817   8.525   9.620  1.00  0.73           N  
ATOM    231  CA  ALA A  30     -17.354   7.505   8.760  1.00  0.73           C  
ATOM    232  C   ALA A  30     -17.569   6.270   9.607  1.00  0.73           C  
ATOM    233  O   ALA A  30     -16.971   6.114  10.669  1.00  0.73           O  
ATOM    234  CB  ALA A  30     -16.398   7.182   7.591  1.00  0.73           C  
ATOM    235  N   ALA A  31     -18.434   5.352   9.158  1.00  0.80           N  
ATOM    236  CA  ALA A  31     -18.617   4.087   9.819  1.00  0.80           C  
ATOM    237  C   ALA A  31     -19.016   3.092   8.760  1.00  0.80           C  
ATOM    238  O   ALA A  31     -19.634   3.451   7.759  1.00  0.80           O  
ATOM    239  CB  ALA A  31     -19.692   4.164  10.924  1.00  0.80           C  
ATOM    240  N   ALA A  32     -18.624   1.820   8.936  1.00  0.84           N  
ATOM    241  CA  ALA A  32     -18.951   0.749   8.023  1.00  0.84           C  
ATOM    242  C   ALA A  32     -20.466   0.477   7.878  1.00  0.84           C  
ATOM    243  O   ALA A  32     -21.202   0.682   8.851  1.00  0.84           O  
ATOM    244  CB  ALA A  32     -18.183  -0.507   8.460  1.00  0.84           C  
ATOM    245  N   PRO A  33     -21.001   0.052   6.722  1.00  0.80           N  
ATOM    246  CA  PRO A  33     -22.442  -0.071   6.482  1.00  0.80           C  
ATOM    247  C   PRO A  33     -23.175  -0.988   7.437  1.00  0.80           C  
ATOM    248  O   PRO A  33     -24.339  -0.739   7.748  1.00  0.80           O  
ATOM    249  CB  PRO A  33     -22.538  -0.598   5.039  1.00  0.80           C  
ATOM    250  CG  PRO A  33     -21.252  -0.104   4.379  1.00  0.80           C  
ATOM    251  CD  PRO A  33     -20.233  -0.249   5.508  1.00  0.80           C  
ATOM    252  N   GLU A  34     -22.515  -2.057   7.910  1.00  0.75           N  
ATOM    253  CA  GLU A  34     -23.029  -3.035   8.840  1.00  0.75           C  
ATOM    254  C   GLU A  34     -23.351  -2.398  10.178  1.00  0.75           C  
ATOM    255  O   GLU A  34     -24.417  -2.613  10.747  1.00  0.75           O  
ATOM    256  CB  GLU A  34     -22.001  -4.183   9.055  1.00  0.75           C  
ATOM    257  CG  GLU A  34     -21.467  -4.837   7.747  1.00  0.75           C  
ATOM    258  CD  GLU A  34     -20.450  -3.983   6.987  1.00  0.75           C  
ATOM    259  OE1 GLU A  34     -20.200  -4.281   5.796  1.00  0.75           O  
ATOM    260  OE2 GLU A  34     -19.964  -2.982   7.577  1.00  0.75           O  
ATOM    261  N   LEU A  35     -22.441  -1.531  10.675  1.00  0.79           N  
ATOM    262  CA  LEU A  35     -22.629  -0.738  11.877  1.00  0.79           C  
ATOM    263  C   LEU A  35     -23.742   0.279  11.741  1.00  0.79           C  
ATOM    264  O   LEU A  35     -24.546   0.452  12.651  1.00  0.79           O  
ATOM    265  CB  LEU A  35     -21.333   0.002  12.287  1.00  0.79           C  
ATOM    266  CG  LEU A  35     -20.176  -0.935  12.680  1.00  0.79           C  
ATOM    267  CD1 LEU A  35     -18.886  -0.133  12.886  1.00  0.79           C  
ATOM    268  CD2 LEU A  35     -20.488  -1.756  13.940  1.00  0.79           C  
ATOM    269  N   LEU A  36     -23.843   0.959  10.580  1.00  0.75           N  
ATOM    270  CA  LEU A  36     -24.912   1.902  10.279  1.00  0.75           C  
ATOM    271  C   LEU A  36     -26.298   1.269  10.308  1.00  0.75           C  
ATOM    272  O   LEU A  36     -27.267   1.880  10.755  1.00  0.75           O  
ATOM    273  CB  LEU A  36     -24.684   2.591   8.911  1.00  0.75           C  
ATOM    274  CG  LEU A  36     -23.429   3.489   8.853  1.00  0.75           C  
ATOM    275  CD1 LEU A  36     -23.170   3.966   7.416  1.00  0.75           C  
ATOM    276  CD2 LEU A  36     -23.546   4.705   9.786  1.00  0.75           C  
ATOM    277  N   ALA A  37     -26.405   0.002   9.865  1.00  0.78           N  
ATOM    278  CA  ALA A  37     -27.646  -0.735   9.820  1.00  0.78           C  
ATOM    279  C   ALA A  37     -27.996  -1.448  11.130  1.00  0.78           C  
ATOM    280  O   ALA A  37     -29.083  -2.019  11.258  1.00  0.78           O  
ATOM    281  CB  ALA A  37     -27.534  -1.777   8.690  1.00  0.78           C  
ATOM    282  N   LEU A  38     -27.114  -1.415  12.152  1.00  0.75           N  
ATOM    283  CA  LEU A  38     -27.441  -1.841  13.505  1.00  0.75           C  
ATOM    284  C   LEU A  38     -28.477  -0.962  14.189  1.00  0.75           C  
ATOM    285  O   LEU A  38     -28.538   0.255  14.008  1.00  0.75           O  
ATOM    286  CB  LEU A  38     -26.215  -1.910  14.453  1.00  0.75           C  
ATOM    287  CG  LEU A  38     -25.153  -2.965  14.091  1.00  0.75           C  
ATOM    288  CD1 LEU A  38     -23.960  -2.862  15.051  1.00  0.75           C  
ATOM    289  CD2 LEU A  38     -25.710  -4.397  14.096  1.00  0.75           C  
ATOM    290  N   ASP A  39     -29.319  -1.590  15.024  1.00  0.76           N  
ATOM    291  CA  ASP A  39     -30.292  -0.924  15.852  1.00  0.76           C  
ATOM    292  C   ASP A  39     -29.653  -0.444  17.153  1.00  0.76           C  
ATOM    293  O   ASP A  39     -28.890  -1.154  17.806  1.00  0.76           O  
ATOM    294  CB  ASP A  39     -31.491  -1.864  16.131  1.00  0.76           C  
ATOM    295  CG  ASP A  39     -32.064  -2.299  14.810  1.00  0.76           C  
ATOM    296  OD1 ASP A  39     -32.950  -1.603  14.257  1.00  0.76           O  
ATOM    297  OD2 ASP A  39     -31.551  -3.290  14.228  1.00  0.76           O  
ATOM    298  N   VAL A  40     -29.946   0.806  17.548  1.00  0.81           N  
ATOM    299  CA  VAL A  40     -29.458   1.406  18.779  1.00  0.81           C  
ATOM    300  C   VAL A  40     -30.469   1.137  19.888  1.00  0.81           C  
ATOM    301  O   VAL A  40     -31.615   0.807  19.572  1.00  0.81           O  
ATOM    302  CB  VAL A  40     -29.188   2.908  18.633  1.00  0.81           C  
ATOM    303  CG1 VAL A  40     -28.199   3.114  17.468  1.00  0.81           C  
ATOM    304  CG2 VAL A  40     -30.487   3.710  18.419  1.00  0.81           C  
ATOM    305  N   PRO A  41     -30.186   1.269  21.184  1.00  0.82           N  
ATOM    306  CA  PRO A  41     -31.106   0.759  22.205  1.00  0.82           C  
ATOM    307  C   PRO A  41     -32.046   1.874  22.648  1.00  0.82           C  
ATOM    308  O   PRO A  41     -32.200   2.130  23.840  1.00  0.82           O  
ATOM    309  CB  PRO A  41     -30.142   0.342  23.335  1.00  0.82           C  
ATOM    310  CG  PRO A  41     -28.979   1.327  23.216  1.00  0.82           C  
ATOM    311  CD  PRO A  41     -28.826   1.451  21.705  1.00  0.82           C  
ATOM    312  N   ALA A  42     -32.698   2.529  21.675  1.00  0.78           N  
ATOM    313  CA  ALA A  42     -33.673   3.571  21.879  1.00  0.78           C  
ATOM    314  C   ALA A  42     -34.427   3.764  20.576  1.00  0.78           C  
ATOM    315  O   ALA A  42     -33.960   3.337  19.513  1.00  0.78           O  
ATOM    316  CB  ALA A  42     -32.990   4.893  22.271  1.00  0.78           C  
ATOM    317  N   ASP A  43     -35.596   4.429  20.618  1.00  0.69           N  
ATOM    318  CA  ASP A  43     -36.379   4.700  19.425  1.00  0.69           C  
ATOM    319  C   ASP A  43     -36.687   6.187  19.264  1.00  0.69           C  
ATOM    320  O   ASP A  43     -37.229   6.611  18.244  1.00  0.69           O  
ATOM    321  CB  ASP A  43     -37.646   3.804  19.356  1.00  0.69           C  
ATOM    322  CG  ASP A  43     -37.313   2.499  18.650  1.00  0.69           C  
ATOM    323  OD1 ASP A  43     -36.964   2.587  17.435  1.00  0.69           O  
ATOM    324  OD2 ASP A  43     -37.345   1.418  19.283  1.00  0.69           O  
ATOM    325  N   ALA A  44     -36.240   7.048  20.198  1.00  0.75           N  
ATOM    326  CA  ALA A  44     -36.105   8.466  19.951  1.00  0.75           C  
ATOM    327  C   ALA A  44     -34.686   8.917  20.274  1.00  0.75           C  
ATOM    328  O   ALA A  44     -34.039   8.467  21.215  1.00  0.75           O  
ATOM    329  CB  ALA A  44     -37.144   9.277  20.749  1.00  0.75           C  
ATOM    330  N   TYR A  45     -34.130   9.863  19.489  1.00  0.75           N  
ATOM    331  CA  TYR A  45     -32.806  10.417  19.732  1.00  0.75           C  
ATOM    332  C   TYR A  45     -32.710  11.134  21.084  1.00  0.75           C  
ATOM    333  O   TYR A  45     -31.710  11.043  21.793  1.00  0.75           O  
ATOM    334  CB  TYR A  45     -32.418  11.333  18.543  1.00  0.75           C  
ATOM    335  CG  TYR A  45     -31.015  11.859  18.653  1.00  0.75           C  
ATOM    336  CD1 TYR A  45     -30.789  13.241  18.760  1.00  0.75           C  
ATOM    337  CD2 TYR A  45     -29.918  10.980  18.686  1.00  0.75           C  
ATOM    338  CE1 TYR A  45     -29.488  13.737  18.919  1.00  0.75           C  
ATOM    339  CE2 TYR A  45     -28.620  11.477  18.863  1.00  0.75           C  
ATOM    340  CZ  TYR A  45     -28.411  12.850  18.986  1.00  0.75           C  
ATOM    341  OH  TYR A  45     -27.111  13.324  19.202  1.00  0.75           O  
ATOM    342  N   GLY A  46     -33.797  11.815  21.508  1.00  0.79           N  
ATOM    343  CA  GLY A  46     -33.887  12.443  22.824  1.00  0.79           C  
ATOM    344  C   GLY A  46     -33.773  11.503  24.006  1.00  0.79           C  
ATOM    345  O   GLY A  46     -33.285  11.896  25.061  1.00  0.79           O  
ATOM    346  N   GLU A  47     -34.178  10.222  23.858  1.00  0.72           N  
ATOM    347  CA  GLU A  47     -33.970   9.189  24.864  1.00  0.72           C  
ATOM    348  C   GLU A  47     -32.494   8.904  25.079  1.00  0.72           C  
ATOM    349  O   GLU A  47     -32.014   8.847  26.208  1.00  0.72           O  
ATOM    350  CB  GLU A  47     -34.653   7.868  24.436  1.00  0.72           C  
ATOM    351  CG  GLU A  47     -36.195   7.958  24.356  1.00  0.72           C  
ATOM    352  CD  GLU A  47     -36.827   6.885  23.466  1.00  0.72           C  
ATOM    353  OE1 GLU A  47     -38.075   6.923  23.352  1.00  0.72           O  
ATOM    354  OE2 GLU A  47     -36.091   6.076  22.841  1.00  0.72           O  
ATOM    355  N   LEU A  48     -31.722   8.785  23.975  1.00  0.80           N  
ATOM    356  CA  LEU A  48     -30.277   8.645  24.011  1.00  0.80           C  
ATOM    357  C   LEU A  48     -29.582   9.861  24.598  1.00  0.80           C  
ATOM    358  O   LEU A  48     -28.682   9.729  25.421  1.00  0.80           O  
ATOM    359  CB  LEU A  48     -29.682   8.392  22.605  1.00  0.80           C  
ATOM    360  CG  LEU A  48     -30.119   7.077  21.942  1.00  0.80           C  
ATOM    361  CD1 LEU A  48     -29.694   7.065  20.468  1.00  0.80           C  
ATOM    362  CD2 LEU A  48     -29.547   5.846  22.665  1.00  0.80           C  
ATOM    363  N   VAL A  49     -29.994  11.088  24.223  1.00  0.81           N  
ATOM    364  CA  VAL A  49     -29.460  12.318  24.802  1.00  0.81           C  
ATOM    365  C   VAL A  49     -29.723  12.410  26.303  1.00  0.81           C  
ATOM    366  O   VAL A  49     -28.825  12.706  27.091  1.00  0.81           O  
ATOM    367  CB  VAL A  49     -30.025  13.547  24.090  1.00  0.81           C  
ATOM    368  CG1 VAL A  49     -29.594  14.859  24.779  1.00  0.81           C  
ATOM    369  CG2 VAL A  49     -29.531  13.557  22.630  1.00  0.81           C  
ATOM    370  N   GLY A  50     -30.958  12.092  26.750  1.00  0.83           N  
ATOM    371  CA  GLY A  50     -31.331  12.105  28.162  1.00  0.83           C  
ATOM    372  C   GLY A  50     -30.655  11.064  29.019  1.00  0.83           C  
ATOM    373  O   GLY A  50     -30.420  11.279  30.211  1.00  0.83           O  
ATOM    374  N   SER A  51     -30.296   9.903  28.442  1.00  0.82           N  
ATOM    375  CA  SER A  51     -29.637   8.825  29.165  1.00  0.82           C  
ATOM    376  C   SER A  51     -28.123   8.874  29.076  1.00  0.82           C  
ATOM    377  O   SER A  51     -27.442   8.189  29.835  1.00  0.82           O  
ATOM    378  CB  SER A  51     -30.113   7.428  28.673  1.00  0.82           C  
ATOM    379  OG  SER A  51     -29.771   7.187  27.306  1.00  0.82           O  
ATOM    380  N   TYR A  52     -27.545   9.711  28.187  1.00  0.33           N  
ATOM    381  CA  TYR A  52     -26.106   9.827  28.015  1.00  0.33           C  
ATOM    382  C   TYR A  52     -25.379  10.371  29.238  1.00  0.33           C  
ATOM    383  O   TYR A  52     -25.696  11.436  29.768  1.00  0.33           O  
ATOM    384  CB  TYR A  52     -25.755  10.689  26.768  1.00  0.33           C  
ATOM    385  CG  TYR A  52     -24.283  10.654  26.427  1.00  0.33           C  
ATOM    386  CD1 TYR A  52     -23.538  11.840  26.302  1.00  0.33           C  
ATOM    387  CD2 TYR A  52     -23.635   9.425  26.228  1.00  0.33           C  
ATOM    388  CE1 TYR A  52     -22.178  11.793  25.963  1.00  0.33           C  
ATOM    389  CE2 TYR A  52     -22.278   9.375  25.886  1.00  0.33           C  
ATOM    390  CZ  TYR A  52     -21.553  10.561  25.750  1.00  0.33           C  
ATOM    391  OH  TYR A  52     -20.194  10.534  25.393  1.00  0.33           O  
ATOM    392  N   ARG A  53     -24.366   9.637  29.720  1.00  0.29           N  
ATOM    393  CA  ARG A  53     -23.586  10.043  30.865  1.00  0.29           C  
ATOM    394  C   ARG A  53     -22.107   9.976  30.507  1.00  0.29           C  
ATOM    395  O   ARG A  53     -21.552   8.877  30.469  1.00  0.29           O  
ATOM    396  CB  ARG A  53     -23.921   9.127  32.070  1.00  0.29           C  
ATOM    397  CG  ARG A  53     -25.358   9.316  32.610  1.00  0.29           C  
ATOM    398  CD  ARG A  53     -25.659  10.732  33.132  1.00  0.29           C  
ATOM    399  NE  ARG A  53     -27.124  10.780  33.486  1.00  0.29           N  
ATOM    400  CZ  ARG A  53     -28.102  11.073  32.617  1.00  0.29           C  
ATOM    401  NH1 ARG A  53     -27.884  11.442  31.363  1.00  0.29           N  
ATOM    402  NH2 ARG A  53     -29.379  10.994  32.991  1.00  0.29           N  
ATOM    403  N   PRO A  54     -21.406  11.089  30.240  1.00  0.39           N  
ATOM    404  CA  PRO A  54     -19.993  11.069  29.873  1.00  0.39           C  
ATOM    405  C   PRO A  54     -19.133  10.893  31.113  1.00  0.39           C  
ATOM    406  O   PRO A  54     -17.935  10.645  30.992  1.00  0.39           O  
ATOM    407  CB  PRO A  54     -19.785  12.439  29.205  1.00  0.39           C  
ATOM    408  CG  PRO A  54     -20.768  13.355  29.937  1.00  0.39           C  
ATOM    409  CD  PRO A  54     -21.972  12.441  30.170  1.00  0.39           C  
ATOM    410  N   ASP A  55     -19.733  11.009  32.313  1.00  0.37           N  
ATOM    411  CA  ASP A  55     -19.187  10.629  33.595  1.00  0.37           C  
ATOM    412  C   ASP A  55     -18.905   9.127  33.674  1.00  0.37           C  
ATOM    413  O   ASP A  55     -17.884   8.687  34.199  1.00  0.37           O  
ATOM    414  CB  ASP A  55     -20.144  11.120  34.734  1.00  0.37           C  
ATOM    415  CG  ASP A  55     -21.622  10.817  34.498  1.00  0.37           C  
ATOM    416  OD1 ASP A  55     -22.176  11.377  33.513  1.00  0.37           O  
ATOM    417  OD2 ASP A  55     -22.226  10.027  35.274  1.00  0.37           O  
ATOM    418  N   ARG A  56     -19.801   8.299  33.106  1.00  0.34           N  
ATOM    419  CA  ARG A  56     -19.731   6.851  33.151  1.00  0.34           C  
ATOM    420  C   ARG A  56     -19.024   6.254  31.948  1.00  0.34           C  
ATOM    421  O   ARG A  56     -19.488   5.288  31.345  1.00  0.34           O  
ATOM    422  CB  ARG A  56     -21.151   6.252  33.273  1.00  0.34           C  
ATOM    423  CG  ARG A  56     -21.882   6.809  34.502  1.00  0.34           C  
ATOM    424  CD  ARG A  56     -23.274   6.234  34.722  1.00  0.34           C  
ATOM    425  NE  ARG A  56     -23.816   6.993  35.892  1.00  0.34           N  
ATOM    426  CZ  ARG A  56     -24.706   6.501  36.764  1.00  0.34           C  
ATOM    427  NH1 ARG A  56     -25.330   5.347  36.539  1.00  0.34           N  
ATOM    428  NH2 ARG A  56     -24.977   7.173  37.879  1.00  0.34           N  
ATOM    429  N   ALA A  57     -17.869   6.826  31.570  1.00  0.50           N  
ATOM    430  CA  ALA A  57     -17.028   6.323  30.506  1.00  0.50           C  
ATOM    431  C   ALA A  57     -16.491   4.906  30.727  1.00  0.50           C  
ATOM    432  O   ALA A  57     -16.090   4.530  31.829  1.00  0.50           O  
ATOM    433  CB  ALA A  57     -15.848   7.292  30.295  1.00  0.50           C  
ATOM    434  N   GLY A  58     -16.450   4.078  29.656  1.00  0.52           N  
ATOM    435  CA  GLY A  58     -15.699   2.825  29.656  1.00  0.52           C  
ATOM    436  C   GLY A  58     -14.213   3.065  29.771  1.00  0.52           C  
ATOM    437  O   GLY A  58     -13.681   3.995  29.173  1.00  0.52           O  
ATOM    438  N   ALA A  59     -13.492   2.229  30.543  1.00  0.65           N  
ATOM    439  CA  ALA A  59     -12.076   2.438  30.797  1.00  0.65           C  
ATOM    440  C   ALA A  59     -11.195   2.305  29.556  1.00  0.65           C  
ATOM    441  O   ALA A  59     -11.231   1.303  28.843  1.00  0.65           O  
ATOM    442  CB  ALA A  59     -11.585   1.474  31.899  1.00  0.65           C  
ATOM    443  N   VAL A  60     -10.357   3.316  29.275  1.00  0.65           N  
ATOM    444  CA  VAL A  60      -9.544   3.372  28.077  1.00  0.65           C  
ATOM    445  C   VAL A  60      -8.098   3.131  28.460  1.00  0.65           C  
ATOM    446  O   VAL A  60      -7.430   3.959  29.080  1.00  0.65           O  
ATOM    447  CB  VAL A  60      -9.672   4.710  27.348  1.00  0.65           C  
ATOM    448  CG1 VAL A  60      -8.864   4.694  26.033  1.00  0.65           C  
ATOM    449  CG2 VAL A  60     -11.156   4.998  27.047  1.00  0.65           C  
ATOM    450  N   THR A  61      -7.557   1.962  28.077  1.00  0.68           N  
ATOM    451  CA  THR A  61      -6.151   1.642  28.290  1.00  0.68           C  
ATOM    452  C   THR A  61      -5.392   1.990  27.037  1.00  0.68           C  
ATOM    453  O   THR A  61      -5.650   1.447  25.963  1.00  0.68           O  
ATOM    454  CB  THR A  61      -5.884   0.167  28.584  1.00  0.68           C  
ATOM    455  OG1 THR A  61      -6.389  -0.191  29.862  1.00  0.68           O  
ATOM    456  CG2 THR A  61      -4.384  -0.171  28.635  1.00  0.68           C  
ATOM    457  N   ALA A  62      -4.392   2.884  27.141  1.00  0.70           N  
ATOM    458  CA  ALA A  62      -3.440   3.083  26.072  1.00  0.70           C  
ATOM    459  C   ALA A  62      -2.427   1.954  26.057  1.00  0.70           C  
ATOM    460  O   ALA A  62      -1.833   1.620  27.081  1.00  0.70           O  
ATOM    461  CB  ALA A  62      -2.683   4.413  26.214  1.00  0.70           C  
ATOM    462  N   VAL A  63      -2.221   1.337  24.889  1.00  0.71           N  
ATOM    463  CA  VAL A  63      -1.277   0.260  24.702  1.00  0.71           C  
ATOM    464  C   VAL A  63      -0.173   0.804  23.832  1.00  0.71           C  
ATOM    465  O   VAL A  63      -0.391   1.136  22.668  1.00  0.71           O  
ATOM    466  CB  VAL A  63      -1.907  -0.946  24.016  1.00  0.71           C  
ATOM    467  CG1 VAL A  63      -0.851  -2.049  23.802  1.00  0.71           C  
ATOM    468  CG2 VAL A  63      -3.084  -1.455  24.872  1.00  0.71           C  
ATOM    469  N   VAL A  64       1.045   0.921  24.386  1.00  0.71           N  
ATOM    470  CA  VAL A  64       2.179   1.457  23.661  1.00  0.71           C  
ATOM    471  C   VAL A  64       3.208   0.364  23.495  1.00  0.71           C  
ATOM    472  O   VAL A  64       3.762  -0.155  24.462  1.00  0.71           O  
ATOM    473  CB  VAL A  64       2.808   2.675  24.338  1.00  0.71           C  
ATOM    474  CG1 VAL A  64       3.915   3.262  23.438  1.00  0.71           C  
ATOM    475  CG2 VAL A  64       1.718   3.741  24.571  1.00  0.71           C  
ATOM    476  N   LEU A  65       3.507  -0.031  22.245  1.00  0.67           N  
ATOM    477  CA  LEU A  65       4.606  -0.940  21.968  1.00  0.67           C  
ATOM    478  C   LEU A  65       5.882  -0.123  21.895  1.00  0.67           C  
ATOM    479  O   LEU A  65       5.900   0.960  21.319  1.00  0.67           O  
ATOM    480  CB  LEU A  65       4.415  -1.731  20.650  1.00  0.67           C  
ATOM    481  CG  LEU A  65       3.642  -3.058  20.804  1.00  0.67           C  
ATOM    482  CD1 LEU A  65       2.207  -2.877  21.324  1.00  0.67           C  
ATOM    483  CD2 LEU A  65       3.639  -3.806  19.464  1.00  0.67           C  
ATOM    484  N   THR A  66       6.976  -0.600  22.512  1.00  0.65           N  
ATOM    485  CA  THR A  66       8.172   0.221  22.640  1.00  0.65           C  
ATOM    486  C   THR A  66       9.418  -0.638  22.595  1.00  0.65           C  
ATOM    487  O   THR A  66       9.372  -1.838  22.869  1.00  0.65           O  
ATOM    488  CB  THR A  66       8.133   1.098  23.893  1.00  0.65           C  
ATOM    489  OG1 THR A  66       9.128   2.105  23.862  1.00  0.65           O  
ATOM    490  CG2 THR A  66       8.314   0.297  25.190  1.00  0.65           C  
ATOM    491  N   HIS A  67      10.552  -0.028  22.202  1.00  0.53           N  
ATOM    492  CA  HIS A  67      11.825  -0.694  22.005  1.00  0.53           C  
ATOM    493  C   HIS A  67      12.867   0.330  21.590  1.00  0.53           C  
ATOM    494  O   HIS A  67      12.927   0.701  20.420  1.00  0.53           O  
ATOM    495  CB  HIS A  67      11.808  -1.767  20.883  1.00  0.53           C  
ATOM    496  CG  HIS A  67      13.111  -2.498  20.854  1.00  0.53           C  
ATOM    497  ND1 HIS A  67      13.311  -3.473  21.804  1.00  0.53           N  
ATOM    498  CD2 HIS A  67      14.297  -2.086  20.343  1.00  0.53           C  
ATOM    499  CE1 HIS A  67      14.622  -3.630  21.868  1.00  0.53           C  
ATOM    500  NE2 HIS A  67      15.265  -2.806  21.006  1.00  0.53           N  
ATOM    501  N   ASP A  68      13.709   0.793  22.532  1.00  0.55           N  
ATOM    502  CA  ASP A  68      14.745   1.794  22.300  1.00  0.55           C  
ATOM    503  C   ASP A  68      14.225   3.157  21.797  1.00  0.55           C  
ATOM    504  O   ASP A  68      14.681   3.717  20.799  1.00  0.55           O  
ATOM    505  CB  ASP A  68      15.937   1.260  21.456  1.00  0.55           C  
ATOM    506  CG  ASP A  68      16.592   0.051  22.097  1.00  0.55           C  
ATOM    507  OD1 ASP A  68      16.611  -0.042  23.352  1.00  0.55           O  
ATOM    508  OD2 ASP A  68      17.103  -0.809  21.330  1.00  0.55           O  
ATOM    509  N   GLU A  69      13.228   3.714  22.516  1.00  0.59           N  
ATOM    510  CA  GLU A  69      12.418   4.848  22.116  1.00  0.59           C  
ATOM    511  C   GLU A  69      12.531   6.017  23.095  1.00  0.59           C  
ATOM    512  O   GLU A  69      11.631   6.859  23.178  1.00  0.59           O  
ATOM    513  CB  GLU A  69      10.931   4.417  22.058  1.00  0.59           C  
ATOM    514  CG  GLU A  69      10.616   3.364  20.964  1.00  0.59           C  
ATOM    515  CD  GLU A  69      10.504   3.937  19.551  1.00  0.59           C  
ATOM    516  OE1 GLU A  69      10.106   3.145  18.655  1.00  0.59           O  
ATOM    517  OE2 GLU A  69      10.758   5.153  19.362  1.00  0.59           O  
ATOM    518  N   GLU A  70      13.627   6.126  23.888  1.00  0.55           N  
ATOM    519  CA  GLU A  70      13.730   7.031  25.034  1.00  0.55           C  
ATOM    520  C   GLU A  70      13.392   8.493  24.764  1.00  0.55           C  
ATOM    521  O   GLU A  70      12.735   9.159  25.561  1.00  0.55           O  
ATOM    522  CB  GLU A  70      15.138   6.964  25.690  1.00  0.55           C  
ATOM    523  CG  GLU A  70      16.311   7.394  24.769  1.00  0.55           C  
ATOM    524  CD  GLU A  70      17.696   7.259  25.390  1.00  0.55           C  
ATOM    525  OE1 GLU A  70      18.633   7.854  24.796  1.00  0.55           O  
ATOM    526  OE2 GLU A  70      17.832   6.594  26.452  1.00  0.55           O  
ATOM    527  N   GLN A  71      13.809   9.021  23.603  1.00  0.56           N  
ATOM    528  CA  GLN A  71      13.585  10.389  23.191  1.00  0.56           C  
ATOM    529  C   GLN A  71      12.123  10.741  22.915  1.00  0.56           C  
ATOM    530  O   GLN A  71      11.666  11.833  23.247  1.00  0.56           O  
ATOM    531  CB  GLN A  71      14.514  10.733  22.001  1.00  0.56           C  
ATOM    532  CG  GLN A  71      15.993  10.417  22.348  1.00  0.56           C  
ATOM    533  CD  GLN A  71      16.991  10.915  21.307  1.00  0.56           C  
ATOM    534  OE1 GLN A  71      16.678  11.683  20.396  1.00  0.56           O  
ATOM    535  NE2 GLN A  71      18.254  10.445  21.440  1.00  0.56           N  
ATOM    536  N   VAL A  72      11.335   9.821  22.315  1.00  0.64           N  
ATOM    537  CA  VAL A  72       9.960  10.107  21.921  1.00  0.64           C  
ATOM    538  C   VAL A  72       8.925   9.599  22.914  1.00  0.64           C  
ATOM    539  O   VAL A  72       7.831  10.158  23.013  1.00  0.64           O  
ATOM    540  CB  VAL A  72       9.624   9.534  20.546  1.00  0.64           C  
ATOM    541  CG1 VAL A  72      10.462  10.262  19.478  1.00  0.64           C  
ATOM    542  CG2 VAL A  72       9.856   8.012  20.485  1.00  0.64           C  
ATOM    543  N   ILE A  73       9.248   8.575  23.740  1.00  0.66           N  
ATOM    544  CA  ILE A  73       8.278   7.905  24.609  1.00  0.66           C  
ATOM    545  C   ILE A  73       7.594   8.831  25.612  1.00  0.66           C  
ATOM    546  O   ILE A  73       6.388   8.761  25.846  1.00  0.66           O  
ATOM    547  CB  ILE A  73       8.881   6.671  25.298  1.00  0.66           C  
ATOM    548  CG1 ILE A  73       7.826   5.777  25.998  1.00  0.66           C  
ATOM    549  CG2 ILE A  73      10.004   7.057  26.288  1.00  0.66           C  
ATOM    550  CD1 ILE A  73       6.789   5.165  25.049  1.00  0.66           C  
ATOM    551  N   GLY A  74       8.341   9.791  26.201  1.00  0.64           N  
ATOM    552  CA  GLY A  74       7.775  10.763  27.128  1.00  0.64           C  
ATOM    553  C   GLY A  74       6.820  11.758  26.512  1.00  0.64           C  
ATOM    554  O   GLY A  74       5.944  12.285  27.191  1.00  0.64           O  
ATOM    555  N   ALA A  75       6.959  12.053  25.204  1.00  0.67           N  
ATOM    556  CA  ALA A  75       6.015  12.876  24.471  1.00  0.67           C  
ATOM    557  C   ALA A  75       4.701  12.151  24.214  1.00  0.67           C  
ATOM    558  O   ALA A  75       3.625  12.704  24.435  1.00  0.67           O  
ATOM    559  CB  ALA A  75       6.636  13.339  23.138  1.00  0.67           C  
ATOM    560  N   CYS A  76       4.782  10.867  23.800  1.00  0.67           N  
ATOM    561  CA  CYS A  76       3.642   9.996  23.549  1.00  0.67           C  
ATOM    562  C   CYS A  76       2.759   9.825  24.783  1.00  0.67           C  
ATOM    563  O   CYS A  76       1.554  10.063  24.750  1.00  0.67           O  
ATOM    564  CB  CYS A  76       4.184   8.608  23.082  1.00  0.67           C  
ATOM    565  SG  CYS A  76       2.931   7.345  22.644  1.00  0.67           S  
ATOM    566  N   LEU A  77       3.357   9.482  25.943  1.00  0.67           N  
ATOM    567  CA  LEU A  77       2.629   9.277  27.185  1.00  0.67           C  
ATOM    568  C   LEU A  77       1.955  10.517  27.751  1.00  0.67           C  
ATOM    569  O   LEU A  77       0.822  10.456  28.224  1.00  0.67           O  
ATOM    570  CB  LEU A  77       3.531   8.627  28.258  1.00  0.67           C  
ATOM    571  CG  LEU A  77       4.087   7.248  27.848  1.00  0.67           C  
ATOM    572  CD1 LEU A  77       5.018   6.722  28.947  1.00  0.67           C  
ATOM    573  CD2 LEU A  77       2.983   6.224  27.536  1.00  0.67           C  
ATOM    574  N   ARG A  78       2.605  11.697  27.676  1.00  0.62           N  
ATOM    575  CA  ARG A  78       2.035  12.946  28.165  1.00  0.62           C  
ATOM    576  C   ARG A  78       0.910  13.493  27.305  1.00  0.62           C  
ATOM    577  O   ARG A  78       0.194  14.400  27.717  1.00  0.62           O  
ATOM    578  CB  ARG A  78       3.104  14.056  28.292  1.00  0.62           C  
ATOM    579  CG  ARG A  78       4.030  13.853  29.501  1.00  0.62           C  
ATOM    580  CD  ARG A  78       4.893  15.073  29.837  1.00  0.62           C  
ATOM    581  NE  ARG A  78       5.848  15.272  28.695  1.00  0.62           N  
ATOM    582  CZ  ARG A  78       7.131  14.887  28.696  1.00  0.62           C  
ATOM    583  NH1 ARG A  78       7.681  14.299  29.752  1.00  0.62           N  
ATOM    584  NH2 ARG A  78       7.880  15.106  27.616  1.00  0.62           N  
ATOM    585  N   ALA A  79       0.716  12.959  26.090  1.00  0.68           N  
ATOM    586  CA  ALA A  79      -0.404  13.340  25.265  1.00  0.68           C  
ATOM    587  C   ALA A  79      -1.579  12.382  25.426  1.00  0.68           C  
ATOM    588  O   ALA A  79      -2.646  12.595  24.865  1.00  0.68           O  
ATOM    589  CB  ALA A  79       0.080  13.352  23.808  1.00  0.68           C  
ATOM    590  N   LEU A  80      -1.430  11.309  26.228  1.00  0.66           N  
ATOM    591  CA  LEU A  80      -2.482  10.327  26.420  1.00  0.66           C  
ATOM    592  C   LEU A  80      -3.097  10.410  27.807  1.00  0.66           C  
ATOM    593  O   LEU A  80      -4.075   9.727  28.097  1.00  0.66           O  
ATOM    594  CB  LEU A  80      -1.898   8.906  26.217  1.00  0.66           C  
ATOM    595  CG  LEU A  80      -1.488   8.607  24.760  1.00  0.66           C  
ATOM    596  CD1 LEU A  80      -0.589   7.363  24.687  1.00  0.66           C  
ATOM    597  CD2 LEU A  80      -2.713   8.446  23.847  1.00  0.66           C  
ATOM    598  N   THR A  81      -2.574  11.269  28.703  1.00  0.62           N  
ATOM    599  CA  THR A  81      -3.050  11.394  30.083  1.00  0.62           C  
ATOM    600  C   THR A  81      -4.469  11.889  30.230  1.00  0.62           C  
ATOM    601  O   THR A  81      -5.204  11.425  31.095  1.00  0.62           O  
ATOM    602  CB  THR A  81      -2.169  12.266  30.967  1.00  0.62           C  
ATOM    603  OG1 THR A  81      -1.816  13.489  30.333  1.00  0.62           O  
ATOM    604  CG2 THR A  81      -0.863  11.504  31.231  1.00  0.62           C  
ATOM    605  N   ASP A  82      -4.896  12.855  29.399  1.00  0.52           N  
ATOM    606  CA  ASP A  82      -6.251  13.372  29.395  1.00  0.52           C  
ATOM    607  C   ASP A  82      -7.309  12.335  28.994  1.00  0.52           C  
ATOM    608  O   ASP A  82      -8.399  12.244  29.560  1.00  0.52           O  
ATOM    609  CB  ASP A  82      -6.317  14.540  28.392  1.00  0.52           C  
ATOM    610  CG  ASP A  82      -5.260  15.579  28.698  1.00  0.52           C  
ATOM    611  OD1 ASP A  82      -5.460  16.395  29.626  1.00  0.52           O  
ATOM    612  OD2 ASP A  82      -4.251  15.637  27.939  1.00  0.52           O  
ATOM    613  N   ASP A  83      -6.996  11.520  27.969  1.00  0.57           N  
ATOM    614  CA  ASP A  83      -7.949  10.629  27.352  1.00  0.57           C  
ATOM    615  C   ASP A  83      -7.905   9.197  27.859  1.00  0.57           C  
ATOM    616  O   ASP A  83      -8.888   8.473  27.703  1.00  0.57           O  
ATOM    617  CB  ASP A  83      -7.670  10.613  25.835  1.00  0.57           C  
ATOM    618  CG  ASP A  83      -8.367  11.800  25.217  1.00  0.57           C  
ATOM    619  OD1 ASP A  83      -9.613  11.702  25.053  1.00  0.57           O  
ATOM    620  OD2 ASP A  83      -7.700  12.809  24.890  1.00  0.57           O  
ATOM    621  N   CYS A  84      -6.822   8.740  28.514  1.00  0.61           N  
ATOM    622  CA  CYS A  84      -6.660   7.333  28.860  1.00  0.61           C  
ATOM    623  C   CYS A  84      -6.446   7.127  30.349  1.00  0.61           C  
ATOM    624  O   CYS A  84      -5.541   7.691  30.956  1.00  0.61           O  
ATOM    625  CB  CYS A  84      -5.473   6.702  28.089  1.00  0.61           C  
ATOM    626  SG  CYS A  84      -5.709   6.799  26.279  1.00  0.61           S  
ATOM    627  N   ASP A  85      -7.287   6.272  30.972  1.00  0.61           N  
ATOM    628  CA  ASP A  85      -7.301   5.960  32.392  1.00  0.61           C  
ATOM    629  C   ASP A  85      -6.052   5.206  32.830  1.00  0.61           C  
ATOM    630  O   ASP A  85      -5.606   5.285  33.973  1.00  0.61           O  
ATOM    631  CB  ASP A  85      -8.544   5.090  32.763  1.00  0.61           C  
ATOM    632  CG  ASP A  85      -9.805   5.626  32.132  1.00  0.61           C  
ATOM    633  OD1 ASP A  85     -10.641   6.273  32.803  1.00  0.61           O  
ATOM    634  OD2 ASP A  85      -9.953   5.438  30.894  1.00  0.61           O  
ATOM    635  N   ARG A  86      -5.470   4.421  31.904  1.00  0.61           N  
ATOM    636  CA  ARG A  86      -4.345   3.569  32.200  1.00  0.61           C  
ATOM    637  C   ARG A  86      -3.377   3.555  31.031  1.00  0.61           C  
ATOM    638  O   ARG A  86      -3.777   3.516  29.867  1.00  0.61           O  
ATOM    639  CB  ARG A  86      -4.855   2.138  32.491  1.00  0.61           C  
ATOM    640  CG  ARG A  86      -3.876   1.272  33.299  1.00  0.61           C  
ATOM    641  CD  ARG A  86      -4.410  -0.127  33.617  1.00  0.61           C  
ATOM    642  NE  ARG A  86      -4.352  -0.904  32.339  1.00  0.61           N  
ATOM    643  CZ  ARG A  86      -4.324  -2.240  32.293  1.00  0.61           C  
ATOM    644  NH1 ARG A  86      -4.417  -2.990  33.385  1.00  0.61           N  
ATOM    645  NH2 ARG A  86      -4.159  -2.850  31.124  1.00  0.61           N  
ATOM    646  N   LEU A  87      -2.060   3.595  31.310  1.00  0.71           N  
ATOM    647  CA  LEU A  87      -1.034   3.625  30.286  1.00  0.71           C  
ATOM    648  C   LEU A  87      -0.183   2.373  30.405  1.00  0.71           C  
ATOM    649  O   LEU A  87       0.527   2.180  31.391  1.00  0.71           O  
ATOM    650  CB  LEU A  87      -0.124   4.874  30.436  1.00  0.71           C  
ATOM    651  CG  LEU A  87      -0.855   6.235  30.381  1.00  0.71           C  
ATOM    652  CD1 LEU A  87       0.140   7.378  30.629  1.00  0.71           C  
ATOM    653  CD2 LEU A  87      -1.594   6.469  29.056  1.00  0.71           C  
ATOM    654  N   LEU A  88      -0.243   1.485  29.395  1.00  0.70           N  
ATOM    655  CA  LEU A  88       0.423   0.198  29.411  1.00  0.70           C  
ATOM    656  C   LEU A  88       1.481   0.144  28.324  1.00  0.70           C  
ATOM    657  O   LEU A  88       1.201   0.271  27.133  1.00  0.70           O  
ATOM    658  CB  LEU A  88      -0.609  -0.936  29.173  1.00  0.70           C  
ATOM    659  CG  LEU A  88      -0.036  -2.370  29.113  1.00  0.70           C  
ATOM    660  CD1 LEU A  88       0.580  -2.803  30.451  1.00  0.70           C  
ATOM    661  CD2 LEU A  88      -1.115  -3.372  28.674  1.00  0.70           C  
ATOM    662  N   LEU A  89       2.748  -0.064  28.716  1.00  0.71           N  
ATOM    663  CA  LEU A  89       3.848  -0.255  27.795  1.00  0.71           C  
ATOM    664  C   LEU A  89       4.107  -1.736  27.617  1.00  0.71           C  
ATOM    665  O   LEU A  89       4.340  -2.470  28.577  1.00  0.71           O  
ATOM    666  CB  LEU A  89       5.166   0.410  28.277  1.00  0.71           C  
ATOM    667  CG  LEU A  89       5.320   1.894  27.890  1.00  0.71           C  
ATOM    668  CD1 LEU A  89       4.170   2.755  28.420  1.00  0.71           C  
ATOM    669  CD2 LEU A  89       6.660   2.438  28.408  1.00  0.71           C  
ATOM    670  N   VAL A  90       4.116  -2.198  26.357  1.00  0.69           N  
ATOM    671  CA  VAL A  90       4.619  -3.511  26.007  1.00  0.69           C  
ATOM    672  C   VAL A  90       6.035  -3.287  25.523  1.00  0.69           C  
ATOM    673  O   VAL A  90       6.279  -2.771  24.431  1.00  0.69           O  
ATOM    674  CB  VAL A  90       3.788  -4.228  24.949  1.00  0.69           C  
ATOM    675  CG1 VAL A  90       4.362  -5.640  24.697  1.00  0.69           C  
ATOM    676  CG2 VAL A  90       2.328  -4.329  25.436  1.00  0.69           C  
ATOM    677  N   ASP A  91       7.013  -3.637  26.370  1.00  0.61           N  
ATOM    678  CA  ASP A  91       8.414  -3.428  26.104  1.00  0.61           C  
ATOM    679  C   ASP A  91       8.976  -4.685  25.458  1.00  0.61           C  
ATOM    680  O   ASP A  91       8.717  -5.805  25.898  1.00  0.61           O  
ATOM    681  CB  ASP A  91       9.131  -3.053  27.426  1.00  0.61           C  
ATOM    682  CG  ASP A  91      10.583  -2.712  27.175  1.00  0.61           C  
ATOM    683  OD1 ASP A  91      10.873  -1.544  26.820  1.00  0.61           O  
ATOM    684  OD2 ASP A  91      11.426  -3.633  27.309  1.00  0.61           O  
ATOM    685  N   ALA A  92       9.752  -4.514  24.374  1.00  0.60           N  
ATOM    686  CA  ALA A  92      10.282  -5.614  23.600  1.00  0.60           C  
ATOM    687  C   ALA A  92      11.715  -5.970  23.986  1.00  0.60           C  
ATOM    688  O   ALA A  92      12.387  -6.670  23.230  1.00  0.60           O  
ATOM    689  CB  ALA A  92      10.191  -5.268  22.102  1.00  0.60           C  
ATOM    690  N   GLU A  93      12.159  -5.499  25.180  1.00  0.49           N  
ATOM    691  CA  GLU A  93      13.493  -5.609  25.750  1.00  0.49           C  
ATOM    692  C   GLU A  93      14.379  -4.448  25.340  1.00  0.49           C  
ATOM    693  O   GLU A  93      15.432  -4.612  24.729  1.00  0.49           O  
ATOM    694  CB  GLU A  93      14.182  -6.998  25.655  1.00  0.49           C  
ATOM    695  CG  GLU A  93      13.344  -8.112  26.329  1.00  0.49           C  
ATOM    696  CD  GLU A  93      13.972  -9.495  26.203  1.00  0.49           C  
ATOM    697  OE1 GLU A  93      14.099 -10.172  27.256  1.00  0.49           O  
ATOM    698  OE2 GLU A  93      14.267  -9.916  25.054  1.00  0.49           O  
ATOM    699  N   SER A  94      13.945  -3.212  25.687  1.00  0.56           N  
ATOM    700  CA  SER A  94      14.721  -1.987  25.472  1.00  0.56           C  
ATOM    701  C   SER A  94      16.050  -1.959  26.224  1.00  0.56           C  
ATOM    702  O   SER A  94      16.123  -2.349  27.389  1.00  0.56           O  
ATOM    703  CB  SER A  94      13.992  -0.684  25.919  1.00  0.56           C  
ATOM    704  OG  SER A  94      12.749  -0.476  25.252  1.00  0.56           O  
ATOM    705  N   GLU A  95      17.127  -1.444  25.594  1.00  0.49           N  
ATOM    706  CA  GLU A  95      18.444  -1.334  26.206  1.00  0.49           C  
ATOM    707  C   GLU A  95      18.800   0.109  26.568  1.00  0.49           C  
ATOM    708  O   GLU A  95      19.799   0.361  27.244  1.00  0.49           O  
ATOM    709  CB  GLU A  95      19.554  -1.894  25.270  1.00  0.49           C  
ATOM    710  CG  GLU A  95      19.457  -3.421  24.996  1.00  0.49           C  
ATOM    711  CD  GLU A  95      20.712  -4.023  24.352  1.00  0.49           C  
ATOM    712  OE1 GLU A  95      20.701  -5.261  24.119  1.00  0.49           O  
ATOM    713  OE2 GLU A  95      21.699  -3.279  24.113  1.00  0.49           O  
ATOM    714  N   ASP A  96      17.982   1.102  26.159  1.00  0.50           N  
ATOM    715  CA  ASP A  96      18.193   2.509  26.458  1.00  0.50           C  
ATOM    716  C   ASP A  96      17.635   2.956  27.829  1.00  0.50           C  
ATOM    717  O   ASP A  96      17.551   2.194  28.792  1.00  0.50           O  
ATOM    718  CB  ASP A  96      17.666   3.353  25.258  1.00  0.50           C  
ATOM    719  CG  ASP A  96      16.157   3.383  25.125  1.00  0.50           C  
ATOM    720  OD1 ASP A  96      15.444   2.673  25.881  1.00  0.50           O  
ATOM    721  OD2 ASP A  96      15.647   4.165  24.289  1.00  0.50           O  
ATOM    722  N   THR A  97      17.209   4.234  27.963  1.00  0.61           N  
ATOM    723  CA  THR A  97      16.562   4.729  29.176  1.00  0.61           C  
ATOM    724  C   THR A  97      15.040   4.742  29.090  1.00  0.61           C  
ATOM    725  O   THR A  97      14.385   5.292  29.977  1.00  0.61           O  
ATOM    726  CB  THR A  97      17.037   6.114  29.621  1.00  0.61           C  
ATOM    727  OG1 THR A  97      16.686   7.146  28.712  1.00  0.61           O  
ATOM    728  CG2 THR A  97      18.566   6.122  29.771  1.00  0.61           C  
ATOM    729  N   THR A  98      14.410   4.102  28.069  1.00  0.60           N  
ATOM    730  CA  THR A  98      12.964   4.154  27.767  1.00  0.60           C  
ATOM    731  C   THR A  98      12.060   3.947  28.958  1.00  0.60           C  
ATOM    732  O   THR A  98      11.156   4.740  29.214  1.00  0.60           O  
ATOM    733  CB  THR A  98      12.536   3.117  26.718  1.00  0.60           C  
ATOM    734  OG1 THR A  98      12.995   3.498  25.439  1.00  0.60           O  
ATOM    735  CG2 THR A  98      11.016   2.961  26.538  1.00  0.60           C  
ATOM    736  N   LEU A  99      12.294   2.892  29.761  1.00  0.58           N  
ATOM    737  CA  LEU A  99      11.496   2.606  30.941  1.00  0.58           C  
ATOM    738  C   LEU A  99      11.649   3.626  32.063  1.00  0.58           C  
ATOM    739  O   LEU A  99      10.718   3.858  32.830  1.00  0.58           O  
ATOM    740  CB  LEU A  99      11.786   1.184  31.474  1.00  0.58           C  
ATOM    741  CG  LEU A  99      11.453   0.061  30.467  1.00  0.58           C  
ATOM    742  CD1 LEU A  99      11.824  -1.311  31.048  1.00  0.58           C  
ATOM    743  CD2 LEU A  99       9.976   0.060  30.041  1.00  0.58           C  
ATOM    744  N   GLY A 100      12.817   4.291  32.180  1.00  0.61           N  
ATOM    745  CA  GLY A 100      13.014   5.379  33.136  1.00  0.61           C  
ATOM    746  C   GLY A 100      12.360   6.655  32.682  1.00  0.61           C  
ATOM    747  O   GLY A 100      11.644   7.302  33.439  1.00  0.61           O  
ATOM    748  N   THR A 101      12.543   7.017  31.399  1.00  0.62           N  
ATOM    749  CA  THR A 101      11.923   8.185  30.771  1.00  0.62           C  
ATOM    750  C   THR A 101      10.413   8.099  30.746  1.00  0.62           C  
ATOM    751  O   THR A 101       9.722   9.082  30.997  1.00  0.62           O  
ATOM    752  CB  THR A 101      12.459   8.455  29.371  1.00  0.62           C  
ATOM    753  OG1 THR A 101      13.840   8.755  29.486  1.00  0.62           O  
ATOM    754  CG2 THR A 101      11.799   9.693  28.739  1.00  0.62           C  
ATOM    755  N   ALA A 102       9.843   6.905  30.489  1.00  0.64           N  
ATOM    756  CA  ALA A 102       8.419   6.662  30.588  1.00  0.64           C  
ATOM    757  C   ALA A 102       7.836   6.893  31.982  1.00  0.64           C  
ATOM    758  O   ALA A 102       6.805   7.544  32.129  1.00  0.64           O  
ATOM    759  CB  ALA A 102       8.138   5.208  30.162  1.00  0.64           C  
ATOM    760  N   ARG A 103       8.510   6.398  33.042  1.00  0.55           N  
ATOM    761  CA  ARG A 103       8.125   6.631  34.427  1.00  0.55           C  
ATOM    762  C   ARG A 103       8.240   8.083  34.859  1.00  0.55           C  
ATOM    763  O   ARG A 103       7.370   8.611  35.538  1.00  0.55           O  
ATOM    764  CB  ARG A 103       8.958   5.746  35.383  1.00  0.55           C  
ATOM    765  CG  ARG A 103       8.640   4.244  35.244  1.00  0.55           C  
ATOM    766  CD  ARG A 103       9.652   3.366  35.982  1.00  0.55           C  
ATOM    767  NE  ARG A 103       9.365   1.940  35.611  1.00  0.55           N  
ATOM    768  CZ  ARG A 103      10.283   0.968  35.659  1.00  0.55           C  
ATOM    769  NH1 ARG A 103      11.447   1.144  36.279  1.00  0.55           N  
ATOM    770  NH2 ARG A 103      10.037  -0.208  35.091  1.00  0.55           N  
ATOM    771  N   SER A 104       9.310   8.787  34.451  1.00  0.63           N  
ATOM    772  CA  SER A 104       9.501  10.192  34.796  1.00  0.63           C  
ATOM    773  C   SER A 104       8.620  11.136  33.997  1.00  0.63           C  
ATOM    774  O   SER A 104       8.500  12.317  34.313  1.00  0.63           O  
ATOM    775  CB  SER A 104      10.962  10.648  34.565  1.00  0.63           C  
ATOM    776  OG  SER A 104      11.849   9.920  35.413  1.00  0.63           O  
ATOM    777  N   ALA A 105       7.995  10.661  32.904  1.00  0.61           N  
ATOM    778  CA  ALA A 105       7.142  11.479  32.075  1.00  0.61           C  
ATOM    779  C   ALA A 105       5.726  11.693  32.593  1.00  0.61           C  
ATOM    780  O   ALA A 105       5.114  12.707  32.258  1.00  0.61           O  
ATOM    781  CB  ALA A 105       7.054  10.852  30.670  1.00  0.61           C  
ATOM    782  N   VAL A 106       5.173  10.757  33.391  1.00  0.56           N  
ATOM    783  CA  VAL A 106       3.765  10.752  33.770  1.00  0.56           C  
ATOM    784  C   VAL A 106       3.604  10.231  35.190  1.00  0.56           C  
ATOM    785  O   VAL A 106       4.483   9.587  35.745  1.00  0.56           O  
ATOM    786  CB  VAL A 106       2.873   9.910  32.845  1.00  0.56           C  
ATOM    787  CG1 VAL A 106       2.728  10.596  31.473  1.00  0.56           C  
ATOM    788  CG2 VAL A 106       3.438   8.485  32.687  1.00  0.56           C  
ATOM    789  N   ALA A 107       2.452  10.518  35.836  1.00  0.36           N  
ATOM    790  CA  ALA A 107       2.177  10.139  37.214  1.00  0.36           C  
ATOM    791  C   ALA A 107       2.091   8.635  37.499  1.00  0.36           C  
ATOM    792  O   ALA A 107       2.488   8.171  38.564  1.00  0.36           O  
ATOM    793  CB  ALA A 107       0.879  10.833  37.675  1.00  0.36           C  
ATOM    794  N   HIS A 108       1.545   7.840  36.561  1.00  0.49           N  
ATOM    795  CA  HIS A 108       1.460   6.399  36.697  1.00  0.49           C  
ATOM    796  C   HIS A 108       1.603   5.800  35.317  1.00  0.49           C  
ATOM    797  O   HIS A 108       1.083   6.335  34.338  1.00  0.49           O  
ATOM    798  CB  HIS A 108       0.118   5.939  37.329  1.00  0.49           C  
ATOM    799  CG  HIS A 108      -0.118   4.453  37.309  1.00  0.49           C  
ATOM    800  ND1 HIS A 108       0.844   3.616  37.837  1.00  0.49           N  
ATOM    801  CD2 HIS A 108      -1.131   3.726  36.765  1.00  0.49           C  
ATOM    802  CE1 HIS A 108       0.399   2.395  37.603  1.00  0.49           C  
ATOM    803  NE2 HIS A 108      -0.792   2.404  36.957  1.00  0.49           N  
ATOM    804  N   VAL A 109       2.339   4.682  35.213  1.00  0.67           N  
ATOM    805  CA  VAL A 109       2.526   3.961  33.974  1.00  0.67           C  
ATOM    806  C   VAL A 109       2.864   2.518  34.313  1.00  0.67           C  
ATOM    807  O   VAL A 109       3.536   2.236  35.305  1.00  0.67           O  
ATOM    808  CB  VAL A 109       3.580   4.621  33.078  1.00  0.67           C  
ATOM    809  CG1 VAL A 109       4.968   4.656  33.745  1.00  0.67           C  
ATOM    810  CG2 VAL A 109       3.644   3.943  31.700  1.00  0.67           C  
ATOM    811  N   GLU A 110       2.399   1.556  33.496  1.00  0.68           N  
ATOM    812  CA  GLU A 110       2.578   0.137  33.726  1.00  0.68           C  
ATOM    813  C   GLU A 110       3.418  -0.419  32.596  1.00  0.68           C  
ATOM    814  O   GLU A 110       3.203  -0.092  31.431  1.00  0.68           O  
ATOM    815  CB  GLU A 110       1.199  -0.575  33.762  1.00  0.68           C  
ATOM    816  CG  GLU A 110       0.330  -0.069  34.940  1.00  0.68           C  
ATOM    817  CD  GLU A 110      -1.131  -0.505  34.924  1.00  0.68           C  
ATOM    818  OE1 GLU A 110      -1.887   0.091  35.741  1.00  0.68           O  
ATOM    819  OE2 GLU A 110      -1.536  -1.381  34.116  1.00  0.68           O  
ATOM    820  N   HIS A 111       4.435  -1.255  32.887  1.00  0.68           N  
ATOM    821  CA  HIS A 111       5.265  -1.845  31.852  1.00  0.68           C  
ATOM    822  C   HIS A 111       5.227  -3.359  31.945  1.00  0.68           C  
ATOM    823  O   HIS A 111       5.323  -3.936  33.025  1.00  0.68           O  
ATOM    824  CB  HIS A 111       6.741  -1.340  31.882  1.00  0.68           C  
ATOM    825  CG  HIS A 111       7.599  -1.963  32.948  1.00  0.68           C  
ATOM    826  ND1 HIS A 111       7.542  -1.515  34.258  1.00  0.68           N  
ATOM    827  CD2 HIS A 111       8.266  -3.144  32.882  1.00  0.68           C  
ATOM    828  CE1 HIS A 111       8.148  -2.457  34.961  1.00  0.68           C  
ATOM    829  NE2 HIS A 111       8.613  -3.457  34.176  1.00  0.68           N  
ATOM    830  N   VAL A 112       5.102  -4.047  30.798  1.00  0.69           N  
ATOM    831  CA  VAL A 112       5.271  -5.487  30.722  1.00  0.69           C  
ATOM    832  C   VAL A 112       6.355  -5.748  29.697  1.00  0.69           C  
ATOM    833  O   VAL A 112       6.245  -5.360  28.536  1.00  0.69           O  
ATOM    834  CB  VAL A 112       3.990  -6.229  30.346  1.00  0.69           C  
ATOM    835  CG1 VAL A 112       4.239  -7.750  30.267  1.00  0.69           C  
ATOM    836  CG2 VAL A 112       2.923  -5.942  31.420  1.00  0.69           C  
ATOM    837  N   THR A 113       7.457  -6.400  30.112  1.00  0.61           N  
ATOM    838  CA  THR A 113       8.592  -6.698  29.241  1.00  0.61           C  
ATOM    839  C   THR A 113       8.435  -8.089  28.674  1.00  0.61           C  
ATOM    840  O   THR A 113       8.258  -9.055  29.413  1.00  0.61           O  
ATOM    841  CB  THR A 113       9.935  -6.619  29.961  1.00  0.61           C  
ATOM    842  OG1 THR A 113      10.132  -5.319  30.496  1.00  0.61           O  
ATOM    843  CG2 THR A 113      11.121  -6.864  29.020  1.00  0.61           C  
ATOM    844  N   ARG A 114       8.464  -8.231  27.336  1.00  0.50           N  
ATOM    845  CA  ARG A 114       8.333  -9.511  26.666  1.00  0.50           C  
ATOM    846  C   ARG A 114       9.324  -9.569  25.526  1.00  0.50           C  
ATOM    847  O   ARG A 114       9.349  -8.681  24.681  1.00  0.50           O  
ATOM    848  CB  ARG A 114       6.929  -9.699  26.034  1.00  0.50           C  
ATOM    849  CG  ARG A 114       5.781  -9.744  27.056  1.00  0.50           C  
ATOM    850  CD  ARG A 114       4.382  -9.795  26.433  1.00  0.50           C  
ATOM    851  NE  ARG A 114       4.081 -11.197  25.965  1.00  0.50           N  
ATOM    852  CZ  ARG A 114       3.725 -11.485  24.708  1.00  0.50           C  
ATOM    853  NH1 ARG A 114       4.174 -10.794  23.662  1.00  0.50           N  
ATOM    854  NH2 ARG A 114       2.788 -12.416  24.499  1.00  0.50           N  
ATOM    855  N   ALA A 115      10.145 -10.633  25.451  1.00  0.53           N  
ATOM    856  CA  ALA A 115      11.152 -10.793  24.422  1.00  0.53           C  
ATOM    857  C   ALA A 115      10.654 -10.744  22.978  1.00  0.53           C  
ATOM    858  O   ALA A 115       9.558 -11.194  22.640  1.00  0.53           O  
ATOM    859  CB  ALA A 115      11.919 -12.108  24.663  1.00  0.53           C  
ATOM    860  N   TRP A 116      11.463 -10.161  22.073  1.00  0.39           N  
ATOM    861  CA  TRP A 116      11.152 -10.097  20.658  1.00  0.39           C  
ATOM    862  C   TRP A 116      11.247 -11.463  19.962  1.00  0.39           C  
ATOM    863  O   TRP A 116      12.302 -12.084  19.871  1.00  0.39           O  
ATOM    864  CB  TRP A 116      12.038  -9.028  19.957  1.00  0.39           C  
ATOM    865  CG  TRP A 116      11.820  -8.894  18.456  1.00  0.39           C  
ATOM    866  CD1 TRP A 116      12.599  -9.398  17.452  1.00  0.39           C  
ATOM    867  CD2 TRP A 116      10.635  -8.373  17.827  1.00  0.39           C  
ATOM    868  NE1 TRP A 116      11.984  -9.221  16.232  1.00  0.39           N  
ATOM    869  CE2 TRP A 116      10.779  -8.593  16.441  1.00  0.39           C  
ATOM    870  CE3 TRP A 116       9.485  -7.784  18.350  1.00  0.39           C  
ATOM    871  CZ2 TRP A 116       9.773  -8.237  15.554  1.00  0.39           C  
ATOM    872  CZ3 TRP A 116       8.465  -7.434  17.453  1.00  0.39           C  
ATOM    873  CH2 TRP A 116       8.607  -7.662  16.077  1.00  0.39           C  
ATOM    874  N   THR A 117      10.114 -11.957  19.424  1.00  0.43           N  
ATOM    875  CA  THR A 117       9.982 -13.307  18.880  1.00  0.43           C  
ATOM    876  C   THR A 117       9.903 -13.332  17.361  1.00  0.43           C  
ATOM    877  O   THR A 117       9.560 -14.361  16.770  1.00  0.43           O  
ATOM    878  CB  THR A 117       8.715 -13.986  19.402  1.00  0.43           C  
ATOM    879  OG1 THR A 117       7.577 -13.144  19.246  1.00  0.43           O  
ATOM    880  CG2 THR A 117       8.866 -14.254  20.905  1.00  0.43           C  
ATOM    881  N   ASP A 118      10.221 -12.198  16.693  1.00  0.38           N  
ATOM    882  CA  ASP A 118       9.925 -11.946  15.290  1.00  0.38           C  
ATOM    883  C   ASP A 118       8.419 -11.939  14.998  1.00  0.38           C  
ATOM    884  O   ASP A 118       7.900 -12.722  14.198  1.00  0.38           O  
ATOM    885  CB  ASP A 118      10.764 -12.832  14.314  1.00  0.38           C  
ATOM    886  CG  ASP A 118      12.041 -12.168  13.834  1.00  0.38           C  
ATOM    887  OD1 ASP A 118      12.384 -11.034  14.258  1.00  0.38           O  
ATOM    888  OD2 ASP A 118      12.715 -12.782  12.971  1.00  0.38           O  
ATOM    889  N   ASP A 119       7.681 -11.030  15.677  1.00  0.38           N  
ATOM    890  CA  ASP A 119       6.235 -10.998  15.635  1.00  0.38           C  
ATOM    891  C   ASP A 119       5.683  -9.700  16.254  1.00  0.38           C  
ATOM    892  O   ASP A 119       5.696  -9.503  17.470  1.00  0.38           O  
ATOM    893  CB  ASP A 119       5.697 -12.220  16.428  1.00  0.38           C  
ATOM    894  CG  ASP A 119       4.332 -12.643  15.932  1.00  0.38           C  
ATOM    895  OD1 ASP A 119       3.446 -11.762  15.815  1.00  0.38           O  
ATOM    896  OD2 ASP A 119       4.165 -13.859  15.653  1.00  0.38           O  
ATOM    897  N   PHE A 120       5.186  -8.752  15.425  1.00  0.38           N  
ATOM    898  CA  PHE A 120       4.483  -7.565  15.899  1.00  0.38           C  
ATOM    899  C   PHE A 120       3.119  -7.883  16.506  1.00  0.38           C  
ATOM    900  O   PHE A 120       2.738  -7.335  17.544  1.00  0.38           O  
ATOM    901  CB  PHE A 120       4.330  -6.503  14.776  1.00  0.38           C  
ATOM    902  CG  PHE A 120       5.644  -5.803  14.545  1.00  0.38           C  
ATOM    903  CD1 PHE A 120       6.112  -4.878  15.493  1.00  0.38           C  
ATOM    904  CD2 PHE A 120       6.426  -6.057  13.406  1.00  0.38           C  
ATOM    905  CE1 PHE A 120       7.344  -4.233  15.318  1.00  0.38           C  
ATOM    906  CE2 PHE A 120       7.662  -5.420  13.228  1.00  0.38           C  
ATOM    907  CZ  PHE A 120       8.122  -4.509  14.187  1.00  0.38           C  
ATOM    908  N   ALA A 121       2.359  -8.817  15.898  1.00  0.57           N  
ATOM    909  CA  ALA A 121       1.059  -9.244  16.371  1.00  0.57           C  
ATOM    910  C   ALA A 121       1.097  -9.898  17.745  1.00  0.57           C  
ATOM    911  O   ALA A 121       0.286  -9.584  18.614  1.00  0.57           O  
ATOM    912  CB  ALA A 121       0.429 -10.214  15.356  1.00  0.57           C  
ATOM    913  N   ALA A 122       2.072 -10.785  18.011  1.00  0.60           N  
ATOM    914  CA  ALA A 122       2.270 -11.394  19.314  1.00  0.60           C  
ATOM    915  C   ALA A 122       2.582 -10.405  20.436  1.00  0.60           C  
ATOM    916  O   ALA A 122       2.219 -10.626  21.593  1.00  0.60           O  
ATOM    917  CB  ALA A 122       3.376 -12.461  19.257  1.00  0.60           C  
ATOM    918  N   GLN A 123       3.280  -9.289  20.138  1.00  0.61           N  
ATOM    919  CA  GLN A 123       3.411  -8.179  21.071  1.00  0.61           C  
ATOM    920  C   GLN A 123       2.124  -7.379  21.267  1.00  0.61           C  
ATOM    921  O   GLN A 123       1.731  -7.104  22.398  1.00  0.61           O  
ATOM    922  CB  GLN A 123       4.587  -7.245  20.684  1.00  0.61           C  
ATOM    923  CG  GLN A 123       5.991  -7.910  20.728  1.00  0.61           C  
ATOM    924  CD  GLN A 123       6.481  -8.280  22.139  1.00  0.61           C  
ATOM    925  OE1 GLN A 123       5.722  -8.527  23.079  1.00  0.61           O  
ATOM    926  NE2 GLN A 123       7.825  -8.351  22.284  1.00  0.61           N  
ATOM    927  N   ARG A 124       1.387  -7.022  20.191  1.00  0.58           N  
ATOM    928  CA  ARG A 124       0.108  -6.326  20.315  1.00  0.58           C  
ATOM    929  C   ARG A 124      -0.984  -7.131  21.019  1.00  0.58           C  
ATOM    930  O   ARG A 124      -1.760  -6.597  21.811  1.00  0.58           O  
ATOM    931  CB  ARG A 124      -0.444  -5.829  18.958  1.00  0.58           C  
ATOM    932  CG  ARG A 124       0.424  -4.759  18.269  1.00  0.58           C  
ATOM    933  CD  ARG A 124      -0.341  -3.980  17.192  1.00  0.58           C  
ATOM    934  NE  ARG A 124       0.644  -3.215  16.368  1.00  0.58           N  
ATOM    935  CZ  ARG A 124       1.001  -1.936  16.530  1.00  0.58           C  
ATOM    936  NH1 ARG A 124       0.668  -1.218  17.589  1.00  0.58           N  
ATOM    937  NH2 ARG A 124       1.741  -1.381  15.573  1.00  0.58           N  
ATOM    938  N   ASN A 125      -1.054  -8.455  20.768  1.00  0.63           N  
ATOM    939  CA  ASN A 125      -2.021  -9.355  21.375  1.00  0.63           C  
ATOM    940  C   ASN A 125      -1.818  -9.552  22.873  1.00  0.63           C  
ATOM    941  O   ASN A 125      -2.751  -9.910  23.588  1.00  0.63           O  
