CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 22031803154361862

Job options:

ID        	=	 22031803154361862
JOBID     	=	 
USERID    	=	 lipawt
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 lipawt
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   18-MAR-22 1MOD    1       02:58
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.96
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.93
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-03-11
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2022-03-16
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.95
REMARK   3  SIM     0.63
REMARK   3  SID     99.38
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG GPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSV
REMARK   3  ALN A TRG SQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAK
REMARK   3  ALN A TRG RIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTH
REMARK   3  ALN A TRG VILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAF
REMARK   3  ALN A TRG DWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFH
REMARK   3  ALN A TRG ESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
REMARK   3  ALN A TPL -PKPVVFLQHGLLADSSNWVTNLAQSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSV
REMARK   3  ALN A TPL SQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAK
REMARK   3  ALN A TPL RIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTH
REMARK   3  ALN A TPL VILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAF
REMARK   3  ALN A TPL DWGSSAKNYFHYQQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFH
REMARK   3  ALN A TPL ESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
REMARK   3  ALN A OFF 41
ATOM      1  N   PRO A   2     117.214  30.884  95.922  1.00  0.80           N  
ATOM      2  CA  PRO A   2     118.030  30.420  97.117  1.00  0.80           C  
ATOM      3  C   PRO A   2     118.543  31.573  97.984  1.00  0.80           C  
ATOM      4  O   PRO A   2     119.283  32.415  97.485  1.00  0.80           O  
ATOM      5  CB  PRO A   2     119.106  29.566  96.481  1.00  0.80           C  
ATOM      6  CG  PRO A   2     118.741  29.285  95.012  1.00  0.80           C  
ATOM      7  CD  PRO A   2     117.779  30.364  94.600  1.00  0.80           C  
ATOM      8  N   LYS A   3     118.162  31.583  99.284  1.00  0.82           N  
ATOM      9  CA  LYS A   3     118.631  32.476 100.338  1.00  0.82           C  
ATOM     10  C   LYS A   3     120.032  32.114 100.844  1.00  0.82           C  
ATOM     11  O   LYS A   3     120.438  30.962 100.694  1.00  0.82           O  
ATOM     12  CB  LYS A   3     117.628  32.409 101.522  1.00  0.82           C  
ATOM     13  CG  LYS A   3     116.269  33.048 101.187  1.00  0.82           C  
ATOM     14  CD  LYS A   3     115.151  32.607 102.151  1.00  0.82           C  
ATOM     15  CE  LYS A   3     113.767  33.196 101.851  1.00  0.82           C  
ATOM     16  NZ  LYS A   3     113.710  34.597 102.319  1.00  0.82           N  
ATOM     17  N   PRO A   4     120.820  33.014 101.439  1.00  0.94           N  
ATOM     18  CA  PRO A   4     122.066  32.648 102.097  1.00  0.94           C  
ATOM     19  C   PRO A   4     121.831  31.807 103.344  1.00  0.94           C  
ATOM     20  O   PRO A   4     120.903  32.078 104.101  1.00  0.94           O  
ATOM     21  CB  PRO A   4     122.735  33.999 102.451  1.00  0.94           C  
ATOM     22  CG  PRO A   4     121.852  35.095 101.831  1.00  0.94           C  
ATOM     23  CD  PRO A   4     120.496  34.421 101.642  1.00  0.94           C  
ATOM     24  N   VAL A   5     122.668  30.781 103.571  1.00  0.96           N  
ATOM     25  CA  VAL A   5     122.506  29.851 104.670  1.00  0.96           C  
ATOM     26  C   VAL A   5     123.275  30.276 105.911  1.00  0.96           C  
ATOM     27  O   VAL A   5     124.445  30.662 105.844  1.00  0.96           O  
ATOM     28  CB  VAL A   5     122.957  28.474 104.228  1.00  0.96           C  
ATOM     29  CG1 VAL A   5     122.956  27.479 105.398  1.00  0.96           C  
ATOM     30  CG2 VAL A   5     121.961  27.983 103.164  1.00  0.96           C  
ATOM     31  N   VAL A   6     122.628  30.185 107.092  1.00  0.97           N  
ATOM     32  CA  VAL A   6     123.269  30.378 108.379  1.00  0.97           C  
ATOM     33  C   VAL A   6     123.084  29.107 109.184  1.00  0.97           C  
ATOM     34  O   VAL A   6     121.975  28.599 109.320  1.00  0.97           O  
ATOM     35  CB  VAL A   6     122.679  31.541 109.172  1.00  0.97           C  
ATOM     36  CG1 VAL A   6     123.480  31.762 110.473  1.00  0.97           C  
ATOM     37  CG2 VAL A   6     122.698  32.818 108.312  1.00  0.97           C  
ATOM     38  N   PHE A   7     124.178  28.560 109.750  1.00  0.96           N  
ATOM     39  CA  PHE A   7     124.125  27.396 110.605  1.00  0.96           C  
ATOM     40  C   PHE A   7     124.360  27.837 112.046  1.00  0.96           C  
ATOM     41  O   PHE A   7     125.392  28.420 112.376  1.00  0.96           O  
ATOM     42  CB  PHE A   7     125.175  26.351 110.156  1.00  0.96           C  
ATOM     43  CG  PHE A   7     125.046  25.063 110.923  1.00  0.96           C  
ATOM     44  CD1 PHE A   7     124.096  24.101 110.556  1.00  0.96           C  
ATOM     45  CD2 PHE A   7     125.852  24.818 112.042  1.00  0.96           C  
ATOM     46  CE1 PHE A   7     124.008  22.882 111.240  1.00  0.96           C  
ATOM     47  CE2 PHE A   7     125.782  23.598 112.720  1.00  0.96           C  
ATOM     48  CZ  PHE A   7     124.874  22.620 112.306  1.00  0.96           C  
ATOM     49  N   LEU A   8     123.381  27.568 112.932  1.00  0.97           N  
ATOM     50  CA  LEU A   8     123.435  27.923 114.336  1.00  0.97           C  
ATOM     51  C   LEU A   8     123.744  26.683 115.164  1.00  0.97           C  
ATOM     52  O   LEU A   8     123.029  25.684 115.100  1.00  0.97           O  
ATOM     53  CB  LEU A   8     122.079  28.505 114.825  1.00  0.97           C  
ATOM     54  CG  LEU A   8     121.535  29.713 114.029  1.00  0.97           C  
ATOM     55  CD1 LEU A   8     120.140  30.143 114.514  1.00  0.97           C  
ATOM     56  CD2 LEU A   8     122.488  30.908 114.111  1.00  0.97           C  
ATOM     57  N   GLN A   9     124.824  26.713 115.974  1.00  0.93           N  
ATOM     58  CA  GLN A   9     125.230  25.569 116.770  1.00  0.93           C  
ATOM     59  C   GLN A   9     125.243  25.880 118.254  1.00  0.93           C  
ATOM     60  O   GLN A   9     125.983  26.736 118.744  1.00  0.93           O  
ATOM     61  CB  GLN A   9     126.641  25.099 116.365  1.00  0.93           C  
ATOM     62  CG  GLN A   9     127.137  23.831 117.104  1.00  0.93           C  
ATOM     63  CD  GLN A   9     126.191  22.651 116.892  1.00  0.93           C  
ATOM     64  OE1 GLN A   9     126.005  22.169 115.771  1.00  0.93           O  
ATOM     65  NE2 GLN A   9     125.556  22.172 117.981  1.00  0.93           N  
ATOM     66  N   HIS A  10     124.414  25.158 119.033  1.00  0.93           N  
ATOM     67  CA  HIS A  10     124.296  25.355 120.460  1.00  0.93           C  
ATOM     68  C   HIS A  10     125.501  24.877 121.259  1.00  0.93           C  
ATOM     69  O   HIS A  10     126.414  24.226 120.751  1.00  0.93           O  
ATOM     70  CB  HIS A  10     123.066  24.612 120.992  1.00  0.93           C  
ATOM     71  CG  HIS A  10     123.267  23.143 120.911  1.00  0.93           C  
ATOM     72  ND1 HIS A  10     122.897  22.497 119.768  1.00  0.93           N  
ATOM     73  CD2 HIS A  10     123.778  22.267 121.812  1.00  0.93           C  
ATOM     74  CE1 HIS A  10     123.157  21.232 120.002  1.00  0.93           C  
ATOM     75  NE2 HIS A  10     123.700  21.036 121.217  1.00  0.93           N  
ATOM     76  N   GLY A  11     125.513  25.218 122.563  1.00  0.99           N  
ATOM     77  CA  GLY A  11     126.623  24.946 123.458  1.00  0.99           C  
ATOM     78  C   GLY A  11     126.558  23.758 124.369  1.00  0.99           C  
ATOM     79  O   GLY A  11     125.979  22.717 124.086  1.00  0.99           O  
ATOM     80  N   LEU A  12     127.240  23.856 125.523  1.00  0.96           N  
ATOM     81  CA  LEU A  12     127.264  22.783 126.490  1.00  0.96           C  
ATOM     82  C   LEU A  12     125.880  22.469 127.064  1.00  0.96           C  
ATOM     83  O   LEU A  12     125.197  23.361 127.562  1.00  0.96           O  
ATOM     84  CB  LEU A  12     128.236  23.170 127.622  1.00  0.96           C  
ATOM     85  CG  LEU A  12     128.340  22.154 128.770  1.00  0.96           C  
ATOM     86  CD1 LEU A  12     129.090  20.883 128.351  1.00  0.96           C  
ATOM     87  CD2 LEU A  12     129.000  22.819 129.981  1.00  0.96           C  
ATOM     88  N   LEU A  13     125.448  21.186 126.976  1.00  0.96           N  
ATOM     89  CA  LEU A  13     124.188  20.669 127.508  1.00  0.96           C  
ATOM     90  C   LEU A  13     122.931  21.330 126.945  1.00  0.96           C  
ATOM     91  O   LEU A  13     121.888  21.375 127.591  1.00  0.96           O  
ATOM     92  CB  LEU A  13     124.172  20.677 129.060  1.00  0.96           C  
ATOM     93  CG  LEU A  13     125.011  19.572 129.727  1.00  0.96           C  
ATOM     94  CD1 LEU A  13     125.716  20.119 130.977  1.00  0.96           C  
ATOM     95  CD2 LEU A  13     124.118  18.377 130.100  1.00  0.96           C  
ATOM     96  N   ALA A  14     122.984  21.803 125.693  1.00  0.98           N  
ATOM     97  CA  ALA A  14     121.915  22.545 125.080  1.00  0.98           C  
ATOM     98  C   ALA A  14     121.480  21.879 123.796  1.00  0.98           C  
ATOM     99  O   ALA A  14     121.938  20.789 123.462  1.00  0.98           O  
ATOM    100  CB  ALA A  14     122.405  23.976 124.815  1.00  0.98           C  
ATOM    101  N   ASP A  15     120.549  22.525 123.084  1.00  0.96           N  
ATOM    102  CA  ASP A  15     119.968  22.039 121.864  1.00  0.96           C  
ATOM    103  C   ASP A  15     119.568  23.222 120.993  1.00  0.96           C  
ATOM    104  O   ASP A  15     119.812  24.390 121.313  1.00  0.96           O  
ATOM    105  CB  ASP A  15     118.755  21.106 122.167  1.00  0.96           C  
ATOM    106  CG  ASP A  15     117.580  21.805 122.839  1.00  0.96           C  
ATOM    107  OD1 ASP A  15     117.772  22.904 123.412  1.00  0.96           O  
ATOM    108  OD2 ASP A  15     116.441  21.288 122.698  1.00  0.96           O  
ATOM    109  N   SER A  16     118.912  22.921 119.854  1.00  0.96           N  
ATOM    110  CA  SER A  16     118.288  23.884 118.952  1.00  0.96           C  
ATOM    111  C   SER A  16     117.372  24.910 119.604  1.00  0.96           C  
ATOM    112  O   SER A  16     117.293  26.043 119.127  1.00  0.96           O  
ATOM    113  CB  SER A  16     117.472  23.187 117.834  1.00  0.96           C  
ATOM    114  OG  SER A  16     118.351  22.684 116.829  1.00  0.96           O  
ATOM    115  N   SER A  17     116.687  24.576 120.724  1.00  0.97           N  
ATOM    116  CA  SER A  17     115.790  25.470 121.458  1.00  0.97           C  
ATOM    117  C   SER A  17     116.398  26.815 121.789  1.00  0.97           C  
ATOM    118  O   SER A  17     115.730  27.838 121.678  1.00  0.97           O  
ATOM    119  CB  SER A  17     115.357  24.900 122.829  1.00  0.97           C  
ATOM    120  OG  SER A  17     114.517  23.754 122.676  1.00  0.97           O  
ATOM    121  N   ASN A  18     117.701  26.852 122.140  1.00  0.96           N  
ATOM    122  CA  ASN A  18     118.499  28.038 122.439  1.00  0.96           C  
ATOM    123  C   ASN A  18     118.310  29.239 121.520  1.00  0.96           C  
ATOM    124  O   ASN A  18     118.421  30.382 121.954  1.00  0.96           O  
ATOM    125  CB  ASN A  18     120.004  27.684 122.362  1.00  0.96           C  
ATOM    126  CG  ASN A  18     120.510  27.128 123.680  1.00  0.96           C  
ATOM    127  OD1 ASN A  18     119.786  26.876 124.648  1.00  0.96           O  
ATOM    128  ND2 ASN A  18     121.855  26.998 123.761  1.00  0.96           N  
ATOM    129  N   TRP A  19     118.040  29.014 120.223  1.00  0.93           N  
ATOM    130  CA  TRP A  19     117.976  30.088 119.258  1.00  0.93           C  
ATOM    131  C   TRP A  19     116.557  30.524 118.941  1.00  0.93           C  
ATOM    132  O   TRP A  19     116.372  31.418 118.116  1.00  0.93           O  
ATOM    133  CB  TRP A  19     118.664  29.661 117.944  1.00  0.93           C  
ATOM    134  CG  TRP A  19     120.035  29.045 118.163  1.00  0.93           C  
ATOM    135  CD1 TRP A  19     120.394  27.728 118.118  1.00  0.93           C  
ATOM    136  CD2 TRP A  19     121.224  29.774 118.518  1.00  0.93           C  
ATOM    137  NE1 TRP A  19     121.737  27.582 118.393  1.00  0.93           N  
ATOM    138  CE2 TRP A  19     122.264  28.833 118.638  1.00  0.93           C  
ATOM    139  CE3 TRP A  19     121.448  31.130 118.732  1.00  0.93           C  
ATOM    140  CZ2 TRP A  19     123.560  29.239 118.941  1.00  0.93           C  
ATOM    141  CZ3 TRP A  19     122.754  31.539 119.030  1.00  0.93           C  
ATOM    142  CH2 TRP A  19     123.799  30.612 119.110  1.00  0.93           C  
ATOM    143  N   VAL A  20     115.534  29.917 119.588  1.00  0.97           N  
ATOM    144  CA  VAL A  20     114.124  30.130 119.299  1.00  0.97           C  
ATOM    145  C   VAL A  20     113.296  30.164 120.591  1.00  0.97           C  
ATOM    146  O   VAL A  20     112.071  30.068 120.560  1.00  0.97           O  
ATOM    147  CB  VAL A  20     113.544  29.099 118.316  1.00  0.97           C  
ATOM    148  CG1 VAL A  20     114.054  29.399 116.888  1.00  0.97           C  
ATOM    149  CG2 VAL A  20     113.853  27.648 118.738  1.00  0.97           C  
ATOM    150  N   THR A  21     113.925  30.351 121.777  1.00  0.96           N  
ATOM    151  CA  THR A  21     113.236  30.292 123.074  1.00  0.96           C  
ATOM    152  C   THR A  21     112.779  31.609 123.678  1.00  0.96           C  
ATOM    153  O   THR A  21     112.032  31.592 124.664  1.00  0.96           O  
ATOM    154  CB  THR A  21     114.057  29.607 124.163  1.00  0.96           C  
ATOM    155  OG1 THR A  21     115.440  29.624 123.860  1.00  0.96           O  
ATOM    156  CG2 THR A  21     113.669  28.132 124.216  1.00  0.96           C  
ATOM    157  N   ASN A  22     113.161  32.770 123.105  1.00  0.93           N  
ATOM    158  CA  ASN A  22     112.613  34.078 123.451  1.00  0.93           C  
ATOM    159  C   ASN A  22     111.317  34.319 122.664  1.00  0.93           C  
ATOM    160  O   ASN A  22     110.487  33.425 122.504  1.00  0.93           O  
ATOM    161  CB  ASN A  22     113.608  35.269 123.260  1.00  0.93           C  
ATOM    162  CG  ASN A  22     114.964  34.950 123.873  1.00  0.93           C  
ATOM    163  OD1 ASN A  22     115.030  34.509 125.025  1.00  0.93           O  
ATOM    164  ND2 ASN A  22     116.070  35.189 123.136  1.00  0.93           N  
ATOM    165  N   LEU A  23     111.086  35.556 122.168  1.00  0.91           N  
ATOM    166  CA  LEU A  23     109.941  35.900 121.339  1.00  0.91           C  
ATOM    167  C   LEU A  23     110.383  35.986 119.888  1.00  0.91           C  
ATOM    168  O   LEU A  23     111.573  36.002 119.591  1.00  0.91           O  
ATOM    169  CB  LEU A  23     109.294  37.259 121.726  1.00  0.91           C  
ATOM    170  CG  LEU A  23     109.048  37.474 123.233  1.00  0.91           C  
ATOM    171  CD1 LEU A  23     108.491  38.886 123.483  1.00  0.91           C  
ATOM    172  CD2 LEU A  23     108.120  36.408 123.838  1.00  0.91           C  
ATOM    173  N   ALA A  24     109.434  36.068 118.927  1.00  0.94           N  
ATOM    174  CA  ALA A  24     109.721  36.082 117.496  1.00  0.94           C  
ATOM    175  C   ALA A  24     110.724  37.160 117.051  1.00  0.94           C  
ATOM    176  O   ALA A  24     111.665  36.898 116.309  1.00  0.94           O  
ATOM    177  CB  ALA A  24     108.394  36.191 116.714  1.00  0.94           C  
ATOM    178  N   ASN A  25     110.611  38.383 117.601  1.00  0.90           N  
ATOM    179  CA  ASN A  25     111.482  39.495 117.266  1.00  0.90           C  
ATOM    180  C   ASN A  25     112.652  39.612 118.241  1.00  0.90           C  
ATOM    181  O   ASN A  25     113.397  40.588 118.202  1.00  0.90           O  
ATOM    182  CB  ASN A  25     110.681  40.827 117.275  1.00  0.90           C  
ATOM    183  CG  ASN A  25     109.665  40.780 116.144  1.00  0.90           C  
ATOM    184  OD1 ASN A  25     109.994  40.362 115.036  1.00  0.90           O  
ATOM    185  ND2 ASN A  25     108.410  41.226 116.364  1.00  0.90           N  
ATOM    186  N   SER A  26     112.859  38.628 119.153  1.00  0.95           N  
ATOM    187  CA  SER A  26     113.967  38.668 120.103  1.00  0.95           C  
ATOM    188  C   SER A  26     114.777  37.381 120.186  1.00  0.95           C  
ATOM    189  O   SER A  26     115.666  37.263 121.027  1.00  0.95           O  
ATOM    190  CB  SER A  26     113.547  39.081 121.545  1.00  0.95           C  
ATOM    191  OG  SER A  26     112.546  38.228 122.109  1.00  0.95           O  
ATOM    192  N   SER A  27     114.555  36.393 119.297  1.00  0.95           N  
ATOM    193  CA  SER A  27     115.348  35.164 119.278  1.00  0.95           C  
ATOM    194  C   SER A  27     116.107  35.033 117.983  1.00  0.95           C  
ATOM    195  O   SER A  27     115.512  35.134 116.916  1.00  0.95           O  
ATOM    196  CB  SER A  27     114.512  33.867 119.263  1.00  0.95           C  
ATOM    197  OG  SER A  27     113.674  33.707 120.395  1.00  0.95           O  
ATOM    198  N   LEU A  28     117.428  34.749 118.023  1.00  0.95           N  
ATOM    199  CA  LEU A  28     118.304  34.866 116.860  1.00  0.95           C  
ATOM    200  C   LEU A  28     117.870  34.073 115.621  1.00  0.95           C  
ATOM    201  O   LEU A  28     117.869  34.592 114.504  1.00  0.95           O  
ATOM    202  CB  LEU A  28     119.747  34.444 117.256  1.00  0.95           C  
ATOM    203  CG  LEU A  28     120.954  35.137 116.555  1.00  0.95           C  
ATOM    204  CD1 LEU A  28     121.979  34.109 116.049  1.00  0.95           C  
ATOM    205  CD2 LEU A  28     120.621  36.131 115.430  1.00  0.95           C  
ATOM    206  N   GLY A  29     117.432  32.807 115.805  1.00  0.97           N  
ATOM    207  CA  GLY A  29     116.876  31.950 114.759  1.00  0.97           C  
ATOM    208  C   GLY A  29     115.721  32.543 113.999  1.00  0.97           C  
ATOM    209  O   GLY A  29     115.670  32.480 112.773  1.00  0.97           O  
ATOM    210  N   PHE A  30     114.767  33.159 114.719  1.00  0.92           N  
ATOM    211  CA  PHE A  30     113.654  33.862 114.113  1.00  0.92           C  
ATOM    212  C   PHE A  30     114.104  35.119 113.377  1.00  0.92           C  
ATOM    213  O   PHE A  30     113.792  35.288 112.200  1.00  0.92           O  
ATOM    214  CB  PHE A  30     112.572  34.213 115.169  1.00  0.92           C  
ATOM    215  CG  PHE A  30     111.918  33.008 115.801  1.00  0.92           C  
ATOM    216  CD1 PHE A  30     111.497  31.902 115.043  1.00  0.92           C  
ATOM    217  CD2 PHE A  30     111.641  33.011 117.179  1.00  0.92           C  
ATOM    218  CE1 PHE A  30     110.839  30.824 115.647  1.00  0.92           C  
ATOM    219  CE2 PHE A  30     111.006  31.926 117.793  1.00  0.92           C  
ATOM    220  CZ  PHE A  30     110.604  30.830 117.024  1.00  0.92           C  
ATOM    221  N   ILE A  31     114.931  35.996 114.004  1.00  0.92           N  
ATOM    222  CA  ILE A  31     115.317  37.256 113.369  1.00  0.92           C  
ATOM    223  C   ILE A  31     116.127  37.089 112.094  1.00  0.92           C  
ATOM    224  O   ILE A  31     116.000  37.862 111.146  1.00  0.92           O  
ATOM    225  CB  ILE A  31     115.946  38.333 114.270  1.00  0.92           C  
ATOM    226  CG1 ILE A  31     117.488  38.323 114.436  1.00  0.92           C  
ATOM    227  CG2 ILE A  31     115.239  38.366 115.642  1.00  0.92           C  
ATOM    228  CD1 ILE A  31     118.040  39.750 114.580  1.00  0.92           C  
ATOM    229  N   LEU A  32     116.991  36.052 112.032  1.00  0.93           N  
ATOM    230  CA  LEU A  32     117.716  35.682 110.829  1.00  0.93           C  
ATOM    231  C   LEU A  32     116.802  35.263 109.692  1.00  0.93           C  
ATOM    232  O   LEU A  32     117.011  35.649 108.541  1.00  0.93           O  
ATOM    233  CB  LEU A  32     118.728  34.543 111.102  1.00  0.93           C  
ATOM    234  CG  LEU A  32     120.023  34.995 111.801  1.00  0.93           C  
ATOM    235  CD1 LEU A  32     120.756  33.796 112.420  1.00  0.93           C  
ATOM    236  CD2 LEU A  32     120.962  35.737 110.840  1.00  0.93           C  
ATOM    237  N   ALA A  33     115.737  34.493 109.977  1.00  0.95           N  
ATOM    238  CA  ALA A  33     114.746  34.130 108.988  1.00  0.95           C  
ATOM    239  C   ALA A  33     114.020  35.339 108.384  1.00  0.95           C  
ATOM    240  O   ALA A  33     113.941  35.478 107.159  1.00  0.95           O  
ATOM    241  CB  ALA A  33     113.748  33.159 109.643  1.00  0.95           C  
ATOM    242  N   ASP A  34     113.585  36.291 109.238  1.00  0.91           N  
ATOM    243  CA  ASP A  34     112.973  37.550 108.843  1.00  0.91           C  
ATOM    244  C   ASP A  34     113.931  38.512 108.149  1.00  0.91           C  
ATOM    245  O   ASP A  34     113.538  39.366 107.355  1.00  0.91           O  
ATOM    246  CB  ASP A  34     112.344  38.223 110.087  1.00  0.91           C  
ATOM    247  CG  ASP A  34     111.000  37.581 110.403  1.00  0.91           C  
ATOM    248  OD1 ASP A  34     110.343  37.078 109.454  1.00  0.91           O  
ATOM    249  OD2 ASP A  34     110.607  37.609 111.594  1.00  0.91           O  
ATOM    250  N   ALA A  35     115.250  38.353 108.357  1.00  0.97           N  
ATOM    251  CA  ALA A  35     116.239  39.176 107.704  1.00  0.97           C  
ATOM    252  C   ALA A  35     116.681  38.610 106.361  1.00  0.97           C  
ATOM    253  O   ALA A  35     117.510  39.222 105.677  1.00  0.97           O  
ATOM    254  CB  ALA A  35     117.466  39.305 108.619  1.00  0.97           C  
ATOM    255  N   GLY A  36     116.078  37.472 105.940  1.00  0.98           N  
ATOM    256  CA  GLY A  36     116.249  36.892 104.616  1.00  0.98           C  
ATOM    257  C   GLY A  36     117.163  35.698 104.508  1.00  0.98           C  
ATOM    258  O   GLY A  36     117.554  35.342 103.397  1.00  0.98           O  
ATOM    259  N   PHE A  37     117.501  35.033 105.627  1.00  0.93           N  
ATOM    260  CA  PHE A  37     118.429  33.917 105.653  1.00  0.93           C  
ATOM    261  C   PHE A  37     117.709  32.577 105.750  1.00  0.93           C  
ATOM    262  O   PHE A  37     116.625  32.466 106.319  1.00  0.93           O  
ATOM    263  CB  PHE A  37     119.407  34.041 106.852  1.00  0.93           C  
ATOM    264  CG  PHE A  37     120.296  35.246 106.685  1.00  0.93           C  
ATOM    265  CD1 PHE A  37     121.408  35.151 105.840  1.00  0.93           C  
ATOM    266  CD2 PHE A  37     120.055  36.465 107.344  1.00  0.93           C  
ATOM    267  CE1 PHE A  37     122.248  36.250 105.629  1.00  0.93           C  
ATOM    268  CE2 PHE A  37     120.899  37.566 107.144  1.00  0.93           C  
ATOM    269  CZ  PHE A  37     121.988  37.462 106.273  1.00  0.93           C  
ATOM    270  N   ASP A  38     118.320  31.516 105.179  1.00  0.93           N  
ATOM    271  CA  ASP A  38     117.921  30.137 105.366  1.00  0.93           C  
ATOM    272  C   ASP A  38     118.600  29.662 106.656  1.00  0.93           C  
ATOM    273  O   ASP A  38     119.823  29.567 106.759  1.00  0.93           O  
ATOM    274  CB  ASP A  38     118.292  29.324 104.088  1.00  0.93           C  
ATOM    275  CG  ASP A  38     117.855  27.871 104.162  1.00  0.93           C  
ATOM    276  OD1 ASP A  38     116.858  27.604 104.873  1.00  0.93           O  
ATOM    277  OD2 ASP A  38     118.499  27.019 103.494  1.00  0.93           O  
ATOM    278  N   VAL A  39     117.793  29.449 107.715  1.00  0.96           N  
ATOM    279  CA  VAL A  39     118.288  29.180 109.051  1.00  0.96           C  
ATOM    280  C   VAL A  39     118.311  27.693 109.317  1.00  0.96           C  
ATOM    281  O   VAL A  39     117.278  27.031 109.360  1.00  0.96           O  
ATOM    282  CB  VAL A  39     117.432  29.838 110.127  1.00  0.96           C  
ATOM    283  CG1 VAL A  39     117.975  29.516 111.538  1.00  0.96           C  
ATOM    284  CG2 VAL A  39     117.442  31.359 109.900  1.00  0.96           C  
ATOM    285  N   TRP A  40     119.510  27.140 109.570  1.00  0.92           N  
ATOM    286  CA  TRP A  40     119.666  25.753 109.942  1.00  0.92           C  
ATOM    287  C   TRP A  40     120.212  25.699 111.354  1.00  0.92           C  
ATOM    288  O   TRP A  40     121.098  26.459 111.733  1.00  0.92           O  
ATOM    289  CB  TRP A  40     120.629  25.022 108.975  1.00  0.92           C  
ATOM    290  CG  TRP A  40     120.074  24.835 107.570  1.00  0.92           C  
ATOM    291  CD1 TRP A  40     119.912  25.763 106.582  1.00  0.92           C  
ATOM    292  CD2 TRP A  40     119.541  23.604 107.052  1.00  0.92           C  
ATOM    293  NE1 TRP A  40     119.348  25.188 105.469  1.00  0.92           N  
ATOM    294  CE2 TRP A  40     119.130  23.858 105.726  1.00  0.92           C  
ATOM    295  CE3 TRP A  40     119.378  22.346 107.623  1.00  0.92           C  
ATOM    296  CZ2 TRP A  40     118.586  22.850 104.941  1.00  0.92           C  
ATOM    297  CZ3 TRP A  40     118.829  21.328 106.831  1.00  0.92           C  
ATOM    298  CH2 TRP A  40     118.446  21.573 105.506  1.00  0.92           C  
ATOM    299  N   MET A  41     119.671  24.804 112.199  1.00  0.94           N  
ATOM    300  CA  MET A  41     120.080  24.684 113.583  1.00  0.94           C  
ATOM    301  C   MET A  41     120.511  23.254 113.828  1.00  0.94           C  
ATOM    302  O   MET A  41     119.770  22.310 113.552  1.00  0.94           O  
ATOM    303  CB  MET A  41     118.926  25.095 114.529  1.00  0.94           C  
ATOM    304  CG  MET A  41     118.745  26.626 114.611  1.00  0.94           C  
ATOM    305  SD  MET A  41     117.051  27.278 114.464  1.00  0.94           S  
ATOM    306  CE  MET A  41     116.446  26.544 116.001  1.00  0.94           C  
ATOM    307  N   GLY A  42     121.756  23.058 114.309  1.00  0.98           N  
ATOM    308  CA  GLY A  42     122.306  21.731 114.541  1.00  0.98           C  
ATOM    309  C   GLY A  42     121.970  21.210 115.899  1.00  0.98           C  
ATOM    310  O   GLY A  42     121.794  21.972 116.838  1.00  0.98           O  
ATOM    311  N   ASN A  43     121.929  19.874 116.048  1.00  0.94           N  
ATOM    312  CA  ASN A  43     121.771  19.246 117.339  1.00  0.94           C  
ATOM    313  C   ASN A  43     122.907  18.253 117.521  1.00  0.94           C  
ATOM    314  O   ASN A  43     122.985  17.258 116.804  1.00  0.94           O  
ATOM    315  CB  ASN A  43     120.425  18.505 117.466  1.00  0.94           C  
ATOM    316  CG  ASN A  43     119.345  19.513 117.798  1.00  0.94           C  
ATOM    317  OD1 ASN A  43     119.361  20.126 118.872  1.00  0.94           O  
ATOM    318  ND2 ASN A  43     118.348  19.700 116.915  1.00  0.94           N  
ATOM    319  N   SER A  44     123.818  18.511 118.481  1.00  0.96           N  
ATOM    320  CA  SER A  44     124.961  17.684 118.831  1.00  0.96           C  
ATOM    321  C   SER A  44     124.566  16.319 119.327  1.00  0.96           C  
ATOM    322  O   SER A  44     123.580  16.158 120.045  1.00  0.96           O  
ATOM    323  CB  SER A  44     125.792  18.314 119.976  1.00  0.96           C  
ATOM    324  OG  SER A  44     126.372  19.552 119.565  1.00  0.96           O  
ATOM    325  N   ARG A  45     125.350  15.285 118.981  1.00  0.89           N  
ATOM    326  CA  ARG A  45     125.096  13.939 119.450  1.00  0.89           C  
ATOM    327  C   ARG A  45     124.957  13.763 120.969  1.00  0.89           C  
ATOM    328  O   ARG A  45     125.691  14.329 121.779  1.00  0.89           O  
ATOM    329  CB  ARG A  45     126.181  12.991 118.898  1.00  0.89           C  
ATOM    330  CG  ARG A  45     127.595  13.334 119.412  1.00  0.89           C  
ATOM    331  CD  ARG A  45     128.669  12.312 119.067  1.00  0.89           C  
ATOM    332  NE  ARG A  45     128.849  12.363 117.603  1.00  0.89           N  
ATOM    333  CZ  ARG A  45     129.542  11.476 116.887  1.00  0.89           C  
ATOM    334  NH1 ARG A  45     130.155  10.448 117.462  1.00  0.89           N  
ATOM    335  NH2 ARG A  45     129.643  11.722 115.588  1.00  0.89           N  
ATOM    336  N   GLY A  46     123.942  12.980 121.392  1.00  0.97           N  
ATOM    337  CA  GLY A  46     123.647  12.726 122.797  1.00  0.97           C  
ATOM    338  C   GLY A  46     122.625  13.644 123.399  1.00  0.97           C  
ATOM    339  O   GLY A  46     122.111  13.363 124.478  1.00  0.97           O  
ATOM    340  N   ASN A  47     122.257  14.757 122.727  1.00  0.94           N  
ATOM    341  CA  ASN A  47     121.188  15.614 123.219  1.00  0.94           C  
ATOM    342  C   ASN A  47     119.802  14.969 123.022  1.00  0.94           C  
ATOM    343  O   ASN A  47     119.677  13.889 122.453  1.00  0.94           O  
ATOM    344  CB  ASN A  47     121.343  17.125 122.804  1.00  0.94           C  
ATOM    345  CG  ASN A  47     121.054  17.547 121.361  1.00  0.94           C  
ATOM    346  OD1 ASN A  47     121.583  18.545 120.857  1.00  0.94           O  
ATOM    347  ND2 ASN A  47     120.163  16.814 120.667  1.00  0.94           N  
ATOM    348  N   THR A  48     118.708  15.608 123.473  1.00  0.94           N  
ATOM    349  CA  THR A  48     117.312  15.173 123.302  1.00  0.94           C  
ATOM    350  C   THR A  48     116.921  14.696 121.908  1.00  0.94           C  
ATOM    351  O   THR A  48     116.299  13.646 121.748  1.00  0.94           O  
ATOM    352  CB  THR A  48     116.360  16.291 123.698  1.00  0.94           C  
ATOM    353  OG1 THR A  48     116.697  16.733 125.002  1.00  0.94           O  
ATOM    354  CG2 THR A  48     114.902  15.821 123.773  1.00  0.94           C  
ATOM    355  N   TRP A  49     117.312  15.432 120.849  1.00  0.89           N  
ATOM    356  CA  TRP A  49     116.897  15.152 119.485  1.00  0.89           C  
ATOM    357  C   TRP A  49     117.897  14.336 118.651  1.00  0.89           C  
ATOM    358  O   TRP A  49     117.557  13.842 117.578  1.00  0.89           O  
ATOM    359  CB  TRP A  49     116.636  16.511 118.774  1.00  0.89           C  
ATOM    360  CG  TRP A  49     115.938  17.556 119.649  1.00  0.89           C  
ATOM    361  CD1 TRP A  49     116.445  18.730 120.131  1.00  0.89           C  
ATOM    362  CD2 TRP A  49     114.653  17.392 120.275  1.00  0.89           C  
ATOM    363  NE1 TRP A  49     115.573  19.299 121.025  1.00  0.89           N  
ATOM    364  CE2 TRP A  49     114.453  18.518 121.107  1.00  0.89           C  
ATOM    365  CE3 TRP A  49     113.707  16.376 120.214  1.00  0.89           C  
ATOM    366  CZ2 TRP A  49     113.294  18.658 121.854  1.00  0.89           C  
ATOM    367  CZ3 TRP A  49     112.547  16.506 120.988  1.00  0.89           C  
ATOM    368  CH2 TRP A  49     112.337  17.635 121.790  1.00  0.89           C  
ATOM    369  N   SER A  50     119.134  14.111 119.148  1.00  0.93           N  
ATOM    370  CA  SER A  50     120.214  13.460 118.401  1.00  0.93           C  
ATOM    371  C   SER A  50     120.779  12.359 119.256  1.00  0.93           C  
ATOM    372  O   SER A  50     121.988  12.229 119.440  1.00  0.93           O  
ATOM    373  CB  SER A  50     121.413  14.369 118.018  1.00  0.93           C  
ATOM    374  OG  SER A  50     121.018  15.387 117.106  1.00  0.93           O  
ATOM    375  N   ARG A  51     119.887  11.525 119.822  1.00  0.84           N  
ATOM    376  CA  ARG A  51     120.266  10.382 120.628  1.00  0.84           C  
ATOM    377  C   ARG A  51     119.854   9.060 119.987  1.00  0.84           C  
ATOM    378  O   ARG A  51     119.394   8.135 120.652  1.00  0.84           O  
ATOM    379  CB  ARG A  51     119.826  10.480 122.112  1.00  0.84           C  
ATOM    380  CG  ARG A  51     118.316  10.611 122.401  1.00  0.84           C  
ATOM    381  CD  ARG A  51     117.986  10.511 123.895  1.00  0.84           C  
ATOM    382  NE  ARG A  51     118.702  11.645 124.557  1.00  0.84           N  
ATOM    383  CZ  ARG A  51     119.181  11.638 125.802  1.00  0.84           C  
ATOM    384  NH1 ARG A  51     119.169  10.559 126.579  1.00  0.84           N  
ATOM    385  NH2 ARG A  51     119.698  12.760 126.300  1.00  0.84           N  
ATOM    386  N   LYS A  52     120.016   8.935 118.655  1.00  0.82           N  
ATOM    387  CA  LYS A  52     119.765   7.706 117.929  1.00  0.82           C  
ATOM    388  C   LYS A  52     120.993   7.349 117.124  1.00  0.82           C  
ATOM    389  O   LYS A  52     121.770   8.218 116.743  1.00  0.82           O  
ATOM    390  CB  LYS A  52     118.542   7.846 116.991  1.00  0.82           C  
ATOM    391  CG  LYS A  52     117.238   7.685 117.782  1.00  0.82           C  
ATOM    392  CD  LYS A  52     115.977   7.721 116.906  1.00  0.82           C  
ATOM    393  CE  LYS A  52     114.731   7.262 117.671  1.00  0.82           C  
ATOM    394  NZ  LYS A  52     113.602   7.042 116.738  1.00  0.82           N  
ATOM    395  N   HIS A  53     121.210   6.047 116.856  1.00  0.83           N  
ATOM    396  CA  HIS A  53     122.350   5.587 116.099  1.00  0.83           C  
ATOM    397  C   HIS A  53     121.832   4.563 115.117  1.00  0.83           C  
ATOM    398  O   HIS A  53     120.731   4.045 115.275  1.00  0.83           O  
ATOM    399  CB  HIS A  53     123.412   4.942 117.018  1.00  0.83           C  
ATOM    400  CG  HIS A  53     124.779   4.778 116.441  1.00  0.83           C  
ATOM    401  ND1 HIS A  53     125.147   3.620 115.784  1.00  0.83           N  
ATOM    402  CD2 HIS A  53     125.836   5.625 116.537  1.00  0.83           C  
ATOM    403  CE1 HIS A  53     126.427   3.784 115.499  1.00  0.83           C  
ATOM    404  NE2 HIS A  53     126.888   4.980 115.931  1.00  0.83           N  
ATOM    405  N   LYS A  54     122.617   4.277 114.063  1.00  0.77           N  
ATOM    406  CA  LYS A  54     122.340   3.253 113.071  1.00  0.77           C  
ATOM    407  C   LYS A  54     122.357   1.838 113.622  1.00  0.77           C  
ATOM    408  O   LYS A  54     121.584   0.987 113.189  1.00  0.77           O  
ATOM    409  CB  LYS A  54     123.360   3.371 111.903  1.00  0.77           C  
ATOM    410  CG  LYS A  54     122.694   3.791 110.584  1.00  0.77           C  
ATOM    411  CD  LYS A  54     123.678   3.933 109.405  1.00  0.77           C  
ATOM    412  CE  LYS A  54     124.303   5.328 109.279  1.00  0.77           C  
ATOM    413  NZ  LYS A  54     125.069   5.445 108.014  1.00  0.77           N  
ATOM    414  N   THR A  55     123.280   1.572 114.563  1.00  0.85           N  
ATOM    415  CA  THR A  55     123.540   0.235 115.082  1.00  0.85           C  
ATOM    416  C   THR A  55     123.451   0.223 116.590  1.00  0.85           C  
ATOM    417  O   THR A  55     122.895  -0.698 117.184  1.00  0.85           O  
ATOM    418  CB  THR A  55     124.946  -0.226 114.685  1.00  0.85           C  
ATOM    419  OG1 THR A  55     124.997  -0.589 113.314  1.00  0.85           O  
ATOM    420  CG2 THR A  55     125.464  -1.446 115.463  1.00  0.85           C  
ATOM    421  N   LEU A  56     124.002   1.244 117.281  1.00  0.86           N  
ATOM    422  CA  LEU A  56     124.071   1.226 118.729  1.00  0.86           C  
ATOM    423  C   LEU A  56     122.777   1.655 119.396  1.00  0.86           C  
ATOM    424  O   LEU A  56     122.048   2.524 118.928  1.00  0.86           O  
ATOM    425  CB  LEU A  56     125.210   2.121 119.273  1.00  0.86           C  
ATOM    426  CG  LEU A  56     126.615   1.759 118.751  1.00  0.86           C  
ATOM    427  CD1 LEU A  56     127.600   2.895 119.060  1.00  0.86           C  
ATOM    428  CD2 LEU A  56     127.131   0.429 119.326  1.00  0.86           C  
ATOM    429  N   SER A  57     122.482   1.063 120.562  1.00  0.88           N  
ATOM    430  CA  SER A  57     121.399   1.521 121.408  1.00  0.88           C  
ATOM    431  C   SER A  57     121.906   2.506 122.432  1.00  0.88           C  
ATOM    432  O   SER A  57     123.057   2.473 122.856  1.00  0.88           O  
ATOM    433  CB  SER A  57     120.697   0.352 122.141  1.00  0.88           C  
ATOM    434  OG  SER A  57     119.557   0.782 122.895  1.00  0.88           O  
ATOM    435  N   VAL A  58     120.994   3.377 122.907  1.00  0.90           N  
ATOM    436  CA  VAL A  58     121.225   4.407 123.901  1.00  0.90           C  
ATOM    437  C   VAL A  58     121.507   3.802 125.276  1.00  0.90           C  
ATOM    438  O   VAL A  58     121.983   4.454 126.203  1.00  0.90           O  
ATOM    439  CB  VAL A  58     120.028   5.370 123.900  1.00  0.90           C  
ATOM    440  CG1 VAL A  58     118.989   5.091 125.012  1.00  0.90           C  
ATOM    441  CG2 VAL A  58     120.542   6.819 123.930  1.00  0.90           C  
ATOM    442  N   SER A  59     121.230   2.488 125.424  1.00  0.89           N  
ATOM    443  CA  SER A  59     121.494   1.701 126.610  1.00  0.89           C  
ATOM    444  C   SER A  59     122.913   1.153 126.693  1.00  0.89           C  
ATOM    445  O   SER A  59     123.319   0.710 127.769  1.00  0.89           O  
ATOM    446  CB  SER A  59     120.494   0.513 126.727  1.00  0.89           C  
ATOM    447  OG  SER A  59     120.534  -0.352 125.587  1.00  0.89           O  
ATOM    448  N   GLN A  60     123.696   1.196 125.591  1.00  0.86           N  
ATOM    449  CA  GLN A  60     125.057   0.692 125.515  1.00  0.86           C  
ATOM    450  C   GLN A  60     126.068   1.796 125.776  1.00  0.86           C  
ATOM    451  O   GLN A  60     125.934   2.913 125.294  1.00  0.86           O  
ATOM    452  CB  GLN A  60     125.365   0.155 124.091  1.00  0.86           C  
ATOM    453  CG  GLN A  60     124.577  -1.117 123.721  1.00  0.86           C  
ATOM    454  CD  GLN A  60     124.814  -1.504 122.264  1.00  0.86           C  
ATOM    455  OE1 GLN A  60     124.131  -1.003 121.368  1.00  0.86           O  
ATOM    456  NE2 GLN A  60     125.782  -2.403 121.988  1.00  0.86           N  
ATOM    457  N   ASP A  61     127.141   1.501 126.524  1.00  0.88           N  
ATOM    458  CA  ASP A  61     128.204   2.415 126.894  1.00  0.88           C  
ATOM    459  C   ASP A  61     128.929   3.022 125.704  1.00  0.88           C  
ATOM    460  O   ASP A  61     129.177   4.226 125.653  1.00  0.88           O  
ATOM    461  CB  ASP A  61     129.179   1.670 127.838  1.00  0.88           C  
ATOM    462  CG  ASP A  61     128.445   1.150 129.077  1.00  0.88           C  
ATOM    463  OD1 ASP A  61     127.324   0.583 128.938  1.00  0.88           O  
ATOM    464  OD2 ASP A  61     128.987   1.310 130.189  1.00  0.88           O  
ATOM    465  N   GLU A  62     129.184   2.197 124.672  1.00  0.84           N  
ATOM    466  CA  GLU A  62     129.781   2.563 123.396  1.00  0.84           C  
ATOM    467  C   GLU A  62     129.037   3.685 122.671  1.00  0.84           C  
ATOM    468  O   GLU A  62     129.637   4.546 122.035  1.00  0.84           O  
ATOM    469  CB  GLU A  62     129.919   1.284 122.527  1.00  0.84           C  
ATOM    470  CG  GLU A  62     130.544   1.462 121.120  1.00  0.84           C  
ATOM    471  CD  GLU A  62     131.947   2.059 121.178  1.00  0.84           C  
ATOM    472  OE1 GLU A  62     132.819   1.425 121.826  1.00  0.84           O  
ATOM    473  OE2 GLU A  62     132.154   3.131 120.557  1.00  0.84           O  
ATOM    474  N   PHE A  63     127.694   3.790 122.817  1.00  0.89           N  
ATOM    475  CA  PHE A  63     126.927   4.911 122.295  1.00  0.89           C  
ATOM    476  C   PHE A  63     127.400   6.245 122.860  1.00  0.89           C  
ATOM    477  O   PHE A  63     127.436   7.251 122.155  1.00  0.89           O  
ATOM    478  CB  PHE A  63     125.413   4.692 122.593  1.00  0.89           C  
ATOM    479  CG  PHE A  63     124.527   5.800 122.082  1.00  0.89           C  
ATOM    480  CD1 PHE A  63     124.382   6.981 122.830  1.00  0.89           C  
ATOM    481  CD2 PHE A  63     123.868   5.698 120.850  1.00  0.89           C  
ATOM    482  CE1 PHE A  63     123.704   8.083 122.307  1.00  0.89           C  
ATOM    483  CE2 PHE A  63     123.153   6.787 120.339  1.00  0.89           C  
ATOM    484  CZ  PHE A  63     123.118   7.992 121.043  1.00  0.89           C  
ATOM    485  N   TRP A  64     127.777   6.276 124.149  1.00  0.90           N  
ATOM    486  CA  TRP A  64     128.097   7.488 124.857  1.00  0.90           C  
ATOM    487  C   TRP A  64     129.591   7.749 124.902  1.00  0.90           C  
ATOM    488  O   TRP A  64     130.032   8.724 125.514  1.00  0.90           O  
ATOM    489  CB  TRP A  64     127.564   7.411 126.299  1.00  0.90           C  
ATOM    490  CG  TRP A  64     126.061   7.225 126.381  1.00  0.90           C  
ATOM    491  CD1 TRP A  64     125.349   6.073 126.545  1.00  0.90           C  
ATOM    492  CD2 TRP A  64     125.096   8.282 126.250  1.00  0.90           C  
ATOM    493  NE1 TRP A  64     123.999   6.345 126.572  1.00  0.90           N  
ATOM    494  CE2 TRP A  64     123.824   7.699 126.403  1.00  0.90           C  
ATOM    495  CE3 TRP A  64     125.238   9.644 126.011  1.00  0.90           C  
ATOM    496  CZ2 TRP A  64     122.674   8.476 126.349  1.00  0.90           C  
ATOM    497  CZ3 TRP A  64     124.078  10.418 125.902  1.00  0.90           C  
ATOM    498  CH2 TRP A  64     122.813   9.845 126.073  1.00  0.90           C  
ATOM    499  N   ALA A  65     130.412   6.919 124.224  1.00  0.93           N  
ATOM    500  CA  ALA A  65     131.851   7.055 124.170  1.00  0.93           C  
ATOM    501  C   ALA A  65     132.292   8.155 123.200  1.00  0.93           C  
ATOM    502  O   ALA A  65     133.056   7.944 122.261  1.00  0.93           O  
ATOM    503  CB  ALA A  65     132.469   5.681 123.829  1.00  0.93           C  
ATOM    504  N   PHE A  66     131.814   9.393 123.430  1.00  0.94           N  
ATOM    505  CA  PHE A  66     132.125  10.535 122.600  1.00  0.94           C  
ATOM    506  C   PHE A  66     132.309  11.775 123.443  1.00  0.94           C  
ATOM    507  O   PHE A  66     131.821  11.868 124.567  1.00  0.94           O  
ATOM    508  CB  PHE A  66     131.034  10.796 121.514  1.00  0.94           C  
ATOM    509  CG  PHE A  66     129.675  11.133 122.092  1.00  0.94           C  
ATOM    510  CD1 PHE A  66     129.362  12.433 122.533  1.00  0.94           C  
ATOM    511  CD2 PHE A  66     128.698  10.137 122.205  1.00  0.94           C  
ATOM    512  CE1 PHE A  66     128.133  12.704 123.145  1.00  0.94           C  
ATOM    513  CE2 PHE A  66     127.451  10.415 122.777  1.00  0.94           C  
ATOM    514  CZ  PHE A  66     127.185  11.688 123.280  1.00  0.94           C  
ATOM    515  N   SER A  67     132.981  12.784 122.879  1.00  0.97           N  
ATOM    516  CA  SER A  67     133.071  14.110 123.451  1.00  0.97           C  
ATOM    517  C   SER A  67     132.850  15.176 122.382  1.00  0.97           C  
ATOM    518  O   SER A  67     132.220  14.933 121.353  1.00  0.97           O  
ATOM    519  CB  SER A  67     134.402  14.297 124.223  1.00  0.97           C  
ATOM    520  OG  SER A  67     135.535  14.272 123.355  1.00  0.97           O  
ATOM    521  N   TYR A  68     133.328  16.424 122.601  1.00  0.96           N  
ATOM    522  CA  TYR A  68     133.293  17.474 121.596  1.00  0.96           C  
ATOM    523  C   TYR A  68     134.280  17.249 120.450  1.00  0.96           C  
ATOM    524  O   TYR A  68     134.120  17.844 119.382  1.00  0.96           O  
ATOM    525  CB  TYR A  68     133.373  18.916 122.186  1.00  0.96           C  
ATOM    526  CG  TYR A  68     134.544  19.148 123.105  1.00  0.96           C  
ATOM    527  CD1 TYR A  68     135.811  19.495 122.606  1.00  0.96           C  
ATOM    528  CD2 TYR A  68     134.364  19.097 124.495  1.00  0.96           C  
ATOM    529  CE1 TYR A  68     136.857  19.832 123.481  1.00  0.96           C  
ATOM    530  CE2 TYR A  68     135.412  19.412 125.368  1.00  0.96           C  
ATOM    531  CZ  TYR A  68     136.649  19.811 124.862  1.00  0.96           C  
ATOM    532  OH  TYR A  68     137.667  20.212 125.748  1.00  0.96           O  
ATOM    533  N   ASP A  69     135.261  16.327 120.610  1.00  0.95           N  
ATOM    534  CA  ASP A  69     136.121  15.843 119.543  1.00  0.95           C  
ATOM    535  C   ASP A  69     135.325  15.270 118.385  1.00  0.95           C  
ATOM    536  O   ASP A  69     135.452  15.699 117.235  1.00  0.95           O  
ATOM    537  CB  ASP A  69     137.030  14.716 120.105  1.00  0.95           C  
ATOM    538  CG  ASP A  69     138.154  15.287 120.934  1.00  0.95           C  
ATOM    539  OD1 ASP A  69     138.379  16.526 120.892  1.00  0.95           O  
ATOM    540  OD2 ASP A  69     138.855  14.500 121.612  1.00  0.95           O  
ATOM    541  N   GLU A  70     134.410  14.327 118.666  1.00  0.92           N  
ATOM    542  CA  GLU A  70     133.574  13.717 117.655  1.00  0.92           C  
ATOM    543  C   GLU A  70     132.511  14.635 117.089  1.00  0.92           C  
ATOM    544  O   GLU A  70     132.109  14.491 115.933  1.00  0.92           O  
ATOM    545  CB  GLU A  70     132.871  12.453 118.188  1.00  0.92           C  
ATOM    546  CG  GLU A  70     133.819  11.258 118.444  1.00  0.92           C  
ATOM    547  CD  GLU A  70     134.651  11.444 119.708  1.00  0.92           C  
ATOM    548  OE1 GLU A  70     134.192  12.208 120.594  1.00  0.92           O  
ATOM    549  OE2 GLU A  70     135.745  10.844 119.778  1.00  0.92           O  
ATOM    550  N   MET A  71     132.034  15.616 117.878  1.00  0.93           N  
ATOM    551  CA  MET A  71     131.135  16.647 117.397  1.00  0.93           C  
ATOM    552  C   MET A  71     131.789  17.542 116.350  1.00  0.93           C  
ATOM    553  O   MET A  71     131.224  17.821 115.294  1.00  0.93           O  
ATOM    554  CB  MET A  71     130.621  17.516 118.568  1.00  0.93           C  
ATOM    555  CG  MET A  71     129.835  16.746 119.651  1.00  0.93           C  
ATOM    556  SD  MET A  71     129.401  17.764 121.099  1.00  0.93           S  
ATOM    557  CE  MET A  71     129.037  16.388 122.227  1.00  0.93           C  
ATOM    558  N   ALA A  72     133.038  17.977 116.590  1.00  0.97           N  
ATOM    559  CA  ALA A  72     133.822  18.680 115.602  1.00  0.97           C  
ATOM    560  C   ALA A  72     134.220  17.846 114.393  1.00  0.97           C  
ATOM    561  O   ALA A  72     134.123  18.287 113.250  1.00  0.97           O  
ATOM    562  CB  ALA A  72     135.064  19.234 116.310  1.00  0.97           C  
ATOM    563  N   LYS A  73     134.675  16.605 114.623  1.00  0.89           N  
ATOM    564  CA  LYS A  73     135.175  15.735 113.582  1.00  0.89           C  
ATOM    565  C   LYS A  73     134.136  15.092 112.665  1.00  0.89           C  
ATOM    566  O   LYS A  73     134.409  14.842 111.491  1.00  0.89           O  
ATOM    567  CB  LYS A  73     136.038  14.652 114.243  1.00  0.89           C  
ATOM    568  CG  LYS A  73     137.066  14.012 113.304  1.00  0.89           C  
ATOM    569  CD  LYS A  73     137.966  13.057 114.097  1.00  0.89           C  
ATOM    570  CE  LYS A  73     138.866  12.180 113.231  1.00  0.89           C  
ATOM    571  NZ  LYS A  73     139.706  11.338 114.112  1.00  0.89           N  
ATOM    572  N   TYR A  74     132.927  14.783 113.185  1.00  0.94           N  
ATOM    573  CA  TYR A  74     131.903  14.076 112.438  1.00  0.94           C  
ATOM    574  C   TYR A  74     130.548  14.776 112.423  1.00  0.94           C  
ATOM    575  O   TYR A  74     129.916  14.812 111.367  1.00  0.94           O  
ATOM    576  CB  TYR A  74     131.686  12.669 113.044  1.00  0.94           C  
ATOM    577  CG  TYR A  74     132.917  11.813 112.942  1.00  0.94           C  
ATOM    578  CD1 TYR A  74     133.457  11.462 111.694  1.00  0.94           C  
ATOM    579  CD2 TYR A  74     133.542  11.340 114.105  1.00  0.94           C  
ATOM    580  CE1 TYR A  74     134.626  10.687 111.614  1.00  0.94           C  