ATOM    942  CB  ASN A 125      -2.001 -10.747  20.691  1.00  0.63           C  
ATOM    943  CG  ASN A 125      -2.667 -10.652  19.324  1.00  0.63           C  
ATOM    944  OD1 ASN A 125      -3.659  -9.939  19.155  1.00  0.63           O  
ATOM    945  ND2 ASN A 125      -2.154 -11.409  18.330  1.00  0.63           N  
ATOM    946  N   ALA A 126      -0.615  -9.264  23.403  1.00  0.69           N  
ATOM    947  CA  ALA A 126      -0.324  -9.400  24.814  1.00  0.69           C  
ATOM    948  C   ALA A 126      -0.996  -8.354  25.688  1.00  0.69           C  
ATOM    949  O   ALA A 126      -1.185  -8.511  26.890  1.00  0.69           O  
ATOM    950  CB  ALA A 126       1.188  -9.287  25.005  1.00  0.69           C  
ATOM    951  N   ALA A 127      -1.437  -7.241  25.086  1.00  0.67           N  
ATOM    952  CA  ALA A 127      -2.196  -6.231  25.782  1.00  0.67           C  
ATOM    953  C   ALA A 127      -3.575  -6.702  26.240  1.00  0.67           C  
ATOM    954  O   ALA A 127      -4.095  -6.233  27.250  1.00  0.67           O  
ATOM    955  CB  ALA A 127      -2.319  -5.013  24.867  1.00  0.67           C  
ATOM    956  N   PHE A 128      -4.177  -7.674  25.517  1.00  0.50           N  
ATOM    957  CA  PHE A 128      -5.414  -8.344  25.892  1.00  0.50           C  
ATOM    958  C   PHE A 128      -5.273  -9.173  27.166  1.00  0.50           C  
ATOM    959  O   PHE A 128      -6.185  -9.211  27.987  1.00  0.50           O  
ATOM    960  CB  PHE A 128      -5.958  -9.257  24.765  1.00  0.50           C  
ATOM    961  CG  PHE A 128      -6.428  -8.464  23.574  1.00  0.50           C  
ATOM    962  CD1 PHE A 128      -7.784  -8.122  23.427  1.00  0.50           C  
ATOM    963  CD2 PHE A 128      -5.530  -8.106  22.557  1.00  0.50           C  
ATOM    964  CE1 PHE A 128      -8.236  -7.479  22.266  1.00  0.50           C  
ATOM    965  CE2 PHE A 128      -5.973  -7.469  21.392  1.00  0.50           C  
ATOM    966  CZ  PHE A 128      -7.332  -7.171  21.242  1.00  0.50           C  
ATOM    967  N   GLU A 129      -4.104  -9.826  27.378  1.00  0.63           N  
ATOM    968  CA  GLU A 129      -3.765 -10.590  28.576  1.00  0.63           C  
ATOM    969  C   GLU A 129      -3.822  -9.720  29.834  1.00  0.63           C  
ATOM    970  O   GLU A 129      -4.240 -10.140  30.908  1.00  0.63           O  
ATOM    971  CB  GLU A 129      -2.310 -11.152  28.489  1.00  0.63           C  
ATOM    972  CG  GLU A 129      -1.930 -12.013  27.245  1.00  0.63           C  
ATOM    973  CD  GLU A 129      -0.404 -12.145  27.044  1.00  0.63           C  
ATOM    974  OE1 GLU A 129       0.029 -12.664  25.975  1.00  0.63           O  
ATOM    975  OE2 GLU A 129       0.366 -11.676  27.922  1.00  0.63           O  
ATOM    976  N   GLN A 130      -3.392  -8.451  29.693  1.00  0.68           N  
ATOM    977  CA  GLN A 130      -3.256  -7.489  30.766  1.00  0.68           C  
ATOM    978  C   GLN A 130      -4.441  -6.531  30.852  1.00  0.68           C  
ATOM    979  O   GLN A 130      -4.387  -5.514  31.549  1.00  0.68           O  
ATOM    980  CB  GLN A 130      -1.990  -6.630  30.503  1.00  0.68           C  
ATOM    981  CG  GLN A 130      -0.707  -7.440  30.189  1.00  0.68           C  
ATOM    982  CD  GLN A 130      -0.338  -8.384  31.333  1.00  0.68           C  
ATOM    983  OE1 GLN A 130      -0.195  -7.963  32.481  1.00  0.68           O  
ATOM    984  NE2 GLN A 130      -0.161  -9.690  31.027  1.00  0.68           N  
ATOM    985  N   ALA A 131      -5.527  -6.792  30.101  1.00  0.63           N  
ATOM    986  CA  ALA A 131      -6.638  -5.880  29.938  1.00  0.63           C  
ATOM    987  C   ALA A 131      -7.655  -5.896  31.077  1.00  0.63           C  
ATOM    988  O   ALA A 131      -7.701  -6.791  31.914  1.00  0.63           O  
ATOM    989  CB  ALA A 131      -7.345  -6.158  28.598  1.00  0.63           C  
ATOM    990  N   ARG A 132      -8.523  -4.864  31.128  1.00  0.55           N  
ATOM    991  CA  ARG A 132      -9.606  -4.793  32.088  1.00  0.55           C  
ATOM    992  C   ARG A 132     -10.919  -4.916  31.318  1.00  0.55           C  
ATOM    993  O   ARG A 132     -11.203  -4.002  30.541  1.00  0.55           O  
ATOM    994  CB  ARG A 132      -9.568  -3.439  32.843  1.00  0.55           C  
ATOM    995  CG  ARG A 132     -10.595  -3.333  33.990  1.00  0.55           C  
ATOM    996  CD  ARG A 132     -10.468  -2.029  34.785  1.00  0.55           C  
ATOM    997  NE  ARG A 132     -11.450  -2.111  35.915  1.00  0.55           N  
ATOM    998  CZ  ARG A 132     -11.498  -1.248  36.940  1.00  0.55           C  
ATOM    999  NH1 ARG A 132     -12.374  -1.445  37.923  1.00  0.55           N  
ATOM   1000  NH2 ARG A 132     -10.692  -0.194  37.005  1.00  0.55           N  
ATOM   1001  N   PRO A 133     -11.716  -5.987  31.435  1.00  0.46           N  
ATOM   1002  CA  PRO A 133     -13.062  -6.109  30.857  1.00  0.46           C  
ATOM   1003  C   PRO A 133     -13.985  -4.911  31.034  1.00  0.46           C  
ATOM   1004  O   PRO A 133     -13.909  -4.244  32.067  1.00  0.46           O  
ATOM   1005  CB  PRO A 133     -13.624  -7.374  31.521  1.00  0.46           C  
ATOM   1006  CG  PRO A 133     -12.385  -8.242  31.744  1.00  0.46           C  
ATOM   1007  CD  PRO A 133     -11.321  -7.216  32.131  1.00  0.46           C  
ATOM   1008  N   GLY A 134     -14.858  -4.613  30.050  1.00  0.34           N  
ATOM   1009  CA  GLY A 134     -15.749  -3.461  30.101  1.00  0.34           C  
ATOM   1010  C   GLY A 134     -15.089  -2.183  29.664  1.00  0.34           C  
ATOM   1011  O   GLY A 134     -15.423  -1.100  30.140  1.00  0.34           O  
ATOM   1012  N   GLY A 135     -14.096  -2.272  28.761  1.00  0.69           N  
ATOM   1013  CA  GLY A 135     -13.356  -1.098  28.333  1.00  0.69           C  
ATOM   1014  C   GLY A 135     -12.753  -1.229  26.967  1.00  0.69           C  
ATOM   1015  O   GLY A 135     -13.123  -2.072  26.151  1.00  0.69           O  
ATOM   1016  N   TRP A 136     -11.775  -0.358  26.685  1.00  0.61           N  
ATOM   1017  CA  TRP A 136     -11.141  -0.231  25.395  1.00  0.61           C  
ATOM   1018  C   TRP A 136      -9.638  -0.382  25.509  1.00  0.61           C  
ATOM   1019  O   TRP A 136      -8.999   0.070  26.461  1.00  0.61           O  
ATOM   1020  CB  TRP A 136     -11.445   1.148  24.758  1.00  0.61           C  
ATOM   1021  CG  TRP A 136     -12.915   1.368  24.453  1.00  0.61           C  
ATOM   1022  CD1 TRP A 136     -13.885   1.923  25.244  1.00  0.61           C  
ATOM   1023  CD2 TRP A 136     -13.558   1.004  23.216  1.00  0.61           C  
ATOM   1024  NE1 TRP A 136     -15.087   1.945  24.573  1.00  0.61           N  
ATOM   1025  CE2 TRP A 136     -14.909   1.398  23.325  1.00  0.61           C  
ATOM   1026  CE3 TRP A 136     -13.079   0.395  22.062  1.00  0.61           C  
ATOM   1027  CZ2 TRP A 136     -15.795   1.200  22.273  1.00  0.61           C  
ATOM   1028  CZ3 TRP A 136     -13.974   0.189  21.000  1.00  0.61           C  
ATOM   1029  CH2 TRP A 136     -15.316   0.589  21.104  1.00  0.61           C  
ATOM   1030  N   LEU A 137      -9.027  -1.012  24.494  1.00  0.64           N  
ATOM   1031  CA  LEU A 137      -7.596  -1.043  24.303  1.00  0.64           C  
ATOM   1032  C   LEU A 137      -7.284  -0.179  23.104  1.00  0.64           C  
ATOM   1033  O   LEU A 137      -7.739  -0.452  21.995  1.00  0.64           O  
ATOM   1034  CB  LEU A 137      -7.087  -2.473  24.000  1.00  0.64           C  
ATOM   1035  CG  LEU A 137      -7.312  -3.488  25.134  1.00  0.64           C  
ATOM   1036  CD1 LEU A 137      -6.842  -4.880  24.696  1.00  0.64           C  
ATOM   1037  CD2 LEU A 137      -6.608  -3.069  26.431  1.00  0.64           C  
ATOM   1038  N   ALA A 138      -6.505   0.899  23.298  1.00  0.68           N  
ATOM   1039  CA  ALA A 138      -6.130   1.802  22.236  1.00  0.68           C  
ATOM   1040  C   ALA A 138      -4.652   1.641  21.935  1.00  0.68           C  
ATOM   1041  O   ALA A 138      -3.796   2.033  22.723  1.00  0.68           O  
ATOM   1042  CB  ALA A 138      -6.430   3.256  22.664  1.00  0.68           C  
ATOM   1043  N   HIS A 139      -4.309   1.047  20.776  1.00  0.68           N  
ATOM   1044  CA  HIS A 139      -2.924   0.858  20.376  1.00  0.68           C  
ATOM   1045  C   HIS A 139      -2.349   2.123  19.764  1.00  0.68           C  
ATOM   1046  O   HIS A 139      -2.870   2.658  18.788  1.00  0.68           O  
ATOM   1047  CB  HIS A 139      -2.754  -0.326  19.397  1.00  0.68           C  
ATOM   1048  CG  HIS A 139      -3.002  -1.647  20.064  1.00  0.68           C  
ATOM   1049  ND1 HIS A 139      -1.951  -2.535  20.218  1.00  0.68           N  
ATOM   1050  CD2 HIS A 139      -4.125  -2.140  20.652  1.00  0.68           C  
ATOM   1051  CE1 HIS A 139      -2.456  -3.544  20.903  1.00  0.68           C  
ATOM   1052  NE2 HIS A 139      -3.767  -3.356  21.191  1.00  0.68           N  
ATOM   1053  N   VAL A 140      -1.257   2.630  20.355  1.00  0.70           N  
ATOM   1054  CA  VAL A 140      -0.568   3.834  19.928  1.00  0.70           C  
ATOM   1055  C   VAL A 140       0.883   3.437  19.773  1.00  0.70           C  
ATOM   1056  O   VAL A 140       1.445   2.795  20.658  1.00  0.70           O  
ATOM   1057  CB  VAL A 140      -0.686   4.960  20.958  1.00  0.70           C  
ATOM   1058  CG1 VAL A 140       0.022   6.230  20.446  1.00  0.70           C  
ATOM   1059  CG2 VAL A 140      -2.175   5.258  21.231  1.00  0.70           C  
ATOM   1060  N   ASP A 141       1.538   3.767  18.647  1.00  0.71           N  
ATOM   1061  CA  ASP A 141       2.930   3.394  18.462  1.00  0.71           C  
ATOM   1062  C   ASP A 141       3.829   4.486  19.052  1.00  0.71           C  
ATOM   1063  O   ASP A 141       3.418   5.620  19.281  1.00  0.71           O  
ATOM   1064  CB  ASP A 141       3.228   3.003  16.985  1.00  0.71           C  
ATOM   1065  CG  ASP A 141       2.600   1.659  16.645  1.00  0.71           C  
ATOM   1066  OD1 ASP A 141       2.186   0.906  17.563  1.00  0.71           O  
ATOM   1067  OD2 ASP A 141       2.519   1.302  15.437  1.00  0.71           O  
ATOM   1068  N   ALA A 142       5.079   4.140  19.417  1.00  0.73           N  
ATOM   1069  CA  ALA A 142       5.899   4.931  20.320  1.00  0.73           C  
ATOM   1070  C   ALA A 142       6.236   6.359  19.894  1.00  0.73           C  
ATOM   1071  O   ALA A 142       6.300   7.255  20.738  1.00  0.73           O  
ATOM   1072  CB  ALA A 142       7.192   4.166  20.628  1.00  0.73           C  
ATOM   1073  N   ASP A 143       6.444   6.617  18.587  1.00  0.64           N  
ATOM   1074  CA  ASP A 143       6.787   7.925  18.079  1.00  0.64           C  
ATOM   1075  C   ASP A 143       5.557   8.727  17.612  1.00  0.64           C  
ATOM   1076  O   ASP A 143       5.681   9.807  17.023  1.00  0.64           O  
ATOM   1077  CB  ASP A 143       7.944   7.774  17.046  1.00  0.64           C  
ATOM   1078  CG  ASP A 143       7.568   7.111  15.737  1.00  0.64           C  
ATOM   1079  OD1 ASP A 143       6.997   5.994  15.763  1.00  0.64           O  
ATOM   1080  OD2 ASP A 143       7.880   7.717  14.674  1.00  0.64           O  
ATOM   1081  N   GLU A 144       4.335   8.247  17.942  1.00  0.64           N  
ATOM   1082  CA  GLU A 144       3.072   8.940  17.740  1.00  0.64           C  
ATOM   1083  C   GLU A 144       2.655   9.759  18.957  1.00  0.64           C  
ATOM   1084  O   GLU A 144       2.651   9.293  20.094  1.00  0.64           O  
ATOM   1085  CB  GLU A 144       1.910   7.953  17.457  1.00  0.64           C  
ATOM   1086  CG  GLU A 144       2.076   7.168  16.138  1.00  0.64           C  
ATOM   1087  CD  GLU A 144       1.096   6.021  15.968  1.00  0.64           C  
ATOM   1088  OE1 GLU A 144       1.155   5.367  14.893  1.00  0.64           O  
ATOM   1089  OE2 GLU A 144       0.287   5.711  16.884  1.00  0.64           O  
ATOM   1090  N   THR A 145       2.239  11.020  18.733  1.00  0.64           N  
ATOM   1091  CA  THR A 145       1.784  11.920  19.793  1.00  0.64           C  
ATOM   1092  C   THR A 145       0.363  12.357  19.488  1.00  0.64           C  
ATOM   1093  O   THR A 145       0.089  12.851  18.396  1.00  0.64           O  
ATOM   1094  CB  THR A 145       2.637  13.185  19.886  1.00  0.64           C  
ATOM   1095  OG1 THR A 145       3.997  12.850  20.115  1.00  0.64           O  
ATOM   1096  CG2 THR A 145       2.227  14.063  21.073  1.00  0.64           C  
ATOM   1097  N   LEU A 146      -0.605  12.201  20.426  1.00  0.64           N  
ATOM   1098  CA  LEU A 146      -1.968  12.712  20.258  1.00  0.64           C  
ATOM   1099  C   LEU A 146      -2.002  14.233  20.089  1.00  0.64           C  
ATOM   1100  O   LEU A 146      -1.279  14.965  20.763  1.00  0.64           O  
ATOM   1101  CB  LEU A 146      -2.872  12.296  21.452  1.00  0.64           C  
ATOM   1102  CG  LEU A 146      -4.368  12.677  21.345  1.00  0.64           C  
ATOM   1103  CD1 LEU A 146      -5.086  11.889  20.246  1.00  0.64           C  
ATOM   1104  CD2 LEU A 146      -5.098  12.456  22.678  1.00  0.64           C  
ATOM   1105  N   SER A 147      -2.808  14.756  19.141  1.00  0.63           N  
ATOM   1106  CA  SER A 147      -2.870  16.186  18.870  1.00  0.63           C  
ATOM   1107  C   SER A 147      -3.527  17.024  19.966  1.00  0.63           C  
ATOM   1108  O   SER A 147      -4.396  16.565  20.704  1.00  0.63           O  
ATOM   1109  CB  SER A 147      -3.416  16.513  17.454  1.00  0.63           C  
ATOM   1110  OG  SER A 147      -4.806  16.820  17.431  1.00  0.63           O  
ATOM   1111  N   ALA A 148      -3.135  18.311  20.089  1.00  0.54           N  
ATOM   1112  CA  ALA A 148      -3.645  19.224  21.097  1.00  0.54           C  
ATOM   1113  C   ALA A 148      -5.138  19.497  20.959  1.00  0.54           C  
ATOM   1114  O   ALA A 148      -5.886  19.574  21.932  1.00  0.54           O  
ATOM   1115  CB  ALA A 148      -2.870  20.551  21.003  1.00  0.54           C  
ATOM   1116  N   GLU A 149      -5.600  19.589  19.704  1.00  0.32           N  
ATOM   1117  CA  GLU A 149      -6.965  19.794  19.282  1.00  0.32           C  
ATOM   1118  C   GLU A 149      -7.808  18.544  19.492  1.00  0.32           C  
ATOM   1119  O   GLU A 149      -9.041  18.580  19.453  1.00  0.32           O  
ATOM   1120  CB  GLU A 149      -7.007  20.139  17.763  1.00  0.32           C  
ATOM   1121  CG  GLU A 149      -5.944  21.175  17.279  1.00  0.32           C  
ATOM   1122  CD  GLU A 149      -4.533  20.615  17.076  1.00  0.32           C  
ATOM   1123  OE1 GLU A 149      -3.599  21.381  16.751  1.00  0.32           O  
ATOM   1124  OE2 GLU A 149      -4.370  19.384  17.299  1.00  0.32           O  
ATOM   1125  N   SER A 150      -7.133  17.396  19.712  1.00  0.60           N  
ATOM   1126  CA  SER A 150      -7.749  16.098  19.902  1.00  0.60           C  
ATOM   1127  C   SER A 150      -7.849  15.697  21.350  1.00  0.60           C  
ATOM   1128  O   SER A 150      -8.408  14.644  21.650  1.00  0.60           O  
ATOM   1129  CB  SER A 150      -7.000  14.956  19.181  1.00  0.60           C  
ATOM   1130  OG  SER A 150      -7.024  15.167  17.773  1.00  0.60           O  
ATOM   1131  N   ARG A 151      -7.368  16.536  22.288  1.00  0.32           N  
ATOM   1132  CA  ARG A 151      -7.495  16.298  23.714  1.00  0.32           C  
ATOM   1133  C   ARG A 151      -8.940  16.171  24.189  1.00  0.32           C  
ATOM   1134  O   ARG A 151      -9.765  17.071  24.030  1.00  0.32           O  
ATOM   1135  CB  ARG A 151      -6.798  17.426  24.520  1.00  0.32           C  
ATOM   1136  CG  ARG A 151      -6.927  17.260  26.049  1.00  0.32           C  
ATOM   1137  CD  ARG A 151      -6.250  18.346  26.893  1.00  0.32           C  
ATOM   1138  NE  ARG A 151      -4.787  18.045  26.893  1.00  0.32           N  
ATOM   1139  CZ  ARG A 151      -3.805  18.929  27.077  1.00  0.32           C  
ATOM   1140  NH1 ARG A 151      -4.065  20.219  27.272  1.00  0.32           N  
ATOM   1141  NH2 ARG A 151      -2.550  18.482  27.112  1.00  0.32           N  
ATOM   1142  N   GLY A 152      -9.277  15.015  24.787  1.00  0.59           N  
ATOM   1143  CA  GLY A 152     -10.586  14.689  25.330  1.00  0.59           C  
ATOM   1144  C   GLY A 152     -11.546  14.173  24.295  1.00  0.59           C  
ATOM   1145  O   GLY A 152     -12.641  13.724  24.623  1.00  0.59           O  
ATOM   1146  N   ARG A 153     -11.154  14.182  23.005  1.00  0.51           N  
ATOM   1147  CA  ARG A 153     -11.959  13.650  21.925  1.00  0.51           C  
ATOM   1148  C   ARG A 153     -12.021  12.135  21.935  1.00  0.51           C  
ATOM   1149  O   ARG A 153     -13.045  11.537  21.612  1.00  0.51           O  
ATOM   1150  CB  ARG A 153     -11.436  14.050  20.528  1.00  0.51           C  
ATOM   1151  CG  ARG A 153     -11.496  15.545  20.169  1.00  0.51           C  
ATOM   1152  CD  ARG A 153     -11.223  15.685  18.668  1.00  0.51           C  
ATOM   1153  NE  ARG A 153     -11.123  17.121  18.267  1.00  0.51           N  
ATOM   1154  CZ  ARG A 153     -11.294  17.503  16.991  1.00  0.51           C  
ATOM   1155  NH1 ARG A 153     -11.598  16.621  16.046  1.00  0.51           N  
ATOM   1156  NH2 ARG A 153     -11.135  18.779  16.661  1.00  0.51           N  
ATOM   1157  N   LEU A 154     -10.898  11.471  22.270  1.00  0.58           N  
ATOM   1158  CA  LEU A 154     -10.790  10.027  22.252  1.00  0.58           C  
ATOM   1159  C   LEU A 154     -11.670   9.375  23.312  1.00  0.58           C  
ATOM   1160  O   LEU A 154     -12.439   8.460  23.020  1.00  0.58           O  
ATOM   1161  CB  LEU A 154      -9.298   9.636  22.396  1.00  0.58           C  
ATOM   1162  CG  LEU A 154      -8.987   8.130  22.465  1.00  0.58           C  
ATOM   1163  CD1 LEU A 154      -9.477   7.382  21.223  1.00  0.58           C  
ATOM   1164  CD2 LEU A 154      -7.480   7.897  22.654  1.00  0.58           C  
ATOM   1165  N   ARG A 155     -11.653   9.896  24.555  1.00  0.54           N  
ATOM   1166  CA  ARG A 155     -12.564   9.473  25.605  1.00  0.54           C  
ATOM   1167  C   ARG A 155     -14.012   9.754  25.258  1.00  0.54           C  
ATOM   1168  O   ARG A 155     -14.867   8.878  25.405  1.00  0.54           O  
ATOM   1169  CB  ARG A 155     -12.199  10.150  26.950  1.00  0.54           C  
ATOM   1170  CG  ARG A 155     -13.093   9.711  28.135  1.00  0.54           C  
ATOM   1171  CD  ARG A 155     -12.721  10.311  29.498  1.00  0.54           C  
ATOM   1172  NE  ARG A 155     -11.356   9.802  29.826  1.00  0.54           N  
ATOM   1173  CZ  ARG A 155     -11.136   8.623  30.418  1.00  0.54           C  
ATOM   1174  NH1 ARG A 155     -11.941   8.100  31.332  1.00  0.54           N  
ATOM   1175  NH2 ARG A 155     -10.063   7.930  30.073  1.00  0.54           N  
ATOM   1176  N   ALA A 156     -14.318  10.945  24.717  1.00  0.58           N  
ATOM   1177  CA  ALA A 156     -15.650  11.352  24.321  1.00  0.58           C  
ATOM   1178  C   ALA A 156     -16.275  10.469  23.243  1.00  0.58           C  
ATOM   1179  O   ALA A 156     -17.374   9.939  23.413  1.00  0.58           O  
ATOM   1180  CB  ALA A 156     -15.559  12.800  23.808  1.00  0.58           C  
ATOM   1181  N   VAL A 157     -15.554  10.218  22.125  1.00  0.57           N  
ATOM   1182  CA  VAL A 157     -16.067   9.402  21.033  1.00  0.57           C  
ATOM   1183  C   VAL A 157     -16.276   7.943  21.411  1.00  0.57           C  
ATOM   1184  O   VAL A 157     -17.301   7.351  21.080  1.00  0.57           O  
ATOM   1185  CB  VAL A 157     -15.289   9.563  19.725  1.00  0.57           C  
ATOM   1186  CG1 VAL A 157     -13.924   8.845  19.728  1.00  0.57           C  
ATOM   1187  CG2 VAL A 157     -16.178   9.105  18.549  1.00  0.57           C  
ATOM   1188  N   LEU A 158     -15.348   7.324  22.176  1.00  0.53           N  
ATOM   1189  CA  LEU A 158     -15.516   5.963  22.666  1.00  0.53           C  
ATOM   1190  C   LEU A 158     -16.701   5.823  23.611  1.00  0.53           C  
ATOM   1191  O   LEU A 158     -17.525   4.924  23.475  1.00  0.53           O  
ATOM   1192  CB  LEU A 158     -14.223   5.454  23.348  1.00  0.53           C  
ATOM   1193  CG  LEU A 158     -13.010   5.333  22.399  1.00  0.53           C  
ATOM   1194  CD1 LEU A 158     -11.747   4.976  23.196  1.00  0.53           C  
ATOM   1195  CD2 LEU A 158     -13.242   4.307  21.281  1.00  0.53           C  
ATOM   1196  N   THR A 159     -16.871   6.790  24.533  1.00  0.54           N  
ATOM   1197  CA  THR A 159     -18.028   6.846  25.437  1.00  0.54           C  
ATOM   1198  C   THR A 159     -19.338   7.002  24.698  1.00  0.54           C  
ATOM   1199  O   THR A 159     -20.338   6.351  24.989  1.00  0.54           O  
ATOM   1200  CB  THR A 159     -17.935   7.977  26.445  1.00  0.54           C  
ATOM   1201  OG1 THR A 159     -16.662   7.922  27.031  1.00  0.54           O  
ATOM   1202  CG2 THR A 159     -18.999   7.759  27.555  1.00  0.54           C  
ATOM   1203  N   ALA A 160     -19.364   7.873  23.667  1.00  0.54           N  
ATOM   1204  CA  ALA A 160     -20.493   8.019  22.771  1.00  0.54           C  
ATOM   1205  C   ALA A 160     -20.833   6.750  21.985  1.00  0.54           C  
ATOM   1206  O   ALA A 160     -21.998   6.361  21.904  1.00  0.54           O  
ATOM   1207  CB  ALA A 160     -20.228   9.197  21.815  1.00  0.54           C  
ATOM   1208  N   LEU A 161     -19.822   6.042  21.435  1.00  0.84           N  
ATOM   1209  CA  LEU A 161     -19.986   4.755  20.773  1.00  0.84           C  
ATOM   1210  C   LEU A 161     -20.505   3.648  21.682  1.00  0.84           C  
ATOM   1211  O   LEU A 161     -21.394   2.900  21.285  1.00  0.84           O  
ATOM   1212  CB  LEU A 161     -18.677   4.288  20.087  1.00  0.84           C  
ATOM   1213  CG  LEU A 161     -18.286   5.113  18.841  1.00  0.84           C  
ATOM   1214  CD1 LEU A 161     -16.860   4.758  18.398  1.00  0.84           C  
ATOM   1215  CD2 LEU A 161     -19.264   4.912  17.670  1.00  0.84           C  
ATOM   1216  N   ASP A 162     -20.021   3.534  22.936  1.00  0.86           N  
ATOM   1217  CA  ASP A 162     -20.558   2.602  23.920  1.00  0.86           C  
ATOM   1218  C   ASP A 162     -22.023   2.836  24.245  1.00  0.86           C  
ATOM   1219  O   ASP A 162     -22.806   1.899  24.365  1.00  0.86           O  
ATOM   1220  CB  ASP A 162     -19.753   2.687  25.239  1.00  0.86           C  
ATOM   1221  CG  ASP A 162     -18.434   1.976  25.089  1.00  0.86           C  
ATOM   1222  OD1 ASP A 162     -18.369   1.012  24.278  1.00  0.86           O  
ATOM   1223  OD2 ASP A 162     -17.473   2.340  25.807  1.00  0.86           O  
ATOM   1224  N   HIS A 163     -22.432   4.107  24.367  1.00  0.84           N  
ATOM   1225  CA  HIS A 163     -23.816   4.475  24.587  1.00  0.84           C  
ATOM   1226  C   HIS A 163     -24.770   4.082  23.459  1.00  0.84           C  
ATOM   1227  O   HIS A 163     -25.871   3.588  23.690  1.00  0.84           O  
ATOM   1228  CB  HIS A 163     -23.881   5.996  24.804  1.00  0.84           C  
ATOM   1229  CG  HIS A 163     -25.202   6.467  25.297  1.00  0.84           C  
ATOM   1230  ND1 HIS A 163     -25.585   6.130  26.578  1.00  0.84           N  
ATOM   1231  CD2 HIS A 163     -26.147   7.235  24.702  1.00  0.84           C  
ATOM   1232  CE1 HIS A 163     -26.763   6.692  26.739  1.00  0.84           C  
ATOM   1233  NE2 HIS A 163     -27.145   7.378  25.637  1.00  0.84           N  
ATOM   1234  N   VAL A 164     -24.373   4.288  22.185  1.00  0.86           N  
ATOM   1235  CA  VAL A 164     -25.274   4.047  21.063  1.00  0.86           C  
ATOM   1236  C   VAL A 164     -25.110   2.671  20.429  1.00  0.86           C  
ATOM   1237  O   VAL A 164     -26.029   2.179  19.780  1.00  0.86           O  
ATOM   1238  CB  VAL A 164     -25.170   5.139  19.998  1.00  0.86           C  
ATOM   1239  CG1 VAL A 164     -25.459   6.505  20.656  1.00  0.86           C  
ATOM   1240  CG2 VAL A 164     -23.791   5.145  19.314  1.00  0.86           C  
ATOM   1241  N   LEU A 165     -23.978   1.975  20.657  1.00  0.83           N  
ATOM   1242  CA  LEU A 165     -23.733   0.625  20.167  1.00  0.83           C  
ATOM   1243  C   LEU A 165     -23.162  -0.273  21.279  1.00  0.83           C  
ATOM   1244  O   LEU A 165     -22.065  -0.827  21.120  1.00  0.83           O  
ATOM   1245  CB  LEU A 165     -22.733   0.645  18.976  1.00  0.83           C  
ATOM   1246  CG  LEU A 165     -23.249   1.300  17.678  1.00  0.83           C  
ATOM   1247  CD1 LEU A 165     -22.104   1.437  16.662  1.00  0.83           C  
ATOM   1248  CD2 LEU A 165     -24.413   0.516  17.055  1.00  0.83           C  
ATOM   1249  N   PRO A 166     -23.829  -0.450  22.430  1.00  0.87           N  
ATOM   1250  CA  PRO A 166     -23.347  -1.295  23.521  1.00  0.87           C  
ATOM   1251  C   PRO A 166     -23.115  -2.742  23.120  1.00  0.87           C  
ATOM   1252  O   PRO A 166     -24.015  -3.400  22.606  1.00  0.87           O  
ATOM   1253  CB  PRO A 166     -24.434  -1.168  24.598  1.00  0.87           C  
ATOM   1254  CG  PRO A 166     -25.715  -0.944  23.793  1.00  0.87           C  
ATOM   1255  CD  PRO A 166     -25.228  -0.059  22.647  1.00  0.87           C  
ATOM   1256  N   GLY A 167     -21.899  -3.275  23.344  1.00  0.87           N  
ATOM   1257  CA  GLY A 167     -21.596  -4.678  23.072  1.00  0.87           C  
ATOM   1258  C   GLY A 167     -21.347  -5.005  21.624  1.00  0.87           C  
ATOM   1259  O   GLY A 167     -21.041  -6.143  21.286  1.00  0.87           O  
ATOM   1260  N   ALA A 168     -21.429  -4.016  20.714  1.00  0.88           N  
ATOM   1261  CA  ALA A 168     -21.039  -4.210  19.335  1.00  0.88           C  
ATOM   1262  C   ALA A 168     -19.525  -4.320  19.219  1.00  0.88           C  
ATOM   1263  O   ALA A 168     -18.794  -3.431  19.665  1.00  0.88           O  
ATOM   1264  CB  ALA A 168     -21.550  -3.052  18.456  1.00  0.88           C  
ATOM   1265  N   ASP A 169     -19.017  -5.427  18.637  1.00  0.81           N  
ATOM   1266  CA  ASP A 169     -17.599  -5.606  18.414  1.00  0.81           C  
ATOM   1267  C   ASP A 169     -17.224  -4.884  17.124  1.00  0.81           C  
ATOM   1268  O   ASP A 169     -17.798  -5.102  16.056  1.00  0.81           O  
ATOM   1269  CB  ASP A 169     -17.222  -7.114  18.410  1.00  0.81           C  
ATOM   1270  CG  ASP A 169     -15.807  -7.357  18.900  1.00  0.81           C  
ATOM   1271  OD1 ASP A 169     -15.073  -6.376  19.187  1.00  0.81           O  
ATOM   1272  OD2 ASP A 169     -15.426  -8.548  19.029  1.00  0.81           O  
ATOM   1273  N   LEU A 170     -16.294  -3.930  17.231  1.00  0.85           N  
ATOM   1274  CA  LEU A 170     -15.998  -2.993  16.179  1.00  0.85           C  
ATOM   1275  C   LEU A 170     -14.641  -2.423  16.471  1.00  0.85           C  
ATOM   1276  O   LEU A 170     -14.144  -2.512  17.596  1.00  0.85           O  
ATOM   1277  CB  LEU A 170     -17.066  -1.862  16.040  1.00  0.85           C  
ATOM   1278  CG  LEU A 170     -17.276  -0.914  17.250  1.00  0.85           C  
ATOM   1279  CD1 LEU A 170     -16.301   0.275  17.273  1.00  0.85           C  
ATOM   1280  CD2 LEU A 170     -18.711  -0.363  17.248  1.00  0.85           C  
ATOM   1281  N   VAL A 171     -14.003  -1.812  15.461  1.00  0.87           N  
ATOM   1282  CA  VAL A 171     -12.710  -1.184  15.645  1.00  0.87           C  
ATOM   1283  C   VAL A 171     -12.798   0.290  15.337  1.00  0.87           C  
ATOM   1284  O   VAL A 171     -13.389   0.730  14.352  1.00  0.87           O  
ATOM   1285  CB  VAL A 171     -11.586  -1.839  14.858  1.00  0.87           C  
ATOM   1286  CG1 VAL A 171     -11.339  -3.229  15.467  1.00  0.87           C  
ATOM   1287  CG2 VAL A 171     -11.929  -1.943  13.363  1.00  0.87           C  
ATOM   1288  N   VAL A 172     -12.212   1.119  16.212  1.00  0.88           N  
ATOM   1289  CA  VAL A 172     -12.205   2.555  16.030  1.00  0.88           C  
ATOM   1290  C   VAL A 172     -10.861   2.943  15.449  1.00  0.88           C  
ATOM   1291  O   VAL A 172      -9.798   2.496  15.888  1.00  0.88           O  
ATOM   1292  CB  VAL A 172     -12.551   3.334  17.297  1.00  0.88           C  
ATOM   1293  CG1 VAL A 172     -12.628   4.843  17.001  1.00  0.88           C  
ATOM   1294  CG2 VAL A 172     -13.902   2.827  17.836  1.00  0.88           C  
ATOM   1295  N   SER A 173     -10.893   3.768  14.393  1.00  0.86           N  
ATOM   1296  CA  SER A 173      -9.724   4.202  13.662  1.00  0.86           C  
ATOM   1297  C   SER A 173      -9.511   5.691  13.874  1.00  0.86           C  
ATOM   1298  O   SER A 173     -10.255   6.499  13.312  1.00  0.86           O  
ATOM   1299  CB  SER A 173      -9.900   4.004  12.135  1.00  0.86           C  
ATOM   1300  OG  SER A 173      -9.930   2.622  11.770  1.00  0.86           O  
ATOM   1301  N   PRO A 174      -8.529   6.129  14.657  1.00  0.86           N  
ATOM   1302  CA  PRO A 174      -8.009   7.489  14.612  1.00  0.86           C  
ATOM   1303  C   PRO A 174      -7.317   7.823  13.311  1.00  0.86           C  
ATOM   1304  O   PRO A 174      -6.908   6.925  12.575  1.00  0.86           O  
ATOM   1305  CB  PRO A 174      -7.000   7.550  15.772  1.00  0.86           C  
ATOM   1306  CG  PRO A 174      -7.439   6.428  16.707  1.00  0.86           C  
ATOM   1307  CD  PRO A 174      -7.917   5.355  15.734  1.00  0.86           C  
ATOM   1308  N   ARG A 175      -7.135   9.123  13.049  1.00  0.77           N  
ATOM   1309  CA  ARG A 175      -6.406   9.634  11.915  1.00  0.77           C  
ATOM   1310  C   ARG A 175      -4.943   9.804  12.297  1.00  0.77           C  
ATOM   1311  O   ARG A 175      -4.624  10.438  13.299  1.00  0.77           O  
ATOM   1312  CB  ARG A 175      -6.957  11.028  11.518  1.00  0.77           C  
ATOM   1313  CG  ARG A 175      -8.447  11.036  11.102  1.00  0.77           C  
ATOM   1314  CD  ARG A 175      -9.073  12.437  11.021  1.00  0.77           C  
ATOM   1315  NE  ARG A 175      -8.289  13.193   9.994  1.00  0.77           N  
ATOM   1316  CZ  ARG A 175      -8.267  14.529   9.909  1.00  0.77           C  
ATOM   1317  NH1 ARG A 175      -9.089  15.310  10.600  1.00  0.77           N  
ATOM   1318  NH2 ARG A 175      -7.379  15.100   9.094  1.00  0.77           N  
ATOM   1319  N   ILE A 176      -4.003   9.261  11.505  1.00  0.77           N  
ATOM   1320  CA  ILE A 176      -2.580   9.461  11.756  1.00  0.77           C  
ATOM   1321  C   ILE A 176      -2.025  10.368  10.671  1.00  0.77           C  
ATOM   1322  O   ILE A 176      -2.100  10.058   9.484  1.00  0.77           O  
ATOM   1323  CB  ILE A 176      -1.791   8.152  11.827  1.00  0.77           C  
ATOM   1324  CG1 ILE A 176      -2.321   7.250  12.969  1.00  0.77           C  
ATOM   1325  CG2 ILE A 176      -0.290   8.453  12.037  1.00  0.77           C  
ATOM   1326  CD1 ILE A 176      -1.754   5.824  12.934  1.00  0.77           C  
ATOM   1327  N   LEU A 177      -1.462  11.527  11.066  1.00  0.68           N  
ATOM   1328  CA  LEU A 177      -0.727  12.428  10.194  1.00  0.68           C  
ATOM   1329  C   LEU A 177       0.754  12.160  10.369  1.00  0.68           C  
ATOM   1330  O   LEU A 177       1.200  11.917  11.486  1.00  0.68           O  
ATOM   1331  CB  LEU A 177      -0.973  13.915  10.562  1.00  0.68           C  
ATOM   1332  CG  LEU A 177      -2.381  14.446  10.231  1.00  0.68           C  
ATOM   1333  CD1 LEU A 177      -2.569  15.833  10.864  1.00  0.68           C  
ATOM   1334  CD2 LEU A 177      -2.612  14.529   8.715  1.00  0.68           C  
ATOM   1335  N   ASP A 178       1.562  12.177   9.293  1.00  0.58           N  
ATOM   1336  CA  ASP A 178       2.997  11.994   9.390  1.00  0.58           C  
ATOM   1337  C   ASP A 178       3.761  13.323   9.270  1.00  0.58           C  
ATOM   1338  O   ASP A 178       3.231  14.413   9.481  1.00  0.58           O  
ATOM   1339  CB  ASP A 178       3.435  10.905   8.366  1.00  0.58           C  
ATOM   1340  CG  ASP A 178       3.569  11.497   6.984  1.00  0.58           C  
ATOM   1341  OD1 ASP A 178       2.632  12.186   6.528  1.00  0.58           O  
ATOM   1342  OD2 ASP A 178       4.700  11.427   6.436  1.00  0.58           O  
ATOM   1343  N   THR A 179       5.055  13.248   8.903  1.00  0.51           N  
ATOM   1344  CA  THR A 179       5.898  14.401   8.646  1.00  0.51           C  
ATOM   1345  C   THR A 179       5.854  14.852   7.194  1.00  0.51           C  
ATOM   1346  O   THR A 179       6.222  15.987   6.895  1.00  0.51           O  
ATOM   1347  CB  THR A 179       7.347  14.138   9.038  1.00  0.51           C  
ATOM   1348  OG1 THR A 179       7.827  12.912   8.501  1.00  0.51           O  
ATOM   1349  CG2 THR A 179       7.412  14.002  10.564  1.00  0.51           C  
ATOM   1350  N   SER A 180       5.361  14.023   6.246  1.00  0.45           N  
ATOM   1351  CA  SER A 180       5.129  14.436   4.863  1.00  0.45           C  
ATOM   1352  C   SER A 180       3.800  15.153   4.669  1.00  0.45           C  
ATOM   1353  O   SER A 180       3.673  15.975   3.761  1.00  0.45           O  
ATOM   1354  CB  SER A 180       5.237  13.259   3.848  1.00  0.45           C  
ATOM   1355  OG  SER A 180       4.181  12.307   3.962  1.00  0.45           O  
ATOM   1356  N   ARG A 181       2.827  14.881   5.571  1.00  0.41           N  
ATOM   1357  CA  ARG A 181       1.460  15.388   5.662  1.00  0.41           C  
ATOM   1358  C   ARG A 181       0.452  14.467   4.988  1.00  0.41           C  
ATOM   1359  O   ARG A 181      -0.659  14.878   4.645  1.00  0.41           O  
ATOM   1360  CB  ARG A 181       1.213  16.845   5.174  1.00  0.41           C  
ATOM   1361  CG  ARG A 181       2.043  17.928   5.886  1.00  0.41           C  
ATOM   1362  CD  ARG A 181       1.791  19.301   5.265  1.00  0.41           C  
ATOM   1363  NE  ARG A 181       2.591  20.298   6.043  1.00  0.41           N  
ATOM   1364  CZ  ARG A 181       2.472  21.624   5.903  1.00  0.41           C  
ATOM   1365  NH1 ARG A 181       1.624  22.156   5.028  1.00  0.41           N  
ATOM   1366  NH2 ARG A 181       3.214  22.435   6.654  1.00  0.41           N  
ATOM   1367  N   GLU A 182       0.785  13.175   4.832  1.00  0.46           N  
ATOM   1368  CA  GLU A 182      -0.155  12.133   4.482  1.00  0.46           C  
ATOM   1369  C   GLU A 182      -1.100  11.859   5.653  1.00  0.46           C  
ATOM   1370  O   GLU A 182      -0.740  12.006   6.820  1.00  0.46           O  
ATOM   1371  CB  GLU A 182       0.583  10.847   4.032  1.00  0.46           C  
ATOM   1372  CG  GLU A 182      -0.333   9.796   3.352  1.00  0.46           C  
ATOM   1373  CD  GLU A 182       0.418   8.552   2.878  1.00  0.46           C  
ATOM   1374  OE1 GLU A 182       0.021   8.000   1.822  1.00  0.46           O  
ATOM   1375  OE2 GLU A 182       1.366   8.117   3.580  1.00  0.46           O  
ATOM   1376  N   CYS A 183      -2.369  11.490   5.385  1.00  0.67           N  
ATOM   1377  CA  CYS A 183      -3.343  11.250   6.436  1.00  0.67           C  
ATOM   1378  C   CYS A 183      -3.858   9.829   6.344  1.00  0.67           C  
ATOM   1379  O   CYS A 183      -4.669   9.488   5.487  1.00  0.67           O  
ATOM   1380  CB  CYS A 183      -4.523  12.262   6.337  1.00  0.67           C  
ATOM   1381  SG  CYS A 183      -5.770  12.132   7.678  1.00  0.67           S  
ATOM   1382  N   HIS A 184      -3.432   8.969   7.282  1.00  0.70           N  
ATOM   1383  CA  HIS A 184      -3.805   7.570   7.306  1.00  0.70           C  
ATOM   1384  C   HIS A 184      -5.059   7.383   8.129  1.00  0.70           C  
ATOM   1385  O   HIS A 184      -5.049   7.584   9.344  1.00  0.70           O  
ATOM   1386  CB  HIS A 184      -2.661   6.725   7.897  1.00  0.70           C  
ATOM   1387  CG  HIS A 184      -1.470   6.811   7.021  1.00  0.70           C  
ATOM   1388  ND1 HIS A 184      -1.495   6.074   5.856  1.00  0.70           N  
ATOM   1389  CD2 HIS A 184      -0.394   7.642   7.052  1.00  0.70           C  
ATOM   1390  CE1 HIS A 184      -0.429   6.471   5.190  1.00  0.70           C  
ATOM   1391  NE2 HIS A 184       0.265   7.410   5.873  1.00  0.70           N  
ATOM   1392  N   THR A 185      -6.191   7.039   7.478  1.00  0.80           N  
ATOM   1393  CA  THR A 185      -7.481   6.916   8.148  1.00  0.80           C  
ATOM   1394  C   THR A 185      -7.824   5.507   8.591  1.00  0.80           C  
ATOM   1395  O   THR A 185      -8.125   5.309   9.761  1.00  0.80           O  
ATOM   1396  CB  THR A 185      -8.640   7.508   7.365  1.00  0.80           C  
ATOM   1397  OG1 THR A 185      -8.926   6.784   6.177  1.00  0.80           O  
ATOM   1398  CG2 THR A 185      -8.316   8.955   6.966  1.00  0.80           C  
ATOM   1399  N   ASP A 186      -7.754   4.471   7.720  1.00  0.80           N  
ATOM   1400  CA  ASP A 186      -8.054   3.090   8.091  1.00  0.80           C  
ATOM   1401  C   ASP A 186      -6.946   2.432   8.930  1.00  0.80           C  
ATOM   1402  O   ASP A 186      -6.256   1.502   8.516  1.00  0.80           O  
ATOM   1403  CB  ASP A 186      -8.426   2.247   6.837  1.00  0.80           C  
ATOM   1404  CG  ASP A 186      -9.036   0.922   7.239  1.00  0.80           C  
ATOM   1405  OD1 ASP A 186      -9.914   0.900   8.138  1.00  0.80           O  
ATOM   1406  OD2 ASP A 186      -8.635  -0.141   6.690  1.00  0.80           O  
ATOM   1407  N   THR A 187      -6.748   2.941  10.155  1.00  0.81           N  
ATOM   1408  CA  THR A 187      -5.744   2.507  11.112  1.00  0.81           C  
ATOM   1409  C   THR A 187      -6.136   1.274  11.905  1.00  0.81           C  
ATOM   1410  O   THR A 187      -5.310   0.386  12.103  1.00  0.81           O  
ATOM   1411  CB  THR A 187      -5.355   3.634  12.063  1.00  0.81           C  
ATOM   1412  OG1 THR A 187      -6.466   4.135  12.791  1.00  0.81           O  
ATOM   1413  CG2 THR A 187      -4.808   4.807  11.243  1.00  0.81           C  
ATOM   1414  N   ARG A 188      -7.404   1.191  12.369  1.00  0.77           N  
ATOM   1415  CA  ARG A 188      -7.992   0.084  13.118  1.00  0.77           C  
ATOM   1416  C   ARG A 188      -7.248  -0.341  14.377  1.00  0.77           C  
ATOM   1417  O   ARG A 188      -6.948  -1.514  14.590  1.00  0.77           O  
ATOM   1418  CB  ARG A 188      -8.310  -1.134  12.220  1.00  0.77           C  
ATOM   1419  CG  ARG A 188      -9.247  -0.767  11.058  1.00  0.77           C  
ATOM   1420  CD  ARG A 188      -9.770  -1.979  10.293  1.00  0.77           C  
ATOM   1421  NE  ARG A 188     -10.564  -1.429   9.163  1.00  0.77           N  
ATOM   1422  CZ  ARG A 188     -10.999  -2.246   8.206  1.00  0.77           C  
ATOM   1423  NH1 ARG A 188     -11.667  -3.356   8.488  1.00  0.77           N  
ATOM   1424  NH2 ARG A 188     -10.685  -1.972   6.944  1.00  0.77           N  
ATOM   1425  N   ARG A 189      -6.934   0.629  15.255  1.00  0.77           N  
ATOM   1426  CA  ARG A 189      -6.056   0.395  16.386  1.00  0.77           C  
ATOM   1427  C   ARG A 189      -6.745   0.393  17.735  1.00  0.77           C  
ATOM   1428  O   ARG A 189      -6.107   0.130  18.754  1.00  0.77           O  
ATOM   1429  CB  ARG A 189      -4.989   1.505  16.420  1.00  0.77           C  
ATOM   1430  CG  ARG A 189      -3.974   1.385  15.274  1.00  0.77           C  
ATOM   1431  CD  ARG A 189      -2.853   2.408  15.412  1.00  0.77           C  
ATOM   1432  NE  ARG A 189      -1.801   2.040  14.420  1.00  0.77           N  
ATOM   1433  CZ  ARG A 189      -0.525   2.398  14.610  1.00  0.77           C  
ATOM   1434  NH1 ARG A 189      -0.184   3.246  15.565  1.00  0.77           N  
ATOM   1435  NH2 ARG A 189       0.445   1.861  13.882  1.00  0.77           N  
ATOM   1436  N   ILE A 190      -8.056   0.675  17.795  1.00  0.85           N  
ATOM   1437  CA  ILE A 190      -8.771   0.733  19.057  1.00  0.85           C  
ATOM   1438  C   ILE A 190      -9.867  -0.308  19.034  1.00  0.85           C  
ATOM   1439  O   ILE A 190     -10.654  -0.377  18.093  1.00  0.85           O  
ATOM   1440  CB  ILE A 190      -9.380   2.100  19.325  1.00  0.85           C  
ATOM   1441  CG1 ILE A 190      -8.338   3.236  19.235  1.00  0.85           C  
ATOM   1442  CG2 ILE A 190     -10.080   2.094  20.705  1.00  0.85           C  
ATOM   1443  CD1 ILE A 190      -9.004   4.612  19.202  1.00  0.85           C  
ATOM   1444  N   VAL A 191      -9.940  -1.150  20.077  1.00  0.87           N  
ATOM   1445  CA  VAL A 191     -10.811  -2.309  20.103  1.00  0.87           C  
ATOM   1446  C   VAL A 191     -11.249  -2.548  21.533  1.00  0.87           C  
ATOM   1447  O   VAL A 191     -10.599  -2.094  22.474  1.00  0.87           O  
ATOM   1448  CB  VAL A 191     -10.085  -3.519  19.519  1.00  0.87           C  
ATOM   1449  CG1 VAL A 191      -8.843  -3.897  20.355  1.00  0.87           C  
ATOM   1450  CG2 VAL A 191     -11.025  -4.722  19.318  1.00  0.87           C  
ATOM   1451  N   ARG A 192     -12.399  -3.216  21.757  1.00  0.79           N  
ATOM   1452  CA  ARG A 192     -12.841  -3.582  23.091  1.00  0.79           C  
ATOM   1453  C   ARG A 192     -11.891  -4.540  23.806  1.00  0.79           C  
ATOM   1454  O   ARG A 192     -11.267  -5.408  23.198  1.00  0.79           O  
ATOM   1455  CB  ARG A 192     -14.256  -4.200  23.093  1.00  0.79           C  
ATOM   1456  CG  ARG A 192     -15.329  -3.321  22.432  1.00  0.79           C  
ATOM   1457  CD  ARG A 192     -16.740  -3.881  22.664  1.00  0.79           C  
ATOM   1458  NE  ARG A 192     -17.731  -2.858  22.185  1.00  0.79           N  
ATOM   1459  CZ  ARG A 192     -18.043  -1.758  22.878  1.00  0.79           C  
ATOM   1460  NH1 ARG A 192     -17.496  -1.471  24.054  1.00  0.79           N  
ATOM   1461  NH2 ARG A 192     -18.908  -0.864  22.409  1.00  0.79           N  
ATOM   1462  N   SER A 193     -11.759  -4.412  25.138  1.00  0.83           N  
ATOM   1463  CA  SER A 193     -10.915  -5.276  25.956  1.00  0.83           C  
ATOM   1464  C   SER A 193     -11.390  -6.715  26.035  1.00  0.83           C  
ATOM   1465  O   SER A 193     -10.590  -7.645  26.126  1.00  0.83           O  
ATOM   1466  CB  SER A 193     -10.744  -4.727  27.394  1.00  0.83           C  
ATOM   1467  OG  SER A 193     -11.997  -4.428  28.005  1.00  0.83           O  
ATOM   1468  N   ASP A 194     -12.713  -6.915  25.971  1.00  0.77           N  
ATOM   1469  CA  ASP A 194     -13.406  -8.183  26.057  1.00  0.77           C  
ATOM   1470  C   ASP A 194     -13.684  -8.781  24.672  1.00  0.77           C  
ATOM   1471  O   ASP A 194     -14.251  -9.865  24.546  1.00  0.77           O  
ATOM   1472  CB  ASP A 194     -14.729  -7.983  26.861  1.00  0.77           C  
ATOM   1473  CG  ASP A 194     -15.286  -6.575  26.703  1.00  0.77           C  
ATOM   1474  OD1 ASP A 194     -15.524  -6.137  25.550  1.00  0.77           O  
ATOM   1475  OD2 ASP A 194     -15.397  -5.887  27.749  1.00  0.77           O  
ATOM   1476  N   SER A 195     -13.227  -8.104  23.596  1.00  0.77           N  
ATOM   1477  CA  SER A 195     -13.328  -8.548  22.207  1.00  0.77           C  
ATOM   1478  C   SER A 195     -12.655  -9.883  21.913  1.00  0.77           C  
ATOM   1479  O   SER A 195     -11.644 -10.266  22.510  1.00  0.77           O  
ATOM   1480  CB  SER A 195     -12.749  -7.492  21.223  1.00  0.77           C  
ATOM   1481  OG  SER A 195     -12.861  -7.853  19.852  1.00  0.77           O  
ATOM   1482  N   ALA A 196     -13.199 -10.626  20.930  1.00  0.73           N  
ATOM   1483  CA  ALA A 196     -12.592 -11.837  20.423  1.00  0.73           C  
ATOM   1484  C   ALA A 196     -11.551 -11.554  19.340  1.00  0.73           C  
ATOM   1485  O   ALA A 196     -10.735 -12.415  19.014  1.00  0.73           O  
ATOM   1486  CB  ALA A 196     -13.694 -12.752  19.855  1.00  0.73           C  
ATOM   1487  N   LEU A 197     -11.529 -10.328  18.777  1.00  0.76           N  
ATOM   1488  CA  LEU A 197     -10.594  -9.907  17.747  1.00  0.76           C  
ATOM   1489  C   LEU A 197      -9.137  -9.910  18.185  1.00  0.76           C  
ATOM   1490  O   LEU A 197      -8.791  -9.500  19.292  1.00  0.76           O  
ATOM   1491  CB  LEU A 197     -10.928  -8.481  17.257  1.00  0.76           C  
ATOM   1492  CG  LEU A 197     -12.345  -8.321  16.674  1.00  0.76           C  
ATOM   1493  CD1 LEU A 197     -12.724  -6.834  16.639  1.00  0.76           C  
ATOM   1494  CD2 LEU A 197     -12.469  -8.976  15.293  1.00  0.76           C  
ATOM   1495  N   ARG A 198      -8.217 -10.355  17.316  1.00  0.72           N  
ATOM   1496  CA  ARG A 198      -6.806 -10.409  17.641  1.00  0.72           C  
ATOM   1497  C   ARG A 198      -6.013 -10.008  16.419  1.00  0.72           C  
ATOM   1498  O   ARG A 198      -6.465 -10.118  15.282  1.00  0.72           O  
ATOM   1499  CB  ARG A 198      -6.354 -11.820  18.116  1.00  0.72           C  
ATOM   1500  CG  ARG A 198      -6.934 -12.266  19.480  1.00  0.72           C  
ATOM   1501  CD  ARG A 198      -6.496 -11.401  20.673  1.00  0.72           C  
ATOM   1502  NE  ARG A 198      -7.160 -11.942  21.912  1.00  0.72           N  
ATOM   1503  CZ  ARG A 198      -8.369 -11.551  22.340  1.00  0.72           C  
ATOM   1504  NH1 ARG A 198      -9.114 -10.673  21.687  1.00  0.72           N  
ATOM   1505  NH2 ARG A 198      -8.871 -12.041  23.473  1.00  0.72           N  
ATOM   1506  N   PHE A 199      -4.796  -9.479  16.627  1.00  0.77           N  
ATOM   1507  CA  PHE A 199      -3.897  -9.118  15.551  1.00  0.77           C  
ATOM   1508  C   PHE A 199      -3.359 -10.363  14.855  1.00  0.77           C  
ATOM   1509  O   PHE A 199      -2.905 -11.297  15.514  1.00  0.77           O  
ATOM   1510  CB  PHE A 199      -2.718  -8.244  16.056  1.00  0.77           C  
ATOM   1511  CG  PHE A 199      -3.203  -6.874  16.447  1.00  0.77           C  
ATOM   1512  CD1 PHE A 199      -3.226  -5.839  15.497  1.00  0.77           C  
ATOM   1513  CD2 PHE A 199      -3.625  -6.600  17.759  1.00  0.77           C  
ATOM   1514  CE1 PHE A 199      -3.654  -4.552  15.850  1.00  0.77           C  
ATOM   1515  CE2 PHE A 199      -4.055  -5.315  18.115  1.00  0.77           C  
ATOM   1516  CZ  PHE A 199      -4.066  -4.290  17.162  1.00  0.77           C  
ATOM   1517  N   ARG A 200      -3.402 -10.413  13.508  1.00  0.75           N  
ATOM   1518  CA  ARG A 200      -2.876 -11.543  12.755  1.00  0.75           C  
ATOM   1519  C   ARG A 200      -1.860 -11.079  11.720  1.00  0.75           C  
ATOM   1520  O   ARG A 200      -2.071 -10.105  10.993  1.00  0.75           O  
ATOM   1521  CB  ARG A 200      -4.005 -12.385  12.092  1.00  0.75           C  
ATOM   1522  CG  ARG A 200      -3.546 -13.740  11.493  1.00  0.75           C  
ATOM   1523  CD  ARG A 200      -4.682 -14.575  10.875  1.00  0.75           C  
ATOM   1524  NE  ARG A 200      -4.068 -15.747  10.151  1.00  0.75           N  
ATOM   1525  CZ  ARG A 200      -4.759 -16.564   9.340  1.00  0.75           C  
ATOM   1526  NH1 ARG A 200      -6.087 -16.586   9.337  1.00  0.75           N  
ATOM   1527  NH2 ARG A 200      -4.106 -17.354   8.492  1.00  0.75           N  
ATOM   1528  N   GLY A 201      -0.717 -11.797  11.647  1.00  0.87           N  
ATOM   1529  CA  GLY A 201       0.403 -11.523  10.753  1.00  0.87           C  
ATOM   1530  C   GLY A 201       1.578 -10.948  11.501  1.00  0.87           C  
ATOM   1531  O   GLY A 201       1.431 -10.026  12.290  1.00  0.87           O  
ATOM   1532  N   ARG A 202       2.805 -11.460  11.260  1.00  0.80           N  
ATOM   1533  CA  ARG A 202       3.987 -11.054  12.018  1.00  0.80           C  
ATOM   1534  C   ARG A 202       4.457  -9.633  11.754  1.00  0.80           C  
ATOM   1535  O   ARG A 202       5.162  -9.039  12.567  1.00  0.80           O  
ATOM   1536  CB  ARG A 202       5.208 -11.936  11.662  1.00  0.80           C  
ATOM   1537  CG  ARG A 202       5.010 -13.434  11.925  1.00  0.80           C  
ATOM   1538  CD  ARG A 202       6.304 -14.232  11.692  1.00  0.80           C  
ATOM   1539  NE  ARG A 202       6.121 -15.608  12.240  1.00  0.80           N  
ATOM   1540  CZ  ARG A 202       5.860 -15.868  13.524  1.00  0.80           C  
ATOM   1541  NH1 ARG A 202       6.197 -15.042  14.499  1.00  0.80           N  
ATOM   1542  NH2 ARG A 202       5.219 -16.996  13.806  1.00  0.80           N  
ATOM   1543  N   LEU A 203       4.100  -9.097  10.579  1.00  0.84           N  
ATOM   1544  CA  LEU A 203       4.465  -7.787  10.106  1.00  0.84           C  
ATOM   1545  C   LEU A 203       3.300  -7.327   9.257  1.00  0.84           C  
ATOM   1546  O   LEU A 203       2.708  -8.137   8.545  1.00  0.84           O  
ATOM   1547  CB  LEU A 203       5.736  -7.891   9.227  1.00  0.84           C  
ATOM   1548  CG  LEU A 203       6.232  -6.570   8.611  1.00  0.84           C  
ATOM   1549  CD1 LEU A 203       6.756  -5.598   9.672  1.00  0.84           C  
ATOM   1550  CD2 LEU A 203       7.312  -6.847   7.558  1.00  0.84           C  
ATOM   1551  N   HIS A 204       2.909  -6.039   9.330  1.00  0.79           N  
ATOM   1552  CA  HIS A 204       1.747  -5.498   8.633  1.00  0.79           C  
ATOM   1553  C   HIS A 204       0.457  -6.119   9.165  1.00  0.79           C  
ATOM   1554  O   HIS A 204      -0.425  -6.596   8.438  1.00  0.79           O  
ATOM   1555  CB  HIS A 204       1.840  -5.564   7.087  1.00  0.79           C  
ATOM   1556  CG  HIS A 204       3.164  -5.124   6.528  1.00  0.79           C  
ATOM   1557  ND1 HIS A 204       3.605  -3.823   6.697  1.00  0.79           N  
ATOM   1558  CD2 HIS A 204       4.096  -5.849   5.854  1.00  0.79           C  
ATOM   1559  CE1 HIS A 204       4.800  -3.794   6.140  1.00  0.79           C  
ATOM   1560  NE2 HIS A 204       5.139  -4.986   5.603  1.00  0.79           N  
ATOM   1561  N   GLU A 205       0.387  -6.170  10.503  1.00  0.76           N  
ATOM   1562  CA  GLU A 205      -0.681  -6.674  11.318  1.00  0.76           C  
ATOM   1563  C   GLU A 205      -1.932  -5.805  11.311  1.00  0.76           C  
ATOM   1564  O   GLU A 205      -1.899  -4.582  11.186  1.00  0.76           O  
ATOM   1565  CB  GLU A 205      -0.175  -6.927  12.767  1.00  0.76           C  
ATOM   1566  CG  GLU A 205       0.144  -5.675  13.641  1.00  0.76           C  
ATOM   1567  CD  GLU A 205       1.392  -4.861  13.275  1.00  0.76           C  
ATOM   1568  OE1 GLU A 205       1.619  -3.851  13.999  1.00  0.76           O  
ATOM   1569  OE2 GLU A 205       2.127  -5.218  12.320  1.00  0.76           O  
ATOM   1570  N   ARG A 206      -3.104  -6.440  11.460  1.00  0.73           N  
ATOM   1571  CA  ARG A 206      -4.360  -5.751  11.664  1.00  0.73           C  
ATOM   1572  C   ARG A 206      -5.177  -6.679  12.530  1.00  0.73           C  
ATOM   1573  O   ARG A 206      -4.882  -7.872  12.605  1.00  0.73           O  
ATOM   1574  CB  ARG A 206      -5.164  -5.476  10.358  1.00  0.73           C  
ATOM   1575  CG  ARG A 206      -4.556  -4.419   9.415  1.00  0.73           C  
ATOM   1576  CD  ARG A 206      -5.350  -4.241   8.116  1.00  0.73           C  
ATOM   1577  NE  ARG A 206      -4.895  -2.932   7.538  1.00  0.73           N  
ATOM   1578  CZ  ARG A 206      -5.748  -1.950   7.212  1.00  0.73           C  
ATOM   1579  NH1 ARG A 206      -7.026  -2.188   6.953  1.00  0.73           N  
ATOM   1580  NH2 ARG A 206      -5.328  -0.692   7.176  1.00  0.73           N  
ATOM   1581  N   LEU A 207      -6.202  -6.152  13.229  1.00  0.81           N  
ATOM   1582  CA  LEU A 207      -7.195  -6.952  13.920  1.00  0.81           C  
ATOM   1583  C   LEU A 207      -8.058  -7.781  12.977  1.00  0.81           C  
ATOM   1584  O   LEU A 207      -8.583  -7.283  11.981  1.00  0.81           O  
ATOM   1585  CB  LEU A 207      -8.112  -6.058  14.787  1.00  0.81           C  
ATOM   1586  CG  LEU A 207      -7.396  -5.454  16.009  1.00  0.81           C  
ATOM   1587  CD1 LEU A 207      -8.143  -4.222  16.521  1.00  0.81           C  
ATOM   1588  CD2 LEU A 207      -7.251  -6.481  17.141  1.00  0.81           C  
ATOM   1589  N   TYR A 208      -8.229  -9.070  13.306  1.00  0.79           N  
ATOM   1590  CA  TYR A 208      -9.039 -10.017  12.575  1.00  0.79           C  
ATOM   1591  C   TYR A 208      -9.756 -10.873  13.596  1.00  0.79           C  
ATOM   1592  O   TYR A 208      -9.389 -10.895  14.771  1.00  0.79           O  
ATOM   1593  CB  TYR A 208      -8.171 -10.953  11.688  1.00  0.79           C  
ATOM   1594  CG  TYR A 208      -7.647 -10.193  10.506  1.00  0.79           C  
ATOM   1595  CD1 TYR A 208      -8.485  -9.985   9.406  1.00  0.79           C  
ATOM   1596  CD2 TYR A 208      -6.348  -9.659  10.475  1.00  0.79           C  
ATOM   1597  CE1 TYR A 208      -8.053  -9.231   8.315  1.00  0.79           C  
ATOM   1598  CE2 TYR A 208      -5.922  -8.875   9.389  1.00  0.79           C  
ATOM   1599  CZ  TYR A 208      -6.795  -8.633   8.318  1.00  0.79           C  
ATOM   1600  OH  TYR A 208      -6.487  -7.787   7.230  1.00  0.79           O  
ATOM   1601  N   ASP A 209     -10.802 -11.609  13.182  1.00  0.75           N  
ATOM   1602  CA  ASP A 209     -11.434 -12.602  14.025  1.00  0.75           C  
ATOM   1603  C   ASP A 209     -10.673 -13.937  13.950  1.00  0.75           C  
ATOM   1604  O   ASP A 209      -9.611 -14.058  13.337  1.00  0.75           O  
ATOM   1605  CB  ASP A 209     -12.966 -12.699  13.733  1.00  0.75           C  
ATOM   1606  CG  ASP A 209     -13.299 -13.721  12.661  1.00  0.75           C  
ATOM   1607  OD1 ASP A 209     -12.648 -13.692  11.590  1.00  0.75           O  
ATOM   1608  OD2 ASP A 209     -14.097 -14.643  12.967  1.00  0.75           O  
ATOM   1609  N   ALA A 210     -11.225 -14.987  14.588  1.00  0.68           N  
ATOM   1610  CA  ALA A 210     -10.723 -16.344  14.518  1.00  0.68           C  
ATOM   1611  C   ALA A 210     -10.681 -16.922  13.100  1.00  0.68           C  
ATOM   1612  O   ALA A 210      -9.774 -17.678  12.753  1.00  0.68           O  
ATOM   1613  CB  ALA A 210     -11.597 -17.238  15.419  1.00  0.68           C  
ATOM   1614  N   HIS A 211     -11.652 -16.555  12.237  1.00  0.69           N  
ATOM   1615  CA  HIS A 211     -11.745 -17.065  10.881  1.00  0.69           C  
ATOM   1616  C   HIS A 211     -10.951 -16.228   9.886  1.00  0.69           C  
ATOM   1617  O   HIS A 211     -10.742 -16.625   8.742  1.00  0.69           O  
ATOM   1618  CB  HIS A 211     -13.225 -17.078  10.444  1.00  0.69           C  
ATOM   1619  CG  HIS A 211     -14.069 -17.914  11.357  1.00  0.69           C  
ATOM   1620  ND1 HIS A 211     -13.869 -19.281  11.403  1.00  0.69           N  
ATOM   1621  CD2 HIS A 211     -15.022 -17.549  12.254  1.00  0.69           C  
ATOM   1622  CE1 HIS A 211     -14.701 -19.719  12.324  1.00  0.69           C  
ATOM   1623  NE2 HIS A 211     -15.423 -18.713  12.873  1.00  0.69           N  
ATOM   1624  N   GLY A 212     -10.442 -15.052  10.310  1.00  0.82           N  
ATOM   1625  CA  GLY A 212      -9.641 -14.163   9.476  1.00  0.82           C  
ATOM   1626  C   GLY A 212     -10.430 -13.074   8.798  1.00  0.82           C  
ATOM   1627  O   GLY A 212      -9.925 -12.432   7.879  1.00  0.82           O  
ATOM   1628  N   ALA A 213     -11.677 -12.832   9.230  1.00  0.85           N  
ATOM   1629  CA  ALA A 213     -12.532 -11.771   8.746  1.00  0.85           C  
ATOM   1630  C   ALA A 213     -12.215 -10.450   9.439  1.00  0.85           C  
ATOM   1631  O   ALA A 213     -11.754 -10.408  10.584  1.00  0.85           O  
ATOM   1632  CB  ALA A 213     -14.012 -12.138   8.971  1.00  0.85           C  
ATOM   1633  N   GLN A 214     -12.416  -9.311   8.750  1.00  0.81           N  
ATOM   1634  CA  GLN A 214     -12.166  -8.007   9.322  1.00  0.81           C  
ATOM   1635  C   GLN A 214     -13.315  -7.535  10.205  1.00  0.81           C  
ATOM   1636  O   GLN A 214     -14.486  -7.755   9.893  1.00  0.81           O  
ATOM   1637  CB  GLN A 214     -11.902  -6.918   8.248  1.00  0.81           C  
ATOM   1638  CG  GLN A 214     -10.474  -7.022   7.678  1.00  0.81           C  
ATOM   1639  CD  GLN A 214     -10.106  -5.961   6.643  1.00  0.81           C  
ATOM   1640  OE1 GLN A 214     -10.799  -4.969   6.402  1.00  0.81           O  
ATOM   1641  NE2 GLN A 214      -8.919  -6.157   6.018  1.00  0.81           N  
ATOM   1642  N   PRO A 215     -13.056  -6.841  11.304  1.00  0.88           N  
ATOM   1643  CA  PRO A 215     -14.104  -6.153  12.033  1.00  0.88           C  
ATOM   1644  C   PRO A 215     -14.526  -4.880  11.306  1.00  0.88           C  
ATOM   1645  O   PRO A 215     -13.670  -4.250  10.664  1.00  0.88           O  
ATOM   1646  CB  PRO A 215     -13.452  -5.834  13.382  1.00  0.88           C  
ATOM   1647  CG  PRO A 215     -11.959  -5.718  13.066  1.00  0.88           C  
ATOM   1648  CD  PRO A 215     -11.758  -6.756  11.971  1.00  0.88           C  
ATOM   1649  N   PRO A 216     -15.792  -4.475  11.361  1.00  0.87           N  
ATOM   1650  CA  PRO A 216     -16.247  -3.232  10.761  1.00  0.87           C  
ATOM   1651  C   PRO A 216     -15.693  -2.034  11.521  1.00  0.87           C  
ATOM   1652  O   PRO A 216     -15.543  -2.076  12.744  1.00  0.87           O  
ATOM   1653  CB  PRO A 216     -17.776  -3.339  10.853  1.00  0.87           C  