ATOM    581  CE2 TYR A  74     134.694  10.549 114.028  1.00  0.94           C  
ATOM    582  CZ  TYR A  74     135.254  10.250 112.785  1.00  0.94           C  
ATOM    583  OH  TYR A  74     136.460   9.519 112.754  1.00  0.94           O  
ATOM    584  N   ASP A  75     130.058  15.379 113.540  1.00  0.94           N  
ATOM    585  CA  ASP A  75     128.756  16.044 113.527  1.00  0.94           C  
ATOM    586  C   ASP A  75     128.765  17.274 112.611  1.00  0.94           C  
ATOM    587  O   ASP A  75     127.929  17.395 111.713  1.00  0.94           O  
ATOM    588  CB  ASP A  75     128.220  16.436 114.947  1.00  0.94           C  
ATOM    589  CG  ASP A  75     128.002  15.271 115.906  1.00  0.94           C  
ATOM    590  OD1 ASP A  75     128.438  14.125 115.616  1.00  0.94           O  
ATOM    591  OD2 ASP A  75     127.419  15.518 116.996  1.00  0.94           O  
ATOM    592  N   LEU A  76     129.754  18.189 112.739  1.00  0.94           N  
ATOM    593  CA  LEU A  76     129.846  19.337 111.837  1.00  0.94           C  
ATOM    594  C   LEU A  76     130.064  19.061 110.349  1.00  0.94           C  
ATOM    595  O   LEU A  76     129.330  19.660 109.558  1.00  0.94           O  
ATOM    596  CB  LEU A  76     130.873  20.416 112.267  1.00  0.94           C  
ATOM    597  CG  LEU A  76     130.382  21.488 113.253  1.00  0.94           C  
ATOM    598  CD1 LEU A  76     131.415  22.627 113.263  1.00  0.94           C  
ATOM    599  CD2 LEU A  76     128.995  22.077 112.961  1.00  0.94           C  
ATOM    600  N   PRO A  77     130.966  18.211 109.862  1.00  0.93           N  
ATOM    601  CA  PRO A  77     131.106  17.962 108.436  1.00  0.93           C  
ATOM    602  C   PRO A  77     129.872  17.320 107.860  1.00  0.93           C  
ATOM    603  O   PRO A  77     129.451  17.712 106.777  1.00  0.93           O  
ATOM    604  CB  PRO A  77     132.326  17.037 108.319  1.00  0.93           C  
ATOM    605  CG  PRO A  77     133.150  17.360 109.563  1.00  0.93           C  
ATOM    606  CD  PRO A  77     132.089  17.665 110.615  1.00  0.93           C  
ATOM    607  N   ALA A  78     129.256  16.351 108.563  1.00  0.94           N  
ATOM    608  CA  ALA A  78     128.032  15.726 108.121  1.00  0.94           C  
ATOM    609  C   ALA A  78     126.864  16.703 108.040  1.00  0.94           C  
ATOM    610  O   ALA A  78     126.172  16.769 107.024  1.00  0.94           O  
ATOM    611  CB  ALA A  78     127.698  14.573 109.083  1.00  0.94           C  
ATOM    612  N   SER A  79     126.656  17.537 109.080  1.00  0.94           N  
ATOM    613  CA  SER A  79     125.606  18.550 109.069  1.00  0.94           C  
ATOM    614  C   SER A  79     125.772  19.621 108.007  1.00  0.94           C  
ATOM    615  O   SER A  79     124.833  19.928 107.279  1.00  0.94           O  
ATOM    616  CB  SER A  79     125.478  19.293 110.421  1.00  0.94           C  
ATOM    617  OG  SER A  79     124.966  18.435 111.443  1.00  0.94           O  
ATOM    618  N   ILE A  80     126.974  20.215 107.858  1.00  0.93           N  
ATOM    619  CA  ILE A  80     127.226  21.235 106.846  1.00  0.93           C  
ATOM    620  C   ILE A  80     127.180  20.684 105.429  1.00  0.93           C  
ATOM    621  O   ILE A  80     126.548  21.267 104.549  1.00  0.93           O  
ATOM    622  CB  ILE A  80     128.532  21.966 107.145  1.00  0.93           C  
ATOM    623  CG1 ILE A  80     128.340  22.893 108.372  1.00  0.93           C  
ATOM    624  CG2 ILE A  80     129.050  22.783 105.938  1.00  0.93           C  
ATOM    625  CD1 ILE A  80     129.613  23.074 109.209  1.00  0.93           C  
ATOM    626  N   ASN A  81     127.796  19.510 105.168  1.00  0.88           N  
ATOM    627  CA  ASN A  81     127.759  18.884 103.855  1.00  0.88           C  
ATOM    628  C   ASN A  81     126.362  18.444 103.431  1.00  0.88           C  
ATOM    629  O   ASN A  81     126.025  18.528 102.249  1.00  0.88           O  
ATOM    630  CB  ASN A  81     128.748  17.701 103.728  1.00  0.88           C  
ATOM    631  CG  ASN A  81     130.190  18.179 103.879  1.00  0.88           C  
ATOM    632  OD1 ASN A  81     130.550  19.327 103.591  1.00  0.88           O  
ATOM    633  ND2 ASN A  81     131.081  17.262 104.317  1.00  0.88           N  
ATOM    634  N   PHE A  82     125.493  18.008 104.377  1.00  0.89           N  
ATOM    635  CA  PHE A  82     124.082  17.776 104.099  1.00  0.89           C  
ATOM    636  C   PHE A  82     123.395  19.035 103.591  1.00  0.89           C  
ATOM    637  O   PHE A  82     122.721  19.020 102.562  1.00  0.89           O  
ATOM    638  CB  PHE A  82     123.360  17.269 105.387  1.00  0.89           C  
ATOM    639  CG  PHE A  82     121.889  16.986 105.174  1.00  0.89           C  
ATOM    640  CD1 PHE A  82     121.463  15.735 104.706  1.00  0.89           C  
ATOM    641  CD2 PHE A  82     120.926  17.990 105.388  1.00  0.89           C  
ATOM    642  CE1 PHE A  82     120.110  15.498 104.429  1.00  0.89           C  
ATOM    643  CE2 PHE A  82     119.575  17.759 105.103  1.00  0.89           C  
ATOM    644  CZ  PHE A  82     119.166  16.512 104.620  1.00  0.89           C  
ATOM    645  N   ILE A  83     123.590  20.174 104.274  1.00  0.90           N  
ATOM    646  CA  ILE A  83     122.942  21.423 103.923  1.00  0.90           C  
ATOM    647  C   ILE A  83     123.336  21.937 102.557  1.00  0.90           C  
ATOM    648  O   ILE A  83     122.485  22.284 101.744  1.00  0.90           O  
ATOM    649  CB  ILE A  83     123.266  22.460 104.976  1.00  0.90           C  
ATOM    650  CG1 ILE A  83     122.623  22.051 106.313  1.00  0.90           C  
ATOM    651  CG2 ILE A  83     122.749  23.855 104.573  1.00  0.90           C  
ATOM    652  CD1 ILE A  83     123.193  22.807 107.513  1.00  0.90           C  
ATOM    653  N   LEU A  84     124.642  21.934 102.243  1.00  0.90           N  
ATOM    654  CA  LEU A  84     125.169  22.366 100.964  1.00  0.90           C  
ATOM    655  C   LEU A  84     124.677  21.510  99.812  1.00  0.90           C  
ATOM    656  O   LEU A  84     124.332  22.009  98.744  1.00  0.90           O  
ATOM    657  CB  LEU A  84     126.707  22.363 101.009  1.00  0.90           C  
ATOM    658  CG  LEU A  84     127.312  23.292 102.080  1.00  0.90           C  
ATOM    659  CD1 LEU A  84     128.781  22.930 102.276  1.00  0.90           C  
ATOM    660  CD2 LEU A  84     127.194  24.775 101.712  1.00  0.90           C  
ATOM    661  N   ASN A  85     124.575  20.183 100.018  1.00  0.84           N  
ATOM    662  CA  ASN A  85     123.937  19.291  99.075  1.00  0.84           C  
ATOM    663  C   ASN A  85     122.450  19.606  98.866  1.00  0.84           C  
ATOM    664  O   ASN A  85     121.961  19.636  97.740  1.00  0.84           O  
ATOM    665  CB  ASN A  85     124.145  17.847  99.598  1.00  0.84           C  
ATOM    666  CG  ASN A  85     123.557  16.786  98.684  1.00  0.84           C  
ATOM    667  OD1 ASN A  85     122.635  16.063  99.072  1.00  0.84           O  
ATOM    668  ND2 ASN A  85     124.068  16.676  97.442  1.00  0.84           N  
ATOM    669  N   LYS A  86     121.706  19.860  99.956  1.00  0.82           N  
ATOM    670  CA  LYS A  86     120.290  20.168  99.920  1.00  0.82           C  
ATOM    671  C   LYS A  86     119.908  21.496  99.283  1.00  0.82           C  
ATOM    672  O   LYS A  86     118.883  21.596  98.603  1.00  0.82           O  
ATOM    673  CB  LYS A  86     119.725  20.110 101.359  1.00  0.82           C  
ATOM    674  CG  LYS A  86     118.338  19.455 101.456  1.00  0.82           C  
ATOM    675  CD  LYS A  86     117.158  20.441 101.402  1.00  0.82           C  
ATOM    676  CE  LYS A  86     115.804  19.777 101.131  1.00  0.82           C  
ATOM    677  NZ  LYS A  86     115.694  19.498  99.682  1.00  0.82           N  
ATOM    678  N   THR A  87     120.704  22.548  99.552  1.00  0.86           N  
ATOM    679  CA  THR A  87     120.484  23.909  99.079  1.00  0.86           C  
ATOM    680  C   THR A  87     121.146  24.217  97.748  1.00  0.86           C  
ATOM    681  O   THR A  87     120.673  25.077  97.003  1.00  0.86           O  
ATOM    682  CB  THR A  87     120.977  24.969 100.065  1.00  0.86           C  
ATOM    683  OG1 THR A  87     122.378  24.902 100.301  1.00  0.86           O  
ATOM    684  CG2 THR A  87     120.294  24.768 101.419  1.00  0.86           C  
ATOM    685  N   GLY A  88     122.274  23.546  97.427  1.00  0.85           N  
ATOM    686  CA  GLY A  88     123.099  23.806  96.249  1.00  0.85           C  
ATOM    687  C   GLY A  88     124.064  24.952  96.427  1.00  0.85           C  
ATOM    688  O   GLY A  88     124.779  25.330  95.502  1.00  0.85           O  
ATOM    689  N   GLN A  89     124.097  25.553  97.630  1.00  0.85           N  
ATOM    690  CA  GLN A  89     125.030  26.596  98.012  1.00  0.85           C  
ATOM    691  C   GLN A  89     126.447  26.073  98.202  1.00  0.85           C  
ATOM    692  O   GLN A  89     126.651  24.932  98.600  1.00  0.85           O  
ATOM    693  CB  GLN A  89     124.577  27.280  99.330  1.00  0.85           C  
ATOM    694  CG  GLN A  89     123.176  27.936  99.276  1.00  0.85           C  
ATOM    695  CD  GLN A  89     123.206  29.277  98.555  1.00  0.85           C  
ATOM    696  OE1 GLN A  89     123.892  30.220  98.974  1.00  0.85           O  
ATOM    697  NE2 GLN A  89     122.439  29.399  97.452  1.00  0.85           N  
ATOM    698  N   GLU A  90     127.477  26.912  97.951  1.00  0.86           N  
ATOM    699  CA  GLU A  90     128.852  26.501  98.169  1.00  0.86           C  
ATOM    700  C   GLU A  90     129.384  26.805  99.563  1.00  0.86           C  
ATOM    701  O   GLU A  90     130.381  26.226  99.999  1.00  0.86           O  
ATOM    702  CB  GLU A  90     129.767  27.200  97.147  1.00  0.86           C  
ATOM    703  CG  GLU A  90     129.611  26.635  95.716  1.00  0.86           C  
ATOM    704  CD  GLU A  90     130.986  26.289  95.149  1.00  0.86           C  
ATOM    705  OE1 GLU A  90     131.365  26.886  94.112  1.00  0.86           O  
ATOM    706  OE2 GLU A  90     131.678  25.438  95.781  1.00  0.86           O  
ATOM    707  N   GLN A  91     128.723  27.701 100.323  1.00  0.92           N  
ATOM    708  CA  GLN A  91     129.222  28.126 101.614  1.00  0.92           C  
ATOM    709  C   GLN A  91     128.092  28.503 102.562  1.00  0.92           C  
ATOM    710  O   GLN A  91     126.979  28.820 102.140  1.00  0.92           O  
ATOM    711  CB  GLN A  91     130.128  29.380 101.508  1.00  0.92           C  
ATOM    712  CG  GLN A  91     131.528  29.176 100.889  1.00  0.92           C  
ATOM    713  CD  GLN A  91     132.230  30.529 100.776  1.00  0.92           C  
ATOM    714  OE1 GLN A  91     131.720  31.445 100.125  1.00  0.92           O  
ATOM    715  NE2 GLN A  91     133.394  30.688 101.445  1.00  0.92           N  
ATOM    716  N   VAL A  92     128.388  28.515 103.881  1.00  0.98           N  
ATOM    717  CA  VAL A  92     127.453  28.887 104.934  1.00  0.98           C  
ATOM    718  C   VAL A  92     128.069  29.963 105.814  1.00  0.98           C  
ATOM    719  O   VAL A  92     129.277  30.185 105.813  1.00  0.98           O  
ATOM    720  CB  VAL A  92     127.020  27.709 105.827  1.00  0.98           C  
ATOM    721  CG1 VAL A  92     126.458  26.584 104.941  1.00  0.98           C  
ATOM    722  CG2 VAL A  92     128.169  27.141 106.690  1.00  0.98           C  
ATOM    723  N   TYR A  93     127.239  30.685 106.593  1.00  0.98           N  
ATOM    724  CA  TYR A  93     127.696  31.422 107.762  1.00  0.98           C  
ATOM    725  C   TYR A  93     127.568  30.518 108.978  1.00  0.98           C  
ATOM    726  O   TYR A  93     126.605  29.765 109.089  1.00  0.98           O  
ATOM    727  CB  TYR A  93     126.829  32.676 108.040  1.00  0.98           C  
ATOM    728  CG  TYR A  93     126.934  33.704 106.952  1.00  0.98           C  
ATOM    729  CD1 TYR A  93     128.067  34.519 106.863  1.00  0.98           C  
ATOM    730  CD2 TYR A  93     125.887  33.901 106.039  1.00  0.98           C  
ATOM    731  CE1 TYR A  93     128.178  35.486 105.851  1.00  0.98           C  
ATOM    732  CE2 TYR A  93     125.986  34.876 105.035  1.00  0.98           C  
ATOM    733  CZ  TYR A  93     127.145  35.646 104.925  1.00  0.98           C  
ATOM    734  OH  TYR A  93     127.290  36.534 103.839  1.00  0.98           O  
ATOM    735  N   TYR A  94     128.524  30.561 109.926  1.00  0.98           N  
ATOM    736  CA  TYR A  94     128.488  29.694 111.087  1.00  0.98           C  
ATOM    737  C   TYR A  94     128.407  30.551 112.337  1.00  0.98           C  
ATOM    738  O   TYR A  94     129.227  31.441 112.548  1.00  0.98           O  
ATOM    739  CB  TYR A  94     129.750  28.794 111.124  1.00  0.98           C  
ATOM    740  CG  TYR A  94     129.730  27.841 112.287  1.00  0.98           C  
ATOM    741  CD1 TYR A  94     129.043  26.626 112.210  1.00  0.98           C  
ATOM    742  CD2 TYR A  94     130.401  28.162 113.474  1.00  0.98           C  
ATOM    743  CE1 TYR A  94     129.065  25.736 113.290  1.00  0.98           C  
ATOM    744  CE2 TYR A  94     130.430  27.272 114.557  1.00  0.98           C  
ATOM    745  CZ  TYR A  94     129.775  26.042 114.451  1.00  0.98           C  
ATOM    746  OH  TYR A  94     129.833  25.084 115.479  1.00  0.98           O  
ATOM    747  N   VAL A  95     127.413  30.295 113.204  1.00  0.99           N  
ATOM    748  CA  VAL A  95     127.277  30.979 114.470  1.00  0.99           C  
ATOM    749  C   VAL A  95     127.300  29.921 115.546  1.00  0.99           C  
ATOM    750  O   VAL A  95     126.518  28.972 115.522  1.00  0.99           O  
ATOM    751  CB  VAL A  95     125.953  31.724 114.578  1.00  0.99           C  
ATOM    752  CG1 VAL A  95     125.787  32.404 115.955  1.00  0.99           C  
ATOM    753  CG2 VAL A  95     125.782  32.735 113.426  1.00  0.99           C  
ATOM    754  N   GLY A  96     128.201  30.052 116.534  1.00  0.99           N  
ATOM    755  CA  GLY A  96     128.284  29.099 117.625  1.00  0.99           C  
ATOM    756  C   GLY A  96     128.175  29.810 118.933  1.00  0.99           C  
ATOM    757  O   GLY A  96     128.654  30.929 119.093  1.00  0.99           O  
ATOM    758  N   HIS A  97     127.569  29.152 119.932  1.00  0.93           N  
ATOM    759  CA  HIS A  97     127.575  29.640 121.299  1.00  0.93           C  
ATOM    760  C   HIS A  97     128.275  28.618 122.174  1.00  0.93           C  
ATOM    761  O   HIS A  97     128.052  27.420 122.024  1.00  0.93           O  
ATOM    762  CB  HIS A  97     126.144  29.900 121.832  1.00  0.93           C  
ATOM    763  CG  HIS A  97     126.067  30.215 123.294  1.00  0.93           C  
ATOM    764  ND1 HIS A  97     125.258  29.449 124.109  1.00  0.93           N  
ATOM    765  CD2 HIS A  97     126.664  31.205 124.010  1.00  0.93           C  
ATOM    766  CE1 HIS A  97     125.371  29.998 125.306  1.00  0.93           C  
ATOM    767  NE2 HIS A  97     126.212  31.055 125.298  1.00  0.93           N  
ATOM    768  N   SER A  98     129.145  29.052 123.123  1.00  0.96           N  
ATOM    769  CA  SER A  98     129.686  28.165 124.160  1.00  0.96           C  
ATOM    770  C   SER A  98     130.500  26.987 123.625  1.00  0.96           C  
ATOM    771  O   SER A  98     131.566  27.163 123.040  1.00  0.96           O  
ATOM    772  CB  SER A  98     128.534  27.757 125.136  1.00  0.96           C  
ATOM    773  OG  SER A  98     128.893  26.823 126.169  1.00  0.96           O  
ATOM    774  N   GLN A  99     130.036  25.737 123.780  1.00  0.92           N  
ATOM    775  CA  GLN A  99     130.623  24.570 123.146  1.00  0.92           C  
ATOM    776  C   GLN A  99     130.490  24.534 121.618  1.00  0.92           C  
ATOM    777  O   GLN A  99     131.326  23.946 120.938  1.00  0.92           O  
ATOM    778  CB  GLN A  99     130.097  23.261 123.771  1.00  0.92           C  
ATOM    779  CG  GLN A  99     130.730  21.947 123.262  1.00  0.92           C  
ATOM    780  CD  GLN A  99     129.924  20.781 123.816  1.00  0.92           C  
ATOM    781  OE1 GLN A  99     130.277  20.146 124.811  1.00  0.92           O  
ATOM    782  NE2 GLN A  99     128.771  20.521 123.157  1.00  0.92           N  
ATOM    783  N   GLY A 100     129.483  25.194 120.993  1.00  0.97           N  
ATOM    784  CA  GLY A 100     129.385  25.261 119.531  1.00  0.97           C  
ATOM    785  C   GLY A 100     130.492  26.063 118.916  1.00  0.97           C  
ATOM    786  O   GLY A 100     130.901  25.853 117.776  1.00  0.97           O  
ATOM    787  N   THR A 101     131.048  26.996 119.696  1.00  0.94           N  
ATOM    788  CA  THR A 101     132.266  27.702 119.342  1.00  0.94           C  
ATOM    789  C   THR A 101     133.492  26.798 119.264  1.00  0.94           C  
ATOM    790  O   THR A 101     134.232  26.836 118.287  1.00  0.94           O  
ATOM    791  CB  THR A 101     132.526  28.842 120.328  1.00  0.94           C  
ATOM    792  OG1 THR A 101     131.964  30.060 119.859  1.00  0.94           O  
ATOM    793  CG2 THR A 101     134.013  29.105 120.539  1.00  0.94           C  
ATOM    794  N   THR A 102     133.753  25.942 120.282  1.00  0.94           N  
ATOM    795  CA  THR A 102     134.965  25.102 120.359  1.00  0.94           C  
ATOM    796  C   THR A 102     134.935  24.069 119.278  1.00  0.94           C  
ATOM    797  O   THR A 102     135.936  23.818 118.614  1.00  0.94           O  
ATOM    798  CB  THR A 102     135.290  24.492 121.748  1.00  0.94           C  
ATOM    799  OG1 THR A 102     135.471  23.078 121.806  1.00  0.94           O  
ATOM    800  CG2 THR A 102     134.099  24.759 122.638  1.00  0.94           C  
ATOM    801  N   ILE A 103     133.733  23.522 119.022  1.00  0.94           N  
ATOM    802  CA  ILE A 103     133.464  22.631 117.911  1.00  0.94           C  
ATOM    803  C   ILE A 103     133.854  23.262 116.575  1.00  0.94           C  
ATOM    804  O   ILE A 103     134.489  22.622 115.735  1.00  0.94           O  
ATOM    805  CB  ILE A 103     131.987  22.237 117.931  1.00  0.94           C  
ATOM    806  CG1 ILE A 103     131.686  21.267 119.093  1.00  0.94           C  
ATOM    807  CG2 ILE A 103     131.561  21.616 116.593  1.00  0.94           C  
ATOM    808  CD1 ILE A 103     130.182  21.065 119.321  1.00  0.94           C  
ATOM    809  N   GLY A 104     133.537  24.559 116.379  1.00  0.98           N  
ATOM    810  CA  GLY A 104     133.994  25.351 115.241  1.00  0.98           C  
ATOM    811  C   GLY A 104     135.487  25.586 115.206  1.00  0.98           C  
ATOM    812  O   GLY A 104     136.128  25.373 114.182  1.00  0.98           O  
ATOM    813  N   PHE A 105     136.110  25.986 116.334  1.00  0.93           N  
ATOM    814  CA  PHE A 105     137.557  26.153 116.421  1.00  0.93           C  
ATOM    815  C   PHE A 105     138.342  24.887 116.127  1.00  0.93           C  
ATOM    816  O   PHE A 105     139.357  24.952 115.443  1.00  0.93           O  
ATOM    817  CB  PHE A 105     138.043  26.686 117.801  1.00  0.93           C  
ATOM    818  CG  PHE A 105     137.653  28.108 118.090  1.00  0.93           C  
ATOM    819  CD1 PHE A 105     137.819  29.117 117.129  1.00  0.93           C  
ATOM    820  CD2 PHE A 105     137.208  28.473 119.369  1.00  0.93           C  
ATOM    821  CE1 PHE A 105     137.454  30.442 117.403  1.00  0.93           C  
ATOM    822  CE2 PHE A 105     136.895  29.805 119.661  1.00  0.93           C  
ATOM    823  CZ  PHE A 105     136.972  30.784 118.668  1.00  0.93           C  
ATOM    824  N   ILE A 106     137.899  23.713 116.617  1.00  0.94           N  
ATOM    825  CA  ILE A 106     138.476  22.432 116.242  1.00  0.94           C  
ATOM    826  C   ILE A 106     138.199  22.056 114.799  1.00  0.94           C  
ATOM    827  O   ILE A 106     139.111  21.771 114.033  1.00  0.94           O  
ATOM    828  CB  ILE A 106     137.954  21.321 117.146  1.00  0.94           C  
ATOM    829  CG1 ILE A 106     138.401  21.579 118.596  1.00  0.94           C  
ATOM    830  CG2 ILE A 106     138.466  19.934 116.688  1.00  0.94           C  
ATOM    831  CD1 ILE A 106     137.676  20.727 119.642  1.00  0.94           C  
ATOM    832  N   ALA A 107     136.935  22.080 114.338  1.00  0.96           N  
ATOM    833  CA  ALA A 107     136.601  21.627 113.003  1.00  0.96           C  
ATOM    834  C   ALA A 107     137.230  22.461 111.902  1.00  0.96           C  
ATOM    835  O   ALA A 107     137.723  21.939 110.906  1.00  0.96           O  
ATOM    836  CB  ALA A 107     135.077  21.598 112.826  1.00  0.96           C  
ATOM    837  N   PHE A 108     137.275  23.792 112.068  1.00  0.93           N  
ATOM    838  CA  PHE A 108     137.798  24.662 111.037  1.00  0.93           C  
ATOM    839  C   PHE A 108     139.313  24.781 111.081  1.00  0.93           C  
ATOM    840  O   PHE A 108     139.916  25.278 110.134  1.00  0.93           O  
ATOM    841  CB  PHE A 108     137.182  26.077 111.126  1.00  0.93           C  
ATOM    842  CG  PHE A 108     135.672  26.097 111.185  1.00  0.93           C  
ATOM    843  CD1 PHE A 108     134.847  25.101 110.623  1.00  0.93           C  
ATOM    844  CD2 PHE A 108     135.061  27.156 111.876  1.00  0.93           C  
ATOM    845  CE1 PHE A 108     133.459  25.145 110.795  1.00  0.93           C  
ATOM    846  CE2 PHE A 108     133.674  27.207 112.041  1.00  0.93           C  
ATOM    847  CZ  PHE A 108     132.874  26.194 111.506  1.00  0.93           C  
ATOM    848  N   SER A 109     139.974  24.309 112.164  1.00  0.94           N  
ATOM    849  CA  SER A 109     141.428  24.229 112.205  1.00  0.94           C  
ATOM    850  C   SER A 109     141.928  22.848 111.826  1.00  0.94           C  
ATOM    851  O   SER A 109     142.999  22.710 111.241  1.00  0.94           O  
ATOM    852  CB  SER A 109     142.019  24.666 113.577  1.00  0.94           C  
ATOM    853  OG  SER A 109     141.872  23.711 114.632  1.00  0.94           O  
ATOM    854  N   GLN A 110     141.144  21.779 112.087  1.00  0.90           N  
ATOM    855  CA  GLN A 110     141.558  20.425 111.779  1.00  0.90           C  
ATOM    856  C   GLN A 110     141.061  19.904 110.444  1.00  0.90           C  
ATOM    857  O   GLN A 110     141.603  18.937 109.911  1.00  0.90           O  
ATOM    858  CB  GLN A 110     141.013  19.448 112.850  1.00  0.90           C  
ATOM    859  CG  GLN A 110     141.482  19.709 114.301  1.00  0.90           C  
ATOM    860  CD  GLN A 110     142.988  19.924 114.392  1.00  0.90           C  
ATOM    861  OE1 GLN A 110     143.770  18.993 114.193  1.00  0.90           O  
ATOM    862  NE2 GLN A 110     143.420  21.166 114.708  1.00  0.90           N  
ATOM    863  N   ILE A 111     140.024  20.517 109.840  1.00  0.92           N  
ATOM    864  CA  ILE A 111     139.477  20.042 108.580  1.00  0.92           C  
ATOM    865  C   ILE A 111     139.451  21.216 107.595  1.00  0.92           C  
ATOM    866  O   ILE A 111     138.431  21.900 107.461  1.00  0.92           O  
ATOM    867  CB  ILE A 111     138.085  19.437 108.762  1.00  0.92           C  
ATOM    868  CG1 ILE A 111     138.064  18.338 109.857  1.00  0.92           C  
ATOM    869  CG2 ILE A 111     137.617  18.823 107.424  1.00  0.92           C  
ATOM    870  CD1 ILE A 111     136.683  18.127 110.486  1.00  0.92           C  
ATOM    871  N   PRO A 112     140.526  21.509 106.845  1.00  0.93           N  
ATOM    872  CA  PRO A 112     140.629  22.715 106.019  1.00  0.93           C  
ATOM    873  C   PRO A 112     139.640  22.709 104.879  1.00  0.93           C  
ATOM    874  O   PRO A 112     139.243  23.763 104.381  1.00  0.93           O  
ATOM    875  CB  PRO A 112     142.081  22.718 105.510  1.00  0.93           C  
ATOM    876  CG  PRO A 112     142.839  21.925 106.573  1.00  0.93           C  
ATOM    877  CD  PRO A 112     141.830  20.864 106.999  1.00  0.93           C  
ATOM    878  N   GLU A 113     139.229  21.506 104.440  1.00  0.85           N  
ATOM    879  CA  GLU A 113     138.222  21.327 103.426  1.00  0.85           C  
ATOM    880  C   GLU A 113     136.853  21.854 103.823  1.00  0.85           C  
ATOM    881  O   GLU A 113     136.105  22.379 102.992  1.00  0.85           O  
ATOM    882  CB  GLU A 113     138.129  19.867 102.950  1.00  0.85           C  
ATOM    883  CG  GLU A 113     137.671  19.877 101.480  1.00  0.85           C  
ATOM    884  CD  GLU A 113     137.513  18.521 100.814  1.00  0.85           C  
ATOM    885  OE1 GLU A 113     137.099  18.600  99.624  1.00  0.85           O  
ATOM    886  OE2 GLU A 113     137.766  17.475 101.448  1.00  0.85           O  
ATOM    887  N   LEU A 114     136.531  21.723 105.126  1.00  0.94           N  
ATOM    888  CA  LEU A 114     135.373  22.292 105.776  1.00  0.94           C  
ATOM    889  C   LEU A 114     135.502  23.798 105.922  1.00  0.94           C  
ATOM    890  O   LEU A 114     134.599  24.530 105.546  1.00  0.94           O  
ATOM    891  CB  LEU A 114     135.173  21.644 107.167  1.00  0.94           C  
ATOM    892  CG  LEU A 114     133.721  21.335 107.598  1.00  0.94           C  
ATOM    893  CD1 LEU A 114     133.668  21.242 109.129  1.00  0.94           C  
ATOM    894  CD2 LEU A 114     132.643  22.308 107.100  1.00  0.94           C  
ATOM    895  N   ALA A 115     136.660  24.318 106.386  1.00  0.99           N  
ATOM    896  CA  ALA A 115     136.874  25.738 106.647  1.00  0.99           C  
ATOM    897  C   ALA A 115     136.636  26.662 105.456  1.00  0.99           C  
ATOM    898  O   ALA A 115     136.065  27.745 105.577  1.00  0.99           O  
ATOM    899  CB  ALA A 115     138.318  25.935 107.136  1.00  0.99           C  
ATOM    900  N   LYS A 116     137.012  26.200 104.254  1.00  0.93           N  
ATOM    901  CA  LYS A 116     136.724  26.799 102.963  1.00  0.93           C  
ATOM    902  C   LYS A 116     135.232  27.048 102.699  1.00  0.93           C  
ATOM    903  O   LYS A 116     134.842  27.993 102.012  1.00  0.93           O  
ATOM    904  CB  LYS A 116     137.249  25.775 101.935  1.00  0.93           C  
ATOM    905  CG  LYS A 116     137.174  26.151 100.448  1.00  0.93           C  
ATOM    906  CD  LYS A 116     136.976  24.897  99.575  1.00  0.93           C  
ATOM    907  CE  LYS A 116     138.066  23.823  99.724  1.00  0.93           C  
ATOM    908  NZ  LYS A 116     137.667  22.583  99.015  1.00  0.93           N  
ATOM    909  N   ARG A 117     134.358  26.190 103.264  1.00  0.89           N  
ATOM    910  CA  ARG A 117     132.914  26.273 103.166  1.00  0.89           C  
ATOM    911  C   ARG A 117     132.306  27.306 104.110  1.00  0.89           C  
ATOM    912  O   ARG A 117     131.106  27.564 104.039  1.00  0.89           O  
ATOM    913  CB  ARG A 117     132.227  24.897 103.408  1.00  0.89           C  
ATOM    914  CG  ARG A 117     132.055  24.055 102.128  1.00  0.89           C  
ATOM    915  CD  ARG A 117     133.262  23.212 101.723  1.00  0.89           C  
ATOM    916  NE  ARG A 117     133.417  23.320 100.227  1.00  0.89           N  
ATOM    917  CZ  ARG A 117     134.152  22.493  99.480  1.00  0.89           C  
ATOM    918  NH1 ARG A 117     134.896  21.551 100.053  1.00  0.89           N  
ATOM    919  NH2 ARG A 117     134.183  22.653  98.158  1.00  0.89           N  
ATOM    920  N   ILE A 118     133.069  27.946 105.016  1.00  0.98           N  
ATOM    921  CA  ILE A 118     132.479  28.910 105.928  1.00  0.98           C  
ATOM    922  C   ILE A 118     132.875  30.314 105.510  1.00  0.98           C  
ATOM    923  O   ILE A 118     134.046  30.674 105.429  1.00  0.98           O  
ATOM    924  CB  ILE A 118     132.780  28.600 107.395  1.00  0.98           C  
ATOM    925  CG1 ILE A 118     131.980  27.352 107.850  1.00  0.98           C  
ATOM    926  CG2 ILE A 118     132.429  29.791 108.318  1.00  0.98           C  
ATOM    927  CD1 ILE A 118     132.715  26.022 107.672  1.00  0.98           C  
ATOM    928  N   LYS A 119     131.859  31.156 105.211  1.00  0.97           N  
ATOM    929  CA  LYS A 119     132.026  32.564 104.901  1.00  0.97           C  
ATOM    930  C   LYS A 119     132.520  33.359 106.081  1.00  0.97           C  
ATOM    931  O   LYS A 119     133.439  34.172 105.976  1.00  0.97           O  
ATOM    932  CB  LYS A 119     130.660  33.187 104.522  1.00  0.97           C  
ATOM    933  CG  LYS A 119     130.161  32.770 103.137  1.00  0.97           C  
ATOM    934  CD  LYS A 119     128.756  33.302 102.823  1.00  0.97           C  
ATOM    935  CE  LYS A 119     128.208  32.773 101.497  1.00  0.97           C  
ATOM    936  NZ  LYS A 119     127.031  33.573 101.106  1.00  0.97           N  
ATOM    937  N   MET A 120     131.890  33.137 107.244  1.00  0.98           N  
ATOM    938  CA  MET A 120     132.227  33.882 108.426  1.00  0.98           C  
ATOM    939  C   MET A 120     131.846  33.071 109.644  1.00  0.98           C  
ATOM    940  O   MET A 120     130.864  32.326 109.629  1.00  0.98           O  
ATOM    941  CB  MET A 120     131.506  35.254 108.396  1.00  0.98           C  
ATOM    942  CG  MET A 120     132.147  36.380 109.222  1.00  0.98           C  
ATOM    943  SD  MET A 120     131.583  38.030 108.696  1.00  0.98           S  
ATOM    944  CE  MET A 120     132.143  38.858 110.206  1.00  0.98           C  
ATOM    945  N   PHE A 121     132.628  33.203 110.727  1.00  0.98           N  
ATOM    946  CA  PHE A 121     132.390  32.521 111.976  1.00  0.98           C  
ATOM    947  C   PHE A 121     132.034  33.572 113.019  1.00  0.98           C  
ATOM    948  O   PHE A 121     132.802  34.475 113.325  1.00  0.98           O  
ATOM    949  CB  PHE A 121     133.661  31.715 112.349  1.00  0.98           C  
ATOM    950  CG  PHE A 121     133.638  30.913 113.630  1.00  0.98           C  
ATOM    951  CD1 PHE A 121     132.538  30.742 114.493  1.00  0.98           C  
ATOM    952  CD2 PHE A 121     134.836  30.268 113.957  1.00  0.98           C  
ATOM    953  CE1 PHE A 121     132.654  29.989 115.669  1.00  0.98           C  
ATOM    954  CE2 PHE A 121     134.944  29.473 115.098  1.00  0.98           C  
ATOM    955  CZ  PHE A 121     133.861  29.358 115.972  1.00  0.98           C  
ATOM    956  N   PHE A 122     130.827  33.485 113.597  1.00  0.98           N  
ATOM    957  CA  PHE A 122     130.394  34.342 114.678  1.00  0.98           C  
ATOM    958  C   PHE A 122     130.463  33.541 115.965  1.00  0.98           C  
ATOM    959  O   PHE A 122     129.730  32.572 116.158  1.00  0.98           O  
ATOM    960  CB  PHE A 122     128.939  34.829 114.468  1.00  0.98           C  
ATOM    961  CG  PHE A 122     128.782  35.519 113.135  1.00  0.98           C  
ATOM    962  CD1 PHE A 122     128.496  34.799 111.959  1.00  0.98           C  
ATOM    963  CD2 PHE A 122     128.953  36.906 113.038  1.00  0.98           C  
ATOM    964  CE1 PHE A 122     128.407  35.449 110.723  1.00  0.98           C  
ATOM    965  CE2 PHE A 122     128.858  37.561 111.806  1.00  0.98           C  
ATOM    966  CZ  PHE A 122     128.581  36.833 110.646  1.00  0.98           C  
ATOM    967  N   ALA A 123     131.369  33.917 116.882  1.00  0.99           N  
ATOM    968  CA  ALA A 123     131.605  33.163 118.088  1.00  0.99           C  
ATOM    969  C   ALA A 123     131.031  33.921 119.267  1.00  0.99           C  
ATOM    970  O   ALA A 123     131.507  34.993 119.642  1.00  0.99           O  
ATOM    971  CB  ALA A 123     133.118  32.949 118.269  1.00  0.99           C  
ATOM    972  N   LEU A 124     129.958  33.381 119.875  1.00  0.96           N  
ATOM    973  CA  LEU A 124     129.280  34.037 120.970  1.00  0.96           C  
ATOM    974  C   LEU A 124     129.710  33.351 122.263  1.00  0.96           C  
ATOM    975  O   LEU A 124     129.512  32.146 122.422  1.00  0.96           O  
ATOM    976  CB  LEU A 124     127.737  33.960 120.803  1.00  0.96           C  
ATOM    977  CG  LEU A 124     127.178  34.288 119.397  1.00  0.96           C  
ATOM    978  CD1 LEU A 124     125.639  34.321 119.445  1.00  0.96           C  
ATOM    979  CD2 LEU A 124     127.729  35.598 118.810  1.00  0.96           C  
ATOM    980  N   GLY A 125     130.346  34.075 123.216  1.00  0.98           N  
ATOM    981  CA  GLY A 125     130.879  33.464 124.441  1.00  0.98           C  
ATOM    982  C   GLY A 125     131.956  32.421 124.217  1.00  0.98           C  
ATOM    983  O   GLY A 125     131.701  31.241 124.474  1.00  0.98           O  
ATOM    984  N   PRO A 126     133.124  32.729 123.661  1.00  0.94           N  
ATOM    985  CA  PRO A 126     133.922  31.693 123.043  1.00  0.94           C  
ATOM    986  C   PRO A 126     134.778  30.910 124.010  1.00  0.94           C  
ATOM    987  O   PRO A 126     135.411  31.489 124.882  1.00  0.94           O  
ATOM    988  CB  PRO A 126     134.799  32.447 122.047  1.00  0.94           C  
ATOM    989  CG  PRO A 126     134.981  33.802 122.714  1.00  0.94           C  
ATOM    990  CD  PRO A 126     133.583  34.063 123.268  1.00  0.94           C  
ATOM    991  N   VAL A 127     134.852  29.579 123.825  1.00  0.95           N  
ATOM    992  CA  VAL A 127     135.620  28.708 124.679  1.00  0.95           C  
ATOM    993  C   VAL A 127     136.623  28.012 123.786  1.00  0.95           C  
ATOM    994  O   VAL A 127     136.263  27.465 122.746  1.00  0.95           O  
ATOM    995  CB  VAL A 127     134.725  27.685 125.372  1.00  0.95           C  
ATOM    996  CG1 VAL A 127     135.533  26.889 126.414  1.00  0.95           C  
ATOM    997  CG2 VAL A 127     133.559  28.426 126.059  1.00  0.95           C  
ATOM    998  N   ALA A 128     137.914  28.038 124.158  1.00  0.96           N  
ATOM    999  CA  ALA A 128     138.926  27.172 123.586  1.00  0.96           C  
ATOM   1000  C   ALA A 128     139.667  26.536 124.739  1.00  0.96           C  
ATOM   1001  O   ALA A 128     139.424  25.390 125.111  1.00  0.96           O  
ATOM   1002  CB  ALA A 128     139.906  27.941 122.669  1.00  0.96           C  
ATOM   1003  N   SER A 129     140.561  27.312 125.379  1.00  0.95           N  
ATOM   1004  CA  SER A 129     141.097  26.976 126.685  1.00  0.95           C  
ATOM   1005  C   SER A 129     140.067  27.369 127.721  1.00  0.95           C  
ATOM   1006  O   SER A 129     139.239  28.242 127.468  1.00  0.95           O  
ATOM   1007  CB  SER A 129     142.466  27.645 126.969  1.00  0.95           C  
ATOM   1008  OG  SER A 129     143.324  26.751 127.684  1.00  0.95           O  
ATOM   1009  N   VAL A 130     140.057  26.676 128.873  1.00  0.96           N  
ATOM   1010  CA  VAL A 130     139.089  26.916 129.928  1.00  0.96           C  
ATOM   1011  C   VAL A 130     139.847  26.883 131.255  1.00  0.96           C  
ATOM   1012  O   VAL A 130     139.358  26.512 132.321  1.00  0.96           O  
ATOM   1013  CB  VAL A 130     137.930  25.915 129.796  1.00  0.96           C  
ATOM   1014  CG1 VAL A 130     138.298  24.504 130.305  1.00  0.96           C  
ATOM   1015  CG2 VAL A 130     136.658  26.468 130.459  1.00  0.96           C  
ATOM   1016  N   ALA A 131     141.131  27.287 131.177  1.00  0.96           N  
ATOM   1017  CA  ALA A 131     142.132  27.294 132.216  1.00  0.96           C  
ATOM   1018  C   ALA A 131     141.797  28.176 133.429  1.00  0.96           C  
ATOM   1019  O   ALA A 131     142.061  27.792 134.575  1.00  0.96           O  
ATOM   1020  CB  ALA A 131     143.466  27.720 131.560  1.00  0.96           C  
ATOM   1021  N   PHE A 132     141.195  29.367 133.207  1.00  0.92           N  
ATOM   1022  CA  PHE A 132     141.015  30.384 134.235  1.00  0.92           C  
ATOM   1023  C   PHE A 132     139.552  30.585 134.611  1.00  0.92           C  
ATOM   1024  O   PHE A 132     139.217  31.496 135.374  1.00  0.92           O  
ATOM   1025  CB  PHE A 132     141.630  31.737 133.788  1.00  0.92           C  
ATOM   1026  CG  PHE A 132     143.091  31.544 133.497  1.00  0.92           C  
ATOM   1027  CD1 PHE A 132     143.983  31.158 134.512  1.00  0.92           C  
ATOM   1028  CD2 PHE A 132     143.573  31.679 132.188  1.00  0.92           C  
ATOM   1029  CE1 PHE A 132     145.332  30.917 134.224  1.00  0.92           C  
ATOM   1030  CE2 PHE A 132     144.923  31.451 131.898  1.00  0.92           C  
ATOM   1031  CZ  PHE A 132     145.804  31.071 132.916  1.00  0.92           C  
ATOM   1032  N   CYS A 133     138.653  29.686 134.141  1.00  0.93           N  
ATOM   1033  CA  CYS A 133     137.235  29.734 134.462  1.00  0.93           C  
ATOM   1034  C   CYS A 133     136.905  29.608 135.956  1.00  0.93           C  
ATOM   1035  O   CYS A 133     137.531  28.847 136.698  1.00  0.93           O  
ATOM   1036  CB  CYS A 133     136.367  28.803 133.552  1.00  0.93           C  
ATOM   1037  SG  CYS A 133     136.175  27.051 134.016  1.00  0.93           S  
ATOM   1038  N   THR A 134     135.897  30.370 136.450  1.00  0.93           N  
ATOM   1039  CA  THR A 134     135.495  30.354 137.863  1.00  0.93           C  
ATOM   1040  C   THR A 134     134.089  29.833 138.035  1.00  0.93           C  
ATOM   1041  O   THR A 134     133.523  29.847 139.128  1.00  0.93           O  
ATOM   1042  CB  THR A 134     135.630  31.707 138.540  1.00  0.93           C  
ATOM   1043  OG1 THR A 134     135.047  32.741 137.760  1.00  0.93           O  
ATOM   1044  CG2 THR A 134     137.128  32.018 138.662  1.00  0.93           C  
ATOM   1045  N   SER A 135     133.528  29.290 136.939  1.00  0.96           N  
ATOM   1046  CA  SER A 135     132.309  28.494 136.886  1.00  0.96           C  
ATOM   1047  C   SER A 135     132.323  27.298 137.864  1.00  0.96           C  
ATOM   1048  O   SER A 135     133.391  26.761 138.175  1.00  0.96           O  
ATOM   1049  CB  SER A 135     131.972  28.116 135.395  1.00  0.96           C  
ATOM   1050  OG  SER A 135     131.481  26.792 135.167  1.00  0.96           O  
ATOM   1051  N   PRO A 136     131.185  26.807 138.366  1.00  0.98           N  
ATOM   1052  CA  PRO A 136     131.056  25.506 139.027  1.00  0.98           C  
ATOM   1053  C   PRO A 136     131.552  24.336 138.185  1.00  0.98           C  
ATOM   1054  O   PRO A 136     131.803  23.264 138.727  1.00  0.98           O  
ATOM   1055  CB  PRO A 136     129.562  25.408 139.384  1.00  0.98           C  
ATOM   1056  CG  PRO A 136     129.108  26.866 139.458  1.00  0.98           C  
ATOM   1057  CD  PRO A 136     129.911  27.514 138.339  1.00  0.98           C  
ATOM   1058  N   MET A 137     131.720  24.494 136.854  1.00  0.94           N  
ATOM   1059  CA  MET A 137     132.357  23.507 136.009  1.00  0.94           C  
ATOM   1060  C   MET A 137     133.810  23.252 136.366  1.00  0.94           C  
ATOM   1061  O   MET A 137     134.271  22.119 136.305  1.00  0.94           O  
ATOM   1062  CB  MET A 137     132.232  23.841 134.509  1.00  0.94           C  
ATOM   1063  CG  MET A 137     132.182  22.574 133.638  1.00  0.94           C  
ATOM   1064  SD  MET A 137     132.020  22.888 131.861  1.00  0.94           S  
ATOM   1065  CE  MET A 137     133.751  23.365 131.615  1.00  0.94           C  
ATOM   1066  N   ALA A 138     134.571  24.283 136.795  1.00  0.99           N  
ATOM   1067  CA  ALA A 138     135.933  24.118 137.268  1.00  0.99           C  
ATOM   1068  C   ALA A 138     136.020  23.319 138.564  1.00  0.99           C  
ATOM   1069  O   ALA A 138     137.010  22.646 138.844  1.00  0.99           O  
ATOM   1070  CB  ALA A 138     136.605  25.491 137.462  1.00  0.99           C  
ATOM   1071  N   LYS A 139     134.962  23.388 139.394  1.00  0.92           N  
ATOM   1072  CA  LYS A 139     134.800  22.594 140.595  1.00  0.92           C  
ATOM   1073  C   LYS A 139     134.526  21.110 140.349  1.00  0.92           C  
ATOM   1074  O   LYS A 139     135.126  20.250 140.992  1.00  0.92           O  
ATOM   1075  CB  LYS A 139     133.666  23.223 141.426  1.00  0.92           C  
ATOM   1076  CG  LYS A 139     133.443  22.633 142.825  1.00  0.92           C  
ATOM   1077  CD  LYS A 139     132.459  23.531 143.599  1.00  0.92           C  
ATOM   1078  CE  LYS A 139     131.856  22.947 144.880  1.00  0.92           C  
ATOM   1079  NZ  LYS A 139     132.840  22.983 145.977  1.00  0.92           N  
ATOM   1080  N   LEU A 140     133.635  20.776 139.386  1.00  0.95           N  
ATOM   1081  CA  LEU A 140     133.456  19.431 138.835  1.00  0.95           C  
ATOM   1082  C   LEU A 140     134.705  18.951 138.115  1.00  0.95           C  
ATOM   1083  O   LEU A 140     135.147  17.812 138.263  1.00  0.95           O  
ATOM   1084  CB  LEU A 140     132.248  19.428 137.851  1.00  0.95           C  
ATOM   1085  CG  LEU A 140     132.003  18.169 136.977  1.00  0.95           C  
ATOM   1086  CD1 LEU A 140     131.717  16.896 137.789  1.00  0.95           C  
ATOM   1087  CD2 LEU A 140     130.844  18.426 135.996  1.00  0.95           C  
ATOM   1088  N   GLY A 141     135.330  19.847 137.333  1.00  0.98           N  
ATOM   1089  CA  GLY A 141     136.517  19.581 136.549  1.00  0.98           C  
ATOM   1090  C   GLY A 141     137.775  19.233 137.291  1.00  0.98           C  
ATOM   1091  O   GLY A 141     138.607  18.489 136.789  1.00  0.98           O  
ATOM   1092  N   ARG A 142     137.952  19.733 138.523  1.00  0.88           N  
ATOM   1093  CA  ARG A 142     139.131  19.451 139.324  1.00  0.88           C  
ATOM   1094  C   ARG A 142     138.952  18.244 140.232  1.00  0.88           C  
ATOM   1095  O   ARG A 142     139.836  17.912 141.019  1.00  0.88           O  
ATOM   1096  CB  ARG A 142     139.528  20.713 140.131  1.00  0.88           C  
ATOM   1097  CG  ARG A 142     140.387  21.693 139.297  1.00  0.88           C  
ATOM   1098  CD  ARG A 142     140.375  23.132 139.831  1.00  0.88           C  
ATOM   1099  NE  ARG A 142     140.991  24.019 138.769  1.00  0.88           N  
ATOM   1100  CZ  ARG A 142     140.624  25.286 138.513  1.00  0.88           C  
ATOM   1101  NH1 ARG A 142     141.118  25.935 137.457  1.00  0.88           N  
ATOM   1102  NH2 ARG A 142     139.725  25.908 139.269  1.00  0.88           N  
ATOM   1103  N   LEU A 143     137.839  17.495 140.105  1.00  0.92           N  
ATOM   1104  CA  LEU A 143     137.762  16.150 140.637  1.00  0.92           C  
ATOM   1105  C   LEU A 143     138.641  15.199 139.803  1.00  0.92           C  
ATOM   1106  O   LEU A 143     138.882  15.456 138.616  1.00  0.92           O  
ATOM   1107  CB  LEU A 143     136.297  15.648 140.692  1.00  0.92           C  
ATOM   1108  CG  LEU A 143     135.328  16.523 141.526  1.00  0.92           C  
ATOM   1109  CD1 LEU A 143     133.887  16.010 141.356  1.00  0.92           C  
ATOM   1110  CD2 LEU A 143     135.701  16.616 143.017  1.00  0.92           C  
ATOM   1111  N   PRO A 144     139.190  14.106 140.323  1.00  0.95           N  
ATOM   1112  CA  PRO A 144     139.914  13.142 139.503  1.00  0.95           C  
ATOM   1113  C   PRO A 144     138.965  12.392 138.574  1.00  0.95           C  
ATOM   1114  O   PRO A 144     137.793  12.229 138.906  1.00  0.95           O  
ATOM   1115  CB  PRO A 144     140.627  12.237 140.522  1.00  0.95           C  
ATOM   1116  CG  PRO A 144     139.834  12.388 141.825  1.00  0.95           C  
ATOM   1117  CD  PRO A 144     139.283  13.813 141.752  1.00  0.95           C  
ATOM   1118  N   ASP A 145     139.437  11.956 137.381  1.00  0.91           N  
ATOM   1119  CA  ASP A 145     138.621  11.338 136.343  1.00  0.91           C  
ATOM   1120  C   ASP A 145     137.927  10.078 136.804  1.00  0.91           C  
ATOM   1121  O   ASP A 145     136.771   9.825 136.463  1.00  0.91           O  
ATOM   1122  CB  ASP A 145     139.486  11.034 135.086  1.00  0.91           C  
ATOM   1123  CG  ASP A 145     139.614  12.277 134.218  1.00  0.91           C  
ATOM   1124  OD1 ASP A 145     139.132  13.346 134.681  1.00  0.91           O  
ATOM   1125  OD2 ASP A 145     140.177  12.205 133.098  1.00  0.91           O  
ATOM   1126  N   HIS A 146     138.617   9.273 137.638  1.00  0.87           N  
ATOM   1127  CA  HIS A 146     138.046   8.085 138.235  1.00  0.87           C  
ATOM   1128  C   HIS A 146     136.833   8.418 139.097  1.00  0.87           C  
ATOM   1129  O   HIS A 146     135.795   7.784 138.973  1.00  0.87           O  
ATOM   1130  CB  HIS A 146     139.099   7.256 139.021  1.00  0.87           C  
ATOM   1131  CG  HIS A 146     139.500   7.804 140.355  1.00  0.87           C  
ATOM   1132  ND1 HIS A 146     140.621   8.600 140.478  1.00  0.87           N  
ATOM   1133  CD2 HIS A 146     138.926   7.600 141.570  1.00  0.87           C  
ATOM   1134  CE1 HIS A 146     140.715   8.854 141.772  1.00  0.87           C  
ATOM   1135  NE2 HIS A 146     139.711   8.277 142.473  1.00  0.87           N  
ATOM   1136  N   LEU A 147     136.900   9.488 139.919  1.00  0.87           N  
ATOM   1137  CA  LEU A 147     135.795   9.914 140.761  1.00  0.87           C  
ATOM   1138  C   LEU A 147     134.573  10.385 139.981  1.00  0.87           C  
ATOM   1139  O   LEU A 147     133.437  10.088 140.340  1.00  0.87           O  
ATOM   1140  CB  LEU A 147     136.259  11.010 141.746  1.00  0.87           C  
ATOM   1141  CG  LEU A 147     135.202  11.485 142.764  1.00  0.87           C  
ATOM   1142  CD1 LEU A 147     134.696  10.344 143.662  1.00  0.87           C  
ATOM   1143  CD2 LEU A 147     135.770  12.623 143.622  1.00  0.87           C  
ATOM   1144  N   ILE A 148     134.762  11.124 138.868  1.00  0.91           N  
ATOM   1145  CA  ILE A 148     133.664  11.496 137.977  1.00  0.91           C  
ATOM   1146  C   ILE A 148     133.000  10.275 137.343  1.00  0.91           C  
ATOM   1147  O   ILE A 148     131.777  10.164 137.293  1.00  0.91           O  
ATOM   1148  CB  ILE A 148     134.145  12.471 136.907  1.00  0.91           C  
ATOM   1149  CG1 ILE A 148     134.629  13.798 137.534  1.00  0.91           C  
ATOM   1150  CG2 ILE A 148     133.051  12.774 135.851  1.00  0.91           C  
ATOM   1151  CD1 ILE A 148     135.653  14.517 136.650  1.00  0.91           C  
ATOM   1152  N   LYS A 149     133.784   9.284 136.891  1.00  0.89           N  
ATOM   1153  CA  LYS A 149     133.247   8.001 136.470  1.00  0.89           C  
ATOM   1154  C   LYS A 149     132.498   7.239 137.562  1.00  0.89           C  
ATOM   1155  O   LYS A 149     131.380   6.782 137.337  1.00  0.89           O  
ATOM   1156  CB  LYS A 149     134.417   7.132 135.976  1.00  0.89           C  
ATOM   1157  CG  LYS A 149     134.974   7.576 134.619  1.00  0.89           C  
ATOM   1158  CD  LYS A 149     136.417   7.092 134.402  1.00  0.89           C  
ATOM   1159  CE  LYS A 149     136.765   6.800 132.945  1.00  0.89           C  
ATOM   1160  NZ  LYS A 149     136.018   5.592 132.518  1.00  0.89           N  
ATOM   1161  N   ASP A 150     133.053   7.137 138.786  1.00  0.92           N  
ATOM   1162  CA  ASP A 150     132.392   6.511 139.918  1.00  0.92           C  
ATOM   1163  C   ASP A 150     131.060   7.170 140.307  1.00  0.92           C  
ATOM   1164  O   ASP A 150     130.066   6.494 140.573  1.00  0.92           O  
ATOM   1165  CB  ASP A 150     133.360   6.532 141.132  1.00  0.92           C  
ATOM   1166  CG  ASP A 150     134.425   5.442 141.063  1.00  0.92           C  
ATOM   1167  OD1 ASP A 150     134.169   4.380 140.444  1.00  0.92           O  
ATOM   1168  OD2 ASP A 150     135.506   5.663 141.672  1.00  0.92           O  
ATOM   1169  N   LEU A 151     130.995   8.519 140.335  1.00  0.94           N  
ATOM   1170  CA  LEU A 151     129.767   9.258 140.604  1.00  0.94           C  
ATOM   1171  C   LEU A 151     128.668   9.115 139.545  1.00  0.94           C  
ATOM   1172  O   LEU A 151     127.493   8.962 139.884  1.00  0.94           O  
ATOM   1173  CB  LEU A 151     130.051  10.774 140.779  1.00  0.94           C  
ATOM   1174  CG  LEU A 151     130.794  11.160 142.075  1.00  0.94           C  
ATOM   1175  CD1 LEU A 151     131.434  12.549 141.911  1.00  0.94           C  
ATOM   1176  CD2 LEU A 151     129.872  11.138 143.309  1.00  0.94           C  
ATOM   1177  N   PHE A 152     129.016   9.198 138.240  1.00  0.92           N  
ATOM   1178  CA  PHE A 152     128.033   9.358 137.172  1.00  0.92           C  
ATOM   1179  C   PHE A 152     127.954   8.198 136.173  1.00  0.92           C  
ATOM   1180  O   PHE A 152     127.088   8.204 135.297  1.00  0.92           O  
ATOM   1181  CB  PHE A 152     128.305  10.644 136.346  1.00  0.92           C  
ATOM   1182  CG  PHE A 152     128.433  11.843 137.240  1.00  0.92           C  