ATOM   1654  CG  PRO A 216     -18.023  -4.169  12.115  1.00  0.87           C  
ATOM   1655  CD  PRO A 216     -16.863  -5.162  12.094  1.00  0.87           C  
ATOM   1656  N   SER A 217     -15.317  -0.966  10.798  1.00  0.85           N  
ATOM   1657  CA  SER A 217     -14.587   0.150  11.366  1.00  0.85           C  
ATOM   1658  C   SER A 217     -15.422   1.403  11.528  1.00  0.85           C  
ATOM   1659  O   SER A 217     -16.432   1.625  10.859  1.00  0.85           O  
ATOM   1660  CB  SER A 217     -13.304   0.492  10.556  1.00  0.85           C  
ATOM   1661  OG  SER A 217     -13.584   0.705   9.171  1.00  0.85           O  
ATOM   1662  N   VAL A 218     -14.992   2.262  12.471  1.00  0.84           N  
ATOM   1663  CA  VAL A 218     -15.502   3.607  12.656  1.00  0.84           C  
ATOM   1664  C   VAL A 218     -14.318   4.546  12.545  1.00  0.84           C  
ATOM   1665  O   VAL A 218     -13.365   4.446  13.317  1.00  0.84           O  
ATOM   1666  CB  VAL A 218     -16.161   3.813  14.021  1.00  0.84           C  
ATOM   1667  CG1 VAL A 218     -16.721   5.244  14.138  1.00  0.84           C  
ATOM   1668  CG2 VAL A 218     -17.304   2.798  14.200  1.00  0.84           C  
ATOM   1669  N   GLU A 219     -14.337   5.497  11.593  1.00  0.77           N  
ATOM   1670  CA  GLU A 219     -13.309   6.517  11.500  1.00  0.77           C  
ATOM   1671  C   GLU A 219     -13.700   7.691  12.370  1.00  0.77           C  
ATOM   1672  O   GLU A 219     -14.832   8.175  12.321  1.00  0.77           O  
ATOM   1673  CB  GLU A 219     -13.083   7.063  10.074  1.00  0.77           C  
ATOM   1674  CG  GLU A 219     -12.453   6.067   9.077  1.00  0.77           C  
ATOM   1675  CD  GLU A 219     -12.004   6.776   7.804  1.00  0.77           C  
ATOM   1676  OE1 GLU A 219     -11.350   6.094   6.973  1.00  0.77           O  
ATOM   1677  OE2 GLU A 219     -12.241   8.005   7.668  1.00  0.77           O  
ATOM   1678  N   VAL A 220     -12.771   8.174  13.211  1.00  0.85           N  
ATOM   1679  CA  VAL A 220     -13.050   9.249  14.146  1.00  0.85           C  
ATOM   1680  C   VAL A 220     -12.085  10.398  13.960  1.00  0.85           C  
ATOM   1681  O   VAL A 220     -10.912  10.224  13.629  1.00  0.85           O  
ATOM   1682  CB  VAL A 220     -13.059   8.806  15.608  1.00  0.85           C  
ATOM   1683  CG1 VAL A 220     -14.221   7.814  15.807  1.00  0.85           C  
ATOM   1684  CG2 VAL A 220     -11.716   8.171  16.020  1.00  0.85           C  
ATOM   1685  N   ASP A 221     -12.558  11.644  14.178  1.00  0.86           N  
ATOM   1686  CA  ASP A 221     -11.735  12.836  14.129  1.00  0.86           C  
ATOM   1687  C   ASP A 221     -10.910  12.996  15.407  1.00  0.86           C  
ATOM   1688  O   ASP A 221     -11.054  13.935  16.187  1.00  0.86           O  
ATOM   1689  CB  ASP A 221     -12.591  14.088  13.793  1.00  0.86           C  
ATOM   1690  CG  ASP A 221     -11.764  15.070  12.986  1.00  0.86           C  
ATOM   1691  OD1 ASP A 221     -11.253  14.641  11.916  1.00  0.86           O  
ATOM   1692  OD2 ASP A 221     -11.609  16.241  13.413  1.00  0.86           O  
ATOM   1693  N   VAL A 222     -10.011  12.031  15.634  1.00  0.89           N  
ATOM   1694  CA  VAL A 222      -9.032  12.004  16.694  1.00  0.89           C  
ATOM   1695  C   VAL A 222      -7.728  11.879  15.947  1.00  0.89           C  
ATOM   1696  O   VAL A 222      -7.550  10.953  15.157  1.00  0.89           O  
ATOM   1697  CB  VAL A 222      -9.219  10.807  17.625  1.00  0.89           C  
ATOM   1698  CG1 VAL A 222      -8.107  10.757  18.689  1.00  0.89           C  
ATOM   1699  CG2 VAL A 222     -10.598  10.893  18.311  1.00  0.89           C  
ATOM   1700  N   VAL A 223      -6.808  12.838  16.126  1.00  0.85           N  
ATOM   1701  CA  VAL A 223      -5.637  12.969  15.284  1.00  0.85           C  
ATOM   1702  C   VAL A 223      -4.390  12.669  16.084  1.00  0.85           C  
ATOM   1703  O   VAL A 223      -4.145  13.222  17.156  1.00  0.85           O  
ATOM   1704  CB  VAL A 223      -5.533  14.359  14.658  1.00  0.85           C  
ATOM   1705  CG1 VAL A 223      -4.285  14.466  13.758  1.00  0.85           C  
ATOM   1706  CG2 VAL A 223      -6.799  14.636  13.821  1.00  0.85           C  
ATOM   1707  N   PHE A 224      -3.546  11.773  15.553  1.00  0.80           N  
ATOM   1708  CA  PHE A 224      -2.240  11.474  16.089  1.00  0.80           C  
ATOM   1709  C   PHE A 224      -1.218  12.019  15.117  1.00  0.80           C  
ATOM   1710  O   PHE A 224      -1.311  11.826  13.907  1.00  0.80           O  
ATOM   1711  CB  PHE A 224      -2.003   9.951  16.245  1.00  0.80           C  
ATOM   1712  CG  PHE A 224      -2.714   9.428  17.460  1.00  0.80           C  
ATOM   1713  CD1 PHE A 224      -1.999   9.204  18.648  1.00  0.80           C  
ATOM   1714  CD2 PHE A 224      -4.089   9.140  17.430  1.00  0.80           C  
ATOM   1715  CE1 PHE A 224      -2.642   8.699  19.783  1.00  0.80           C  
ATOM   1716  CE2 PHE A 224      -4.737   8.635  18.565  1.00  0.80           C  
ATOM   1717  CZ  PHE A 224      -4.011   8.408  19.742  1.00  0.80           C  
ATOM   1718  N   HIS A 225      -0.204  12.723  15.642  1.00  0.75           N  
ATOM   1719  CA  HIS A 225       0.909  13.207  14.858  1.00  0.75           C  
ATOM   1720  C   HIS A 225       2.044  12.216  14.993  1.00  0.75           C  
ATOM   1721  O   HIS A 225       2.614  12.045  16.070  1.00  0.75           O  
ATOM   1722  CB  HIS A 225       1.413  14.583  15.347  1.00  0.75           C  
ATOM   1723  CG  HIS A 225       0.429  15.689  15.128  1.00  0.75           C  
ATOM   1724  ND1 HIS A 225       0.026  15.967  13.840  1.00  0.75           N  
ATOM   1725  CD2 HIS A 225      -0.115  16.583  15.996  1.00  0.75           C  
ATOM   1726  CE1 HIS A 225      -0.754  17.022  13.941  1.00  0.75           C  
ATOM   1727  NE2 HIS A 225      -0.875  17.439  15.225  1.00  0.75           N  
ATOM   1728  N   HIS A 226       2.386  11.533  13.894  1.00  0.72           N  
ATOM   1729  CA  HIS A 226       3.453  10.562  13.821  1.00  0.72           C  
ATOM   1730  C   HIS A 226       4.759  11.264  13.535  1.00  0.72           C  
ATOM   1731  O   HIS A 226       4.915  11.921  12.507  1.00  0.72           O  
ATOM   1732  CB  HIS A 226       3.174   9.550  12.688  1.00  0.72           C  
ATOM   1733  CG  HIS A 226       4.190   8.472  12.610  1.00  0.72           C  
ATOM   1734  ND1 HIS A 226       4.334   7.723  13.744  1.00  0.72           N  
ATOM   1735  CD2 HIS A 226       5.093   8.098  11.667  1.00  0.72           C  
ATOM   1736  CE1 HIS A 226       5.321   6.893  13.492  1.00  0.72           C  
ATOM   1737  NE2 HIS A 226       5.821   7.078  12.245  1.00  0.72           N  
ATOM   1738  N   THR A 227       5.741  11.172  14.450  1.00  0.71           N  
ATOM   1739  CA  THR A 227       6.968  11.954  14.312  1.00  0.71           C  
ATOM   1740  C   THR A 227       7.961  11.359  13.339  1.00  0.71           C  
ATOM   1741  O   THR A 227       8.796  12.079  12.794  1.00  0.71           O  
ATOM   1742  CB  THR A 227       7.667  12.286  15.626  1.00  0.71           C  
ATOM   1743  OG1 THR A 227       8.058  11.139  16.358  1.00  0.71           O  
ATOM   1744  CG2 THR A 227       6.723  13.085  16.534  1.00  0.71           C  
ATOM   1745  N   GLY A 228       7.875  10.044  13.041  1.00  0.71           N  
ATOM   1746  CA  GLY A 228       8.688   9.410  12.010  1.00  0.71           C  
ATOM   1747  C   GLY A 228      10.111   9.220  12.448  1.00  0.71           C  
ATOM   1748  O   GLY A 228      11.047   9.431  11.677  1.00  0.71           O  
ATOM   1749  N   TYR A 229      10.306   8.849  13.725  1.00  0.61           N  
ATOM   1750  CA  TYR A 229      11.591   8.900  14.398  1.00  0.61           C  
ATOM   1751  C   TYR A 229      12.553   7.767  14.017  1.00  0.61           C  
ATOM   1752  O   TYR A 229      12.843   6.852  14.781  1.00  0.61           O  
ATOM   1753  CB  TYR A 229      11.405   9.047  15.937  1.00  0.61           C  
ATOM   1754  CG  TYR A 229      12.699   9.418  16.623  1.00  0.61           C  
ATOM   1755  CD1 TYR A 229      13.347   8.489  17.454  1.00  0.61           C  
ATOM   1756  CD2 TYR A 229      13.315  10.659  16.380  1.00  0.61           C  
ATOM   1757  CE1 TYR A 229      14.615   8.768  17.984  1.00  0.61           C  
ATOM   1758  CE2 TYR A 229      14.580  10.944  16.917  1.00  0.61           C  
ATOM   1759  CZ  TYR A 229      15.235   9.988  17.700  1.00  0.61           C  
ATOM   1760  OH  TYR A 229      16.538  10.234  18.168  1.00  0.61           O  
ATOM   1761  N   GLU A 230      13.124   7.841  12.803  1.00  0.55           N  
ATOM   1762  CA  GLU A 230      14.276   7.052  12.414  1.00  0.55           C  
ATOM   1763  C   GLU A 230      15.515   7.937  12.406  1.00  0.55           C  
ATOM   1764  O   GLU A 230      15.733   8.657  11.426  1.00  0.55           O  
ATOM   1765  CB  GLU A 230      14.111   6.494  10.983  1.00  0.55           C  
ATOM   1766  CG  GLU A 230      13.027   5.398  10.868  1.00  0.55           C  
ATOM   1767  CD  GLU A 230      12.808   4.963   9.430  1.00  0.55           C  
ATOM   1768  OE1 GLU A 230      11.990   4.029   9.223  1.00  0.55           O  
ATOM   1769  OE2 GLU A 230      13.440   5.544   8.515  1.00  0.55           O  
ATOM   1770  N   PRO A 231      16.375   7.937  13.416  1.00  0.57           N  
ATOM   1771  CA  PRO A 231      17.685   8.549  13.304  1.00  0.57           C  
ATOM   1772  C   PRO A 231      18.623   7.626  12.541  1.00  0.57           C  
ATOM   1773  O   PRO A 231      18.572   6.414  12.725  1.00  0.57           O  
ATOM   1774  CB  PRO A 231      18.102   8.743  14.770  1.00  0.57           C  
ATOM   1775  CG  PRO A 231      17.440   7.584  15.525  1.00  0.57           C  
ATOM   1776  CD  PRO A 231      16.152   7.329  14.733  1.00  0.57           C  
ATOM   1777  N   GLU A 232      19.477   8.195  11.671  1.00  0.50           N  
ATOM   1778  CA  GLU A 232      20.512   7.479  10.945  1.00  0.50           C  
ATOM   1779  C   GLU A 232      20.100   6.516   9.831  1.00  0.50           C  
ATOM   1780  O   GLU A 232      19.029   5.916   9.774  1.00  0.50           O  
ATOM   1781  CB  GLU A 232      21.550   6.767  11.842  1.00  0.50           C  
ATOM   1782  CG  GLU A 232      22.245   7.684  12.872  1.00  0.50           C  
ATOM   1783  CD  GLU A 232      23.387   6.955  13.577  1.00  0.50           C  
ATOM   1784  OE1 GLU A 232      23.962   7.568  14.511  1.00  0.50           O  
ATOM   1785  OE2 GLU A 232      23.699   5.804  13.174  1.00  0.50           O  
ATOM   1786  N   VAL A 233      21.031   6.344   8.870  1.00  0.37           N  
ATOM   1787  CA  VAL A 233      20.957   5.366   7.796  1.00  0.37           C  
ATOM   1788  C   VAL A 233      20.987   3.934   8.322  1.00  0.37           C  
ATOM   1789  O   VAL A 233      20.270   3.061   7.835  1.00  0.37           O  
ATOM   1790  CB  VAL A 233      22.087   5.590   6.788  1.00  0.37           C  
ATOM   1791  CG1 VAL A 233      22.024   4.570   5.631  1.00  0.37           C  
ATOM   1792  CG2 VAL A 233      21.977   7.020   6.220  1.00  0.37           C  
ATOM   1793  N   ILE A 234      21.815   3.664   9.354  1.00  0.41           N  
ATOM   1794  CA  ILE A 234      22.015   2.347   9.946  1.00  0.41           C  
ATOM   1795  C   ILE A 234      20.745   1.767  10.563  1.00  0.41           C  
ATOM   1796  O   ILE A 234      20.390   0.615  10.311  1.00  0.41           O  
ATOM   1797  CB  ILE A 234      23.149   2.400  10.973  1.00  0.41           C  
ATOM   1798  CG1 ILE A 234      24.470   2.857  10.299  1.00  0.41           C  
ATOM   1799  CG2 ILE A 234      23.334   1.024  11.658  1.00  0.41           C  
ATOM   1800  CD1 ILE A 234      25.573   3.208  11.305  1.00  0.41           C  
ATOM   1801  N   ALA A 235      19.985   2.567  11.343  1.00  0.44           N  
ATOM   1802  CA  ALA A 235      18.726   2.142  11.929  1.00  0.44           C  
ATOM   1803  C   ALA A 235      17.650   1.832  10.893  1.00  0.44           C  
ATOM   1804  O   ALA A 235      16.947   0.825  10.975  1.00  0.44           O  
ATOM   1805  CB  ALA A 235      18.214   3.226  12.892  1.00  0.44           C  
ATOM   1806  N   ARG A 236      17.534   2.684   9.853  1.00  0.42           N  
ATOM   1807  CA  ARG A 236      16.659   2.462   8.715  1.00  0.42           C  
ATOM   1808  C   ARG A 236      17.015   1.208   7.927  1.00  0.42           C  
ATOM   1809  O   ARG A 236      16.144   0.438   7.521  1.00  0.42           O  
ATOM   1810  CB  ARG A 236      16.692   3.690   7.774  1.00  0.42           C  
ATOM   1811  CG  ARG A 236      15.766   3.572   6.542  1.00  0.42           C  
ATOM   1812  CD  ARG A 236      15.747   4.826   5.661  1.00  0.42           C  
ATOM   1813  NE  ARG A 236      14.972   5.844   6.421  1.00  0.42           N  
ATOM   1814  CZ  ARG A 236      15.306   7.124   6.620  1.00  0.42           C  
ATOM   1815  NH1 ARG A 236      16.154   7.768   5.830  1.00  0.42           N  
ATOM   1816  NH2 ARG A 236      14.730   7.738   7.651  1.00  0.42           N  
ATOM   1817  N   LYS A 237      18.318   0.953   7.701  1.00  0.52           N  
ATOM   1818  CA  LYS A 237      18.790  -0.264   7.070  1.00  0.52           C  
ATOM   1819  C   LYS A 237      18.456  -1.524   7.863  1.00  0.52           C  
ATOM   1820  O   LYS A 237      17.869  -2.460   7.322  1.00  0.52           O  
ATOM   1821  CB  LYS A 237      20.319  -0.175   6.837  1.00  0.52           C  
ATOM   1822  CG  LYS A 237      20.891  -1.417   6.146  1.00  0.52           C  
ATOM   1823  CD  LYS A 237      22.403  -1.361   5.886  1.00  0.52           C  
ATOM   1824  CE  LYS A 237      22.898  -2.764   5.524  1.00  0.52           C  
ATOM   1825  NZ  LYS A 237      24.336  -2.784   5.199  1.00  0.52           N  
ATOM   1826  N   GLY A 238      18.732  -1.541   9.186  1.00  0.58           N  
ATOM   1827  CA  GLY A 238      18.430  -2.688  10.042  1.00  0.58           C  
ATOM   1828  C   GLY A 238      16.954  -2.955  10.212  1.00  0.58           C  
ATOM   1829  O   GLY A 238      16.514  -4.088  10.401  1.00  0.58           O  
ATOM   1830  N   LYS A 239      16.123  -1.901  10.115  1.00  0.58           N  
ATOM   1831  CA  LYS A 239      14.679  -2.007  10.032  1.00  0.58           C  
ATOM   1832  C   LYS A 239      14.207  -2.722   8.771  1.00  0.58           C  
ATOM   1833  O   LYS A 239      13.347  -3.599   8.842  1.00  0.58           O  
ATOM   1834  CB  LYS A 239      14.059  -0.595  10.129  1.00  0.58           C  
ATOM   1835  CG  LYS A 239      12.522  -0.522  10.143  1.00  0.58           C  
ATOM   1836  CD  LYS A 239      12.076   0.927  10.399  1.00  0.58           C  
ATOM   1837  CE  LYS A 239      10.566   1.175  10.306  1.00  0.58           C  
ATOM   1838  NZ  LYS A 239      10.291   2.607  10.536  1.00  0.58           N  
ATOM   1839  N   ARG A 240      14.794  -2.405   7.595  1.00  0.52           N  
ATOM   1840  CA  ARG A 240      14.544  -3.113   6.345  1.00  0.52           C  
ATOM   1841  C   ARG A 240      15.003  -4.566   6.376  1.00  0.52           C  
ATOM   1842  O   ARG A 240      14.267  -5.465   5.976  1.00  0.52           O  
ATOM   1843  CB  ARG A 240      15.256  -2.423   5.154  1.00  0.52           C  
ATOM   1844  CG  ARG A 240      14.722  -1.017   4.826  1.00  0.52           C  
ATOM   1845  CD  ARG A 240      15.571  -0.314   3.766  1.00  0.52           C  
ATOM   1846  NE  ARG A 240      14.974   1.043   3.561  1.00  0.52           N  
ATOM   1847  CZ  ARG A 240      15.338   1.874   2.576  1.00  0.52           C  
ATOM   1848  NH1 ARG A 240      16.320   1.572   1.735  1.00  0.52           N  
ATOM   1849  NH2 ARG A 240      14.678   3.018   2.405  1.00  0.52           N  
ATOM   1850  N   GLU A 241      16.218  -4.835   6.894  1.00  0.58           N  
ATOM   1851  CA  GLU A 241      16.774  -6.171   7.047  1.00  0.58           C  
ATOM   1852  C   GLU A 241      15.957  -7.041   8.006  1.00  0.58           C  
ATOM   1853  O   GLU A 241      15.704  -8.220   7.755  1.00  0.58           O  
ATOM   1854  CB  GLU A 241      18.276  -6.073   7.429  1.00  0.58           C  
ATOM   1855  CG  GLU A 241      19.120  -5.474   6.265  1.00  0.58           C  
ATOM   1856  CD  GLU A 241      20.580  -5.152   6.592  1.00  0.58           C  
ATOM   1857  OE1 GLU A 241      21.438  -5.372   5.692  1.00  0.58           O  
ATOM   1858  OE2 GLU A 241      20.854  -4.597   7.688  1.00  0.58           O  
ATOM   1859  N   ARG A 242      15.449  -6.465   9.117  1.00  0.51           N  
ATOM   1860  CA  ARG A 242      14.445  -7.107   9.954  1.00  0.51           C  
ATOM   1861  C   ARG A 242      13.119  -7.376   9.244  1.00  0.51           C  
ATOM   1862  O   ARG A 242      12.570  -8.470   9.343  1.00  0.51           O  
ATOM   1863  CB  ARG A 242      14.174  -6.241  11.213  1.00  0.51           C  
ATOM   1864  CG  ARG A 242      13.155  -6.841  12.210  1.00  0.51           C  
ATOM   1865  CD  ARG A 242      12.997  -6.054  13.520  1.00  0.51           C  
ATOM   1866  NE  ARG A 242      12.435  -4.711  13.156  1.00  0.51           N  
ATOM   1867  CZ  ARG A 242      12.419  -3.649  13.974  1.00  0.51           C  
ATOM   1868  NH1 ARG A 242      12.898  -3.706  15.213  1.00  0.51           N  
ATOM   1869  NH2 ARG A 242      11.906  -2.498  13.541  1.00  0.51           N  
ATOM   1870  N   TYR A 243      12.570  -6.398   8.493  1.00  0.57           N  
ATOM   1871  CA  TYR A 243      11.309  -6.548   7.776  1.00  0.57           C  
ATOM   1872  C   TYR A 243      11.366  -7.605   6.683  1.00  0.57           C  
ATOM   1873  O   TYR A 243      10.449  -8.412   6.552  1.00  0.57           O  
ATOM   1874  CB  TYR A 243      10.811  -5.203   7.174  1.00  0.57           C  
ATOM   1875  CG  TYR A 243      10.154  -4.265   8.169  1.00  0.57           C  
ATOM   1876  CD1 TYR A 243      10.294  -4.355   9.572  1.00  0.57           C  
ATOM   1877  CD2 TYR A 243       9.332  -3.250   7.647  1.00  0.57           C  
ATOM   1878  CE1 TYR A 243       9.642  -3.445  10.417  1.00  0.57           C  
ATOM   1879  CE2 TYR A 243       8.669  -2.348   8.491  1.00  0.57           C  
ATOM   1880  CZ  TYR A 243       8.836  -2.443   9.876  1.00  0.57           C  
ATOM   1881  OH  TYR A 243       8.170  -1.554  10.740  1.00  0.57           O  
ATOM   1882  N   ALA A 244      12.470  -7.667   5.910  1.00  0.71           N  
ATOM   1883  CA  ALA A 244      12.690  -8.694   4.909  1.00  0.71           C  
ATOM   1884  C   ALA A 244      12.685 -10.102   5.498  1.00  0.71           C  
ATOM   1885  O   ALA A 244      11.966 -10.977   5.022  1.00  0.71           O  
ATOM   1886  CB  ALA A 244      14.034  -8.429   4.201  1.00  0.71           C  
ATOM   1887  N   ARG A 245      13.398 -10.307   6.628  1.00  0.67           N  
ATOM   1888  CA  ARG A 245      13.403 -11.560   7.365  1.00  0.67           C  
ATOM   1889  C   ARG A 245      12.022 -11.964   7.874  1.00  0.67           C  
ATOM   1890  O   ARG A 245      11.622 -13.125   7.797  1.00  0.67           O  
ATOM   1891  CB  ARG A 245      14.369 -11.464   8.573  1.00  0.67           C  
ATOM   1892  CG  ARG A 245      14.519 -12.790   9.352  1.00  0.67           C  
ATOM   1893  CD  ARG A 245      15.445 -12.723  10.567  1.00  0.67           C  
ATOM   1894  NE  ARG A 245      14.773 -11.860  11.594  1.00  0.67           N  
ATOM   1895  CZ  ARG A 245      15.318 -10.806  12.206  1.00  0.67           C  
ATOM   1896  NH1 ARG A 245      16.439 -10.244  11.765  1.00  0.67           N  
ATOM   1897  NH2 ARG A 245      14.725 -10.301  13.283  1.00  0.67           N  
ATOM   1898  N   LEU A 246      11.223 -11.003   8.386  1.00  0.71           N  
ATOM   1899  CA  LEU A 246       9.843 -11.251   8.769  1.00  0.71           C  
ATOM   1900  C   LEU A 246       8.972 -11.702   7.603  1.00  0.71           C  
ATOM   1901  O   LEU A 246       8.217 -12.662   7.728  1.00  0.71           O  
ATOM   1902  CB  LEU A 246       9.195  -9.998   9.413  1.00  0.71           C  
ATOM   1903  CG  LEU A 246       9.784  -9.607  10.782  1.00  0.71           C  
ATOM   1904  CD1 LEU A 246       9.261  -8.237  11.233  1.00  0.71           C  
ATOM   1905  CD2 LEU A 246       9.475 -10.652  11.856  1.00  0.71           C  
ATOM   1906  N   VAL A 247       9.084 -11.059   6.424  1.00  0.74           N  
ATOM   1907  CA  VAL A 247       8.388 -11.482   5.215  1.00  0.74           C  
ATOM   1908  C   VAL A 247       8.826 -12.858   4.711  1.00  0.74           C  
ATOM   1909  O   VAL A 247       7.987 -13.695   4.382  1.00  0.74           O  
ATOM   1910  CB  VAL A 247       8.500 -10.441   4.109  1.00  0.74           C  
ATOM   1911  CG1 VAL A 247       7.799 -10.930   2.831  1.00  0.74           C  
ATOM   1912  CG2 VAL A 247       7.827  -9.131   4.564  1.00  0.74           C  
ATOM   1913  N   GLU A 248      10.140 -13.165   4.687  1.00  0.73           N  
ATOM   1914  CA  GLU A 248      10.674 -14.483   4.351  1.00  0.73           C  
ATOM   1915  C   GLU A 248      10.199 -15.581   5.297  1.00  0.73           C  
ATOM   1916  O   GLU A 248       9.822 -16.688   4.897  1.00  0.73           O  
ATOM   1917  CB  GLU A 248      12.216 -14.454   4.397  1.00  0.73           C  
ATOM   1918  CG  GLU A 248      12.859 -13.643   3.247  1.00  0.73           C  
ATOM   1919  CD  GLU A 248      14.366 -13.466   3.430  1.00  0.73           C  
ATOM   1920  OE1 GLU A 248      14.995 -12.970   2.460  1.00  0.73           O  
ATOM   1921  OE2 GLU A 248      14.892 -13.809   4.521  1.00  0.73           O  
ATOM   1922  N   ARG A 249      10.163 -15.275   6.606  1.00  0.71           N  
ATOM   1923  CA  ARG A 249       9.580 -16.138   7.607  1.00  0.71           C  
ATOM   1924  C   ARG A 249       8.084 -16.366   7.409  1.00  0.71           C  
ATOM   1925  O   ARG A 249       7.616 -17.501   7.433  1.00  0.71           O  
ATOM   1926  CB  ARG A 249       9.855 -15.560   9.012  1.00  0.71           C  
ATOM   1927  CG  ARG A 249       9.364 -16.483  10.134  1.00  0.71           C  
ATOM   1928  CD  ARG A 249       9.771 -16.040  11.535  1.00  0.71           C  
ATOM   1929  NE  ARG A 249       9.138 -17.062  12.409  1.00  0.71           N  
ATOM   1930  CZ  ARG A 249       9.153 -17.086  13.744  1.00  0.71           C  
ATOM   1931  NH1 ARG A 249       9.832 -16.203  14.463  1.00  0.71           N  
ATOM   1932  NH2 ARG A 249       8.425 -18.035  14.323  1.00  0.71           N  
ATOM   1933  N   CYS A 250       7.299 -15.304   7.134  1.00  0.73           N  
ATOM   1934  CA  CYS A 250       5.884 -15.412   6.807  1.00  0.73           C  
ATOM   1935  C   CYS A 250       5.605 -16.210   5.542  1.00  0.73           C  
ATOM   1936  O   CYS A 250       4.665 -16.995   5.498  1.00  0.73           O  
ATOM   1937  CB  CYS A 250       5.212 -14.034   6.633  1.00  0.73           C  
ATOM   1938  SG  CYS A 250       5.074 -13.070   8.165  1.00  0.73           S  
ATOM   1939  N   LEU A 251       6.428 -16.062   4.484  1.00  0.72           N  
ATOM   1940  CA  LEU A 251       6.363 -16.899   3.296  1.00  0.72           C  
ATOM   1941  C   LEU A 251       6.606 -18.373   3.583  1.00  0.72           C  
ATOM   1942  O   LEU A 251       5.947 -19.236   3.018  1.00  0.72           O  
ATOM   1943  CB  LEU A 251       7.395 -16.444   2.236  1.00  0.72           C  
ATOM   1944  CG  LEU A 251       7.013 -15.157   1.484  1.00  0.72           C  
ATOM   1945  CD1 LEU A 251       8.222 -14.638   0.697  1.00  0.72           C  
ATOM   1946  CD2 LEU A 251       5.831 -15.394   0.535  1.00  0.72           C  
ATOM   1947  N   THR A 252       7.559 -18.708   4.476  1.00  0.73           N  
ATOM   1948  CA  THR A 252       7.739 -20.086   4.948  1.00  0.73           C  
ATOM   1949  C   THR A 252       6.536 -20.598   5.746  1.00  0.73           C  
ATOM   1950  O   THR A 252       6.058 -21.708   5.528  1.00  0.73           O  
ATOM   1951  CB  THR A 252       9.001 -20.261   5.816  1.00  0.73           C  
ATOM   1952  OG1 THR A 252      10.180 -19.793   5.165  1.00  0.73           O  
ATOM   1953  CG2 THR A 252       9.175 -21.750   6.209  1.00  0.73           C  
ATOM   1954  N   GLU A 253       6.007 -19.797   6.696  1.00  0.69           N  
ATOM   1955  CA  GLU A 253       4.886 -20.173   7.550  1.00  0.69           C  
ATOM   1956  C   GLU A 253       3.508 -20.223   6.862  1.00  0.69           C  
ATOM   1957  O   GLU A 253       2.744 -21.164   7.071  1.00  0.69           O  
ATOM   1958  CB  GLU A 253       4.878 -19.302   8.840  1.00  0.69           C  
ATOM   1959  CG  GLU A 253       6.137 -19.530   9.737  1.00  0.69           C  
ATOM   1960  CD  GLU A 253       6.173 -18.693  11.009  1.00  0.69           C  
ATOM   1961  OE1 GLU A 253       7.181 -18.764  11.769  1.00  0.69           O  
ATOM   1962  OE2 GLU A 253       5.214 -17.923  11.273  1.00  0.69           O  
ATOM   1963  N   GLU A 254       3.157 -19.245   5.995  1.00  0.61           N  
ATOM   1964  CA  GLU A 254       1.906 -19.218   5.239  1.00  0.61           C  
ATOM   1965  C   GLU A 254       2.164 -19.120   3.720  1.00  0.61           C  
ATOM   1966  O   GLU A 254       1.884 -18.073   3.128  1.00  0.61           O  
ATOM   1967  CB  GLU A 254       0.987 -18.024   5.658  1.00  0.61           C  
ATOM   1968  CG  GLU A 254       0.424 -18.065   7.113  1.00  0.61           C  
ATOM   1969  CD  GLU A 254      -0.544 -16.932   7.423  1.00  0.61           C  
ATOM   1970  OE1 GLU A 254      -1.500 -17.108   8.229  1.00  0.61           O  
ATOM   1971  OE2 GLU A 254      -0.352 -15.824   6.859  1.00  0.61           O  
ATOM   1972  N   PRO A 255       2.661 -20.135   3.000  1.00  0.71           N  
ATOM   1973  CA  PRO A 255       3.222 -19.964   1.652  1.00  0.71           C  
ATOM   1974  C   PRO A 255       2.191 -19.704   0.574  1.00  0.71           C  
ATOM   1975  O   PRO A 255       2.538 -19.164  -0.478  1.00  0.71           O  
ATOM   1976  CB  PRO A 255       3.963 -21.292   1.390  1.00  0.71           C  
ATOM   1977  CG  PRO A 255       3.289 -22.302   2.323  1.00  0.71           C  
ATOM   1978  CD  PRO A 255       2.981 -21.451   3.552  1.00  0.71           C  
ATOM   1979  N   SER A 256       0.926 -20.093   0.796  1.00  0.63           N  
ATOM   1980  CA  SER A 256      -0.163 -19.920  -0.149  1.00  0.63           C  
ATOM   1981  C   SER A 256      -0.933 -18.646   0.122  1.00  0.63           C  
ATOM   1982  O   SER A 256      -1.918 -18.357  -0.548  1.00  0.63           O  
ATOM   1983  CB  SER A 256      -1.171 -21.099  -0.073  1.00  0.63           C  
ATOM   1984  OG  SER A 256      -1.532 -21.377   1.284  1.00  0.63           O  
ATOM   1985  N   ASN A 257      -0.490 -17.816   1.088  1.00  0.57           N  
ATOM   1986  CA  ASN A 257      -1.121 -16.544   1.367  1.00  0.57           C  
ATOM   1987  C   ASN A 257      -0.526 -15.465   0.439  1.00  0.57           C  
ATOM   1988  O   ASN A 257       0.662 -15.141   0.559  1.00  0.57           O  
ATOM   1989  CB  ASN A 257      -0.932 -16.204   2.871  1.00  0.57           C  
ATOM   1990  CG  ASN A 257      -1.672 -14.942   3.290  1.00  0.57           C  
ATOM   1991  OD1 ASN A 257      -2.236 -14.216   2.469  1.00  0.57           O  
ATOM   1992  ND2 ASN A 257      -1.663 -14.639   4.605  1.00  0.57           N  
ATOM   1993  N   PRO A 258      -1.270 -14.855  -0.488  1.00  0.61           N  
ATOM   1994  CA  PRO A 258      -0.717 -13.887  -1.430  1.00  0.61           C  
ATOM   1995  C   PRO A 258      -0.428 -12.540  -0.784  1.00  0.61           C  
ATOM   1996  O   PRO A 258       0.239 -11.718  -1.417  1.00  0.61           O  
ATOM   1997  CB  PRO A 258      -1.790 -13.799  -2.520  1.00  0.61           C  
ATOM   1998  CG  PRO A 258      -3.096 -14.111  -1.788  1.00  0.61           C  
ATOM   1999  CD  PRO A 258      -2.675 -15.165  -0.775  1.00  0.61           C  
ATOM   2000  N   LYS A 259      -0.858 -12.297   0.477  1.00  0.55           N  
ATOM   2001  CA  LYS A 259      -0.513 -11.108   1.247  1.00  0.55           C  
ATOM   2002  C   LYS A 259       1.001 -10.963   1.409  1.00  0.55           C  
ATOM   2003  O   LYS A 259       1.577  -9.896   1.203  1.00  0.55           O  
ATOM   2004  CB  LYS A 259      -1.210 -11.161   2.647  1.00  0.55           C  
ATOM   2005  CG  LYS A 259      -0.842 -10.024   3.620  1.00  0.55           C  
ATOM   2006  CD  LYS A 259      -1.639  -9.997   4.947  1.00  0.55           C  
ATOM   2007  CE  LYS A 259      -1.070  -8.954   5.932  1.00  0.55           C  
ATOM   2008  NZ  LYS A 259      -1.912  -8.708   7.118  1.00  0.55           N  
ATOM   2009  N   TRP A 260       1.701 -12.067   1.733  1.00  0.65           N  
ATOM   2010  CA  TRP A 260       3.145 -12.085   1.900  1.00  0.65           C  
ATOM   2011  C   TRP A 260       3.945 -11.944   0.623  1.00  0.65           C  
ATOM   2012  O   TRP A 260       4.974 -11.275   0.598  1.00  0.65           O  
ATOM   2013  CB  TRP A 260       3.599 -13.335   2.678  1.00  0.65           C  
ATOM   2014  CG  TRP A 260       2.868 -13.482   3.993  1.00  0.65           C  
ATOM   2015  CD1 TRP A 260       2.111 -14.535   4.417  1.00  0.65           C  
ATOM   2016  CD2 TRP A 260       2.792 -12.477   5.022  1.00  0.65           C  
ATOM   2017  NE1 TRP A 260       1.523 -14.238   5.625  1.00  0.65           N  
ATOM   2018  CE2 TRP A 260       1.933 -12.990   6.022  1.00  0.65           C  
ATOM   2019  CE3 TRP A 260       3.394 -11.225   5.166  1.00  0.65           C  
ATOM   2020  CZ2 TRP A 260       1.666 -12.258   7.165  1.00  0.65           C  
ATOM   2021  CZ3 TRP A 260       3.097 -10.479   6.315  1.00  0.65           C  
ATOM   2022  CH2 TRP A 260       2.242 -10.991   7.302  1.00  0.65           C  
ATOM   2023  N   HIS A 261       3.489 -12.545  -0.493  1.00  0.64           N  
ATOM   2024  CA  HIS A 261       4.128 -12.375  -1.792  1.00  0.64           C  
ATOM   2025  C   HIS A 261       4.104 -10.936  -2.287  1.00  0.64           C  
ATOM   2026  O   HIS A 261       5.086 -10.452  -2.845  1.00  0.64           O  
ATOM   2027  CB  HIS A 261       3.520 -13.294  -2.862  1.00  0.64           C  
ATOM   2028  CG  HIS A 261       3.791 -14.741  -2.591  1.00  0.64           C  
ATOM   2029  ND1 HIS A 261       5.047 -15.275  -2.855  1.00  0.64           N  
ATOM   2030  CD2 HIS A 261       2.959 -15.696  -2.098  1.00  0.64           C  
ATOM   2031  CE1 HIS A 261       4.934 -16.554  -2.521  1.00  0.64           C  
ATOM   2032  NE2 HIS A 261       3.697 -16.856  -2.054  1.00  0.64           N  
ATOM   2033  N   PHE A 262       2.997 -10.201  -2.040  1.00  0.59           N  
ATOM   2034  CA  PHE A 262       2.924  -8.765  -2.260  1.00  0.59           C  
ATOM   2035  C   PHE A 262       3.973  -7.985  -1.458  1.00  0.59           C  
ATOM   2036  O   PHE A 262       4.709  -7.171  -2.014  1.00  0.59           O  
ATOM   2037  CB  PHE A 262       1.475  -8.290  -1.919  1.00  0.59           C  
ATOM   2038  CG  PHE A 262       1.345  -6.791  -1.814  1.00  0.59           C  
ATOM   2039  CD1 PHE A 262       1.360  -6.170  -0.552  1.00  0.59           C  
ATOM   2040  CD2 PHE A 262       1.313  -5.994  -2.964  1.00  0.59           C  
ATOM   2041  CE1 PHE A 262       1.326  -4.774  -0.444  1.00  0.59           C  
ATOM   2042  CE2 PHE A 262       1.259  -4.600  -2.854  1.00  0.59           C  
ATOM   2043  CZ  PHE A 262       1.265  -3.989  -1.598  1.00  0.59           C  
ATOM   2044  N   TYR A 263       4.102  -8.243  -0.140  1.00  0.62           N  
ATOM   2045  CA  TYR A 263       5.097  -7.587   0.697  1.00  0.62           C  
ATOM   2046  C   TYR A 263       6.524  -7.934   0.325  1.00  0.62           C  
ATOM   2047  O   TYR A 263       7.405  -7.084   0.360  1.00  0.62           O  
ATOM   2048  CB  TYR A 263       4.880  -7.858   2.204  1.00  0.62           C  
ATOM   2049  CG  TYR A 263       3.620  -7.193   2.681  1.00  0.62           C  
ATOM   2050  CD1 TYR A 263       3.431  -5.808   2.525  1.00  0.62           C  
ATOM   2051  CD2 TYR A 263       2.629  -7.937   3.333  1.00  0.62           C  
ATOM   2052  CE1 TYR A 263       2.268  -5.189   3.004  1.00  0.62           C  
ATOM   2053  CE2 TYR A 263       1.471  -7.311   3.808  1.00  0.62           C  
ATOM   2054  CZ  TYR A 263       1.284  -5.937   3.648  1.00  0.62           C  
ATOM   2055  OH  TYR A 263       0.141  -5.268   4.142  1.00  0.62           O  
ATOM   2056  N   ALA A 264       6.791  -9.185  -0.092  1.00  0.67           N  
ATOM   2057  CA  ALA A 264       8.098  -9.612  -0.550  1.00  0.67           C  
ATOM   2058  C   ALA A 264       8.603  -8.832  -1.750  1.00  0.67           C  
ATOM   2059  O   ALA A 264       9.777  -8.481  -1.840  1.00  0.67           O  
ATOM   2060  CB  ALA A 264       8.044 -11.111  -0.894  1.00  0.67           C  
ATOM   2061  N   VAL A 265       7.707  -8.528  -2.705  1.00  0.66           N  
ATOM   2062  CA  VAL A 265       8.023  -7.608  -3.777  1.00  0.66           C  
ATOM   2063  C   VAL A 265       8.060  -6.148  -3.317  1.00  0.66           C  
ATOM   2064  O   VAL A 265       9.011  -5.433  -3.614  1.00  0.66           O  
ATOM   2065  CB  VAL A 265       7.081  -7.798  -4.955  1.00  0.66           C  
ATOM   2066  CG1 VAL A 265       7.518  -6.886  -6.110  1.00  0.66           C  
ATOM   2067  CG2 VAL A 265       7.140  -9.268  -5.424  1.00  0.66           C  
ATOM   2068  N   ARG A 266       7.057  -5.662  -2.546  1.00  0.59           N  
ATOM   2069  CA  ARG A 266       6.978  -4.259  -2.144  1.00  0.59           C  
ATOM   2070  C   ARG A 266       8.109  -3.789  -1.242  1.00  0.59           C  
ATOM   2071  O   ARG A 266       8.738  -2.759  -1.480  1.00  0.59           O  
ATOM   2072  CB  ARG A 266       5.652  -3.955  -1.386  1.00  0.59           C  
ATOM   2073  CG  ARG A 266       5.355  -2.440  -1.260  1.00  0.59           C  
ATOM   2074  CD  ARG A 266       4.254  -2.057  -0.262  1.00  0.59           C  
ATOM   2075  NE  ARG A 266       4.804  -2.317   1.102  1.00  0.59           N  
ATOM   2076  CZ  ARG A 266       4.141  -2.211   2.257  1.00  0.59           C  
ATOM   2077  NH1 ARG A 266       2.939  -1.660   2.344  1.00  0.59           N  
ATOM   2078  NH2 ARG A 266       4.723  -2.710   3.342  1.00  0.59           N  
ATOM   2079  N   ASP A 267       8.421  -4.557  -0.183  1.00  0.65           N  
ATOM   2080  CA  ASP A 267       9.307  -4.117   0.875  1.00  0.65           C  
ATOM   2081  C   ASP A 267      10.762  -4.267   0.437  1.00  0.65           C  
ATOM   2082  O   ASP A 267      11.669  -3.617   0.956  1.00  0.65           O  
ATOM   2083  CB  ASP A 267       8.971  -4.845   2.210  1.00  0.65           C  
ATOM   2084  CG  ASP A 267       7.595  -4.451   2.731  1.00  0.65           C  
ATOM   2085  OD1 ASP A 267       6.902  -3.612   2.097  1.00  0.65           O  
ATOM   2086  OD2 ASP A 267       7.181  -4.954   3.806  1.00  0.65           O  
ATOM   2087  N   GLY A 268      10.996  -5.058  -0.635  1.00  0.65           N  
ATOM   2088  CA  GLY A 268      12.279  -5.148  -1.321  1.00  0.65           C  
ATOM   2089  C   GLY A 268      12.560  -4.008  -2.275  1.00  0.65           C  
ATOM   2090  O   GLY A 268      13.663  -3.902  -2.812  1.00  0.65           O  
ATOM   2091  N   LEU A 269      11.580  -3.113  -2.510  1.00  0.56           N  
ATOM   2092  CA  LEU A 269      11.734  -1.948  -3.367  1.00  0.56           C  
ATOM   2093  C   LEU A 269      11.775  -0.647  -2.588  1.00  0.56           C  
ATOM   2094  O   LEU A 269      11.975   0.420  -3.164  1.00  0.56           O  
ATOM   2095  CB  LEU A 269      10.538  -1.831  -4.338  1.00  0.56           C  
ATOM   2096  CG  LEU A 269      10.433  -2.975  -5.356  1.00  0.56           C  
ATOM   2097  CD1 LEU A 269       9.107  -2.852  -6.113  1.00  0.56           C  
ATOM   2098  CD2 LEU A 269      11.618  -2.996  -6.329  1.00  0.56           C  
ATOM   2099  N   VAL A 270      11.604  -0.677  -1.252  1.00  0.48           N  
ATOM   2100  CA  VAL A 270      11.509   0.533  -0.443  1.00  0.48           C  
ATOM   2101  C   VAL A 270      12.764   1.402  -0.495  1.00  0.48           C  
ATOM   2102  O   VAL A 270      13.820   1.085   0.051  1.00  0.48           O  
ATOM   2103  CB  VAL A 270      11.085   0.228   0.993  1.00  0.48           C  
ATOM   2104  CG1 VAL A 270      11.134   1.477   1.899  1.00  0.48           C  
ATOM   2105  CG2 VAL A 270       9.639  -0.301   0.957  1.00  0.48           C  
ATOM   2106  N   GLY A 271      12.664   2.564  -1.178  1.00  0.35           N  
ATOM   2107  CA  GLY A 271      13.774   3.489  -1.355  1.00  0.35           C  
ATOM   2108  C   GLY A 271      14.672   3.195  -2.526  1.00  0.35           C  
ATOM   2109  O   GLY A 271      15.834   3.588  -2.511  1.00  0.35           O  
ATOM   2110  N   ARG A 272      14.170   2.507  -3.565  1.00  0.32           N  
ATOM   2111  CA  ARG A 272      14.903   2.304  -4.797  1.00  0.32           C  
ATOM   2112  C   ARG A 272      13.915   2.094  -5.931  1.00  0.32           C  
ATOM   2113  O   ARG A 272      12.704   2.079  -5.727  1.00  0.32           O  
ATOM   2114  CB  ARG A 272      15.896   1.112  -4.715  1.00  0.32           C  
ATOM   2115  CG  ARG A 272      15.233  -0.276  -4.618  1.00  0.32           C  
ATOM   2116  CD  ARG A 272      16.245  -1.409  -4.467  1.00  0.32           C  
ATOM   2117  NE  ARG A 272      15.475  -2.686  -4.553  1.00  0.32           N  
ATOM   2118  CZ  ARG A 272      15.457  -3.507  -5.611  1.00  0.32           C  
ATOM   2119  NH1 ARG A 272      16.028  -3.217  -6.774  1.00  0.32           N  
ATOM   2120  NH2 ARG A 272      14.829  -4.668  -5.488  1.00  0.32           N  
ATOM   2121  N   LYS A 273      14.403   1.949  -7.178  1.00  0.38           N  
ATOM   2122  CA  LYS A 273      13.587   1.522  -8.297  1.00  0.38           C  
ATOM   2123  C   LYS A 273      14.249   0.284  -8.893  1.00  0.38           C  
ATOM   2124  O   LYS A 273      15.479   0.201  -8.849  1.00  0.38           O  
ATOM   2125  CB  LYS A 273      13.420   2.642  -9.357  1.00  0.38           C  
ATOM   2126  CG  LYS A 273      12.531   3.787  -8.840  1.00  0.38           C  
ATOM   2127  CD  LYS A 273      12.214   4.849  -9.906  1.00  0.38           C  
ATOM   2128  CE  LYS A 273      11.196   5.885  -9.412  1.00  0.38           C  
ATOM   2129  NZ  LYS A 273      10.835   6.830 -10.495  1.00  0.38           N  
ATOM   2130  N   PRO A 274      13.526  -0.715  -9.395  1.00  0.47           N  
ATOM   2131  CA  PRO A 274      14.125  -1.871 -10.046  1.00  0.47           C  
ATOM   2132  C   PRO A 274      14.520  -1.560 -11.480  1.00  0.47           C  
ATOM   2133  O   PRO A 274      13.900  -0.714 -12.126  1.00  0.47           O  
ATOM   2134  CB  PRO A 274      12.991  -2.906  -9.993  1.00  0.47           C  
ATOM   2135  CG  PRO A 274      11.710  -2.078 -10.138  1.00  0.47           C  
ATOM   2136  CD  PRO A 274      12.060  -0.746  -9.463  1.00  0.47           C  
ATOM   2137  N   GLY A 275      15.574  -2.220 -12.008  1.00  0.53           N  
ATOM   2138  CA  GLY A 275      15.885  -2.153 -13.438  1.00  0.53           C  
ATOM   2139  C   GLY A 275      14.928  -2.983 -14.274  1.00  0.53           C  
ATOM   2140  O   GLY A 275      14.192  -3.786 -13.701  1.00  0.53           O  
ATOM   2141  N   PRO A 276      14.909  -2.883 -15.605  1.00  0.50           N  
ATOM   2142  CA  PRO A 276      13.955  -3.594 -16.455  1.00  0.50           C  
ATOM   2143  C   PRO A 276      13.839  -5.094 -16.246  1.00  0.50           C  
ATOM   2144  O   PRO A 276      12.741  -5.601 -16.029  1.00  0.50           O  
ATOM   2145  CB  PRO A 276      14.401  -3.243 -17.881  1.00  0.50           C  
ATOM   2146  CG  PRO A 276      14.956  -1.826 -17.735  1.00  0.50           C  
ATOM   2147  CD  PRO A 276      15.639  -1.862 -16.362  1.00  0.50           C  
ATOM   2148  N   ASP A 277      14.963  -5.818 -16.281  1.00  0.55           N  
ATOM   2149  CA  ASP A 277      15.069  -7.251 -16.118  1.00  0.55           C  
ATOM   2150  C   ASP A 277      14.595  -7.721 -14.746  1.00  0.55           C  
ATOM   2151  O   ASP A 277      13.870  -8.707 -14.599  1.00  0.55           O  
ATOM   2152  CB  ASP A 277      16.546  -7.668 -16.349  1.00  0.55           C  
ATOM   2153  CG  ASP A 277      17.114  -6.964 -17.573  1.00  0.55           C  
ATOM   2154  OD1 ASP A 277      17.256  -7.631 -18.623  1.00  0.55           O  
ATOM   2155  OD2 ASP A 277      17.387  -5.737 -17.453  1.00  0.55           O  
ATOM   2156  N   GLU A 278      14.966  -6.968 -13.690  1.00  0.51           N  
ATOM   2157  CA  GLU A 278      14.490  -7.195 -12.339  1.00  0.51           C  
ATOM   2158  C   GLU A 278      12.990  -6.968 -12.204  1.00  0.51           C  
ATOM   2159  O   GLU A 278      12.257  -7.785 -11.651  1.00  0.51           O  
ATOM   2160  CB  GLU A 278      15.216  -6.266 -11.339  1.00  0.51           C  
ATOM   2161  CG  GLU A 278      14.894  -6.639  -9.873  1.00  0.51           C  
ATOM   2162  CD  GLU A 278      15.409  -5.661  -8.836  1.00  0.51           C  
ATOM   2163  OE1 GLU A 278      15.296  -6.015  -7.635  1.00  0.51           O  
ATOM   2164  OE2 GLU A 278      15.873  -4.538  -9.159  1.00  0.51           O  
ATOM   2165  N   ALA A 279      12.483  -5.860 -12.774  1.00  0.51           N  
ATOM   2166  CA  ALA A 279      11.083  -5.504 -12.781  1.00  0.51           C  
ATOM   2167  C   ALA A 279      10.211  -6.535 -13.492  1.00  0.51           C  
ATOM   2168  O   ALA A 279       9.136  -6.897 -13.016  1.00  0.51           O  
ATOM   2169  CB  ALA A 279      10.944  -4.120 -13.432  1.00  0.51           C  
ATOM   2170  N   LEU A 280      10.704  -7.078 -14.624  1.00  0.48           N  
ATOM   2171  CA  LEU A 280      10.130  -8.206 -15.334  1.00  0.48           C  
ATOM   2172  C   LEU A 280      10.041  -9.475 -14.494  1.00  0.48           C  
ATOM   2173  O   LEU A 280       8.998 -10.128 -14.425  1.00  0.48           O  
ATOM   2174  CB  LEU A 280      10.992  -8.457 -16.597  1.00  0.48           C  
ATOM   2175  CG  LEU A 280      10.637  -9.696 -17.443  1.00  0.48           C  
ATOM   2176  CD1 LEU A 280       9.205  -9.637 -17.975  1.00  0.48           C  
ATOM   2177  CD2 LEU A 280      11.621  -9.833 -18.613  1.00  0.48           C  
ATOM   2178  N   ALA A 281      11.122  -9.840 -13.775  1.00  0.61           N  
ATOM   2179  CA  ALA A 281      11.130 -10.964 -12.860  1.00  0.61           C  
ATOM   2180  C   ALA A 281      10.160 -10.809 -11.687  1.00  0.61           C  
ATOM   2181  O   ALA A 281       9.404 -11.722 -11.349  1.00  0.61           O  
ATOM   2182  CB  ALA A 281      12.566 -11.159 -12.338  1.00  0.61           C  
ATOM   2183  N   LEU A 282      10.128  -9.613 -11.068  1.00  0.61           N  
ATOM   2184  CA  LEU A 282       9.192  -9.268 -10.016  1.00  0.61           C  
ATOM   2185  C   LEU A 282       7.736  -9.261 -10.468  1.00  0.61           C  
ATOM   2186  O   LEU A 282       6.873  -9.793  -9.770  1.00  0.61           O  
ATOM   2187  CB  LEU A 282       9.553  -7.899  -9.395  1.00  0.61           C  
ATOM   2188  CG  LEU A 282      10.896  -7.862  -8.634  1.00  0.61           C  
ATOM   2189  CD1 LEU A 282      11.247  -6.419  -8.242  1.00  0.61           C  
ATOM   2190  CD2 LEU A 282      10.906  -8.763  -7.389  1.00  0.61           C  
ATOM   2191  N   PHE A 283       7.417  -8.703 -11.661  1.00  0.44           N  
ATOM   2192  CA  PHE A 283       6.077  -8.747 -12.232  1.00  0.44           C  
ATOM   2193  C   PHE A 283       5.602 -10.171 -12.483  1.00  0.44           C  
ATOM   2194  O   PHE A 283       4.492 -10.520 -12.094  1.00  0.44           O  
ATOM   2195  CB  PHE A 283       6.002  -7.920 -13.553  1.00  0.44           C  
ATOM   2196  CG  PHE A 283       4.668  -8.050 -14.268  1.00  0.44           C  
ATOM   2197  CD1 PHE A 283       4.533  -8.938 -15.352  1.00  0.44           C  
ATOM   2198  CD2 PHE A 283       3.536  -7.349 -13.826  1.00  0.44           C  
ATOM   2199  CE1 PHE A 283       3.291  -9.133 -15.970  1.00  0.44           C  
ATOM   2200  CE2 PHE A 283       2.295  -7.523 -14.457  1.00  0.44           C  
ATOM   2201  CZ  PHE A 283       2.170  -8.422 -15.524  1.00  0.44           C  
ATOM   2202  N   ARG A 284       6.432 -11.044 -13.092  1.00  0.55           N  
ATOM   2203  CA  ARG A 284       6.043 -12.423 -13.345  1.00  0.55           C  
ATOM   2204  C   ARG A 284       5.741 -13.192 -12.061  1.00  0.55           C  
ATOM   2205  O   ARG A 284       4.705 -13.843 -11.956  1.00  0.55           O  
ATOM   2206  CB  ARG A 284       7.135 -13.176 -14.142  1.00  0.55           C  
ATOM   2207  CG  ARG A 284       7.277 -12.754 -15.623  1.00  0.55           C  
ATOM   2208  CD  ARG A 284       8.459 -13.473 -16.285  1.00  0.55           C  
ATOM   2209  NE  ARG A 284       8.529 -13.121 -17.739  1.00  0.55           N  
ATOM   2210  CZ  ARG A 284       9.554 -13.419 -18.546  1.00  0.55           C  
ATOM   2211  NH1 ARG A 284      10.631 -14.060 -18.104  1.00  0.55           N  
ATOM   2212  NH2 ARG A 284       9.505 -13.042 -19.818  1.00  0.55           N  
ATOM   2213  N   ARG A 285       6.601 -13.055 -11.028  1.00  0.62           N  
ATOM   2214  CA  ARG A 285       6.378 -13.638  -9.714  1.00  0.62           C  
ATOM   2215  C   ARG A 285       5.120 -13.118  -9.026  1.00  0.62           C  
ATOM   2216  O   ARG A 285       4.333 -13.869  -8.454  1.00  0.62           O  
ATOM   2217  CB  ARG A 285       7.596 -13.316  -8.804  1.00  0.62           C  
ATOM   2218  CG  ARG A 285       7.454 -13.829  -7.354  1.00  0.62           C  
ATOM   2219  CD  ARG A 285       8.603 -13.433  -6.427  1.00  0.62           C  
ATOM   2220  NE  ARG A 285       8.179 -13.891  -5.064  1.00  0.62           N  
ATOM   2221  CZ  ARG A 285       8.881 -13.719  -3.937  1.00  0.62           C  
ATOM   2222  NH1 ARG A 285      10.064 -13.111  -3.940  1.00  0.62           N  
ATOM   2223  NH2 ARG A 285       8.375 -14.172  -2.792  1.00  0.62           N  
ATOM   2224  N   LEU A 286       4.887 -11.792  -9.053  1.00  0.60           N  
ATOM   2225  CA  LEU A 286       3.699 -11.203  -8.466  1.00  0.60           C  
ATOM   2226  C   LEU A 286       2.422 -11.566  -9.218  1.00  0.60           C  
ATOM   2227  O   LEU A 286       1.381 -11.818  -8.619  1.00  0.60           O  
ATOM   2228  CB  LEU A 286       3.872  -9.678  -8.300  1.00  0.60           C  
ATOM   2229  CG  LEU A 286       2.845  -8.999  -7.368  1.00  0.60           C  
ATOM   2230  CD1 LEU A 286       2.802  -9.596  -5.952  1.00  0.60           C  
ATOM   2231  CD2 LEU A 286       3.146  -7.500  -7.271  1.00  0.60           C  
ATOM   2232  N   ARG A 287       2.475 -11.653 -10.563  1.00  0.44           N  
ATOM   2233  CA  ARG A 287       1.388 -12.138 -11.395  1.00  0.44           C  
ATOM   2234  C   ARG A 287       1.021 -13.595 -11.130  1.00  0.44           C  
ATOM   2235  O   ARG A 287      -0.160 -13.930 -11.029  1.00  0.44           O  
ATOM   2236  CB  ARG A 287       1.735 -11.943 -12.898  1.00  0.44           C  
ATOM   2237  CG  ARG A 287       0.571 -12.171 -13.890  1.00  0.44           C  
ATOM   2238  CD  ARG A 287      -0.574 -11.167 -13.709  1.00  0.44           C  
ATOM   2239  NE  ARG A 287      -1.643 -11.467 -14.718  1.00  0.44           N  
ATOM   2240  CZ  ARG A 287      -2.895 -11.847 -14.413  1.00  0.44           C  
ATOM   2241  NH1 ARG A 287      -3.350 -11.888 -13.163  1.00  0.44           N  
ATOM   2242  NH2 ARG A 287      -3.717 -12.186 -15.400  1.00  0.44           N  
ATOM   2243  N   GLU A 288       2.029 -14.480 -10.969  1.00  0.61           N  
ATOM   2244  CA  GLU A 288       1.868 -15.866 -10.553  1.00  0.61           C  
ATOM   2245  C   GLU A 288       1.259 -15.995  -9.161  1.00  0.61           C  
ATOM   2246  O   GLU A 288       0.265 -16.688  -8.949  1.00  0.61           O  
ATOM   2247  CB  GLU A 288       3.265 -16.530 -10.564  1.00  0.61           C  
ATOM   2248  CG  GLU A 288       3.300 -18.042 -10.232  1.00  0.61           C  
ATOM   2249  CD  GLU A 288       4.730 -18.587 -10.188  1.00  0.61           C  
ATOM   2250  OE1 GLU A 288       4.859 -19.827 -10.026  1.00  0.61           O  
ATOM   2251  OE2 GLU A 288       5.691 -17.782 -10.301  1.00  0.61           O  
ATOM   2252  N   ALA A 289       1.785 -15.228  -8.184  1.00  0.64           N  
ATOM   2253  CA  ALA A 289       1.264 -15.143  -6.834  1.00  0.64           C  
ATOM   2254  C   ALA A 289      -0.152 -14.585  -6.750  1.00  0.64           C  
ATOM   2255  O   ALA A 289      -0.942 -14.965  -5.890  1.00  0.64           O  
ATOM   2256  CB  ALA A 289       2.202 -14.283  -5.971  1.00  0.64           C  
ATOM   2257  N   HIS A 290      -0.526 -13.671  -7.666  1.00  0.43           N  
ATOM   2258  CA  HIS A 290      -1.868 -13.124  -7.755  1.00  0.43           C  
ATOM   2259  C   HIS A 290      -2.930 -14.162  -8.096  1.00  0.43           C  
ATOM   2260  O   HIS A 290      -4.089 -14.007  -7.732  1.00  0.43           O  
ATOM   2261  CB  HIS A 290      -1.968 -11.960  -8.769  1.00  0.43           C  
ATOM   2262  CG  HIS A 290      -3.206 -11.133  -8.563  1.00  0.43           C  
ATOM   2263  ND1 HIS A 290      -3.145 -10.023  -7.738  1.00  0.43           N  
ATOM   2264  CD2 HIS A 290      -4.492 -11.379  -8.926  1.00  0.43           C  
ATOM   2265  CE1 HIS A 290      -4.398  -9.620  -7.611  1.00  0.43           C  
ATOM   2266  NE2 HIS A 290      -5.251 -10.408  -8.309  1.00  0.43           N  
ATOM   2267  N   ALA A 291      -2.568 -15.284  -8.751  1.00  0.48           N  
ATOM   2268  CA  ALA A 291      -3.510 -16.345  -9.068  1.00  0.48           C  
ATOM   2269  C   ALA A 291      -4.036 -17.075  -7.829  1.00  0.48           C  
ATOM   2270  O   ALA A 291      -5.080 -17.718  -7.852  1.00  0.48           O  
ATOM   2271  CB  ALA A 291      -2.848 -17.348 -10.032  1.00  0.48           C  
ATOM   2272  N   LEU A 292      -3.365 -16.911  -6.670  1.00  0.37           N  
ATOM   2273  CA  LEU A 292      -3.836 -17.404  -5.389  1.00  0.37           C  
ATOM   2274  C   LEU A 292      -5.042 -16.616  -4.870  1.00  0.37           C  
ATOM   2275  O   LEU A 292      -5.761 -17.070  -3.986  1.00  0.37           O  
ATOM   2276  CB  LEU A 292      -2.704 -17.320  -4.336  1.00  0.37           C  
ATOM   2277  CG  LEU A 292      -1.423 -18.108  -4.688  1.00  0.37           C  
ATOM   2278  CD1 LEU A 292      -0.275 -17.707  -3.747  1.00  0.37           C  
ATOM   2279  CD2 LEU A 292      -1.658 -19.623  -4.640  1.00  0.37           C  
ATOM   2280  N   TYR A 293      -5.343 -15.422  -5.436  1.00  0.33           N  
ATOM   2281  CA  TYR A 293      -6.581 -14.708  -5.147  1.00  0.33           C  
ATOM   2282  C   TYR A 293      -7.779 -15.315  -5.871  1.00  0.33           C  
ATOM   2283  O   TYR A 293      -8.921 -15.037  -5.511  1.00  0.33           O  
ATOM   2284  CB  TYR A 293      -6.520 -13.200  -5.520  1.00  0.33           C  
ATOM   2285  CG  TYR A 293      -5.575 -12.434  -4.634  1.00  0.33           C  
ATOM   2286  CD1 TYR A 293      -5.878 -12.167  -3.286  1.00  0.33           C  
ATOM   2287  CD2 TYR A 293      -4.386 -11.923  -5.167  1.00  0.33           C  
ATOM   2288  CE1 TYR A 293      -4.994 -11.413  -2.497  1.00  0.33           C  
ATOM   2289  CE2 TYR A 293      -3.494 -11.187  -4.380  1.00  0.33           C  
ATOM   2290  CZ  TYR A 293      -3.795 -10.940  -3.039  1.00  0.33           C  
ATOM   2291  OH  TYR A 293      -2.877 -10.247  -2.228  1.00  0.33           O  
ATOM   2292  N   ASP A 294      -7.544 -16.184  -6.879  1.00  0.36           N  
ATOM   2293  CA  ASP A 294      -8.593 -16.865  -7.608  1.00  0.36           C  
ATOM   2294  C   ASP A 294      -8.875 -18.246  -6.987  1.00  0.36           C  
ATOM   2295  O   ASP A 294      -9.779 -18.971  -7.408  1.00  0.36           O  
ATOM   2296  CB  ASP A 294      -8.161 -17.069  -9.093  1.00  0.36           C  
ATOM   2297  CG  ASP A 294      -7.791 -15.774  -9.804  1.00  0.36           C  
ATOM   2298  OD1 ASP A 294      -8.643 -14.853  -9.857  1.00  0.36           O  
ATOM   2299  OD2 ASP A 294      -6.659 -15.709 -10.361  1.00  0.36           O  
ATOM   2300  N   GLU A 295      -8.120 -18.644  -5.937  1.00  0.33           N  
ATOM   2301  CA  GLU A 295      -8.234 -19.950  -5.312  1.00  0.33           C  
ATOM   2302  C   GLU A 295      -9.102 -19.921  -4.062  1.00  0.33           C  
ATOM   2303  O   GLU A 295      -8.752 -19.314  -3.054  1.00  0.33           O  
ATOM   2304  CB  GLU A 295      -6.853 -20.533  -4.918  1.00  0.33           C  
ATOM   2305  CG  GLU A 295      -5.958 -20.898  -6.128  1.00  0.33           C  
ATOM   2306  CD  GLU A 295      -4.678 -21.639  -5.735  1.00  0.33           C  
ATOM   2307  OE1 GLU A 295      -3.923 -22.004  -6.673  1.00  0.33           O  
ATOM   2308  OE2 GLU A 295      -4.445 -21.861  -4.519  1.00  0.33           O  
ATOM   2309  N   ALA A 296     -10.247 -20.648  -4.105  1.00  0.31           N  
ATOM   2310  CA  ALA A 296     -11.195 -20.821  -3.009  1.00  0.31           C  
ATOM   2311  C   ALA A 296     -11.877 -19.533  -2.506  1.00  0.31           C  
ATOM   2312  O   ALA A 296     -11.503 -18.430  -2.902  1.00  0.31           O  
ATOM   2313  CB  ALA A 296     -10.511 -21.596  -1.852  1.00  0.31           C  
ATOM   2314  N   PRO A 297     -12.918 -19.538  -1.669  1.00  0.27           N  
ATOM   2315  CA  PRO A 297     -13.164 -18.401  -0.787  1.00  0.27           C  
ATOM   2316  C   PRO A 297     -11.990 -18.136   0.156  1.00  0.27           C  
ATOM   2317  O   PRO A 297     -11.647 -19.004   0.956  1.00  0.27           O  
ATOM   2318  CB  PRO A 297     -14.454 -18.783  -0.041  1.00  0.27           C  
ATOM   2319  CG  PRO A 297     -14.432 -20.315  -0.019  1.00  0.27           C  
ATOM   2320  CD  PRO A 297     -13.793 -20.676  -1.363  1.00  0.27           C  
ATOM   2321  N   LEU A 298     -11.398 -16.932   0.110  1.00  0.31           N  
ATOM   2322  CA  LEU A 298     -10.337 -16.531   1.013  1.00  0.31           C  
ATOM   2323  C   LEU A 298     -10.913 -15.762   2.180  1.00  0.31           C  
ATOM   2324  O   LEU A 298     -11.995 -15.184   2.094  1.00  0.31           O  
ATOM   2325  CB  LEU A 298      -9.332 -15.589   0.308  1.00  0.31           C  
ATOM   2326  CG  LEU A 298      -8.474 -16.254  -0.782  1.00  0.31           C  
ATOM   2327  CD1 LEU A 298      -7.588 -15.197  -1.452  1.00  0.31           C  
ATOM   2328  CD2 LEU A 298      -7.593 -17.384  -0.229  1.00  0.31           C  
ATOM   2329  N   SER A 299     -10.184 -15.702   3.307  1.00  0.32           N  
ATOM   2330  CA  SER A 299     -10.506 -14.770   4.374  1.00  0.32           C  
ATOM   2331  C   SER A 299     -10.035 -13.360   4.045  1.00  0.32           C  
ATOM   2332  O   SER A 299      -9.157 -13.151   3.208  1.00  0.32           O  
ATOM   2333  CB  SER A 299      -9.913 -15.205   5.741  1.00  0.32           C  
ATOM   2334  OG  SER A 299      -8.484 -15.134   5.769  1.00  0.32           O  
ATOM   2335  N   ASP A 300     -10.591 -12.333   4.713  1.00  0.34           N  
ATOM   2336  CA  ASP A 300     -10.236 -10.937   4.535  1.00  0.34           C  
ATOM   2337  C   ASP A 300      -8.755 -10.651   4.792  1.00  0.34           C  
ATOM   2338  O   ASP A 300      -8.153  -9.784   4.168  1.00  0.34           O  
ATOM   2339  CB  ASP A 300     -11.049 -10.032   5.488  1.00  0.34           C  
ATOM   2340  CG  ASP A 300     -12.558 -10.197   5.409  1.00  0.34           C  
ATOM   2341  OD1 ASP A 300     -13.065 -11.087   4.690  1.00  0.34           O  
ATOM   2342  OD2 ASP A 300     -13.213  -9.436   6.166  1.00  0.34           O  
ATOM   2343  N   TYR A 301      -8.133 -11.397   5.726  1.00  0.29           N  
ATOM   2344  CA  TYR A 301      -6.701 -11.417   5.986  1.00  0.29           C  
ATOM   2345  C   TYR A 301      -5.869 -11.861   4.774  1.00  0.29           C  
ATOM   2346  O   TYR A 301      -4.873 -11.232   4.421  1.00  0.29           O  
ATOM   2347  CB  TYR A 301      -6.490 -12.361   7.212  1.00  0.29           C  
ATOM   2348  CG  TYR A 301      -5.046 -12.688   7.520  1.00  0.29           C  
ATOM   2349  CD1 TYR A 301      -4.555 -13.938   7.143  1.00  0.29           C  
ATOM   2350  CD2 TYR A 301      -4.154 -11.772   8.090  1.00  0.29           C  
ATOM   2351  CE1 TYR A 301      -3.218 -14.285   7.329  1.00  0.29           C  
ATOM   2352  CE2 TYR A 301      -2.807 -12.096   8.283  1.00  0.29           C  
ATOM   2353  CZ  TYR A 301      -2.363 -13.370   7.940  1.00  0.29           C  
ATOM   2354  OH  TYR A 301      -1.092 -13.768   8.331  1.00  0.29           O  
ATOM   2355  N   GLU A 302      -6.277 -12.945   4.092  1.00  0.76           N  
ATOM   2356  CA  GLU A 302      -5.630 -13.462   2.895  1.00  0.76           C  
ATOM   2357  C   GLU A 302      -5.901 -12.599   1.673  1.00  0.76           C  
ATOM   2358  O   GLU A 302      -5.051 -12.406   0.806  1.00  0.76           O  
ATOM   2359  CB  GLU A 302      -6.100 -14.913   2.665  1.00  0.76           C  
ATOM   2360  CG  GLU A 302      -5.622 -15.845   3.807  1.00  0.76           C  
ATOM   2361  CD  GLU A 302      -6.514 -17.059   4.033  1.00  0.76           C  
ATOM   2362  OE1 GLU A 302      -5.970 -18.129   4.395  1.00  0.76           O  
ATOM   2363  OE2 GLU A 302      -7.761 -16.881   3.965  1.00  0.76           O  
ATOM   2364  N   ALA A 303      -7.104 -12.000   1.606  1.00  0.79           N  
ATOM   2365  CA  ALA A 303      -7.542 -11.168   0.507  1.00  0.79           C  