ATOM   1183  CD1 PHE A 152     127.350  12.372 137.963  1.00  0.92           C  
ATOM   1184  CD2 PHE A 152     129.688  12.441 137.376  1.00  0.92           C  
ATOM   1185  CE1 PHE A 152     127.538  13.471 138.813  1.00  0.92           C  
ATOM   1186  CE2 PHE A 152     129.892  13.515 138.242  1.00  0.92           C  
ATOM   1187  CZ  PHE A 152     128.810  14.034 138.953  1.00  0.92           C  
ATOM   1188  N   GLY A 153     128.807   7.153 136.263  1.00  0.96           N  
ATOM   1189  CA  GLY A 153     128.803   6.048 135.301  1.00  0.96           C  
ATOM   1190  C   GLY A 153     129.485   6.367 133.989  1.00  0.96           C  
ATOM   1191  O   GLY A 153     130.197   7.357 133.858  1.00  0.96           O  
ATOM   1192  N   ASP A 154     129.299   5.502 132.970  1.00  0.92           N  
ATOM   1193  CA  ASP A 154     129.998   5.609 131.700  1.00  0.92           C  
ATOM   1194  C   ASP A 154     129.061   6.006 130.548  1.00  0.92           C  
ATOM   1195  O   ASP A 154     129.444   6.011 129.378  1.00  0.92           O  
ATOM   1196  CB  ASP A 154     130.716   4.265 131.409  1.00  0.92           C  
ATOM   1197  CG  ASP A 154     131.524   3.857 132.638  1.00  0.92           C  
ATOM   1198  OD1 ASP A 154     132.725   4.272 132.725  1.00  0.92           O  
ATOM   1199  OD2 ASP A 154     130.931   3.180 133.523  1.00  0.92           O  
ATOM   1200  N   LYS A 155     127.792   6.376 130.852  1.00  0.89           N  
ATOM   1201  CA  LYS A 155     126.771   6.681 129.852  1.00  0.89           C  
ATOM   1202  C   LYS A 155     126.408   8.168 129.770  1.00  0.89           C  
ATOM   1203  O   LYS A 155     127.263   9.031 129.561  1.00  0.89           O  
ATOM   1204  CB  LYS A 155     125.513   5.787 130.008  1.00  0.89           C  
ATOM   1205  CG  LYS A 155     125.839   4.294 129.838  1.00  0.89           C  
ATOM   1206  CD  LYS A 155     124.587   3.405 129.845  1.00  0.89           C  
ATOM   1207  CE  LYS A 155     124.885   1.982 130.330  1.00  0.89           C  
ATOM   1208  NZ  LYS A 155     123.665   1.379 130.903  1.00  0.89           N  
ATOM   1209  N   GLU A 156     125.102   8.515 129.871  1.00  0.92           N  
ATOM   1210  CA  GLU A 156     124.632   9.891 129.937  1.00  0.92           C  
ATOM   1211  C   GLU A 156     125.030  10.588 131.238  1.00  0.92           C  
ATOM   1212  O   GLU A 156     125.052   9.979 132.304  1.00  0.92           O  
ATOM   1213  CB  GLU A 156     123.107  10.015 129.709  1.00  0.92           C  
ATOM   1214  CG  GLU A 156     122.705  11.441 129.270  1.00  0.92           C  
ATOM   1215  CD  GLU A 156     121.263  11.571 128.871  1.00  0.92           C  
ATOM   1216  OE1 GLU A 156     120.536  10.552 128.774  1.00  0.92           O  
ATOM   1217  OE2 GLU A 156     120.863  12.734 128.598  1.00  0.92           O  
ATOM   1218  N   PHE A 157     125.362  11.895 131.193  1.00  0.94           N  
ATOM   1219  CA  PHE A 157     125.676  12.662 132.384  1.00  0.94           C  
ATOM   1220  C   PHE A 157     124.387  13.166 133.031  1.00  0.94           C  
ATOM   1221  O   PHE A 157     123.826  14.186 132.630  1.00  0.94           O  
ATOM   1222  CB  PHE A 157     126.608  13.849 132.015  1.00  0.94           C  
ATOM   1223  CG  PHE A 157     126.975  14.714 133.195  1.00  0.94           C  
ATOM   1224  CD1 PHE A 157     127.779  14.213 134.230  1.00  0.94           C  
ATOM   1225  CD2 PHE A 157     126.532  16.047 133.267  1.00  0.94           C  
ATOM   1226  CE1 PHE A 157     128.137  15.030 135.309  1.00  0.94           C  
ATOM   1227  CE2 PHE A 157     126.903  16.866 134.341  1.00  0.94           C  
ATOM   1228  CZ  PHE A 157     127.700  16.355 135.368  1.00  0.94           C  
ATOM   1229  N   LEU A 158     123.903  12.453 134.068  1.00  0.94           N  
ATOM   1230  CA  LEU A 158     122.681  12.770 134.782  1.00  0.94           C  
ATOM   1231  C   LEU A 158     122.978  12.978 136.271  1.00  0.94           C  
ATOM   1232  O   LEU A 158     122.851  12.045 137.066  1.00  0.94           O  
ATOM   1233  CB  LEU A 158     121.687  11.599 134.599  1.00  0.94           C  
ATOM   1234  CG  LEU A 158     121.214  11.429 133.138  1.00  0.94           C  
ATOM   1235  CD1 LEU A 158     120.623  10.035 132.883  1.00  0.94           C  
ATOM   1236  CD2 LEU A 158     120.204  12.517 132.739  1.00  0.94           C  
ATOM   1237  N   PRO A 159     123.411  14.156 136.719  1.00  0.94           N  
ATOM   1238  CA  PRO A 159     123.670  14.413 138.126  1.00  0.94           C  
ATOM   1239  C   PRO A 159     122.381  14.626 138.901  1.00  0.94           C  
ATOM   1240  O   PRO A 159     121.494  15.345 138.447  1.00  0.94           O  
ATOM   1241  CB  PRO A 159     124.521  15.695 138.121  1.00  0.94           C  
ATOM   1242  CG  PRO A 159     124.131  16.414 136.826  1.00  0.94           C  
ATOM   1243  CD  PRO A 159     123.778  15.279 135.867  1.00  0.94           C  
ATOM   1244  N   GLN A 160     122.281  14.031 140.107  1.00  0.86           N  
ATOM   1245  CA  GLN A 160     121.125  14.145 140.971  1.00  0.86           C  
ATOM   1246  C   GLN A 160     121.212  15.354 141.886  1.00  0.86           C  
ATOM   1247  O   GLN A 160     122.245  16.013 141.999  1.00  0.86           O  
ATOM   1248  CB  GLN A 160     120.956  12.859 141.827  1.00  0.86           C  
ATOM   1249  CG  GLN A 160     120.610  11.599 140.997  1.00  0.86           C  
ATOM   1250  CD  GLN A 160     119.262  11.750 140.298  1.00  0.86           C  
ATOM   1251  OE1 GLN A 160     119.189  12.102 139.119  1.00  0.86           O  
ATOM   1252  NE2 GLN A 160     118.148  11.498 141.015  1.00  0.86           N  
ATOM   1253  N   SER A 161     120.099  15.643 142.603  1.00  0.91           N  
ATOM   1254  CA  SER A 161     119.875  16.853 143.401  1.00  0.91           C  
ATOM   1255  C   SER A 161     120.972  17.171 144.409  1.00  0.91           C  
ATOM   1256  O   SER A 161     121.415  18.311 144.551  1.00  0.91           O  
ATOM   1257  CB  SER A 161     118.524  16.740 144.164  1.00  0.91           C  
ATOM   1258  OG  SER A 161     118.062  18.006 144.634  1.00  0.91           O  
ATOM   1259  N   ALA A 162     121.491  16.140 145.105  1.00  0.88           N  
ATOM   1260  CA  ALA A 162     122.590  16.259 146.041  1.00  0.88           C  
ATOM   1261  C   ALA A 162     123.899  16.766 145.433  1.00  0.88           C  
ATOM   1262  O   ALA A 162     124.585  17.601 146.021  1.00  0.88           O  
ATOM   1263  CB  ALA A 162     122.816  14.893 146.720  1.00  0.88           C  
ATOM   1264  N   PHE A 163     124.266  16.301 144.219  1.00  0.90           N  
ATOM   1265  CA  PHE A 163     125.450  16.765 143.523  1.00  0.90           C  
ATOM   1266  C   PHE A 163     125.325  18.226 143.106  1.00  0.90           C  
ATOM   1267  O   PHE A 163     126.246  19.016 143.287  1.00  0.90           O  
ATOM   1268  CB  PHE A 163     125.757  15.860 142.298  1.00  0.90           C  
ATOM   1269  CG  PHE A 163     127.109  16.203 141.734  1.00  0.90           C  
ATOM   1270  CD1 PHE A 163     128.265  15.821 142.429  1.00  0.90           C  
ATOM   1271  CD2 PHE A 163     127.236  16.993 140.580  1.00  0.90           C  
ATOM   1272  CE1 PHE A 163     129.528  16.238 141.996  1.00  0.90           C  
ATOM   1273  CE2 PHE A 163     128.499  17.412 140.143  1.00  0.90           C  
ATOM   1274  CZ  PHE A 163     129.645  17.042 140.859  1.00  0.90           C  
ATOM   1275  N   LEU A 164     124.160  18.633 142.571  1.00  0.92           N  
ATOM   1276  CA  LEU A 164     123.896  20.005 142.177  1.00  0.92           C  
ATOM   1277  C   LEU A 164     123.884  20.963 143.359  1.00  0.92           C  
ATOM   1278  O   LEU A 164     124.401  22.075 143.277  1.00  0.92           O  
ATOM   1279  CB  LEU A 164     122.596  20.092 141.353  1.00  0.92           C  
ATOM   1280  CG  LEU A 164     122.572  19.147 140.132  1.00  0.92           C  
ATOM   1281  CD1 LEU A 164     121.154  19.044 139.554  1.00  0.92           C  
ATOM   1282  CD2 LEU A 164     123.563  19.577 139.040  1.00  0.92           C  
ATOM   1283  N   LYS A 165     123.366  20.520 144.525  1.00  0.89           N  
ATOM   1284  CA  LYS A 165     123.525  21.240 145.780  1.00  0.89           C  
ATOM   1285  C   LYS A 165     124.979  21.462 146.177  1.00  0.89           C  
ATOM   1286  O   LYS A 165     125.354  22.567 146.558  1.00  0.89           O  
ATOM   1287  CB  LYS A 165     122.842  20.467 146.942  1.00  0.89           C  
ATOM   1288  CG  LYS A 165     121.324  20.677 147.030  1.00  0.89           C  
ATOM   1289  CD  LYS A 165     120.896  21.482 148.274  1.00  0.89           C  
ATOM   1290  CE  LYS A 165     120.837  20.639 149.556  1.00  0.89           C  
ATOM   1291  NZ  LYS A 165     120.318  21.445 150.686  1.00  0.89           N  
ATOM   1292  N   TRP A 166     125.830  20.421 146.073  1.00  0.89           N  
ATOM   1293  CA  TRP A 166     127.264  20.503 146.295  1.00  0.89           C  
ATOM   1294  C   TRP A 166     127.997  21.388 145.296  1.00  0.89           C  
ATOM   1295  O   TRP A 166     128.918  22.120 145.653  1.00  0.89           O  
ATOM   1296  CB  TRP A 166     127.897  19.088 146.299  1.00  0.89           C  
ATOM   1297  CG  TRP A 166     129.407  19.073 146.540  1.00  0.89           C  
ATOM   1298  CD1 TRP A 166     130.093  19.210 147.712  1.00  0.89           C  
ATOM   1299  CD2 TRP A 166     130.401  19.048 145.496  1.00  0.89           C  
ATOM   1300  NE1 TRP A 166     131.455  19.246 147.478  1.00  0.89           N  
ATOM   1301  CE2 TRP A 166     131.660  19.149 146.117  1.00  0.89           C  
ATOM   1302  CE3 TRP A 166     130.289  18.949 144.112  1.00  0.89           C  
ATOM   1303  CZ2 TRP A 166     132.833  19.133 145.366  1.00  0.89           C  
ATOM   1304  CZ3 TRP A 166     131.470  18.936 143.359  1.00  0.89           C  
ATOM   1305  CH2 TRP A 166     132.722  19.022 143.972  1.00  0.89           C  
ATOM   1306  N   LEU A 167     127.624  21.332 144.011  1.00  0.94           N  
ATOM   1307  CA  LEU A 167     128.159  22.179 142.966  1.00  0.94           C  
ATOM   1308  C   LEU A 167     127.816  23.651 143.164  1.00  0.94           C  
ATOM   1309  O   LEU A 167     128.626  24.542 142.904  1.00  0.94           O  
ATOM   1310  CB  LEU A 167     127.678  21.646 141.597  1.00  0.94           C  
ATOM   1311  CG  LEU A 167     128.743  21.645 140.487  1.00  0.94           C  
ATOM   1312  CD1 LEU A 167     129.941  20.756 140.852  1.00  0.94           C  
ATOM   1313  CD2 LEU A 167     128.114  21.156 139.174  1.00  0.94           C  
ATOM   1314  N   GLY A 168     126.590  23.908 143.661  1.00  0.96           N  
ATOM   1315  CA  GLY A 168     126.037  25.208 144.001  1.00  0.96           C  
ATOM   1316  C   GLY A 168     126.394  25.781 145.359  1.00  0.96           C  
ATOM   1317  O   GLY A 168     125.954  26.888 145.679  1.00  0.96           O  
ATOM   1318  N   THR A 169     127.185  25.073 146.204  1.00  0.90           N  
ATOM   1319  CA  THR A 169     127.614  25.559 147.527  1.00  0.90           C  
ATOM   1320  C   THR A 169     128.347  26.884 147.512  1.00  0.90           C  
ATOM   1321  O   THR A 169     129.462  27.012 147.018  1.00  0.90           O  
ATOM   1322  CB  THR A 169     128.465  24.632 148.411  1.00  0.90           C  
ATOM   1323  OG1 THR A 169     129.587  24.045 147.765  1.00  0.90           O  
ATOM   1324  CG2 THR A 169     127.605  23.470 148.890  1.00  0.90           C  
ATOM   1325  N   HIS A 170     127.704  27.922 148.081  1.00  0.87           N  
ATOM   1326  CA  HIS A 170     128.181  29.291 148.147  1.00  0.87           C  
ATOM   1327  C   HIS A 170     128.856  29.888 146.917  1.00  0.87           C  
ATOM   1328  O   HIS A 170     129.945  30.454 146.964  1.00  0.87           O  
ATOM   1329  CB  HIS A 170     128.868  29.632 149.482  1.00  0.87           C  
ATOM   1330  CG  HIS A 170     127.862  30.016 150.526  1.00  0.87           C  
ATOM   1331  ND1 HIS A 170     127.192  29.044 151.235  1.00  0.87           N  
ATOM   1332  CD2 HIS A 170     127.469  31.253 150.936  1.00  0.87           C  
ATOM   1333  CE1 HIS A 170     126.419  29.701 152.079  1.00  0.87           C  
ATOM   1334  NE2 HIS A 170     126.547  31.042 151.935  1.00  0.87           N  
ATOM   1335  N   VAL A 171     128.125  29.823 145.788  1.00  0.92           N  
ATOM   1336  CA  VAL A 171     128.548  30.370 144.510  1.00  0.92           C  
ATOM   1337  C   VAL A 171     127.325  30.889 143.775  1.00  0.92           C  
ATOM   1338  O   VAL A 171     127.404  31.626 142.796  1.00  0.92           O  
ATOM   1339  CB  VAL A 171     129.266  29.279 143.712  1.00  0.92           C  
ATOM   1340  CG1 VAL A 171     128.288  28.251 143.107  1.00  0.92           C  
ATOM   1341  CG2 VAL A 171     130.197  29.862 142.633  1.00  0.92           C  
ATOM   1342  N   CYS A 172     126.125  30.564 144.296  1.00  0.92           N  
ATOM   1343  CA  CYS A 172     124.855  30.904 143.703  1.00  0.92           C  
ATOM   1344  C   CYS A 172     123.972  31.489 144.793  1.00  0.92           C  
ATOM   1345  O   CYS A 172     122.839  31.074 145.016  1.00  0.92           O  
ATOM   1346  CB  CYS A 172     124.273  29.603 143.098  1.00  0.92           C  
ATOM   1347  SG  CYS A 172     123.140  29.845 141.692  1.00  0.92           S  
ATOM   1348  N   THR A 173     124.525  32.457 145.563  1.00  0.90           N  
ATOM   1349  CA  THR A 173     123.928  32.878 146.833  1.00  0.90           C  
ATOM   1350  C   THR A 173     123.482  34.329 146.855  1.00  0.90           C  
ATOM   1351  O   THR A 173     122.715  34.754 147.715  1.00  0.90           O  
ATOM   1352  CB  THR A 173     124.883  32.582 147.988  1.00  0.90           C  
ATOM   1353  OG1 THR A 173     124.234  32.586 149.249  1.00  0.90           O  
ATOM   1354  CG2 THR A 173     126.059  33.565 148.061  1.00  0.90           C  
ATOM   1355  N   HIS A 174     123.888  35.133 145.855  1.00  0.84           N  
ATOM   1356  CA  HIS A 174     123.502  36.532 145.752  1.00  0.84           C  
ATOM   1357  C   HIS A 174     122.609  36.686 144.549  1.00  0.84           C  
ATOM   1358  O   HIS A 174     122.855  37.495 143.661  1.00  0.84           O  
ATOM   1359  CB  HIS A 174     124.725  37.465 145.647  1.00  0.84           C  
ATOM   1360  CG  HIS A 174     125.452  37.594 146.947  1.00  0.84           C  
ATOM   1361  ND1 HIS A 174     126.691  38.193 146.955  1.00  0.84           N  
ATOM   1362  CD2 HIS A 174     125.060  37.303 148.218  1.00  0.84           C  
ATOM   1363  CE1 HIS A 174     127.036  38.257 148.226  1.00  0.84           C  
ATOM   1364  NE2 HIS A 174     126.084  37.731 149.031  1.00  0.84           N  
ATOM   1365  N   VAL A 175     121.554  35.860 144.510  1.00  0.88           N  
ATOM   1366  CA  VAL A 175     120.683  35.662 143.375  1.00  0.88           C  
ATOM   1367  C   VAL A 175     119.276  35.713 143.925  1.00  0.88           C  
ATOM   1368  O   VAL A 175     119.020  35.212 145.021  1.00  0.88           O  
ATOM   1369  CB  VAL A 175     120.995  34.315 142.716  1.00  0.88           C  
ATOM   1370  CG1 VAL A 175     119.780  33.656 142.037  1.00  0.88           C  
ATOM   1371  CG2 VAL A 175     122.106  34.564 141.685  1.00  0.88           C  
ATOM   1372  N   ILE A 176     118.331  36.347 143.204  1.00  0.82           N  
ATOM   1373  CA  ILE A 176     116.946  36.457 143.634  1.00  0.82           C  
ATOM   1374  C   ILE A 176     116.176  35.172 143.362  1.00  0.82           C  
ATOM   1375  O   ILE A 176     115.444  34.678 144.219  1.00  0.82           O  
ATOM   1376  CB  ILE A 176     116.244  37.633 142.955  1.00  0.82           C  
ATOM   1377  CG1 ILE A 176     116.997  38.970 143.177  1.00  0.82           C  
ATOM   1378  CG2 ILE A 176     114.780  37.767 143.445  1.00  0.82           C  
ATOM   1379  CD1 ILE A 176     116.981  39.857 141.924  1.00  0.82           C  
ATOM   1380  N   LEU A 177     116.319  34.578 142.156  1.00  0.88           N  
ATOM   1381  CA  LEU A 177     115.540  33.407 141.779  1.00  0.88           C  
ATOM   1382  C   LEU A 177     115.848  32.117 142.526  1.00  0.88           C  
ATOM   1383  O   LEU A 177     114.932  31.431 142.973  1.00  0.88           O  
ATOM   1384  CB  LEU A 177     115.689  33.134 140.256  1.00  0.88           C  
ATOM   1385  CG  LEU A 177     114.484  33.438 139.323  1.00  0.88           C  
ATOM   1386  CD1 LEU A 177     113.338  34.259 139.930  1.00  0.88           C  
ATOM   1387  CD2 LEU A 177     114.975  34.149 138.053  1.00  0.88           C  
ATOM   1388  N   LYS A 178     117.139  31.744 142.658  1.00  0.87           N  
ATOM   1389  CA  LYS A 178     117.663  30.597 143.406  1.00  0.87           C  
ATOM   1390  C   LYS A 178     117.234  29.191 142.959  1.00  0.87           C  
ATOM   1391  O   LYS A 178     118.043  28.270 142.987  1.00  0.87           O  
ATOM   1392  CB  LYS A 178     117.485  30.787 144.934  1.00  0.87           C  
ATOM   1393  CG  LYS A 178     118.448  31.832 145.525  1.00  0.87           C  
ATOM   1394  CD  LYS A 178     118.028  32.301 146.928  1.00  0.87           C  
ATOM   1395  CE  LYS A 178     118.524  31.403 148.061  1.00  0.87           C  
ATOM   1396  NZ  LYS A 178     118.091  31.971 149.357  1.00  0.87           N  
ATOM   1397  N   GLU A 179     116.021  29.016 142.404  1.00  0.88           N  
ATOM   1398  CA  GLU A 179     115.531  27.830 141.714  1.00  0.88           C  
ATOM   1399  C   GLU A 179     116.399  27.500 140.506  1.00  0.88           C  
ATOM   1400  O   GLU A 179     116.682  26.350 140.168  1.00  0.88           O  
ATOM   1401  CB  GLU A 179     114.060  28.068 141.280  1.00  0.88           C  
ATOM   1402  CG  GLU A 179     113.046  28.087 142.451  1.00  0.88           C  
ATOM   1403  CD  GLU A 179     112.844  26.675 142.990  1.00  0.88           C  
ATOM   1404  OE1 GLU A 179     111.928  25.983 142.478  1.00  0.88           O  
ATOM   1405  OE2 GLU A 179     113.617  26.280 143.898  1.00  0.88           O  
ATOM   1406  N   LEU A 180     116.933  28.558 139.872  1.00  0.90           N  
ATOM   1407  CA  LEU A 180     117.908  28.526 138.797  1.00  0.90           C  
ATOM   1408  C   LEU A 180     119.193  27.800 139.160  1.00  0.90           C  
ATOM   1409  O   LEU A 180     119.839  27.192 138.310  1.00  0.90           O  
ATOM   1410  CB  LEU A 180     118.231  29.968 138.356  1.00  0.90           C  
ATOM   1411  CG  LEU A 180     117.354  30.489 137.201  1.00  0.90           C  
ATOM   1412  CD1 LEU A 180     115.841  30.358 137.443  1.00  0.90           C  
ATOM   1413  CD2 LEU A 180     117.758  31.937 136.888  1.00  0.90           C  
ATOM   1414  N   CYS A 181     119.576  27.805 140.447  1.00  0.93           N  
ATOM   1415  CA  CYS A 181     120.747  27.118 140.943  1.00  0.93           C  
ATOM   1416  C   CYS A 181     120.530  25.612 141.033  1.00  0.93           C  
ATOM   1417  O   CYS A 181     121.485  24.854 141.174  1.00  0.93           O  
ATOM   1418  CB  CYS A 181     121.133  27.653 142.344  1.00  0.93           C  
ATOM   1419  SG  CYS A 181     121.300  29.466 142.444  1.00  0.93           S  
ATOM   1420  N   GLY A 182     119.271  25.121 140.934  1.00  0.94           N  
ATOM   1421  CA  GLY A 182     119.003  23.695 140.787  1.00  0.94           C  
ATOM   1422  C   GLY A 182     119.110  23.210 139.365  1.00  0.94           C  
ATOM   1423  O   GLY A 182     119.157  22.011 139.103  1.00  0.94           O  
ATOM   1424  N   ASN A 183     119.159  24.131 138.386  1.00  0.92           N  
ATOM   1425  CA  ASN A 183     119.231  23.783 136.986  1.00  0.92           C  
ATOM   1426  C   ASN A 183     120.687  23.682 136.537  1.00  0.92           C  
ATOM   1427  O   ASN A 183     121.435  24.650 136.624  1.00  0.92           O  
ATOM   1428  CB  ASN A 183     118.499  24.859 136.145  1.00  0.92           C  
ATOM   1429  CG  ASN A 183     118.418  24.429 134.689  1.00  0.92           C  
ATOM   1430  OD1 ASN A 183     119.395  24.580 133.941  1.00  0.92           O  
ATOM   1431  ND2 ASN A 183     117.282  23.837 134.280  1.00  0.92           N  
ATOM   1432  N   LEU A 184     121.113  22.526 135.981  1.00  0.94           N  
ATOM   1433  CA  LEU A 184     122.492  22.278 135.587  1.00  0.94           C  
ATOM   1434  C   LEU A 184     123.090  23.283 134.594  1.00  0.94           C  
ATOM   1435  O   LEU A 184     124.227  23.725 134.754  1.00  0.94           O  
ATOM   1436  CB  LEU A 184     122.555  20.850 134.996  1.00  0.94           C  
ATOM   1437  CG  LEU A 184     123.939  20.318 134.571  1.00  0.94           C  
ATOM   1438  CD1 LEU A 184     124.947  20.259 135.731  1.00  0.94           C  
ATOM   1439  CD2 LEU A 184     123.759  18.933 133.927  1.00  0.94           C  
ATOM   1440  N   CYS A 185     122.337  23.700 133.553  1.00  0.95           N  
ATOM   1441  CA  CYS A 185     122.801  24.675 132.575  1.00  0.95           C  
ATOM   1442  C   CYS A 185     122.965  26.065 133.153  1.00  0.95           C  
ATOM   1443  O   CYS A 185     123.977  26.721 132.935  1.00  0.95           O  
ATOM   1444  CB  CYS A 185     121.850  24.747 131.356  1.00  0.95           C  
ATOM   1445  SG  CYS A 185     122.278  23.546 130.059  1.00  0.95           S  
ATOM   1446  N   PHE A 186     121.998  26.550 133.952  1.00  0.95           N  
ATOM   1447  CA  PHE A 186     122.139  27.817 134.652  1.00  0.95           C  
ATOM   1448  C   PHE A 186     123.282  27.794 135.661  1.00  0.95           C  
ATOM   1449  O   PHE A 186     124.039  28.756 135.764  1.00  0.95           O  
ATOM   1450  CB  PHE A 186     120.820  28.258 135.329  1.00  0.95           C  
ATOM   1451  CG  PHE A 186     119.856  28.860 134.340  1.00  0.95           C  
ATOM   1452  CD1 PHE A 186     119.165  28.085 133.395  1.00  0.95           C  
ATOM   1453  CD2 PHE A 186     119.615  30.241 134.367  1.00  0.95           C  
ATOM   1454  CE1 PHE A 186     118.266  28.678 132.501  1.00  0.95           C  
ATOM   1455  CE2 PHE A 186     118.742  30.846 133.461  1.00  0.95           C  
ATOM   1456  CZ  PHE A 186     118.062  30.063 132.526  1.00  0.95           C  
ATOM   1457  N   LEU A 187     123.463  26.671 136.385  1.00  0.94           N  
ATOM   1458  CA  LEU A 187     124.587  26.465 137.281  1.00  0.94           C  
ATOM   1459  C   LEU A 187     125.972  26.521 136.647  1.00  0.94           C  
ATOM   1460  O   LEU A 187     126.855  27.227 137.121  1.00  0.94           O  
ATOM   1461  CB  LEU A 187     124.480  25.068 137.946  1.00  0.94           C  
ATOM   1462  CG  LEU A 187     124.442  25.036 139.483  1.00  0.94           C  
ATOM   1463  CD1 LEU A 187     124.645  23.581 139.930  1.00  0.94           C  
ATOM   1464  CD2 LEU A 187     125.474  25.932 140.186  1.00  0.94           C  
ATOM   1465  N   LEU A 188     126.215  25.765 135.558  1.00  0.96           N  
ATOM   1466  CA  LEU A 188     127.528  25.705 134.940  1.00  0.96           C  
ATOM   1467  C   LEU A 188     127.873  26.939 134.140  1.00  0.96           C  
ATOM   1468  O   LEU A 188     129.035  27.345 134.077  1.00  0.96           O  
ATOM   1469  CB  LEU A 188     127.675  24.480 134.013  1.00  0.96           C  
ATOM   1470  CG  LEU A 188     127.548  23.109 134.708  1.00  0.96           C  
ATOM   1471  CD1 LEU A 188     127.620  21.998 133.650  1.00  0.96           C  
ATOM   1472  CD2 LEU A 188     128.609  22.876 135.795  1.00  0.96           C  
ATOM   1473  N   CYS A 189     126.869  27.534 133.475  1.00  0.95           N  
ATOM   1474  CA  CYS A 189     127.054  28.659 132.590  1.00  0.95           C  
ATOM   1475  C   CYS A 189     127.048  30.006 133.298  1.00  0.95           C  
ATOM   1476  O   CYS A 189     127.892  30.855 133.020  1.00  0.95           O  
ATOM   1477  CB  CYS A 189     125.964  28.625 131.492  1.00  0.95           C  
ATOM   1478  SG  CYS A 189     126.044  27.093 130.491  1.00  0.95           S  
ATOM   1479  N   GLY A 190     126.114  30.231 134.247  1.00  0.99           N  
ATOM   1480  CA  GLY A 190     125.903  31.526 134.890  1.00  0.99           C  
ATOM   1481  C   GLY A 190     124.883  32.379 134.176  1.00  0.99           C  
ATOM   1482  O   GLY A 190     124.730  32.338 132.955  1.00  0.99           O  
ATOM   1483  N   PHE A 191     124.145  33.197 134.952  1.00  0.95           N  
ATOM   1484  CA  PHE A 191     123.041  34.001 134.473  1.00  0.95           C  
ATOM   1485  C   PHE A 191     123.047  35.403 135.065  1.00  0.95           C  
ATOM   1486  O   PHE A 191     123.134  35.589 136.275  1.00  0.95           O  
ATOM   1487  CB  PHE A 191     121.672  33.335 134.806  1.00  0.95           C  
ATOM   1488  CG  PHE A 191     121.606  32.804 136.225  1.00  0.95           C  
ATOM   1489  CD1 PHE A 191     122.128  31.537 136.538  1.00  0.95           C  
ATOM   1490  CD2 PHE A 191     121.011  33.550 137.254  1.00  0.95           C  
ATOM   1491  CE1 PHE A 191     122.031  31.013 137.830  1.00  0.95           C  
ATOM   1492  CE2 PHE A 191     120.915  33.033 138.551  1.00  0.95           C  
ATOM   1493  CZ  PHE A 191     121.418  31.760 138.839  1.00  0.95           C  
ATOM   1494  N   ASN A 192     122.892  36.431 134.205  1.00  0.95           N  
ATOM   1495  CA  ASN A 192     122.781  37.808 134.630  1.00  0.95           C  
ATOM   1496  C   ASN A 192     121.312  38.141 134.904  1.00  0.95           C  
ATOM   1497  O   ASN A 192     120.485  38.218 133.997  1.00  0.95           O  
ATOM   1498  CB  ASN A 192     123.363  38.682 133.489  1.00  0.95           C  
ATOM   1499  CG  ASN A 192     123.257  40.183 133.711  1.00  0.95           C  
ATOM   1500  OD1 ASN A 192     122.971  40.651 134.821  1.00  0.95           O  
ATOM   1501  ND2 ASN A 192     123.435  40.943 132.607  1.00  0.95           N  
ATOM   1502  N   GLU A 193     120.940  38.385 136.182  1.00  0.92           N  
ATOM   1503  CA  GLU A 193     119.563  38.678 136.556  1.00  0.92           C  
ATOM   1504  C   GLU A 193     119.087  40.068 136.123  1.00  0.92           C  
ATOM   1505  O   GLU A 193     117.889  40.306 136.006  1.00  0.92           O  
ATOM   1506  CB  GLU A 193     119.320  38.438 138.072  1.00  0.92           C  
ATOM   1507  CG  GLU A 193     119.167  36.934 138.443  1.00  0.92           C  
ATOM   1508  CD  GLU A 193     118.726  36.696 139.888  1.00  0.92           C  
ATOM   1509  OE1 GLU A 193     119.324  37.300 140.812  1.00  0.92           O  
ATOM   1510  OE2 GLU A 193     117.803  35.866 140.107  1.00  0.92           O  
ATOM   1511  N   ARG A 194     120.001  41.010 135.788  1.00  0.88           N  
ATOM   1512  CA  ARG A 194     119.652  42.298 135.188  1.00  0.88           C  
ATOM   1513  C   ARG A 194     119.019  42.169 133.811  1.00  0.88           C  
ATOM   1514  O   ARG A 194     118.216  43.008 133.403  1.00  0.88           O  
ATOM   1515  CB  ARG A 194     120.907  43.206 135.060  1.00  0.88           C  
ATOM   1516  CG  ARG A 194     121.311  43.922 136.362  1.00  0.88           C  
ATOM   1517  CD  ARG A 194     122.833  44.095 136.510  1.00  0.88           C  
ATOM   1518  NE  ARG A 194     123.289  45.342 135.815  1.00  0.88           N  
ATOM   1519  CZ  ARG A 194     124.102  46.268 136.342  1.00  0.88           C  
ATOM   1520  NH1 ARG A 194     124.496  47.272 135.564  1.00  0.88           N  
ATOM   1521  NH2 ARG A 194     124.601  46.143 137.569  1.00  0.88           N  
ATOM   1522  N   ASN A 195     119.389  41.113 133.065  1.00  0.94           N  
ATOM   1523  CA  ASN A 195     119.154  41.024 131.653  1.00  0.94           C  
ATOM   1524  C   ASN A 195     118.360  39.772 131.280  1.00  0.94           C  
ATOM   1525  O   ASN A 195     118.308  39.370 130.122  1.00  0.94           O  
ATOM   1526  CB  ASN A 195     120.538  41.044 130.990  1.00  0.94           C  
ATOM   1527  CG  ASN A 195     120.422  41.351 129.517  1.00  0.94           C  
ATOM   1528  OD1 ASN A 195     119.481  42.023 129.076  1.00  0.94           O  
ATOM   1529  ND2 ASN A 195     121.391  40.870 128.722  1.00  0.94           N  
ATOM   1530  N   LEU A 196     117.690  39.113 132.246  1.00  0.94           N  
ATOM   1531  CA  LEU A 196     116.941  37.901 131.962  1.00  0.94           C  
ATOM   1532  C   LEU A 196     115.459  38.145 132.146  1.00  0.94           C  
ATOM   1533  O   LEU A 196     115.017  38.827 133.067  1.00  0.94           O  
ATOM   1534  CB  LEU A 196     117.363  36.706 132.854  1.00  0.94           C  
ATOM   1535  CG  LEU A 196     117.027  35.314 132.266  1.00  0.94           C  
ATOM   1536  CD1 LEU A 196     118.012  34.933 131.145  1.00  0.94           C  
ATOM   1537  CD2 LEU A 196     117.022  34.245 133.368  1.00  0.94           C  
ATOM   1538  N   ASN A 197     114.620  37.561 131.265  1.00  0.91           N  
ATOM   1539  CA  ASN A 197     113.186  37.586 131.448  1.00  0.91           C  
ATOM   1540  C   ASN A 197     112.819  36.523 132.480  1.00  0.91           C  
ATOM   1541  O   ASN A 197     112.701  35.341 132.164  1.00  0.91           O  
ATOM   1542  CB  ASN A 197     112.479  37.357 130.082  1.00  0.91           C  
ATOM   1543  CG  ASN A 197     110.971  37.544 130.177  1.00  0.91           C  
ATOM   1544  OD1 ASN A 197     110.389  37.654 131.260  1.00  0.91           O  
ATOM   1545  ND2 ASN A 197     110.284  37.584 129.015  1.00  0.91           N  
ATOM   1546  N   MET A 198     112.620  36.942 133.748  1.00  0.91           N  
ATOM   1547  CA  MET A 198     112.381  36.047 134.861  1.00  0.91           C  
ATOM   1548  C   MET A 198     111.017  35.368 134.802  1.00  0.91           C  
ATOM   1549  O   MET A 198     110.804  34.313 135.393  1.00  0.91           O  
ATOM   1550  CB  MET A 198     112.588  36.790 136.201  1.00  0.91           C  
ATOM   1551  CG  MET A 198     113.960  37.491 136.298  1.00  0.91           C  
ATOM   1552  SD  MET A 198     114.494  37.824 138.008  1.00  0.91           S  
ATOM   1553  CE  MET A 198     114.892  39.576 137.766  1.00  0.91           C  
ATOM   1554  N   SER A 199     110.085  35.918 134.001  1.00  0.94           N  
ATOM   1555  CA  SER A 199     108.800  35.308 133.694  1.00  0.94           C  
ATOM   1556  C   SER A 199     108.895  34.181 132.680  1.00  0.94           C  
ATOM   1557  O   SER A 199     107.977  33.379 132.542  1.00  0.94           O  
ATOM   1558  CB  SER A 199     107.818  36.338 133.090  1.00  0.94           C  
ATOM   1559  OG  SER A 199     107.673  37.459 133.962  1.00  0.94           O  
ATOM   1560  N   ARG A 200     110.017  34.077 131.932  1.00  0.84           N  
ATOM   1561  CA  ARG A 200     110.214  33.029 130.944  1.00  0.84           C  
ATOM   1562  C   ARG A 200     111.088  31.903 131.469  1.00  0.84           C  
ATOM   1563  O   ARG A 200     111.442  30.991 130.721  1.00  0.84           O  
ATOM   1564  CB  ARG A 200     110.841  33.569 129.631  1.00  0.84           C  
ATOM   1565  CG  ARG A 200     109.813  33.960 128.550  1.00  0.84           C  
ATOM   1566  CD  ARG A 200     110.432  34.013 127.137  1.00  0.84           C  
ATOM   1567  NE  ARG A 200     110.111  32.753 126.383  1.00  0.84           N  
ATOM   1568  CZ  ARG A 200     108.959  32.516 125.741  1.00  0.84           C  
ATOM   1569  NH1 ARG A 200     107.957  33.388 125.760  1.00  0.84           N  
ATOM   1570  NH2 ARG A 200     108.831  31.400 125.029  1.00  0.84           N  
ATOM   1571  N   VAL A 201     111.419  31.903 132.776  1.00  0.92           N  
ATOM   1572  CA  VAL A 201     112.287  30.917 133.409  1.00  0.92           C  
ATOM   1573  C   VAL A 201     111.906  29.470 133.152  1.00  0.92           C  
ATOM   1574  O   VAL A 201     112.765  28.675 132.779  1.00  0.92           O  
ATOM   1575  CB  VAL A 201     112.401  31.219 134.900  1.00  0.92           C  
ATOM   1576  CG1 VAL A 201     112.653  29.983 135.794  1.00  0.92           C  
ATOM   1577  CG2 VAL A 201     113.540  32.244 135.058  1.00  0.92           C  
ATOM   1578  N   ASP A 202     110.615  29.102 133.255  1.00  0.91           N  
ATOM   1579  CA  ASP A 202     110.133  27.758 132.994  1.00  0.91           C  
ATOM   1580  C   ASP A 202     110.378  27.265 131.577  1.00  0.91           C  
ATOM   1581  O   ASP A 202     110.642  26.084 131.353  1.00  0.91           O  
ATOM   1582  CB  ASP A 202     108.651  27.630 133.411  1.00  0.91           C  
ATOM   1583  CG  ASP A 202     108.529  27.637 134.931  1.00  0.91           C  
ATOM   1584  OD1 ASP A 202     109.578  27.583 135.622  1.00  0.91           O  
ATOM   1585  OD2 ASP A 202     107.369  27.699 135.403  1.00  0.91           O  
ATOM   1586  N   VAL A 203     110.361  28.148 130.559  1.00  0.95           N  
ATOM   1587  CA  VAL A 203     110.747  27.751 129.216  1.00  0.95           C  
ATOM   1588  C   VAL A 203     112.218  27.359 129.157  1.00  0.95           C  
ATOM   1589  O   VAL A 203     112.586  26.306 128.637  1.00  0.95           O  
ATOM   1590  CB  VAL A 203     110.467  28.853 128.200  1.00  0.95           C  
ATOM   1591  CG1 VAL A 203     110.793  28.366 126.772  1.00  0.95           C  
ATOM   1592  CG2 VAL A 203     108.987  29.278 128.293  1.00  0.95           C  
ATOM   1593  N   TYR A 204     113.102  28.179 129.753  1.00  0.92           N  
ATOM   1594  CA  TYR A 204     114.527  27.910 129.795  1.00  0.92           C  
ATOM   1595  C   TYR A 204     114.873  26.670 130.618  1.00  0.92           C  
ATOM   1596  O   TYR A 204     115.672  25.835 130.203  1.00  0.92           O  
ATOM   1597  CB  TYR A 204     115.300  29.118 130.373  1.00  0.92           C  
ATOM   1598  CG  TYR A 204     114.949  30.434 129.730  1.00  0.92           C  
ATOM   1599  CD1 TYR A 204     114.780  30.592 128.342  1.00  0.92           C  
ATOM   1600  CD2 TYR A 204     114.820  31.563 130.553  1.00  0.92           C  
ATOM   1601  CE1 TYR A 204     114.437  31.843 127.803  1.00  0.92           C  
ATOM   1602  CE2 TYR A 204     114.476  32.808 130.018  1.00  0.92           C  
ATOM   1603  CZ  TYR A 204     114.255  32.939 128.649  1.00  0.92           C  
ATOM   1604  OH  TYR A 204     113.862  34.198 128.158  1.00  0.92           O  
ATOM   1605  N   THR A 205     114.236  26.529 131.795  1.00  0.92           N  
ATOM   1606  CA  THR A 205     114.353  25.411 132.736  1.00  0.92           C  
ATOM   1607  C   THR A 205     113.907  24.070 132.190  1.00  0.92           C  
ATOM   1608  O   THR A 205     114.541  23.054 132.461  1.00  0.92           O  
ATOM   1609  CB  THR A 205     113.570  25.688 134.021  1.00  0.92           C  
ATOM   1610  OG1 THR A 205     114.222  26.685 134.790  1.00  0.92           O  
ATOM   1611  CG2 THR A 205     113.386  24.500 134.981  1.00  0.92           C  
ATOM   1612  N   THR A 206     112.793  24.002 131.431  1.00  0.92           N  
ATOM   1613  CA  THR A 206     112.322  22.746 130.834  1.00  0.92           C  
ATOM   1614  C   THR A 206     113.147  22.258 129.659  1.00  0.92           C  
ATOM   1615  O   THR A 206     113.383  21.061 129.512  1.00  0.92           O  
ATOM   1616  CB  THR A 206     110.866  22.805 130.405  1.00  0.92           C  
ATOM   1617  OG1 THR A 206     110.058  23.148 131.519  1.00  0.92           O  
ATOM   1618  CG2 THR A 206     110.322  21.449 129.931  1.00  0.92           C  
ATOM   1619  N   HIS A 207     113.600  23.164 128.767  1.00  0.91           N  
ATOM   1620  CA  HIS A 207     114.393  22.769 127.611  1.00  0.91           C  
ATOM   1621  C   HIS A 207     115.876  22.554 127.902  1.00  0.91           C  
ATOM   1622  O   HIS A 207     116.544  21.815 127.184  1.00  0.91           O  
ATOM   1623  CB  HIS A 207     114.244  23.813 126.484  1.00  0.91           C  
ATOM   1624  CG  HIS A 207     112.854  23.818 125.908  1.00  0.91           C  
ATOM   1625  ND1 HIS A 207     112.526  22.793 125.053  1.00  0.91           N  
ATOM   1626  CD2 HIS A 207     111.771  24.626 126.098  1.00  0.91           C  
ATOM   1627  CE1 HIS A 207     111.269  22.989 124.728  1.00  0.91           C  
ATOM   1628  NE2 HIS A 207     110.758  24.081 125.338  1.00  0.91           N  
ATOM   1629  N   SER A 208     116.435  23.161 128.970  1.00  0.95           N  
ATOM   1630  CA  SER A 208     117.852  23.018 129.295  1.00  0.95           C  
ATOM   1631  C   SER A 208     118.022  22.502 130.708  1.00  0.95           C  
ATOM   1632  O   SER A 208     117.421  23.071 131.616  1.00  0.95           O  
ATOM   1633  CB  SER A 208     118.649  24.347 129.219  1.00  0.95           C  
ATOM   1634  OG  SER A 208     119.205  24.533 127.916  1.00  0.95           O  
ATOM   1635  N   PRO A 209     118.838  21.498 131.014  1.00  0.96           N  
ATOM   1636  CA  PRO A 209     119.799  20.833 130.141  1.00  0.96           C  
ATOM   1637  C   PRO A 209     119.144  19.853 129.183  1.00  0.96           C  
ATOM   1638  O   PRO A 209     118.156  19.221 129.538  1.00  0.96           O  
ATOM   1639  CB  PRO A 209     120.719  20.085 131.120  1.00  0.96           C  
ATOM   1640  CG  PRO A 209     119.809  19.771 132.311  1.00  0.96           C  
ATOM   1641  CD  PRO A 209     118.905  21.001 132.384  1.00  0.96           C  
ATOM   1642  N   ALA A 210     119.708  19.718 127.967  1.00  0.97           N  
ATOM   1643  CA  ALA A 210     119.200  18.877 126.907  1.00  0.97           C  
ATOM   1644  C   ALA A 210     120.029  17.610 126.672  1.00  0.97           C  
ATOM   1645  O   ALA A 210     119.755  16.837 125.756  1.00  0.97           O  
ATOM   1646  CB  ALA A 210     119.201  19.735 125.634  1.00  0.97           C  
ATOM   1647  N   GLY A 211     121.051  17.331 127.512  1.00  0.99           N  
ATOM   1648  CA  GLY A 211     121.764  16.047 127.527  1.00  0.99           C  
ATOM   1649  C   GLY A 211     123.153  16.046 126.944  1.00  0.99           C  
ATOM   1650  O   GLY A 211     123.460  16.727 125.968  1.00  0.99           O  
ATOM   1651  N   THR A 212     124.056  15.252 127.556  1.00  0.97           N  
ATOM   1652  CA  THR A 212     125.405  15.039 127.046  1.00  0.97           C  
ATOM   1653  C   THR A 212     125.978  13.812 127.718  1.00  0.97           C  
ATOM   1654  O   THR A 212     125.410  13.296 128.677  1.00  0.97           O  
ATOM   1655  CB  THR A 212     126.366  16.223 127.209  1.00  0.97           C  
ATOM   1656  OG1 THR A 212     127.510  16.107 126.367  1.00  0.97           O  
ATOM   1657  CG2 THR A 212     126.867  16.401 128.652  1.00  0.97           C  
ATOM   1658  N   SER A 213     127.127  13.304 127.236  1.00  0.97           N  
ATOM   1659  CA  SER A 213     127.792  12.127 127.779  1.00  0.97           C  
ATOM   1660  C   SER A 213     128.615  12.426 129.029  1.00  0.97           C  
ATOM   1661  O   SER A 213     129.052  13.551 129.264  1.00  0.97           O  
ATOM   1662  CB  SER A 213     128.712  11.434 126.731  1.00  0.97           C  
ATOM   1663  OG  SER A 213     129.787  12.282 126.328  1.00  0.97           O  
ATOM   1664  N   VAL A 214     128.890  11.401 129.872  1.00  0.97           N  
ATOM   1665  CA  VAL A 214     129.891  11.500 130.939  1.00  0.97           C  
ATOM   1666  C   VAL A 214     131.291  11.769 130.385  1.00  0.97           C  
ATOM   1667  O   VAL A 214     132.055  12.567 130.927  1.00  0.97           O  
ATOM   1668  CB  VAL A 214     129.903  10.277 131.855  1.00  0.97           C  
ATOM   1669  CG1 VAL A 214     130.933  10.435 132.992  1.00  0.97           C  
ATOM   1670  CG2 VAL A 214     128.519  10.105 132.504  1.00  0.97           C  
ATOM   1671  N   GLN A 215     131.648  11.151 129.239  1.00  0.93           N  
ATOM   1672  CA  GLN A 215     132.901  11.388 128.539  1.00  0.93           C  
ATOM   1673  C   GLN A 215     133.130  12.831 128.083  1.00  0.93           C  
ATOM   1674  O   GLN A 215     134.238  13.357 128.178  1.00  0.93           O  
ATOM   1675  CB  GLN A 215     133.063  10.417 127.352  1.00  0.93           C  
ATOM   1676  CG  GLN A 215     134.432  10.569 126.639  1.00  0.93           C  
ATOM   1677  CD  GLN A 215     134.687   9.455 125.628  1.00  0.93           C  
ATOM   1678  OE1 GLN A 215     134.518   8.277 125.963  1.00  0.93           O  
ATOM   1679  NE2 GLN A 215     135.117   9.793 124.393  1.00  0.93           N  
ATOM   1680  N   ASN A 216     132.088  13.541 127.609  1.00  0.95           N  
ATOM   1681  CA  ASN A 216     132.166  14.954 127.299  1.00  0.95           C  
ATOM   1682  C   ASN A 216     132.493  15.811 128.515  1.00  0.95           C  
ATOM   1683  O   ASN A 216     133.341  16.703 128.465  1.00  0.95           O  
ATOM   1684  CB  ASN A 216     130.834  15.381 126.642  1.00  0.95           C  
ATOM   1685  CG  ASN A 216     131.023  16.689 125.907  1.00  0.95           C  
ATOM   1686  OD1 ASN A 216     131.987  16.821 125.144  1.00  0.95           O  
ATOM   1687  ND2 ASN A 216     130.138  17.683 126.111  1.00  0.95           N  
ATOM   1688  N   MET A 217     131.861  15.515 129.665  1.00  0.94           N  
ATOM   1689  CA  MET A 217     132.210  16.144 130.923  1.00  0.94           C  
ATOM   1690  C   MET A 217     133.629  15.831 131.381  1.00  0.94           C  
ATOM   1691  O   MET A 217     134.354  16.740 131.773  1.00  0.94           O  
ATOM   1692  CB  MET A 217     131.176  15.826 132.025  1.00  0.94           C  
ATOM   1693  CG  MET A 217     129.735  16.249 131.670  1.00  0.94           C  
ATOM   1694  SD  MET A 217     129.541  17.912 130.946  1.00  0.94           S  
ATOM   1695  CE  MET A 217     130.006  18.901 132.397  1.00  0.94           C  
ATOM   1696  N   LEU A 218     134.099  14.568 131.251  1.00  0.96           N  
ATOM   1697  CA  LEU A 218     135.494  14.179 131.464  1.00  0.96           C  
ATOM   1698  C   LEU A 218     136.464  14.995 130.616  1.00  0.96           C  
ATOM   1699  O   LEU A 218     137.474  15.496 131.106  1.00  0.96           O  
ATOM   1700  CB  LEU A 218     135.713  12.677 131.096  1.00  0.96           C  
ATOM   1701  CG  LEU A 218     135.804  11.592 132.197  1.00  0.96           C  
ATOM   1702  CD1 LEU A 218     135.748  12.117 133.633  1.00  0.96           C  
ATOM   1703  CD2 LEU A 218     134.724  10.528 131.949  1.00  0.96           C  
ATOM   1704  N   HIS A 219     136.166  15.201 129.321  1.00  0.93           N  
ATOM   1705  CA  HIS A 219     136.980  16.054 128.474  1.00  0.93           C  
ATOM   1706  C   HIS A 219     137.044  17.505 128.910  1.00  0.93           C  
ATOM   1707  O   HIS A 219     138.105  18.126 128.934  1.00  0.93           O  
ATOM   1708  CB  HIS A 219     136.480  16.016 127.034  1.00  0.93           C  
ATOM   1709  CG  HIS A 219     137.496  16.458 126.034  1.00  0.93           C  
ATOM   1710  ND1 HIS A 219     137.226  16.093 124.742  1.00  0.93           N  
ATOM   1711  CD2 HIS A 219     138.683  17.126 126.106  1.00  0.93           C  
ATOM   1712  CE1 HIS A 219     138.253  16.538 124.041  1.00  0.93           C  
ATOM   1713  NE2 HIS A 219     139.155  17.173 124.819  1.00  0.93           N  
ATOM   1714  N   TRP A 220     135.908  18.089 129.319  1.00  0.94           N  
ATOM   1715  CA  TRP A 220     135.904  19.393 129.947  1.00  0.94           C  
ATOM   1716  C   TRP A 220     136.695  19.446 131.251  1.00  0.94           C  
ATOM   1717  O   TRP A 220     137.424  20.402 131.503  1.00  0.94           O  
ATOM   1718  CB  TRP A 220     134.463  19.913 130.135  1.00  0.94           C  
ATOM   1719  CG  TRP A 220     133.803  20.368 128.843  1.00  0.94           C  
ATOM   1720  CD1 TRP A 220     132.689  19.906 128.199  1.00  0.94           C  
ATOM   1721  CD2 TRP A 220     134.316  21.446 128.041  1.00  0.94           C  
ATOM   1722  NE1 TRP A 220     132.475  20.621 127.035  1.00  0.94           N  
ATOM   1723  CE2 TRP A 220     133.459  21.582 126.932  1.00  0.94           C  
ATOM   1724  CE3 TRP A 220     135.431  22.266 128.197  1.00  0.94           C  
ATOM   1725  CZ2 TRP A 220     133.704  22.549 125.963  1.00  0.94           C  
ATOM   1726  CZ3 TRP A 220     135.691  23.223 127.214  1.00  0.94           C  
ATOM   1727  CH2 TRP A 220     134.839  23.363 126.115  1.00  0.94           C  
ATOM   1728  N   SER A 221     136.630  18.395 132.087  1.00  0.97           N  
ATOM   1729  CA  SER A 221     137.480  18.256 133.263  1.00  0.97           C  
ATOM   1730  C   SER A 221     138.971  18.230 132.979  1.00  0.97           C  
ATOM   1731  O   SER A 221     139.758  18.901 133.644  1.00  0.97           O  
ATOM   1732  CB  SER A 221     137.160  16.976 134.068  1.00  0.97           C  
ATOM   1733  OG  SER A 221     135.776  16.941 134.405  1.00  0.97           O  
ATOM   1734  N   GLN A 222     139.403  17.479 131.951  1.00  0.93           N  
ATOM   1735  CA  GLN A 222     140.760  17.472 131.428  1.00  0.93           C  
ATOM   1736  C   GLN A 222     141.208  18.828 130.905  1.00  0.93           C  
ATOM   1737  O   GLN A 222     142.327  19.262 131.168  1.00  0.93           O  
ATOM   1738  CB  GLN A 222     140.876  16.416 130.308  1.00  0.93           C  
ATOM   1739  CG  GLN A 222     140.801  14.967 130.843  1.00  0.93           C  
ATOM   1740  CD  GLN A 222     140.822  13.931 129.719  1.00  0.93           C  
ATOM   1741  OE1 GLN A 222     140.876  14.261 128.528  1.00  0.93           O  
ATOM   1742  NE2 GLN A 222     140.799  12.640 130.114  1.00  0.93           N  
ATOM   1743  N   ALA A 223     140.327  19.565 130.204  1.00  0.97           N  
ATOM   1744  CA  ALA A 223     140.578  20.924 129.765  1.00  0.97           C  
ATOM   1745  C   ALA A 223     140.869  21.891 130.922  1.00  0.97           C  
ATOM   1746  O   ALA A 223     141.807  22.686 130.856  1.00  0.97           O  
ATOM   1747  CB  ALA A 223     139.377  21.398 128.919  1.00  0.97           C  
ATOM   1748  N   VAL A 224     140.108  21.813 132.036  1.00  0.95           N  
ATOM   1749  CA  VAL A 224     140.393  22.562 133.260  1.00  0.95           C  
ATOM   1750  C   VAL A 224     141.679  22.145 133.967  1.00  0.95           C  
ATOM   1751  O   VAL A 224     142.472  22.982 134.404  1.00  0.95           O  
ATOM   1752  CB  VAL A 224     139.261  22.392 134.275  1.00  0.95           C  
ATOM   1753  CG1 VAL A 224     139.561  23.103 135.615  1.00  0.95           C  
ATOM   1754  CG2 VAL A 224     137.960  22.971 133.698  1.00  0.95           C  
ATOM   1755  N   LYS A 225     141.894  20.823 134.136  1.00  0.90           N  
ATOM   1756  CA  LYS A 225     143.052  20.271 134.815  1.00  0.90           C  
ATOM   1757  C   LYS A 225     144.366  20.417 134.079  1.00  0.90           C  
ATOM   1758  O   LYS A 225     145.381  20.761 134.677  1.00  0.90           O  
ATOM   1759  CB  LYS A 225     142.853  18.765 135.106  1.00  0.90           C  
ATOM   1760  CG  LYS A 225     141.859  18.500 136.241  1.00  0.90           C  
ATOM   1761  CD  LYS A 225     141.650  17.009 136.546  1.00  0.90           C  
ATOM   1762  CE  LYS A 225     140.665  16.345 135.590  1.00  0.90           C  
ATOM   1763  NZ  LYS A 225     140.153  15.122 136.210  1.00  0.90           N  
ATOM   1764  N   PHE A 226     144.401  20.144 132.763  1.00  0.91           N  
ATOM   1765  CA  PHE A 226     145.649  20.166 132.028  1.00  0.91           C  
ATOM   1766  C   PHE A 226     145.932  21.525 131.426  1.00  0.91           C  
ATOM   1767  O   PHE A 226     147.062  21.785 131.015  1.00  0.91           O  
ATOM   1768  CB  PHE A 226     145.627  19.148 130.856  1.00  0.91           C  
ATOM   1769  CG  PHE A 226     145.383  17.719 131.275  1.00  0.91           C  
ATOM   1770  CD1 PHE A 226     145.775  17.187 132.520  1.00  0.91           C  
ATOM   1771  CD2 PHE A 226     144.753  16.865 130.355  1.00  0.91           C  
ATOM   1772  CE1 PHE A 226     145.519  15.846 132.838  1.00  0.91           C  
ATOM   1773  CE2 PHE A 226     144.496  15.528 130.670  1.00  0.91           C  
ATOM   1774  CZ  PHE A 226     144.871  15.018 131.915  1.00  0.91           C  
ATOM   1775  N   GLN A 227     144.917  22.409 131.348  1.00  0.89           N  
ATOM   1776  CA  GLN A 227     145.002  23.735 130.757  1.00  0.89           C  
ATOM   1777  C   GLN A 227     145.467  23.755 129.301  1.00  0.89           C  
ATOM   1778  O   GLN A 227     146.242  24.605 128.869  1.00  0.89           O  
ATOM   1779  CB  GLN A 227     145.822  24.715 131.629  1.00  0.89           C  
ATOM   1780  CG  GLN A 227     145.300  24.823 133.079  1.00  0.89           C  
ATOM   1781  CD  GLN A 227     146.008  25.944 133.836  1.00  0.89           C  
ATOM   1782  OE1 GLN A 227     146.952  26.585 133.366  1.00  0.89           O  
ATOM   1783  NE2 GLN A 227     145.524  26.232 135.064  1.00  0.89           N  