ATOM   2366  C   ALA A 303      -7.190  -9.691   0.699  1.00  0.79           C  
ATOM   2367  O   ALA A 303      -7.478  -8.860  -0.163  1.00  0.79           O  
ATOM   2368  CB  ALA A 303      -9.071 -11.310   0.376  1.00  0.79           C  
ATOM   2369  N   GLU A 304      -6.496  -9.348   1.810  1.00  0.35           N  
ATOM   2370  CA  GLU A 304      -6.227  -7.999   2.300  1.00  0.35           C  
ATOM   2371  C   GLU A 304      -5.551  -7.100   1.284  1.00  0.35           C  
ATOM   2372  O   GLU A 304      -5.864  -5.918   1.161  1.00  0.35           O  
ATOM   2373  CB  GLU A 304      -5.309  -8.080   3.558  1.00  0.35           C  
ATOM   2374  CG  GLU A 304      -5.063  -6.731   4.287  1.00  0.35           C  
ATOM   2375  CD  GLU A 304      -3.910  -6.787   5.276  1.00  0.35           C  
ATOM   2376  OE1 GLU A 304      -2.842  -6.181   4.980  1.00  0.35           O  
ATOM   2377  OE2 GLU A 304      -4.057  -7.413   6.361  1.00  0.35           O  
ATOM   2378  N   ARG A 305      -4.606  -7.671   0.521  1.00  0.35           N  
ATOM   2379  CA  ARG A 305      -3.778  -6.942  -0.408  1.00  0.35           C  
ATOM   2380  C   ARG A 305      -4.159  -7.195  -1.848  1.00  0.35           C  
ATOM   2381  O   ARG A 305      -3.352  -6.961  -2.742  1.00  0.35           O  
ATOM   2382  CB  ARG A 305      -2.287  -7.329  -0.208  1.00  0.35           C  
ATOM   2383  CG  ARG A 305      -1.735  -6.901   1.163  1.00  0.35           C  
ATOM   2384  CD  ARG A 305      -1.700  -5.374   1.328  1.00  0.35           C  
ATOM   2385  NE  ARG A 305      -2.514  -5.019   2.527  1.00  0.35           N  
ATOM   2386  CZ  ARG A 305      -3.009  -3.802   2.769  1.00  0.35           C  
ATOM   2387  NH1 ARG A 305      -3.156  -2.873   1.838  1.00  0.35           N  
ATOM   2388  NH2 ARG A 305      -3.358  -3.544   4.028  1.00  0.35           N  
ATOM   2389  N   CYS A 306      -5.387  -7.673  -2.155  1.00  0.39           N  
ATOM   2390  CA  CYS A 306      -5.751  -7.994  -3.534  1.00  0.39           C  
ATOM   2391  C   CYS A 306      -5.674  -6.801  -4.481  1.00  0.39           C  
ATOM   2392  O   CYS A 306      -5.031  -6.870  -5.525  1.00  0.39           O  
ATOM   2393  CB  CYS A 306      -7.159  -8.647  -3.608  1.00  0.39           C  
ATOM   2394  SG  CYS A 306      -7.549  -9.372  -5.247  1.00  0.39           S  
ATOM   2395  N   THR A 307      -6.256  -5.647  -4.097  1.00  0.37           N  
ATOM   2396  CA  THR A 307      -6.175  -4.404  -4.864  1.00  0.37           C  
ATOM   2397  C   THR A 307      -4.769  -3.849  -4.942  1.00  0.37           C  
ATOM   2398  O   THR A 307      -4.301  -3.457  -6.009  1.00  0.37           O  
ATOM   2399  CB  THR A 307      -7.083  -3.304  -4.331  1.00  0.37           C  
ATOM   2400  OG1 THR A 307      -8.378  -3.831  -4.085  1.00  0.37           O  
ATOM   2401  CG2 THR A 307      -7.255  -2.194  -5.379  1.00  0.37           C  
ATOM   2402  N   ASP A 308      -4.020  -3.846  -3.819  1.00  0.40           N  
ATOM   2403  CA  ASP A 308      -2.633  -3.420  -3.769  1.00  0.40           C  
ATOM   2404  C   ASP A 308      -1.721  -4.279  -4.639  1.00  0.40           C  
ATOM   2405  O   ASP A 308      -0.817  -3.787  -5.306  1.00  0.40           O  
ATOM   2406  CB  ASP A 308      -2.087  -3.480  -2.331  1.00  0.40           C  
ATOM   2407  CG  ASP A 308      -2.998  -2.767  -1.366  1.00  0.40           C  
ATOM   2408  OD1 ASP A 308      -2.919  -1.526  -1.238  1.00  0.40           O  
ATOM   2409  OD2 ASP A 308      -3.749  -3.494  -0.666  1.00  0.40           O  
ATOM   2410  N   SER A 309      -1.965  -5.605  -4.675  1.00  0.48           N  
ATOM   2411  CA  SER A 309      -1.293  -6.562  -5.542  1.00  0.48           C  
ATOM   2412  C   SER A 309      -1.477  -6.216  -7.001  1.00  0.48           C  
ATOM   2413  O   SER A 309      -0.512  -6.213  -7.766  1.00  0.48           O  
ATOM   2414  CB  SER A 309      -1.782  -8.012  -5.280  1.00  0.48           C  
ATOM   2415  OG  SER A 309      -1.059  -8.989  -6.033  1.00  0.48           O  
ATOM   2416  N   LEU A 310      -2.707  -5.836  -7.422  1.00  0.39           N  
ATOM   2417  CA  LEU A 310      -2.944  -5.294  -8.752  1.00  0.39           C  
ATOM   2418  C   LEU A 310      -2.157  -4.014  -8.988  1.00  0.39           C  
ATOM   2419  O   LEU A 310      -1.445  -3.903  -9.973  1.00  0.39           O  
ATOM   2420  CB  LEU A 310      -4.440  -4.977  -9.028  1.00  0.39           C  
ATOM   2421  CG  LEU A 310      -5.423  -6.143  -8.807  1.00  0.39           C  
ATOM   2422  CD1 LEU A 310      -6.877  -5.659  -8.913  1.00  0.39           C  
ATOM   2423  CD2 LEU A 310      -5.199  -7.317  -9.763  1.00  0.39           C  
ATOM   2424  N   VAL A 311      -2.193  -3.043  -8.052  1.00  0.42           N  
ATOM   2425  CA  VAL A 311      -1.448  -1.793  -8.171  1.00  0.42           C  
ATOM   2426  C   VAL A 311       0.066  -1.981  -8.237  1.00  0.42           C  
ATOM   2427  O   VAL A 311       0.722  -1.410  -9.096  1.00  0.42           O  
ATOM   2428  CB  VAL A 311      -1.827  -0.801  -7.077  1.00  0.42           C  
ATOM   2429  CG1 VAL A 311      -0.997   0.497  -7.175  1.00  0.42           C  
ATOM   2430  CG2 VAL A 311      -3.320  -0.449  -7.234  1.00  0.42           C  
ATOM   2431  N   LEU A 312       0.680  -2.828  -7.394  1.00  0.48           N  
ATOM   2432  CA  LEU A 312       2.106  -3.118  -7.456  1.00  0.48           C  
ATOM   2433  C   LEU A 312       2.537  -3.857  -8.715  1.00  0.48           C  
ATOM   2434  O   LEU A 312       3.584  -3.559  -9.287  1.00  0.48           O  
ATOM   2435  CB  LEU A 312       2.577  -3.865  -6.192  1.00  0.48           C  
ATOM   2436  CG  LEU A 312       4.095  -4.135  -6.077  1.00  0.48           C  
ATOM   2437  CD1 LEU A 312       4.922  -2.839  -6.113  1.00  0.48           C  
ATOM   2438  CD2 LEU A 312       4.395  -4.920  -4.794  1.00  0.48           C  
ATOM   2439  N   GLN A 313       1.721  -4.804  -9.241  1.00  0.45           N  
ATOM   2440  CA  GLN A 313       1.957  -5.386 -10.561  1.00  0.45           C  
ATOM   2441  C   GLN A 313       2.013  -4.312 -11.637  1.00  0.45           C  
ATOM   2442  O   GLN A 313       2.934  -4.267 -12.448  1.00  0.45           O  
ATOM   2443  CB  GLN A 313       0.831  -6.378 -10.957  1.00  0.45           C  
ATOM   2444  CG  GLN A 313       0.991  -7.780 -10.338  1.00  0.45           C  
ATOM   2445  CD  GLN A 313      -0.305  -8.586 -10.420  1.00  0.45           C  
ATOM   2446  OE1 GLN A 313      -0.591  -9.312 -11.370  1.00  0.45           O  
ATOM   2447  NE2 GLN A 313      -1.128  -8.459  -9.360  1.00  0.45           N  
ATOM   2448  N   CYS A 314       1.046  -3.383 -11.578  1.00  0.39           N  
ATOM   2449  CA  CYS A 314       0.931  -2.197 -12.394  1.00  0.39           C  
ATOM   2450  C   CYS A 314       2.036  -1.179 -12.218  1.00  0.39           C  
ATOM   2451  O   CYS A 314       2.328  -0.474 -13.165  1.00  0.39           O  
ATOM   2452  CB  CYS A 314      -0.411  -1.490 -12.134  1.00  0.39           C  
ATOM   2453  SG  CYS A 314      -1.806  -2.583 -12.570  1.00  0.39           S  
ATOM   2454  N   GLU A 315       2.646  -1.026 -11.027  1.00  0.37           N  
ATOM   2455  CA  GLU A 315       3.834  -0.211 -10.810  1.00  0.37           C  
ATOM   2456  C   GLU A 315       5.145  -0.823 -11.308  1.00  0.37           C  
ATOM   2457  O   GLU A 315       5.914  -0.160 -12.004  1.00  0.37           O  
ATOM   2458  CB  GLU A 315       4.005   0.163  -9.317  1.00  0.37           C  
ATOM   2459  CG  GLU A 315       2.958   1.186  -8.808  1.00  0.37           C  
ATOM   2460  CD  GLU A 315       3.091   1.527  -7.322  1.00  0.37           C  
ATOM   2461  OE1 GLU A 315       2.445   2.529  -6.921  1.00  0.37           O  
ATOM   2462  OE2 GLU A 315       3.815   0.807  -6.588  1.00  0.37           O  
ATOM   2463  N   LEU A 316       5.431  -2.120 -11.013  1.00  0.40           N  
ATOM   2464  CA  LEU A 316       6.667  -2.822 -11.374  1.00  0.40           C  
ATOM   2465  C   LEU A 316       6.906  -2.804 -12.856  1.00  0.40           C  
ATOM   2466  O   LEU A 316       7.958  -2.428 -13.367  1.00  0.40           O  
ATOM   2467  CB  LEU A 316       6.494  -4.317 -11.034  1.00  0.40           C  
ATOM   2468  CG  LEU A 316       6.612  -4.622  -9.545  1.00  0.40           C  
ATOM   2469  CD1 LEU A 316       5.948  -5.972  -9.262  1.00  0.40           C  
ATOM   2470  CD2 LEU A 316       8.085  -4.609  -9.137  1.00  0.40           C  
ATOM   2471  N   ALA A 317       5.805  -3.128 -13.536  1.00  0.38           N  
ATOM   2472  CA  ALA A 317       5.474  -2.927 -14.911  1.00  0.38           C  
ATOM   2473  C   ALA A 317       6.244  -1.879 -15.679  1.00  0.38           C  
ATOM   2474  O   ALA A 317       6.877  -2.130 -16.692  1.00  0.38           O  
ATOM   2475  CB  ALA A 317       4.027  -2.452 -14.852  1.00  0.38           C  
ATOM   2476  N   LEU A 318       6.208  -0.637 -15.197  1.00  0.34           N  
ATOM   2477  CA  LEU A 318       6.552   0.509 -15.980  1.00  0.34           C  
ATOM   2478  C   LEU A 318       8.052   0.734 -15.971  1.00  0.34           C  
ATOM   2479  O   LEU A 318       8.595   1.423 -16.832  1.00  0.34           O  
ATOM   2480  CB  LEU A 318       5.726   1.669 -15.413  1.00  0.34           C  
ATOM   2481  CG  LEU A 318       4.204   1.394 -15.473  1.00  0.34           C  
ATOM   2482  CD1 LEU A 318       3.519   1.908 -14.206  1.00  0.34           C  
ATOM   2483  CD2 LEU A 318       3.562   1.915 -16.764  1.00  0.34           C  
ATOM   2484  N   GLY A 319       8.771   0.015 -15.074  1.00  0.34           N  
ATOM   2485  CA  GLY A 319      10.228  -0.075 -15.074  1.00  0.34           C  
ATOM   2486  C   GLY A 319      10.772  -0.826 -16.265  1.00  0.34           C  
ATOM   2487  O   GLY A 319      11.920  -0.646 -16.650  1.00  0.34           O  
ATOM   2488  N   PHE A 320       9.941  -1.672 -16.907  1.00  0.31           N  
ATOM   2489  CA  PHE A 320      10.281  -2.380 -18.133  1.00  0.31           C  
ATOM   2490  C   PHE A 320       9.271  -2.079 -19.246  1.00  0.31           C  
ATOM   2491  O   PHE A 320       9.164  -2.767 -20.268  1.00  0.31           O  
ATOM   2492  CB  PHE A 320      10.512  -3.901 -17.881  1.00  0.31           C  
ATOM   2493  CG  PHE A 320       9.321  -4.735 -17.480  1.00  0.31           C  
ATOM   2494  CD1 PHE A 320       8.738  -4.629 -16.209  1.00  0.31           C  
ATOM   2495  CD2 PHE A 320       8.861  -5.746 -18.336  1.00  0.31           C  
ATOM   2496  CE1 PHE A 320       7.702  -5.483 -15.819  1.00  0.31           C  
ATOM   2497  CE2 PHE A 320       7.829  -6.608 -17.945  1.00  0.31           C  
ATOM   2498  CZ  PHE A 320       7.249  -6.479 -16.685  1.00  0.31           C  
ATOM   2499  N   GLY A 321       8.489  -0.989 -19.056  1.00  0.34           N  
ATOM   2500  CA  GLY A 321       7.308  -0.633 -19.844  1.00  0.34           C  
ATOM   2501  C   GLY A 321       6.236  -1.697 -19.949  1.00  0.34           C  
ATOM   2502  O   GLY A 321       6.349  -2.785 -19.404  1.00  0.34           O  
ATOM   2503  N   GLY A 322       5.144  -1.426 -20.702  1.00  0.34           N  
ATOM   2504  CA  GLY A 322       4.059  -2.392 -20.883  1.00  0.34           C  
ATOM   2505  C   GLY A 322       3.788  -3.321 -22.047  1.00  0.34           C  
ATOM   2506  O   GLY A 322       3.414  -4.439 -21.777  1.00  0.34           O  
ATOM   2507  N   GLY A 323       3.892  -3.012 -23.346  1.00  0.33           N  
ATOM   2508  CA  GLY A 323       3.902  -4.047 -24.415  1.00  0.33           C  
ATOM   2509  C   GLY A 323       2.684  -4.872 -24.751  1.00  0.33           C  
ATOM   2510  O   GLY A 323       2.037  -4.561 -25.739  1.00  0.33           O  
ATOM   2511  N   ARG A 324       2.309  -5.932 -23.987  1.00  0.28           N  
ATOM   2512  CA  ARG A 324       0.976  -6.546 -24.099  1.00  0.28           C  
ATOM   2513  C   ARG A 324       0.131  -6.551 -22.770  1.00  0.28           C  
ATOM   2514  O   ARG A 324      -1.069  -6.796 -22.813  1.00  0.28           O  
ATOM   2515  CB  ARG A 324       0.986  -7.832 -24.973  1.00  0.28           C  
ATOM   2516  CG  ARG A 324       0.585  -7.525 -26.438  1.00  0.28           C  
ATOM   2517  CD  ARG A 324       0.771  -8.647 -27.452  1.00  0.28           C  
ATOM   2518  NE  ARG A 324       0.862  -7.917 -28.737  1.00  0.28           N  
ATOM   2519  CZ  ARG A 324       1.385  -8.396 -29.865  1.00  0.28           C  
ATOM   2520  NH1 ARG A 324       1.458  -9.690 -30.121  1.00  0.28           N  
ATOM   2521  NH2 ARG A 324       1.872  -7.505 -30.723  1.00  0.28           N  
ATOM   2522  N   GLU A 325       0.704  -6.143 -21.599  1.00  0.33           N  
ATOM   2523  CA  GLU A 325       0.174  -6.107 -20.236  1.00  0.33           C  
ATOM   2524  C   GLU A 325      -1.020  -5.196 -19.700  1.00  0.33           C  
ATOM   2525  O   GLU A 325      -1.848  -5.821 -19.095  1.00  0.33           O  
ATOM   2526  CB  GLU A 325       1.410  -6.018 -19.315  1.00  0.33           C  
ATOM   2527  CG  GLU A 325       2.548  -7.101 -19.453  1.00  0.33           C  
ATOM   2528  CD  GLU A 325       3.598  -6.935 -20.557  1.00  0.33           C  
ATOM   2529  OE1 GLU A 325       3.244  -7.159 -21.744  1.00  0.33           O  
ATOM   2530  OE2 GLU A 325       4.778  -6.575 -20.295  1.00  0.33           O  
ATOM   2531  N   ILE A 326      -1.249  -3.793 -19.868  1.00  0.25           N  
ATOM   2532  CA  ILE A 326      -2.539  -2.902 -19.671  1.00  0.25           C  
ATOM   2533  C   ILE A 326      -3.585  -3.576 -20.549  1.00  0.25           C  
ATOM   2534  O   ILE A 326      -3.958  -3.128 -21.620  1.00  0.25           O  
ATOM   2535  CB  ILE A 326      -2.718  -1.248 -19.834  1.00  0.25           C  
ATOM   2536  CG1 ILE A 326      -2.130  -0.269 -18.762  1.00  0.25           C  
ATOM   2537  CG2 ILE A 326      -4.190  -0.730 -19.942  1.00  0.25           C  
ATOM   2538  CD1 ILE A 326      -1.302   1.019 -19.028  1.00  0.25           C  
ATOM   2539  N   ALA A 327      -4.044  -4.743 -20.096  1.00  0.27           N  
ATOM   2540  CA  ALA A 327      -5.004  -5.538 -20.772  1.00  0.27           C  
ATOM   2541  C   ALA A 327      -5.720  -6.549 -19.844  1.00  0.27           C  
ATOM   2542  O   ALA A 327      -6.773  -7.044 -20.222  1.00  0.27           O  
ATOM   2543  CB  ALA A 327      -4.330  -6.181 -22.004  1.00  0.27           C  
ATOM   2544  N   ASP A 328      -5.250  -6.763 -18.581  1.00  0.29           N  
ATOM   2545  CA  ASP A 328      -5.822  -7.650 -17.549  1.00  0.29           C  
ATOM   2546  C   ASP A 328      -6.544  -6.981 -16.289  1.00  0.29           C  
ATOM   2547  O   ASP A 328      -7.761  -7.048 -16.133  1.00  0.29           O  
ATOM   2548  CB  ASP A 328      -4.690  -8.615 -17.035  1.00  0.29           C  
ATOM   2549  CG  ASP A 328      -3.525  -8.847 -17.998  1.00  0.29           C  
ATOM   2550  OD1 ASP A 328      -3.739  -9.430 -19.082  1.00  0.29           O  
ATOM   2551  OD2 ASP A 328      -2.395  -8.459 -17.606  1.00  0.29           O  
ATOM   2552  N   LEU A 329      -5.777  -6.320 -15.357  1.00  0.30           N  
ATOM   2553  CA  LEU A 329      -5.976  -6.005 -13.925  1.00  0.30           C  
ATOM   2554  C   LEU A 329      -6.567  -4.669 -13.329  1.00  0.30           C  
ATOM   2555  O   LEU A 329      -6.579  -4.523 -12.113  1.00  0.30           O  
ATOM   2556  CB  LEU A 329      -4.536  -5.926 -13.318  1.00  0.30           C  
ATOM   2557  CG  LEU A 329      -3.530  -7.057 -13.600  1.00  0.30           C  
ATOM   2558  CD1 LEU A 329      -2.198  -6.681 -12.926  1.00  0.30           C  
ATOM   2559  CD2 LEU A 329      -4.012  -8.428 -13.124  1.00  0.30           C  
ATOM   2560  N   ALA A 330      -7.048  -3.651 -14.070  1.00  0.25           N  
ATOM   2561  CA  ALA A 330      -7.445  -2.309 -13.628  1.00  0.25           C  
ATOM   2562  C   ALA A 330      -8.773  -1.762 -14.230  1.00  0.25           C  
ATOM   2563  O   ALA A 330      -9.319  -0.805 -13.682  1.00  0.25           O  
ATOM   2564  CB  ALA A 330      -6.325  -1.302 -13.970  1.00  0.25           C  
ATOM   2565  N   PRO A 331      -9.366  -2.331 -15.295  1.00  0.19           N  
ATOM   2566  CA  PRO A 331     -10.757  -2.804 -15.210  1.00  0.19           C  
ATOM   2567  C   PRO A 331     -11.024  -3.945 -14.243  1.00  0.19           C  
ATOM   2568  O   PRO A 331     -12.178  -4.336 -14.094  1.00  0.19           O  
ATOM   2569  CB  PRO A 331     -11.092  -3.145 -16.661  1.00  0.19           C  
ATOM   2570  CG  PRO A 331     -10.527  -1.929 -17.395  1.00  0.19           C  
ATOM   2571  CD  PRO A 331      -9.292  -1.549 -16.552  1.00  0.19           C  
ATOM   2572  N   LEU A 332      -9.970  -4.457 -13.580  1.00  0.20           N  
ATOM   2573  CA  LEU A 332     -10.005  -5.085 -12.266  1.00  0.20           C  
ATOM   2574  C   LEU A 332     -10.226  -6.584 -12.313  1.00  0.20           C  
ATOM   2575  O   LEU A 332     -10.735  -7.188 -11.372  1.00  0.20           O  
ATOM   2576  CB  LEU A 332     -10.912  -4.346 -11.236  1.00  0.20           C  
ATOM   2577  CG  LEU A 332     -10.575  -2.846 -11.051  1.00  0.20           C  
ATOM   2578  CD1 LEU A 332     -11.713  -2.117 -10.326  1.00  0.20           C  
ATOM   2579  CD2 LEU A 332      -9.249  -2.626 -10.308  1.00  0.20           C  
ATOM   2580  N   LEU A 333      -9.803  -7.224 -13.424  1.00  0.22           N  
ATOM   2581  CA  LEU A 333     -10.072  -8.621 -13.701  1.00  0.22           C  
ATOM   2582  C   LEU A 333      -8.784  -9.407 -13.965  1.00  0.22           C  
ATOM   2583  O   LEU A 333      -7.795  -9.312 -13.238  1.00  0.22           O  
ATOM   2584  CB  LEU A 333     -11.065  -8.750 -14.893  1.00  0.22           C  
ATOM   2585  CG  LEU A 333     -12.391  -7.974 -14.718  1.00  0.22           C  
ATOM   2586  CD1 LEU A 333     -13.231  -8.044 -16.001  1.00  0.22           C  
ATOM   2587  CD2 LEU A 333     -13.216  -8.480 -13.525  1.00  0.22           C  
ATOM   2588  N   HIS A 334      -8.780 -10.260 -15.007  1.00  0.24           N  
ATOM   2589  CA  HIS A 334      -7.734 -11.224 -15.281  1.00  0.24           C  
ATOM   2590  C   HIS A 334      -7.537 -11.262 -16.790  1.00  0.24           C  
ATOM   2591  O   HIS A 334      -8.319 -10.678 -17.537  1.00  0.24           O  
ATOM   2592  CB  HIS A 334      -8.130 -12.609 -14.705  1.00  0.24           C  
ATOM   2593  CG  HIS A 334      -7.023 -13.508 -14.234  1.00  0.24           C  
ATOM   2594  ND1 HIS A 334      -5.979 -13.887 -15.065  1.00  0.24           N  
ATOM   2595  CD2 HIS A 334      -6.983 -14.218 -13.079  1.00  0.24           C  
ATOM   2596  CE1 HIS A 334      -5.343 -14.842 -14.398  1.00  0.24           C  
ATOM   2597  NE2 HIS A 334      -5.907 -15.070 -13.189  1.00  0.24           N  
ATOM   2598  N   ALA A 335      -6.462 -11.909 -17.275  1.00  0.30           N  
ATOM   2599  CA  ALA A 335      -6.015 -11.835 -18.654  1.00  0.30           C  
ATOM   2600  C   ALA A 335      -6.901 -12.630 -19.599  1.00  0.30           C  
ATOM   2601  O   ALA A 335      -7.138 -13.820 -19.395  1.00  0.30           O  
ATOM   2602  CB  ALA A 335      -4.561 -12.344 -18.769  1.00  0.30           C  
ATOM   2603  N   ARG A 336      -7.431 -11.998 -20.665  1.00  0.20           N  
ATOM   2604  CA  ARG A 336      -8.329 -12.701 -21.554  1.00  0.20           C  
ATOM   2605  C   ARG A 336      -8.499 -11.967 -22.868  1.00  0.20           C  
ATOM   2606  O   ARG A 336      -8.871 -10.800 -22.906  1.00  0.20           O  
ATOM   2607  CB  ARG A 336      -9.723 -12.919 -20.912  1.00  0.20           C  
ATOM   2608  CG  ARG A 336     -10.593 -13.919 -21.691  1.00  0.20           C  
ATOM   2609  CD  ARG A 336     -11.883 -14.278 -20.959  1.00  0.20           C  
ATOM   2610  NE  ARG A 336     -12.556 -15.304 -21.817  1.00  0.20           N  
ATOM   2611  CZ  ARG A 336     -13.754 -15.840 -21.554  1.00  0.20           C  
ATOM   2612  NH1 ARG A 336     -14.257 -16.748 -22.387  1.00  0.20           N  
ATOM   2613  NH2 ARG A 336     -14.452 -15.485 -20.481  1.00  0.20           N  
ATOM   2614  N   GLY A 337      -8.212 -12.639 -24.008  1.00  0.26           N  
ATOM   2615  CA  GLY A 337      -8.352 -12.040 -25.339  1.00  0.26           C  
ATOM   2616  C   GLY A 337      -7.169 -11.204 -25.746  1.00  0.26           C  
ATOM   2617  O   GLY A 337      -7.127 -10.626 -26.827  1.00  0.26           O  
ATOM   2618  N   ARG A 338      -6.150 -11.148 -24.880  1.00  0.19           N  
ATOM   2619  CA  ARG A 338      -4.908 -10.470 -25.129  1.00  0.19           C  
ATOM   2620  C   ARG A 338      -3.780 -11.456 -24.863  1.00  0.19           C  
ATOM   2621  O   ARG A 338      -3.896 -12.231 -23.912  1.00  0.19           O  
ATOM   2622  CB  ARG A 338      -4.760  -9.251 -24.191  1.00  0.19           C  
ATOM   2623  CG  ARG A 338      -4.074  -8.041 -24.861  1.00  0.19           C  
ATOM   2624  CD  ARG A 338      -5.028  -7.259 -25.777  1.00  0.19           C  
ATOM   2625  NE  ARG A 338      -4.602  -5.813 -25.849  1.00  0.19           N  
ATOM   2626  CZ  ARG A 338      -3.769  -5.291 -26.760  1.00  0.19           C  
ATOM   2627  NH1 ARG A 338      -3.669  -3.968 -26.885  1.00  0.19           N  
ATOM   2628  NH2 ARG A 338      -3.050  -6.064 -27.565  1.00  0.19           N  
ATOM   2629  N   PRO A 339      -2.689 -11.520 -25.623  1.00  0.23           N  
ATOM   2630  CA  PRO A 339      -1.429 -12.083 -25.140  1.00  0.23           C  
ATOM   2631  C   PRO A 339      -0.822 -11.161 -24.081  1.00  0.23           C  
ATOM   2632  O   PRO A 339      -1.313 -10.047 -23.943  1.00  0.23           O  
ATOM   2633  CB  PRO A 339      -0.548 -12.134 -26.416  1.00  0.23           C  
ATOM   2634  CG  PRO A 339      -1.470 -11.749 -27.588  1.00  0.23           C  
ATOM   2635  CD  PRO A 339      -2.542 -10.892 -26.931  1.00  0.23           C  
ATOM   2636  N   LEU A 340       0.267 -11.546 -23.383  1.00  0.24           N  
ATOM   2637  CA  LEU A 340       1.052 -10.595 -22.608  1.00  0.24           C  
ATOM   2638  C   LEU A 340       2.515 -10.712 -23.025  1.00  0.24           C  
ATOM   2639  O   LEU A 340       2.890 -11.670 -23.700  1.00  0.24           O  
ATOM   2640  CB  LEU A 340       0.748 -10.596 -21.089  1.00  0.24           C  
ATOM   2641  CG  LEU A 340       1.065 -11.852 -20.257  1.00  0.24           C  
ATOM   2642  CD1 LEU A 340       2.558 -11.998 -19.933  1.00  0.24           C  
ATOM   2643  CD2 LEU A 340       0.280 -11.758 -18.938  1.00  0.24           C  
ATOM   2644  N   GLU A 341       3.340  -9.672 -22.761  1.00  0.27           N  
ATOM   2645  CA  GLU A 341       4.740  -9.472 -23.139  1.00  0.27           C  
ATOM   2646  C   GLU A 341       5.048  -9.341 -24.628  1.00  0.27           C  
ATOM   2647  O   GLU A 341       5.945  -8.599 -25.032  1.00  0.27           O  
ATOM   2648  CB  GLU A 341       5.727 -10.476 -22.495  1.00  0.27           C  
ATOM   2649  CG  GLU A 341       5.956 -10.255 -20.981  1.00  0.27           C  
ATOM   2650  CD  GLU A 341       7.111 -11.084 -20.461  1.00  0.27           C  
ATOM   2651  OE1 GLU A 341       6.945 -11.863 -19.489  1.00  0.27           O  
ATOM   2652  OE2 GLU A 341       8.229 -10.976 -21.016  1.00  0.27           O  
ATOM   2653  N   ALA A 342       4.269 -10.009 -25.498  1.00  0.30           N  
ATOM   2654  CA  ALA A 342       4.602 -10.245 -26.888  1.00  0.30           C  
ATOM   2655  C   ALA A 342       4.835  -9.036 -27.788  1.00  0.30           C  
ATOM   2656  O   ALA A 342       5.672  -9.120 -28.682  1.00  0.30           O  
ATOM   2657  CB  ALA A 342       3.630 -11.268 -27.518  1.00  0.30           C  
ATOM   2658  N   SER A 343       4.170  -7.865 -27.604  1.00  0.25           N  
ATOM   2659  CA  SER A 343       4.505  -6.705 -28.442  1.00  0.25           C  
ATOM   2660  C   SER A 343       5.921  -6.237 -28.274  1.00  0.25           C  
ATOM   2661  O   SER A 343       6.496  -5.762 -29.240  1.00  0.25           O  
ATOM   2662  CB  SER A 343       3.722  -5.389 -28.218  1.00  0.25           C  
ATOM   2663  OG  SER A 343       2.343  -5.479 -28.581  1.00  0.25           O  
ATOM   2664  N   TYR A 344       6.525  -6.322 -27.065  1.00  0.24           N  
ATOM   2665  CA  TYR A 344       7.894  -5.868 -26.902  1.00  0.24           C  
ATOM   2666  C   TYR A 344       8.857  -6.655 -27.773  1.00  0.24           C  
ATOM   2667  O   TYR A 344       9.548  -6.098 -28.610  1.00  0.24           O  
ATOM   2668  CB  TYR A 344       8.308  -6.009 -25.415  1.00  0.24           C  
ATOM   2669  CG  TYR A 344       9.661  -5.437 -25.074  1.00  0.24           C  
ATOM   2670  CD1 TYR A 344      10.468  -6.109 -24.143  1.00  0.24           C  
ATOM   2671  CD2 TYR A 344      10.112  -4.213 -25.599  1.00  0.24           C  
ATOM   2672  CE1 TYR A 344      11.705  -5.583 -23.753  1.00  0.24           C  
ATOM   2673  CE2 TYR A 344      11.317  -3.649 -25.156  1.00  0.24           C  
ATOM   2674  CZ  TYR A 344      12.119  -4.344 -24.244  1.00  0.24           C  
ATOM   2675  OH  TYR A 344      13.337  -3.800 -23.798  1.00  0.24           O  
ATOM   2676  N   TYR A 345       8.826  -7.993 -27.656  1.00  0.27           N  
ATOM   2677  CA  TYR A 345       9.701  -8.871 -28.401  1.00  0.27           C  
ATOM   2678  C   TYR A 345       9.416  -8.853 -29.897  1.00  0.27           C  
ATOM   2679  O   TYR A 345      10.336  -8.768 -30.706  1.00  0.27           O  
ATOM   2680  CB  TYR A 345       9.634 -10.317 -27.843  1.00  0.27           C  
ATOM   2681  CG  TYR A 345       9.868 -10.344 -26.347  1.00  0.27           C  
ATOM   2682  CD1 TYR A 345      11.033  -9.809 -25.759  1.00  0.27           C  
ATOM   2683  CD2 TYR A 345       8.902 -10.926 -25.509  1.00  0.27           C  
ATOM   2684  CE1 TYR A 345      11.196  -9.809 -24.362  1.00  0.27           C  
ATOM   2685  CE2 TYR A 345       9.078 -10.946 -24.120  1.00  0.27           C  
ATOM   2686  CZ  TYR A 345      10.206 -10.362 -23.541  1.00  0.27           C  
ATOM   2687  OH  TYR A 345      10.347 -10.346 -22.140  1.00  0.27           O  
ATOM   2688  N   GLN A 346       8.123  -8.869 -30.303  1.00  0.41           N  
ATOM   2689  CA  GLN A 346       7.727  -8.762 -31.699  1.00  0.41           C  
ATOM   2690  C   GLN A 346       8.143  -7.446 -32.342  1.00  0.41           C  
ATOM   2691  O   GLN A 346       8.731  -7.420 -33.420  1.00  0.41           O  
ATOM   2692  CB  GLN A 346       6.182  -8.908 -31.835  1.00  0.41           C  
ATOM   2693  CG  GLN A 346       5.654  -8.879 -33.293  1.00  0.41           C  
ATOM   2694  CD  GLN A 346       4.130  -9.007 -33.375  1.00  0.41           C  
ATOM   2695  OE1 GLN A 346       3.400  -9.107 -32.386  1.00  0.41           O  
ATOM   2696  NE2 GLN A 346       3.612  -8.962 -34.625  1.00  0.41           N  
ATOM   2697  N   ALA A 347       7.880  -6.302 -31.686  1.00  0.37           N  
ATOM   2698  CA  ALA A 347       8.149  -5.020 -32.287  1.00  0.37           C  
ATOM   2699  C   ALA A 347       9.581  -4.547 -32.140  1.00  0.37           C  
ATOM   2700  O   ALA A 347      10.078  -3.818 -32.990  1.00  0.37           O  
ATOM   2701  CB  ALA A 347       7.206  -3.973 -31.702  1.00  0.37           C  
ATOM   2702  N   PHE A 348      10.315  -4.976 -31.093  1.00  0.32           N  
ATOM   2703  CA  PHE A 348      11.751  -4.772 -30.993  1.00  0.32           C  
ATOM   2704  C   PHE A 348      12.479  -5.557 -32.081  1.00  0.32           C  
ATOM   2705  O   PHE A 348      13.399  -5.049 -32.719  1.00  0.32           O  
ATOM   2706  CB  PHE A 348      12.251  -5.135 -29.569  1.00  0.32           C  
ATOM   2707  CG  PHE A 348      13.642  -4.638 -29.288  1.00  0.32           C  
ATOM   2708  CD1 PHE A 348      14.758  -5.453 -29.541  1.00  0.32           C  
ATOM   2709  CD2 PHE A 348      13.842  -3.359 -28.739  1.00  0.32           C  
ATOM   2710  CE1 PHE A 348      16.051  -5.004 -29.243  1.00  0.32           C  
ATOM   2711  CE2 PHE A 348      15.134  -2.907 -28.438  1.00  0.32           C  
ATOM   2712  CZ  PHE A 348      16.238  -3.732 -28.686  1.00  0.32           C  
ATOM   2713  N   ALA A 349      12.037  -6.804 -32.364  1.00  0.59           N  
ATOM   2714  CA  ALA A 349      12.512  -7.577 -33.495  1.00  0.59           C  
ATOM   2715  C   ALA A 349      12.218  -6.928 -34.847  1.00  0.59           C  
ATOM   2716  O   ALA A 349      13.118  -6.808 -35.677  1.00  0.59           O  
ATOM   2717  CB  ALA A 349      11.911  -8.995 -33.449  1.00  0.59           C  
ATOM   2718  N   GLU A 350      10.981  -6.418 -35.070  1.00  0.42           N  
ATOM   2719  CA  GLU A 350      10.644  -5.627 -36.248  1.00  0.42           C  
ATOM   2720  C   GLU A 350      11.492  -4.366 -36.353  1.00  0.42           C  
ATOM   2721  O   GLU A 350      12.120  -4.127 -37.375  1.00  0.42           O  
ATOM   2722  CB  GLU A 350       9.154  -5.184 -36.232  1.00  0.42           C  
ATOM   2723  CG  GLU A 350       8.116  -6.306 -36.494  1.00  0.42           C  
ATOM   2724  CD  GLU A 350       7.844  -6.532 -37.970  1.00  0.42           C  
ATOM   2725  OE1 GLU A 350       6.728  -6.168 -38.442  1.00  0.42           O  
ATOM   2726  OE2 GLU A 350       8.708  -7.108 -38.681  1.00  0.42           O  
ATOM   2727  N   PHE A 351      11.616  -3.559 -35.278  1.00  0.31           N  
ATOM   2728  CA  PHE A 351      12.401  -2.333 -35.242  1.00  0.31           C  
ATOM   2729  C   PHE A 351      13.881  -2.572 -35.531  1.00  0.31           C  
ATOM   2730  O   PHE A 351      14.495  -1.883 -36.344  1.00  0.31           O  
ATOM   2731  CB  PHE A 351      12.189  -1.667 -33.852  1.00  0.31           C  
ATOM   2732  CG  PHE A 351      12.912  -0.360 -33.663  1.00  0.31           C  
ATOM   2733  CD1 PHE A 351      13.880  -0.238 -32.652  1.00  0.31           C  
ATOM   2734  CD2 PHE A 351      12.609   0.758 -34.458  1.00  0.31           C  
ATOM   2735  CE1 PHE A 351      14.530   0.982 -32.432  1.00  0.31           C  
ATOM   2736  CE2 PHE A 351      13.267   1.977 -34.247  1.00  0.31           C  
ATOM   2737  CZ  PHE A 351      14.226   2.089 -33.233  1.00  0.31           C  
ATOM   2738  N   SER A 352      14.470  -3.624 -34.927  1.00  0.47           N  
ATOM   2739  CA  SER A 352      15.828  -4.072 -35.212  1.00  0.47           C  
ATOM   2740  C   SER A 352      16.003  -4.497 -36.665  1.00  0.47           C  
ATOM   2741  O   SER A 352      16.971  -4.125 -37.328  1.00  0.47           O  
ATOM   2742  CB  SER A 352      16.242  -5.241 -34.279  1.00  0.47           C  
ATOM   2743  OG  SER A 352      17.634  -5.542 -34.399  1.00  0.47           O  
ATOM   2744  N   ALA A 353      15.028  -5.238 -37.230  1.00  0.52           N  
ATOM   2745  CA  ALA A 353      14.975  -5.579 -38.638  1.00  0.52           C  
ATOM   2746  C   ALA A 353      14.847  -4.375 -39.578  1.00  0.52           C  
ATOM   2747  O   ALA A 353      15.519  -4.321 -40.609  1.00  0.52           O  
ATOM   2748  CB  ALA A 353      13.837  -6.585 -38.894  1.00  0.52           C  
ATOM   2749  N   LEU A 354      14.019  -3.358 -39.237  1.00  0.44           N  
ATOM   2750  CA  LEU A 354      13.917  -2.100 -39.967  1.00  0.44           C  
ATOM   2751  C   LEU A 354      15.246  -1.343 -40.003  1.00  0.44           C  
ATOM   2752  O   LEU A 354      15.717  -0.945 -41.069  1.00  0.44           O  
ATOM   2753  CB  LEU A 354      12.864  -1.134 -39.344  1.00  0.44           C  
ATOM   2754  CG  LEU A 354      11.393  -1.608 -39.280  1.00  0.44           C  
ATOM   2755  CD1 LEU A 354      10.555  -0.591 -38.495  1.00  0.44           C  
ATOM   2756  CD2 LEU A 354      10.751  -1.856 -40.646  1.00  0.44           C  
ATOM   2757  N   LEU A 355      15.925  -1.186 -38.844  1.00  0.47           N  
ATOM   2758  CA  LEU A 355      17.241  -0.563 -38.752  1.00  0.47           C  
ATOM   2759  C   LEU A 355      18.318  -1.339 -39.507  1.00  0.47           C  
ATOM   2760  O   LEU A 355      19.112  -0.777 -40.264  1.00  0.47           O  
ATOM   2761  CB  LEU A 355      17.680  -0.427 -37.272  1.00  0.47           C  
ATOM   2762  CG  LEU A 355      16.817   0.520 -36.410  1.00  0.47           C  
ATOM   2763  CD1 LEU A 355      17.220   0.383 -34.935  1.00  0.47           C  
ATOM   2764  CD2 LEU A 355      16.928   1.990 -36.836  1.00  0.47           C  
ATOM   2765  N   SER A 356      18.329  -2.678 -39.350  1.00  0.48           N  
ATOM   2766  CA  SER A 356      19.236  -3.606 -40.017  1.00  0.48           C  
ATOM   2767  C   SER A 356      19.063  -3.663 -41.520  1.00  0.48           C  
ATOM   2768  O   SER A 356      20.018  -3.848 -42.273  1.00  0.48           O  
ATOM   2769  CB  SER A 356      19.100  -5.057 -39.500  1.00  0.48           C  
ATOM   2770  OG  SER A 356      19.433  -5.128 -38.118  1.00  0.48           O  
ATOM   2771  N   ARG A 357      17.827  -3.543 -42.040  1.00  0.50           N  
ATOM   2772  CA  ARG A 357      17.616  -3.331 -43.461  1.00  0.50           C  
ATOM   2773  C   ARG A 357      18.110  -1.962 -43.916  1.00  0.50           C  
ATOM   2774  O   ARG A 357      18.917  -1.880 -44.835  1.00  0.50           O  
ATOM   2775  CB  ARG A 357      16.128  -3.540 -43.824  1.00  0.50           C  
ATOM   2776  CG  ARG A 357      15.866  -3.899 -45.306  1.00  0.50           C  
ATOM   2777  CD  ARG A 357      14.368  -4.087 -45.581  1.00  0.50           C  
ATOM   2778  NE  ARG A 357      14.156  -4.816 -46.867  1.00  0.50           N  
ATOM   2779  CZ  ARG A 357      13.004  -5.415 -47.195  1.00  0.50           C  
ATOM   2780  NH1 ARG A 357      11.927  -5.391 -46.424  1.00  0.50           N  
ATOM   2781  NH2 ARG A 357      12.878  -5.937 -48.406  1.00  0.50           N  
ATOM   2782  N   SER A 358      17.732  -0.870 -43.216  1.00  0.58           N  
ATOM   2783  CA  SER A 358      18.109   0.503 -43.557  1.00  0.58           C  
ATOM   2784  C   SER A 358      19.602   0.770 -43.571  1.00  0.58           C  
ATOM   2785  O   SER A 358      20.104   1.461 -44.454  1.00  0.58           O  
ATOM   2786  CB  SER A 358      17.449   1.548 -42.624  1.00  0.58           C  
ATOM   2787  OG  SER A 358      16.044   1.593 -42.863  1.00  0.58           O  
ATOM   2788  N   SER A 359      20.381   0.213 -42.615  1.00  0.56           N  
ATOM   2789  CA  SER A 359      21.844   0.278 -42.685  1.00  0.56           C  
ATOM   2790  C   SER A 359      22.416  -0.430 -43.899  1.00  0.56           C  
ATOM   2791  O   SER A 359      23.246   0.122 -44.606  1.00  0.56           O  
ATOM   2792  CB  SER A 359      22.563  -0.283 -41.428  1.00  0.56           C  
ATOM   2793  OG  SER A 359      23.959   0.042 -41.426  1.00  0.56           O  
ATOM   2794  N   ARG A 360      21.939  -1.648 -44.225  1.00  0.50           N  
ATOM   2795  CA  ARG A 360      22.407  -2.369 -45.398  1.00  0.50           C  
ATOM   2796  C   ARG A 360      22.125  -1.648 -46.710  1.00  0.50           C  
ATOM   2797  O   ARG A 360      22.972  -1.618 -47.599  1.00  0.50           O  
ATOM   2798  CB  ARG A 360      21.823  -3.800 -45.441  1.00  0.50           C  
ATOM   2799  CG  ARG A 360      22.448  -4.717 -44.370  1.00  0.50           C  
ATOM   2800  CD  ARG A 360      21.933  -6.158 -44.407  1.00  0.50           C  
ATOM   2801  NE  ARG A 360      20.505  -6.113 -43.958  1.00  0.50           N  
ATOM   2802  CZ  ARG A 360      19.594  -7.055 -44.236  1.00  0.50           C  
ATOM   2803  NH1 ARG A 360      19.904  -8.135 -44.948  1.00  0.50           N  
ATOM   2804  NH2 ARG A 360      18.348  -6.925 -43.786  1.00  0.50           N  
ATOM   2805  N   LEU A 361      20.947  -1.003 -46.840  1.00  0.54           N  
ATOM   2806  CA  LEU A 361      20.626  -0.136 -47.964  1.00  0.54           C  
ATOM   2807  C   LEU A 361      21.575   1.050 -48.083  1.00  0.54           C  
ATOM   2808  O   LEU A 361      22.040   1.384 -49.170  1.00  0.54           O  
ATOM   2809  CB  LEU A 361      19.189   0.425 -47.846  1.00  0.54           C  
ATOM   2810  CG  LEU A 361      18.075  -0.636 -47.773  1.00  0.54           C  
ATOM   2811  CD1 LEU A 361      16.740   0.053 -47.455  1.00  0.54           C  
ATOM   2812  CD2 LEU A 361      17.992  -1.524 -49.025  1.00  0.54           C  
ATOM   2813  N   LEU A 362      21.928   1.695 -46.950  1.00  0.53           N  
ATOM   2814  CA  LEU A 362      22.934   2.743 -46.912  1.00  0.53           C  
ATOM   2815  C   LEU A 362      24.308   2.269 -47.359  1.00  0.53           C  
ATOM   2816  O   LEU A 362      24.935   2.892 -48.210  1.00  0.53           O  
ATOM   2817  CB  LEU A 362      23.030   3.333 -45.485  1.00  0.53           C  
ATOM   2818  CG  LEU A 362      24.135   4.385 -45.256  1.00  0.53           C  
ATOM   2819  CD1 LEU A 362      24.024   5.583 -46.205  1.00  0.53           C  
ATOM   2820  CD2 LEU A 362      24.090   4.863 -43.804  1.00  0.53           C  
ATOM   2821  N   ASP A 363      24.791   1.115 -46.867  1.00  0.48           N  
ATOM   2822  CA  ASP A 363      26.064   0.555 -47.282  1.00  0.48           C  
ATOM   2823  C   ASP A 363      26.105   0.187 -48.772  1.00  0.48           C  
ATOM   2824  O   ASP A 363      27.090   0.450 -49.463  1.00  0.48           O  
ATOM   2825  CB  ASP A 363      26.461  -0.612 -46.346  1.00  0.48           C  
ATOM   2826  CG  ASP A 363      26.632  -0.061 -44.946  1.00  0.48           C  
ATOM   2827  OD1 ASP A 363      27.371   0.948 -44.784  1.00  0.48           O  
ATOM   2828  OD2 ASP A 363      26.005  -0.588 -43.992  1.00  0.48           O  
ATOM   2829  N   GLN A 364      24.999  -0.352 -49.333  1.00  0.49           N  
ATOM   2830  CA  GLN A 364      24.823  -0.560 -50.768  1.00  0.49           C  
ATOM   2831  C   GLN A 364      24.893   0.725 -51.601  1.00  0.49           C  
ATOM   2832  O   GLN A 364      25.497   0.754 -52.676  1.00  0.49           O  
ATOM   2833  CB  GLN A 364      23.472  -1.267 -51.052  1.00  0.49           C  
ATOM   2834  CG  GLN A 364      23.449  -2.748 -50.602  1.00  0.49           C  
ATOM   2835  CD  GLN A 364      22.039  -3.339 -50.663  1.00  0.49           C  
ATOM   2836  OE1 GLN A 364      21.018  -2.656 -50.708  1.00  0.49           O  
ATOM   2837  NE2 GLN A 364      21.967  -4.691 -50.650  1.00  0.49           N  
ATOM   2838  N   LEU A 365      24.287   1.835 -51.132  1.00  0.42           N  
ATOM   2839  CA  LEU A 365      24.459   3.148 -51.736  1.00  0.42           C  
ATOM   2840  C   LEU A 365      25.870   3.704 -51.631  1.00  0.42           C  
ATOM   2841  O   LEU A 365      26.461   4.140 -52.618  1.00  0.42           O  
ATOM   2842  CB  LEU A 365      23.569   4.188 -51.021  1.00  0.42           C  
ATOM   2843  CG  LEU A 365      22.064   3.997 -51.181  1.00  0.42           C  
ATOM   2844  CD1 LEU A 365      21.305   4.917 -50.222  1.00  0.42           C  
ATOM   2845  CD2 LEU A 365      21.647   4.324 -52.603  1.00  0.42           C  
ATOM   2846  N   SER A 366      26.445   3.672 -50.414  1.00  0.54           N  
ATOM   2847  CA  SER A 366      27.749   4.223 -50.082  1.00  0.54           C  
ATOM   2848  C   SER A 366      28.867   3.560 -50.830  1.00  0.54           C  
ATOM   2849  O   SER A 366      29.793   4.227 -51.290  1.00  0.54           O  
ATOM   2850  CB  SER A 366      28.079   4.115 -48.573  1.00  0.54           C  
ATOM   2851  OG  SER A 366      27.244   5.003 -47.835  1.00  0.54           O  
ATOM   2852  N   GLU A 367      28.811   2.223 -50.985  1.00  0.42           N  
ATOM   2853  CA  GLU A 367      29.739   1.515 -51.840  1.00  0.42           C  
ATOM   2854  C   GLU A 367      29.563   1.839 -53.318  1.00  0.42           C  
ATOM   2855  O   GLU A 367      30.524   2.157 -54.011  1.00  0.42           O  
ATOM   2856  CB  GLU A 367      29.678  -0.012 -51.581  1.00  0.42           C  
ATOM   2857  CG  GLU A 367      30.931  -0.790 -52.064  1.00  0.42           C  
ATOM   2858  CD  GLU A 367      32.215  -0.403 -51.332  1.00  0.42           C  
ATOM   2859  OE1 GLU A 367      33.306  -0.819 -51.794  1.00  0.42           O  
ATOM   2860  OE2 GLU A 367      32.145   0.330 -50.312  1.00  0.42           O  
ATOM   2861  N   GLY A 368      28.307   1.875 -53.832  1.00  0.39           N  
ATOM   2862  CA  GLY A 368      28.032   2.178 -55.239  1.00  0.39           C  
ATOM   2863  C   GLY A 368      28.502   3.534 -55.712  1.00  0.39           C  
ATOM   2864  O   GLY A 368      28.884   3.696 -56.868  1.00  0.39           O  
ATOM   2865  N   SER A 369      28.528   4.540 -54.810  1.00  0.41           N  
ATOM   2866  CA  SER A 369      29.106   5.857 -55.070  1.00  0.41           C  
ATOM   2867  C   SER A 369      30.596   5.807 -55.359  1.00  0.41           C  
ATOM   2868  O   SER A 369      31.102   6.566 -56.181  1.00  0.41           O  
ATOM   2869  CB  SER A 369      28.939   6.874 -53.899  1.00  0.41           C  
ATOM   2870  OG  SER A 369      27.601   7.362 -53.777  1.00  0.41           O  
ATOM   2871  N   ARG A 370      31.346   4.932 -54.657  1.00  0.27           N  
ATOM   2872  CA  ARG A 370      32.792   4.833 -54.771  1.00  0.27           C  
ATOM   2873  C   ARG A 370      33.267   4.284 -56.105  1.00  0.27           C  
ATOM   2874  O   ARG A 370      34.156   4.844 -56.741  1.00  0.27           O  
ATOM   2875  CB  ARG A 370      33.354   3.899 -53.669  1.00  0.27           C  
ATOM   2876  CG  ARG A 370      33.060   4.374 -52.235  1.00  0.27           C  
ATOM   2877  CD  ARG A 370      33.310   3.277 -51.196  1.00  0.27           C  
ATOM   2878  NE  ARG A 370      32.864   3.841 -49.876  1.00  0.27           N  
ATOM   2879  CZ  ARG A 370      32.969   3.177 -48.718  1.00  0.27           C  
ATOM   2880  NH1 ARG A 370      33.335   1.906 -48.663  1.00  0.27           N  
ATOM   2881  NH2 ARG A 370      32.684   3.799 -47.572  1.00  0.27           N  
ATOM   2882  N   HIS A 371      32.675   3.162 -56.562  1.00  0.24           N  
ATOM   2883  CA  HIS A 371      33.057   2.510 -57.804  1.00  0.24           C  
ATOM   2884  C   HIS A 371      32.753   3.310 -59.051  1.00  0.24           C  
ATOM   2885  O   HIS A 371      33.536   3.293 -59.999  1.00  0.24           O  
ATOM   2886  CB  HIS A 371      32.448   1.096 -57.955  1.00  0.24           C  
ATOM   2887  CG  HIS A 371      32.960   0.159 -56.907  1.00  0.24           C  
ATOM   2888  ND1 HIS A 371      32.442   0.274 -55.638  1.00  0.24           N  
ATOM   2889  CD2 HIS A 371      33.964  -0.759 -56.925  1.00  0.24           C  
ATOM   2890  CE1 HIS A 371      33.136  -0.566 -54.899  1.00  0.24           C  
ATOM   2891  NE2 HIS A 371      34.070  -1.221 -55.630  1.00  0.24           N  
ATOM   2892  N   GLN A 372      31.610   4.021 -59.100  1.00  0.27           N  
ATOM   2893  CA  GLN A 372      31.276   4.770 -60.292  1.00  0.27           C  
ATOM   2894  C   GLN A 372      30.263   5.863 -60.014  1.00  0.27           C  
ATOM   2895  O   GLN A 372      29.070   5.622 -59.841  1.00  0.27           O  
ATOM   2896  CB  GLN A 372      30.721   3.831 -61.396  1.00  0.27           C  
ATOM   2897  CG  GLN A 372      30.585   4.492 -62.785  1.00  0.27           C  
ATOM   2898  CD  GLN A 372      30.191   3.451 -63.832  1.00  0.27           C  
ATOM   2899  OE1 GLN A 372      29.861   2.301 -63.543  1.00  0.27           O  
ATOM   2900  NE2 GLN A 372      30.246   3.859 -65.121  1.00  0.27           N  
ATOM   2901  N   LEU A 373      30.720   7.132 -59.984  1.00  0.28           N  
ATOM   2902  CA  LEU A 373      29.834   8.281 -60.006  1.00  0.28           C  
ATOM   2903  C   LEU A 373      29.067   8.410 -61.337  1.00  0.28           C  
ATOM   2904  O   LEU A 373      29.647   8.156 -62.397  1.00  0.28           O  
ATOM   2905  CB  LEU A 373      30.598   9.599 -59.719  1.00  0.28           C  
ATOM   2906  CG  LEU A 373      31.089   9.742 -58.261  1.00  0.28           C  
ATOM   2907  CD1 LEU A 373      32.126  10.871 -58.143  1.00  0.28           C  
ATOM   2908  CD2 LEU A 373      29.927   9.989 -57.283  1.00  0.28           C  
ATOM   2909  N   PRO A 374      27.788   8.796 -61.354  1.00  0.30           N  
ATOM   2910  CA  PRO A 374      27.057   9.106 -62.573  1.00  0.30           C  
ATOM   2911  C   PRO A 374      27.633  10.265 -63.363  1.00  0.30           C  
ATOM   2912  O   PRO A 374      28.321  11.122 -62.815  1.00  0.30           O  
ATOM   2913  CB  PRO A 374      25.622   9.455 -62.119  1.00  0.30           C  
ATOM   2914  CG  PRO A 374      25.488   8.896 -60.698  1.00  0.30           C  
ATOM   2915  CD  PRO A 374      26.924   8.782 -60.182  1.00  0.30           C  
ATOM   2916  N   GLY A 375      27.274  10.348 -64.660  1.00  0.26           N  
ATOM   2917  CA  GLY A 375      27.499  11.537 -65.483  1.00  0.26           C  
ATOM   2918  C   GLY A 375      26.452  12.606 -65.279  1.00  0.26           C  
ATOM   2919  O   GLY A 375      26.494  13.650 -65.911  1.00  0.26           O  
ATOM   2920  N   ASN A 376      25.467  12.342 -64.401  1.00  0.29           N  
ATOM   2921  CA  ASN A 376      24.396  13.245 -64.037  1.00  0.29           C  
ATOM   2922  C   ASN A 376      24.677  13.731 -62.617  1.00  0.29           C  
ATOM   2923  O   ASN A 376      24.624  12.970 -61.647  1.00  0.29           O  
ATOM   2924  CB  ASN A 376      23.051  12.459 -64.124  1.00  0.29           C  
ATOM   2925  CG  ASN A 376      21.810  13.298 -63.819  1.00  0.29           C  
ATOM   2926  OD1 ASN A 376      21.701  13.967 -62.790  1.00  0.29           O  
ATOM   2927  ND2 ASN A 376      20.791  13.221 -64.705  1.00  0.29           N  
ATOM   2928  N   ARG A 377      24.995  15.028 -62.460  1.00  0.37           N  
ATOM   2929  CA  ARG A 377      25.346  15.624 -61.187  1.00  0.37           C  
ATOM   2930  C   ARG A 377      24.210  15.640 -60.180  1.00  0.37           C  
ATOM   2931  O   ARG A 377      24.400  15.354 -58.994  1.00  0.37           O  
ATOM   2932  CB  ARG A 377      25.829  17.064 -61.441  1.00  0.37           C  
ATOM   2933  CG  ARG A 377      26.331  17.827 -60.205  1.00  0.37           C  
ATOM   2934  CD  ARG A 377      26.860  19.199 -60.606  1.00  0.37           C  
ATOM   2935  NE  ARG A 377      27.316  19.897 -59.360  1.00  0.37           N  
ATOM   2936  CZ  ARG A 377      27.633  21.198 -59.381  1.00  0.37           C  
ATOM   2937  NH1 ARG A 377      27.798  21.830 -60.536  1.00  0.37           N  
ATOM   2938  NH2 ARG A 377      27.767  21.881 -58.249  1.00  0.37           N  
ATOM   2939  N   GLN A 378      22.984  15.963 -60.640  1.00  0.44           N  
ATOM   2940  CA  GLN A 378      21.809  16.018 -59.790  1.00  0.44           C  
ATOM   2941  C   GLN A 378      21.446  14.661 -59.203  1.00  0.44           C  
ATOM   2942  O   GLN A 378      21.147  14.546 -58.018  1.00  0.44           O  
ATOM   2943  CB  GLN A 378      20.582  16.623 -60.518  1.00  0.44           C  
ATOM   2944  CG  GLN A 378      19.431  16.938 -59.529  1.00  0.44           C  
ATOM   2945  CD  GLN A 378      18.187  17.511 -60.204  1.00  0.44           C  
ATOM   2946  OE1 GLN A 378      17.225  16.778 -60.451  1.00  0.44           O  
ATOM   2947  NE2 GLN A 378      18.181  18.845 -60.457  1.00  0.44           N  
ATOM   2948  N   LEU A 379      21.509  13.579 -60.002  1.00  0.39           N  
ATOM   2949  CA  LEU A 379      21.264  12.219 -59.551  1.00  0.39           C  
ATOM   2950  C   LEU A 379      22.241  11.748 -58.480  1.00  0.39           C  
ATOM   2951  O   LEU A 379      21.854  11.146 -57.478  1.00  0.39           O  
ATOM   2952  CB  LEU A 379      21.268  11.260 -60.759  1.00  0.39           C  
ATOM   2953  CG  LEU A 379      20.855   9.805 -60.459  1.00  0.39           C  
ATOM   2954  CD1 LEU A 379      19.508   9.687 -59.728  1.00  0.39           C  
ATOM   2955  CD2 LEU A 379      20.764   9.022 -61.772  1.00  0.39           C  
ATOM   2956  N   ALA A 380      23.539  12.084 -58.621  1.00  0.43           N  
ATOM   2957  CA  ALA A 380      24.519  11.888 -57.569  1.00  0.43           C  
ATOM   2958  C   ALA A 380      24.192  12.671 -56.289  1.00  0.43           C  
ATOM   2959  O   ALA A 380      24.245  12.129 -55.187  1.00  0.43           O  
ATOM   2960  CB  ALA A 380      25.910  12.274 -58.109  1.00  0.43           C  
ATOM   2961  N   GLY A 381      23.779  13.955 -56.415  1.00  0.53           N  
ATOM   2962  CA  GLY A 381      23.208  14.767 -55.332  1.00  0.53           C  
ATOM   2963  C   GLY A 381      22.044  14.147 -54.596  1.00  0.53           C  
ATOM   2964  O   GLY A 381      22.031  14.068 -53.370  1.00  0.53           O  
ATOM   2965  N   ARG A 382      21.035  13.665 -55.351  1.00  0.42           N  
ATOM   2966  CA  ARG A 382      19.867  12.960 -54.841  1.00  0.42           C  
ATOM   2967  C   ARG A 382      20.246  11.689 -54.081  1.00  0.42           C  
ATOM   2968  O   ARG A 382      19.680  11.372 -53.035  1.00  0.42           O  
ATOM   2969  CB  ARG A 382      18.912  12.518 -55.986  1.00  0.42           C  
ATOM   2970  CG  ARG A 382      18.183  13.618 -56.790  1.00  0.42           C  
ATOM   2971  CD  ARG A 382      17.319  13.003 -57.894  1.00  0.42           C  
ATOM   2972  NE  ARG A 382      16.774  14.094 -58.773  1.00  0.42           N  
ATOM   2973  CZ  ARG A 382      15.772  13.817 -59.622  1.00  0.42           C  
ATOM   2974  NH1 ARG A 382      15.196  12.622 -59.610  1.00  0.42           N  
ATOM   2975  NH2 ARG A 382      15.398  14.701 -60.541  1.00  0.42           N  
ATOM   2976  N   SER A 383      21.236  10.925 -54.593  1.00  0.49           N  
ATOM   2977  CA  SER A 383      21.761   9.739 -53.923  1.00  0.49           C  
ATOM   2978  C   SER A 383      22.395  10.043 -52.580  1.00  0.49           C  
ATOM   2979  O   SER A 383      22.111   9.381 -51.586  1.00  0.49           O  
ATOM   2980  CB  SER A 383      22.759   8.953 -54.813  1.00  0.49           C  
ATOM   2981  OG  SER A 383      23.004   7.643 -54.292  1.00  0.49           O  
ATOM   2982  N   TYR A 384      23.211  11.110 -52.489  1.00  0.53           N  
ATOM   2983  CA  TYR A 384      23.752  11.586 -51.227  1.00  0.53           C  
ATOM   2984  C   TYR A 384      22.700  12.069 -50.227  1.00  0.53           C  
ATOM   2985  O   TYR A 384      22.825  11.821 -49.029  1.00  0.53           O  
ATOM   2986  CB  TYR A 384      24.832  12.671 -51.455  1.00  0.53           C  
ATOM   2987  CG  TYR A 384      26.091  12.072 -52.020  1.00  0.53           C  
ATOM   2988  CD1 TYR A 384      26.746  11.026 -51.345  1.00  0.53           C  
ATOM   2989  CD2 TYR A 384      26.667  12.583 -53.195  1.00  0.53           C  
ATOM   2990  CE1 TYR A 384      27.935  10.483 -51.847  1.00  0.53           C  
ATOM   2991  CE2 TYR A 384      27.872  12.057 -53.687  1.00  0.53           C  
ATOM   2992  CZ  TYR A 384      28.501  11.005 -53.010  1.00  0.53           C  
ATOM   2993  OH  TYR A 384      29.730  10.496 -53.468  1.00  0.53           O  
ATOM   2994  N   ASP A 385      21.612  12.729 -50.684  1.00  0.57           N  
ATOM   2995  CA  ASP A 385      20.471  13.086 -49.846  1.00  0.57           C  
ATOM   2996  C   ASP A 385      19.780  11.848 -49.254  1.00  0.57           C  
ATOM   2997  O   ASP A 385      19.527  11.746 -48.056  1.00  0.57           O  
ATOM   2998  CB  ASP A 385      19.494  13.938 -50.708  1.00  0.57           C  
ATOM   2999  CG  ASP A 385      18.509  14.776 -49.910  1.00  0.57           C  
ATOM   3000  OD1 ASP A 385      18.502  14.730 -48.653  1.00  0.57           O  
ATOM   3001  OD2 ASP A 385      17.773  15.558 -50.569  1.00  0.57           O  
ATOM   3002  N   LEU A 386      19.544  10.801 -50.072  1.00  0.55           N  
ATOM   3003  CA  LEU A 386      19.040   9.529 -49.578  1.00  0.55           C  
ATOM   3004  C   LEU A 386      19.981   8.836 -48.595  1.00  0.55           C  
ATOM   3005  O   LEU A 386      19.553   8.309 -47.569  1.00  0.55           O  
ATOM   3006  CB  LEU A 386      18.730   8.579 -50.754  1.00  0.55           C  
ATOM   3007  CG  LEU A 386      18.166   7.198 -50.356  1.00  0.55           C  
ATOM   3008  CD1 LEU A 386      16.831   7.295 -49.598  1.00  0.55           C  
ATOM   3009  CD2 LEU A 386      18.027   6.308 -51.595  1.00  0.55           C  
ATOM   3010  N   GLN A 387      21.303   8.856 -48.863  1.00  0.62           N  
ATOM   3011  CA  GLN A 387      22.319   8.351 -47.954  1.00  0.62           C  
ATOM   3012  C   GLN A 387      22.312   9.067 -46.606  1.00  0.62           C  
ATOM   3013  O   GLN A 387      22.337   8.430 -45.555  1.00  0.62           O  
ATOM   3014  CB  GLN A 387      23.727   8.449 -48.604  1.00  0.62           C  
ATOM   3015  CG  GLN A 387      23.918   7.454 -49.772  1.00  0.62           C  
ATOM   3016  CD  GLN A 387      25.182   7.682 -50.610  1.00  0.62           C  
ATOM   3017  OE1 GLN A 387      26.273   7.954 -50.112  1.00  0.62           O  
ATOM   3018  NE2 GLN A 387      25.047   7.526 -51.950  1.00  0.62           N  
ATOM   3019  N   ALA A 388      22.209  10.410 -46.591  1.00  0.66           N  
ATOM   3020  CA  ALA A 388      22.074  11.189 -45.376  1.00  0.66           C  
ATOM   3021  C   ALA A 388      20.802  10.879 -44.583  1.00  0.66           C  
ATOM   3022  O   ALA A 388      20.848  10.676 -43.370  1.00  0.66           O  
ATOM   3023  CB  ALA A 388      22.139  12.684 -45.737  1.00  0.66           C  
ATOM   3024  N   LEU A 389      19.637  10.768 -45.253  1.00  0.59           N  
ATOM   3025  CA  LEU A 389      18.390  10.363 -44.624  1.00  0.59           C  
ATOM   3026  C   LEU A 389      18.400   8.946 -44.056  1.00  0.59           C  
ATOM   3027  O   LEU A 389      17.935   8.693 -42.942  1.00  0.59           O  
ATOM   3028  CB  LEU A 389      17.210  10.508 -45.611  1.00  0.59           C  
ATOM   3029  CG  LEU A 389      15.823  10.208 -45.001  1.00  0.59           C  
ATOM   3030  CD1 LEU A 389      15.488  11.137 -43.828  1.00  0.59           C  
ATOM   3031  CD2 LEU A 389      14.732  10.328 -46.065  1.00  0.59           C  
ATOM   3032  N   LEU A 390      18.966   7.965 -44.787  1.00  0.58           N  
ATOM   3033  CA  LEU A 390      19.158   6.620 -44.270  1.00  0.58           C  
ATOM   3034  C   LEU A 390      20.096   6.578 -43.079  1.00  0.58           C  
ATOM   3035  O   LEU A 390      19.787   5.939 -42.078  1.00  0.58           O  
ATOM   3036  CB  LEU A 390      19.670   5.660 -45.365  1.00  0.58           C  
ATOM   3037  CG  LEU A 390      18.556   5.161 -46.302  1.00  0.58           C  
ATOM   3038  CD1 LEU A 390      19.164   4.569 -47.572  1.00  0.58           C  
ATOM   3039  CD2 LEU A 390      17.672   4.109 -45.620  1.00  0.58           C  
ATOM   3040  N   ALA A 391      21.227   7.312 -43.125  1.00  0.62           N  
ATOM   3041  CA  ALA A 391      22.165   7.439 -42.025  1.00  0.62           C  
ATOM   3042  C   ALA A 391      21.550   8.046 -40.766  1.00  0.62           C  
ATOM   3043  O   ALA A 391      21.740   7.540 -39.660  1.00  0.62           O  
ATOM   3044  CB  ALA A 391      23.375   8.259 -42.510  1.00  0.62           C  
ATOM   3045  N   LEU A 392      20.719   9.099 -40.927  1.00  0.56           N  
ATOM   3046  CA  LEU A 392      19.897   9.684 -39.879  1.00  0.56           C  
ATOM   3047  C   LEU A 392      18.912   8.680 -39.284  1.00  0.56           C  
ATOM   3048  O   LEU A 392      18.765   8.567 -38.073  1.00  0.56           O  
ATOM   3049  CB  LEU A 392      19.116  10.885 -40.486  1.00  0.56           C  
ATOM   3050  CG  LEU A 392      18.202  11.683 -39.530  1.00  0.56           C  
ATOM   3051  CD1 LEU A 392      18.999  12.443 -38.463  1.00  0.56           C  
ATOM   3052  CD2 LEU A 392      17.327  12.664 -40.325  1.00  0.56           C  
ATOM   3053  N   THR A 393      18.235   7.889 -40.140  1.00  0.55           N  
ATOM   3054  CA  THR A 393      17.293   6.847 -39.723  1.00  0.55           C  
ATOM   3055  C   THR A 393      17.931   5.669 -38.998  1.00  0.55           C  
ATOM   3056  O   THR A 393      17.399   5.171 -38.011  1.00  0.55           O  
ATOM   3057  CB  THR A 393      16.472   6.266 -40.875  1.00  0.55           C  
ATOM   3058  OG1 THR A 393      15.866   7.296 -41.643  1.00  0.55           O  
ATOM   3059  CG2 THR A 393      15.310   5.411 -40.330  1.00  0.55           C  
ATOM   3060  N   CYS A 394      19.091   5.156 -39.467  1.00  0.53           N  
ATOM   3061  CA  CYS A 394      19.668   3.930 -38.923  1.00  0.53           C  
ATOM   3062  C   CYS A 394      20.735   4.153 -37.859  1.00  0.53           C  
ATOM   3063  O   CYS A 394      21.275   3.198 -37.305  1.00  0.53           O  
ATOM   3064  CB  CYS A 394      20.210   2.994 -40.042  1.00  0.53           C  
ATOM   3065  SG  CYS A 394      21.627   3.656 -40.983  1.00  0.53           S  
ATOM   3066  N   GLY A 395      21.036   5.417 -37.500  1.00  0.61           N  
ATOM   3067  CA  GLY A 395      21.802   5.718 -36.294  1.00  0.61           C  
ATOM   3068  C   GLY A 395      23.230   6.149 -36.496  1.00  0.61           C  
ATOM   3069  O   GLY A 395      23.994   6.226 -35.530  1.00  0.61           O  
ATOM   3070  N   ARG A 396      23.609   6.448 -37.748  1.00  0.60           N  
ATOM   3071  CA  ARG A 396      24.954   6.797 -38.181  1.00  0.60           C  
ATOM   3072  C   ARG A 396      24.998   8.293 -38.460  1.00  0.60           C  
ATOM   3073  O   ARG A 396      25.149   8.765 -39.584  1.00  0.60           O  
ATOM   3074  CB  ARG A 396      25.332   5.964 -39.435  1.00  0.60           C  
ATOM   3075  CG  ARG A 396      25.469   4.459 -39.106  1.00  0.60           C  
ATOM   3076  CD  ARG A 396      25.286   3.489 -40.281  1.00  0.60           C  
ATOM   3077  NE  ARG A 396      26.403   3.658 -41.247  1.00  0.60           N  