ATOM   1784  N   LYS A 228     144.971  22.806 128.487  1.00  0.87           N  
ATOM   1785  CA  LYS A 228     145.411  22.633 127.120  1.00  0.87           C  
ATOM   1786  C   LYS A 228     144.205  22.389 126.261  1.00  0.87           C  
ATOM   1787  O   LYS A 228     143.298  21.647 126.626  1.00  0.87           O  
ATOM   1788  CB  LYS A 228     146.336  21.399 126.945  1.00  0.87           C  
ATOM   1789  CG  LYS A 228     147.780  21.636 127.414  1.00  0.87           C  
ATOM   1790  CD  LYS A 228     148.575  20.323 127.538  1.00  0.87           C  
ATOM   1791  CE  LYS A 228     149.146  20.111 128.947  1.00  0.87           C  
ATOM   1792  NZ  LYS A 228     149.430  18.678 129.194  1.00  0.87           N  
ATOM   1793  N   PHE A 229     144.199  22.995 125.062  1.00  0.89           N  
ATOM   1794  CA  PHE A 229     143.185  22.744 124.066  1.00  0.89           C  
ATOM   1795  C   PHE A 229     143.635  21.553 123.220  1.00  0.89           C  
ATOM   1796  O   PHE A 229     144.515  21.653 122.364  1.00  0.89           O  
ATOM   1797  CB  PHE A 229     142.978  24.024 123.213  1.00  0.89           C  
ATOM   1798  CG  PHE A 229     141.748  24.012 122.339  1.00  0.89           C  
ATOM   1799  CD1 PHE A 229     140.538  23.415 122.734  1.00  0.89           C  
ATOM   1800  CD2 PHE A 229     141.791  24.681 121.104  1.00  0.89           C  
ATOM   1801  CE1 PHE A 229     139.399  23.502 121.925  1.00  0.89           C  
ATOM   1802  CE2 PHE A 229     140.652  24.775 120.296  1.00  0.89           C  
ATOM   1803  CZ  PHE A 229     139.450  24.202 120.718  1.00  0.89           C  
ATOM   1804  N   GLN A 230     143.074  20.363 123.490  1.00  0.90           N  
ATOM   1805  CA  GLN A 230     143.525  19.130 122.899  1.00  0.90           C  
ATOM   1806  C   GLN A 230     142.396  18.139 122.907  1.00  0.90           C  
ATOM   1807  O   GLN A 230     141.380  18.352 123.567  1.00  0.90           O  
ATOM   1808  CB  GLN A 230     144.738  18.529 123.671  1.00  0.90           C  
ATOM   1809  CG  GLN A 230     144.489  18.199 125.173  1.00  0.90           C  
ATOM   1810  CD  GLN A 230     145.706  17.617 125.902  1.00  0.90           C  
ATOM   1811  OE1 GLN A 230     145.633  17.091 127.016  1.00  0.90           O  
ATOM   1812  NE2 GLN A 230     146.902  17.714 125.283  1.00  0.90           N  
ATOM   1813  N   ALA A 231     142.563  17.045 122.141  1.00  0.97           N  
ATOM   1814  CA  ALA A 231     141.687  15.899 122.122  1.00  0.97           C  
ATOM   1815  C   ALA A 231     141.630  15.170 123.455  1.00  0.97           C  
ATOM   1816  O   ALA A 231     142.461  15.368 124.337  1.00  0.97           O  
ATOM   1817  CB  ALA A 231     142.155  14.932 121.021  1.00  0.97           C  
ATOM   1818  N   PHE A 232     140.613  14.322 123.640  1.00  0.95           N  
ATOM   1819  CA  PHE A 232     140.400  13.565 124.849  1.00  0.95           C  
ATOM   1820  C   PHE A 232     141.565  12.629 125.202  1.00  0.95           C  
ATOM   1821  O   PHE A 232     142.025  11.852 124.371  1.00  0.95           O  
ATOM   1822  CB  PHE A 232     139.065  12.795 124.651  1.00  0.95           C  
ATOM   1823  CG  PHE A 232     138.650  12.031 125.864  1.00  0.95           C  
ATOM   1824  CD1 PHE A 232     138.386  12.717 127.050  1.00  0.95           C  
ATOM   1825  CD2 PHE A 232     138.618  10.630 125.862  1.00  0.95           C  
ATOM   1826  CE1 PHE A 232     138.114  12.018 128.225  1.00  0.95           C  
ATOM   1827  CE2 PHE A 232     138.299   9.925 127.028  1.00  0.95           C  
ATOM   1828  CZ  PHE A 232     138.045  10.621 128.215  1.00  0.95           C  
ATOM   1829  N   ASP A 233     142.062  12.669 126.461  1.00  0.94           N  
ATOM   1830  CA  ASP A 233     143.013  11.689 126.936  1.00  0.94           C  
ATOM   1831  C   ASP A 233     142.223  10.461 127.397  1.00  0.94           C  
ATOM   1832  O   ASP A 233     141.349  10.537 128.258  1.00  0.94           O  
ATOM   1833  CB  ASP A 233     143.936  12.269 128.041  1.00  0.94           C  
ATOM   1834  CG  ASP A 233     144.993  11.223 128.335  1.00  0.94           C  
ATOM   1835  OD1 ASP A 233     145.892  11.035 127.475  1.00  0.94           O  
ATOM   1836  OD2 ASP A 233     144.844  10.507 129.357  1.00  0.94           O  
ATOM   1837  N   TRP A 234     142.506   9.268 126.826  1.00  0.89           N  
ATOM   1838  CA  TRP A 234     141.713   8.091 127.116  1.00  0.89           C  
ATOM   1839  C   TRP A 234     142.286   7.305 128.295  1.00  0.89           C  
ATOM   1840  O   TRP A 234     141.774   6.247 128.677  1.00  0.89           O  
ATOM   1841  CB  TRP A 234     141.601   7.186 125.859  1.00  0.89           C  
ATOM   1842  CG  TRP A 234     140.780   7.755 124.706  1.00  0.89           C  
ATOM   1843  CD1 TRP A 234     141.155   8.658 123.753  1.00  0.89           C  
ATOM   1844  CD2 TRP A 234     139.408   7.420 124.418  1.00  0.89           C  
ATOM   1845  NE1 TRP A 234     140.108   8.922 122.897  1.00  0.89           N  
ATOM   1846  CE2 TRP A 234     139.027   8.168 123.282  1.00  0.89           C  
ATOM   1847  CE3 TRP A 234     138.507   6.567 125.049  1.00  0.89           C  
ATOM   1848  CZ2 TRP A 234     137.737   8.089 122.772  1.00  0.89           C  
ATOM   1849  CZ3 TRP A 234     137.210   6.476 124.524  1.00  0.89           C  
ATOM   1850  CH2 TRP A 234     136.829   7.226 123.405  1.00  0.89           C  
ATOM   1851  N   GLY A 235     143.341   7.833 128.951  1.00  0.94           N  
ATOM   1852  CA  GLY A 235     143.886   7.346 130.209  1.00  0.94           C  
ATOM   1853  C   GLY A 235     145.046   6.395 130.091  1.00  0.94           C  
ATOM   1854  O   GLY A 235     145.540   5.892 131.097  1.00  0.94           O  
ATOM   1855  N   SER A 236     145.514   6.081 128.874  1.00  0.92           N  
ATOM   1856  CA  SER A 236     146.724   5.286 128.728  1.00  0.92           C  
ATOM   1857  C   SER A 236     147.280   5.436 127.344  1.00  0.92           C  
ATOM   1858  O   SER A 236     146.554   5.737 126.400  1.00  0.92           O  
ATOM   1859  CB  SER A 236     146.596   3.748 129.019  1.00  0.92           C  
ATOM   1860  OG  SER A 236     145.776   3.034 128.081  1.00  0.92           O  
ATOM   1861  N   SER A 237     148.594   5.163 127.180  1.00  0.92           N  
ATOM   1862  CA  SER A 237     149.267   5.177 125.885  1.00  0.92           C  
ATOM   1863  C   SER A 237     148.653   4.246 124.865  1.00  0.92           C  
ATOM   1864  O   SER A 237     148.480   4.604 123.703  1.00  0.92           O  
ATOM   1865  CB  SER A 237     150.753   4.754 126.007  1.00  0.92           C  
ATOM   1866  OG  SER A 237     151.499   5.766 126.679  1.00  0.92           O  
ATOM   1867  N   ALA A 238     148.292   3.022 125.289  1.00  0.93           N  
ATOM   1868  CA  ALA A 238     147.610   2.046 124.474  1.00  0.93           C  
ATOM   1869  C   ALA A 238     146.203   2.449 124.064  1.00  0.93           C  
ATOM   1870  O   ALA A 238     145.820   2.300 122.904  1.00  0.93           O  
ATOM   1871  CB  ALA A 238     147.539   0.725 125.255  1.00  0.93           C  
ATOM   1872  N   LYS A 239     145.397   3.003 124.997  1.00  0.88           N  
ATOM   1873  CA  LYS A 239     144.089   3.529 124.659  1.00  0.88           C  
ATOM   1874  C   LYS A 239     144.156   4.737 123.734  1.00  0.88           C  
ATOM   1875  O   LYS A 239     143.421   4.813 122.756  1.00  0.88           O  
ATOM   1876  CB  LYS A 239     143.257   3.871 125.917  1.00  0.88           C  
ATOM   1877  CG  LYS A 239     142.623   2.655 126.619  1.00  0.88           C  
ATOM   1878  CD  LYS A 239     141.676   3.089 127.755  1.00  0.88           C  
ATOM   1879  CE  LYS A 239     142.317   3.065 129.148  1.00  0.88           C  
ATOM   1880  NZ  LYS A 239     141.574   3.957 130.064  1.00  0.88           N  
ATOM   1881  N   ASN A 240     145.070   5.697 123.967  1.00  0.89           N  
ATOM   1882  CA  ASN A 240     145.280   6.799 123.046  1.00  0.89           C  
ATOM   1883  C   ASN A 240     145.731   6.351 121.656  1.00  0.89           C  
ATOM   1884  O   ASN A 240     145.255   6.871 120.650  1.00  0.89           O  
ATOM   1885  CB  ASN A 240     146.307   7.804 123.612  1.00  0.89           C  
ATOM   1886  CG  ASN A 240     145.706   8.593 124.772  1.00  0.89           C  
ATOM   1887  OD1 ASN A 240     144.498   8.856 124.799  1.00  0.89           O  
ATOM   1888  ND2 ASN A 240     146.554   9.017 125.732  1.00  0.89           N  
ATOM   1889  N   TYR A 241     146.622   5.338 121.558  1.00  0.88           N  
ATOM   1890  CA  TYR A 241     147.052   4.770 120.287  1.00  0.88           C  
ATOM   1891  C   TYR A 241     145.900   4.143 119.500  1.00  0.88           C  
ATOM   1892  O   TYR A 241     145.785   4.355 118.296  1.00  0.88           O  
ATOM   1893  CB  TYR A 241     148.242   3.789 120.490  1.00  0.88           C  
ATOM   1894  CG  TYR A 241     148.985   3.532 119.200  1.00  0.88           C  
ATOM   1895  CD1 TYR A 241     148.490   2.626 118.248  1.00  0.88           C  
ATOM   1896  CD2 TYR A 241     150.169   4.230 118.907  1.00  0.88           C  
ATOM   1897  CE1 TYR A 241     149.142   2.446 117.021  1.00  0.88           C  
ATOM   1898  CE2 TYR A 241     150.828   4.043 117.682  1.00  0.88           C  
ATOM   1899  CZ  TYR A 241     150.314   3.148 116.740  1.00  0.88           C  
ATOM   1900  OH  TYR A 241     150.967   2.953 115.508  1.00  0.88           O  
ATOM   1901  N   PHE A 242     144.979   3.430 120.182  1.00  0.88           N  
ATOM   1902  CA  PHE A 242     143.754   2.864 119.626  1.00  0.88           C  
ATOM   1903  C   PHE A 242     142.857   3.898 118.910  1.00  0.88           C  
ATOM   1904  O   PHE A 242     142.156   3.570 117.954  1.00  0.88           O  
ATOM   1905  CB  PHE A 242     143.011   2.120 120.781  1.00  0.88           C  
ATOM   1906  CG  PHE A 242     141.771   1.375 120.361  1.00  0.88           C  
ATOM   1907  CD1 PHE A 242     141.813   0.027 119.967  1.00  0.88           C  
ATOM   1908  CD2 PHE A 242     140.530   2.028 120.398  1.00  0.88           C  
ATOM   1909  CE1 PHE A 242     140.635  -0.653 119.624  1.00  0.88           C  
ATOM   1910  CE2 PHE A 242     139.353   1.353 120.064  1.00  0.88           C  
ATOM   1911  CZ  PHE A 242     139.404   0.011 119.675  1.00  0.88           C  
ATOM   1912  N   HIS A 243     142.882   5.174 119.358  1.00  0.87           N  
ATOM   1913  CA  HIS A 243     142.041   6.242 118.842  1.00  0.87           C  
ATOM   1914  C   HIS A 243     142.765   7.254 117.959  1.00  0.87           C  
ATOM   1915  O   HIS A 243     142.187   7.796 117.014  1.00  0.87           O  
ATOM   1916  CB  HIS A 243     141.459   7.008 120.048  1.00  0.87           C  
ATOM   1917  CG  HIS A 243     140.440   6.195 120.781  1.00  0.87           C  
ATOM   1918  ND1 HIS A 243     139.221   6.020 120.169  1.00  0.87           N  
ATOM   1919  CD2 HIS A 243     140.457   5.563 121.987  1.00  0.87           C  
ATOM   1920  CE1 HIS A 243     138.512   5.297 121.010  1.00  0.87           C  
ATOM   1921  NE2 HIS A 243     139.215   4.984 122.122  1.00  0.87           N  
ATOM   1922  N   TYR A 244     144.054   7.552 118.227  1.00  0.89           N  
ATOM   1923  CA  TYR A 244     144.755   8.611 117.522  1.00  0.89           C  
ATOM   1924  C   TYR A 244     145.958   8.140 116.728  1.00  0.89           C  
ATOM   1925  O   TYR A 244     146.555   8.937 116.009  1.00  0.89           O  
ATOM   1926  CB  TYR A 244     145.254   9.687 118.519  1.00  0.89           C  
ATOM   1927  CG  TYR A 244     144.139  10.194 119.388  1.00  0.89           C  
ATOM   1928  CD1 TYR A 244     142.932  10.679 118.853  1.00  0.89           C  
ATOM   1929  CD2 TYR A 244     144.311  10.197 120.779  1.00  0.89           C  
ATOM   1930  CE1 TYR A 244     141.916  11.139 119.699  1.00  0.89           C  
ATOM   1931  CE2 TYR A 244     143.298  10.660 121.624  1.00  0.89           C  
ATOM   1932  CZ  TYR A 244     142.097  11.122 121.080  1.00  0.89           C  
ATOM   1933  OH  TYR A 244     141.050  11.570 121.896  1.00  0.89           O  
ATOM   1934  N   ASN A 245     146.356   6.854 116.829  1.00  0.89           N  
ATOM   1935  CA  ASN A 245     147.601   6.328 116.277  1.00  0.89           C  
ATOM   1936  C   ASN A 245     148.866   6.937 116.892  1.00  0.89           C  
ATOM   1937  O   ASN A 245     149.941   6.938 116.294  1.00  0.89           O  
ATOM   1938  CB  ASN A 245     147.644   6.354 114.725  1.00  0.89           C  
ATOM   1939  CG  ASN A 245     146.470   5.551 114.191  1.00  0.89           C  
ATOM   1940  OD1 ASN A 245     146.240   4.411 114.597  1.00  0.89           O  
ATOM   1941  ND2 ASN A 245     145.704   6.115 113.229  1.00  0.89           N  
ATOM   1942  N   GLN A 246     148.774   7.421 118.148  1.00  0.88           N  
ATOM   1943  CA  GLN A 246     149.879   7.997 118.877  1.00  0.88           C  
ATOM   1944  C   GLN A 246     149.519   7.939 120.344  1.00  0.88           C  
ATOM   1945  O   GLN A 246     148.353   7.803 120.695  1.00  0.88           O  
ATOM   1946  CB  GLN A 246     150.166   9.468 118.470  1.00  0.88           C  
ATOM   1947  CG  GLN A 246     148.926  10.393 118.537  1.00  0.88           C  
ATOM   1948  CD  GLN A 246     149.246  11.806 118.057  1.00  0.88           C  
ATOM   1949  OE1 GLN A 246     149.467  12.044 116.868  1.00  0.88           O  
ATOM   1950  NE2 GLN A 246     149.266  12.797 118.974  1.00  0.88           N  
ATOM   1951  N   SER A 247     150.504   8.016 121.259  1.00  0.92           N  
ATOM   1952  CA  SER A 247     150.291   7.731 122.670  1.00  0.92           C  
ATOM   1953  C   SER A 247     149.747   8.885 123.504  1.00  0.92           C  
ATOM   1954  O   SER A 247     149.276   8.671 124.619  1.00  0.92           O  
ATOM   1955  CB  SER A 247     151.616   7.249 123.308  1.00  0.92           C  
ATOM   1956  OG  SER A 247     152.685   8.152 123.013  1.00  0.92           O  
ATOM   1957  N   TYR A 248     149.768  10.124 122.981  1.00  0.91           N  
ATOM   1958  CA  TYR A 248     149.311  11.333 123.644  1.00  0.91           C  
ATOM   1959  C   TYR A 248     148.249  11.984 122.762  1.00  0.91           C  
ATOM   1960  O   TYR A 248     148.350  11.833 121.542  1.00  0.91           O  
ATOM   1961  CB  TYR A 248     150.492  12.326 123.911  1.00  0.91           C  
ATOM   1962  CG  TYR A 248     151.295  12.656 122.666  1.00  0.91           C  
ATOM   1963  CD1 TYR A 248     152.285  11.774 122.199  1.00  0.91           C  
ATOM   1964  CD2 TYR A 248     151.064  13.842 121.945  1.00  0.91           C  
ATOM   1965  CE1 TYR A 248     152.996  12.049 121.025  1.00  0.91           C  
ATOM   1966  CE2 TYR A 248     151.800  14.133 120.785  1.00  0.91           C  
ATOM   1967  CZ  TYR A 248     152.760  13.228 120.319  1.00  0.91           C  
ATOM   1968  OH  TYR A 248     153.495  13.475 119.142  1.00  0.91           O  
ATOM   1969  N   PRO A 249     147.221  12.684 123.239  1.00  0.94           N  
ATOM   1970  CA  PRO A 249     146.148  13.151 122.368  1.00  0.94           C  
ATOM   1971  C   PRO A 249     146.634  14.292 121.464  1.00  0.94           C  
ATOM   1972  O   PRO A 249     147.424  15.098 121.963  1.00  0.94           O  
ATOM   1973  CB  PRO A 249     145.024  13.592 123.321  1.00  0.94           C  
ATOM   1974  CG  PRO A 249     145.660  13.726 124.709  1.00  0.94           C  
ATOM   1975  CD  PRO A 249     146.894  12.824 124.657  1.00  0.94           C  
ATOM   1976  N   PRO A 250     146.280  14.417 120.179  1.00  0.95           N  
ATOM   1977  CA  PRO A 250     146.544  15.605 119.364  1.00  0.95           C  
ATOM   1978  C   PRO A 250     146.118  16.924 120.005  1.00  0.95           C  
ATOM   1979  O   PRO A 250     145.050  16.992 120.611  1.00  0.95           O  
ATOM   1980  CB  PRO A 250     145.825  15.353 118.022  1.00  0.95           C  
ATOM   1981  CG  PRO A 250     145.486  13.857 118.017  1.00  0.95           C  
ATOM   1982  CD  PRO A 250     145.380  13.499 119.498  1.00  0.95           C  
ATOM   1983  N   THR A 251     146.938  17.988 119.887  1.00  0.93           N  
ATOM   1984  CA  THR A 251     146.616  19.327 120.378  1.00  0.93           C  
ATOM   1985  C   THR A 251     145.944  20.112 119.265  1.00  0.93           C  
ATOM   1986  O   THR A 251     146.209  19.884 118.089  1.00  0.93           O  
ATOM   1987  CB  THR A 251     147.791  20.062 121.082  1.00  0.93           C  
ATOM   1988  OG1 THR A 251     148.212  21.281 120.486  1.00  0.93           O  
ATOM   1989  CG2 THR A 251     149.051  19.184 121.122  1.00  0.93           C  
ATOM   1990  N   TYR A 252     145.021  21.033 119.609  1.00  0.94           N  
ATOM   1991  CA  TYR A 252     144.270  21.805 118.643  1.00  0.94           C  
ATOM   1992  C   TYR A 252     144.810  23.216 118.676  1.00  0.94           C  
ATOM   1993  O   TYR A 252     144.805  23.874 119.714  1.00  0.94           O  
ATOM   1994  CB  TYR A 252     142.763  21.871 119.013  1.00  0.94           C  
ATOM   1995  CG  TYR A 252     142.117  20.514 119.069  1.00  0.94           C  
ATOM   1996  CD1 TYR A 252     142.223  19.636 117.983  1.00  0.94           C  
ATOM   1997  CD2 TYR A 252     141.331  20.130 120.171  1.00  0.94           C  
ATOM   1998  CE1 TYR A 252     141.519  18.430 117.968  1.00  0.94           C  
ATOM   1999  CE2 TYR A 252     140.636  18.907 120.164  1.00  0.94           C  
ATOM   2000  CZ  TYR A 252     140.726  18.063 119.048  1.00  0.94           C  
ATOM   2001  OH  TYR A 252     140.035  16.844 118.932  1.00  0.94           O  
ATOM   2002  N   ASN A 253     145.292  23.739 117.532  1.00  0.94           N  
ATOM   2003  CA  ASN A 253     145.841  25.069 117.490  1.00  0.94           C  
ATOM   2004  C   ASN A 253     144.842  25.996 116.801  1.00  0.94           C  
ATOM   2005  O   ASN A 253     144.428  25.791 115.664  1.00  0.94           O  
ATOM   2006  CB  ASN A 253     147.235  25.023 116.813  1.00  0.94           C  
ATOM   2007  CG  ASN A 253     148.017  26.296 117.091  1.00  0.94           C  
ATOM   2008  OD1 ASN A 253     147.494  27.288 117.625  1.00  0.94           O  
ATOM   2009  ND2 ASN A 253     149.318  26.295 116.742  1.00  0.94           N  
ATOM   2010  N   VAL A 254     144.404  27.061 117.507  1.00  0.97           N  
ATOM   2011  CA  VAL A 254     143.527  28.095 116.972  1.00  0.97           C  
ATOM   2012  C   VAL A 254     144.195  28.930 115.880  1.00  0.97           C  
ATOM   2013  O   VAL A 254     143.531  29.474 115.003  1.00  0.97           O  
ATOM   2014  CB  VAL A 254     143.000  28.957 118.116  1.00  0.97           C  
ATOM   2015  CG1 VAL A 254     142.340  30.263 117.628  1.00  0.97           C  
ATOM   2016  CG2 VAL A 254     141.976  28.124 118.916  1.00  0.97           C  
ATOM   2017  N   LYS A 255     145.538  29.002 115.844  1.00  0.92           N  
ATOM   2018  CA  LYS A 255     146.264  29.690 114.789  1.00  0.92           C  
ATOM   2019  C   LYS A 255     146.096  29.120 113.377  1.00  0.92           C  
ATOM   2020  O   LYS A 255     146.222  29.869 112.407  1.00  0.92           O  
ATOM   2021  CB  LYS A 255     147.762  29.796 115.170  1.00  0.92           C  
ATOM   2022  CG  LYS A 255     148.121  31.115 115.877  1.00  0.92           C  
ATOM   2023  CD  LYS A 255     148.297  32.252 114.859  1.00  0.92           C  
ATOM   2024  CE  LYS A 255     148.414  33.637 115.492  1.00  0.92           C  
ATOM   2025  NZ  LYS A 255     148.437  34.658 114.425  1.00  0.92           N  
ATOM   2026  N   ASP A 256     145.751  27.818 113.246  1.00  0.96           N  
ATOM   2027  CA  ASP A 256     145.489  27.126 111.995  1.00  0.96           C  
ATOM   2028  C   ASP A 256     144.106  27.498 111.441  1.00  0.96           C  
ATOM   2029  O   ASP A 256     143.742  27.208 110.304  1.00  0.96           O  
ATOM   2030  CB  ASP A 256     145.606  25.591 112.242  1.00  0.96           C  
ATOM   2031  CG  ASP A 256     147.005  25.165 112.683  1.00  0.96           C  
ATOM   2032  OD1 ASP A 256     147.965  25.962 112.535  1.00  0.96           O  
ATOM   2033  OD2 ASP A 256     147.110  24.042 113.242  1.00  0.96           O  
ATOM   2034  N   MET A 257     143.280  28.186 112.251  1.00  0.93           N  
ATOM   2035  CA  MET A 257     141.929  28.553 111.907  1.00  0.93           C  
ATOM   2036  C   MET A 257     141.917  29.877 111.138  1.00  0.93           C  
ATOM   2037  O   MET A 257     142.087  30.947 111.716  1.00  0.93           O  
ATOM   2038  CB  MET A 257     141.159  28.646 113.251  1.00  0.93           C  
ATOM   2039  CG  MET A 257     139.701  28.166 113.274  1.00  0.93           C  
ATOM   2040  SD  MET A 257     138.456  29.293 112.593  1.00  0.93           S  
ATOM   2041  CE  MET A 257     138.700  30.657 113.759  1.00  0.93           C  
ATOM   2042  N   LEU A 258     141.746  29.847 109.791  1.00  0.96           N  
ATOM   2043  CA  LEU A 258     141.889  31.052 108.975  1.00  0.96           C  
ATOM   2044  C   LEU A 258     140.567  31.650 108.522  1.00  0.96           C  
ATOM   2045  O   LEU A 258     140.545  32.619 107.759  1.00  0.96           O  
ATOM   2046  CB  LEU A 258     142.750  30.795 107.711  1.00  0.96           C  
ATOM   2047  CG  LEU A 258     144.130  30.150 107.968  1.00  0.96           C  
ATOM   2048  CD1 LEU A 258     144.877  29.963 106.636  1.00  0.96           C  
ATOM   2049  CD2 LEU A 258     144.993  30.946 108.964  1.00  0.96           C  
ATOM   2050  N   VAL A 259     139.431  31.101 108.986  1.00  1.00           N  
ATOM   2051  CA  VAL A 259     138.088  31.587 108.708  1.00  1.00           C  
ATOM   2052  C   VAL A 259     137.928  33.028 109.218  1.00  1.00           C  
ATOM   2053  O   VAL A 259     138.437  33.306 110.304  1.00  1.00           O  
ATOM   2054  CB  VAL A 259     137.070  30.668 109.375  1.00  1.00           C  
ATOM   2055  CG1 VAL A 259     135.620  31.089 109.083  1.00  1.00           C  
ATOM   2056  CG2 VAL A 259     137.289  29.222 108.883  1.00  1.00           C  
ATOM   2057  N   PRO A 260     137.315  34.003 108.543  1.00  1.00           N  
ATOM   2058  CA  PRO A 260     137.009  35.302 109.135  1.00  1.00           C  
ATOM   2059  C   PRO A 260     136.105  35.226 110.354  1.00  1.00           C  
ATOM   2060  O   PRO A 260     134.982  34.741 110.244  1.00  1.00           O  
ATOM   2061  CB  PRO A 260     136.374  36.110 107.989  1.00  1.00           C  
ATOM   2062  CG  PRO A 260     136.843  35.402 106.714  1.00  1.00           C  
ATOM   2063  CD  PRO A 260     136.923  33.937 107.142  1.00  1.00           C  
ATOM   2064  N   THR A 261     136.550  35.741 111.514  1.00  0.99           N  
ATOM   2065  CA  THR A 261     135.833  35.481 112.762  1.00  0.99           C  
ATOM   2066  C   THR A 261     135.427  36.756 113.441  1.00  0.99           C  
ATOM   2067  O   THR A 261     136.181  37.722 113.503  1.00  0.99           O  
ATOM   2068  CB  THR A 261     136.631  34.629 113.723  1.00  0.99           C  
ATOM   2069  OG1 THR A 261     136.966  33.426 113.061  1.00  0.99           O  
ATOM   2070  CG2 THR A 261     135.839  34.160 114.951  1.00  0.99           C  
ATOM   2071  N   ALA A 262     134.195  36.793 113.977  1.00  1.00           N  
ATOM   2072  CA  ALA A 262     133.692  37.893 114.759  1.00  1.00           C  
ATOM   2073  C   ALA A 262     133.361  37.369 116.145  1.00  1.00           C  
ATOM   2074  O   ALA A 262     132.665  36.367 116.295  1.00  1.00           O  
ATOM   2075  CB  ALA A 262     132.437  38.480 114.087  1.00  1.00           C  
ATOM   2076  N   VAL A 263     133.898  38.007 117.202  1.00  0.99           N  
ATOM   2077  CA  VAL A 263     133.857  37.439 118.540  1.00  0.99           C  
ATOM   2078  C   VAL A 263     133.127  38.338 119.521  1.00  0.99           C  
ATOM   2079  O   VAL A 263     133.441  39.514 119.659  1.00  0.99           O  
ATOM   2080  CB  VAL A 263     135.259  37.171 119.066  1.00  0.99           C  
ATOM   2081  CG1 VAL A 263     135.179  36.671 120.518  1.00  0.99           C  
ATOM   2082  CG2 VAL A 263     135.916  36.081 118.201  1.00  0.99           C  
ATOM   2083  N   TRP A 264     132.157  37.789 120.280  1.00  0.95           N  
ATOM   2084  CA  TRP A 264     131.503  38.527 121.345  1.00  0.95           C  