ATOM   3078  CZ  ARG A 396      26.628   2.854 -42.290  1.00  0.60           C  
ATOM   3079  NH1 ARG A 396      25.963   1.727 -42.484  1.00  0.60           N  
ATOM   3080  NH2 ARG A 396      27.542   3.191 -43.190  1.00  0.60           N  
ATOM   3081  N   TYR A 397      24.810   9.095 -37.397  1.00  0.54           N  
ATOM   3082  CA  TYR A 397      24.606  10.534 -37.466  1.00  0.54           C  
ATOM   3083  C   TYR A 397      25.877  11.302 -37.781  1.00  0.54           C  
ATOM   3084  O   TYR A 397      25.843  12.419 -38.285  1.00  0.54           O  
ATOM   3085  CB  TYR A 397      24.066  11.086 -36.129  1.00  0.54           C  
ATOM   3086  CG  TYR A 397      22.833  10.348 -35.705  1.00  0.54           C  
ATOM   3087  CD1 TYR A 397      21.555  10.700 -36.159  1.00  0.54           C  
ATOM   3088  CD2 TYR A 397      22.964   9.256 -34.842  1.00  0.54           C  
ATOM   3089  CE1 TYR A 397      20.434   9.954 -35.761  1.00  0.54           C  
ATOM   3090  CE2 TYR A 397      21.843   8.565 -34.379  1.00  0.54           C  
ATOM   3091  CZ  TYR A 397      20.579   8.899 -34.857  1.00  0.54           C  
ATOM   3092  OH  TYR A 397      19.472   8.130 -34.455  1.00  0.54           O  
ATOM   3093  N   ASP A 398      27.028  10.679 -37.518  1.00  0.63           N  
ATOM   3094  CA  ASP A 398      28.374  11.066 -37.857  1.00  0.63           C  
ATOM   3095  C   ASP A 398      28.606  11.172 -39.368  1.00  0.63           C  
ATOM   3096  O   ASP A 398      29.198  12.135 -39.857  1.00  0.63           O  
ATOM   3097  CB  ASP A 398      29.331  10.048 -37.164  1.00  0.63           C  
ATOM   3098  CG  ASP A 398      28.802   8.616 -37.234  1.00  0.63           C  
ATOM   3099  OD1 ASP A 398      27.794   8.322 -36.530  1.00  0.63           O  
ATOM   3100  OD2 ASP A 398      29.366   7.826 -38.020  1.00  0.63           O  
ATOM   3101  N   GLU A 399      28.080  10.217 -40.160  1.00  0.66           N  
ATOM   3102  CA  GLU A 399      28.086  10.281 -41.611  1.00  0.66           C  
ATOM   3103  C   GLU A 399      27.168  11.362 -42.189  1.00  0.66           C  
ATOM   3104  O   GLU A 399      27.420  11.900 -43.268  1.00  0.66           O  
ATOM   3105  CB  GLU A 399      27.723   8.903 -42.221  1.00  0.66           C  
ATOM   3106  CG  GLU A 399      28.783   7.814 -41.921  1.00  0.66           C  
ATOM   3107  CD  GLU A 399      28.435   6.458 -42.523  1.00  0.66           C  
ATOM   3108  OE1 GLU A 399      28.195   5.508 -41.736  1.00  0.66           O  
ATOM   3109  OE2 GLU A 399      28.407   6.309 -43.771  1.00  0.66           O  
ATOM   3110  N   VAL A 400      26.082  11.745 -41.476  1.00  0.67           N  
ATOM   3111  CA  VAL A 400      25.062  12.674 -41.969  1.00  0.67           C  
ATOM   3112  C   VAL A 400      25.585  14.052 -42.391  1.00  0.67           C  
ATOM   3113  O   VAL A 400      25.217  14.458 -43.495  1.00  0.67           O  
ATOM   3114  CB  VAL A 400      23.873  12.812 -41.006  1.00  0.67           C  
ATOM   3115  CG1 VAL A 400      22.831  13.845 -41.491  1.00  0.67           C  
ATOM   3116  CG2 VAL A 400      23.184  11.448 -40.864  1.00  0.67           C  
ATOM   3117  N   PRO A 401      26.443  14.816 -41.694  1.00  0.65           N  
ATOM   3118  CA  PRO A 401      26.974  16.074 -42.211  1.00  0.65           C  
ATOM   3119  C   PRO A 401      27.754  15.948 -43.499  1.00  0.65           C  
ATOM   3120  O   PRO A 401      27.639  16.820 -44.358  1.00  0.65           O  
ATOM   3121  CB  PRO A 401      27.867  16.604 -41.076  1.00  0.65           C  
ATOM   3122  CG  PRO A 401      27.221  16.047 -39.808  1.00  0.65           C  
ATOM   3123  CD  PRO A 401      26.706  14.679 -40.259  1.00  0.65           C  
ATOM   3124  N   LEU A 402      28.558  14.880 -43.649  1.00  0.61           N  
ATOM   3125  CA  LEU A 402      29.356  14.632 -44.833  1.00  0.61           C  
ATOM   3126  C   LEU A 402      28.497  14.322 -46.050  1.00  0.61           C  
ATOM   3127  O   LEU A 402      28.639  14.923 -47.114  1.00  0.61           O  
ATOM   3128  CB  LEU A 402      30.309  13.439 -44.564  1.00  0.61           C  
ATOM   3129  CG  LEU A 402      31.284  13.651 -43.385  1.00  0.61           C  
ATOM   3130  CD1 LEU A 402      31.995  12.335 -43.039  1.00  0.61           C  
ATOM   3131  CD2 LEU A 402      32.313  14.752 -43.681  1.00  0.61           C  
ATOM   3132  N   LEU A 403      27.522  13.409 -45.885  1.00  0.64           N  
ATOM   3133  CA  LEU A 403      26.574  13.037 -46.917  1.00  0.64           C  
ATOM   3134  C   LEU A 403      25.644  14.181 -47.303  1.00  0.64           C  
ATOM   3135  O   LEU A 403      25.411  14.455 -48.478  1.00  0.64           O  
ATOM   3136  CB  LEU A 403      25.762  11.808 -46.444  1.00  0.64           C  
ATOM   3137  CG  LEU A 403      26.622  10.548 -46.194  1.00  0.64           C  
ATOM   3138  CD1 LEU A 403      25.827   9.490 -45.416  1.00  0.64           C  
ATOM   3139  CD2 LEU A 403      27.171   9.957 -47.499  1.00  0.64           C  
ATOM   3140  N   LEU A 404      25.119  14.932 -46.313  1.00  0.65           N  
ATOM   3141  CA  LEU A 404      24.302  16.106 -46.555  1.00  0.65           C  
ATOM   3142  C   LEU A 404      25.060  17.248 -47.224  1.00  0.65           C  
ATOM   3143  O   LEU A 404      24.543  17.916 -48.120  1.00  0.65           O  
ATOM   3144  CB  LEU A 404      23.638  16.568 -45.237  1.00  0.65           C  
ATOM   3145  CG  LEU A 404      22.572  17.672 -45.380  1.00  0.65           C  
ATOM   3146  CD1 LEU A 404      21.524  17.329 -46.446  1.00  0.65           C  
ATOM   3147  CD2 LEU A 404      21.880  17.922 -44.034  1.00  0.65           C  
ATOM   3148  N   GLY A 405      26.332  17.486 -46.831  1.00  0.66           N  
ATOM   3149  CA  GLY A 405      27.277  18.346 -47.547  1.00  0.66           C  
ATOM   3150  C   GLY A 405      27.416  18.036 -49.019  1.00  0.66           C  
ATOM   3151  O   GLY A 405      27.237  18.907 -49.868  1.00  0.66           O  
ATOM   3152  N   GLU A 406      27.703  16.764 -49.348  1.00  0.60           N  
ATOM   3153  CA  GLU A 406      27.790  16.266 -50.713  1.00  0.60           C  
ATOM   3154  C   GLU A 406      26.473  16.314 -51.494  1.00  0.60           C  
ATOM   3155  O   GLU A 406      26.445  16.532 -52.707  1.00  0.60           O  
ATOM   3156  CB  GLU A 406      28.415  14.846 -50.747  1.00  0.60           C  
ATOM   3157  CG  GLU A 406      29.973  14.835 -50.660  1.00  0.60           C  
ATOM   3158  CD  GLU A 406      30.657  15.308 -51.938  1.00  0.60           C  
ATOM   3159  OE1 GLU A 406      30.568  16.528 -52.247  1.00  0.60           O  
ATOM   3160  OE2 GLU A 406      31.163  14.463 -52.724  1.00  0.60           O  
ATOM   3161  N   ALA A 407      25.312  16.134 -50.840  1.00  0.61           N  
ATOM   3162  CA  ALA A 407      24.037  16.404 -51.476  1.00  0.61           C  
ATOM   3163  C   ALA A 407      23.859  17.873 -51.868  1.00  0.61           C  
ATOM   3164  O   ALA A 407      23.521  18.206 -53.003  1.00  0.61           O  
ATOM   3165  CB  ALA A 407      22.918  15.983 -50.511  1.00  0.61           C  
ATOM   3166  N   ARG A 408      24.166  18.795 -50.937  1.00  0.55           N  
ATOM   3167  CA  ARG A 408      24.078  20.235 -51.117  1.00  0.55           C  
ATOM   3168  C   ARG A 408      25.036  20.793 -52.166  1.00  0.55           C  
ATOM   3169  O   ARG A 408      24.677  21.684 -52.934  1.00  0.55           O  
ATOM   3170  CB  ARG A 408      24.239  20.947 -49.753  1.00  0.55           C  
ATOM   3171  CG  ARG A 408      23.021  20.726 -48.826  1.00  0.55           C  
ATOM   3172  CD  ARG A 408      23.296  21.134 -47.380  1.00  0.55           C  
ATOM   3173  NE  ARG A 408      22.014  21.030 -46.604  1.00  0.55           N  
ATOM   3174  CZ  ARG A 408      21.923  21.401 -45.321  1.00  0.55           C  
ATOM   3175  NH1 ARG A 408      23.017  21.642 -44.612  1.00  0.55           N  
ATOM   3176  NH2 ARG A 408      20.740  21.580 -44.747  1.00  0.55           N  
ATOM   3177  N   SER A 409      26.266  20.244 -52.287  1.00  0.59           N  
ATOM   3178  CA  SER A 409      27.256  20.653 -53.291  1.00  0.59           C  
ATOM   3179  C   SER A 409      26.830  20.343 -54.730  1.00  0.59           C  
ATOM   3180  O   SER A 409      27.354  20.885 -55.708  1.00  0.59           O  
ATOM   3181  CB  SER A 409      28.658  20.019 -53.022  1.00  0.59           C  
ATOM   3182  OG  SER A 409      28.666  18.606 -53.242  1.00  0.59           O  
ATOM   3183  N   ARG A 410      25.821  19.468 -54.892  1.00  0.51           N  
ATOM   3184  CA  ARG A 410      25.237  19.089 -56.160  1.00  0.51           C  
ATOM   3185  C   ARG A 410      23.782  19.525 -56.278  1.00  0.51           C  
ATOM   3186  O   ARG A 410      23.066  19.045 -57.153  1.00  0.51           O  
ATOM   3187  CB  ARG A 410      25.348  17.559 -56.322  1.00  0.51           C  
ATOM   3188  CG  ARG A 410      26.808  17.076 -56.409  1.00  0.51           C  
ATOM   3189  CD  ARG A 410      26.935  15.548 -56.374  1.00  0.51           C  
ATOM   3190  NE  ARG A 410      28.392  15.185 -56.379  1.00  0.51           N  
ATOM   3191  CZ  ARG A 410      29.138  15.248 -55.266  1.00  0.51           C  
ATOM   3192  NH1 ARG A 410      28.671  15.752 -54.136  1.00  0.51           N  
ATOM   3193  NH2 ARG A 410      30.383  14.784 -55.238  1.00  0.51           N  
ATOM   3194  N   GLN A 411      23.339  20.468 -55.416  1.00  0.49           N  
ATOM   3195  CA  GLN A 411      22.011  21.072 -55.429  1.00  0.49           C  
ATOM   3196  C   GLN A 411      20.871  20.127 -55.051  1.00  0.49           C  
ATOM   3197  O   GLN A 411      19.787  20.136 -55.632  1.00  0.49           O  
ATOM   3198  CB  GLN A 411      21.708  21.873 -56.727  1.00  0.49           C  
ATOM   3199  CG  GLN A 411      22.715  23.020 -56.991  1.00  0.49           C  
ATOM   3200  CD  GLN A 411      22.388  23.771 -58.283  1.00  0.49           C  
ATOM   3201  OE1 GLN A 411      21.480  23.437 -59.040  1.00  0.49           O  
ATOM   3202  NE2 GLN A 411      23.170  24.841 -58.564  1.00  0.49           N  
ATOM   3203  N   ALA A 412      21.090  19.316 -54.003  1.00  0.48           N  
ATOM   3204  CA  ALA A 412      20.075  18.515 -53.362  1.00  0.48           C  
ATOM   3205  C   ALA A 412      20.199  18.709 -51.854  1.00  0.48           C  
ATOM   3206  O   ALA A 412      20.692  19.731 -51.376  1.00  0.48           O  
ATOM   3207  CB  ALA A 412      20.258  17.036 -53.758  1.00  0.48           C  
ATOM   3208  N   GLY A 413      19.743  17.739 -51.036  1.00  0.50           N  
ATOM   3209  CA  GLY A 413      19.836  17.825 -49.584  1.00  0.50           C  
ATOM   3210  C   GLY A 413      18.560  18.287 -48.954  1.00  0.50           C  
ATOM   3211  O   GLY A 413      18.469  18.395 -47.734  1.00  0.50           O  
ATOM   3212  N   SER A 414      17.528  18.581 -49.760  1.00  0.58           N  
ATOM   3213  CA  SER A 414      16.222  19.036 -49.311  1.00  0.58           C  
ATOM   3214  C   SER A 414      15.437  17.992 -48.540  1.00  0.58           C  
ATOM   3215  O   SER A 414      14.793  18.322 -47.546  1.00  0.58           O  
ATOM   3216  CB  SER A 414      15.354  19.601 -50.469  1.00  0.58           C  
ATOM   3217  OG  SER A 414      15.212  18.669 -51.543  1.00  0.58           O  
ATOM   3218  N   LEU A 415      15.485  16.707 -48.951  1.00  0.50           N  
ATOM   3219  CA  LEU A 415      14.745  15.631 -48.311  1.00  0.50           C  
ATOM   3220  C   LEU A 415      15.214  15.375 -46.883  1.00  0.50           C  
ATOM   3221  O   LEU A 415      14.431  15.305 -45.931  1.00  0.50           O  
ATOM   3222  CB  LEU A 415      14.905  14.350 -49.165  1.00  0.50           C  
ATOM   3223  CG  LEU A 415      14.156  13.102 -48.663  1.00  0.50           C  
ATOM   3224  CD1 LEU A 415      12.630  13.248 -48.737  1.00  0.50           C  
ATOM   3225  CD2 LEU A 415      14.620  11.867 -49.449  1.00  0.50           C  
ATOM   3226  N   THR A 416      16.543  15.301 -46.685  1.00  0.55           N  
ATOM   3227  CA  THR A 416      17.153  15.224 -45.361  1.00  0.55           C  
ATOM   3228  C   THR A 416      16.929  16.475 -44.546  1.00  0.55           C  
ATOM   3229  O   THR A 416      16.572  16.404 -43.372  1.00  0.55           O  
ATOM   3230  CB  THR A 416      18.650  15.003 -45.414  1.00  0.55           C  
ATOM   3231  OG1 THR A 416      18.934  13.845 -46.171  1.00  0.55           O  
ATOM   3232  CG2 THR A 416      19.241  14.746 -44.017  1.00  0.55           C  
ATOM   3233  N   THR A 417      17.098  17.672 -45.155  1.00  0.60           N  
ATOM   3234  CA  THR A 417      16.949  18.955 -44.453  1.00  0.60           C  
ATOM   3235  C   THR A 417      15.561  19.140 -43.882  1.00  0.60           C  
ATOM   3236  O   THR A 417      15.416  19.367 -42.685  1.00  0.60           O  
ATOM   3237  CB  THR A 417      17.287  20.171 -45.312  1.00  0.60           C  
ATOM   3238  OG1 THR A 417      18.630  20.085 -45.766  1.00  0.60           O  
ATOM   3239  CG2 THR A 417      17.218  21.471 -44.513  1.00  0.60           C  
ATOM   3240  N   ALA A 418      14.509  18.901 -44.694  1.00  0.59           N  
ATOM   3241  CA  ALA A 418      13.123  18.976 -44.270  1.00  0.59           C  
ATOM   3242  C   ALA A 418      12.781  17.986 -43.162  1.00  0.59           C  
ATOM   3243  O   ALA A 418      12.033  18.270 -42.228  1.00  0.59           O  
ATOM   3244  CB  ALA A 418      12.215  18.717 -45.489  1.00  0.59           C  
ATOM   3245  N   THR A 419      13.358  16.770 -43.230  1.00  0.59           N  
ATOM   3246  CA  THR A 419      13.232  15.755 -42.185  1.00  0.59           C  
ATOM   3247  C   THR A 419      13.835  16.193 -40.858  1.00  0.59           C  
ATOM   3248  O   THR A 419      13.225  16.040 -39.800  1.00  0.59           O  
ATOM   3249  CB  THR A 419      13.866  14.429 -42.581  1.00  0.59           C  
ATOM   3250  OG1 THR A 419      13.295  13.956 -43.793  1.00  0.59           O  
ATOM   3251  CG2 THR A 419      13.562  13.345 -41.537  1.00  0.59           C  
ATOM   3252  N   VAL A 420      15.044  16.791 -40.888  1.00  0.64           N  
ATOM   3253  CA  VAL A 420      15.720  17.373 -39.734  1.00  0.64           C  
ATOM   3254  C   VAL A 420      14.979  18.570 -39.143  1.00  0.64           C  
ATOM   3255  O   VAL A 420      14.820  18.669 -37.928  1.00  0.64           O  
ATOM   3256  CB  VAL A 420      17.164  17.728 -40.089  1.00  0.64           C  
ATOM   3257  CG1 VAL A 420      17.867  18.521 -38.969  1.00  0.64           C  
ATOM   3258  CG2 VAL A 420      17.940  16.418 -40.335  1.00  0.64           C  
ATOM   3259  N   GLU A 421      14.460  19.491 -39.978  1.00  0.51           N  
ATOM   3260  CA  GLU A 421      13.621  20.603 -39.547  1.00  0.51           C  
ATOM   3261  C   GLU A 421      12.311  20.149 -38.908  1.00  0.51           C  
ATOM   3262  O   GLU A 421      11.939  20.595 -37.826  1.00  0.51           O  
ATOM   3263  CB  GLU A 421      13.349  21.530 -40.752  1.00  0.51           C  
ATOM   3264  CG  GLU A 421      14.632  22.265 -41.220  1.00  0.51           C  
ATOM   3265  CD  GLU A 421      14.542  22.853 -42.627  1.00  0.51           C  
ATOM   3266  OE1 GLU A 421      15.367  23.760 -42.912  1.00  0.51           O  
ATOM   3267  OE2 GLU A 421      13.727  22.359 -43.448  1.00  0.51           O  
ATOM   3268  N   SER A 422      11.624  19.157 -39.515  1.00  0.51           N  
ATOM   3269  CA  SER A 422      10.431  18.525 -38.951  1.00  0.51           C  
ATOM   3270  C   SER A 422      10.691  17.854 -37.607  1.00  0.51           C  
ATOM   3271  O   SER A 422       9.888  17.950 -36.681  1.00  0.51           O  
ATOM   3272  CB  SER A 422       9.811  17.504 -39.947  1.00  0.51           C  
ATOM   3273  OG  SER A 422       8.563  16.963 -39.496  1.00  0.51           O  
ATOM   3274  N   LEU A 423      11.855  17.189 -37.429  1.00  0.49           N  
ATOM   3275  CA  LEU A 423      12.301  16.761 -36.112  1.00  0.49           C  
ATOM   3276  C   LEU A 423      12.515  17.915 -35.138  1.00  0.49           C  
ATOM   3277  O   LEU A 423      12.018  17.875 -34.020  1.00  0.49           O  
ATOM   3278  CB  LEU A 423      13.637  15.977 -36.203  1.00  0.49           C  
ATOM   3279  CG  LEU A 423      13.480  14.507 -36.622  1.00  0.49           C  
ATOM   3280  CD1 LEU A 423      14.817  13.932 -37.108  1.00  0.49           C  
ATOM   3281  CD2 LEU A 423      12.938  13.656 -35.463  1.00  0.49           C  
ATOM   3282  N   ALA A 424      13.221  18.989 -35.540  1.00  0.51           N  
ATOM   3283  CA  ALA A 424      13.571  20.103 -34.677  1.00  0.51           C  
ATOM   3284  C   ALA A 424      12.390  20.872 -34.090  1.00  0.51           C  
ATOM   3285  O   ALA A 424      12.339  21.110 -32.882  1.00  0.51           O  
ATOM   3286  CB  ALA A 424      14.463  21.076 -35.466  1.00  0.51           C  
ATOM   3287  N   ASP A 425      11.382  21.200 -34.923  1.00  0.43           N  
ATOM   3288  CA  ASP A 425      10.148  21.864 -34.534  1.00  0.43           C  
ATOM   3289  C   ASP A 425       9.326  21.052 -33.539  1.00  0.43           C  
ATOM   3290  O   ASP A 425       8.567  21.576 -32.725  1.00  0.43           O  
ATOM   3291  CB  ASP A 425       9.271  22.103 -35.789  1.00  0.43           C  
ATOM   3292  CG  ASP A 425       9.807  23.221 -36.669  1.00  0.43           C  
ATOM   3293  OD1 ASP A 425      10.806  23.880 -36.289  1.00  0.43           O  
ATOM   3294  OD2 ASP A 425       9.165  23.438 -37.729  1.00  0.43           O  
ATOM   3295  N   ARG A 426       9.458  19.716 -33.592  1.00  0.30           N  
ATOM   3296  CA  ARG A 426       8.691  18.796 -32.785  1.00  0.30           C  
ATOM   3297  C   ARG A 426       9.521  18.206 -31.641  1.00  0.30           C  
ATOM   3298  O   ARG A 426       9.039  17.376 -30.873  1.00  0.30           O  
ATOM   3299  CB  ARG A 426       8.101  17.724 -33.729  1.00  0.30           C  
ATOM   3300  CG  ARG A 426       7.177  18.352 -34.807  1.00  0.30           C  
ATOM   3301  CD  ARG A 426       6.788  17.360 -35.899  1.00  0.30           C  
ATOM   3302  NE  ARG A 426       5.872  18.000 -36.871  1.00  0.30           N  
ATOM   3303  CZ  ARG A 426       5.050  17.265 -37.623  1.00  0.30           C  
ATOM   3304  NH1 ARG A 426       5.196  15.950 -37.775  1.00  0.30           N  
ATOM   3305  NH2 ARG A 426       3.937  17.840 -38.054  1.00  0.30           N  
ATOM   3306  N   LEU A 427      10.769  18.690 -31.454  1.00  0.30           N  
ATOM   3307  CA  LEU A 427      11.640  18.373 -30.328  1.00  0.30           C  
ATOM   3308  C   LEU A 427      11.958  19.535 -29.357  1.00  0.30           C  
ATOM   3309  O   LEU A 427      12.914  19.342 -28.599  1.00  0.30           O  
ATOM   3310  CB  LEU A 427      13.000  17.835 -30.870  1.00  0.30           C  
ATOM   3311  CG  LEU A 427      12.985  16.379 -31.380  1.00  0.30           C  
ATOM   3312  CD1 LEU A 427      14.287  16.090 -32.143  1.00  0.30           C  
ATOM   3313  CD2 LEU A 427      12.824  15.375 -30.228  1.00  0.30           C  
ATOM   3314  N   PRO A 428      11.332  20.725 -29.214  1.00  0.27           N  
ATOM   3315  CA  PRO A 428      11.887  21.823 -28.415  1.00  0.27           C  
ATOM   3316  C   PRO A 428      12.037  21.506 -26.938  1.00  0.27           C  
ATOM   3317  O   PRO A 428      12.934  22.057 -26.308  1.00  0.27           O  
ATOM   3318  CB  PRO A 428      10.926  23.004 -28.655  1.00  0.27           C  
ATOM   3319  CG  PRO A 428       9.605  22.347 -29.063  1.00  0.27           C  
ATOM   3320  CD  PRO A 428      10.079  21.131 -29.852  1.00  0.27           C  
ATOM   3321  N   SER A 429      11.196  20.611 -26.386  1.00  0.27           N  
ATOM   3322  CA  SER A 429      11.166  20.255 -24.976  1.00  0.27           C  
ATOM   3323  C   SER A 429      12.073  19.084 -24.634  1.00  0.27           C  
ATOM   3324  O   SER A 429      11.965  18.481 -23.568  1.00  0.27           O  
ATOM   3325  CB  SER A 429       9.726  19.911 -24.508  1.00  0.27           C  
ATOM   3326  OG  SER A 429       9.109  18.939 -25.360  1.00  0.27           O  
ATOM   3327  N   TRP A 430      13.034  18.725 -25.516  1.00  0.24           N  
ATOM   3328  CA  TRP A 430      14.022  17.693 -25.233  1.00  0.24           C  
ATOM   3329  C   TRP A 430      14.943  18.034 -24.060  1.00  0.24           C  
ATOM   3330  O   TRP A 430      15.382  17.170 -23.306  1.00  0.24           O  
ATOM   3331  CB  TRP A 430      14.826  17.275 -26.504  1.00  0.24           C  
ATOM   3332  CG  TRP A 430      16.099  18.044 -26.855  1.00  0.24           C  
ATOM   3333  CD1 TRP A 430      16.282  19.114 -27.687  1.00  0.24           C  
ATOM   3334  CD2 TRP A 430      17.409  17.667 -26.386  1.00  0.24           C  
ATOM   3335  NE1 TRP A 430      17.629  19.424 -27.785  1.00  0.24           N  
ATOM   3336  CE2 TRP A 430      18.334  18.536 -26.995  1.00  0.24           C  
ATOM   3337  CE3 TRP A 430      17.831  16.650 -25.527  1.00  0.24           C  
ATOM   3338  CZ2 TRP A 430      19.701  18.394 -26.773  1.00  0.24           C  
ATOM   3339  CZ3 TRP A 430      19.208  16.515 -25.294  1.00  0.24           C  
ATOM   3340  CH2 TRP A 430      20.131  17.366 -25.918  1.00  0.24           C  
ATOM   3341  N   ARG A 431      15.247  19.332 -23.875  1.00  0.25           N  
ATOM   3342  CA  ARG A 431      16.067  19.817 -22.781  1.00  0.25           C  
ATOM   3343  C   ARG A 431      15.344  19.819 -21.447  1.00  0.25           C  
ATOM   3344  O   ARG A 431      15.974  19.744 -20.394  1.00  0.25           O  
ATOM   3345  CB  ARG A 431      16.523  21.258 -23.089  1.00  0.25           C  
ATOM   3346  CG  ARG A 431      17.503  21.320 -24.273  1.00  0.25           C  
ATOM   3347  CD  ARG A 431      17.927  22.749 -24.598  1.00  0.25           C  
ATOM   3348  NE  ARG A 431      19.061  22.631 -25.572  1.00  0.25           N  
ATOM   3349  CZ  ARG A 431      19.950  23.607 -25.795  1.00  0.25           C  
ATOM   3350  NH1 ARG A 431      19.750  24.838 -25.334  1.00  0.25           N  
ATOM   3351  NH2 ARG A 431      21.064  23.343 -26.474  1.00  0.25           N  
ATOM   3352  N   ASP A 432      14.002  19.861 -21.487  1.00  0.35           N  
ATOM   3353  CA  ASP A 432      13.135  19.958 -20.335  1.00  0.35           C  
ATOM   3354  C   ASP A 432      12.687  18.570 -19.894  1.00  0.35           C  
ATOM   3355  O   ASP A 432      11.894  18.390 -18.969  1.00  0.35           O  
ATOM   3356  CB  ASP A 432      11.908  20.817 -20.714  1.00  0.35           C  
ATOM   3357  CG  ASP A 432      12.400  22.123 -21.308  1.00  0.35           C  
ATOM   3358  OD1 ASP A 432      12.802  23.022 -20.531  1.00  0.35           O  
ATOM   3359  OD2 ASP A 432      12.417  22.202 -22.564  1.00  0.35           O  
ATOM   3360  N   LEU A 433      13.234  17.516 -20.537  1.00  0.34           N  
ATOM   3361  CA  LEU A 433      13.187  16.165 -20.023  1.00  0.34           C  
ATOM   3362  C   LEU A 433      13.913  16.063 -18.679  1.00  0.34           C  
ATOM   3363  O   LEU A 433      15.007  16.618 -18.553  1.00  0.34           O  
ATOM   3364  CB  LEU A 433      13.841  15.162 -21.009  1.00  0.34           C  
ATOM   3365  CG  LEU A 433      13.095  14.986 -22.347  1.00  0.34           C  
ATOM   3366  CD1 LEU A 433      13.896  14.073 -23.288  1.00  0.34           C  
ATOM   3367  CD2 LEU A 433      11.688  14.422 -22.132  1.00  0.34           C  
ATOM   3368  N   PRO A 434      13.394  15.409 -17.637  1.00  0.45           N  
ATOM   3369  CA  PRO A 434      14.157  15.190 -16.414  1.00  0.45           C  
ATOM   3370  C   PRO A 434      15.448  14.424 -16.658  1.00  0.45           C  
ATOM   3371  O   PRO A 434      15.412  13.285 -17.118  1.00  0.45           O  
ATOM   3372  CB  PRO A 434      13.178  14.433 -15.503  1.00  0.45           C  
ATOM   3373  CG  PRO A 434      12.288  13.660 -16.481  1.00  0.45           C  
ATOM   3374  CD  PRO A 434      12.161  14.618 -17.666  1.00  0.45           C  
ATOM   3375  N   GLN A 435      16.603  15.019 -16.317  1.00  0.41           N  
ATOM   3376  CA  GLN A 435      17.884  14.378 -16.512  1.00  0.41           C  
ATOM   3377  C   GLN A 435      18.170  13.436 -15.363  1.00  0.41           C  
ATOM   3378  O   GLN A 435      18.014  13.778 -14.193  1.00  0.41           O  
ATOM   3379  CB  GLN A 435      19.026  15.404 -16.696  1.00  0.41           C  
ATOM   3380  CG  GLN A 435      18.809  16.298 -17.941  1.00  0.41           C  
ATOM   3381  CD  GLN A 435      20.022  17.181 -18.236  1.00  0.41           C  
ATOM   3382  OE1 GLN A 435      21.000  17.253 -17.494  1.00  0.41           O  
ATOM   3383  NE2 GLN A 435      19.963  17.892 -19.387  1.00  0.41           N  
ATOM   3384  N   THR A 436      18.534  12.187 -15.689  1.00  0.48           N  
ATOM   3385  CA  THR A 436      18.648  11.101 -14.733  1.00  0.48           C  
ATOM   3386  C   THR A 436      19.846  11.211 -13.814  1.00  0.48           C  
ATOM   3387  O   THR A 436      21.001  11.229 -14.234  1.00  0.48           O  
ATOM   3388  CB  THR A 436      18.607   9.732 -15.404  1.00  0.48           C  
ATOM   3389  OG1 THR A 436      19.318   9.741 -16.635  1.00  0.48           O  
ATOM   3390  CG2 THR A 436      17.143   9.431 -15.754  1.00  0.48           C  
ATOM   3391  N   SER A 437      19.561  11.299 -12.506  1.00  0.47           N  
ATOM   3392  CA  SER A 437      20.532  11.292 -11.435  1.00  0.47           C  
ATOM   3393  C   SER A 437      20.316  10.014 -10.590  1.00  0.47           C  
ATOM   3394  O   SER A 437      19.206   9.893  -9.992  1.00  0.47           O  
ATOM   3395  CB  SER A 437      20.347  12.511 -10.492  1.00  0.47           C  
ATOM   3396  OG  SER A 437      19.027  12.527  -9.951  1.00  0.47           O  
ATOM   3397  OXT SER A 437      21.247   9.172 -10.518  1.00  0.47           O  
TER    3398      SER A 437                                                      
ATOM   3399  N   MET B   1      53.485   0.679 -84.490  1.00  0.73           N  
ATOM   3400  CA  MET B   1      53.156   0.880 -83.040  1.00  0.73           C  
ATOM   3401  C   MET B   1      51.659   1.127 -82.856  1.00  0.73           C  
ATOM   3402  O   MET B   1      50.994   1.465 -83.830  1.00  0.73           O  
ATOM   3403  CB  MET B   1      54.044   2.069 -82.563  1.00  0.73           C  
ATOM   3404  CG  MET B   1      53.828   2.546 -81.119  1.00  0.73           C  
ATOM   3405  SD  MET B   1      54.843   3.971 -80.619  1.00  0.73           S  
ATOM   3406  CE  MET B   1      56.375   3.031 -80.387  1.00  0.73           C  
ATOM   3407  N   LYS B   2      51.060   0.957 -81.655  1.00  0.74           N  
ATOM   3408  CA  LYS B   2      49.651   1.260 -81.440  1.00  0.74           C  
ATOM   3409  C   LYS B   2      49.429   2.666 -80.897  1.00  0.74           C  
ATOM   3410  O   LYS B   2      50.333   3.328 -80.391  1.00  0.74           O  
ATOM   3411  CB  LYS B   2      48.991   0.266 -80.453  1.00  0.74           C  
ATOM   3412  CG  LYS B   2      49.004  -1.203 -80.901  1.00  0.74           C  
ATOM   3413  CD  LYS B   2      48.169  -1.391 -82.170  1.00  0.74           C  
ATOM   3414  CE  LYS B   2      47.915  -2.844 -82.567  1.00  0.74           C  
ATOM   3415  NZ  LYS B   2      47.078  -2.852 -83.775  1.00  0.74           N  
ATOM   3416  N   PHE B   3      48.184   3.179 -81.000  1.00  0.77           N  
ATOM   3417  CA  PHE B   3      47.793   4.477 -80.469  1.00  0.77           C  
ATOM   3418  C   PHE B   3      47.894   4.563 -78.946  1.00  0.77           C  
ATOM   3419  O   PHE B   3      48.289   5.595 -78.405  1.00  0.77           O  
ATOM   3420  CB  PHE B   3      46.384   4.877 -80.994  1.00  0.77           C  
ATOM   3421  CG  PHE B   3      45.940   6.272 -80.596  1.00  0.77           C  
ATOM   3422  CD1 PHE B   3      44.637   6.478 -80.109  1.00  0.77           C  
ATOM   3423  CD2 PHE B   3      46.801   7.381 -80.693  1.00  0.77           C  
ATOM   3424  CE1 PHE B   3      44.206   7.750 -79.712  1.00  0.77           C  
ATOM   3425  CE2 PHE B   3      46.381   8.651 -80.274  1.00  0.77           C  
ATOM   3426  CZ  PHE B   3      45.082   8.837 -79.790  1.00  0.77           C  
ATOM   3427  N   SER B   4      47.602   3.464 -78.215  1.00  0.80           N  
ATOM   3428  CA  SER B   4      47.840   3.366 -76.774  1.00  0.80           C  
ATOM   3429  C   SER B   4      49.273   3.663 -76.380  1.00  0.80           C  
ATOM   3430  O   SER B   4      49.540   4.522 -75.546  1.00  0.80           O  
ATOM   3431  CB  SER B   4      47.521   1.938 -76.244  1.00  0.80           C  
ATOM   3432  OG  SER B   4      48.005   0.912 -77.123  1.00  0.80           O  
ATOM   3433  N   ASP B   5      50.232   3.021 -77.062  1.00  0.80           N  
ATOM   3434  CA  ASP B   5      51.654   3.100 -76.832  1.00  0.80           C  
ATOM   3435  C   ASP B   5      52.164   4.526 -77.011  1.00  0.80           C  
ATOM   3436  O   ASP B   5      53.001   5.026 -76.261  1.00  0.80           O  
ATOM   3437  CB  ASP B   5      52.407   2.193 -77.852  1.00  0.80           C  
ATOM   3438  CG  ASP B   5      51.766   0.845 -78.167  1.00  0.80           C  
ATOM   3439  OD1 ASP B   5      50.804   0.416 -77.483  1.00  0.80           O  
ATOM   3440  OD2 ASP B   5      52.201   0.277 -79.207  1.00  0.80           O  
ATOM   3441  N   VAL B   6      51.644   5.213 -78.048  1.00  0.83           N  
ATOM   3442  CA  VAL B   6      51.891   6.613 -78.344  1.00  0.83           C  
ATOM   3443  C   VAL B   6      51.393   7.547 -77.250  1.00  0.83           C  
ATOM   3444  O   VAL B   6      52.114   8.450 -76.828  1.00  0.83           O  
ATOM   3445  CB  VAL B   6      51.252   6.974 -79.683  1.00  0.83           C  
ATOM   3446  CG1 VAL B   6      51.302   8.481 -79.986  1.00  0.83           C  
ATOM   3447  CG2 VAL B   6      52.004   6.225 -80.790  1.00  0.83           C  
ATOM   3448  N   LEU B   7      50.164   7.344 -76.730  1.00  0.80           N  
ATOM   3449  CA  LEU B   7      49.654   8.117 -75.607  1.00  0.80           C  
ATOM   3450  C   LEU B   7      50.427   7.879 -74.319  1.00  0.80           C  
ATOM   3451  O   LEU B   7      50.829   8.832 -73.653  1.00  0.80           O  
ATOM   3452  CB  LEU B   7      48.151   7.841 -75.351  1.00  0.80           C  
ATOM   3453  CG  LEU B   7      47.200   8.319 -76.470  1.00  0.80           C  
ATOM   3454  CD1 LEU B   7      45.759   7.909 -76.136  1.00  0.80           C  
ATOM   3455  CD2 LEU B   7      47.271   9.837 -76.701  1.00  0.80           C  
ATOM   3456  N   ASP B   8      50.723   6.614 -73.970  1.00  0.78           N  
ATOM   3457  CA  ASP B   8      51.479   6.259 -72.782  1.00  0.78           C  
ATOM   3458  C   ASP B   8      52.892   6.843 -72.791  1.00  0.78           C  
ATOM   3459  O   ASP B   8      53.359   7.408 -71.806  1.00  0.78           O  
ATOM   3460  CB  ASP B   8      51.539   4.717 -72.642  1.00  0.78           C  
ATOM   3461  CG  ASP B   8      50.180   4.124 -72.291  1.00  0.78           C  
ATOM   3462  OD1 ASP B   8      49.229   4.895 -72.007  1.00  0.78           O  
ATOM   3463  OD2 ASP B   8      50.101   2.870 -72.281  1.00  0.78           O  
ATOM   3464  N   GLN B   9      53.600   6.785 -73.939  1.00  0.75           N  
ATOM   3465  CA  GLN B   9      54.881   7.452 -74.118  1.00  0.75           C  
ATOM   3466  C   GLN B   9      54.804   8.976 -74.054  1.00  0.75           C  
ATOM   3467  O   GLN B   9      55.630   9.607 -73.401  1.00  0.75           O  
ATOM   3468  CB  GLN B   9      55.581   6.965 -75.408  1.00  0.75           C  
ATOM   3469  CG  GLN B   9      56.102   5.516 -75.240  1.00  0.75           C  
ATOM   3470  CD  GLN B   9      56.542   4.883 -76.561  1.00  0.75           C  
ATOM   3471  OE1 GLN B   9      57.690   4.972 -76.997  1.00  0.75           O  
ATOM   3472  NE2 GLN B   9      55.586   4.200 -77.229  1.00  0.75           N  
ATOM   3473  N   ALA B  10      53.775   9.608 -74.660  1.00  0.83           N  
ATOM   3474  CA  ALA B  10      53.528  11.038 -74.543  1.00  0.83           C  
ATOM   3475  C   ALA B  10      53.281  11.495 -73.104  1.00  0.83           C  
ATOM   3476  O   ALA B  10      53.788  12.516 -72.637  1.00  0.83           O  
ATOM   3477  CB  ALA B  10      52.305  11.418 -75.403  1.00  0.83           C  
ATOM   3478  N   TRP B  11      52.517  10.712 -72.326  1.00  0.68           N  
ATOM   3479  CA  TRP B  11      52.274  10.972 -70.920  1.00  0.68           C  
ATOM   3480  C   TRP B  11      53.468  10.662 -70.017  1.00  0.68           C  
ATOM   3481  O   TRP B  11      53.495  11.139 -68.891  1.00  0.68           O  
ATOM   3482  CB  TRP B  11      51.005  10.223 -70.436  1.00  0.68           C  
ATOM   3483  CG  TRP B  11      49.709  10.947 -70.784  1.00  0.68           C  
ATOM   3484  CD1 TRP B  11      48.861  10.786 -71.848  1.00  0.68           C  
ATOM   3485  CD2 TRP B  11      49.146  11.994 -69.973  1.00  0.68           C  
ATOM   3486  NE1 TRP B  11      47.809  11.675 -71.758  1.00  0.68           N  
ATOM   3487  CE2 TRP B  11      47.956  12.417 -70.612  1.00  0.68           C  
ATOM   3488  CE3 TRP B  11      49.561  12.574 -68.775  1.00  0.68           C  
ATOM   3489  CZ2 TRP B  11      47.170  13.416 -70.062  1.00  0.68           C  
ATOM   3490  CZ3 TRP B  11      48.762  13.585 -68.221  1.00  0.68           C  
ATOM   3491  CH2 TRP B  11      47.582  14.002 -68.857  1.00  0.68           C  
ATOM   3492  N   ALA B  12      54.491   9.922 -70.499  1.00  0.75           N  
ATOM   3493  CA  ALA B  12      55.681   9.561 -69.738  1.00  0.75           C  
ATOM   3494  C   ALA B  12      56.937  10.376 -70.085  1.00  0.75           C  
ATOM   3495  O   ALA B  12      58.039  10.093 -69.612  1.00  0.75           O  
ATOM   3496  CB  ALA B  12      55.972   8.064 -69.978  1.00  0.75           C  
ATOM   3497  N   GLU B  13      56.829  11.431 -70.921  1.00  0.67           N  
ATOM   3498  CA  GLU B  13      57.902  12.404 -71.121  1.00  0.67           C  
ATOM   3499  C   GLU B  13      58.156  13.325 -69.917  1.00  0.67           C  
ATOM   3500  O   GLU B  13      57.822  14.508 -69.934  1.00  0.67           O  
ATOM   3501  CB  GLU B  13      57.626  13.344 -72.317  1.00  0.67           C  
ATOM   3502  CG  GLU B  13      57.497  12.667 -73.697  1.00  0.67           C  
ATOM   3503  CD  GLU B  13      57.325  13.727 -74.773  1.00  0.67           C  
ATOM   3504  OE1 GLU B  13      57.734  13.484 -75.935  1.00  0.67           O  
ATOM   3505  OE2 GLU B  13      56.800  14.825 -74.460  1.00  0.67           O  
ATOM   3506  N   ASP B  14      58.758  12.803 -68.834  1.00  0.57           N  
ATOM   3507  CA  ASP B  14      58.898  13.549 -67.591  1.00  0.57           C  
ATOM   3508  C   ASP B  14      60.336  13.998 -67.333  1.00  0.57           C  
ATOM   3509  O   ASP B  14      60.658  14.635 -66.332  1.00  0.57           O  
ATOM   3510  CB  ASP B  14      58.365  12.674 -66.434  1.00  0.57           C  
ATOM   3511  CG  ASP B  14      56.909  12.339 -66.734  1.00  0.57           C  
ATOM   3512  OD1 ASP B  14      56.145  13.267 -67.130  1.00  0.57           O  
ATOM   3513  OD2 ASP B  14      56.564  11.137 -66.622  1.00  0.57           O  
ATOM   3514  N   SER B  15      61.261  13.717 -68.268  1.00  0.54           N  
ATOM   3515  CA  SER B  15      62.684  14.005 -68.143  1.00  0.54           C  
ATOM   3516  C   SER B  15      63.086  15.375 -68.679  1.00  0.54           C  
ATOM   3517  O   SER B  15      64.197  15.574 -69.165  1.00  0.54           O  
ATOM   3518  CB  SER B  15      63.536  12.897 -68.824  1.00  0.54           C  
ATOM   3519  OG  SER B  15      63.036  12.577 -70.126  1.00  0.54           O  
ATOM   3520  N   GLY B  16      62.199  16.384 -68.567  1.00  0.60           N  
ATOM   3521  CA  GLY B  16      62.472  17.731 -69.043  1.00  0.60           C  
ATOM   3522  C   GLY B  16      61.179  18.438 -69.331  1.00  0.60           C  
ATOM   3523  O   GLY B  16      60.155  18.075 -68.754  1.00  0.60           O  
ATOM   3524  N   PRO B  17      61.135  19.441 -70.200  1.00  0.63           N  
ATOM   3525  CA  PRO B  17      59.883  19.878 -70.800  1.00  0.63           C  
ATOM   3526  C   PRO B  17      59.400  18.820 -71.797  1.00  0.63           C  
ATOM   3527  O   PRO B  17      60.259  18.204 -72.430  1.00  0.63           O  
ATOM   3528  CB  PRO B  17      60.264  21.204 -71.483  1.00  0.63           C  
ATOM   3529  CG  PRO B  17      61.739  21.027 -71.865  1.00  0.63           C  
ATOM   3530  CD  PRO B  17      62.298  20.157 -70.734  1.00  0.63           C  
ATOM   3531  N   PRO B  18      58.109  18.530 -71.944  1.00  0.75           N  
ATOM   3532  CA  PRO B  18      57.629  17.600 -72.959  1.00  0.75           C  
ATOM   3533  C   PRO B  18      57.879  18.085 -74.378  1.00  0.75           C  
ATOM   3534  O   PRO B  18      58.104  19.276 -74.608  1.00  0.75           O  
ATOM   3535  CB  PRO B  18      56.127  17.501 -72.647  1.00  0.75           C  
ATOM   3536  CG  PRO B  18      55.772  18.900 -72.144  1.00  0.75           C  
ATOM   3537  CD  PRO B  18      57.013  19.291 -71.337  1.00  0.75           C  
ATOM   3538  N   THR B  19      57.827  17.169 -75.359  1.00  0.79           N  
ATOM   3539  CA  THR B  19      57.950  17.500 -76.771  1.00  0.79           C  
ATOM   3540  C   THR B  19      56.689  18.179 -77.262  1.00  0.79           C  
ATOM   3541  O   THR B  19      55.653  18.176 -76.601  1.00  0.79           O  
ATOM   3542  CB  THR B  19      58.302  16.329 -77.699  1.00  0.79           C  
ATOM   3543  OG1 THR B  19      57.290  15.337 -77.800  1.00  0.79           O  
ATOM   3544  CG2 THR B  19      59.599  15.658 -77.226  1.00  0.79           C  
ATOM   3545  N   THR B  20      56.710  18.817 -78.451  1.00  0.82           N  
ATOM   3546  CA  THR B  20      55.506  19.435 -79.008  1.00  0.82           C  
ATOM   3547  C   THR B  20      54.398  18.427 -79.245  1.00  0.82           C  
ATOM   3548  O   THR B  20      53.253  18.631 -78.860  1.00  0.82           O  
ATOM   3549  CB  THR B  20      55.759  20.166 -80.320  1.00  0.82           C  
ATOM   3550  OG1 THR B  20      56.976  20.894 -80.247  1.00  0.82           O  
ATOM   3551  CG2 THR B  20      54.644  21.188 -80.569  1.00  0.82           C  
ATOM   3552  N   LEU B  21      54.733  17.253 -79.820  1.00  0.83           N  
ATOM   3553  CA  LEU B  21      53.785  16.165 -79.966  1.00  0.83           C  
ATOM   3554  C   LEU B  21      53.334  15.591 -78.627  1.00  0.83           C  
ATOM   3555  O   LEU B  21      52.145  15.373 -78.406  1.00  0.83           O  
ATOM   3556  CB  LEU B  21      54.390  15.043 -80.842  1.00  0.83           C  
ATOM   3557  CG  LEU B  21      53.429  13.877 -81.156  1.00  0.83           C  
ATOM   3558  CD1 LEU B  21      52.195  14.320 -81.958  1.00  0.83           C  
ATOM   3559  CD2 LEU B  21      54.167  12.764 -81.903  1.00  0.83           C  
ATOM   3560  N   GLY B  22      54.275  15.365 -77.684  1.00  0.86           N  
ATOM   3561  CA  GLY B  22      54.004  14.977 -76.302  1.00  0.86           C  
ATOM   3562  C   GLY B  22      53.020  15.842 -75.575  1.00  0.86           C  
ATOM   3563  O   GLY B  22      52.033  15.365 -75.023  1.00  0.86           O  
ATOM   3564  N   ARG B  23      53.243  17.167 -75.600  1.00  0.74           N  
ATOM   3565  CA  ARG B  23      52.365  18.170 -75.031  1.00  0.74           C  
ATOM   3566  C   ARG B  23      50.964  18.141 -75.625  1.00  0.74           C  
ATOM   3567  O   ARG B  23      49.966  18.140 -74.904  1.00  0.74           O  
ATOM   3568  CB  ARG B  23      52.980  19.567 -75.307  1.00  0.74           C  
ATOM   3569  CG  ARG B  23      52.209  20.764 -74.707  1.00  0.74           C  
ATOM   3570  CD  ARG B  23      52.675  22.127 -75.239  1.00  0.74           C  
ATOM   3571  NE  ARG B  23      52.246  22.195 -76.668  1.00  0.74           N  
ATOM   3572  CZ  ARG B  23      52.601  23.107 -77.575  1.00  0.74           C  
ATOM   3573  NH1 ARG B  23      53.401  24.122 -77.268  1.00  0.74           N  
ATOM   3574  NH2 ARG B  23      52.132  22.997 -78.813  1.00  0.74           N  
ATOM   3575  N   ASP B  24      50.863  18.072 -76.963  1.00  0.84           N  
ATOM   3576  CA  ASP B  24      49.603  18.219 -77.659  1.00  0.84           C  
ATOM   3577  C   ASP B  24      48.805  16.912 -77.690  1.00  0.84           C  
ATOM   3578  O   ASP B  24      47.583  16.907 -77.839  1.00  0.84           O  
ATOM   3579  CB  ASP B  24      49.897  18.828 -79.057  1.00  0.84           C  
ATOM   3580  CG  ASP B  24      50.485  20.219 -78.888  1.00  0.84           C  
ATOM   3581  OD1 ASP B  24      50.327  20.822 -77.794  1.00  0.84           O  
ATOM   3582  OD2 ASP B  24      51.102  20.763 -79.837  1.00  0.84           O  
ATOM   3583  N   LEU B  25      49.461  15.757 -77.444  1.00  0.84           N  
ATOM   3584  CA  LEU B  25      48.786  14.500 -77.155  1.00  0.84           C  
ATOM   3585  C   LEU B  25      48.355  14.357 -75.698  1.00  0.84           C  
ATOM   3586  O   LEU B  25      47.429  13.608 -75.401  1.00  0.84           O  
ATOM   3587  CB  LEU B  25      49.678  13.286 -77.496  1.00  0.84           C  
ATOM   3588  CG  LEU B  25      49.902  13.047 -79.002  1.00  0.84           C  
ATOM   3589  CD1 LEU B  25      50.968  11.959 -79.171  1.00  0.84           C  
ATOM   3590  CD2 LEU B  25      48.615  12.652 -79.745  1.00  0.84           C  
ATOM   3591  N   ARG B  26      48.940  15.121 -74.745  1.00  0.72           N  
ATOM   3592  CA  ARG B  26      48.504  15.136 -73.347  1.00  0.72           C  
ATOM   3593  C   ARG B  26      47.163  15.850 -73.183  1.00  0.72           C  
ATOM   3594  O   ARG B  26      46.510  15.784 -72.143  1.00  0.72           O  
ATOM   3595  CB  ARG B  26      49.546  15.802 -72.405  1.00  0.72           C  
ATOM   3596  CG  ARG B  26      50.780  14.927 -72.089  1.00  0.72           C  
ATOM   3597  CD  ARG B  26      51.908  15.708 -71.393  1.00  0.72           C  
ATOM   3598  NE  ARG B  26      53.076  14.782 -71.226  1.00  0.72           N  
ATOM   3599  CZ  ARG B  26      53.965  14.789 -70.219  1.00  0.72           C  
ATOM   3600  NH1 ARG B  26      54.060  15.774 -69.339  1.00  0.72           N  
ATOM   3601  NH2 ARG B  26      54.799  13.765 -70.090  1.00  0.72           N  
ATOM   3602  N   LEU B  27      46.697  16.537 -74.242  1.00  0.83           N  
ATOM   3603  CA  LEU B  27      45.361  17.080 -74.323  1.00  0.83           C  
ATOM   3604  C   LEU B  27      44.293  16.011 -74.525  1.00  0.83           C  
ATOM   3605  O   LEU B  27      43.119  16.254 -74.256  1.00  0.83           O  
ATOM   3606  CB  LEU B  27      45.281  18.095 -75.486  1.00  0.83           C  
ATOM   3607  CG  LEU B  27      46.217  19.310 -75.320  1.00  0.83           C  
ATOM   3608  CD1 LEU B  27      46.157  20.206 -76.565  1.00  0.83           C  
ATOM   3609  CD2 LEU B  27      45.872  20.105 -74.054  1.00  0.83           C  
ATOM   3610  N   VAL B  28      44.659  14.789 -74.969  1.00  0.81           N  
ATOM   3611  CA  VAL B  28      43.750  13.651 -75.016  1.00  0.81           C  
ATOM   3612  C   VAL B  28      43.480  13.128 -73.608  1.00  0.81           C  
ATOM   3613  O   VAL B  28      44.384  12.738 -72.872  1.00  0.81           O  
ATOM   3614  CB  VAL B  28      44.264  12.529 -75.919  1.00  0.81           C  
ATOM   3615  CG1 VAL B  28      43.319  11.308 -75.895  1.00  0.81           C  
ATOM   3616  CG2 VAL B  28      44.400  13.068 -77.359  1.00  0.81           C  
ATOM   3617  N   ARG B  29      42.199  13.124 -73.193  1.00  0.59           N  
ATOM   3618  CA  ARG B  29      41.787  12.708 -71.866  1.00  0.59           C  
ATOM   3619  C   ARG B  29      41.264  11.289 -71.866  1.00  0.59           C  
ATOM   3620  O   ARG B  29      41.403  10.566 -70.882  1.00  0.59           O  
ATOM   3621  CB  ARG B  29      40.636  13.626 -71.381  1.00  0.59           C  
ATOM   3622  CG  ARG B  29      41.075  15.076 -71.086  1.00  0.59           C  
ATOM   3623  CD  ARG B  29      42.019  15.250 -69.890  1.00  0.59           C  
ATOM   3624  NE  ARG B  29      41.286  14.716 -68.699  1.00  0.59           N  
ATOM   3625  CZ  ARG B  29      41.766  14.720 -67.450  1.00  0.59           C  
ATOM   3626  NH1 ARG B  29      42.931  15.288 -67.157  1.00  0.59           N  
ATOM   3627  NH2 ARG B  29      41.063  14.141 -66.479  1.00  0.59           N  
ATOM   3628  N   ALA B  30      40.675  10.853 -72.989  1.00  0.72           N  
ATOM   3629  CA  ALA B  30      40.201   9.506 -73.149  1.00  0.72           C  
ATOM   3630  C   ALA B  30      40.038   9.258 -74.631  1.00  0.72           C  
ATOM   3631  O   ALA B  30      39.920  10.191 -75.424  1.00  0.72           O  
ATOM   3632  CB  ALA B  30      38.853   9.285 -72.427  1.00  0.72           C  
ATOM   3633  N   ALA B  31      40.025   7.987 -75.053  1.00  0.80           N  
ATOM   3634  CA  ALA B  31      39.750   7.638 -76.420  1.00  0.80           C  
ATOM   3635  C   ALA B  31      39.106   6.274 -76.405  1.00  0.80           C  
ATOM   3636  O   ALA B  31      39.371   5.464 -75.518  1.00  0.80           O  
ATOM   3637  CB  ALA B  31      41.031   7.623 -77.280  1.00  0.80           C  
ATOM   3638  N   ALA B  32      38.205   6.012 -77.364  1.00  0.84           N  
ATOM   3639  CA  ALA B  32      37.525   4.744 -77.497  1.00  0.84           C  
ATOM   3640  C   ALA B  32      38.462   3.544 -77.763  1.00  0.84           C  
ATOM   3641  O   ALA B  32      39.506   3.734 -78.400  1.00  0.84           O  
ATOM   3642  CB  ALA B  32      36.452   4.885 -78.586  1.00  0.84           C  
ATOM   3643  N   PRO B  33      38.185   2.314 -77.299  1.00  0.80           N  
ATOM   3644  CA  PRO B  33      39.109   1.179 -77.385  1.00  0.80           C  
ATOM   3645  C   PRO B  33      39.547   0.814 -78.788  1.00  0.80           C  
ATOM   3646  O   PRO B  33      40.676   0.361 -78.975  1.00  0.80           O  
ATOM   3647  CB  PRO B  33      38.336   0.016 -76.737  1.00  0.80           C  
ATOM   3648  CG  PRO B  33      37.373   0.706 -75.771  1.00  0.80           C  
ATOM   3649  CD  PRO B  33      36.973   1.956 -76.553  1.00  0.80           C  
ATOM   3650  N   GLU B  34      38.668   0.997 -79.786  1.00  0.75           N  
ATOM   3651  CA  GLU B  34      38.900   0.730 -81.186  1.00  0.75           C  
ATOM   3652  C   GLU B  34      40.004   1.613 -81.734  1.00  0.75           C  
ATOM   3653  O   GLU B  34      40.913   1.149 -82.415  1.00  0.75           O  
ATOM   3654  CB  GLU B  34      37.601   0.963 -82.012  1.00  0.75           C  
ATOM   3655  CG  GLU B  34      36.341   0.227 -81.472  1.00  0.75           C  
ATOM   3656  CD  GLU B  34      35.733   0.859 -80.218  1.00  0.75           C  
ATOM   3657  OE1 GLU B  34      34.921   0.181 -79.548  1.00  0.75           O  
ATOM   3658  OE2 GLU B  34      36.129   2.008 -79.886  1.00  0.75           O  
ATOM   3659  N   LEU B  35      39.975   2.916 -81.379  1.00  0.80           N  
ATOM   3660  CA  LEU B  35      41.008   3.883 -81.706  1.00  0.80           C  
ATOM   3661  C   LEU B  35      42.331   3.577 -81.037  1.00  0.80           C  
ATOM   3662  O   LEU B  35      43.384   3.671 -81.660  1.00  0.80           O  
ATOM   3663  CB  LEU B  35      40.588   5.324 -81.330  1.00  0.80           C  
ATOM   3664  CG  LEU B  35      39.375   5.848 -82.121  1.00  0.80           C  
ATOM   3665  CD1 LEU B  35      38.912   7.197 -81.557  1.00  0.80           C  
ATOM   3666  CD2 LEU B  35      39.667   5.981 -83.623  1.00  0.80           C  
ATOM   3667  N   LEU B  36      42.313   3.165 -79.753  1.00  0.75           N  
ATOM   3668  CA  LEU B  36      43.500   2.756 -79.012  1.00  0.75           C  
ATOM   3669  C   LEU B  36      44.217   1.564 -79.637  1.00  0.75           C  
ATOM   3670  O   LEU B  36      45.444   1.495 -79.647  1.00  0.75           O  
ATOM   3671  CB  LEU B  36      43.159   2.441 -77.535  1.00  0.75           C  
ATOM   3672  CG  LEU B  36      42.670   3.658 -76.722  1.00  0.75           C  
ATOM   3673  CD1 LEU B  36      42.166   3.220 -75.339  1.00  0.75           C  
ATOM   3674  CD2 LEU B  36      43.768   4.720 -76.557  1.00  0.75           C  
ATOM   3675  N   ALA B  37      43.450   0.618 -80.212  1.00  0.78           N  
ATOM   3676  CA  ALA B  37      43.974  -0.573 -80.839  1.00  0.78           C  
ATOM   3677  C   ALA B  37      44.372  -0.382 -82.306  1.00  0.78           C  
ATOM   3678  O   ALA B  37      44.936  -1.292 -82.923  1.00  0.78           O  
ATOM   3679  CB  ALA B  37      42.894  -1.669 -80.745  1.00  0.78           C  
ATOM   3680  N   LEU B  38      44.126   0.804 -82.905  1.00  0.75           N  
ATOM   3681  CA  LEU B  38      44.676   1.173 -84.201  1.00  0.75           C  
ATOM   3682  C   LEU B  38      46.189   1.329 -84.202  1.00  0.75           C  
ATOM   3683  O   LEU B  38      46.810   1.777 -83.237  1.00  0.75           O  
ATOM   3684  CB  LEU B  38      44.089   2.488 -84.777  1.00  0.75           C  
ATOM   3685  CG  LEU B  38      42.589   2.451 -85.124  1.00  0.75           C  
ATOM   3686  CD1 LEU B  38      42.123   3.838 -85.593  1.00  0.75           C  
ATOM   3687  CD2 LEU B  38      42.248   1.395 -86.186  1.00  0.75           C  
ATOM   3688  N   ASP B  39      46.815   0.964 -85.331  1.00  0.75           N  
ATOM   3689  CA  ASP B  39      48.224   1.141 -85.574  1.00  0.75           C  
ATOM   3690  C   ASP B  39      48.508   2.549 -86.091  1.00  0.75           C  
ATOM   3691  O   ASP B  39      47.814   3.080 -86.956  1.00  0.75           O  
ATOM   3692  CB  ASP B  39      48.735   0.068 -86.567  1.00  0.75           C  
ATOM   3693  CG  ASP B  39      48.417  -1.288 -85.998  1.00  0.75           C  
ATOM   3694  OD1 ASP B  39      49.236  -1.847 -85.229  1.00  0.75           O  
ATOM   3695  OD2 ASP B  39      47.277  -1.778 -86.209  1.00  0.75           O  
ATOM   3696  N   VAL B  40      49.547   3.200 -85.540  1.00  0.81           N  
ATOM   3697  CA  VAL B  40      49.981   4.528 -85.941  1.00  0.81           C  
ATOM   3698  C   VAL B  40      51.033   4.388 -87.037  1.00  0.81           C  
ATOM   3699  O   VAL B  40      51.594   3.299 -87.178  1.00  0.81           O  
ATOM   3700  CB  VAL B  40      50.518   5.350 -84.764  1.00  0.81           C  
ATOM   3701  CG1 VAL B  40      49.429   5.412 -83.676  1.00  0.81           C  
ATOM   3702  CG2 VAL B  40      51.836   4.773 -84.212  1.00  0.81           C  
ATOM   3703  N   PRO B  41      51.397   5.393 -87.833  1.00  0.81           N  
ATOM   3704  CA  PRO B  41      52.217   5.144 -89.023  1.00  0.81           C  
ATOM   3705  C   PRO B  41      53.689   5.335 -88.677  1.00  0.81           C  
ATOM   3706  O   PRO B  41      54.408   6.057 -89.365  1.00  0.81           O  
ATOM   3707  CB  PRO B  41      51.714   6.226 -90.000  1.00  0.81           C  
ATOM   3708  CG  PRO B  41      51.317   7.391 -89.094  1.00  0.81           C  
ATOM   3709  CD  PRO B  41      50.676   6.669 -87.915  1.00  0.81           C  
ATOM   3710  N   ALA B  42      54.146   4.663 -87.609  1.00  0.78           N  
ATOM   3711  CA  ALA B  42      55.512   4.658 -87.148  1.00  0.78           C  
ATOM   3712  C   ALA B  42      55.671   3.502 -86.178  1.00  0.78           C  
ATOM   3713  O   ALA B  42      54.677   2.976 -85.662  1.00  0.78           O  
ATOM   3714  CB  ALA B  42      55.854   5.975 -86.429  1.00  0.78           C  
ATOM   3715  N   ASP B  43      56.919   3.093 -85.886  1.00  0.69           N  
ATOM   3716  CA  ASP B  43      57.183   2.020 -84.943  1.00  0.69           C  
ATOM   3717  C   ASP B  43      58.142   2.451 -83.835  1.00  0.69           C  
ATOM   3718  O   ASP B  43      58.375   1.710 -82.881  1.00  0.69           O  
ATOM   3719  CB  ASP B  43      57.633   0.720 -85.666  1.00  0.69           C  
ATOM   3720  CG  ASP B  43      56.414  -0.113 -86.029  1.00  0.69           C  
ATOM   3721  OD1 ASP B  43      55.722  -0.554 -85.063  1.00  0.69           O  
ATOM   3722  OD2 ASP B  43      56.111  -0.291 -87.232  1.00  0.69           O  
ATOM   3723  N   ALA B  44      58.628   3.706 -83.849  1.00  0.75           N  
ATOM   3724  CA  ALA B  44      59.183   4.341 -82.675  1.00  0.75           C  
ATOM   3725  C   ALA B  44      58.483   5.670 -82.422  1.00  0.75           C  
ATOM   3726  O   ALA B  44      58.127   6.420 -83.327  1.00  0.75           O  
ATOM   3727  CB  ALA B  44      60.708   4.529 -82.804  1.00  0.75           C  
ATOM   3728  N   TYR B  45      58.260   6.034 -81.142  1.00  0.75           N  
ATOM   3729  CA  TYR B  45      57.655   7.306 -80.774  1.00  0.75           C  
ATOM   3730  C   TYR B  45      58.492   8.507 -81.227  1.00  0.75           C  
ATOM   3731  O   TYR B  45      57.971   9.526 -81.675  1.00  0.75           O  
ATOM   3732  CB  TYR B  45      57.384   7.309 -79.247  1.00  0.75           C  
ATOM   3733  CG  TYR B  45      56.652   8.541 -78.793  1.00  0.75           C  
ATOM   3734  CD1 TYR B  45      57.259   9.424 -77.885  1.00  0.75           C  
ATOM   3735  CD2 TYR B  45      55.375   8.843 -79.296  1.00  0.75           C  
ATOM   3736  CE1 TYR B  45      56.607  10.603 -77.500  1.00  0.75           C  
ATOM   3737  CE2 TYR B  45      54.732  10.031 -78.923  1.00  0.75           C  
ATOM   3738  CZ  TYR B  45      55.353  10.908 -78.034  1.00  0.75           C  
ATOM   3739  OH  TYR B  45      54.712  12.109 -77.704  1.00  0.75           O  
ATOM   3740  N   GLY B  46      59.837   8.381 -81.186  1.00  0.79           N  
ATOM   3741  CA  GLY B  46      60.754   9.398 -81.697  1.00  0.79           C  
ATOM   3742  C   GLY B  46      60.632   9.703 -83.175  1.00  0.79           C  
ATOM   3743  O   GLY B  46      60.887  10.828 -83.595  1.00  0.79           O  
ATOM   3744  N   GLU B  47      60.198   8.730 -84.007  1.00  0.72           N  
ATOM   3745  CA  GLU B  47      59.887   8.948 -85.413  1.00  0.72           C  
ATOM   3746  C   GLU B  47      58.711   9.892 -85.587  1.00  0.72           C  
ATOM   3747  O   GLU B  47      58.762  10.836 -86.372  1.00  0.72           O  
ATOM   3748  CB  GLU B  47      59.531   7.611 -86.105  1.00  0.72           C  
ATOM   3749  CG  GLU B  47      60.706   6.608 -86.169  1.00  0.72           C  
ATOM   3750  CD  GLU B  47      60.264   5.155 -86.356  1.00  0.72           C  
ATOM   3751  OE1 GLU B  47      61.176   4.297 -86.397  1.00  0.72           O  
ATOM   3752  OE2 GLU B  47      59.036   4.873 -86.385  1.00  0.72           O  
ATOM   3753  N   LEU B  48      57.636   9.691 -84.793  1.00  0.80           N  
ATOM   3754  CA  LEU B  48      56.490  10.582 -84.743  1.00  0.80           C  
ATOM   3755  C   LEU B  48      56.843  11.968 -84.235  1.00  0.80           C  
ATOM   3756  O   LEU B  48      56.418  12.968 -84.804  1.00  0.80           O  
ATOM   3757  CB  LEU B  48      55.357  10.023 -83.848  1.00  0.80           C  
ATOM   3758  CG  LEU B  48      54.727   8.711 -84.339  1.00  0.80           C  
ATOM   3759  CD1 LEU B  48      53.825   8.120 -83.249  1.00  0.80           C  
ATOM   3760  CD2 LEU B  48      53.928   8.904 -85.638  1.00  0.80           C  
ATOM   3761  N   VAL B  49      57.657  12.080 -83.166  1.00  0.81           N  
ATOM   3762  CA  VAL B  49      58.135  13.364 -82.662  1.00  0.81           C  
ATOM   3763  C   VAL B  49      58.969  14.115 -83.698  1.00  0.81           C  
ATOM   3764  O   VAL B  49      58.761  15.302 -83.946  1.00  0.81           O  
ATOM   3765  CB  VAL B  49      58.934  13.182 -81.372  1.00  0.81           C  
ATOM   3766  CG1 VAL B  49      59.576  14.504 -80.902  1.00  0.81           C  
ATOM   3767  CG2 VAL B  49      57.996  12.654 -80.269  1.00  0.81           C  
ATOM   3768  N   GLY B  50      59.904  13.420 -84.383  1.00  0.83           N  
ATOM   3769  CA  GLY B  50      60.745  14.009 -85.422  1.00  0.83           C  
ATOM   3770  C   GLY B  50      60.019  14.441 -86.672  1.00  0.83           C  
ATOM   3771  O   GLY B  50      60.423  15.394 -87.343  1.00  0.83           O  
ATOM   3772  N   SER B  51      58.907  13.770 -87.024  1.00  0.82           N  
ATOM   3773  CA  SER B  51      58.122  14.095 -88.207  1.00  0.82           C  
ATOM   3774  C   SER B  51      56.975  15.049 -87.929  1.00  0.82           C  
ATOM   3775  O   SER B  51      56.397  15.600 -88.862  1.00  0.82           O  
ATOM   3776  CB  SER B  51      57.545  12.818 -88.881  1.00  0.82           C  
ATOM   3777  OG  SER B  51      56.625  12.124 -88.036  1.00  0.82           O  
ATOM   3778  N   TYR B  52      56.638  15.313 -86.648  1.00  0.33           N  
ATOM   3779  CA  TYR B  52      55.551  16.204 -86.274  1.00  0.33           C  
ATOM   3780  C   TYR B  52      55.772  17.654 -86.680  1.00  0.33           C  
ATOM   3781  O   TYR B  52      56.784  18.277 -86.356  1.00  0.33           O  
ATOM   3782  CB  TYR B  52      55.257  16.123 -84.748  1.00  0.33           C  
ATOM   3783  CG  TYR B  52      53.999  16.862 -84.354  1.00  0.33           C  
ATOM   3784  CD1 TYR B  52      54.020  17.850 -83.355  1.00  0.33           C  
ATOM   3785  CD2 TYR B  52      52.781  16.567 -84.987  1.00  0.33           C  
ATOM   3786  CE1 TYR B  52      52.839  18.512 -82.983  1.00  0.33           C  
ATOM   3787  CE2 TYR B  52      51.600  17.224 -84.617  1.00  0.33           C  
ATOM   3788  CZ  TYR B  52      51.632  18.193 -83.611  1.00  0.33           C  
ATOM   3789  OH  TYR B  52      50.456  18.853 -83.214  1.00  0.33           O  
ATOM   3790  N   ARG B  53      54.810  18.235 -87.410  1.00  0.29           N  
ATOM   3791  CA  ARG B  53      54.888  19.608 -87.850  1.00  0.29           C  
ATOM   3792  C   ARG B  53      53.600  20.327 -87.465  1.00  0.29           C  
ATOM   3793  O   ARG B  53      52.585  20.128 -88.134  1.00  0.29           O  
ATOM   3794  CB  ARG B  53      55.125  19.648 -89.382  1.00  0.29           C  
ATOM   3795  CG  ARG B  53      56.517  19.123 -89.805  1.00  0.29           C  
ATOM   3796  CD  ARG B  53      57.699  19.924 -89.231  1.00  0.29           C  
ATOM   3797  NE  ARG B  53      58.964  19.202 -89.624  1.00  0.29           N  
ATOM   3798  CZ  ARG B  53      59.514  18.203 -88.920  1.00  0.29           C  
ATOM   3799  NH1 ARG B  53      59.056  17.792 -87.747  1.00  0.29           N  
ATOM   3800  NH2 ARG B  53      60.579  17.554 -89.393  1.00  0.29           N  
ATOM   3801  N   PRO B  54      53.560  21.168 -86.421  1.00  0.39           N  
ATOM   3802  CA  PRO B  54      52.344  21.862 -86.006  1.00  0.39           C  
ATOM   3803  C   PRO B  54      52.090  23.058 -86.906  1.00  0.39           C  
ATOM   3804  O   PRO B  54      51.011  23.644 -86.850  1.00  0.39           O  
ATOM   3805  CB  PRO B  54      52.654  22.274 -84.557  1.00  0.39           C  
ATOM   3806  CG  PRO B  54      54.166  22.510 -84.559  1.00  0.39           C  
ATOM   3807  CD  PRO B  54      54.676  21.419 -85.502  1.00  0.39           C  
ATOM   3808  N   ASP B  55      53.073  23.426 -87.752  1.00  0.37           N  
ATOM   3809  CA  ASP B  55      52.963  24.343 -88.861  1.00  0.37           C  
ATOM   3810  C   ASP B  55      51.984  23.841 -89.924  1.00  0.37           C  
ATOM   3811  O   ASP B  55      51.189  24.595 -90.481  1.00  0.37           O  
ATOM   3812  CB  ASP B  55      54.389  24.627 -89.445  1.00  0.37           C  
ATOM   3813  CG  ASP B  55      55.246  23.382 -89.663  1.00  0.37           C  
ATOM   3814  OD1 ASP B  55      55.575  22.720 -88.641  1.00  0.37           O  
ATOM   3815  OD2 ASP B  55      55.584  23.058 -90.834  1.00  0.37           O  
ATOM   3816  N   ARG B  56      51.995  22.523 -90.200  1.00  0.34           N  
ATOM   3817  CA  ARG B  56      51.191  21.888 -91.228  1.00  0.34           C  
ATOM   3818  C   ARG B  56      49.871  21.354 -90.702  1.00  0.34           C  
ATOM   3819  O   ARG B  56      49.471  20.230 -90.999  1.00  0.34           O  
ATOM   3820  CB  ARG B  56      51.987  20.746 -91.898  1.00  0.34           C  
ATOM   3821  CG  ARG B  56      53.314  21.261 -92.473  1.00  0.34           C  
ATOM   3822  CD  ARG B  56      54.141  20.206 -93.194  1.00  0.34           C  
ATOM   3823  NE  ARG B  56      55.410  20.908 -93.565  1.00  0.34           N  
ATOM   3824  CZ  ARG B  56      56.158  20.600 -94.632  1.00  0.34           C  
ATOM   3825  NH1 ARG B  56      55.926  19.501 -95.347  1.00  0.34           N  
ATOM   3826  NH2 ARG B  56      57.156  21.403 -94.991  1.00  0.34           N  
ATOM   3827  N   ALA B  57      49.159  22.162 -89.899  1.00  0.50           N  
ATOM   3828  CA  ALA B  57      47.844  21.840 -89.391  1.00  0.50           C  
ATOM   3829  C   ALA B  57      46.775  21.627 -90.466  1.00  0.50           C  
ATOM   3830  O   ALA B  57      46.705  22.348 -91.461  1.00  0.50           O  
ATOM   3831  CB  ALA B  57      47.389  22.955 -88.428  1.00  0.50           C  
ATOM   3832  N   GLY B  58      45.885  20.624 -90.274  1.00  0.52           N  
ATOM   3833  CA  GLY B  58      44.655  20.501 -91.053  1.00  0.52           C  
ATOM   3834  C   GLY B  58      43.711  21.649 -90.791  1.00  0.52           C  
ATOM   3835  O   GLY B  58      43.570  22.099 -89.657  1.00  0.52           O  
ATOM   3836  N   ALA B  59      43.027  22.161 -91.833  1.00  0.65           N  
ATOM   3837  CA  ALA B  59      42.174  23.329 -91.700  1.00  0.65           C  
ATOM   3838  C   ALA B  59      40.955  23.112 -90.804  1.00  0.65           C  
ATOM   3839  O   ALA B  59      40.170  22.184 -90.997  1.00  0.65           O  
ATOM   3840  CB  ALA B  59      41.723  23.821 -93.093  1.00  0.65           C  
ATOM   3841  N   VAL B  60      40.752  23.984 -89.804  1.00  0.65           N  
ATOM   3842  CA  VAL B  60      39.702  23.839 -88.816  1.00  0.65           C  
ATOM   3843  C   VAL B  60      38.638  24.884 -89.083  1.00  0.65           C  
ATOM   3844  O   VAL B  60      38.817  26.083 -88.870  1.00  0.65           O  
ATOM   3845  CB  VAL B  60      40.223  23.984 -87.386  1.00  0.65           C  
ATOM   3846  CG1 VAL B  60      39.093  23.733 -86.366  1.00  0.65           C  
ATOM   3847  CG2 VAL B  60      41.374  22.985 -87.150  1.00  0.65           C  
ATOM   3848  N   THR B  61      37.460  24.442 -89.557  1.00  0.68           N  
ATOM   3849  CA  THR B  61      36.317  25.323 -89.762  1.00  0.68           C  
ATOM   3850  C   THR B  61      35.441  25.253 -88.540  1.00  0.68           C  
ATOM   3851  O   THR B  61      34.926  24.193 -88.183  1.00  0.68           O  
ATOM   3852  CB  THR B  61      35.448  24.948 -90.962  1.00  0.68           C  
ATOM   3853  OG1 THR B  61      36.137  25.193 -92.179  1.00  0.68           O  
ATOM   3854  CG2 THR B  61      34.161  25.787 -91.053  1.00  0.68           C  
ATOM   3855  N   ALA B  62      35.205  26.399 -87.875  1.00  0.70           N  
ATOM   3856  CA  ALA B  62      34.177  26.489 -86.864  1.00  0.70           C  
ATOM   3857  C   ALA B  62      32.810  26.587 -87.515  1.00  0.70           C  
ATOM   3858  O   ALA B  62      32.587  27.408 -88.403  1.00  0.70           O  
ATOM   3859  CB  ALA B  62      34.369  27.712 -85.953  1.00  0.70           C  
ATOM   3860  N   VAL B  63      31.870  25.738 -87.087  1.00  0.71           N  
ATOM   3861  CA  VAL B  63      30.516  25.716 -87.588  1.00  0.71           C  
ATOM   3862  C   VAL B  63      29.635  26.189 -86.461  1.00  0.71           C  
ATOM   3863  O   VAL B  63      29.519  25.531 -85.429  1.00  0.71           O  
ATOM   3864  CB  VAL B  63      30.080  24.318 -88.011  1.00  0.71           C  
ATOM   3865  CG1 VAL B  63      28.617  24.341 -88.497  1.00  0.71           C  
ATOM   3866  CG2 VAL B  63      31.030  23.806 -89.113  1.00  0.71           C  
ATOM   3867  N   VAL B  64      28.998  27.360 -86.629  1.00  0.71           N  
ATOM   3868  CA  VAL B  64      28.147  27.935 -85.606  1.00  0.71           C  
ATOM   3869  C   VAL B  64      26.728  27.973 -86.123  1.00  0.71           C  
ATOM   3870  O   VAL B  64      26.415  28.644 -87.105  1.00  0.71           O  
ATOM   3871  CB  VAL B  64      28.586  29.331 -85.169  1.00  0.71           C  
ATOM   3872  CG1 VAL B  64      27.714  29.811 -83.990  1.00  0.71           C  
ATOM   3873  CG2 VAL B  64      30.063  29.281 -84.726  1.00  0.71           C  
ATOM   3874  N   LEU B  65      25.804  27.245 -85.471  1.00  0.67           N  
ATOM   3875  CA  LEU B  65      24.387  27.353 -85.774  1.00  0.67           C  
ATOM   3876  C   LEU B  65      23.834  28.536 -85.005  1.00  0.67           C  
ATOM   3877  O   LEU B  65      24.170  28.741 -83.842  1.00  0.67           O  
ATOM   3878  CB  LEU B  65      23.594  26.073 -85.408  1.00  0.67           C  
ATOM   3879  CG  LEU B  65      23.531  25.014 -86.529  1.00  0.67           C  
ATOM   3880  CD1 LEU B  65      24.909  24.475 -86.945  1.00  0.67           C  
ATOM   3881  CD2 LEU B  65      22.611  23.865 -86.095  1.00  0.67           C  
ATOM   3882  N   THR B  66      22.999  29.374 -85.644  1.00  0.65           N  
ATOM   3883  CA  THR B  66      22.587  30.625 -85.023  1.00  0.65           C  
ATOM   3884  C   THR B  66      21.177  30.989 -85.437  1.00  0.65           C  
ATOM   3885  O   THR B  66      20.681  30.533 -86.470  1.00  0.65           O  
ATOM   3886  CB  THR B  66      23.573  31.759 -85.311  1.00  0.65           C  
ATOM   3887  OG1 THR B  66      23.347  32.878 -84.472  1.00  0.65           O  
ATOM   3888  CG2 THR B  66      23.520  32.243 -86.766  1.00  0.65           C  
ATOM   3889  N   HIS B  67      20.495  31.792 -84.600  1.00  0.54           N  
ATOM   3890  CA  HIS B  67      19.108  32.178 -84.770  1.00  0.54           C  
ATOM   3891  C   HIS B  67      18.705  33.111 -83.641  1.00  0.54           C  
ATOM   3892  O   HIS B  67      18.400  32.648 -82.546  1.00  0.54           O  
ATOM   3893  CB  HIS B  67      18.111  30.989 -84.718  1.00  0.54           C  
ATOM   3894  CG  HIS B  67      16.733  31.461 -85.049  1.00  0.54           C  
ATOM   3895  ND1 HIS B  67      16.437  31.671 -86.376  1.00  0.54           N  
ATOM   3896  CD2 HIS B  67      15.860  32.134 -84.259  1.00  0.54           C  
ATOM   3897  CE1 HIS B  67      15.394  32.482 -86.374  1.00  0.54           C  
ATOM   3898  NE2 HIS B  67      15.010  32.798 -85.113  1.00  0.54           N  
ATOM   3899  N   ASP B  68      18.688  34.434 -83.889  1.00  0.56           N  
ATOM   3900  CA  ASP B  68      18.350  35.459 -82.907  1.00  0.56           C  
ATOM   3901  C   ASP B  68      19.268  35.491 -81.667  1.00  0.56           C  
ATOM   3902  O   ASP B  68      18.832  35.477 -80.515  1.00  0.56           O  
ATOM   3903  CB  ASP B  68      16.841  35.479 -82.536  1.00  0.56           C  
ATOM   3904  CG  ASP B  68      15.957  35.689 -83.751  1.00  0.56           C  
ATOM   3905  OD1 ASP B  68      16.385  36.388 -84.705  1.00  0.56           O  
ATOM   3906  OD2 ASP B  68      14.816  35.153 -83.741  1.00  0.56           O  
ATOM   3907  N   GLU B  69      20.594  35.536 -81.911  1.00  0.59           N  
ATOM   3908  CA  GLU B  69      21.648  35.330 -80.937  1.00  0.59           C  
ATOM   3909  C   GLU B  69      22.567  36.545 -80.810  1.00  0.59           C  
ATOM   3910  O   GLU B  69      23.724  36.420 -80.393  1.00  0.59           O  
ATOM   3911  CB  GLU B  69      22.514  34.120 -81.371  1.00  0.59           C  
ATOM   3912  CG  GLU B  69      21.764  32.764 -81.360  1.00  0.59           C  
ATOM   3913  CD  GLU B  69      21.599  32.145 -79.972  1.00  0.59           C  
ATOM   3914  OE1 GLU B  69      21.126  30.978 -79.933  1.00  0.59           O  
ATOM   3915  OE2 GLU B  69      21.981  32.791 -78.964  1.00  0.59           O  
ATOM   3916  N   GLU B  70      22.113  37.773 -81.168  1.00  0.55           N  
ATOM   3917  CA  GLU B  70      22.965  38.950 -81.344  1.00  0.55           C  
ATOM   3918  C   GLU B  70      23.889  39.286 -80.179  1.00  0.55           C  
ATOM   3919  O   GLU B  70      25.048  39.650 -80.363  1.00  0.55           O  
ATOM   3920  CB  GLU B  70      22.128  40.214 -81.689  1.00  0.55           C  
ATOM   3921  CG  GLU B  70      21.114  40.647 -80.596  1.00  0.55           C  
ATOM   3922  CD  GLU B  70      20.245  41.843 -80.966  1.00  0.55           C  
ATOM   3923  OE1 GLU B  70      19.624  42.395 -80.020  1.00  0.55           O  
ATOM   3924  OE2 GLU B  70      20.206  42.228 -82.165  1.00  0.55           O  
ATOM   3925  N   GLN B  71      23.401  39.136 -78.938  1.00  0.56           N  
ATOM   3926  CA  GLN B  71      24.135  39.417 -77.724  1.00  0.56           C  
ATOM   3927  C   GLN B  71      25.312  38.478 -77.458  1.00  0.56           C  
ATOM   3928  O   GLN B  71      26.366  38.908 -76.991  1.00  0.56           O  
ATOM   3929  CB  GLN B  71      23.154  39.493 -76.528  1.00  0.56           C  
ATOM   3930  CG  GLN B  71      22.011  40.502 -76.818  1.00  0.56           C  
ATOM   3931  CD  GLN B  71      21.118  40.784 -75.614  1.00  0.56           C  
ATOM   3932  OE1 GLN B  71      21.404  40.424 -74.470  1.00  0.56           O  
ATOM   3933  NE2 GLN B  71      19.971  41.452 -75.884  1.00  0.56           N  
ATOM   3934  N   VAL B  72      25.181  37.168 -77.762  1.00  0.64           N  
ATOM   3935  CA  VAL B  72      26.212  36.185 -77.448  1.00  0.64           C  
ATOM   3936  C   VAL B  72      27.109  35.846 -78.629  1.00  0.64           C  
ATOM   3937  O   VAL B  72      28.266  35.466 -78.443  1.00  0.64           O  
ATOM   3938  CB  VAL B  72      25.622  34.885 -76.907  1.00  0.64           C  
ATOM   3939  CG1 VAL B  72      24.961  35.160 -75.543  1.00  0.64           C  
ATOM   3940  CG2 VAL B  72      24.616  34.257 -77.890  1.00  0.64           C  
ATOM   3941  N   ILE B  73      26.646  36.038 -79.887  1.00  0.66           N  
ATOM   3942  CA  ILE B  73      27.359  35.590 -81.085  1.00  0.66           C  
ATOM   3943  C   ILE B  73      28.757  36.184 -81.239  1.00  0.66           C  
ATOM   3944  O   ILE B  73      29.718  35.503 -81.596  1.00  0.66           O  
ATOM   3945  CB  ILE B  73      26.521  35.782 -82.358  1.00  0.66           C  
ATOM   3946  CG1 ILE B  73      27.113  35.071 -83.602  1.00  0.66           C  
ATOM   3947  CG2 ILE B  73      26.269  37.277 -82.662  1.00  0.66           C  
ATOM   3948  CD1 ILE B  73      27.195  33.545 -83.475  1.00  0.66           C  
ATOM   3949  N   GLY B  74      28.936  37.480 -80.903  1.00  0.64           N  
ATOM   3950  CA  GLY B  74      30.241  38.129 -80.956  1.00  0.64           C  
ATOM   3951  C   GLY B  74      31.246  37.635 -79.942  1.00  0.64           C  
ATOM   3952  O   GLY B  74      32.450  37.719 -80.165  1.00  0.64           O  
ATOM   3953  N   ALA B  75      30.786  37.105 -78.792  1.00  0.67           N  
ATOM   3954  CA  ALA B  75      31.645  36.466 -77.812  1.00  0.67           C  
ATOM   3955  C   ALA B  75      32.147  35.109 -78.288  1.00  0.67           C  
ATOM   3956  O   ALA B  75      33.335  34.809 -78.190  1.00  0.67           O  
ATOM   3957  CB  ALA B  75      30.903  36.316 -76.470  1.00  0.67           C  
ATOM   3958  N   CYS B  76      31.242  34.294 -78.874  1.00  0.67           N  
ATOM   3959  CA  CYS B  76      31.538  32.982 -79.435  1.00  0.67           C  
ATOM   3960  C   CYS B  76      32.593  33.046 -80.536  1.00  0.67           C  
ATOM   3961  O   CYS B  76      33.612  32.361 -80.491  1.00  0.67           O  
ATOM   3962  CB  CYS B  76      30.211  32.384 -79.999  1.00  0.67           C  
ATOM   3963  SG  CYS B  76      30.310  30.698 -80.710  1.00  0.67           S  
ATOM   3964  N   LEU B  77      32.416  33.945 -81.527  1.00  0.67           N  
ATOM   3965  CA  LEU B  77      33.341  34.098 -82.640  1.00  0.67           C  
ATOM   3966  C   LEU B  77      34.728  34.595 -82.263  1.00  0.67           C  
ATOM   3967  O   LEU B  77      35.732  34.107 -82.776  1.00  0.67           O  
ATOM   3968  CB  LEU B  77      32.738  34.993 -83.745  1.00  0.67           C  
ATOM   3969  CG  LEU B  77      31.427  34.442 -84.344  1.00  0.67           C  
ATOM   3970  CD1 LEU B  77      30.880  35.431 -85.379  1.00  0.67           C  
ATOM   3971  CD2 LEU B  77      31.591  33.044 -84.962  1.00  0.67           C  
ATOM   3972  N   ARG B  78      34.836  35.549 -81.314  1.00  0.62           N  
ATOM   3973  CA  ARG B  78      36.119  36.074 -80.864  1.00  0.62           C  
ATOM   3974  C   ARG B  78      36.918  35.108 -80.008  1.00  0.62           C  
ATOM   3975  O   ARG B  78      38.099  35.326 -79.758  1.00  0.62           O  
ATOM   3976  CB  ARG B  78      35.955  37.383 -80.058  1.00  0.62           C  
ATOM   3977  CG  ARG B  78      35.625  38.591 -80.948  1.00  0.62           C  
ATOM   3978  CD  ARG B  78      35.757  39.942 -80.239  1.00  0.62           C  
ATOM   3979  NE  ARG B  78      34.697  39.992 -79.174  1.00  0.62           N  
ATOM   3980  CZ  ARG B  78      33.529  40.638 -79.290  1.00  0.62           C  
ATOM   3981  NH1 ARG B  78      33.218  41.324 -80.382  1.00  0.62           N  
ATOM   3982  NH2 ARG B  78      32.659  40.600 -78.281  1.00  0.62           N  
ATOM   3983  N   ALA B  79      36.305  34.012 -79.537  1.00  0.68           N  
ATOM   3984  CA  ALA B  79      37.025  32.990 -78.820  1.00  0.68           C  
ATOM   3985  C   ALA B  79      37.463  31.855 -79.738  1.00  0.68           C  
ATOM   3986  O   ALA B  79      38.158  30.938 -79.320  1.00  0.68           O  
ATOM   3987  CB  ALA B  79      36.097  32.458 -77.718  1.00  0.68           C  
ATOM   3988  N   LEU B  80      37.096  31.896 -81.034  1.00  0.66           N  
ATOM   3989  CA  LEU B  80      37.440  30.847 -81.977  1.00  0.66           C  
ATOM   3990  C   LEU B  80      38.489  31.297 -82.979  1.00  0.66           C  
ATOM   3991  O   LEU B  80      38.974  30.499 -83.775  1.00  0.66           O  
ATOM   3992  CB  LEU B  80      36.167  30.414 -82.748  1.00  0.66           C  
ATOM   3993  CG  LEU B  80      35.129  29.683 -81.871  1.00  0.66           C  
ATOM   3994  CD1 LEU B  80      33.765  29.618 -82.574  1.00  0.66           C  
ATOM   3995  CD2 LEU B  80      35.606  28.277 -81.479  1.00  0.66           C  
ATOM   3996  N   THR B  81      38.903  32.579 -82.958  1.00  0.62           N  
ATOM   3997  CA  THR B  81      39.868  33.137 -83.909  1.00  0.62           C  
ATOM   3998  C   THR B  81      41.255  32.544 -83.840  1.00  0.62           C  
ATOM   3999  O   THR B  81      41.899  32.346 -84.864  1.00  0.62           O  
ATOM   4000  CB  THR B  81      40.015  34.650 -83.829  1.00  0.62           C  
ATOM   4001  OG1 THR B  81      40.151  35.106 -82.488  1.00  0.62           O  
ATOM   4002  CG2 THR B  81      38.732  35.281 -84.388  1.00  0.62           C  
ATOM   4003  N   ASP B  82      41.763  32.252 -82.631  1.00  0.51           N  
ATOM   4004  CA  ASP B  82      43.054  31.623 -82.432  1.00  0.51           C  
ATOM   4005  C   ASP B  82      43.141  30.196 -82.991  1.00  0.51           C  
ATOM   4006  O   ASP B  82      44.134  29.775 -83.587  1.00  0.51           O  
ATOM   4007  CB  ASP B  82      43.332  31.563 -80.917  1.00  0.51           C  
ATOM   4008  CG  ASP B  82      43.209  32.935 -80.288  1.00  0.51           C  
ATOM   4009  OD1 ASP B  82      44.157  33.744 -80.406  1.00  0.51           O  
ATOM   4010  OD2 ASP B  82      42.184  33.174 -79.589  1.00  0.51           O  
ATOM   4011  N   ASP B  83      42.072  29.403 -82.790  1.00  0.57           N  
ATOM   4012  CA  ASP B  83      42.074  27.990 -83.082  1.00  0.57           C  
ATOM   4013  C   ASP B  83      41.478  27.617 -84.430  1.00  0.57           C  
ATOM   4014  O   ASP B  83      41.771  26.534 -84.937  1.00  0.57           O  
ATOM   4015  CB  ASP B  83      41.261  27.277 -81.981  1.00  0.57           C  
ATOM   4016  CG  ASP B  83      42.173  27.043 -80.803  1.00  0.57           C  
ATOM   4017  OD1 ASP B  83      42.993  26.091 -80.903  1.00  0.57           O  
ATOM   4018  OD2 ASP B  83      42.079  27.776 -79.791  1.00  0.57           O  
ATOM   4019  N   CYS B  84      40.679  28.479 -85.083  1.00  0.61           N  
ATOM   4020  CA  CYS B  84      39.945  28.100 -86.285  1.00  0.61           C  
ATOM   4021  C   CYS B  84      40.258  29.008 -87.462  1.00  0.61           C  
ATOM   4022  O   CYS B  84      40.116  30.225 -87.394  1.00  0.61           O  
ATOM   4023  CB  CYS B  84      38.416  28.113 -86.033  1.00  0.61           C  
ATOM   4024  SG  CYS B  84      37.936  26.950 -84.706  1.00  0.61           S  
ATOM   4025  N   ASP B  85      40.680  28.409 -88.597  1.00  0.61           N  
ATOM   4026  CA  ASP B  85      41.081  29.077 -89.825  1.00  0.61           C  
ATOM   4027  C   ASP B  85      39.913  29.775 -90.510  1.00  0.61           C  
ATOM   4028  O   ASP B  85      40.068  30.769 -91.217  1.00  0.61           O  
ATOM   4029  CB  ASP B  85      41.698  28.063 -90.839  1.00  0.61           C  
ATOM   4030  CG  ASP B  85      42.683  27.137 -90.169  1.00  0.61           C  
ATOM   4031  OD1 ASP B  85      43.918  27.302 -90.298  1.00  0.61           O  
ATOM   4032  OD2 ASP B  85      42.210  26.227 -89.437  1.00  0.61           O  
ATOM   4033  N   ARG B  86      38.696  29.231 -90.325  1.00  0.61           N  
ATOM   4034  CA  ARG B  86      37.514  29.718 -90.992  1.00  0.61           C  
ATOM   4035  C   ARG B  86      36.322  29.656 -90.054  1.00  0.61           C  
ATOM   4036  O   ARG B  86      36.146  28.698 -89.302  1.00  0.61           O  
ATOM   4037  CB  ARG B  86      37.252  28.859 -92.251  1.00  0.61           C  
ATOM   4038  CG  ARG B  86      36.372  29.544 -93.309  1.00  0.61           C  
ATOM   4039  CD  ARG B  86      36.156  28.701 -94.568  1.00  0.61           C  
ATOM   4040  NE  ARG B  86      35.199  27.613 -94.192  1.00  0.61           N  
ATOM   4041  CZ  ARG B  86      34.450  26.953 -95.081  1.00  0.61           C  
ATOM   4042  NH1 ARG B  86      34.548  27.166 -96.388  1.00  0.61           N  
ATOM   4043  NH2 ARG B  86      33.546  26.078 -94.654  1.00  0.61           N  
ATOM   4044  N   LEU B  87      35.463  30.694 -90.069  1.00  0.71           N  
ATOM   4045  CA  LEU B  87      34.307  30.776 -89.198  1.00  0.71           C  
ATOM   4046  C   LEU B  87      33.049  30.788 -90.049  1.00  0.71           C  
ATOM   4047  O   LEU B  87      32.799  31.730 -90.799  1.00  0.71           O  
ATOM   4048  CB  LEU B  87      34.345  32.063 -88.331  1.00  0.71           C  
ATOM   4049  CG  LEU B  87      35.595  32.220 -87.435  1.00  0.71           C  
ATOM   4050  CD1 LEU B  87      35.551  33.568 -86.702  1.00  0.71           C  
ATOM   4051  CD2 LEU B  87      35.756  31.081 -86.420  1.00  0.71           C  
ATOM   4052  N   LEU B  88      32.226  29.725 -89.953  1.00  0.70           N  
ATOM   4053  CA  LEU B  88      31.049  29.539 -90.777  1.00  0.70           C  
ATOM   4054  C   LEU B  88      29.800  29.565 -89.915  1.00  0.70           C  
ATOM   4055  O   LEU B  88      29.611  28.749 -89.014  1.00  0.70           O  
ATOM   4056  CB  LEU B  88      31.129  28.177 -91.517  1.00  0.70           C  
ATOM   4057  CG  LEU B  88      29.913  27.815 -92.400  1.00  0.70           C  
ATOM   4058  CD1 LEU B  88      29.745  28.786 -93.578  1.00  0.70           C  
ATOM   4059  CD2 LEU B  88      30.020  26.370 -92.911  1.00  0.70           C  
ATOM   4060  N   LEU B  89      28.891  30.514 -90.187  1.00  0.71           N  
ATOM   4061  CA  LEU B  89      27.602  30.597 -89.534  1.00  0.71           C  
ATOM   4062  C   LEU B  89      26.552  29.939 -90.402  1.00  0.71           C  
ATOM   4063  O   LEU B  89      26.362  30.293 -91.566  1.00  0.71           O  
ATOM   4064  CB  LEU B  89      27.154  32.058 -89.259  1.00  0.71           C  
ATOM   4065  CG  LEU B  89      27.675  32.657 -87.937  1.00  0.71           C  
ATOM   4066  CD1 LEU B  89      29.203  32.639 -87.853  1.00  0.71           C  
ATOM   4067  CD2 LEU B  89      27.160  34.093 -87.768  1.00  0.71           C  
ATOM   4068  N   VAL B  90      25.806  28.984 -89.826  1.00  0.69           N  
ATOM   4069  CA  VAL B  90      24.594  28.466 -90.427  1.00  0.69           C  
ATOM   4070  C   VAL B  90      23.459  29.211 -89.758  1.00  0.69           C  
ATOM   4071  O   VAL B  90      23.122  28.984 -88.595  1.00  0.69           O  
ATOM   4072  CB  VAL B  90      24.422  26.959 -90.270  1.00  0.69           C  
ATOM   4073  CG1 VAL B  90      23.143  26.496 -91.001  1.00  0.69           C  
ATOM   4074  CG2 VAL B  90      25.656  26.246 -90.861  1.00  0.69           C  
ATOM   4075  N   ASP B  91      22.869  30.170 -90.487  1.00  0.61           N  
ATOM   4076  CA  ASP B  91      21.824  31.026 -89.986  1.00  0.61           C  
ATOM   4077  C   ASP B  91      20.481  30.401 -90.331  1.00  0.61           C  
ATOM   4078  O   ASP B  91      20.253  29.943 -91.450  1.00  0.61           O  
ATOM   4079  CB  ASP B  91      22.002  32.446 -90.581  1.00  0.61           C  
ATOM   4080  CG  ASP B  91      20.994  33.408 -89.993  1.00  0.61           C  
ATOM   4081  OD1 ASP B  91      21.258  33.958 -88.896  1.00  0.61           O  
ATOM   4082  OD2 ASP B  91      19.923  33.584 -90.625  1.00  0.61           O  
ATOM   4083  N   ALA B  92      19.565  30.354 -89.349  1.00  0.60           N  
ATOM   4084  CA  ALA B  92      18.279  29.710 -89.498  1.00  0.60           C  
ATOM   4085  C   ALA B  92      17.164  30.692 -89.848  1.00  0.60           C  
ATOM   4086  O   ALA B  92      15.991  30.344 -89.715  1.00  0.60           O  
ATOM   4087  CB  ALA B  92      17.944  28.944 -88.204  1.00  0.60           C  
ATOM   4088  N   GLU B  93      17.548  31.906 -90.318  1.00  0.49           N  
ATOM   4089  CA  GLU B  93      16.711  33.051 -90.641  1.00  0.49           C  
ATOM   4090  C   GLU B  93      16.501  33.953 -89.438  1.00  0.49           C  
ATOM   4091  O   GLU B  93      15.383  34.200 -88.992  1.00  0.49           O  
ATOM   4092  CB  GLU B  93      15.418  32.766 -91.453  1.00  0.49           C  
ATOM   4093  CG  GLU B  93      15.720  32.072 -92.804  1.00  0.49           C  
ATOM   4094  CD  GLU B  93      14.465  31.732 -93.598  1.00  0.49           C  
ATOM   4095  OE1 GLU B  93      14.422  32.100 -94.801  1.00  0.49           O  
ATOM   4096  OE2 GLU B  93      13.570  31.047 -93.038  1.00  0.49           O  
ATOM   4097  N   SER B  94      17.619  34.477 -88.881  1.00  0.57           N  
ATOM   4098  CA  SER B  94      17.603  35.452 -87.786  1.00  0.57           C  
ATOM   4099  C   SER B  94      16.913  36.767 -88.142  1.00  0.57           C  
ATOM   4100  O   SER B  94      17.107  37.305 -89.233  1.00  0.57           O  
ATOM   4101  CB  SER B  94      19.018  35.875 -87.288  1.00  0.57           C  
ATOM   4102  OG  SER B  94      19.801  34.781 -86.818  1.00  0.57           O  
ATOM   4103  N   GLU B  95      16.131  37.349 -87.209  1.00  0.50           N  
ATOM   4104  CA  GLU B  95      15.439  38.615 -87.412  1.00  0.50           C  
ATOM   4105  C   GLU B  95      16.080  39.762 -86.626  1.00  0.50           C  
ATOM   4106  O   GLU B  95      15.728  40.927 -86.814  1.00  0.50           O  
ATOM   4107  CB  GLU B  95      13.941  38.516 -87.002  1.00  0.50           C  
ATOM   4108  CG  GLU B  95      13.096  37.548 -87.877  1.00  0.50           C  
ATOM   4109  CD  GLU B  95      11.581  37.693 -87.686  1.00  0.50           C  
ATOM   4110  OE1 GLU B  95      10.840  36.946 -88.380  1.00  0.50           O  
ATOM   4111  OE2 GLU B  95      11.141  38.557 -86.884  1.00  0.50           O  
ATOM   4112  N   ASP B  96      17.061  39.476 -85.745  1.00  0.51           N  
ATOM   4113  CA  ASP B  96      17.767  40.474 -84.958  1.00  0.51           C  
ATOM   4114  C   ASP B  96      18.961  41.129 -85.689  1.00  0.51           C  
ATOM   4115  O   ASP B  96      18.996  41.267 -86.912  1.00  0.51           O  
ATOM   4116  CB  ASP B  96      18.142  39.842 -83.582  1.00  0.51           C  
ATOM   4117  CG  ASP B  96      19.238  38.799 -83.647  1.00  0.51           C  
ATOM   4118  OD1 ASP B  96      19.694  38.432 -84.761  1.00  0.51           O  
ATOM   4119  OD2 ASP B  96      19.710  38.362 -82.571  1.00  0.51           O  
ATOM   4120  N   THR B  97      20.012  41.555 -84.950  1.00  0.61           N  
ATOM   4121  CA  THR B  97      21.236  42.085 -85.547  1.00  0.61           C  
ATOM   4122  C   THR B  97      22.353  41.054 -85.657  1.00  0.61           C  
ATOM   4123  O   THR B  97      23.484  41.415 -85.985  1.00  0.61           O  
ATOM   4124  CB  THR B  97      21.788  43.328 -84.846  1.00  0.61           C  
ATOM   4125  OG1 THR B  97      22.245  43.073 -83.527  1.00  0.61           O  
ATOM   4126  CG2 THR B  97      20.703  44.412 -84.765  1.00  0.61           C  
ATOM   4127  N   THR B  98      22.087  39.736 -85.450  1.00  0.60           N  
ATOM   4128  CA  THR B  98      23.082  38.647 -85.372  1.00  0.60           C  
ATOM   4129  C   THR B  98      24.118  38.655 -86.470  1.00  0.60           C  
ATOM   4130  O   THR B  98      25.319  38.605 -86.209  1.00  0.60           O  
ATOM   4131  CB  THR B  98      22.442  37.250 -85.395  1.00  0.60           C  
ATOM   4132  OG1 THR B  98      21.799  36.987 -84.167  1.00  0.60           O  
ATOM   4133  CG2 THR B  98      23.431  36.083 -85.557  1.00  0.60           C  
ATOM   4134  N   LEU B  99      23.697  38.761 -87.744  1.00  0.58           N  
ATOM   4135  CA  LEU B  99      24.607  38.793 -88.876  1.00  0.58           C  
ATOM   4136  C   LEU B  99      25.473  40.045 -88.949  1.00  0.58           C  
ATOM   4137  O   LEU B  99      26.596  40.002 -89.445  1.00  0.58           O  
ATOM   4138  CB  LEU B  99      23.842  38.599 -90.206  1.00  0.58           C  
ATOM   4139  CG  LEU B  99      23.102  37.247 -90.308  1.00  0.58           C  
ATOM   4140  CD1 LEU B  99      22.323  37.158 -91.627  1.00  0.58           C  
ATOM   4141  CD2 LEU B  99      24.044  36.039 -90.181  1.00  0.58           C  
ATOM   4142  N   GLY B 100      24.994  41.196 -88.431  1.00  0.61           N  
ATOM   4143  CA  GLY B 100      25.798  42.412 -88.334  1.00  0.61           C  
ATOM   4144  C   GLY B 100      26.789  42.345 -87.205  1.00  0.61           C  
ATOM   4145  O   GLY B 100      27.968  42.638 -87.380  1.00  0.61           O  
ATOM   4146  N   THR B 101      26.342  41.891 -86.020  1.00  0.62           N  
ATOM   4147  CA  THR B 101      27.182  41.691 -84.838  1.00  0.62           C  
ATOM   4148  C   THR B 101      28.261  40.655 -85.060  1.00  0.62           C  
ATOM   4149  O   THR B 101      29.400  40.832 -84.640  1.00  0.62           O  
ATOM   4150  CB  THR B 101      26.375  41.353 -83.591  1.00  0.62           C  
ATOM   4151  OG1 THR B 101      25.541  42.463 -83.301  1.00  0.62           O  
ATOM   4152  CG2 THR B 101      27.280  41.159 -82.363  1.00  0.62           C  
ATOM   4153  N   ALA B 102      27.955  39.552 -85.772  1.00  0.64           N  
ATOM   4154  CA  ALA B 102      28.935  38.567 -86.182  1.00  0.64           C  
ATOM   4155  C   ALA B 102      30.041  39.116 -87.082  1.00  0.64           C  
ATOM   4156  O   ALA B 102      31.218  38.850 -86.858  1.00  0.64           O  
ATOM   4157  CB  ALA B 102      28.206  37.427 -86.919  1.00  0.64           C  
ATOM   4158  N   ARG B 103      29.687  39.931 -88.098  1.00  0.55           N  
ATOM   4159  CA  ARG B 103      30.642  40.604 -88.968  1.00  0.55           C  
ATOM   4160  C   ARG B 103      31.496  41.639 -88.255  1.00  0.55           C  
ATOM   4161  O   ARG B 103      32.696  41.728 -88.476  1.00  0.55           O  
ATOM   4162  CB  ARG B 103      29.921  41.271 -90.161  1.00  0.55           C  
ATOM   4163  CG  ARG B 103      29.308  40.251 -91.141  1.00  0.55           C  
ATOM   4164  CD  ARG B 103      28.370  40.911 -92.153  1.00  0.55           C  
ATOM   4165  NE  ARG B 103      27.683  39.813 -92.912  1.00  0.55           N  
ATOM   4166  CZ  ARG B 103      26.496  39.962 -93.510  1.00  0.55           C  
ATOM   4167  NH1 ARG B 103      25.957  41.166 -93.691  1.00  0.55           N  
ATOM   4168  NH2 ARG B 103      25.834  38.897 -93.951  1.00  0.55           N  
ATOM   4169  N   SER B 104      30.906  42.438 -87.349  1.00  0.63           N  
ATOM   4170  CA  SER B 104      31.644  43.449 -86.598  1.00  0.63           C  
ATOM   4171  C   SER B 104      32.495  42.871 -85.481  1.00  0.63           C  
ATOM   4172  O   SER B 104      33.336  43.553 -84.902  1.00  0.63           O  
ATOM   4173  CB  SER B 104      30.697  44.484 -85.943  1.00  0.63           C  
ATOM   4174  OG  SER B 104      29.977  45.200 -86.946  1.00  0.63           O  
ATOM   4175  N   ALA B 105      32.284  41.595 -85.108  1.00  0.61           N  
ATOM   4176  CA  ALA B 105      33.034  40.956 -84.053  1.00  0.61           C  
ATOM   4177  C   ALA B 105      34.414  40.444 -84.441  1.00  0.61           C  
ATOM   4178  O   ALA B 105      35.282  40.346 -83.573  1.00  0.61           O  
ATOM   4179  CB  ALA B 105      32.218  39.772 -83.498  1.00  0.61           C  
ATOM   4180  N   VAL B 106      34.646  40.095 -85.724  1.00  0.55           N  
ATOM   4181  CA  VAL B 106      35.849  39.400 -86.165  1.00  0.55           C  
ATOM   4182  C   VAL B 106      36.250  39.871 -87.554  1.00  0.55           C  
ATOM   4183  O   VAL B 106      35.465  40.451 -88.290  1.00  0.55           O  
ATOM   4184  CB  VAL B 106      35.711  37.870 -86.196  1.00  0.55           C  
ATOM   4185  CG1 VAL B 106      35.647  37.310 -84.762  1.00  0.55           C  
ATOM   4186  CG2 VAL B 106      34.467  37.450 -87.004  1.00  0.55           C  
ATOM   4187  N   ALA B 107      37.521  39.641 -87.952  1.00  0.35           N  
ATOM   4188  CA  ALA B 107      38.066  40.082 -89.227  1.00  0.35           C  
ATOM   4189  C   ALA B 107      37.444  39.460 -90.482  1.00  0.35           C  
ATOM   4190  O   ALA B 107      37.316  40.113 -91.513  1.00  0.35           O  
ATOM   4191  CB  ALA B 107      39.590  39.848 -89.229  1.00  0.35           C  
ATOM   4192  N   HIS B 108      37.064  38.169 -90.431  1.00  0.49           N  
ATOM   4193  CA  HIS B 108      36.416  37.491 -91.537  1.00  0.49           C  
ATOM   4194  C   HIS B 108      35.450  36.486 -90.953  1.00  0.49           C  
ATOM   4195  O   HIS B 108      35.742  35.838 -89.948  1.00  0.49           O  
ATOM   4196  CB  HIS B 108      37.428  36.765 -92.465  1.00  0.49           C  
ATOM   4197  CG  HIS B 108      36.808  35.876 -93.509  1.00  0.49           C  
ATOM   4198  ND1 HIS B 108      35.848  36.400 -94.349  1.00  0.49           N  
ATOM   4199  CD2 HIS B 108      36.970  34.546 -93.746  1.00  0.49           C  
ATOM   4200  CE1 HIS B 108      35.442  35.379 -95.082  1.00  0.49           C  
ATOM   4201  NE2 HIS B 108      36.089  34.234 -94.758  1.00  0.49           N  
ATOM   4202  N   VAL B 109      34.262  36.358 -91.567  1.00  0.67           N  
ATOM   4203  CA  VAL B 109      33.254  35.404 -91.163  1.00  0.67           C  
ATOM   4204  C   VAL B 109      32.366  35.118 -92.364  1.00  0.67           C  
ATOM   4205  O   VAL B 109      32.100  35.995 -93.184  1.00  0.67           O  
ATOM   4206  CB  VAL B 109      32.462  35.886 -89.943  1.00  0.67           C  
ATOM   4207  CG1 VAL B 109      31.699  37.194 -90.228  1.00  0.67           C  
ATOM   4208  CG2 VAL B 109      31.514  34.793 -89.425  1.00  0.67           C  
ATOM   4209  N   GLU B 110      31.886  33.869 -92.505  1.00  0.68           N  
ATOM   4210  CA  GLU B 110      31.087  33.428 -93.631  1.00  0.68           C  
ATOM   4211  C   GLU B 110      29.718  33.043 -93.112  1.00  0.68           C  
ATOM   4212  O   GLU B 110      29.598  32.382 -92.083  1.00  0.68           O  
ATOM   4213  CB  GLU B 110      31.760  32.207 -94.314  1.00  0.68           C  
ATOM   4214  CG  GLU B 110      33.143  32.577 -94.905  1.00  0.68           C  
ATOM   4215  CD  GLU B 110      34.002  31.408 -95.369  1.00  0.68           C  
ATOM   4216  OE1 GLU B 110      35.207  31.686 -95.627  1.00  0.68           O  
ATOM   4217  OE2 GLU B 110      33.526  30.246 -95.451  1.00  0.68           O  
ATOM   4218  N   HIS B 111      28.625  33.465 -93.778  1.00  0.68           N  
ATOM   4219  CA  HIS B 111      27.282  33.111 -93.351  1.00  0.68           C  
ATOM   4220  C   HIS B 111      26.543  32.403 -94.471  1.00  0.68           C  
ATOM   4221  O   HIS B 111      26.587  32.814 -95.627  1.00  0.68           O  
ATOM   4222  CB  HIS B 111      26.453  34.332 -92.847  1.00  0.68           C  
ATOM   4223  CG  HIS B 111      25.895  35.208 -93.934  1.00  0.68           C  
ATOM   4224  ND1 HIS B 111      26.688  36.154 -94.562  1.00  0.68           N  
ATOM   4225  CD2 HIS B 111      24.740  35.026 -94.626  1.00  0.68           C  
ATOM   4226  CE1 HIS B 111      26.008  36.499 -95.643  1.00  0.68           C  
ATOM   4227  NE2 HIS B 111      24.820  35.856 -95.722  1.00  0.68           N  
ATOM   4228  N   VAL B 112      25.823  31.316 -94.147  1.00  0.70           N  
ATOM   4229  CA  VAL B 112      24.901  30.679 -95.071  1.00  0.70           C  
ATOM   4230  C   VAL B 112      23.546  30.656 -94.394  1.00  0.70           C  
ATOM   4231  O   VAL B 112      23.380  30.096 -93.312  1.00  0.70           O  
ATOM   4232  CB  VAL B 112      25.322  29.266 -95.470  1.00  0.70           C  
ATOM   4233  CG1 VAL B 112      24.296  28.640 -96.439  1.00  0.70           C  
ATOM   4234  CG2 VAL B 112      26.696  29.340 -96.162  1.00  0.70           C  
ATOM   4235  N   THR B 113      22.534  31.296 -95.009  1.00  0.61           N  
ATOM   4236  CA  THR B 113      21.182  31.379 -94.462  1.00  0.61           C  
ATOM   4237  C   THR B 113      20.339  30.267 -95.041  1.00  0.61           C  
ATOM   4238  O   THR B 113      20.249  30.113 -96.257  1.00  0.61           O  
ATOM   4239  CB  THR B 113      20.497  32.709 -94.759  1.00  0.61           C  
ATOM   4240  OG1 THR B 113      21.249  33.783 -94.215  1.00  0.61           O  
ATOM   4241  CG2 THR B 113      19.107  32.810 -94.118  1.00  0.61           C  
ATOM   4242  N   ARG B 114      19.718  29.436 -94.184  1.00  0.50           N  
ATOM   4243  CA  ARG B 114      18.874  28.335 -94.610  1.00  0.50           C  
ATOM   4244  C   ARG B 114      17.653  28.284 -93.723  1.00  0.50           C  
ATOM   4245  O   ARG B 114      17.775  28.240 -92.503  1.00  0.50           O  
ATOM   4246  CB  ARG B 114      19.583  26.963 -94.458  1.00  0.50           C  
ATOM   4247  CG  ARG B 114      20.821  26.794 -95.354  1.00  0.50           C  
ATOM   4248  CD  ARG B 114      21.601  25.497 -95.113  1.00  0.50           C  
ATOM   4249  NE  ARG B 114      20.900  24.345 -95.787  1.00  0.50           N  
ATOM   4250  CZ  ARG B 114      20.522  23.239 -95.135  1.00  0.50           C  
ATOM   4251  NH1 ARG B 114      20.142  23.256 -93.859  1.00  0.50           N  
ATOM   4252  NH2 ARG B 114      20.650  22.055 -95.744  1.00  0.50           N  
ATOM   4253  N   ALA B 115      16.442  28.254 -94.308  1.00  0.54           N  
ATOM   4254  CA  ALA B 115      15.197  28.229 -93.567  1.00  0.54           C  
ATOM   4255  C   ALA B 115      15.031  27.086 -92.566  1.00  0.54           C  
ATOM   4256  O   ALA B 115      15.484  25.958 -92.769  1.00  0.54           O  
ATOM   4257  CB  ALA B 115      14.017  28.226 -94.559  1.00  0.54           C  
ATOM   4258  N   TRP B 116      14.379  27.367 -91.422  1.00  0.39           N  
ATOM   4259  CA  TRP B 116      14.093  26.370 -90.409  1.00  0.39           C  
ATOM   4260  C   TRP B 116      13.023  25.359 -90.849  1.00  0.39           C  
ATOM   4261  O   TRP B 116      11.865  25.688 -91.089  1.00  0.39           O  
ATOM   4262  CB  TRP B 116      13.720  27.056 -89.064  1.00  0.39           C  
ATOM   4263  CG  TRP B 116      13.367  26.104 -87.930  1.00  0.39           C  
ATOM   4264  CD1 TRP B 116      12.121  25.777 -87.472  1.00  0.39           C  
ATOM   4265  CD2 TRP B 116      14.288  25.222 -87.263  1.00  0.39           C  
ATOM   4266  NE1 TRP B 116      12.200  24.752 -86.556  1.00  0.39           N  
ATOM   4267  CE2 TRP B 116      13.520  24.398 -86.412  1.00  0.39           C  
ATOM   4268  CE3 TRP B 116      15.669  25.067 -87.364  1.00  0.39           C  
ATOM   4269  CZ2 TRP B 116      14.118  23.401 -85.655  1.00  0.39           C  
ATOM   4270  CZ3 TRP B 116      16.271  24.052 -86.605  1.00  0.39           C  
ATOM   4271  CH2 TRP B 116      15.504  23.230 -85.767  1.00  0.39           C  
ATOM   4272  N   THR B 117      13.402  24.068 -90.944  1.00  0.43           N  
ATOM   4273  CA  THR B 117      12.571  23.006 -91.507  1.00  0.43           C  
ATOM   4274  C   THR B 117      12.023  22.056 -90.454  1.00  0.43           C  
ATOM   4275  O   THR B 117      11.503  20.986 -90.787  1.00  0.43           O  
ATOM   4276  CB  THR B 117      13.366  22.158 -92.501  1.00  0.43           C  
ATOM   4277  OG1 THR B 117      14.608  21.739 -91.942  1.00  0.43           O  
ATOM   4278  CG2 THR B 117      13.698  23.003 -93.737  1.00  0.43           C  
ATOM   4279  N   ASP B 118      12.124  22.426 -89.155  1.00  0.38           N  
ATOM   4280  CA  ASP B 118      11.931  21.537 -88.018  1.00  0.38           C  
ATOM   4281  C   ASP B 118      12.952  20.392 -87.985  1.00  0.38           C  
ATOM   4282  O   ASP B 118      12.613  19.206 -88.021  1.00  0.38           O  
ATOM   4283  CB  ASP B 118      10.448  21.079 -87.838  1.00  0.38           C  
ATOM   4284  CG  ASP B 118       9.653  21.951 -86.886  1.00  0.38           C  
ATOM   4285  OD1 ASP B 118      10.163  22.974 -86.361  1.00  0.38           O  
ATOM   4286  OD2 ASP B 118       8.482  21.584 -86.616  1.00  0.38           O  
ATOM   4287  N   ASP B 119      14.255  20.753 -87.926  1.00  0.38           N  
ATOM   4288  CA  ASP B 119      15.342  19.806 -88.047  1.00  0.38           C  
ATOM   4289  C   ASP B 119      16.689  20.441 -87.653  1.00  0.38           C  
ATOM   4290  O   ASP B 119      17.260  21.257 -88.380  1.00  0.38           O  
ATOM   4291  CB  ASP B 119      15.408  19.324 -89.522  1.00  0.38           C  
ATOM   4292  CG  ASP B 119      16.016  17.943 -89.626  1.00  0.38           C  
ATOM   4293  OD1 ASP B 119      17.102  17.728 -89.038  1.00  0.38           O  
ATOM   4294  OD2 ASP B 119      15.385  17.078 -90.289  1.00  0.38           O  
ATOM   4295  N   PHE B 120      17.241  20.097 -86.466  1.00  0.38           N  
ATOM   4296  CA  PHE B 120      18.585  20.496 -86.065  1.00  0.38           C  
ATOM   4297  C   PHE B 120      19.679  19.811 -86.880  1.00  0.38           C  
ATOM   4298  O   PHE B 120      20.662  20.437 -87.283  1.00  0.38           O  
ATOM   4299  CB  PHE B 120      18.824  20.259 -84.548  1.00  0.38           C  
ATOM   4300  CG  PHE B 120      18.118  21.318 -83.743  1.00  0.38           C  
ATOM   4301  CD1 PHE B 120      18.628  22.627 -83.720  1.00  0.38           C  
ATOM   4302  CD2 PHE B 120      16.949  21.036 -83.015  1.00  0.38           C  
ATOM   4303  CE1 PHE B 120      17.976  23.638 -83.003  1.00  0.38           C  
ATOM   4304  CE2 PHE B 120      16.289  22.045 -82.301  1.00  0.38           C  
ATOM   4305  CZ  PHE B 120      16.802  23.348 -82.296  1.00  0.38           C  
ATOM   4306  N   ALA B 121      19.516  18.508 -87.185  1.00  0.58           N  
ATOM   4307  CA  ALA B 121      20.451  17.732 -87.973  1.00  0.58           C  
ATOM   4308  C   ALA B 121      20.613  18.240 -89.398  1.00  0.58           C  
ATOM   4309  O   ALA B 121      21.729  18.375 -89.895  1.00  0.58           O  
ATOM   4310  CB  ALA B 121      20.012  16.258 -87.999  1.00  0.58           C  
ATOM   4311  N   ALA B 122      19.514  18.596 -90.086  1.00  0.60           N  
ATOM   4312  CA  ALA B 122      19.551  19.189 -91.411  1.00  0.60           C  
ATOM   4313  C   ALA B 122      20.282  20.529 -91.486  1.00  0.60           C  
ATOM   4314  O   ALA B 122      20.890  20.861 -92.505  1.00  0.60           O  
ATOM   4315  CB  ALA B 122      18.132  19.353 -91.978  1.00  0.60           C  
ATOM   4316  N   GLN B 123      20.233  21.352 -90.417  1.00  0.61           N  
ATOM   4317  CA  GLN B 123      21.089  22.523 -90.296  1.00  0.61           C  
ATOM   4318  C   GLN B 123      22.558  22.193 -90.034  1.00  0.61           C  
ATOM   4319  O   GLN B 123      23.443  22.731 -90.695  1.00  0.61           O  
ATOM   4320  CB  GLN B 123      20.551  23.515 -89.234  1.00  0.61           C  
ATOM   4321  CG  GLN B 123      19.159  24.128 -89.558  1.00  0.61           C  
ATOM   4322  CD  GLN B 123      19.147  25.089 -90.759  1.00  0.61           C  
ATOM   4323  OE1 GLN B 123      19.954  25.026 -91.690  1.00  0.61           O  
ATOM   4324  NE2 GLN B 123      18.157  26.012 -90.752  1.00  0.61           N  
ATOM   4325  N   ARG B 124      22.880  21.259 -89.110  1.00  0.58           N  
ATOM   4326  CA  ARG B 124      24.259  20.841 -88.868  1.00  0.58           C  
ATOM   4327  C   ARG B 124      24.928  20.151 -90.056  1.00  0.58           C  
ATOM   4328  O   ARG B 124      26.105  20.371 -90.342  1.00  0.58           O  
ATOM   4329  CB  ARG B 124      24.406  19.933 -87.624  1.00  0.58           C  
ATOM   4330  CG  ARG B 124      24.053  20.616 -86.289  1.00  0.58           C  
ATOM   4331  CD  ARG B 124      24.619  19.870 -85.075  1.00  0.58           C  
ATOM   4332  NE  ARG B 124      23.963  20.400 -83.841  1.00  0.58           N  
ATOM   4333  CZ  ARG B 124      24.436  21.350 -83.028  1.00  0.58           C  
ATOM   4334  NH1 ARG B 124      25.483  22.103 -83.322  1.00  0.58           N  
ATOM   4335  NH2 ARG B 124      23.801  21.541 -81.874  1.00  0.58           N  
ATOM   4336  N   ASN B 125      24.179  19.314 -90.803  1.00  0.63           N  
ATOM   4337  CA  ASN B 125      24.666  18.603 -91.975  1.00  0.63           C  
ATOM   4338  C   ASN B 125      24.996  19.514 -93.152  1.00  0.63           C  
ATOM   4339  O   ASN B 125      25.788  19.151 -94.019  1.00  0.63           O  
ATOM   4340  CB  ASN B 125      23.643  17.538 -92.451  1.00  0.63           C  
ATOM   4341  CG  ASN B 125      23.659  16.353 -91.494  1.00  0.63           C  
ATOM   4342  OD1 ASN B 125      24.718  15.957 -90.998  1.00  0.63           O  
ATOM   4343  ND2 ASN B 125      22.482  15.736 -91.250  1.00  0.63           N  
ATOM   4344  N   ALA B 126      24.452  20.744 -93.185  1.00  0.69           N  
ATOM   4345  CA  ALA B 126      24.714  21.690 -94.249  1.00  0.69           C  
ATOM   4346  C   ALA B 126      26.117  22.275 -94.226  1.00  0.69           C  
ATOM   4347  O   ALA B 126      26.646  22.778 -95.211  1.00  0.69           O  
ATOM   4348  CB  ALA B 126      23.712  22.837 -94.126  1.00  0.69           C  
ATOM   4349  N   ALA B 127      26.804  22.179 -93.079  1.00  0.67           N  
ATOM   4350  CA  ALA B 127      28.182  22.586 -92.965  1.00  0.67           C  
ATOM   4351  C   ALA B 127      29.148  21.728 -93.780  1.00  0.67           C  
ATOM   4352  O   ALA B 127      30.183  22.208 -94.235  1.00  0.67           O  
ATOM   4353  CB  ALA B 127      28.564  22.566 -91.484  1.00  0.67           C  
ATOM   4354  N   PHE B 128      28.801  20.441 -94.011  1.00  0.50           N  
ATOM   4355  CA  PHE B 128      29.521  19.531 -94.890  1.00  0.50           C  
ATOM   4356  C   PHE B 128      29.474  19.961 -96.354  1.00  0.50           C  
ATOM   4357  O   PHE B 128      30.461  19.831 -97.072  1.00  0.50           O  
ATOM   4358  CB  PHE B 128      29.003  18.074 -94.786  1.00  0.50           C  
ATOM   4359  CG  PHE B 128      29.312  17.460 -93.446  1.00  0.50           C  
ATOM   4360  CD1 PHE B 128      30.455  16.661 -93.267  1.00  0.50           C  
ATOM   4361  CD2 PHE B 128      28.429  17.624 -92.367  1.00  0.50           C  
ATOM   4362  CE1 PHE B 128      30.681  16.003 -92.049  1.00  0.50           C  
ATOM   4363  CE2 PHE B 128      28.644  16.966 -91.151  1.00  0.50           C  
ATOM   4364  CZ  PHE B 128      29.765  16.142 -91.000  1.00  0.50           C  
ATOM   4365  N   GLU B 129      28.332  20.526 -96.817  1.00  0.63           N  
ATOM   4366  CA  GLU B 129      28.141  21.073 -98.158  1.00  0.63           C  
ATOM   4367  C   GLU B 129      29.139  22.195 -98.456  1.00  0.63           C  
ATOM   4368  O   GLU B 129      29.650  22.347 -99.562  1.00  0.63           O  
ATOM   4369  CB  GLU B 129      26.715  21.693 -98.313  1.00  0.63           C  
ATOM   4370  CG  GLU B 129      25.485  20.793 -97.980  1.00  0.63           C  
ATOM   4371  CD  GLU B 129      24.190  21.601 -97.746  1.00  0.63           C  
ATOM   4372  OE1 GLU B 129      23.170  21.004 -97.294  1.00  0.63           O  
ATOM   4373  OE2 GLU B 129      24.204  22.842 -97.953  1.00  0.63           O  
ATOM   4374  N   GLN B 130      29.434  23.011 -97.426  1.00  0.69           N  
ATOM   4375  CA  GLN B 130      30.264  24.195 -97.506  1.00  0.69           C  
ATOM   4376  C   GLN B 130      31.696  23.942 -97.044  1.00  0.69           C  
ATOM   4377  O   GLN B 130      32.469  24.880 -96.828  1.00  0.69           O  
ATOM   4378  CB  GLN B 130      29.665  25.282 -96.572  1.00  0.69           C  
ATOM   4379  CG  GLN B 130      28.149  25.536 -96.758  1.00  0.69           C  
ATOM   4380  CD  GLN B 130      27.818  25.984 -98.182  1.00  0.69           C  
ATOM   4381  OE1 GLN B 130      28.384  26.952 -98.689  1.00  0.69           O  
ATOM   4382  NE2 GLN B 130      26.871  25.283 -98.848  1.00  0.69           N  
ATOM   4383  N   ALA B 131      32.079  22.672 -96.820  1.00  0.63           N  
ATOM   4384  CA  ALA B 131      33.334  22.300 -96.205  1.00  0.63           C  
ATOM   4385  C   ALA B 131      34.536  22.298 -97.147  1.00  0.63           C  
ATOM   4386  O   ALA B 131      34.424  22.319 -98.368  1.00  0.63           O  
ATOM   4387  CB  ALA B 131      33.193  20.923 -95.530  1.00  0.63           C  
ATOM   4388  N   ARG B 132      35.756  22.268 -96.572  1.00  0.55           N  
ATOM   4389  CA  ARG B 132      36.984  22.162 -97.334  1.00  0.55           C  
ATOM   4390  C   ARG B 132      37.604  20.799 -97.029  1.00  0.55           C  
ATOM   4391  O   ARG B 132      37.998  20.606 -95.877  1.00  0.55           O  
ATOM   4392  CB  ARG B 132      37.970  23.288 -96.927  1.00  0.55           C  
ATOM   4393  CG  ARG B 132      39.247  23.344 -97.791  1.00  0.55           C  
ATOM   4394  CD  ARG B 132      40.155  24.526 -97.438  1.00  0.55           C  
ATOM   4395  NE  ARG B 132      41.292  24.510 -98.415  1.00  0.55           N  
ATOM   4396  CZ  ARG B 132      42.187  25.498 -98.551  1.00  0.55           C  
ATOM   4397  NH1 ARG B 132      43.126  25.409 -99.490  1.00  0.55           N  
ATOM   4398  NH2 ARG B 132      42.166  26.574 -97.770  1.00  0.55           N  
ATOM   4399  N   PRO B 133      37.682  19.830 -97.950  1.00  0.46           N  
ATOM   4400  CA  PRO B 133      38.403  18.560 -97.786  1.00  0.46           C  
ATOM   4401  C   PRO B 133      39.801  18.648 -97.189  1.00  0.46           C  
ATOM   4402  O   PRO B 133      40.503  19.626 -97.451  1.00  0.46           O  
ATOM   4403  CB  PRO B 133      38.416  17.967 -99.202  1.00  0.46           C  
ATOM   4404  CG  PRO B 133      37.112  18.479 -99.816  1.00  0.46           C  
ATOM   4405  CD  PRO B 133      37.008  19.895 -99.251  1.00  0.46           C  
ATOM   4406  N   GLY B 134      40.229  17.651 -96.387  1.00  0.34           N  
ATOM   4407  CA  GLY B 134      41.530  17.664 -95.730  1.00  0.34           C  
ATOM   4408  C   GLY B 134      41.540  18.460 -94.455  1.00  0.34           C  
ATOM   4409  O   GLY B 134      42.553  19.050 -94.082  1.00  0.34           O  
ATOM   4410  N   GLY B 135      40.394  18.533 -93.757  1.00  0.68           N  
ATOM   4411  CA  GLY B 135      40.292  19.336 -92.551  1.00  0.68           C  
ATOM   4412  C   GLY B 135      39.235  18.865 -91.598  1.00  0.68           C  
ATOM   4413  O   GLY B 135      38.746  17.739 -91.647  1.00  0.68           O  
ATOM   4414  N   TRP B 136      38.853  19.760 -90.678  1.00  0.61           N  
ATOM   4415  CA  TRP B 136      37.938  19.480 -89.597  1.00  0.61           C  
ATOM   4416  C   TRP B 136      36.773  20.449 -89.603  1.00  0.61           C  
ATOM   4417  O   TRP B 136      36.906  21.639 -89.892  1.00  0.61           O  
ATOM   4418  CB  TRP B 136      38.649  19.583 -88.225  1.00  0.61           C  
ATOM   4419  CG  TRP B 136      39.752  18.559 -88.031  1.00  0.61           C  
ATOM   4420  CD1 TRP B 136      41.085  18.662 -88.324  1.00  0.61           C  
ATOM   4421  CD2 TRP B 136      39.558  17.241 -87.480  1.00  0.61           C  
ATOM   4422  NE1 TRP B 136      41.738  17.500 -87.975  1.00  0.61           N  
ATOM   4423  CE2 TRP B 136      40.824  16.621 -87.445  1.00  0.61           C  
ATOM   4424  CE3 TRP B 136      38.421  16.582 -87.024  1.00  0.61           C  
ATOM   4425  CZ2 TRP B 136      40.973  15.334 -86.940  1.00  0.61           C  
ATOM   4426  CZ3 TRP B 136      38.570  15.279 -86.518  1.00  0.61           C  
ATOM   4427  CH2 TRP B 136      39.831  14.664 -86.475  1.00  0.61           C  
ATOM   4428  N   LEU B 137      35.582  19.945 -89.245  1.00  0.64           N  
ATOM   4429  CA  LEU B 137      34.416  20.747 -88.961  1.00  0.64           C  
ATOM   4430  C   LEU B 137      34.170  20.671 -87.472  1.00  0.64           C  
ATOM   4431  O   LEU B 137      33.932  19.595 -86.928  1.00  0.64           O  
ATOM   4432  CB  LEU B 137      33.155  20.203 -89.676  1.00  0.64           C  
ATOM   4433  CG  LEU B 137      33.230  20.224 -91.213  1.00  0.64           C  
ATOM   4434  CD1 LEU B 137      31.967  19.594 -91.810  1.00  0.64           C  
ATOM   4435  CD2 LEU B 137      33.432  21.643 -91.761  1.00  0.64           C  
ATOM   4436  N   ALA B 138      34.233  21.815 -86.771  1.00  0.68           N  
ATOM   4437  CA  ALA B 138      34.016  21.878 -85.345  1.00  0.68           C  
ATOM   4438  C   ALA B 138      32.702  22.583 -85.067  1.00  0.68           C  
ATOM   4439  O   ALA B 138      32.575  23.790 -85.253  1.00  0.68           O  
ATOM   4440  CB  ALA B 138      35.181  22.642 -84.678  1.00  0.68           C  
ATOM   4441  N   HIS B 139      31.674  21.839 -84.613  1.00  0.68           N  
ATOM   4442  CA  HIS B 139      30.377  22.412 -84.294  1.00  0.68           C  
ATOM   4443  C   HIS B 139      30.376  23.044 -82.914  1.00  0.68           C  
ATOM   4444  O   HIS B 139      30.669  22.397 -81.911  1.00  0.68           O  
ATOM   4445  CB  HIS B 139      29.237  21.373 -84.398  1.00  0.68           C  
ATOM   4446  CG  HIS B 139      28.982  20.958 -85.818  1.00  0.68           C  
ATOM   4447  ND1 HIS B 139      27.782  21.296 -86.417  1.00  0.68           N  
ATOM   4448  CD2 HIS B 139      29.795  20.332 -86.711  1.00  0.68           C  
ATOM   4449  CE1 HIS B 139      27.894  20.877 -87.663  1.00  0.68           C  
ATOM   4450  NE2 HIS B 139      29.091  20.287 -87.895  1.00  0.68           N  
ATOM   4451  N   VAL B 140      30.057  24.345 -82.852  1.00  0.70           N  
ATOM   4452  CA  VAL B 140      30.012  25.131 -81.632  1.00  0.70           C  
ATOM   4453  C   VAL B 140      28.650  25.788 -81.624  1.00  0.70           C  
ATOM   4454  O   VAL B 140      28.233  26.358 -82.632  1.00  0.70           O  
ATOM   4455  CB  VAL B 140      31.102  26.205 -81.599  1.00  0.70           C  
ATOM   4456  CG1 VAL B 140      31.044  26.984 -80.270  1.00  0.70           C  
ATOM   4457  CG2 VAL B 140      32.485  25.543 -81.764  1.00  0.70           C  
ATOM   4458  N   ASP B 141      27.892  25.717 -80.517  1.00  0.71           N  
ATOM   4459  CA  ASP B 141      26.576  26.330 -80.477  1.00  0.71           C  
ATOM   4460  C   ASP B 141      26.711  27.790 -80.032  1.00  0.71           C  
ATOM   4461  O   ASP B 141      27.712  28.210 -79.457  1.00  0.71           O  
ATOM   4462  CB  ASP B 141      25.565  25.470 -79.663  1.00  0.71           C  
ATOM   4463  CG  ASP B 141      25.190  24.209 -80.428  1.00  0.71           C  
ATOM   4464  OD1 ASP B 141      25.461  24.109 -81.653  1.00  0.71           O  
ATOM   4465  OD2 ASP B 141      24.588  23.276 -79.827  1.00  0.71           O  
ATOM   4466  N   ALA B 142      25.731  28.647 -80.381  1.00  0.73           N  
ATOM   4467  CA  ALA B 142      25.889  30.091 -80.375  1.00  0.73           C  
ATOM   4468  C   ALA B 142      26.226  30.756 -79.041  1.00  0.73           C  
ATOM   4469  O   ALA B 142      26.983  31.728 -79.011  1.00  0.73           O  
ATOM   4470  CB  ALA B 142      24.633  30.738 -80.971  1.00  0.73           C  
ATOM   4471  N   ASP B 143      25.695  30.251 -77.909  1.00  0.64           N  
ATOM   4472  CA  ASP B 143      25.931  30.814 -76.599  1.00  0.64           C  
ATOM   4473  C   ASP B 143      27.098  30.135 -75.856  1.00  0.64           C  
ATOM   4474  O   ASP B 143      27.345  30.395 -74.673  1.00  0.64           O  
ATOM   4475  CB  ASP B 143      24.576  30.885 -75.834  1.00  0.64           C  
ATOM   4476  CG  ASP B 143      24.002  29.552 -75.399  1.00  0.64           C  
ATOM   4477  OD1 ASP B 143      23.849  28.647 -76.255  1.00  0.64           O  
ATOM   4478  OD2 ASP B 143      23.680  29.432 -74.184  1.00  0.64           O  
ATOM   4479  N   GLU B 144      27.891  29.301 -76.570  1.00  0.64           N  
ATOM   4480  CA  GLU B 144      29.129  28.701 -76.097  1.00  0.64           C  
ATOM   4481  C   GLU B 144      30.353  29.542 -76.444  1.00  0.64           C  
ATOM   4482  O   GLU B 144      30.551  29.981 -77.575  1.00  0.64           O  
ATOM   4483  CB  GLU B 144      29.367  27.302 -76.720  1.00  0.64           C  
ATOM   4484  CG  GLU B 144      28.309  26.257 -76.309  1.00  0.64           C  
ATOM   4485  CD  GLU B 144      28.369  24.964 -77.102  1.00  0.64           C  
ATOM   4486  OE1 GLU B 144      27.555  24.055 -76.786  1.00  0.64           O  
ATOM   4487  OE2 GLU B 144      29.171  24.823 -78.066  1.00  0.64           O  
ATOM   4488  N   THR B 145      31.250  29.753 -75.462  1.00  0.64           N  
ATOM   4489  CA  THR B 145      32.484  30.516 -75.646  1.00  0.64           C  
ATOM   4490  C   THR B 145      33.665  29.630 -75.297  1.00  0.64           C  
ATOM   4491  O   THR B 145      33.708  29.056 -74.211  1.00  0.64           O  
ATOM   4492  CB  THR B 145      32.552  31.743 -74.736  1.00  0.64           C  
ATOM   4493  OG1 THR B 145      31.441  32.595 -74.970  1.00  0.64           O  
ATOM   4494  CG2 THR B 145      33.790  32.599 -75.025  1.00  0.64           C  
ATOM   4495  N   LEU B 146      34.677  29.475 -76.189  1.00  0.64           N  
ATOM   4496  CA  LEU B 146      35.907  28.742 -75.880  1.00  0.64           C  
ATOM   4497  C   LEU B 146      36.675  29.364 -74.711  1.00  0.64           C  
ATOM   4498  O   LEU B 146      36.784  30.584 -74.598  1.00  0.64           O  
ATOM   4499  CB  LEU B 146      36.832  28.651 -77.126  1.00  0.64           C  
ATOM   4500  CG  LEU B 146      38.118  27.804 -76.965  1.00  0.64           C  
ATOM   4501  CD1 LEU B 146      37.809  26.312 -76.815  1.00  0.64           C  
ATOM   4502  CD2 LEU B 146      39.070  28.002 -78.154  1.00  0.64           C  
ATOM   4503  N   SER B 147      37.188  28.543 -73.771  1.00  0.63           N  
ATOM   4504  CA  SER B 147      37.887  29.042 -72.594  1.00  0.63           C  
ATOM   4505  C   SER B 147      39.254  29.665 -72.870  1.00  0.63           C  
ATOM   4506  O   SER B 147      39.953  29.308 -73.817  1.00  0.63           O  
ATOM   4507  CB  SER B 147      37.915  28.021 -71.426  1.00  0.63           C  
ATOM   4508  OG  SER B 147      39.114  27.255 -71.362  1.00  0.63           O  
ATOM   4509  N   ALA B 148      39.692  30.618 -72.020  1.00  0.54           N  
ATOM   4510  CA  ALA B 148      40.954  31.321 -72.165  1.00  0.54           C  
ATOM   4511  C   ALA B 148      42.167  30.405 -72.056  1.00  0.54           C  
ATOM   4512  O   ALA B 148      43.151  30.525 -72.784  1.00  0.54           O  
ATOM   4513  CB  ALA B 148      41.040  32.416 -71.086  1.00  0.54           C  
ATOM   4514  N   GLU B 149      42.072  29.417 -71.154  1.00  0.32           N  
ATOM   4515  CA  GLU B 149      43.041  28.384 -70.875  1.00  0.32           C  
ATOM   4516  C   GLU B 149      43.093  27.351 -71.991  1.00  0.32           C  
ATOM   4517  O   GLU B 149      44.023  26.545 -72.086  1.00  0.32           O  
ATOM   4518  CB  GLU B 149      42.661  27.638 -69.562  1.00  0.32           C  
ATOM   4519  CG  GLU B 149      42.222  28.550 -68.372  1.00  0.32           C  
ATOM   4520  CD  GLU B 149      40.786  29.075 -68.449  1.00  0.32           C  
ATOM   4521  OE1 GLU B 149      40.364  29.865 -67.575  1.00  0.32           O  
ATOM   4522  OE2 GLU B 149      40.097  28.711 -69.440  1.00  0.32           O  
ATOM   4523  N   SER B 150      42.062  27.357 -72.863  1.00  0.60           N  
ATOM   4524  CA  SER B 150      41.909  26.436 -73.971  1.00  0.60           C  
ATOM   4525  C   SER B 150      42.339  27.021 -75.291  1.00  0.60           C  
ATOM   4526  O   SER B 150      42.317  26.320 -76.300  1.00  0.60           O  
ATOM   4527  CB  SER B 150      40.458  25.944 -74.161  1.00  0.60           C  
ATOM   4528  OG  SER B 150      40.036  25.209 -73.016  1.00  0.60           O  
ATOM   4529  N   ARG B 151      42.790  28.290 -75.318  1.00  0.32           N  
ATOM   4530  CA  ARG B 151      43.318  28.925 -76.513  1.00  0.32           C  
ATOM   4531  C   ARG B 151      44.523  28.202 -77.111  1.00  0.32           C  
ATOM   4532  O   ARG B 151      45.558  28.013 -76.473  1.00  0.32           O  
ATOM   4533  CB  ARG B 151      43.708  30.397 -76.221  1.00  0.32           C  
ATOM   4534  CG  ARG B 151      44.316  31.126 -77.438  1.00  0.32           C  
ATOM   4535  CD  ARG B 151      44.714  32.587 -77.206  1.00  0.32           C  
ATOM   4536  NE  ARG B 151      43.455  33.391 -77.240  1.00  0.32           N  
ATOM   4537  CZ  ARG B 151      43.259  34.566 -76.641  1.00  0.32           C  
ATOM   4538  NH1 ARG B 151      44.217  35.141 -75.918  1.00  0.32           N  
ATOM   4539  NH2 ARG B 151      42.092  35.183 -76.825  1.00  0.32           N  
ATOM   4540  N   GLY B 152      44.396  27.769 -78.377  1.00  0.60           N  
ATOM   4541  CA  GLY B 152      45.419  27.078 -79.146  1.00  0.60           C  
ATOM   4542  C   GLY B 152      45.461  25.599 -78.881  1.00  0.60           C  
ATOM   4543  O   GLY B 152      46.174  24.860 -79.556  1.00  0.60           O  
ATOM   4544  N   ARG B 153      44.666  25.105 -77.911  1.00  0.51           N  
ATOM   4545  CA  ARG B 153      44.566  23.691 -77.608  1.00  0.51           C  
ATOM   4546  C   ARG B 153      43.811  22.919 -78.673  1.00  0.51           C  
ATOM   4547  O   ARG B 153      44.137  21.773 -78.979  1.00  0.51           O  
ATOM   4548  CB  ARG B 153      43.837  23.410 -76.275  1.00  0.51           C  
ATOM   4549  CG  ARG B 153      44.536  23.890 -74.991  1.00  0.51           C  
ATOM   4550  CD  ARG B 153      43.817  23.259 -73.795  1.00  0.51           C  
ATOM   4551  NE  ARG B 153      44.348  23.789 -72.502  1.00  0.51           N  
ATOM   4552  CZ  ARG B 153      44.181  23.119 -71.351  1.00  0.51           C  
ATOM   4553  NH1 ARG B 153      43.570  21.940 -71.326  1.00  0.51           N  
ATOM   4554  NH2 ARG B 153      44.610  23.651 -70.213  1.00  0.51           N  
ATOM   4555  N   LEU B 154      42.747  23.518 -79.237  1.00  0.58           N  
ATOM   4556  CA  LEU B 154      41.891  22.874 -80.213  1.00  0.58           C  
ATOM   4557  C   LEU B 154      42.621  22.604 -81.522  1.00  0.58           C  
ATOM   4558  O   LEU B 154      42.598  21.489 -82.041  1.00  0.58           O  
ATOM   4559  CB  LEU B 154      40.619  23.736 -80.408  1.00  0.58           C  
ATOM   4560  CG  LEU B 154      39.613  23.243 -81.463  1.00  0.58           C  
ATOM   4561  CD1 LEU B 154      39.097  21.835 -81.157  1.00  0.58           C  
ATOM   4562  CD2 LEU B 154      38.430  24.218 -81.580  1.00  0.58           C  
ATOM   4563  N   ARG B 155      43.372  23.596 -82.043  1.00  0.54           N  
ATOM   4564  CA  ARG B 155      44.242  23.412 -83.192  1.00  0.54           C  
ATOM   4565  C   ARG B 155      45.342  22.403 -82.922  1.00  0.54           C  
ATOM   4566  O   ARG B 155      45.573  21.504 -83.733  1.00  0.54           O  
ATOM   4567  CB  ARG B 155      44.856  24.763 -83.635  1.00  0.54           C  
ATOM   4568  CG  ARG B 155      45.759  24.661 -84.888  1.00  0.54           C  
ATOM   4569  CD  ARG B 155      46.331  25.992 -85.396  1.00  0.54           C  
ATOM   4570  NE  ARG B 155      45.164  26.821 -85.820  1.00  0.54           N  
ATOM   4571  CZ  ARG B 155      44.603  26.734 -87.032  1.00  0.54           C  
ATOM   4572  NH1 ARG B 155      45.289  26.491 -88.140  1.00  0.54           N  
ATOM   4573  NH2 ARG B 155      43.294  26.891 -87.139  1.00  0.54           N  
ATOM   4574  N   ALA B 156      45.995  22.471 -81.749  1.00  0.58           N  
ATOM   4575  CA  ALA B 156      47.056  21.575 -81.345  1.00  0.58           C  
ATOM   4576  C   ALA B 156      46.635  20.109 -81.264  1.00  0.58           C  
ATOM   4577  O   ALA B 156      47.246  19.236 -81.882  1.00  0.58           O  
ATOM   4578  CB  ALA B 156      47.556  22.040 -79.965  1.00  0.58           C  
ATOM   4579  N   VAL B 157      45.523  19.802 -80.557  1.00  0.57           N  
ATOM   4580  CA  VAL B 157      45.046  18.433 -80.407  1.00  0.57           C  
ATOM   4581  C   VAL B 157      44.577  17.806 -81.711  1.00  0.57           C  
ATOM   4582  O   VAL B 157      44.903  16.660 -82.008  1.00  0.57           O  
ATOM   4583  CB  VAL B 157      44.036  18.252 -79.272  1.00  0.57           C  
ATOM   4584  CG1 VAL B 157      42.630  18.790 -79.609  1.00  0.57           C  
ATOM   4585  CG2 VAL B 157      43.999  16.765 -78.860  1.00  0.57           C  
ATOM   4586  N   LEU B 158      43.850  18.553 -82.573  1.00  0.53           N  
ATOM   4587  CA  LEU B 158      43.446  18.068 -83.885  1.00  0.53           C  
ATOM   4588  C   LEU B 158      44.632  17.781 -84.794  1.00  0.53           C  
ATOM   4589  O   LEU B 158      44.720  16.729 -85.420  1.00  0.53           O  
ATOM   4590  CB  LEU B 158      42.472  19.057 -84.569  1.00  0.53           C  
ATOM   4591  CG  LEU B 158      41.124  19.231 -83.833  1.00  0.53           C  
ATOM   4592  CD1 LEU B 158      40.297  20.341 -84.497  1.00  0.53           C  
ATOM   4593  CD2 LEU B 158      40.315  17.927 -83.777  1.00  0.53           C  
ATOM   4594  N   THR B 159      45.636  18.680 -84.799  1.00  0.54           N  
ATOM   4595  CA  THR B 159      46.887  18.485 -85.541  1.00  0.54           C  
ATOM   4596  C   THR B 159      47.667  17.279 -85.064  1.00  0.54           C  
ATOM   4597  O   THR B 159      48.186  16.484 -85.842  1.00  0.54           O  
ATOM   4598  CB  THR B 159      47.812  19.685 -85.465  1.00  0.54           C  
ATOM   4599  OG1 THR B 159      47.057  20.825 -85.780  1.00  0.54           O  
ATOM   4600  CG2 THR B 159      48.930  19.540 -86.531  1.00  0.54           C  
ATOM   4601  N   ALA B 160      47.744  17.085 -83.731  1.00  0.54           N  
ATOM   4602  CA  ALA B 160      48.320  15.900 -83.129  1.00  0.54           C  
ATOM   4603  C   ALA B 160      47.593  14.602 -83.490  1.00  0.54           C  
ATOM   4604  O   ALA B 160      48.230  13.610 -83.841  1.00  0.54           O  
ATOM   4605  CB  ALA B 160      48.372  16.089 -81.601  1.00  0.54           C  
ATOM   4606  N   LEU B 161      46.242  14.593 -83.468  1.00  0.84           N  
ATOM   4607  CA  LEU B 161      45.423  13.473 -83.910  1.00  0.84           C  
ATOM   4608  C   LEU B 161      45.581  13.127 -85.385  1.00  0.84           C  
ATOM   4609  O   LEU B 161      45.696  11.953 -85.727  1.00  0.84           O  
ATOM   4610  CB  LEU B 161      43.923  13.694 -83.589  1.00  0.84           C  
ATOM   4611  CG  LEU B 161      43.578  13.621 -82.085  1.00  0.84           C  
ATOM   4612  CD1 LEU B 161      42.145  14.115 -81.846  1.00  0.84           C  
ATOM   4613  CD2 LEU B 161      43.748  12.205 -81.509  1.00  0.84           C  
ATOM   4614  N   ASP B 162      45.647  14.117 -86.298  1.00  0.86           N  
ATOM   4615  CA  ASP B 162      45.942  13.889 -87.707  1.00  0.86           C  
ATOM   4616  C   ASP B 162      47.294  13.243 -87.951  1.00  0.86           C  
ATOM   4617  O   ASP B 162      47.432  12.347 -88.779  1.00  0.86           O  
ATOM   4618  CB  ASP B 162      45.899  15.223 -88.490  1.00  0.86           C  
ATOM   4619  CG  ASP B 162      44.471  15.645 -88.719  1.00  0.86           C  
ATOM   4620  OD1 ASP B 162      43.592  14.744 -88.803  1.00  0.86           O  
ATOM   4621  OD2 ASP B 162      44.224  16.865 -88.862  1.00  0.86           O  
ATOM   4622  N   HIS B 163      48.324  13.668 -87.205  1.00  0.84           N  
ATOM   4623  CA  HIS B 163      49.645  13.078 -87.272  1.00  0.84           C  
ATOM   4624  C   HIS B 163      49.712  11.608 -86.856  1.00  0.84           C  
ATOM   4625  O   HIS B 163      50.368  10.788 -87.494  1.00  0.84           O  
ATOM   4626  CB  HIS B 163      50.587  13.904 -86.380  1.00  0.84           C  
ATOM   4627  CG  HIS B 163      52.023  13.564 -86.562  1.00  0.84           C  
ATOM   4628  ND1 HIS B 163      52.633  13.900 -87.751  1.00  0.84           N  
ATOM   4629  CD2 HIS B 163      52.908  12.978 -85.719  1.00  0.84           C  
ATOM   4630  CE1 HIS B 163      53.880  13.503 -87.618  1.00  0.84           C  
ATOM   4631  NE2 HIS B 163      54.100  12.946 -86.404  1.00  0.84           N  
ATOM   4632  N   VAL B 164      49.024  11.222 -85.760  1.00  0.86           N  
ATOM   4633  CA  VAL B 164      49.134   9.865 -85.237  1.00  0.86           C  
ATOM   4634  C   VAL B 164      48.032   8.930 -85.720  1.00  0.86           C  
ATOM   4635  O   VAL B 164      48.207   7.715 -85.709  1.00  0.86           O  
ATOM   4636  CB  VAL B 164      49.218   9.843 -83.711  1.00  0.86           C  
ATOM   4637  CG1 VAL B 164      50.418  10.705 -83.266  1.00  0.86           C  
ATOM   4638  CG2 VAL B 164      47.917  10.341 -83.055  1.00  0.86           C  
ATOM   4639  N   LEU B 165      46.901   9.459 -86.229  1.00  0.83           N  
ATOM   4640  CA  LEU B 165      45.808   8.673 -86.788  1.00  0.83           C  
ATOM   4641  C   LEU B 165      45.338   9.255 -88.133  1.00  0.83           C  
ATOM   4642  O   LEU B 165      44.157   9.604 -88.273  1.00  0.83           O  
ATOM   4643  CB  LEU B 165      44.600   8.636 -85.808  1.00  0.83           C  
ATOM   4644  CG  LEU B 165      44.827   7.862 -84.492  1.00  0.83           C  
ATOM   4645  CD1 LEU B 165      43.642   8.078 -83.538  1.00  0.83           C  
ATOM   4646  CD2 LEU B 165      45.043   6.360 -84.731  1.00  0.83           C  
ATOM   4647  N   PRO B 166      46.195   9.408 -89.152  1.00  0.87           N  
ATOM   4648  CA  PRO B 166      45.811   9.946 -90.456  1.00  0.87           C  
ATOM   4649  C   PRO B 166      44.712   9.156 -91.147  1.00  0.87           C  
ATOM   4650  O   PRO B 166      44.837   7.952 -91.345  1.00  0.87           O  
ATOM   4651  CB  PRO B 166      47.118   9.931 -91.264  1.00  0.87           C  
ATOM   4652  CG  PRO B 166      47.884   8.740 -90.689  1.00  0.87           C  
ATOM   4653  CD  PRO B 166      47.539   8.818 -89.203  1.00  0.87           C  
ATOM   4654  N   GLY B 167      43.603   9.817 -91.530  1.00  0.87           N  
ATOM   4655  CA  GLY B 167      42.524   9.170 -92.273  1.00  0.87           C  
ATOM   4656  C   GLY B 167      41.596   8.326 -91.441  1.00  0.87           C  
ATOM   4657  O   GLY B 167      40.629   7.773 -91.952  1.00  0.87           O  
ATOM   4658  N   ALA B 168      41.826   8.224 -90.118  1.00  0.88           N  
ATOM   4659  CA  ALA B 168      40.890   7.578 -89.225  1.00  0.88           C  
ATOM   4660  C   ALA B 168      39.648   8.439 -89.038  1.00  0.88           C  
ATOM   4661  O   ALA B 168      39.746   9.607 -88.652  1.00  0.88           O  
ATOM   4662  CB  ALA B 168      41.544   7.297 -87.859  1.00  0.88           C  
ATOM   4663  N   ASP B 169      38.451   7.889 -89.330  1.00  0.81           N  
ATOM   4664  CA  ASP B 169      37.203   8.592 -89.127  1.00  0.81           C  
ATOM   4665  C   ASP B 169      36.800   8.433 -87.665  1.00  0.81           C  
ATOM   4666  O   ASP B 169      36.697   7.331 -87.125  1.00  0.81           O  
ATOM   4667  CB  ASP B 169      36.117   8.099 -90.124  1.00  0.81           C  
ATOM   4668  CG  ASP B 169      35.117   9.185 -90.473  1.00  0.81           C  
ATOM   4669  OD1 ASP B 169      35.199  10.307 -89.910  1.00  0.81           O  
ATOM   4670  OD2 ASP B 169      34.249   8.927 -91.344  1.00  0.81           O  
ATOM   4671  N   LEU B 170      36.649   9.565 -86.969  1.00  0.85           N  
ATOM   4672  CA  LEU B 170      36.512   9.599 -85.536  1.00  0.85           C  
ATOM   4673  C   LEU B 170      35.910  10.929 -85.187  1.00  0.85           C  
ATOM   4674  O   LEU B 170      35.929  11.865 -85.989  1.00  0.85           O  
ATOM   4675  CB  LEU B 170      37.861   9.376 -84.782  1.00  0.85           C  
ATOM   4676  CG  LEU B 170      38.996  10.409 -85.010  1.00  0.85           C  
ATOM   4677  CD1 LEU B 170      38.904  11.635 -84.086  1.00  0.85           C  
ATOM   4678  CD2 LEU B 170      40.367   9.745 -84.798  1.00  0.85           C  
ATOM   4679  N   VAL B 171      35.360  11.050 -83.969  1.00  0.87           N  
ATOM   4680  CA  VAL B 171      34.792  12.303 -83.511  1.00  0.87           C  
ATOM   4681  C   VAL B 171      35.519  12.785 -82.280  1.00  0.87           C  
ATOM   4682  O   VAL B 171      35.811  12.041 -81.344  1.00  0.87           O  
ATOM   4683  CB  VAL B 171      33.292  12.252 -83.272  1.00  0.87           C  
ATOM   4684  CG1 VAL B 171      32.606  12.090 -84.638  1.00  0.87           C  
ATOM   4685  CG2 VAL B 171      32.909  11.105 -82.321  1.00  0.87           C  
ATOM   4686  N   VAL B 172      35.863  14.080 -82.259  1.00  0.88           N  
ATOM   4687  CA  VAL B 172      36.550  14.679 -81.134  1.00  0.88           C  
ATOM   4688  C   VAL B 172      35.518  15.402 -80.292  1.00  0.88           C  
ATOM   4689  O   VAL B 172      34.653  16.129 -80.787  1.00  0.88           O  
ATOM   4690  CB  VAL B 172      37.720  15.573 -81.537  1.00  0.88           C  
ATOM   4691  CG1 VAL B 172      38.465  16.086 -80.291  1.00  0.88           C  
ATOM   4692  CG2 VAL B 172      38.676  14.764 -82.433  1.00  0.88           C  
ATOM   4693  N   SER B 173      35.568  15.169 -78.972  1.00  0.86           N  
ATOM   4694  CA  SER B 173      34.633  15.713 -78.012  1.00  0.86           C  
ATOM   4695  C   SER B 173      35.347  16.701 -77.106  1.00  0.86           C  
ATOM   4696  O   SER B 173      36.116  16.285 -76.236  1.00  0.86           O  
ATOM   4697  CB  SER B 173      34.062  14.612 -77.083  1.00  0.86           C  
ATOM   4698  OG  SER B 173      33.208  13.705 -77.783  1.00  0.86           O  
ATOM   4699  N   PRO B 174      35.148  18.010 -77.243  1.00  0.86           N  
ATOM   4700  CA  PRO B 174      35.460  18.984 -76.205  1.00  0.86           C  
ATOM   4701  C   PRO B 174      34.605  18.835 -74.967  1.00  0.86           C  
ATOM   4702  O   PRO B 174      33.534  18.231 -75.019  1.00  0.86           O  
ATOM   4703  CB  PRO B 174      35.187  20.346 -76.868  1.00  0.86           C  
ATOM   4704  CG  PRO B 174      35.289  20.060 -78.363  1.00  0.86           C  
ATOM   4705  CD  PRO B 174      34.698  18.658 -78.472  1.00  0.86           C  
ATOM   4706  N   ARG B 175      35.054  19.434 -73.857  1.00  0.77           N  
ATOM   4707  CA  ARG B 175      34.333  19.490 -72.610  1.00  0.77           C  
ATOM   4708  C   ARG B 175      33.471  20.744 -72.585  1.00  0.77           C  
ATOM   4709  O   ARG B 175      33.963  21.848 -72.807  1.00  0.77           O  
ATOM   4710  CB  ARG B 175      35.335  19.580 -71.429  1.00  0.77           C  
ATOM   4711  CG  ARG B 175      36.298  18.376 -71.309  1.00  0.77           C  
ATOM   4712  CD  ARG B 175      37.482  18.605 -70.357  1.00  0.77           C  
ATOM   4713  NE  ARG B 175      36.895  18.881 -69.008  1.00  0.77           N  
ATOM   4714  CZ  ARG B 175      37.556  19.494 -68.019  1.00  0.77           C  
ATOM   4715  NH1 ARG B 175      38.859  19.743 -68.067  1.00  0.77           N  
ATOM   4716  NH2 ARG B 175      36.874  19.873 -66.937  1.00  0.77           N  
ATOM   4717  N   ILE B 176      32.164  20.624 -72.297  1.00  0.79           N  
ATOM   4718  CA  ILE B 176      31.299  21.792 -72.170  1.00  0.79           C  
ATOM   4719  C   ILE B 176      30.933  21.963 -70.705  1.00  0.79           C  
ATOM   4720  O   ILE B 176      30.356  21.070 -70.088  1.00  0.79           O  
ATOM   4721  CB  ILE B 176      30.041  21.704 -73.035  1.00  0.79           C  
ATOM   4722  CG1 ILE B 176      30.413  21.586 -74.534  1.00  0.79           C  
ATOM   4723  CG2 ILE B 176      29.156  22.950 -72.804  1.00  0.79           C  
ATOM   4724  CD1 ILE B 176      29.219  21.238 -75.434  1.00  0.79           C  
ATOM   4725  N   LEU B 177      31.275  23.123 -70.112  1.00  0.73           N  
ATOM   4726  CA  LEU B 177      30.872  23.508 -68.770  1.00  0.73           C  
ATOM   4727  C   LEU B 177      29.663  24.416 -68.867  1.00  0.73           C  
ATOM   4728  O   LEU B 177      29.622  25.291 -69.727  1.00  0.73           O  
ATOM   4729  CB  LEU B 177      31.989  24.301 -68.040  1.00  0.73           C  
ATOM   4730  CG  LEU B 177      33.205  23.460 -67.607  1.00  0.73           C  
ATOM   4731  CD1 LEU B 177      34.328  24.387 -67.123  1.00  0.73           C  
ATOM   4732  CD2 LEU B 177      32.838  22.465 -66.498  1.00  0.73           C  
ATOM   4733  N   ASP B 178      28.642  24.243 -68.007  1.00  0.66           N  
ATOM   4734  CA  ASP B 178      27.496  25.134 -67.971  1.00  0.66           C  
ATOM   4735  C   ASP B 178      27.618  26.182 -66.856  1.00  0.66           C  
ATOM   4736  O   ASP B 178      28.670  26.409 -66.258  1.00  0.66           O  
ATOM   4737  CB  ASP B 178      26.163  24.317 -67.901  1.00  0.66           C  
ATOM   4738  CG  ASP B 178      25.915  23.729 -66.525  1.00  0.66           C  
ATOM   4739  OD1 ASP B 178      26.899  23.558 -65.768  1.00  0.66           O  
ATOM   4740  OD2 ASP B 178      24.734  23.564 -66.135  1.00  0.66           O  
ATOM   4741  N   THR B 179      26.491  26.843 -66.538  1.00  0.60           N  
ATOM   4742  CA  THR B 179      26.376  27.798 -65.452  1.00  0.60           C  
ATOM   4743  C   THR B 179      26.117  27.141 -64.107  1.00  0.60           C  
ATOM   4744  O   THR B 179      26.308  27.765 -63.065  1.00  0.60           O  
ATOM   4745  CB  THR B 179      25.269  28.808 -65.721  1.00  0.60           C  
ATOM   4746  OG1 THR B 179      24.065  28.162 -66.118  1.00  0.60           O  
ATOM   4747  CG2 THR B 179      25.698  29.694 -66.897  1.00  0.60           C  
ATOM   4748  N   SER B 180      25.720  25.848 -64.064  1.00  0.54           N  
ATOM   4749  CA  SER B 180      25.603  25.114 -62.807  1.00  0.54           C  
ATOM   4750  C   SER B 180      26.954  24.573 -62.346  1.00  0.54           C  
ATOM   4751  O   SER B 180      27.194  24.370 -61.152  1.00  0.54           O  
ATOM   4752  CB  SER B 180      24.562  23.954 -62.883  1.00  0.54           C  
ATOM   4753  OG  SER B 180      25.018  22.810 -63.607  1.00  0.54           O  
ATOM   4754  N   ARG B 181      27.860  24.353 -63.325  1.00  0.46           N  
ATOM   4755  CA  ARG B 181      29.197  23.784 -63.280  1.00  0.46           C  
ATOM   4756  C   ARG B 181      29.156  22.273 -63.494  1.00  0.46           C  
ATOM   4757  O   ARG B 181      29.990  21.531 -62.976  1.00  0.46           O  
ATOM   4758  CB  ARG B 181      30.085  24.136 -62.053  1.00  0.46           C  
ATOM   4759  CG  ARG B 181      30.251  25.638 -61.749  1.00  0.46           C  
ATOM   4760  CD  ARG B 181      31.034  25.838 -60.450  1.00  0.46           C  
ATOM   4761  NE  ARG B 181      31.134  27.306 -60.179  1.00  0.46           N  
ATOM   4762  CZ  ARG B 181      31.790  27.819 -59.128  1.00  0.46           C  
ATOM   4763  NH1 ARG B 181      32.419  27.039 -58.254  1.00  0.46           N  
ATOM   4764  NH2 ARG B 181      31.822  29.137 -58.949  1.00  0.46           N  
ATOM   4765  N   GLU B 182      28.170  21.761 -64.254  1.00  0.54           N  
ATOM   4766  CA  GLU B 182      28.166  20.402 -64.761  1.00  0.54           C  
ATOM   4767  C   GLU B 182      29.063  20.340 -65.994  1.00  0.54           C  
ATOM   4768  O   GLU B 182      29.234  21.319 -66.718  1.00  0.54           O  
ATOM   4769  CB  GLU B 182      26.732  19.874 -65.047  1.00  0.54           C  
ATOM   4770  CG  GLU B 182      26.671  18.344 -65.319  1.00  0.54           C  
ATOM   4771  CD  GLU B 182      25.250  17.777 -65.344  1.00  0.54           C  
ATOM   4772  OE1 GLU B 182      24.938  16.946 -64.444  1.00  0.54           O  
ATOM   4773  OE2 GLU B 182      24.479  18.151 -66.261  1.00  0.54           O  
ATOM   4774  N   CYS B 183      29.729  19.194 -66.231  1.00  0.70           N  
ATOM   4775  CA  CYS B 183      30.733  19.076 -67.270  1.00  0.70           C  
ATOM   4776  C   CYS B 183      30.330  17.991 -68.243  1.00  0.70           C  
ATOM   4777  O   CYS B 183      30.433  16.800 -67.961  1.00  0.70           O  
ATOM   4778  CB  CYS B 183      32.121  18.749 -66.644  1.00  0.70           C  
ATOM   4779  SG  CYS B 183      33.511  18.663 -67.839  1.00  0.70           S  
ATOM   4780  N   HIS B 184      29.908  18.388 -69.451  1.00  0.69           N  
ATOM   4781  CA  HIS B 184      29.424  17.468 -70.459  1.00  0.69           C  
ATOM   4782  C   HIS B 184      30.574  17.042 -71.346  1.00  0.69           C  
ATOM   4783  O   HIS B 184      31.119  17.848 -72.099  1.00  0.69           O  
ATOM   4784  CB  HIS B 184      28.310  18.140 -71.289  1.00  0.69           C  
ATOM   4785  CG  HIS B 184      27.183  18.536 -70.389  1.00  0.69           C  
ATOM   4786  ND1 HIS B 184      26.366  17.533 -69.914  1.00  0.69           N  
ATOM   4787  CD2 HIS B 184      26.920  19.709 -69.749  1.00  0.69           C  
ATOM   4788  CE1 HIS B 184      25.619  18.109 -68.987  1.00  0.69           C  
ATOM   4789  NE2 HIS B 184      25.915  19.425 -68.850  1.00  0.69           N  
ATOM   4790  N   THR B 185      31.018  15.770 -71.231  1.00  0.78           N  
ATOM   4791  CA  THR B 185      32.194  15.279 -71.943  1.00  0.78           C  
ATOM   4792  C   THR B 185      31.895  14.626 -73.277  1.00  0.78           C  
ATOM   4793  O   THR B 185      32.489  15.011 -74.276  1.00  0.78           O  
ATOM   4794  CB  THR B 185      33.077  14.363 -71.117  1.00  0.78           C  
ATOM   4795  OG1 THR B 185      32.448  13.128 -70.812  1.00  0.78           O  
ATOM   4796  CG2 THR B 185      33.442  15.045 -69.791  1.00  0.78           C  
ATOM   4797  N   ASP B 186      30.950  13.659 -73.372  1.00  0.79           N  
ATOM   4798  CA  ASP B 186      30.595  12.995 -74.624  1.00  0.79           C  
ATOM   4799  C   ASP B 186      29.751  13.885 -75.551  1.00  0.79           C  
ATOM   4800  O   ASP B 186      28.576  13.642 -75.821  1.00  0.79           O  
ATOM   4801  CB  ASP B 186      29.927  11.614 -74.352  1.00  0.79           C  
ATOM   4802  CG  ASP B 186      29.829  10.796 -75.624  1.00  0.79           C  
ATOM   4803  OD1 ASP B 186      30.824  10.748 -76.389  1.00  0.79           O  
ATOM   4804  OD2 ASP B 186      28.749  10.209 -75.913  1.00  0.79           O  
ATOM   4805  N   THR B 187      30.355  14.975 -76.045  1.00  0.80           N  
ATOM   4806  CA  THR B 187      29.746  15.975 -76.906  1.00  0.80           C  
ATOM   4807  C   THR B 187      29.696  15.582 -78.371  1.00  0.80           C  
ATOM   4808  O   THR B 187      28.680  15.798 -79.029  1.00  0.80           O  
ATOM   4809  CB  THR B 187      30.424  17.332 -76.757  1.00  0.80           C  
ATOM   4810  OG1 THR B 187      31.810  17.281 -77.058  1.00  0.80           O  
ATOM   4811  CG2 THR B 187      30.313  17.780 -75.296  1.00  0.80           C  
ATOM   4812  N   ARG B 188      30.787  14.991 -78.909  1.00  0.77           N  
ATOM   4813  CA  ARG B 188      30.936  14.506 -80.277  1.00  0.77           C  
ATOM   4814  C   ARG B 188      30.643  15.516 -81.377  1.00  0.77           C  
ATOM   4815  O   ARG B 188      29.878  15.262 -82.306  1.00  0.77           O  
ATOM   4816  CB  ARG B 188      30.175  13.182 -80.521  1.00  0.77           C  
ATOM   4817  CG  ARG B 188      30.616  12.075 -79.550  1.00  0.77           C  
ATOM   4818  CD  ARG B 188      30.067  10.697 -79.904  1.00  0.77           C  
ATOM   4819  NE  ARG B 188      30.511   9.793 -78.811  1.00  0.77           N  
ATOM   4820  CZ  ARG B 188      30.028   8.554 -78.746  1.00  0.77           C  
ATOM   4821  NH1 ARG B 188      30.046   7.744 -79.795  1.00  0.77           N  
ATOM   4822  NH2 ARG B 188      29.445   8.153 -77.622  1.00  0.77           N  
ATOM   4823  N   ARG B 189      31.264  16.706 -81.292  1.00  0.77           N  
ATOM   4824  CA  ARG B 189      30.922  17.822 -82.153  1.00  0.77           C  
ATOM   4825  C   ARG B 189      31.967  18.163 -83.195  1.00  0.77           C  
ATOM   4826  O   ARG B 189      31.747  19.044 -84.025  1.00  0.77           O  
ATOM   4827  CB  ARG B 189      30.722  19.075 -81.280  1.00  0.77           C  
ATOM   4828  CG  ARG B 189      29.446  19.006 -80.428  1.00  0.77           C  
ATOM   4829  CD  ARG B 189      29.201  20.313 -79.684  1.00  0.77           C  
ATOM   4830  NE  ARG B 189      27.826  20.237 -79.109  1.00  0.77           N  
ATOM   4831  CZ  ARG B 189      27.133  21.352 -78.843  1.00  0.77           C  
ATOM   4832  NH1 ARG B 189      27.703  22.544 -78.893  1.00  0.77           N  
ATOM   4833  NH2 ARG B 189      25.834  21.296 -78.581  1.00  0.77           N  
ATOM   4834  N   ILE B 190      33.126  17.485 -83.197  1.00  0.85           N  
ATOM   4835  CA  ILE B 190      34.188  17.786 -84.140  1.00  0.85           C  
ATOM   4836  C   ILE B 190      34.450  16.554 -84.975  1.00  0.85           C  
ATOM   4837  O   ILE B 190      34.637  15.460 -84.448  1.00  0.85           O  
ATOM   4838  CB  ILE B 190      35.477  18.215 -83.456  1.00  0.85           C  
ATOM   4839  CG1 ILE B 190      35.261  19.392 -82.480  1.00  0.85           C  
ATOM   4840  CG2 ILE B 190      36.540  18.563 -84.524  1.00  0.85           C  
ATOM   4841  CD1 ILE B 190      36.479  19.611 -81.582  1.00  0.85           C  
ATOM   4842  N   VAL B 191      34.465  16.705 -86.309  1.00  0.87           N  
ATOM   4843  CA  VAL B 191      34.515  15.590 -87.235  1.00  0.87           C  
ATOM   4844  C   VAL B 191      35.277  16.025 -88.470  1.00  0.87           C  
ATOM   4845  O   VAL B 191      35.398  17.218 -88.747  1.00  0.87           O  
ATOM   4846  CB  VAL B 191      33.098  15.130 -87.572  1.00  0.87           C  
ATOM   4847  CG1 VAL B 191      32.292  16.240 -88.279  1.00  0.87           C  
ATOM   4848  CG2 VAL B 191      33.086  13.816 -88.374  1.00  0.87           C  
ATOM   4849  N   ARG B 192      35.874  15.084 -89.229  1.00  0.79           N  
ATOM   4850  CA  ARG B 192      36.534  15.398 -90.484  1.00  0.79           C  
ATOM   4851  C   ARG B 192      35.592  15.964 -91.543  1.00  0.79           C  
ATOM   4852  O   ARG B 192      34.424  15.590 -91.637  1.00  0.79           O  
ATOM   4853  CB  ARG B 192      37.270  14.179 -91.082  1.00  0.79           C  
ATOM   4854  CG  ARG B 192      38.285  13.525 -90.131  1.00  0.79           C  
ATOM   4855  CD  ARG B 192      39.138  12.472 -90.853  1.00  0.79           C  
ATOM   4856  NE  ARG B 192      40.238  12.048 -89.921  1.00  0.79           N  
ATOM   4857  CZ  ARG B 192      41.329  12.786 -89.688  1.00  0.79           C  
ATOM   4858  NH1 ARG B 192      41.531  13.968 -90.260  1.00  0.79           N  
ATOM   4859  NH2 ARG B 192      42.270  12.387 -88.838  1.00  0.79           N  
ATOM   4860  N   SER B 193      36.082  16.891 -92.384  1.00  0.83           N  
ATOM   4861  CA  SER B 193      35.310  17.495 -93.465  1.00  0.83           C  
ATOM   4862  C   SER B 193      34.932  16.530 -94.574  1.00  0.83           C  
ATOM   4863  O   SER B 193      33.871  16.646 -95.185  1.00  0.83           O  
ATOM   4864  CB  SER B 193      36.037  18.712 -94.088  1.00  0.83           C  
ATOM   4865  OG  SER B 193      37.376  18.400 -94.465  1.00  0.83           O  
ATOM   4866  N   ASP B 194      35.796  15.538 -94.827  1.00  0.77           N  
ATOM   4867  CA  ASP B 194      35.677  14.519 -95.848  1.00  0.77           C  
ATOM   4868  C   ASP B 194      35.027  13.238 -95.310  1.00  0.77           C  
ATOM   4869  O   ASP B 194      34.828  12.268 -96.039  1.00  0.77           O  
ATOM   4870  CB  ASP B 194      37.092  14.228 -96.440  1.00  0.77           C  
ATOM   4871  CG  ASP B 194      38.197  14.462 -95.419  1.00  0.77           C  
ATOM   4872  OD1 ASP B 194      38.157  13.848 -94.324  1.00  0.77           O  
ATOM   4873  OD2 ASP B 194      39.055  15.336 -95.701  1.00  0.77           O  
ATOM   4874  N   SER B 195      34.621  13.236 -94.022  1.00  0.77           N  
ATOM   4875  CA  SER B 195      33.917  12.143 -93.354  1.00  0.77           C  
ATOM   4876  C   SER B 195      32.588  11.758 -93.990  1.00  0.77           C  
ATOM   4877  O   SER B 195      31.858  12.575 -94.560  1.00  0.77           O  
ATOM   4878  CB  SER B 195      33.657  12.460 -91.854  1.00  0.77           C  
ATOM   4879  OG  SER B 195      33.013  11.410 -91.142  1.00  0.77           O  
ATOM   4880  N   ALA B 196      32.216  10.468 -93.870  1.00  0.73           N  
ATOM   4881  CA  ALA B 196      30.919   9.975 -94.277  1.00  0.73           C  
ATOM   4882  C   ALA B 196      29.862  10.155 -93.187  1.00  0.73           C  
ATOM   4883  O   ALA B 196      28.665  10.074 -93.455  1.00  0.73           O  
ATOM   4884  CB  ALA B 196      31.039   8.483 -94.639  1.00  0.73           C  
ATOM   4885  N   LEU B 197      30.277  10.439 -91.934  1.00  0.75           N  
ATOM   4886  CA  LEU B 197      29.394  10.648 -90.799  1.00  0.75           C  
ATOM   4887  C   LEU B 197      28.468  11.849 -90.939  1.00  0.75           C  
ATOM   4888  O   LEU B 197      28.860  12.919 -91.401  1.00  0.75           O  
ATOM   4889  CB  LEU B 197      30.211  10.842 -89.502  1.00  0.75           C  
ATOM   4890  CG  LEU B 197      31.132   9.660 -89.145  1.00  0.75           C  
ATOM   4891  CD1 LEU B 197      32.192  10.119 -88.134  1.00  0.75           C  
ATOM   4892  CD2 LEU B 197      30.336   8.453 -88.632  1.00  0.75           C  
ATOM   4893  N   ARG B 198      27.201  11.721 -90.520  1.00  0.72           N  
ATOM   4894  CA  ARG B 198      26.240  12.801 -90.620  1.00  0.72           C  
ATOM   4895  C   ARG B 198      25.378  12.797 -89.379  1.00  0.72           C  
ATOM   4896  O   ARG B 198      25.215  11.788 -88.699  1.00  0.72           O  
ATOM   4897  CB  ARG B 198      25.337  12.684 -91.883  1.00  0.72           C  
ATOM   4898  CG  ARG B 198      26.071  12.887 -93.230  1.00  0.72           C  
ATOM   4899  CD  ARG B 198      26.667  14.290 -93.427  1.00  0.72           C  
ATOM   4900  NE  ARG B 198      27.365  14.318 -94.762  1.00  0.72           N  
ATOM   4901  CZ  ARG B 198      28.649  13.974 -94.939  1.00  0.72           C  
ATOM   4902  NH1 ARG B 198      29.418  13.538 -93.955  1.00  0.72           N  
ATOM   4903  NH2 ARG B 198      29.209  14.071 -96.144  1.00  0.72           N  
ATOM   4904  N   PHE B 199      24.826  13.967 -89.017  1.00  0.76           N  
ATOM   4905  CA  PHE B 199      23.920  14.100 -87.895  1.00  0.76           C  
ATOM   4906  C   PHE B 199      22.583  13.436 -88.199  1.00  0.76           C  
ATOM   4907  O   PHE B 199      22.002  13.661 -89.260  1.00  0.76           O  
ATOM   4908  CB  PHE B 199      23.697  15.585 -87.509  1.00  0.76           C  
ATOM   4909  CG  PHE B 199      24.941  16.167 -86.894  1.00  0.76           C  
ATOM   4910  CD1 PHE B 199      25.136  16.102 -85.504  1.00  0.76           C  
ATOM   4911  CD2 PHE B 199      25.918  16.792 -87.687  1.00  0.76           C  
ATOM   4912  CE1 PHE B 199      26.279  16.658 -84.913  1.00  0.76           C  
ATOM   4913  CE2 PHE B 199      27.064  17.348 -87.101  1.00  0.76           C  
ATOM   4914  CZ  PHE B 199      27.242  17.284 -85.714  1.00  0.76           C  
ATOM   4915  N   ARG B 200      22.062  12.595 -87.282  1.00  0.75           N  
ATOM   4916  CA  ARG B 200      20.772  11.946 -87.466  1.00  0.75           C  
ATOM   4917  C   ARG B 200      19.851  12.228 -86.287  1.00  0.75           C  
ATOM   4918  O   ARG B 200      20.244  12.144 -85.121  1.00  0.75           O  
ATOM   4919  CB  ARG B 200      20.914  10.415 -87.710  1.00  0.75           C  
ATOM   4920  CG  ARG B 200      19.614   9.702 -88.166  1.00  0.75           C  
ATOM   4921  CD  ARG B 200      19.782   8.196 -88.437  1.00  0.75           C  
ATOM   4922  NE  ARG B 200      18.414   7.601 -88.660  1.00  0.75           N  
ATOM   4923  CZ  ARG B 200      18.181   6.281 -88.733  1.00  0.75           C  
ATOM   4924  NH1 ARG B 200      19.165   5.407 -88.910  1.00  0.75           N  
ATOM   4925  NH2 ARG B 200      16.939   5.824 -88.599  1.00  0.75           N  
ATOM   4926  N   GLY B 201      18.581  12.574 -86.594  1.00  0.86           N  
ATOM   4927  CA  GLY B 201      17.536  12.913 -85.634  1.00  0.86           C  
ATOM   4928  C   GLY B 201      17.251  14.392 -85.628  1.00  0.86           C  
ATOM   4929  O   GLY B 201      18.159  15.207 -85.568  1.00  0.86           O  
ATOM   4930  N   ARG B 202      15.962  14.798 -85.666  1.00  0.80           N  
ATOM   4931  CA  ARG B 202      15.586  16.205 -85.782  1.00  0.80           C  
ATOM   4932  C   ARG B 202      15.885  17.049 -84.553  1.00  0.80           C  
ATOM   4933  O   ARG B 202      15.989  18.270 -84.635  1.00  0.80           O  
ATOM   4934  CB  ARG B 202      14.061  16.360 -85.994  1.00  0.80           C  
ATOM   4935  CG  ARG B 202      13.517  15.656 -87.244  1.00  0.80           C  
ATOM   4936  CD  ARG B 202      12.029  15.970 -87.476  1.00  0.80           C  
ATOM   4937  NE  ARG B 202      11.651  15.501 -88.841  1.00  0.80           N  
ATOM   4938  CZ  ARG B 202      12.211  15.956 -89.965  1.00  0.80           C  
ATOM   4939  NH1 ARG B 202      12.778  17.146 -90.046  1.00  0.80           N  
ATOM   4940  NH2 ARG B 202      12.204  15.155 -91.024  1.00  0.80           N  
ATOM   4941  N   LEU B 203      15.978  16.392 -83.389  1.00  0.84           N  
ATOM   4942  CA  LEU B 203      16.213  16.989 -82.101  1.00  0.84           C  
ATOM   4943  C   LEU B 203      16.998  15.960 -81.317  1.00  0.84           C  
ATOM   4944  O   LEU B 203      16.733  14.765 -81.445  1.00  0.84           O  
ATOM   4945  CB  LEU B 203      14.858  17.251 -81.397  1.00  0.84           C  
ATOM   4946  CG  LEU B 203      14.944  17.858 -79.986  1.00  0.84           C  
ATOM   4947  CD1 LEU B 203      15.483  19.291 -80.004  1.00  0.84           C  
ATOM   4948  CD2 LEU B 203      13.572  17.811 -79.302  1.00  0.84           C  
ATOM   4949  N   HIS B 204      18.003  16.375 -80.520  1.00  0.79           N  
ATOM   4950  CA  HIS B 204      18.889  15.476 -79.788  1.00  0.79           C  
ATOM   4951  C   HIS B 204      19.741  14.650 -80.750  1.00  0.79           C  
ATOM   4952  O   HIS B 204      19.874  13.421 -80.664  1.00  0.79           O  
ATOM   4953  CB  HIS B 204      18.175  14.600 -78.724  1.00  0.79           C  
ATOM   4954  CG  HIS B 204      17.190  15.345 -77.868  1.00  0.79           C  
ATOM   4955  ND1 HIS B 204      17.608  16.378 -77.046  1.00  0.79           N  
ATOM   4956  CD2 HIS B 204      15.841  15.194 -77.777  1.00  0.79           C  
ATOM   4957  CE1 HIS B 204      16.505  16.842 -76.492  1.00  0.79           C  
ATOM   4958  NE2 HIS B 204      15.411  16.153 -76.888  1.00  0.79           N  
ATOM   4959  N   GLU B 205      20.287  15.363 -81.746  1.00  0.76           N  
ATOM   4960  CA  GLU B 205      21.141  14.904 -82.804  1.00  0.76           C  
ATOM   4961  C   GLU B 205      22.540  14.512 -82.349  1.00  0.76           C  
ATOM   4962  O   GLU B 205      23.115  15.051 -81.404  1.00  0.76           O  
ATOM   4963  CB  GLU B 205      21.192  15.958 -83.947  1.00  0.76           C  
ATOM   4964  CG  GLU B 205      21.960  17.285 -83.664  1.00  0.76           C  
ATOM   4965  CD  GLU B 205      21.314  18.277 -82.689  1.00  0.76           C  
ATOM   4966  OE1 GLU B 205      21.963  19.341 -82.479  1.00  0.76           O  
ATOM   4967  OE2 GLU B 205      20.201  18.021 -82.166  1.00  0.76           O  
ATOM   4968  N   ARG B 206      23.143  13.531 -83.040  1.00  0.72           N  
ATOM   4969  CA  ARG B 206      24.533  13.170 -82.860  1.00  0.72           C  
ATOM   4970  C   ARG B 206      24.994  12.693 -84.215  1.00  0.72           C  
ATOM   4971  O   ARG B 206      24.169  12.343 -85.059  1.00  0.72           O  
ATOM   4972  CB  ARG B 206      24.770  12.019 -81.839  1.00  0.72           C  
ATOM   4973  CG  ARG B 206      24.504  12.387 -80.368  1.00  0.72           C  
ATOM   4974  CD  ARG B 206      24.683  11.205 -79.411  1.00  0.72           C  
ATOM   4975  NE  ARG B 206      24.823  11.809 -78.044  1.00  0.72           N  
ATOM   4976  CZ  ARG B 206      25.846  11.525 -77.225  1.00  0.72           C  
ATOM   4977  NH1 ARG B 206      26.548  10.406 -77.332  1.00  0.72           N  
ATOM   4978  NH2 ARG B 206      26.197  12.398 -76.290  1.00  0.72           N  
ATOM   4979  N   LEU B 207      26.317  12.696 -84.466  1.00  0.81           N  
ATOM   4980  CA  LEU B 207      26.910  12.062 -85.629  1.00  0.81           C  
ATOM   4981  C   LEU B 207      26.749  10.547 -85.631  1.00  0.81           C  
ATOM   4982  O   LEU B 207      27.018   9.871 -84.639  1.00  0.81           O  
ATOM   4983  CB  LEU B 207      28.413  12.409 -85.733  1.00  0.81           C  
ATOM   4984  CG  LEU B 207      28.676  13.882 -86.098  1.00  0.81           C  
ATOM   4985  CD1 LEU B 207      30.091  14.296 -85.697  1.00  0.81           C  
ATOM   4986  CD2 LEU B 207      28.466  14.137 -87.597  1.00  0.81           C  
ATOM   4987  N   TYR B 208      26.320   9.998 -86.777  1.00  0.78           N  
ATOM   4988  CA  TYR B 208      26.139   8.583 -87.005  1.00  0.78           C  
ATOM   4989  C   TYR B 208      26.621   8.296 -88.412  1.00  0.78           C  
ATOM   4990  O   TYR B 208      26.791   9.209 -89.220  1.00  0.78           O  
ATOM   4991  CB  TYR B 208      24.643   8.172 -86.913  1.00  0.78           C  
ATOM   4992  CG  TYR B 208      24.191   8.193 -85.481  1.00  0.78           C  
ATOM   4993  CD1 TYR B 208      24.501   7.108 -84.654  1.00  0.78           C  
ATOM   4994  CD2 TYR B 208      23.483   9.275 -84.935  1.00  0.78           C  
ATOM   4995  CE1 TYR B 208      24.145   7.118 -83.304  1.00  0.78           C  
ATOM   4996  CE2 TYR B 208      23.150   9.298 -83.568  1.00  0.78           C  
ATOM   4997  CZ  TYR B 208      23.515   8.226 -82.741  1.00  0.78           C  
ATOM   4998  OH  TYR B 208      23.311   8.201 -81.342  1.00  0.78           O  
ATOM   4999  N   ASP B 209      26.856   7.017 -88.752  1.00  0.74           N  
ATOM   5000  CA  ASP B 209      27.134   6.615 -90.115  1.00  0.74           C  
ATOM   5001  C   ASP B 209      25.824   6.413 -90.896  1.00  0.74           C  
ATOM   5002  O   ASP B 209      24.721   6.684 -90.417  1.00  0.74           O  
ATOM   5003  CB  ASP B 209      28.119   5.403 -90.158  1.00  0.74           C  
ATOM   5004  CG  ASP B 209      27.408   4.061 -90.134  1.00  0.74           C  
ATOM   5005  OD1 ASP B 209      26.511   3.880 -89.278  1.00  0.74           O  
ATOM   5006  OD2 ASP B 209      27.646   3.262 -91.075  1.00  0.74           O  
ATOM   5007  N   ALA B 210      25.931   5.916 -92.144  1.00  0.68           N  
ATOM   5008  CA  ALA B 210      24.806   5.540 -92.975  1.00  0.68           C  
ATOM   5009  C   ALA B 210      23.912   4.458 -92.362  1.00  0.68           C  
ATOM   5010  O   ALA B 210      22.693   4.473 -92.535  1.00  0.68           O  
ATOM   5011  CB  ALA B 210      25.341   5.063 -94.340  1.00  0.68           C  
ATOM   5012  N   HIS B 211      24.497   3.507 -91.604  1.00  0.68           N  
ATOM   5013  CA  HIS B 211      23.767   2.405 -91.005  1.00  0.68           C  
ATOM   5014  C   HIS B 211      23.229   2.744 -89.620  1.00  0.68           C  
ATOM   5015  O   HIS B 211      22.420   2.013 -89.053  1.00  0.68           O  
ATOM   5016  CB  HIS B 211      24.702   1.183 -90.884  1.00  0.68           C  
ATOM   5017  CG  HIS B 211      25.248   0.764 -92.215  1.00  0.68           C  
ATOM   5018  ND1 HIS B 211      24.390   0.253 -93.171  1.00  0.68           N  
ATOM   5019  CD2 HIS B 211      26.510   0.846 -92.713  1.00  0.68           C  
ATOM   5020  CE1 HIS B 211      25.144   0.038 -94.229  1.00  0.68           C  
ATOM   5021  NE2 HIS B 211      26.436   0.380 -94.008  1.00  0.68           N  
ATOM   5022  N   GLY B 212      23.629   3.899 -89.047  1.00  0.82           N  
ATOM   5023  CA  GLY B 212      23.175   4.363 -87.741  1.00  0.82           C  
ATOM   5024  C   GLY B 212      24.080   3.988 -86.598  1.00  0.82           C  
ATOM   5025  O   GLY B 212      23.685   4.094 -85.438  1.00  0.82           O  
ATOM   5026  N   ALA B 213      25.314   3.546 -86.887  1.00  0.86           N  
ATOM   5027  CA  ALA B 213      26.332   3.226 -85.911  1.00  0.86           C  
ATOM   5028  C   ALA B 213      27.068   4.480 -85.455  1.00  0.86           C  
ATOM   5029  O   ALA B 213      27.196   5.465 -86.188  1.00  0.86           O  
ATOM   5030  CB  ALA B 213      27.335   2.218 -86.506  1.00  0.86           C  
ATOM   5031  N   GLN B 214      27.552   4.504 -84.200  1.00  0.81           N  
ATOM   5032  CA  GLN B 214      28.286   5.634 -83.676  1.00  0.81           C  
ATOM   5033  C   GLN B 214      29.745   5.632 -84.117  1.00  0.81           C  
ATOM   5034  O   GLN B 214      30.384   4.583 -84.188  1.00  0.81           O  
ATOM   5035  CB  GLN B 214      28.247   5.709 -82.126  1.00  0.81           C  
ATOM   5036  CG  GLN B 214      26.897   6.258 -81.624  1.00  0.81           C  
ATOM   5037  CD  GLN B 214      26.780   6.410 -80.109  1.00  0.81           C  
ATOM   5038  OE1 GLN B 214      27.732   6.292 -79.333  1.00  0.81           O  
ATOM   5039  NE2 GLN B 214      25.543   6.735 -79.660  1.00  0.81           N  
ATOM   5040  N   PRO B 215      30.349   6.781 -84.386  1.00  0.88           N  
ATOM   5041  CA  PRO B 215      31.787   6.863 -84.554  1.00  0.88           C  
ATOM   5042  C   PRO B 215      32.496   6.785 -83.205  1.00  0.88           C  
ATOM   5043  O   PRO B 215      31.935   7.271 -82.209  1.00  0.88           O  
ATOM   5044  CB  PRO B 215      31.995   8.229 -85.214  1.00  0.88           C  
ATOM   5045  CG  PRO B 215      30.811   9.070 -84.731  1.00  0.88           C  
ATOM   5046  CD  PRO B 215      29.679   8.054 -84.648  1.00  0.88           C  
ATOM   5047  N   PRO B 216      33.684   6.194 -83.115  1.00  0.88           N  
ATOM   5048  CA  PRO B 216      34.452   6.155 -81.881  1.00  0.88           C  
ATOM   5049  C   PRO B 216      34.969   7.542 -81.525  1.00  0.88           C  
ATOM   5050  O   PRO B 216      35.311   8.335 -82.407  1.00  0.88           O  
ATOM   5051  CB  PRO B 216      35.580   5.165 -82.204  1.00  0.88           C  
ATOM   5052  CG  PRO B 216      35.819   5.338 -83.705  1.00  0.88           C  
ATOM   5053  CD  PRO B 216      34.412   5.593 -84.241  1.00  0.88           C  
ATOM   5054  N   SER B 217      34.973   7.884 -80.226  1.00  0.85           N  
ATOM   5055  CA  SER B 217      35.237   9.234 -79.769  1.00  0.85           C  
ATOM   5056  C   SER B 217      36.593   9.399 -79.115  1.00  0.85           C  
ATOM   5057  O   SER B 217      37.209   8.462 -78.606  1.00  0.85           O  
ATOM   5058  CB  SER B 217      34.137   9.756 -78.802  1.00  0.85           C  
ATOM   5059  OG  SER B 217      33.921   8.867 -77.704  1.00  0.85           O  
ATOM   5060  N   VAL B 218      37.094  10.648 -79.139  1.00  0.84           N  
ATOM   5061  CA  VAL B 218      38.263  11.082 -78.397  1.00  0.84           C  
ATOM   5062  C   VAL B 218      37.827  12.243 -77.527  1.00  0.84           C  
ATOM   5063  O   VAL B 218      37.360  13.263 -78.031  1.00  0.84           O  
ATOM   5064  CB  VAL B 218      39.402  11.553 -79.304  1.00  0.84           C  
ATOM   5065  CG1 VAL B 218      40.629  11.955 -78.461  1.00  0.84           C  
ATOM   5066  CG2 VAL B 218      39.793  10.421 -80.270  1.00  0.84           C  
ATOM   5067  N   GLU B 219      37.973  12.137 -76.193  1.00  0.76           N  
ATOM   5068  CA  GLU B 219      37.705  13.248 -75.297  1.00  0.76           C  
ATOM   5069  C   GLU B 219      38.963  14.074 -75.149  1.00  0.76           C  
ATOM   5070  O   GLU B 219      40.051  13.546 -74.913  1.00  0.76           O  
ATOM   5071  CB  GLU B 219      37.266  12.830 -73.877  1.00  0.76           C  
ATOM   5072  CG  GLU B 219      35.871  12.177 -73.780  1.00  0.76           C  
ATOM   5073  CD  GLU B 219      35.412  12.084 -72.328  1.00  0.76           C  
ATOM   5074  OE1 GLU B 219      34.229  11.700 -72.135  1.00  0.76           O  
ATOM   5075  OE2 GLU B 219      36.190  12.443 -71.408  1.00  0.76           O  
ATOM   5076  N   VAL B 220      38.853  15.404 -75.302  1.00  0.85           N  
ATOM   5077  CA  VAL B 220      40.000  16.293 -75.256  1.00  0.85           C  
ATOM   5078  C   VAL B 220      39.814  17.371 -74.213  1.00  0.85           C  
ATOM   5079  O   VAL B 220      38.711  17.854 -73.958  1.00  0.85           O  
ATOM   5080  CB  VAL B 220      40.345  16.924 -76.604  1.00  0.85           C  
ATOM   5081  CG1 VAL B 220      40.769  15.802 -77.571  1.00  0.85           C  
ATOM   5082  CG2 VAL B 220      39.161  17.727 -77.177  1.00  0.85           C  
ATOM   5083  N   ASP B 221      40.917  17.799 -73.563  1.00  0.86           N  
ATOM   5084  CA  ASP B 221      40.914  18.886 -72.604  1.00  0.86           C  
ATOM   5085  C   ASP B 221      40.877  20.247 -73.302  1.00  0.86           C  
ATOM   5086  O   ASP B 221      41.789  21.067 -73.223  1.00  0.86           O  
ATOM   5087  CB  ASP B 221      42.091  18.745 -71.601  1.00  0.86           C  
ATOM   5088  CG  ASP B 221      41.675  19.286 -70.247  1.00  0.86           C  
ATOM   5089  OD1 ASP B 221      40.647  18.781 -69.722  1.00  0.86           O  
ATOM   5090  OD2 ASP B 221      42.348  20.208 -69.720  1.00  0.86           O  
ATOM   5091  N   VAL B 222      39.778  20.492 -74.025  1.00  0.89           N  
ATOM   5092  CA  VAL B 222      39.442  21.733 -74.681  1.00  0.89           C  
ATOM   5093  C   VAL B 222      38.104  22.081 -74.081  1.00  0.89           C  
ATOM   5094  O   VAL B 222      37.169  21.284 -74.139  1.00  0.89           O  
ATOM   5095  CB  VAL B 222      39.312  21.571 -76.195  1.00  0.89           C  
ATOM   5096  CG1 VAL B 222      38.867  22.890 -76.853  1.00  0.89           C  
ATOM   5097  CG2 VAL B 222      40.662  21.119 -76.787  1.00  0.89           C  
ATOM   5098  N   VAL B 223      37.992  23.251 -73.434  1.00  0.85           N  
ATOM   5099  CA  VAL B 223      36.852  23.582 -72.604  1.00  0.85           C  
ATOM   5100  C   VAL B 223      36.068  24.713 -73.232  1.00  0.85           C  
ATOM   5101  O   VAL B 223      36.597  25.767 -73.582  1.00  0.85           O  
ATOM   5102  CB  VAL B 223      37.268  23.963 -71.184  1.00  0.85           C  
ATOM   5103  CG1 VAL B 223      36.035  24.300 -70.321  1.00  0.85           C  
ATOM   5104  CG2 VAL B 223      38.039  22.787 -70.549  1.00  0.85           C  
ATOM   5105  N   PHE B 224      34.750  24.513 -73.374  1.00  0.81           N  
ATOM   5106  CA  PHE B 224      33.819  25.528 -73.805  1.00  0.81           C  
ATOM   5107  C   PHE B 224      32.961  25.886 -72.613  1.00  0.81           C  
ATOM   5108  O   PHE B 224      32.445  25.024 -71.903  1.00  0.81           O  
ATOM   5109  CB  PHE B 224      32.894  25.032 -74.944  1.00  0.81           C  
ATOM   5110  CG  PHE B 224      33.627  25.026 -76.256  1.00  0.81           C  
ATOM   5111  CD1 PHE B 224      33.435  26.074 -77.170  1.00  0.81           C  
ATOM   5112  CD2 PHE B 224      34.496  23.977 -76.597  1.00  0.81           C  
ATOM   5113  CE1 PHE B 224      34.095  26.074 -78.404  1.00  0.81           C  
ATOM   5114  CE2 PHE B 224      35.160  23.973 -77.832  1.00  0.81           C  
ATOM   5115  CZ  PHE B 224      34.954  25.020 -78.739  1.00  0.81           C  
ATOM   5116  N   HIS B 225      32.788  27.193 -72.367  1.00  0.77           N  
ATOM   5117  CA  HIS B 225      31.902  27.690 -71.339  1.00  0.77           C  
ATOM   5118  C   HIS B 225      30.571  28.010 -71.980  1.00  0.77           C  
ATOM   5119  O   HIS B 225      30.468  28.905 -72.817  1.00  0.77           O  
ATOM   5120  CB  HIS B 225      32.440  28.979 -70.680  1.00  0.77           C  
ATOM   5121  CG  HIS B 225      33.680  28.759 -69.873  1.00  0.77           C  
ATOM   5122  ND1 HIS B 225      33.626  27.885 -68.808  1.00  0.77           N  
ATOM   5123  CD2 HIS B 225      34.905  29.345 -69.941  1.00  0.77           C  
ATOM   5124  CE1 HIS B 225      34.814  27.952 -68.245  1.00  0.77           C  
ATOM   5125  NE2 HIS B 225      35.630  28.822 -68.889  1.00  0.77           N  
ATOM   5126  N   HIS B 226      29.520  27.270 -71.601  1.00  0.74           N  
ATOM   5127  CA  HIS B 226      28.175  27.444 -72.098  1.00  0.74           C  
ATOM   5128  C   HIS B 226      27.454  28.474 -71.263  1.00  0.74           C  
ATOM   5129  O   HIS B 226      27.274  28.302 -70.058  1.00  0.74           O  
ATOM   5130  CB  HIS B 226      27.397  26.112 -72.015  1.00  0.74           C  
ATOM   5131  CG  HIS B 226      26.040  26.199 -72.609  1.00  0.74           C  
ATOM   5132  ND1 HIS B 226      26.000  26.585 -73.919  1.00  0.74           N  
ATOM   5133  CD2 HIS B 226      24.785  26.057 -72.110  1.00  0.74           C  
ATOM   5134  CE1 HIS B 226      24.725  26.677 -74.218  1.00  0.74           C  
ATOM   5135  NE2 HIS B 226      23.941  26.369 -73.155  1.00  0.74           N  
ATOM   5136  N   THR B 227      27.036  29.601 -71.869  1.00  0.73           N  
ATOM   5137  CA  THR B 227      26.464  30.699 -71.092  1.00  0.73           C  
ATOM   5138  C   THR B 227      25.023  30.470 -70.688  1.00  0.73           C  
ATOM   5139  O   THR B 227      24.573  31.015 -69.682  1.00  0.73           O  
ATOM   5140  CB  THR B 227      26.614  32.078 -71.725  1.00  0.73           C  
ATOM   5141  OG1 THR B 227      25.989  32.185 -72.990  1.00  0.73           O  
ATOM   5142  CG2 THR B 227      28.100  32.397 -71.940  1.00  0.73           C  
ATOM   5143  N   GLY B 228      24.270  29.618 -71.416  1.00  0.73           N  
ATOM   5144  CA  GLY B 228      22.916  29.233 -71.034  1.00  0.73           C  
ATOM   5145  C   GLY B 228      21.921  30.323 -71.304  1.00  0.73           C  
ATOM   5146  O   GLY B 228      21.030  30.585 -70.497  1.00  0.73           O  
ATOM   5147  N   TYR B 229      22.078  31.015 -72.446  1.00  0.61           N  
ATOM   5148  CA  TYR B 229      21.401  32.265 -72.737  1.00  0.61           C  
ATOM   5149  C   TYR B 229      19.928  32.112 -73.137  1.00  0.61           C  
ATOM   5150  O   TYR B 229      19.523  32.298 -74.280  1.00  0.61           O  
ATOM   5151  CB  TYR B 229      22.220  33.115 -73.754  1.00  0.61           C  
ATOM   5152  CG  TYR B 229      21.713  34.536 -73.831  1.00  0.61           C  
ATOM   5153  CD1 TYR B 229      21.058  34.988 -74.989  1.00  0.61           C  
ATOM   5154  CD2 TYR B 229      21.814  35.399 -72.725  1.00  0.61           C  
ATOM   5155  CE1 TYR B 229      20.460  36.255 -75.021  1.00  0.61           C  
ATOM   5156  CE2 TYR B 229      21.225  36.672 -72.759  1.00  0.61           C  
ATOM   5157  CZ  TYR B 229      20.531  37.088 -73.900  1.00  0.61           C  
ATOM   5158  OH  TYR B 229      19.866  38.326 -73.908  1.00  0.61           O  
ATOM   5159  N   GLU B 230      19.062  31.810 -72.155  1.00  0.55           N  
ATOM   5160  CA  GLU B 230      17.625  31.944 -72.289  1.00  0.55           C  
ATOM   5161  C   GLU B 230      17.161  33.176 -71.523  1.00  0.55           C  
ATOM   5162  O   GLU B 230      16.995  33.097 -70.301  1.00  0.55           O  
ATOM   5163  CB  GLU B 230      16.893  30.729 -71.678  1.00  0.55           C  
ATOM   5164  CG  GLU B 230      17.079  29.425 -72.485  1.00  0.55           C  
ATOM   5165  CD  GLU B 230      16.450  28.231 -71.790  1.00  0.55           C  
ATOM   5166  OE1 GLU B 230      16.487  27.124 -72.387  1.00  0.55           O  
ATOM   5167  OE2 GLU B 230      15.926  28.389 -70.661  1.00  0.55           O  
ATOM   5168  N   PRO B 231      16.909  34.324 -72.138  1.00  0.57           N  
ATOM   5169  CA  PRO B 231      16.206  35.407 -71.479  1.00  0.57           C  
ATOM   5170  C   PRO B 231      14.712  35.120 -71.465  1.00  0.57           C  
ATOM   5171  O   PRO B 231      14.179  34.602 -72.441  1.00  0.57           O  
ATOM   5172  CB  PRO B 231      16.569  36.628 -72.338  1.00  0.57           C  
ATOM   5173  CG  PRO B 231      16.746  36.073 -73.757  1.00  0.57           C  
ATOM   5174  CD  PRO B 231      17.269  34.651 -73.523  1.00  0.57           C  
ATOM   5175  N   GLU B 232      14.031  35.443 -70.350  1.00  0.50           N  
ATOM   5176  CA  GLU B 232      12.588  35.342 -70.207  1.00  0.50           C  
ATOM   5177  C   GLU B 232      11.951  33.954 -70.131  1.00  0.50           C  
ATOM   5178  O   GLU B 232      12.415  32.933 -70.635  1.00  0.50           O  
ATOM   5179  CB  GLU B 232      11.782  36.192 -71.215  1.00  0.50           C  
ATOM   5180  CG  GLU B 232      12.150  37.691 -71.229  1.00  0.50           C  
ATOM   5181  CD  GLU B 232      11.181  38.489 -72.099  1.00  0.50           C  
ATOM   5182  OE1 GLU B 232      11.440  39.706 -72.270  1.00  0.50           O  
ATOM   5183  OE2 GLU B 232      10.177  37.894 -72.573  1.00  0.50           O  
ATOM   5184  N   VAL B 233      10.784  33.913 -69.457  1.00  0.37           N  
ATOM   5185  CA  VAL B 233       9.899  32.761 -69.379  1.00  0.37           C  
ATOM   5186  C   VAL B 233       9.323  32.389 -70.742  1.00  0.37           C  
ATOM   5187  O   VAL B 233       9.207  31.214 -71.086  1.00  0.37           O  
ATOM   5188  CB  VAL B 233       8.774  33.015 -68.373  1.00  0.37           C  
ATOM   5189  CG1 VAL B 233       7.827  31.801 -68.265  1.00  0.37           C  
ATOM   5190  CG2 VAL B 233       9.394  33.309 -66.991  1.00  0.37           C  
ATOM   5191  N   ILE B 234       8.960  33.397 -71.564  1.00  0.41           N  
ATOM   5192  CA  ILE B 234       8.343  33.231 -72.874  1.00  0.41           C  
ATOM   5193  C   ILE B 234       9.231  32.485 -73.867  1.00  0.41           C  
ATOM   5194  O   ILE B 234       8.788  31.545 -74.528  1.00  0.41           O  
ATOM   5195  CB  ILE B 234       7.921  34.593 -73.432  1.00  0.41           C  
ATOM   5196  CG1 ILE B 234       6.908  35.279 -72.479  1.00  0.41           C  
ATOM   5197  CG2 ILE B 234       7.320  34.442 -74.851  1.00  0.41           C  
ATOM   5198  CD1 ILE B 234       6.659  36.754 -72.820  1.00  0.41           C  
ATOM   5199  N   ALA B 235      10.532  32.837 -73.957  1.00  0.44           N  
ATOM   5200  CA  ALA B 235      11.482  32.155 -74.818  1.00  0.44           C  
ATOM   5201  C   ALA B 235      11.721  30.700 -74.424  1.00  0.44           C  
ATOM   5202  O   ALA B 235      11.746  29.801 -75.264  1.00  0.44           O  
ATOM   5203  CB  ALA B 235      12.820  32.913 -74.812  1.00  0.44           C  
ATOM   5204  N   ARG B 236      11.853  30.433 -73.108  1.00  0.42           N  
ATOM   5205  CA  ARG B 236      11.947  29.092 -72.558  1.00  0.42           C  
ATOM   5206  C   ARG B 236      10.704  28.250 -72.823  1.00  0.42           C  
ATOM   5207  O   ARG B 236      10.792  27.073 -73.171  1.00  0.42           O  
ATOM   5208  CB  ARG B 236      12.205  29.163 -71.033  1.00  0.42           C  
ATOM   5209  CG  ARG B 236      12.357  27.785 -70.349  1.00  0.42           C  
ATOM   5210  CD  ARG B 236      12.691  27.870 -68.856  1.00  0.42           C  
ATOM   5211  NE  ARG B 236      14.112  28.307 -68.783  1.00  0.42           N  
ATOM   5212  CZ  ARG B 236      14.619  29.266 -67.999  1.00  0.42           C  
ATOM   5213  NH1 ARG B 236      14.013  29.670 -66.890  1.00  0.42           N  
ATOM   5214  NH2 ARG B 236      15.781  29.793 -68.375  1.00  0.42           N  
ATOM   5215  N   LYS B 237       9.501  28.841 -72.685  1.00  0.51           N  
ATOM   5216  CA  LYS B 237       8.253  28.185 -73.023  1.00  0.51           C  
ATOM   5217  C   LYS B 237       8.146  27.817 -74.499  1.00  0.51           C  
ATOM   5218  O   LYS B 237       7.878  26.664 -74.833  1.00  0.51           O  
ATOM   5219  CB  LYS B 237       7.061  29.085 -72.613  1.00  0.51           C  
ATOM   5220  CG  LYS B 237       5.701  28.447 -72.914  1.00  0.51           C  
ATOM   5221  CD  LYS B 237       4.493  29.303 -72.510  1.00  0.51           C  
ATOM   5222  CE  LYS B 237       3.234  28.730 -73.166  1.00  0.51           C  
ATOM   5223  NZ  LYS B 237       2.016  29.463 -72.778  1.00  0.51           N  
ATOM   5224  N   GLY B 238       8.448  28.761 -75.419  1.00  0.57           N  
ATOM   5225  CA  GLY B 238       8.401  28.505 -76.859  1.00  0.57           C  
ATOM   5226  C   GLY B 238       9.435  27.516 -77.340  1.00  0.57           C  
ATOM   5227  O   GLY B 238       9.238  26.788 -78.312  1.00  0.57           O  
ATOM   5228  N   LYS B 239      10.581  27.434 -76.640  1.00  0.58           N  
ATOM   5229  CA  LYS B 239      11.577  26.397 -76.826  1.00  0.58           C  
ATOM   5230  C   LYS B 239      11.058  25.005 -76.479  1.00  0.58           C  
ATOM   5231  O   LYS B 239      11.266  24.061 -77.240  1.00  0.58           O  
ATOM   5232  CB  LYS B 239      12.831  26.740 -75.990  1.00  0.58           C  
ATOM   5233  CG  LYS B 239      14.030  25.787 -76.133  1.00  0.58           C  
ATOM   5234  CD  LYS B 239      15.235  26.354 -75.364  1.00  0.58           C  
ATOM   5235  CE  LYS B 239      16.465  25.440 -75.306  1.00  0.58           C  
ATOM   5236  NZ  LYS B 239      17.522  26.095 -74.509  1.00  0.58           N  
ATOM   5237  N   ARG B 240      10.325  24.855 -75.353  1.00  0.52           N  
ATOM   5238  CA  ARG B 240       9.647  23.618 -74.985  1.00  0.52           C  
ATOM   5239  C   ARG B 240       8.543  23.226 -75.960  1.00  0.52           C  
ATOM   5240  O   ARG B 240       8.462  22.076 -76.385  1.00  0.52           O  
ATOM   5241  CB  ARG B 240       9.011  23.721 -73.575  1.00  0.52           C  
ATOM   5242  CG  ARG B 240      10.031  23.861 -72.430  1.00  0.52           C  
ATOM   5243  CD  ARG B 240       9.350  24.124 -71.085  1.00  0.52           C  
ATOM   5244  NE  ARG B 240      10.439  24.266 -70.068  1.00  0.52           N  
ATOM   5245  CZ  ARG B 240      10.221  24.326 -68.748  1.00  0.52           C  
ATOM   5246  NH1 ARG B 240       8.992  24.322 -68.243  1.00  0.52           N  
ATOM   5247  NH2 ARG B 240      11.256  24.360 -67.912  1.00  0.52           N  
ATOM   5248  N   GLU B 241       7.690  24.185 -76.371  1.00  0.58           N  
ATOM   5249  CA  GLU B 241       6.623  23.984 -77.339  1.00  0.58           C  
ATOM   5250  C   GLU B 241       7.150  23.588 -78.721  1.00  0.58           C  
ATOM   5251  O   GLU B 241       6.617  22.702 -79.389  1.00  0.58           O  
ATOM   5252  CB  GLU B 241       5.696  25.229 -77.365  1.00  0.58           C  
ATOM   5253  CG  GLU B 241       4.924  25.390 -76.021  1.00  0.58           C  
ATOM   5254  CD  GLU B 241       4.126  26.685 -75.857  1.00  0.58           C  
ATOM   5255  OE1 GLU B 241       3.011  26.609 -75.268  1.00  0.58           O  
ATOM   5256  OE2 GLU B 241       4.645  27.773 -76.218  1.00  0.58           O  
ATOM   5257  N   ARG B 242       8.274  24.188 -79.173  1.00  0.51           N  
ATOM   5258  CA  ARG B 242       9.015  23.712 -80.332  1.00  0.51           C  
ATOM   5259  C   ARG B 242       9.591  22.306 -80.172  1.00  0.51           C  
ATOM   5260  O   ARG B 242       9.461  21.474 -81.065  1.00  0.51           O  
ATOM   5261  CB  ARG B 242      10.171  24.695 -80.660  1.00  0.51           C  
ATOM   5262  CG  ARG B 242      11.009  24.323 -81.907  1.00  0.51           C  
ATOM   5263  CD  ARG B 242      12.057  25.369 -82.311  1.00  0.51           C  
ATOM   5264  NE  ARG B 242      13.051  25.447 -81.189  1.00  0.51           N  
ATOM   5265  CZ  ARG B 242      13.947  26.432 -81.037  1.00  0.51           C  
ATOM   5266  NH1 ARG B 242      14.042  27.439 -81.900  1.00  0.51           N  
ATOM   5267  NH2 ARG B 242      14.774  26.408 -79.993  1.00  0.51           N  
ATOM   5268  N   TYR B 243      10.228  21.988 -79.025  1.00  0.57           N  
ATOM   5269  CA  TYR B 243      10.815  20.677 -78.769  1.00  0.57           C  
ATOM   5270  C   TYR B 243       9.782  19.562 -78.715  1.00  0.57           C  
ATOM   5271  O   TYR B 243       9.991  18.495 -79.288  1.00  0.57           O  
ATOM   5272  CB  TYR B 243      11.668  20.660 -77.469  1.00  0.57           C  
ATOM   5273  CG  TYR B 243      13.049  21.272 -77.605  1.00  0.57           C  
ATOM   5274  CD1 TYR B 243      13.446  22.137 -78.650  1.00  0.57           C  
ATOM   5275  CD2 TYR B 243      14.002  20.929 -76.629  1.00  0.57           C  
ATOM   5276  CE1 TYR B 243      14.749  22.651 -78.698  1.00  0.57           C  
ATOM   5277  CE2 TYR B 243      15.310  21.432 -76.684  1.00  0.57           C  
ATOM   5278  CZ  TYR B 243      15.676  22.302 -77.714  1.00  0.57           C  
ATOM   5279  OH  TYR B 243      16.986  22.809 -77.793  1.00  0.57           O  
ATOM   5280  N   ALA B 244       8.617  19.798 -78.078  1.00  0.71           N  
ATOM   5281  CA  ALA B 244       7.513  18.856 -78.052  1.00  0.71           C  
ATOM   5282  C   ALA B 244       7.001  18.509 -79.446  1.00  0.71           C  
ATOM   5283  O   ALA B 244       6.888  17.337 -79.798  1.00  0.71           O  
ATOM   5284  CB  ALA B 244       6.367  19.445 -77.205  1.00  0.71           C  
ATOM   5285  N   ARG B 245       6.800  19.530 -80.308  1.00  0.67           N  
ATOM   5286  CA  ARG B 245       6.420  19.351 -81.700  1.00  0.67           C  
ATOM   5287  C   ARG B 245       7.443  18.553 -82.504  1.00  0.67           C  
ATOM   5288  O   ARG B 245       7.097  17.683 -83.301  1.00  0.67           O  
ATOM   5289  CB  ARG B 245       6.220  20.730 -82.379  1.00  0.67           C  
ATOM   5290  CG  ARG B 245       5.708  20.635 -83.833  1.00  0.67           C  
ATOM   5291  CD  ARG B 245       5.523  21.979 -84.540  1.00  0.67           C  
ATOM   5292  NE  ARG B 245       6.887  22.565 -84.753  1.00  0.67           N  
ATOM   5293  CZ  ARG B 245       7.276  23.791 -84.393  1.00  0.67           C  
ATOM   5294  NH1 ARG B 245       6.558  24.534 -83.557  1.00  0.67           N  
ATOM   5295  NH2 ARG B 245       8.411  24.282 -84.879  1.00  0.67           N  
ATOM   5296  N   LEU B 246       8.754  18.800 -82.294  1.00  0.72           N  
ATOM   5297  CA  LEU B 246       9.809  18.003 -82.898  1.00  0.72           C  
ATOM   5298  C   LEU B 246       9.766  16.538 -82.480  1.00  0.72           C  
ATOM   5299  O   LEU B 246       9.873  15.650 -83.321  1.00  0.72           O  
ATOM   5300  CB  LEU B 246      11.213  18.572 -82.571  1.00  0.72           C  
ATOM   5301  CG  LEU B 246      11.511  19.944 -83.207  1.00  0.72           C  
ATOM   5302  CD1 LEU B 246      12.809  20.539 -82.645  1.00  0.72           C  
ATOM   5303  CD2 LEU B 246      11.606  19.858 -84.732  1.00  0.72           C  
ATOM   5304  N   VAL B 247       9.560  16.239 -81.181  1.00  0.74           N  
ATOM   5305  CA  VAL B 247       9.383  14.876 -80.693  1.00  0.74           C  
ATOM   5306  C   VAL B 247       8.128  14.195 -81.241  1.00  0.74           C  
ATOM   5307  O   VAL B 247       8.186  13.050 -81.688  1.00  0.74           O  
ATOM   5308  CB  VAL B 247       9.409  14.816 -79.170  1.00  0.74           C  
ATOM   5309  CG1 VAL B 247       9.159  13.381 -78.671  1.00  0.74           C  
ATOM   5310  CG2 VAL B 247      10.789  15.277 -78.662  1.00  0.74           C  
ATOM   5311  N   GLU B 248       6.969  14.886 -81.287  1.00  0.73           N  
ATOM   5312  CA  GLU B 248       5.739  14.395 -81.903  1.00  0.73           C  
ATOM   5313  C   GLU B 248       5.888  14.105 -83.392  1.00  0.73           C  
ATOM   5314  O   GLU B 248       5.430  13.085 -83.920  1.00  0.73           O  
ATOM   5315  CB  GLU B 248       4.613  15.438 -81.735  1.00  0.73           C  
ATOM   5316  CG  GLU B 248       4.108  15.579 -80.280  1.00  0.73           C  
ATOM   5317  CD  GLU B 248       3.142  16.751 -80.109  1.00  0.73           C  
ATOM   5318  OE1 GLU B 248       2.551  16.834 -79.002  1.00  0.73           O  
ATOM   5319  OE2 GLU B 248       2.994  17.562 -81.060  1.00  0.73           O  
ATOM   5320  N   ARG B 249       6.589  14.995 -84.115  1.00  0.71           N  
ATOM   5321  CA  ARG B 249       6.960  14.781 -85.495  1.00  0.71           C  
ATOM   5322  C   ARG B 249       7.884  13.584 -85.693  1.00  0.71           C  
ATOM   5323  O   ARG B 249       7.643  12.743 -86.555  1.00  0.71           O  
ATOM   5324  CB  ARG B 249       7.609  16.062 -86.062  1.00  0.71           C  
ATOM   5325  CG  ARG B 249       7.925  15.948 -87.559  1.00  0.71           C  
ATOM   5326  CD  ARG B 249       8.402  17.247 -88.201  1.00  0.71           C  
ATOM   5327  NE  ARG B 249       8.676  16.848 -89.606  1.00  0.71           N  
ATOM   5328  CZ  ARG B 249       9.174  17.625 -90.571  1.00  0.71           C  
ATOM   5329  NH1 ARG B 249       9.415  18.916 -90.389  1.00  0.71           N  
ATOM   5330  NH2 ARG B 249       9.444  17.028 -91.727  1.00  0.71           N  
ATOM   5331  N   CYS B 250       8.930  13.430 -84.855  1.00  0.73           N  
ATOM   5332  CA  CYS B 250       9.807  12.268 -84.866  1.00  0.73           C  
ATOM   5333  C   CYS B 250       9.097  10.959 -84.554  1.00  0.73           C  
ATOM   5334  O   CYS B 250       9.368   9.941 -85.179  1.00  0.73           O  
ATOM   5335  CB  CYS B 250      10.976  12.402 -83.867  1.00  0.73           C  
ATOM   5336  SG  CYS B 250      12.192  13.676 -84.308  1.00  0.73           S  
ATOM   5337  N   LEU B 251       8.143  10.949 -83.601  1.00  0.72           N  
ATOM   5338  CA  LEU B 251       7.281   9.805 -83.345  1.00  0.72           C  
ATOM   5339  C   LEU B 251       6.427   9.412 -84.541  1.00  0.72           C  
ATOM   5340  O   LEU B 251       6.241   8.233 -84.815  1.00  0.72           O  
ATOM   5341  CB  LEU B 251       6.334  10.077 -82.151  1.00  0.72           C  
ATOM   5342  CG  LEU B 251       7.016  10.020 -80.772  1.00  0.72           C  
ATOM   5343  CD1 LEU B 251       6.081  10.606 -79.706  1.00  0.72           C  
ATOM   5344  CD2 LEU B 251       7.404   8.584 -80.400  1.00  0.72           C  
ATOM   5345  N   THR B 252       5.883  10.387 -85.295  1.00  0.73           N  
ATOM   5346  CA  THR B 252       5.202  10.106 -86.564  1.00  0.73           C  
ATOM   5347  C   THR B 252       6.146   9.544 -87.631  1.00  0.73           C  
ATOM   5348  O   THR B 252       5.830   8.566 -88.304  1.00  0.73           O  
ATOM   5349  CB  THR B 252       4.496  11.344 -87.152  1.00  0.73           C  
ATOM   5350  OG1 THR B 252       3.583  11.940 -86.234  1.00  0.73           O  
ATOM   5351  CG2 THR B 252       3.734  10.966 -88.444  1.00  0.73           C  
ATOM   5352  N   GLU B 253       7.341  10.147 -87.815  1.00  0.69           N  
ATOM   5353  CA  GLU B 253       8.317   9.736 -88.818  1.00  0.69           C  
ATOM   5354  C   GLU B 253       9.057   8.416 -88.527  1.00  0.69           C  
ATOM   5355  O   GLU B 253       9.212   7.583 -89.418  1.00  0.69           O  
ATOM   5356  CB  GLU B 253       9.290  10.909 -89.132  1.00  0.69           C  
ATOM   5357  CG  GLU B 253       8.575  12.138 -89.778  1.00  0.69           C  
ATOM   5358  CD  GLU B 253       9.491  13.313 -90.098  1.00  0.69           C  
ATOM   5359  OE1 GLU B 253       8.992  14.376 -90.567  1.00  0.69           O  
ATOM   5360  OE2 GLU B 253      10.723  13.220 -89.868  1.00  0.69           O  
ATOM   5361  N   GLU B 254       9.500   8.159 -87.275  1.00  0.61           N  
ATOM   5362  CA  GLU B 254      10.158   6.919 -86.867  1.00  0.61           C  
ATOM   5363  C   GLU B 254       9.419   6.247 -85.689  1.00  0.61           C  
ATOM   5364  O   GLU B 254       9.953   6.228 -84.576  1.00  0.61           O  
ATOM   5365  CB  GLU B 254      11.646   7.149 -86.444  1.00  0.61           C  
ATOM   5366  CG  GLU B 254      12.619   7.614 -87.573  1.00  0.61           C  
ATOM   5367  CD  GLU B 254      14.068   7.718 -87.122  1.00  0.61           C  
ATOM   5368  OE1 GLU B 254      15.010   7.481 -87.930  1.00  0.61           O  
ATOM   5369  OE2 GLU B 254      14.291   8.053 -85.930  1.00  0.61           O  
ATOM   5370  N   PRO B 255       8.223   5.657 -85.823  1.00  0.71           N  
ATOM   5371  CA  PRO B 255       7.363   5.317 -84.680  1.00  0.71           C  
ATOM   5372  C   PRO B 255       7.853   4.146 -83.855  1.00  0.71           C  
ATOM   5373  O   PRO B 255       7.468   4.021 -82.691  1.00  0.71           O  
ATOM   5374  CB  PRO B 255       6.000   4.997 -85.328  1.00  0.71           C  
ATOM   5375  CG  PRO B 255       6.338   4.611 -86.771  1.00  0.71           C  
ATOM   5376  CD  PRO B 255       7.503   5.544 -87.090  1.00  0.71           C  
ATOM   5377  N   SER B 256       8.682   3.265 -84.434  1.00  0.63           N  
ATOM   5378  CA  SER B 256       9.222   2.091 -83.772  1.00  0.63           C  
ATOM   5379  C   SER B 256      10.583   2.372 -83.173  1.00  0.63           C  
ATOM   5380  O   SER B 256      11.213   1.481 -82.615  1.00  0.63           O  
ATOM   5381  CB  SER B 256       9.383   0.906 -84.762  1.00  0.63           C  
ATOM   5382  OG  SER B 256      10.039   1.328 -85.963  1.00  0.63           O  
ATOM   5383  N   ASN B 257      11.070   3.628 -83.231  1.00  0.57           N  
ATOM   5384  CA  ASN B 257      12.329   4.000 -82.623  1.00  0.57           C  
ATOM   5385  C   ASN B 257      12.095   4.367 -81.143  1.00  0.57           C  
ATOM   5386  O   ASN B 257      11.430   5.369 -80.856  1.00  0.57           O  
ATOM   5387  CB  ASN B 257      12.960   5.167 -83.432  1.00  0.57           C  
ATOM   5388  CG  ASN B 257      14.351   5.545 -82.940  1.00  0.57           C  
ATOM   5389  OD1 ASN B 257      14.834   5.054 -81.918  1.00  0.57           O  
ATOM   5390  ND2 ASN B 257      15.024   6.463 -83.665  1.00  0.57           N  
ATOM   5391  N   PRO B 258      12.613   3.632 -80.155  1.00  0.62           N  
ATOM   5392  CA  PRO B 258      12.351   3.906 -78.746  1.00  0.62           C  
ATOM   5393  C   PRO B 258      13.112   5.118 -78.228  1.00  0.62           C  
ATOM   5394  O   PRO B 258      12.817   5.563 -77.117  1.00  0.62           O  
ATOM   5395  CB  PRO B 258      12.770   2.608 -78.048  1.00  0.62           C  
ATOM   5396  CG  PRO B 258      13.864   2.034 -78.949  1.00  0.62           C  
ATOM   5397  CD  PRO B 258      13.380   2.395 -80.344  1.00  0.62           C  
ATOM   5398  N   LYS B 259      14.052   5.704 -79.009  1.00  0.56           N  
ATOM   5399  CA  LYS B 259      14.724   6.955 -78.681  1.00  0.56           C  
ATOM   5400  C   LYS B 259      13.726   8.102 -78.510  1.00  0.56           C  
ATOM   5401  O   LYS B 259      13.774   8.866 -77.547  1.00  0.56           O  
ATOM   5402  CB  LYS B 259      15.767   7.302 -79.793  1.00  0.56           C  
ATOM   5403  CG  LYS B 259      16.478   8.662 -79.643  1.00  0.56           C  
ATOM   5404  CD  LYS B 259      17.608   8.930 -80.666  1.00  0.56           C  
ATOM   5405  CE  LYS B 259      18.117  10.384 -80.593  1.00  0.56           C  
ATOM   5406  NZ  LYS B 259      19.363  10.629 -81.342  1.00  0.56           N  
ATOM   5407  N   TRP B 260      12.745   8.216 -79.425  1.00  0.64           N  
ATOM   5408  CA  TRP B 260      11.718   9.244 -79.384  1.00  0.64           C  
ATOM   5409  C   TRP B 260      10.693   9.089 -78.282  1.00  0.64           C  
ATOM   5410  O   TRP B 260      10.272  10.068 -77.672  1.00  0.64           O  
ATOM   5411  CB  TRP B 260      11.015   9.384 -80.748  1.00  0.64           C  
ATOM   5412  CG  TRP B 260      11.995   9.605 -81.876  1.00  0.64           C  
ATOM   5413  CD1 TRP B 260      12.166   8.848 -83.000  1.00  0.64           C  
ATOM   5414  CD2 TRP B 260      12.989  10.648 -81.928  1.00  0.64           C  
ATOM   5415  NE1 TRP B 260      13.237   9.315 -83.729  1.00  0.64           N  
ATOM   5416  CE2 TRP B 260      13.749  10.422 -83.097  1.00  0.64           C  
ATOM   5417  CE3 TRP B 260      13.258  11.734 -81.092  1.00  0.64           C  
ATOM   5418  CZ2 TRP B 260      14.787  11.273 -83.440  1.00  0.64           C  
ATOM   5419  CZ3 TRP B 260      14.327  12.576 -81.433  1.00  0.64           C  
ATOM   5420  CH2 TRP B 260      15.081  12.346 -82.592  1.00  0.64           C  
ATOM   5421  N   HIS B 261      10.275   7.849 -77.963  1.00  0.64           N  
ATOM   5422  CA  HIS B 261       9.376   7.588 -76.845  1.00  0.64           C  
ATOM   5423  C   HIS B 261       9.966   7.974 -75.496  1.00  0.64           C  
ATOM   5424  O   HIS B 261       9.267   8.514 -74.642  1.00  0.64           O  
ATOM   5425  CB  HIS B 261       8.919   6.122 -76.801  1.00  0.64           C  
ATOM   5426  CG  HIS B 261       8.055   5.757 -77.968  1.00  0.64           C  
ATOM   5427  ND1 HIS B 261       6.725   6.158 -78.002  1.00  0.64           N  
ATOM   5428  CD2 HIS B 261       8.367   5.040 -79.080  1.00  0.64           C  
ATOM   5429  CE1 HIS B 261       6.263   5.657 -79.141  1.00  0.64           C  
ATOM   5430  NE2 HIS B 261       7.215   4.980 -79.829  1.00  0.64           N  
ATOM   5431  N   PHE B 262      11.284   7.753 -75.293  1.00  0.60           N  
ATOM   5432  CA  PHE B 262      12.012   8.261 -74.140  1.00  0.60           C  
ATOM   5433  C   PHE B 262      11.963   9.789 -74.034  1.00  0.60           C  
ATOM   5434  O   PHE B 262      11.638  10.335 -72.981  1.00  0.60           O  
ATOM   5435  CB  PHE B 262      13.484   7.748 -74.218  1.00  0.60           C  
ATOM   5436  CG  PHE B 262      14.395   8.386 -73.199  1.00  0.60           C  
ATOM   5437  CD1 PHE B 262      15.233   9.451 -73.571  1.00  0.60           C  
ATOM   5438  CD2 PHE B 262      14.367   7.979 -71.859  1.00  0.60           C  
ATOM   5439  CE1 PHE B 262      16.046  10.085 -72.624  1.00  0.60           C  
ATOM   5440  CE2 PHE B 262      15.192   8.599 -70.911  1.00  0.60           C  
ATOM   5441  CZ  PHE B 262      16.035   9.649 -71.294  1.00  0.60           C  
ATOM   5442  N   TYR B 263      12.239  10.521 -75.133  1.00  0.63           N  
ATOM   5443  CA  TYR B 263      12.155  11.974 -75.152  1.00  0.63           C  
ATOM   5444  C   TYR B 263      10.750  12.505 -74.956  1.00  0.63           C  
ATOM   5445  O   TYR B 263      10.549  13.510 -74.287  1.00  0.63           O  
ATOM   5446  CB  TYR B 263      12.764  12.589 -76.433  1.00  0.63           C  
ATOM   5447  CG  TYR B 263      14.248  12.359 -76.470  1.00  0.63           C  
ATOM   5448  CD1 TYR B 263      15.073  12.761 -75.404  1.00  0.63           C  
ATOM   5449  CD2 TYR B 263      14.842  11.779 -77.597  1.00  0.63           C  
ATOM   5450  CE1 TYR B 263      16.461  12.572 -75.467  1.00  0.63           C  
ATOM   5451  CE2 TYR B 263      16.229  11.606 -77.658  1.00  0.63           C  
ATOM   5452  CZ  TYR B 263      17.045  12.001 -76.596  1.00  0.63           C  
ATOM   5453  OH  TYR B 263      18.451  11.878 -76.642  1.00  0.63           O  
ATOM   5454  N   ALA B 264       9.722  11.823 -75.490  1.00  0.67           N  
ATOM   5455  CA  ALA B 264       8.335  12.187 -75.281  1.00  0.67           C  
ATOM   5456  C   ALA B 264       7.916  12.176 -73.817  1.00  0.67           C  
ATOM   5457  O   ALA B 264       7.186  13.051 -73.355  1.00  0.67           O  
ATOM   5458  CB  ALA B 264       7.437  11.232 -76.088  1.00  0.67           C  
ATOM   5459  N   VAL B 265       8.389  11.182 -73.045  1.00  0.66           N  
ATOM   5460  CA  VAL B 265       8.245  11.194 -71.601  1.00  0.66           C  
ATOM   5461  C   VAL B 265       9.164  12.211 -70.921  1.00  0.66           C  
ATOM   5462  O   VAL B 265       8.715  12.998 -70.094  1.00  0.66           O  
ATOM   5463  CB  VAL B 265       8.455   9.799 -71.026  1.00  0.66           C  
ATOM   5464  CG1 VAL B 265       8.245   9.808 -69.502  1.00  0.66           C  
ATOM   5465  CG2 VAL B 265       7.439   8.831 -71.669  1.00  0.66           C  
ATOM   5466  N   ARG B 266      10.473  12.261 -71.264  1.00  0.59           N  
ATOM   5467  CA  ARG B 266      11.433  13.140 -70.603  1.00  0.59           C  
ATOM   5468  C   ARG B 266      11.178  14.630 -70.796  1.00  0.59           C  
ATOM   5469  O   ARG B 266      11.164  15.406 -69.841  1.00  0.59           O  
ATOM   5470  CB  ARG B 266      12.883  12.855 -71.094  1.00  0.59           C  
ATOM   5471  CG  ARG B 266      13.978  13.514 -70.218  1.00  0.59           C  
ATOM   5472  CD  ARG B 266      15.384  13.555 -70.833  1.00  0.59           C  
ATOM   5473  NE  ARG B 266      15.345  14.576 -71.921  1.00  0.59           N  
ATOM   5474  CZ  ARG B 266      16.341  14.899 -72.750  1.00  0.59           C  
ATOM   5475  NH1 ARG B 266      17.581  14.460 -72.588  1.00  0.59           N  
ATOM   5476  NH2 ARG B 266      16.045  15.669 -73.790  1.00  0.59           N  
ATOM   5477  N   ASP B 267      10.940  15.072 -72.045  1.00  0.65           N  
ATOM   5478  CA  ASP B 267      10.907  16.479 -72.393  1.00  0.65           C  
ATOM   5479  C   ASP B 267       9.562  17.088 -72.004  1.00  0.65           C  
ATOM   5480  O   ASP B 267       9.427  18.295 -71.805  1.00  0.65           O  
ATOM   5481  CB  ASP B 267      11.276  16.689 -73.893  1.00  0.65           C  
ATOM   5482  CG  ASP B 267      12.723  16.305 -74.174  1.00  0.65           C  
ATOM   5483  OD1 ASP B 267      13.448  15.882 -73.236  1.00  0.65           O  
ATOM   5484  OD2 ASP B 267      13.180  16.437 -75.338  1.00  0.65           O  
ATOM   5485  N   GLY B 268       8.547  16.225 -71.767  1.00  0.65           N  
ATOM   5486  CA  GLY B 268       7.265  16.610 -71.189  1.00  0.65           C  
ATOM   5487  C   GLY B 268       7.286  16.781 -69.687  1.00  0.65           C  
ATOM   5488  O   GLY B 268       6.302  17.228 -69.095  1.00  0.65           O  
ATOM   5489  N   LEU B 269       8.409  16.442 -69.023  1.00  0.56           N  
ATOM   5490  CA  LEU B 269       8.587  16.599 -67.589  1.00  0.56           C  
ATOM   5491  C   LEU B 269       9.569  17.706 -67.242  1.00  0.56           C  
ATOM   5492  O   LEU B 269       9.787  18.008 -66.070  1.00  0.56           O  
ATOM   5493  CB  LEU B 269       9.125  15.286 -66.968  1.00  0.56           C  
ATOM   5494  CG  LEU B 269       8.139  14.105 -67.026  1.00  0.56           C  
ATOM   5495  CD1 LEU B 269       8.823  12.817 -66.547  1.00  0.56           C  
ATOM   5496  CD2 LEU B 269       6.874  14.382 -66.206  1.00  0.56           C  
ATOM   5497  N   VAL B 270      10.183  18.376 -68.239  1.00  0.47           N  
ATOM   5498  CA  VAL B 270      11.194  19.399 -67.999  1.00  0.47           C  
ATOM   5499  C   VAL B 270      10.672  20.606 -67.221  1.00  0.47           C  
ATOM   5500  O   VAL B 270       9.912  21.441 -67.711  1.00  0.47           O  
ATOM   5501  CB  VAL B 270      11.904  19.823 -69.284  1.00  0.47           C  
ATOM   5502  CG1 VAL B 270      12.865  21.012 -69.063  1.00  0.47           C  
ATOM   5503  CG2 VAL B 270      12.718  18.620 -69.794  1.00  0.47           C  
ATOM   5504  N   GLY B 271      11.100  20.729 -65.946  1.00  0.34           N  
ATOM   5505  CA  GLY B 271      10.689  21.810 -65.061  1.00  0.34           C  
ATOM   5506  C   GLY B 271       9.402  21.568 -64.323  1.00  0.34           C  
ATOM   5507  O   GLY B 271       8.740  22.524 -63.932  1.00  0.34           O  
ATOM   5508  N   ARG B 272       9.015  20.300 -64.109  1.00  0.32           N  
ATOM   5509  CA  ARG B 272       7.871  19.960 -63.290  1.00  0.32           C  
ATOM   5510  C   ARG B 272       8.062  18.562 -62.733  1.00  0.32           C  
ATOM   5511  O   ARG B 272       9.057  17.896 -63.005  1.00  0.32           O  
ATOM   5512  CB  ARG B 272       6.526  20.060 -64.059  1.00  0.32           C  
ATOM   5513  CG  ARG B 272       6.326  18.998 -65.159  1.00  0.32           C  
ATOM   5514  CD  ARG B 272       5.007  19.166 -65.910  1.00  0.32           C  
ATOM   5515  NE  ARG B 272       4.873  17.987 -66.817  1.00  0.32           N  
ATOM   5516  CZ  ARG B 272       4.024  16.967 -66.637  1.00  0.32           C  
ATOM   5517  NH1 ARG B 272       3.305  16.799 -65.535  1.00  0.32           N  
ATOM   5518  NH2 ARG B 272       3.911  16.071 -67.608  1.00  0.32           N  
ATOM   5519  N   LYS B 273       7.115  18.081 -61.905  1.00  0.40           N  
ATOM   5520  CA  LYS B 273       7.060  16.693 -61.496  1.00  0.40           C  
ATOM   5521  C   LYS B 273       5.683  16.169 -61.885  1.00  0.40           C  
ATOM   5522  O   LYS B 273       4.736  16.959 -61.888  1.00  0.40           O  
ATOM   5523  CB  LYS B 273       7.309  16.528 -59.976  1.00  0.40           C  
ATOM   5524  CG  LYS B 273       8.769  16.830 -59.601  1.00  0.40           C  
ATOM   5525  CD  LYS B 273       9.062  16.618 -58.108  1.00  0.40           C  
ATOM   5526  CE  LYS B 273      10.539  16.838 -57.768  1.00  0.40           C  
ATOM   5527  NZ  LYS B 273      10.771  16.624 -56.322  1.00  0.40           N  
ATOM   5528  N   PRO B 274       5.507  14.908 -62.264  1.00  0.54           N  
ATOM   5529  CA  PRO B 274       4.191  14.341 -62.511  1.00  0.54           C  
ATOM   5530  C   PRO B 274       3.521  13.922 -61.213  1.00  0.54           C  
ATOM   5531  O   PRO B 274       4.201  13.639 -60.226  1.00  0.54           O  
ATOM   5532  CB  PRO B 274       4.519  13.121 -63.385  1.00  0.54           C  
ATOM   5533  CG  PRO B 274       5.873  12.626 -62.863  1.00  0.54           C  
ATOM   5534  CD  PRO B 274       6.572  13.906 -62.392  1.00  0.54           C  
ATOM   5535  N   GLY B 275       2.171  13.891 -61.171  1.00  0.57           N  
ATOM   5536  CA  GLY B 275       1.449  13.263 -60.061  1.00  0.57           C  
ATOM   5537  C   GLY B 275       1.551  11.746 -60.088  1.00  0.57           C  
ATOM   5538  O   GLY B 275       1.956  11.210 -61.118  1.00  0.57           O  
ATOM   5539  N   PRO B 276       1.174  10.998 -59.050  1.00  0.62           N  
ATOM   5540  CA  PRO B 276       1.256   9.533 -59.020  1.00  0.62           C  
ATOM   5541  C   PRO B 276       0.620   8.811 -60.193  1.00  0.62           C  
ATOM   5542  O   PRO B 276       1.260   7.967 -60.818  1.00  0.62           O  
ATOM   5543  CB  PRO B 276       0.599   9.158 -57.684  1.00  0.62           C  
ATOM   5544  CG  PRO B 276       0.929  10.353 -56.787  1.00  0.62           C  
ATOM   5545  CD  PRO B 276       0.792  11.540 -57.744  1.00  0.62           C  
ATOM   5546  N   ASP B 277      -0.633   9.150 -60.525  1.00  0.60           N  
ATOM   5547  CA  ASP B 277      -1.415   8.607 -61.612  1.00  0.60           C  
ATOM   5548  C   ASP B 277      -0.784   8.878 -62.971  1.00  0.60           C  
ATOM   5549  O   ASP B 277      -0.675   8.003 -63.832  1.00  0.60           O  
ATOM   5550  CB  ASP B 277      -2.838   9.226 -61.563  1.00  0.60           C  
ATOM   5551  CG  ASP B 277      -3.359   9.242 -60.134  1.00  0.60           C  
ATOM   5552  OD1 ASP B 277      -4.213   8.386 -59.808  1.00  0.60           O  
ATOM   5553  OD2 ASP B 277      -2.869  10.109 -59.358  1.00  0.60           O  
ATOM   5554  N   GLU B 278      -0.292  10.119 -63.168  1.00  0.54           N  
ATOM   5555  CA  GLU B 278       0.450  10.513 -64.349  1.00  0.54           C  
ATOM   5556  C   GLU B 278       1.778   9.780 -64.471  1.00  0.54           C  
ATOM   5557  O   GLU B 278       2.126   9.260 -65.529  1.00  0.54           O  
ATOM   5558  CB  GLU B 278       0.711  12.037 -64.367  1.00  0.54           C  
ATOM   5559  CG  GLU B 278       1.260  12.508 -65.735  1.00  0.54           C  
ATOM   5560  CD  GLU B 278       1.732  13.949 -65.776  1.00  0.54           C  
ATOM   5561  OE1 GLU B 278       2.089  14.388 -66.899  1.00  0.54           O  
ATOM   5562  OE2 GLU B 278       1.811  14.646 -64.733  1.00  0.54           O  
ATOM   5563  N   ALA B 279       2.532   9.657 -63.360  1.00  0.59           N  
ATOM   5564  CA  ALA B 279       3.779   8.925 -63.292  1.00  0.59           C  
ATOM   5565  C   ALA B 279       3.606   7.452 -63.641  1.00  0.59           C  
ATOM   5566  O   ALA B 279       4.376   6.890 -64.415  1.00  0.59           O  
ATOM   5567  CB  ALA B 279       4.385   9.070 -61.881  1.00  0.59           C  
ATOM   5568  N   LEU B 280       2.535   6.815 -63.130  1.00  0.55           N  
ATOM   5569  CA  LEU B 280       2.119   5.472 -63.487  1.00  0.55           C  
ATOM   5570  C   LEU B 280       1.733   5.312 -64.957  1.00  0.55           C  
ATOM   5571  O   LEU B 280       2.122   4.348 -65.618  1.00  0.55           O  
ATOM   5572  CB  LEU B 280       0.944   5.055 -62.571  1.00  0.55           C  
ATOM   5573  CG  LEU B 280       0.413   3.617 -62.749  1.00  0.55           C  
ATOM   5574  CD1 LEU B 280       1.506   2.562 -62.530  1.00  0.55           C  
ATOM   5575  CD2 LEU B 280      -0.746   3.383 -61.770  1.00  0.55           C  
ATOM   5576  N   ALA B 281       0.979   6.268 -65.534  1.00  0.63           N  
ATOM   5577  CA  ALA B 281       0.654   6.290 -66.950  1.00  0.63           C  
ATOM   5578  C   ALA B 281       1.871   6.449 -67.865  1.00  0.63           C  
ATOM   5579  O   ALA B 281       2.042   5.712 -68.839  1.00  0.63           O  
ATOM   5580  CB  ALA B 281      -0.352   7.428 -67.211  1.00  0.63           C  
ATOM   5581  N   LEU B 282       2.784   7.385 -67.533  1.00  0.63           N  
ATOM   5582  CA  LEU B 282       4.056   7.572 -68.210  1.00  0.63           C  
ATOM   5583  C   LEU B 282       4.970   6.362 -68.091  1.00  0.63           C  
ATOM   5584  O   LEU B 282       5.595   5.951 -69.066  1.00  0.63           O  
ATOM   5585  CB  LEU B 282       4.791   8.823 -67.672  1.00  0.63           C  
ATOM   5586  CG  LEU B 282       4.107  10.167 -68.003  1.00  0.63           C  
ATOM   5587  CD1 LEU B 282       4.782  11.310 -67.231  1.00  0.63           C  
ATOM   5588  CD2 LEU B 282       4.102  10.479 -69.508  1.00  0.63           C  
ATOM   5589  N   PHE B 283       5.030   5.730 -66.900  1.00  0.53           N  
ATOM   5590  CA  PHE B 283       5.759   4.498 -66.654  1.00  0.53           C  
ATOM   5591  C   PHE B 283       5.286   3.353 -67.533  1.00  0.53           C  
ATOM   5592  O   PHE B 283       6.096   2.663 -68.143  1.00  0.53           O  
ATOM   5593  CB  PHE B 283       5.589   4.101 -65.159  1.00  0.53           C  
ATOM   5594  CG  PHE B 283       6.283   2.817 -64.793  1.00  0.53           C  
ATOM   5595  CD1 PHE B 283       5.590   1.593 -64.811  1.00  0.53           C  
ATOM   5596  CD2 PHE B 283       7.641   2.827 -64.462  1.00  0.53           C  
ATOM   5597  CE1 PHE B 283       6.260   0.393 -64.539  1.00  0.53           C  
ATOM   5598  CE2 PHE B 283       8.310   1.633 -64.170  1.00  0.53           C  
ATOM   5599  CZ  PHE B 283       7.625   0.414 -64.229  1.00  0.53           C  
ATOM   5600  N   ARG B 284       3.961   3.138 -67.649  1.00  0.57           N  
ATOM   5601  CA  ARG B 284       3.411   2.090 -68.492  1.00  0.57           C  
ATOM   5602  C   ARG B 284       3.735   2.284 -69.964  1.00  0.57           C  
ATOM   5603  O   ARG B 284       4.205   1.360 -70.620  1.00  0.57           O  
ATOM   5604  CB  ARG B 284       1.881   1.985 -68.294  1.00  0.57           C  
ATOM   5605  CG  ARG B 284       1.504   1.388 -66.923  1.00  0.57           C  
ATOM   5606  CD  ARG B 284       0.009   1.493 -66.619  1.00  0.57           C  
ATOM   5607  NE  ARG B 284      -0.210   0.818 -65.298  1.00  0.57           N  
ATOM   5608  CZ  ARG B 284      -1.378   0.798 -64.644  1.00  0.57           C  
ATOM   5609  NH1 ARG B 284      -2.449   1.428 -65.116  1.00  0.57           N  
ATOM   5610  NH2 ARG B 284      -1.474   0.137 -63.492  1.00  0.57           N  
ATOM   5611  N   ARG B 285       3.578   3.520 -70.483  1.00  0.62           N  
ATOM   5612  CA  ARG B 285       3.961   3.867 -71.841  1.00  0.62           C  
ATOM   5613  C   ARG B 285       5.455   3.701 -72.108  1.00  0.62           C  
ATOM   5614  O   ARG B 285       5.878   3.160 -73.128  1.00  0.62           O  
ATOM   5615  CB  ARG B 285       3.573   5.345 -72.114  1.00  0.62           C  
ATOM   5616  CG  ARG B 285       3.964   5.840 -73.523  1.00  0.62           C  
ATOM   5617  CD  ARG B 285       3.659   7.314 -73.779  1.00  0.62           C  
ATOM   5618  NE  ARG B 285       4.253   7.604 -75.125  1.00  0.62           N  
ATOM   5619  CZ  ARG B 285       4.246   8.795 -75.733  1.00  0.62           C  
ATOM   5620  NH1 ARG B 285       3.676   9.859 -75.175  1.00  0.62           N  
ATOM   5621  NH2 ARG B 285       4.827   8.907 -76.926  1.00  0.62           N  
ATOM   5622  N   LEU B 286       6.316   4.166 -71.182  1.00  0.61           N  
ATOM   5623  CA  LEU B 286       7.751   4.010 -71.298  1.00  0.61           C  
ATOM   5624  C   LEU B 286       8.196   2.558 -71.201  1.00  0.61           C  
ATOM   5625  O   LEU B 286       9.075   2.112 -71.932  1.00  0.61           O  
ATOM   5626  CB  LEU B 286       8.482   4.896 -70.263  1.00  0.61           C  
ATOM   5627  CG  LEU B 286      10.000   5.057 -70.490  1.00  0.61           C  
ATOM   5628  CD1 LEU B 286      10.351   5.609 -71.882  1.00  0.61           C  
ATOM   5629  CD2 LEU B 286      10.590   5.981 -69.420  1.00  0.61           C  
ATOM   5630  N   ARG B 287       7.569   1.758 -70.316  1.00  0.48           N  
ATOM   5631  CA  ARG B 287       7.797   0.329 -70.214  1.00  0.48           C  
ATOM   5632  C   ARG B 287       7.405  -0.450 -71.465  1.00  0.48           C  
ATOM   5633  O   ARG B 287       8.154  -1.315 -71.917  1.00  0.48           O  
ATOM   5634  CB  ARG B 287       7.053  -0.257 -68.983  1.00  0.48           C  
ATOM   5635  CG  ARG B 287       7.465  -1.696 -68.601  1.00  0.48           C  
ATOM   5636  CD  ARG B 287       8.928  -1.769 -68.160  1.00  0.48           C  
ATOM   5637  NE  ARG B 287       9.301  -3.198 -67.924  1.00  0.48           N  
ATOM   5638  CZ  ARG B 287      10.573  -3.617 -67.975  1.00  0.48           C  
ATOM   5639  NH1 ARG B 287      11.577  -2.759 -68.142  1.00  0.48           N  
ATOM   5640  NH2 ARG B 287      10.841  -4.916 -67.859  1.00  0.48           N  
ATOM   5641  N   GLU B 288       6.241  -0.129 -72.068  1.00  0.59           N  
ATOM   5642  CA  GLU B 288       5.785  -0.670 -73.339  1.00  0.59           C  
ATOM   5643  C   GLU B 288       6.721  -0.323 -74.491  1.00  0.59           C  
ATOM   5644  O   GLU B 288       7.175  -1.184 -75.242  1.00  0.59           O  
ATOM   5645  CB  GLU B 288       4.381  -0.087 -73.619  1.00  0.59           C  
ATOM   5646  CG  GLU B 288       3.671  -0.615 -74.889  1.00  0.59           C  
ATOM   5647  CD  GLU B 288       2.322   0.071 -75.117  1.00  0.59           C  
ATOM   5648  OE1 GLU B 288       1.621  -0.358 -76.068  1.00  0.59           O  
ATOM   5649  OE2 GLU B 288       1.989   1.023 -74.363  1.00  0.59           O  
ATOM   5650  N   ALA B 289       7.124   0.960 -74.589  1.00  0.65           N  
ATOM   5651  CA  ALA B 289       8.099   1.445 -75.545  1.00  0.65           C  
ATOM   5652  C   ALA B 289       9.490   0.846 -75.373  1.00  0.65           C  
ATOM   5653  O   ALA B 289      10.231   0.657 -76.334  1.00  0.65           O  
ATOM   5654  CB  ALA B 289       8.189   2.976 -75.452  1.00  0.65           C  
ATOM   5655  N   HIS B 290       9.885   0.517 -74.128  1.00  0.49           N  
ATOM   5656  CA  HIS B 290      11.144  -0.139 -73.821  1.00  0.49           C  
ATOM   5657  C   HIS B 290      11.295  -1.515 -74.457  1.00  0.49           C  
ATOM   5658  O   HIS B 290      12.400  -1.925 -74.788  1.00  0.49           O  
ATOM   5659  CB  HIS B 290      11.392  -0.262 -72.300  1.00  0.49           C  
ATOM   5660  CG  HIS B 290      12.832  -0.541 -71.983  1.00  0.49           C  
ATOM   5661  ND1 HIS B 290      13.692   0.520 -71.749  1.00  0.49           N  
ATOM   5662  CD2 HIS B 290      13.525  -1.708 -72.028  1.00  0.49           C  
ATOM   5663  CE1 HIS B 290      14.891  -0.027 -71.661  1.00  0.49           C  
ATOM   5664  NE2 HIS B 290      14.845  -1.371 -71.824  1.00  0.49           N  
ATOM   5665  N   ALA B 291      10.190  -2.251 -74.697  1.00  0.51           N  
ATOM   5666  CA  ALA B 291      10.232  -3.565 -75.320  1.00  0.51           C  
ATOM   5667  C   ALA B 291      10.712  -3.538 -76.776  1.00  0.51           C  
ATOM   5668  O   ALA B 291      11.169  -4.537 -77.323  1.00  0.51           O  
ATOM   5669  CB  ALA B 291       8.829  -4.197 -75.246  1.00  0.51           C  
ATOM   5670  N   LEU B 292      10.701  -2.350 -77.417  1.00  0.36           N  
ATOM   5671  CA  LEU B 292      11.271  -2.135 -78.735  1.00  0.36           C  
ATOM   5672  C   LEU B 292      12.799  -2.194 -78.724  1.00  0.36           C  
ATOM   5673  O   LEU B 292      13.433  -2.336 -79.764  1.00  0.36           O  
ATOM   5674  CB  LEU B 292      10.856  -0.747 -79.283  1.00  0.36           C  
ATOM   5675  CG  LEU B 292       9.337  -0.514 -79.418  1.00  0.36           C  
ATOM   5676  CD1 LEU B 292       9.051   0.975 -79.675  1.00  0.36           C  
ATOM   5677  CD2 LEU B 292       8.730  -1.379 -80.531  1.00  0.36           C  
ATOM   5678  N   TYR B 293      13.455  -2.123 -77.540  1.00  0.34           N  
ATOM   5679  CA  TYR B 293      14.891  -2.333 -77.427  1.00  0.34           C  
ATOM   5680  C   TYR B 293      15.280  -3.799 -77.554  1.00  0.34           C  
ATOM   5681  O   TYR B 293      16.441  -4.108 -77.817  1.00  0.34           O  
ATOM   5682  CB  TYR B 293      15.467  -1.820 -76.079  1.00  0.34           C  
ATOM   5683  CG  TYR B 293      15.492  -0.317 -76.022  1.00  0.34           C  
ATOM   5684  CD1 TYR B 293      16.339   0.425 -76.863  1.00  0.34           C  
ATOM   5685  CD2 TYR B 293      14.707   0.369 -75.085  1.00  0.34           C  
ATOM   5686  CE1 TYR B 293      16.378   1.825 -76.774  1.00  0.34           C  
ATOM   5687  CE2 TYR B 293      14.717   1.768 -75.015  1.00  0.34           C  
ATOM   5688  CZ  TYR B 293      15.548   2.496 -75.871  1.00  0.34           C  
ATOM   5689  OH  TYR B 293      15.539   3.904 -75.845  1.00  0.34           O  
ATOM   5690  N   ASP B 294      14.308  -4.717 -77.395  1.00  0.36           N  
ATOM   5691  CA  ASP B 294      14.521  -6.144 -77.465  1.00  0.36           C  
ATOM   5692  C   ASP B 294      14.114  -6.685 -78.845  1.00  0.36           C  
ATOM   5693  O   ASP B 294      14.226  -7.878 -79.135  1.00  0.36           O  
ATOM   5694  CB  ASP B 294      13.690  -6.817 -76.339  1.00  0.36           C  
ATOM   5695  CG  ASP B 294      14.064  -6.242 -74.979  1.00  0.36           C  
ATOM   5696  OD1 ASP B 294      15.253  -6.365 -74.586  1.00  0.36           O  
ATOM   5697  OD2 ASP B 294      13.161  -5.674 -74.308  1.00  0.36           O  
ATOM   5698  N   GLU B 295      13.660  -5.803 -79.764  1.00  0.32           N  
ATOM   5699  CA  GLU B 295      13.261  -6.170 -81.109  1.00  0.32           C  
ATOM   5700  C   GLU B 295      14.399  -5.997 -82.104  1.00  0.32           C  
ATOM   5701  O   GLU B 295      14.838  -4.885 -82.385  1.00  0.32           O  
ATOM   5702  CB  GLU B 295      12.057  -5.335 -81.616  1.00  0.32           C  
ATOM   5703  CG  GLU B 295      10.727  -5.641 -80.882  1.00  0.32           C  
ATOM   5704  CD  GLU B 295       9.516  -4.946 -81.507  1.00  0.32           C  
ATOM   5705  OE1 GLU B 295       8.394  -5.187 -80.991  1.00  0.32           O  
ATOM   5706  OE2 GLU B 295       9.685  -4.191 -82.499  1.00  0.32           O  
ATOM   5707  N   ALA B 296      14.863  -7.126 -82.699  1.00  0.31           N  
ATOM   5708  CA  ALA B 296      15.916  -7.189 -83.707  1.00  0.31           C  
ATOM   5709  C   ALA B 296      17.306  -6.703 -83.248  1.00  0.31           C  
ATOM   5710  O   ALA B 296      17.446  -6.144 -82.161  1.00  0.31           O  
ATOM   5711  CB  ALA B 296      15.448  -6.459 -84.993  1.00  0.31           C  
ATOM   5712  N   PRO B 297      18.419  -6.896 -83.962  1.00  0.27           N  
ATOM   5713  CA  PRO B 297      19.555  -5.989 -83.822  1.00  0.27           C  
ATOM   5714  C   PRO B 297      19.190  -4.546 -84.173  1.00  0.27           C  
ATOM   5715  O   PRO B 297      18.792  -4.279 -85.304  1.00  0.27           O  
ATOM   5716  CB  PRO B 297      20.619  -6.581 -84.762  1.00  0.27           C  
ATOM   5717  CG  PRO B 297      19.803  -7.301 -85.842  1.00  0.27           C  
ATOM   5718  CD  PRO B 297      18.600  -7.845 -85.067  1.00  0.27           C  
ATOM   5719  N   LEU B 298      19.366  -3.602 -83.234  1.00  0.31           N  
ATOM   5720  CA  LEU B 298      19.137  -2.192 -83.472  1.00  0.31           C  
ATOM   5721  C   LEU B 298      20.436  -1.506 -83.825  1.00  0.31           C  
ATOM   5722  O   LEU B 298      21.522  -1.979 -83.496  1.00  0.31           O  
ATOM   5723  CB  LEU B 298      18.597  -1.493 -82.202  1.00  0.31           C  
ATOM   5724  CG  LEU B 298      17.169  -1.895 -81.800  1.00  0.31           C  
ATOM   5725  CD1 LEU B 298      16.793  -1.193 -80.490  1.00  0.31           C  
ATOM   5726  CD2 LEU B 298      16.133  -1.549 -82.879  1.00  0.31           C  
ATOM   5727  N   SER B 299      20.361  -0.337 -84.483  1.00  0.32           N  
ATOM   5728  CA  SER B 299      21.512   0.538 -84.619  1.00  0.32           C  
ATOM   5729  C   SER B 299      21.764   1.332 -83.343  1.00  0.32           C  
ATOM   5730  O   SER B 299      20.882   1.498 -82.498  1.00  0.32           O  
ATOM   5731  CB  SER B 299      21.375   1.511 -85.821  1.00  0.32           C  
ATOM   5732  OG  SER B 299      20.348   2.487 -85.624  1.00  0.32           O  
ATOM   5733  N   ASP B 300      22.981   1.876 -83.166  1.00  0.35           N  
ATOM   5734  CA  ASP B 300      23.377   2.674 -82.019  1.00  0.35           C  
ATOM   5735  C   ASP B 300      22.502   3.913 -81.816  1.00  0.35           C  
ATOM   5736  O   ASP B 300      22.226   4.331 -80.695  1.00  0.35           O  
ATOM   5737  CB  ASP B 300      24.838   3.154 -82.171  1.00  0.35           C  
ATOM   5738  CG  ASP B 300      25.852   2.041 -82.374  1.00  0.35           C  
ATOM   5739  OD1 ASP B 300      25.482   0.845 -82.406  1.00  0.35           O  
ATOM   5740  OD2 ASP B 300      27.035   2.425 -82.555  1.00  0.35           O  
ATOM   5741  N   TYR B 301      22.026   4.513 -82.926  1.00  0.29           N  
ATOM   5742  CA  TYR B 301      21.041   5.583 -82.966  1.00  0.29           C  
ATOM   5743  C   TYR B 301      19.702   5.194 -82.324  1.00  0.29           C  
ATOM   5744  O   TYR B 301      19.136   5.942 -81.528  1.00  0.29           O  
ATOM   5745  CB  TYR B 301      20.874   5.969 -84.470  1.00  0.29           C  
ATOM   5746  CG  TYR B 301      19.739   6.925 -84.762  1.00  0.29           C  
ATOM   5747  CD1 TYR B 301      18.564   6.412 -85.311  1.00  0.29           C  
ATOM   5748  CD2 TYR B 301      19.776   8.285 -84.433  1.00  0.29           C  
ATOM   5749  CE1 TYR B 301      17.450   7.219 -85.538  1.00  0.29           C  
ATOM   5750  CE2 TYR B 301      18.670   9.114 -84.649  1.00  0.29           C  
ATOM   5751  CZ  TYR B 301      17.529   8.579 -85.242  1.00  0.29           C  
ATOM   5752  OH  TYR B 301      16.519   9.435 -85.655  1.00  0.29           O  
ATOM   5753  N   GLU B 302      19.176   3.998 -82.640  1.00  0.77           N  
ATOM   5754  CA  GLU B 302      17.946   3.462 -82.080  1.00  0.77           C  
ATOM   5755  C   GLU B 302      18.114   2.991 -80.643  1.00  0.77           C  
ATOM   5756  O   GLU B 302      17.226   3.124 -79.804  1.00  0.77           O  
ATOM   5757  CB  GLU B 302      17.449   2.317 -82.986  1.00  0.77           C  
ATOM   5758  CG  GLU B 302      17.050   2.843 -84.387  1.00  0.77           C  
ATOM   5759  CD  GLU B 302      17.164   1.805 -85.496  1.00  0.77           C  
ATOM   5760  OE1 GLU B 302      16.322   1.842 -86.425  1.00  0.77           O  
ATOM   5761  OE2 GLU B 302      18.172   1.047 -85.478  1.00  0.77           O  
ATOM   5762  N   ALA B 303      19.306   2.464 -80.304  1.00  0.82           N  
ATOM   5763  CA  ALA B 303      19.610   1.908 -79.003  1.00  0.82           C  
ATOM   5764  C   ALA B 303      20.155   2.944 -78.016  1.00  0.82           C  
ATOM   5765  O   ALA B 303      20.429   2.629 -76.856  1.00  0.82           O  
ATOM   5766  CB  ALA B 303      20.661   0.797 -79.196  1.00  0.82           C  
ATOM   5767  N   GLU B 304      20.255   4.221 -78.451  1.00  0.39           N  
ATOM   5768  CA  GLU B 304      20.939   5.334 -77.804  1.00  0.39           C  
ATOM   5769  C   GLU B 304      20.518   5.594 -76.361  1.00  0.39           C  
ATOM   5770  O   GLU B 304      21.339   5.898 -75.499  1.00  0.39           O  
ATOM   5771  CB  GLU B 304      20.694   6.623 -78.650  1.00  0.39           C  
ATOM   5772  CG  GLU B 304      21.543   7.860 -78.250  1.00  0.39           C  
ATOM   5773  CD  GLU B 304      21.063   9.150 -78.899  1.00  0.39           C  
ATOM   5774  OE1 GLU B 304      20.448   9.985 -78.176  1.00  0.39           O  
ATOM   5775  OE2 GLU B 304      21.309   9.364 -80.118  1.00  0.39           O  
ATOM   5776  N   ARG B 305      19.212   5.461 -76.061  1.00  0.39           N  
ATOM   5777  CA  ARG B 305      18.646   5.825 -74.775  1.00  0.39           C  
ATOM   5778  C   ARG B 305      18.190   4.628 -73.960  1.00  0.39           C  
ATOM   5779  O   ARG B 305      17.449   4.777 -72.992  1.00  0.39           O  
ATOM   5780  CB  ARG B 305      17.466   6.813 -74.980  1.00  0.39           C  
ATOM   5781  CG  ARG B 305      17.921   8.147 -75.606  1.00  0.39           C  
ATOM   5782  CD  ARG B 305      18.833   8.961 -74.672  1.00  0.39           C  
ATOM   5783  NE  ARG B 305      19.956   9.492 -75.491  1.00  0.39           N  
ATOM   5784  CZ  ARG B 305      21.078  10.023 -75.000  1.00  0.39           C  
ATOM   5785  NH1 ARG B 305      21.407  10.010 -73.717  1.00  0.39           N  
ATOM   5786  NH2 ARG B 305      21.894  10.599 -75.881  1.00  0.39           N  
ATOM   5787  N   CYS B 306      18.639   3.398 -74.289  1.00  0.47           N  
ATOM   5788  CA  CYS B 306      18.182   2.179 -73.623  1.00  0.47           C  
ATOM   5789  C   CYS B 306      18.449   2.131 -72.123  1.00  0.47           C  
ATOM   5790  O   CYS B 306      17.583   1.789 -71.320  1.00  0.47           O  
ATOM   5791  CB  CYS B 306      18.834   0.938 -74.299  1.00  0.47           C  
ATOM   5792  SG  CYS B 306      18.170  -0.677 -73.741  1.00  0.47           S  
ATOM   5793  N   THR B 307      19.668   2.504 -71.700  1.00  0.51           N  
ATOM   5794  CA  THR B 307      20.041   2.570 -70.290  1.00  0.51           C  
ATOM   5795  C   THR B 307      19.341   3.704 -69.558  1.00  0.51           C  
ATOM   5796  O   THR B 307      18.807   3.525 -68.465  1.00  0.51           O  
ATOM   5797  CB  THR B 307      21.548   2.681 -70.116  1.00  0.51           C  
ATOM   5798  OG1 THR B 307      22.195   1.597 -70.781  1.00  0.51           O  
ATOM   5799  CG2 THR B 307      21.941   2.574 -68.640  1.00  0.51           C  
ATOM   5800  N   ASP B 308      19.277   4.896 -70.182  1.00  0.50           N  
ATOM   5801  CA  ASP B 308      18.626   6.094 -69.682  1.00  0.50           C  
ATOM   5802  C   ASP B 308      17.119   5.908 -69.480  1.00  0.50           C  
ATOM   5803  O   ASP B 308      16.524   6.393 -68.519  1.00  0.50           O  
ATOM   5804  CB  ASP B 308      18.871   7.267 -70.665  1.00  0.50           C  
ATOM   5805  CG  ASP B 308      20.343   7.571 -70.917  1.00  0.50           C  
ATOM   5806  OD1 ASP B 308      21.247   6.964 -70.286  1.00  0.50           O  
ATOM   5807  OD2 ASP B 308      20.565   8.441 -71.801  1.00  0.50           O  
ATOM   5808  N   SER B 309      16.468   5.146 -70.383  1.00  0.58           N  
ATOM   5809  CA  SER B 309      15.069   4.733 -70.307  1.00  0.58           C  
ATOM   5810  C   SER B 309      14.745   3.984 -69.027  1.00  0.58           C  
ATOM   5811  O   SER B 309      13.738   4.250 -68.374  1.00  0.58           O  
ATOM   5812  CB  SER B 309      14.713   3.830 -71.524  1.00  0.58           C  
ATOM   5813  OG  SER B 309      13.345   3.420 -71.551  1.00  0.58           O  
ATOM   5814  N   LEU B 310      15.624   3.059 -68.597  1.00  0.61           N  
ATOM   5815  CA  LEU B 310      15.504   2.363 -67.327  1.00  0.61           C  
ATOM   5816  C   LEU B 310      15.616   3.293 -66.117  1.00  0.61           C  
ATOM   5817  O   LEU B 310      14.856   3.170 -65.159  1.00  0.61           O  
ATOM   5818  CB  LEU B 310      16.555   1.235 -67.225  1.00  0.61           C  
ATOM   5819  CG  LEU B 310      16.448   0.150 -68.316  1.00  0.61           C  
ATOM   5820  CD1 LEU B 310      17.706  -0.726 -68.291  1.00  0.61           C  
ATOM   5821  CD2 LEU B 310      15.197  -0.725 -68.159  1.00  0.61           C  
ATOM   5822  N   VAL B 311      16.537   4.284 -66.150  1.00  0.59           N  
ATOM   5823  CA  VAL B 311      16.671   5.315 -65.117  1.00  0.59           C  
ATOM   5824  C   VAL B 311      15.401   6.155 -64.990  1.00  0.59           C  
ATOM   5825  O   VAL B 311      14.867   6.367 -63.903  1.00  0.59           O  
ATOM   5826  CB  VAL B 311      17.864   6.237 -65.400  1.00  0.59           C  
ATOM   5827  CG1 VAL B 311      18.017   7.311 -64.311  1.00  0.59           C  
ATOM   5828  CG2 VAL B 311      19.166   5.417 -65.456  1.00  0.59           C  
ATOM   5829  N   LEU B 312      14.834   6.595 -66.131  1.00  0.61           N  
ATOM   5830  CA  LEU B 312      13.574   7.318 -66.177  1.00  0.61           C  
ATOM   5831  C   LEU B 312      12.372   6.493 -65.717  1.00  0.61           C  
ATOM   5832  O   LEU B 312      11.532   6.980 -64.963  1.00  0.61           O  
ATOM   5833  CB  LEU B 312      13.362   7.918 -67.586  1.00  0.61           C  
ATOM   5834  CG  LEU B 312      12.153   8.868 -67.747  1.00  0.61           C  
ATOM   5835  CD1 LEU B 312      12.173  10.039 -66.752  1.00  0.61           C  
ATOM   5836  CD2 LEU B 312      12.098   9.413 -69.182  1.00  0.61           C  
ATOM   5837  N   GLN B 313      12.288   5.192 -66.091  1.00  0.64           N  
ATOM   5838  CA  GLN B 313      11.296   4.257 -65.564  1.00  0.64           C  
ATOM   5839  C   GLN B 313      11.361   4.156 -64.044  1.00  0.64           C  
ATOM   5840  O   GLN B 313      10.342   4.212 -63.362  1.00  0.64           O  
ATOM   5841  CB  GLN B 313      11.481   2.827 -66.158  1.00  0.64           C  
ATOM   5842  CG  GLN B 313      10.937   2.657 -67.595  1.00  0.64           C  
ATOM   5843  CD  GLN B 313      11.486   1.405 -68.291  1.00  0.64           C  
ATOM   5844  OE1 GLN B 313      11.204   0.246 -67.967  1.00  0.64           O  
ATOM   5845  NE2 GLN B 313      12.313   1.651 -69.329  1.00  0.64           N  
ATOM   5846  N   CYS B 314      12.567   4.066 -63.460  1.00  0.66           N  
ATOM   5847  CA  CYS B 314      12.738   4.129 -62.020  1.00  0.66           C  
ATOM   5848  C   CYS B 314      12.322   5.447 -61.359  1.00  0.66           C  
ATOM   5849  O   CYS B 314      11.678   5.421 -60.312  1.00  0.66           O  
ATOM   5850  CB  CYS B 314      14.185   3.814 -61.603  1.00  0.66           C  
ATOM   5851  SG  CYS B 314      14.704   2.110 -61.958  1.00  0.66           S  
ATOM   5852  N   GLU B 315      12.631   6.634 -61.932  1.00  0.55           N  
ATOM   5853  CA  GLU B 315      12.143   7.907 -61.399  1.00  0.55           C  
ATOM   5854  C   GLU B 315      10.627   8.030 -61.415  1.00  0.55           C  
ATOM   5855  O   GLU B 315      10.001   8.469 -60.451  1.00  0.55           O  
ATOM   5856  CB  GLU B 315      12.763   9.133 -62.104  1.00  0.55           C  
ATOM   5857  CG  GLU B 315      14.296   9.160 -61.932  1.00  0.55           C  
ATOM   5858  CD  GLU B 315      14.875  10.549 -61.835  1.00  0.55           C  
ATOM   5859  OE1 GLU B 315      16.095  10.652 -61.536  1.00  0.55           O  
ATOM   5860  OE2 GLU B 315      14.110  11.547 -61.904  1.00  0.55           O  
ATOM   5861  N   LEU B 316       9.984   7.575 -62.504  1.00  0.59           N  
ATOM   5862  CA  LEU B 316       8.539   7.470 -62.590  1.00  0.59           C  
ATOM   5863  C   LEU B 316       7.947   6.497 -61.580  1.00  0.59           C  
ATOM   5864  O   LEU B 316       6.940   6.793 -60.942  1.00  0.59           O  
ATOM   5865  CB  LEU B 316       8.126   7.056 -64.016  1.00  0.59           C  
ATOM   5866  CG  LEU B 316       8.460   8.120 -65.077  1.00  0.59           C  
ATOM   5867  CD1 LEU B 316       8.406   7.503 -66.477  1.00  0.59           C  
ATOM   5868  CD2 LEU B 316       7.520   9.329 -64.980  1.00  0.59           C  
ATOM   5869  N   ALA B 317       8.598   5.334 -61.367  1.00  0.64           N  
ATOM   5870  CA  ALA B 317       8.242   4.369 -60.347  1.00  0.64           C  
ATOM   5871  C   ALA B 317       8.300   4.919 -58.927  1.00  0.64           C  
ATOM   5872  O   ALA B 317       7.397   4.682 -58.128  1.00  0.64           O  
ATOM   5873  CB  ALA B 317       9.104   3.107 -60.496  1.00  0.64           C  
ATOM   5874  N   LEU B 318       9.313   5.746 -58.586  1.00  0.50           N  
ATOM   5875  CA  LEU B 318       9.348   6.479 -57.325  1.00  0.50           C  
ATOM   5876  C   LEU B 318       8.133   7.382 -57.130  1.00  0.50           C  
ATOM   5877  O   LEU B 318       7.572   7.456 -56.039  1.00  0.50           O  
ATOM   5878  CB  LEU B 318      10.610   7.373 -57.199  1.00  0.50           C  
ATOM   5879  CG  LEU B 318      11.955   6.633 -57.075  1.00  0.50           C  
ATOM   5880  CD1 LEU B 318      13.096   7.660 -57.002  1.00  0.50           C  
ATOM   5881  CD2 LEU B 318      11.997   5.746 -55.828  1.00  0.50           C  
ATOM   5882  N   GLY B 319       7.672   8.045 -58.213  1.00  0.55           N  
ATOM   5883  CA  GLY B 319       6.517   8.938 -58.215  1.00  0.55           C  
ATOM   5884  C   GLY B 319       5.187   8.330 -57.835  1.00  0.55           C  
ATOM   5885  O   GLY B 319       4.314   9.039 -57.345  1.00  0.55           O  
ATOM   5886  N   PHE B 320       4.985   7.011 -58.037  1.00  0.46           N  
ATOM   5887  CA  PHE B 320       3.781   6.330 -57.574  1.00  0.46           C  
ATOM   5888  C   PHE B 320       4.050   5.293 -56.489  1.00  0.46           C  
ATOM   5889  O   PHE B 320       3.144   4.576 -56.071  1.00  0.46           O  
ATOM   5890  CB  PHE B 320       2.955   5.717 -58.743  1.00  0.46           C  
ATOM   5891  CG  PHE B 320       3.664   4.653 -59.538  1.00  0.46           C  
ATOM   5892  CD1 PHE B 320       4.354   4.998 -60.708  1.00  0.46           C  
ATOM   5893  CD2 PHE B 320       3.587   3.297 -59.172  1.00  0.46           C  
ATOM   5894  CE1 PHE B 320       4.945   4.013 -61.505  1.00  0.46           C  
ATOM   5895  CE2 PHE B 320       4.195   2.308 -59.958  1.00  0.46           C  
ATOM   5896  CZ  PHE B 320       4.877   2.668 -61.126  1.00  0.46           C  
ATOM   5897  N   GLY B 321       5.292   5.199 -55.966  1.00  0.53           N  
ATOM   5898  CA  GLY B 321       5.615   4.239 -54.910  1.00  0.53           C  
ATOM   5899  C   GLY B 321       5.880   2.827 -55.380  1.00  0.53           C  
ATOM   5900  O   GLY B 321       5.825   1.883 -54.594  1.00  0.53           O  
ATOM   5901  N   GLY B 322       6.185   2.643 -56.678  1.00  0.53           N  
ATOM   5902  CA  GLY B 322       6.363   1.346 -57.324  1.00  0.53           C  
ATOM   5903  C   GLY B 322       7.651   0.647 -56.983  1.00  0.53           C  
ATOM   5904  O   GLY B 322       8.617   0.627 -57.745  1.00  0.53           O  
ATOM   5905  N   GLY B 323       7.698   0.030 -55.789  1.00  0.54           N  
ATOM   5906  CA  GLY B 323       8.879  -0.669 -55.306  1.00  0.54           C  
ATOM   5907  C   GLY B 323       9.097  -2.047 -55.874  1.00  0.54           C  
ATOM   5908  O   GLY B 323      10.198  -2.581 -55.779  1.00  0.54           O  
ATOM   5909  N   ARG B 324       8.078  -2.661 -56.508  1.00  0.46           N  
ATOM   5910  CA  ARG B 324       8.247  -3.930 -57.203  1.00  0.46           C  
ATOM   5911  C   ARG B 324       8.894  -3.696 -58.549  1.00  0.46           C  
ATOM   5912  O   ARG B 324       9.850  -4.353 -58.945  1.00  0.46           O  
ATOM   5913  CB  ARG B 324       6.884  -4.623 -57.440  1.00  0.46           C  
ATOM   5914  CG  ARG B 324       6.204  -5.101 -56.146  1.00  0.46           C  
ATOM   5915  CD  ARG B 324       4.880  -5.809 -56.431  1.00  0.46           C  
ATOM   5916  NE  ARG B 324       4.395  -6.359 -55.122  1.00  0.46           N  
ATOM   5917  CZ  ARG B 324       3.394  -7.241 -55.004  1.00  0.46           C  
ATOM   5918  NH1 ARG B 324       2.691  -7.637 -56.060  1.00  0.46           N  
ATOM   5919  NH2 ARG B 324       3.093  -7.739 -53.807  1.00  0.46           N  
ATOM   5920  N   GLU B 325       8.398  -2.666 -59.240  1.00  0.54           N  
ATOM   5921  CA  GLU B 325       8.818  -2.171 -60.520  1.00  0.54           C  
ATOM   5922  C   GLU B 325      10.279  -1.757 -60.497  1.00  0.54           C  
ATOM   5923  O   GLU B 325      11.072  -2.102 -61.367  1.00  0.54           O  
ATOM   5924  CB  GLU B 325       7.923  -0.944 -60.844  1.00  0.54           C  
ATOM   5925  CG  GLU B 325       6.400  -1.247 -60.996  1.00  0.54           C  
ATOM   5926  CD  GLU B 325       5.564  -1.4