ATOM   2085  C   TRP A 264     131.740  37.809 122.661  1.00  0.95           C  
ATOM   2086  O   TRP A 264     131.555  36.599 122.766  1.00  0.95           O  
ATOM   2087  CB  TRP A 264     129.974  38.658 121.128  1.00  0.95           C  
ATOM   2088  CG  TRP A 264     129.548  39.643 120.071  1.00  0.95           C  
ATOM   2089  CD1 TRP A 264     129.123  40.928 120.241  1.00  0.95           C  
ATOM   2090  CD2 TRP A 264     129.521  39.387 118.661  1.00  0.95           C  
ATOM   2091  NE1 TRP A 264     128.835  41.505 119.029  1.00  0.95           N  
ATOM   2092  CE2 TRP A 264     129.083  40.572 118.039  1.00  0.95           C  
ATOM   2093  CE3 TRP A 264     129.865  38.262 117.924  1.00  0.95           C  
ATOM   2094  CZ2 TRP A 264     128.998  40.650 116.654  1.00  0.95           C  
ATOM   2095  CZ3 TRP A 264     129.766  38.338 116.534  1.00  0.95           C  
ATOM   2096  CH2 TRP A 264     129.329  39.511 115.905  1.00  0.95           C  
ATOM   2097  N   SER A 265     132.150  38.544 123.709  1.00  0.98           N  
ATOM   2098  CA  SER A 265     132.427  37.998 125.031  1.00  0.98           C  
ATOM   2099  C   SER A 265     131.771  38.845 126.098  1.00  0.98           C  
ATOM   2100  O   SER A 265     131.336  39.968 125.856  1.00  0.98           O  
ATOM   2101  CB  SER A 265     133.940  37.890 125.341  1.00  0.98           C  
ATOM   2102  OG  SER A 265     134.627  39.108 125.037  1.00  0.98           O  
ATOM   2103  N   GLY A 266     131.609  38.280 127.314  1.00  1.00           N  
ATOM   2104  CA  GLY A 266     130.966  38.964 128.422  1.00  1.00           C  
ATOM   2105  C   GLY A 266     131.971  39.200 129.501  1.00  1.00           C  
ATOM   2106  O   GLY A 266     132.793  38.337 129.799  1.00  1.00           O  
ATOM   2107  N   GLY A 267     131.933  40.375 130.150  1.00  1.00           N  
ATOM   2108  CA  GLY A 267     132.870  40.682 131.231  1.00  1.00           C  
ATOM   2109  C   GLY A 267     132.626  39.942 132.523  1.00  1.00           C  
ATOM   2110  O   GLY A 267     133.544  39.761 133.321  1.00  1.00           O  
ATOM   2111  N   HIS A 268     131.388  39.457 132.728  1.00  0.94           N  
ATOM   2112  CA  HIS A 268     130.981  38.665 133.871  1.00  0.94           C  
ATOM   2113  C   HIS A 268     130.791  37.226 133.448  1.00  0.94           C  
ATOM   2114  O   HIS A 268     130.228  36.413 134.171  1.00  0.94           O  
ATOM   2115  CB  HIS A 268     129.705  39.234 134.546  1.00  0.94           C  
ATOM   2116  CG  HIS A 268     130.019  40.435 135.399  1.00  0.94           C  
ATOM   2117  ND1 HIS A 268     129.852  41.706 134.897  1.00  0.94           N  
ATOM   2118  CD2 HIS A 268     130.580  40.503 136.639  1.00  0.94           C  
ATOM   2119  CE1 HIS A 268     130.308  42.519 135.821  1.00  0.94           C  
ATOM   2120  NE2 HIS A 268     130.761  41.844 136.900  1.00  0.94           N  
ATOM   2121  N   ASP A 269     131.303  36.820 132.269  1.00  0.97           N  
ATOM   2122  CA  ASP A 269     131.228  35.443 131.873  1.00  0.97           C  
ATOM   2123  C   ASP A 269     132.118  34.535 132.729  1.00  0.97           C  
ATOM   2124  O   ASP A 269     133.337  34.679 132.815  1.00  0.97           O  
ATOM   2125  CB  ASP A 269     131.503  35.369 130.365  1.00  0.97           C  
ATOM   2126  CG  ASP A 269     131.025  34.071 129.756  1.00  0.97           C  
ATOM   2127  OD1 ASP A 269     131.087  33.011 130.439  1.00  0.97           O  
ATOM   2128  OD2 ASP A 269     130.576  34.153 128.586  1.00  0.97           O  
ATOM   2129  N   TRP A 270     131.474  33.584 133.428  1.00  0.92           N  
ATOM   2130  CA  TRP A 270     132.108  32.544 134.196  1.00  0.92           C  
ATOM   2131  C   TRP A 270     132.912  31.538 133.387  1.00  0.92           C  
ATOM   2132  O   TRP A 270     133.939  31.050 133.858  1.00  0.92           O  
ATOM   2133  CB  TRP A 270     131.000  31.760 134.936  1.00  0.92           C  
ATOM   2134  CG  TRP A 270     130.810  32.016 136.412  1.00  0.92           C  
ATOM   2135  CD1 TRP A 270     131.547  32.715 137.325  1.00  0.92           C  
ATOM   2136  CD2 TRP A 270     129.725  31.426 137.138  1.00  0.92           C  
ATOM   2137  NE1 TRP A 270     130.980  32.611 138.578  1.00  0.92           N  
ATOM   2138  CE2 TRP A 270     129.847  31.839 138.473  1.00  0.92           C  
ATOM   2139  CE3 TRP A 270     128.685  30.606 136.723  1.00  0.92           C  
ATOM   2140  CZ2 TRP A 270     128.905  31.465 139.421  1.00  0.92           C  
ATOM   2141  CZ3 TRP A 270     127.721  30.249 137.672  1.00  0.92           C  
ATOM   2142  CH2 TRP A 270     127.829  30.667 139.003  1.00  0.92           C  
ATOM   2143  N   LEU A 271     132.394  31.139 132.207  1.00  0.96           N  
ATOM   2144  CA  LEU A 271     132.902  30.020 131.432  1.00  0.96           C  
ATOM   2145  C   LEU A 271     133.839  30.485 130.354  1.00  0.96           C  
ATOM   2146  O   LEU A 271     134.905  29.907 130.155  1.00  0.96           O  
ATOM   2147  CB  LEU A 271     131.749  29.261 130.722  1.00  0.96           C  
ATOM   2148  CG  LEU A 271     131.523  27.790 131.133  1.00  0.96           C  
ATOM   2149  CD1 LEU A 271     130.455  27.190 130.204  1.00  0.96           C  
ATOM   2150  CD2 LEU A 271     132.790  26.918 131.067  1.00  0.96           C  
ATOM   2151  N   ALA A 272     133.428  31.528 129.612  1.00  0.99           N  
ATOM   2152  CA  ALA A 272     134.242  32.110 128.574  1.00  0.99           C  
ATOM   2153  C   ALA A 272     134.844  33.390 129.121  1.00  0.99           C  
ATOM   2154  O   ALA A 272     134.588  34.494 128.636  1.00  0.99           O  
ATOM   2155  CB  ALA A 272     133.406  32.360 127.301  1.00  0.99           C  
ATOM   2156  N   ASP A 273     135.652  33.264 130.194  1.00  0.96           N  
ATOM   2157  CA  ASP A 273     136.131  34.374 130.973  1.00  0.96           C  
ATOM   2158  C   ASP A 273     137.048  35.320 130.219  1.00  0.96           C  
ATOM   2159  O   ASP A 273     137.590  35.037 129.153  1.00  0.96           O  
ATOM   2160  CB  ASP A 273     136.745  33.870 132.300  1.00  0.96           C  
ATOM   2161  CG  ASP A 273     137.963  33.038 131.970  1.00  0.96           C  
ATOM   2162  OD1 ASP A 273     137.781  31.810 131.808  1.00  0.96           O  
ATOM   2163  OD2 ASP A 273     139.058  33.649 131.820  1.00  0.96           O  
ATOM   2164  N   VAL A 274     137.242  36.519 130.782  1.00  0.97           N  
ATOM   2165  CA  VAL A 274     138.038  37.564 130.181  1.00  0.97           C  
ATOM   2166  C   VAL A 274     139.484  37.157 129.913  1.00  0.97           C  
ATOM   2167  O   VAL A 274     140.061  37.502 128.882  1.00  0.97           O  
ATOM   2168  CB  VAL A 274     138.027  38.792 131.077  1.00  0.97           C  
ATOM   2169  CG1 VAL A 274     138.694  39.978 130.355  1.00  0.97           C  
ATOM   2170  CG2 VAL A 274     136.580  39.156 131.474  1.00  0.97           C  
ATOM   2171  N   TYR A 275     140.115  36.408 130.837  1.00  0.93           N  
ATOM   2172  CA  TYR A 275     141.494  35.988 130.700  1.00  0.93           C  
ATOM   2173  C   TYR A 275     141.667  34.966 129.586  1.00  0.93           C  
ATOM   2174  O   TYR A 275     142.471  35.192 128.680  1.00  0.93           O  
ATOM   2175  CB  TYR A 275     142.040  35.410 132.029  1.00  0.93           C  
ATOM   2176  CG  TYR A 275     141.727  36.323 133.181  1.00  0.93           C  
ATOM   2177  CD1 TYR A 275     142.432  37.520 133.382  1.00  0.93           C  
ATOM   2178  CD2 TYR A 275     140.680  35.995 134.057  1.00  0.93           C  
ATOM   2179  CE1 TYR A 275     142.083  38.380 134.433  1.00  0.93           C  
ATOM   2180  CE2 TYR A 275     140.330  36.855 135.107  1.00  0.93           C  
ATOM   2181  CZ  TYR A 275     141.033  38.051 135.292  1.00  0.93           C  
ATOM   2182  OH  TYR A 275     140.699  38.932 136.338  1.00  0.93           O  
ATOM   2183  N   ASP A 276     140.855  33.879 129.568  1.00  0.95           N  
ATOM   2184  CA  ASP A 276     140.848  32.920 128.474  1.00  0.95           C  
ATOM   2185  C   ASP A 276     140.444  33.534 127.124  1.00  0.95           C  
ATOM   2186  O   ASP A 276     141.093  33.289 126.105  1.00  0.95           O  
ATOM   2187  CB  ASP A 276     140.030  31.638 128.821  1.00  0.95           C  
ATOM   2188  CG  ASP A 276     140.909  30.633 129.566  1.00  0.95           C  
ATOM   2189  OD1 ASP A 276     142.054  30.399 129.086  1.00  0.95           O  
ATOM   2190  OD2 ASP A 276     140.478  30.027 130.580  1.00  0.95           O  
ATOM   2191  N   VAL A 277     139.415  34.414 127.070  1.00  0.97           N  
ATOM   2192  CA  VAL A 277     139.054  35.139 125.850  1.00  0.97           C  
ATOM   2193  C   VAL A 277     140.162  36.026 125.306  1.00  0.97           C  
ATOM   2194  O   VAL A 277     140.445  35.995 124.109  1.00  0.97           O  
ATOM   2195  CB  VAL A 277     137.778  35.962 126.015  1.00  0.97           C  
ATOM   2196  CG1 VAL A 277     137.515  36.910 124.820  1.00  0.97           C  
ATOM   2197  CG2 VAL A 277     136.606  34.976 126.163  1.00  0.97           C  
ATOM   2198  N   ASN A 278     140.863  36.812 126.150  1.00  0.93           N  
ATOM   2199  CA  ASN A 278     141.967  37.642 125.686  1.00  0.93           C  
ATOM   2200  C   ASN A 278     143.110  36.850 125.058  1.00  0.93           C  
ATOM   2201  O   ASN A 278     143.647  37.254 124.029  1.00  0.93           O  
ATOM   2202  CB  ASN A 278     142.558  38.518 126.813  1.00  0.93           C  
ATOM   2203  CG  ASN A 278     141.562  39.580 127.254  1.00  0.93           C  
ATOM   2204  OD1 ASN A 278     140.588  39.916 126.570  1.00  0.93           O  
ATOM   2205  ND2 ASN A 278     141.822  40.181 128.435  1.00  0.93           N  
ATOM   2206  N   ILE A 279     143.480  35.687 125.639  1.00  0.94           N  
ATOM   2207  CA  ILE A 279     144.428  34.740 125.053  1.00  0.94           C  
ATOM   2208  C   ILE A 279     143.951  34.192 123.716  1.00  0.94           C  
ATOM   2209  O   ILE A 279     144.707  34.080 122.755  1.00  0.94           O  
ATOM   2210  CB  ILE A 279     144.694  33.572 126.006  1.00  0.94           C  
ATOM   2211  CG1 ILE A 279     145.333  34.023 127.344  1.00  0.94           C  
ATOM   2212  CG2 ILE A 279     145.534  32.447 125.350  1.00  0.94           C  
ATOM   2213  CD1 ILE A 279     146.702  34.703 127.225  1.00  0.94           C  
ATOM   2214  N   LEU A 280     142.661  33.852 123.599  1.00  0.94           N  
ATOM   2215  CA  LEU A 280     142.077  33.397 122.358  1.00  0.94           C  
ATOM   2216  C   LEU A 280     142.091  34.418 121.217  1.00  0.94           C  
ATOM   2217  O   LEU A 280     142.418  34.082 120.080  1.00  0.94           O  
ATOM   2218  CB  LEU A 280     140.651  32.927 122.677  1.00  0.94           C  
ATOM   2219  CG  LEU A 280     139.820  32.418 121.494  1.00  0.94           C  
ATOM   2220  CD1 LEU A 280     140.481  31.252 120.747  1.00  0.94           C  
ATOM   2221  CD2 LEU A 280     138.436  32.029 122.012  1.00  0.94           C  
ATOM   2222  N   LEU A 281     141.781  35.707 121.482  1.00  0.95           N  
ATOM   2223  CA  LEU A 281     141.806  36.767 120.478  1.00  0.95           C  
ATOM   2224  C   LEU A 281     143.172  36.985 119.839  1.00  0.95           C  
ATOM   2225  O   LEU A 281     143.268  37.302 118.655  1.00  0.95           O  
ATOM   2226  CB  LEU A 281     141.284  38.112 121.036  1.00  0.95           C  
ATOM   2227  CG  LEU A 281     139.815  38.108 121.513  1.00  0.95           C  
ATOM   2228  CD1 LEU A 281     139.475  39.464 122.152  1.00  0.95           C  
ATOM   2229  CD2 LEU A 281     138.801  37.775 120.405  1.00  0.95           C  
ATOM   2230  N   THR A 282     144.279  36.775 120.582  1.00  0.95           N  
ATOM   2231  CA  THR A 282     145.635  36.927 120.050  1.00  0.95           C  
ATOM   2232  C   THR A 282     146.026  35.789 119.114  1.00  0.95           C  
ATOM   2233  O   THR A 282     146.969  35.891 118.324  1.00  0.95           O  
ATOM   2234  CB  THR A 282     146.715  37.068 121.126  1.00  0.95           C  
ATOM   2235  OG1 THR A 282     146.865  35.896 121.909  1.00  0.95           O  
ATOM   2236  CG2 THR A 282     146.331  38.180 122.106  1.00  0.95           C  
ATOM   2237  N   GLN A 283     145.270  34.672 119.157  1.00  0.91           N  
ATOM   2238  CA  GLN A 283     145.506  33.514 118.334  1.00  0.91           C  
ATOM   2239  C   GLN A 283     144.619  33.459 117.108  1.00  0.91           C  
ATOM   2240  O   GLN A 283     144.897  32.689 116.190  1.00  0.91           O  
ATOM   2241  CB  GLN A 283     145.278  32.226 119.152  1.00  0.91           C  
ATOM   2242  CG  GLN A 283     146.383  31.990 120.201  1.00  0.91           C  
ATOM   2243  CD  GLN A 283     146.169  30.653 120.901  1.00  0.91           C  
ATOM   2244  OE1 GLN A 283     145.442  30.528 121.889  1.00  0.91           O  
ATOM   2245  NE2 GLN A 283     146.796  29.578 120.369  1.00  0.91           N  
ATOM   2246  N   ILE A 284     143.573  34.302 117.003  1.00  0.95           N  
ATOM   2247  CA  ILE A 284     142.702  34.273 115.841  1.00  0.95           C  
ATOM   2248  C   ILE A 284     143.314  35.113 114.733  1.00  0.95           C  
ATOM   2249  O   ILE A 284     143.266  36.341 114.702  1.00  0.95           O  
ATOM   2250  CB  ILE A 284     141.267  34.694 116.150  1.00  0.95           C  
ATOM   2251  CG1 ILE A 284     140.626  33.703 117.153  1.00  0.95           C  
ATOM   2252  CG2 ILE A 284     140.418  34.742 114.858  1.00  0.95           C  
ATOM   2253  CD1 ILE A 284     139.342  34.223 117.813  1.00  0.95           C  
ATOM   2254  N   THR A 285     143.943  34.426 113.761  1.00  0.95           N  
ATOM   2255  CA  THR A 285     144.292  34.993 112.460  1.00  0.95           C  
ATOM   2256  C   THR A 285     143.006  35.382 111.742  1.00  0.95           C  
ATOM   2257  O   THR A 285     142.060  34.605 111.741  1.00  0.95           O  
ATOM   2258  CB  THR A 285     145.056  33.994 111.591  1.00  0.95           C  
ATOM   2259  OG1 THR A 285     146.160  33.427 112.299  1.00  0.95           O  
ATOM   2260  CG2 THR A 285     145.639  34.631 110.321  1.00  0.95           C  
ATOM   2261  N   ASN A 286     142.915  36.592 111.141  1.00  0.96           N  
ATOM   2262  CA  ASN A 286     141.693  37.074 110.498  1.00  0.96           C  
ATOM   2263  C   ASN A 286     140.545  37.378 111.462  1.00  0.96           C  
ATOM   2264  O   ASN A 286     139.381  37.064 111.208  1.00  0.96           O  
ATOM   2265  CB  ASN A 286     141.210  36.167 109.333  1.00  0.96           C  
ATOM   2266  CG  ASN A 286     142.375  35.967 108.384  1.00  0.96           C  
ATOM   2267  OD1 ASN A 286     143.076  36.921 108.028  1.00  0.96           O  
ATOM   2268  ND2 ASN A 286     142.619  34.717 107.947  1.00  0.96           N  
ATOM   2269  N   LEU A 287     140.834  38.052 112.596  1.00  0.96           N  
ATOM   2270  CA  LEU A 287     139.791  38.541 113.476  1.00  0.96           C  
ATOM   2271  C   LEU A 287     139.172  39.811 112.894  1.00  0.96           C  
ATOM   2272  O   LEU A 287     139.819  40.846 112.772  1.00  0.96           O  
ATOM   2273  CB  LEU A 287     140.370  38.782 114.890  1.00  0.96           C  
ATOM   2274  CG  LEU A 287     139.377  39.183 116.002  1.00  0.96           C  
ATOM   2275  CD1 LEU A 287     138.296  38.121 116.261  1.00  0.96           C  
ATOM   2276  CD2 LEU A 287     140.159  39.474 117.294  1.00  0.96           C  
ATOM   2277  N   VAL A 288     137.893  39.733 112.474  1.00  0.98           N  
ATOM   2278  CA  VAL A 288     137.192  40.802 111.778  1.00  0.98           C  
ATOM   2279  C   VAL A 288     136.587  41.782 112.758  1.00  0.98           C  
ATOM   2280  O   VAL A 288     136.434  42.970 112.470  1.00  0.98           O  
ATOM   2281  CB  VAL A 288     136.120  40.177 110.877  1.00  0.98           C  
ATOM   2282  CG1 VAL A 288     134.996  41.143 110.440  1.00  0.98           C  
ATOM   2283  CG2 VAL A 288     136.828  39.613 109.630  1.00  0.98           C  
ATOM   2284  N   PHE A 289     136.225  41.307 113.960  1.00  0.97           N  
ATOM   2285  CA  PHE A 289     135.561  42.139 114.928  1.00  0.97           C  
ATOM   2286  C   PHE A 289     135.691  41.458 116.278  1.00  0.97           C  
ATOM   2287  O   PHE A 289     135.669  40.230 116.365  1.00  0.97           O  
ATOM   2288  CB  PHE A 289     134.072  42.307 114.478  1.00  0.97           C  
ATOM   2289  CG  PHE A 289     133.172  42.961 115.480  1.00  0.97           C  
ATOM   2290  CD1 PHE A 289     132.992  44.353 115.506  1.00  0.97           C  
ATOM   2291  CD2 PHE A 289     132.509  42.169 116.429  1.00  0.97           C  
ATOM   2292  CE1 PHE A 289     132.136  44.938 116.447  1.00  0.97           C  
ATOM   2293  CE2 PHE A 289     131.672  42.754 117.378  1.00  0.97           C  
ATOM   2294  CZ  PHE A 289     131.461  44.134 117.368  1.00  0.97           C  
ATOM   2295  N   HIS A 290     135.774  42.230 117.378  1.00  0.94           N  
ATOM   2296  CA  HIS A 290     135.628  41.663 118.695  1.00  0.94           C  
ATOM   2297  C   HIS A 290     134.996  42.676 119.621  1.00  0.94           C  
ATOM   2298  O   HIS A 290     135.341  43.853 119.588  1.00  0.94           O  
ATOM   2299  CB  HIS A 290     136.965  41.143 119.295  1.00  0.94           C  
ATOM   2300  CG  HIS A 290     138.028  42.182 119.530  1.00  0.94           C  
ATOM   2301  ND1 HIS A 290     138.650  42.780 118.454  1.00  0.94           N  
ATOM   2302  CD2 HIS A 290     138.531  42.677 120.695  1.00  0.94           C  
ATOM   2303  CE1 HIS A 290     139.512  43.627 118.977  1.00  0.94           C  
ATOM   2304  NE2 HIS A 290     139.482  43.603 120.329  1.00  0.94           N  
ATOM   2305  N   GLU A 291     134.053  42.240 120.480  1.00  0.93           N  
ATOM   2306  CA  GLU A 291     133.398  43.127 121.425  1.00  0.93           C  
ATOM   2307  C   GLU A 291     133.263  42.417 122.754  1.00  0.93           C  
ATOM   2308  O   GLU A 291     132.937  41.234 122.820  1.00  0.93           O  
ATOM   2309  CB  GLU A 291     131.995  43.590 120.949  1.00  0.93           C  
ATOM   2310  CG  GLU A 291     131.424  44.817 121.715  1.00  0.93           C  
ATOM   2311  CD  GLU A 291     130.018  45.264 121.289  1.00  0.93           C  
ATOM   2312  OE1 GLU A 291     129.727  45.309 120.063  1.00  0.93           O  
ATOM   2313  OE2 GLU A 291     129.238  45.628 122.209  1.00  0.93           O  
ATOM   2314  N   SER A 292     133.537  43.132 123.862  1.00  0.98           N  
ATOM   2315  CA  SER A 292     133.350  42.596 125.200  1.00  0.98           C  
ATOM   2316  C   SER A 292     132.256  43.398 125.840  1.00  0.98           C  
ATOM   2317  O   SER A 292     132.402  44.602 126.038  1.00  0.98           O  
ATOM   2318  CB  SER A 292     134.600  42.712 126.109  1.00  0.98           C  
ATOM   2319  OG  SER A 292     134.388  42.083 127.380  1.00  0.98           O  
ATOM   2320  N   ILE A 293     131.119  42.768 126.173  1.00  0.96           N  
ATOM   2321  CA  ILE A 293     130.013  43.488 126.774  1.00  0.96           C  
ATOM   2322  C   ILE A 293     130.131  43.373 128.293  1.00  0.96           C  
ATOM   2323  O   ILE A 293     130.009  42.260 128.808  1.00  0.96           O  
ATOM   2324  CB  ILE A 293     128.662  42.985 126.295  1.00  0.96           C  
ATOM   2325  CG1 ILE A 293     128.484  43.307 124.793  1.00  0.96           C  
ATOM   2326  CG2 ILE A 293     127.536  43.656 127.112  1.00  0.96           C  
ATOM   2327  CD1 ILE A 293     127.956  42.133 123.960  1.00  0.96           C  
ATOM   2328  N   PRO A 294     130.370  44.433 129.081  1.00  0.99           N  
ATOM   2329  CA  PRO A 294     130.957  44.283 130.408  1.00  0.99           C  
ATOM   2330  C   PRO A 294     130.112  43.552 131.416  1.00  0.99           C  
ATOM   2331  O   PRO A 294     130.706  42.859 132.230  1.00  0.99           O  
ATOM   2332  CB  PRO A 294     131.296  45.711 130.880  1.00  0.99           C  
ATOM   2333  CG  PRO A 294     130.635  46.616 129.839  1.00  0.99           C  
ATOM   2334  CD  PRO A 294     130.676  45.761 128.579  1.00  0.99           C  
ATOM   2335  N   GLU A 295     128.769  43.693 131.392  1.00  0.96           N  
ATOM   2336  CA  GLU A 295     127.913  43.087 132.392  1.00  0.96           C  
ATOM   2337  C   GLU A 295     127.382  41.728 131.975  1.00  0.96           C  
ATOM   2338  O   GLU A 295     126.740  41.029 132.754  1.00  0.96           O  
ATOM   2339  CB  GLU A 295     126.723  44.004 132.806  1.00  0.96           C  
ATOM   2340  CG  GLU A 295     125.542  44.220 131.826  1.00  0.96           C  
ATOM   2341  CD  GLU A 295     124.327  44.695 132.634  1.00  0.96           C  
ATOM   2342  OE1 GLU A 295     123.339  43.922 132.693  1.00  0.96           O  
ATOM   2343  OE2 GLU A 295     124.380  45.787 133.275  1.00  0.96           O  
ATOM   2344  N   TRP A 296     127.628  41.306 130.719  1.00  0.95           N  
ATOM   2345  CA  TRP A 296     127.097  40.059 130.204  1.00  0.95           C  
ATOM   2346  C   TRP A 296     127.693  38.805 130.799  1.00  0.95           C  
ATOM   2347  O   TRP A 296     128.900  38.699 131.018  1.00  0.95           O  
ATOM   2348  CB  TRP A 296     127.184  39.980 128.665  1.00  0.95           C  
ATOM   2349  CG  TRP A 296     126.054  40.701 127.950  1.00  0.95           C  
ATOM   2350  CD1 TRP A 296     125.161  41.635 128.409  1.00  0.95           C  
ATOM   2351  CD2 TRP A 296     125.632  40.369 126.620  1.00  0.95           C  
ATOM   2352  NE1 TRP A 296     124.260  41.957 127.420  1.00  0.95           N  
ATOM   2353  CE2 TRP A 296     124.520  41.183 126.328  1.00  0.95           C  
ATOM   2354  CE3 TRP A 296     126.094  39.428 125.706  1.00  0.95           C  
ATOM   2355  CZ2 TRP A 296     123.855  41.075 125.124  1.00  0.95           C  
ATOM   2356  CZ3 TRP A 296     125.407  39.312 124.492  1.00  0.95           C  
ATOM   2357  CH2 TRP A 296     124.292  40.110 124.213  1.00  0.95           C  
ATOM   2358  N   GLU A 297     126.817  37.808 130.997  1.00  0.96           N  
ATOM   2359  CA  GLU A 297     127.145  36.500 131.499  1.00  0.96           C  
ATOM   2360  C   GLU A 297     126.997  35.506 130.353  1.00  0.96           C  
ATOM   2361  O   GLU A 297     126.591  35.846 129.240  1.00  0.96           O  
ATOM   2362  CB  GLU A 297     126.166  36.159 132.643  1.00  0.96           C  
ATOM   2363  CG  GLU A 297     126.716  35.371 133.857  1.00  0.96           C  
ATOM   2364  CD  GLU A 297     126.989  36.215 135.108  1.00  0.96           C  
ATOM   2365  OE1 GLU A 297     126.535  37.385 135.170  1.00  0.96           O  
ATOM   2366  OE2 GLU A 297     127.582  35.632 136.052  1.00  0.96           O  
ATOM   2367  N   HIS A 298     127.330  34.223 130.582  1.00  0.96           N  
ATOM   2368  CA  HIS A 298     127.374  33.216 129.528  1.00  0.96           C  
ATOM   2369  C   HIS A 298     126.061  32.902 128.821  1.00  0.96           C  
ATOM   2370  O   HIS A 298     126.046  32.474 127.667  1.00  0.96           O  
ATOM   2371  CB  HIS A 298     127.904  31.883 130.066  1.00  0.96           C  
ATOM   2372  CG  HIS A 298     128.356  30.939 128.991  1.00  0.96           C  
ATOM   2373  ND1 HIS A 298     129.371  31.359 128.174  1.00  0.96           N  
ATOM   2374  CD2 HIS A 298     128.113  29.622 128.775  1.00  0.96           C  
ATOM   2375  CE1 HIS A 298     129.756  30.315 127.498  1.00  0.96           C  
ATOM   2376  NE2 HIS A 298     129.029  29.232 127.828  1.00  0.96           N  
ATOM   2377  N   LEU A 299     124.900  33.078 129.482  1.00  0.99           N  
ATOM   2378  CA  LEU A 299     123.608  32.841 128.860  1.00  0.99           C  
ATOM   2379  C   LEU A 299     122.982  34.093 128.242  1.00  0.99           C  
ATOM   2380  O   LEU A 299     121.974  34.002 127.541  1.00  0.99           O  
ATOM   2381  CB  LEU A 299     122.614  32.234 129.877  1.00  0.99           C  
ATOM   2382  CG  LEU A 299     123.026  30.850 130.422  1.00  0.99           C  
ATOM   2383  CD1 LEU A 299     122.128  30.454 131.601  1.00  0.99           C  
ATOM   2384  CD2 LEU A 299     122.994  29.752 129.344  1.00  0.99           C  
ATOM   2385  N   ASP A 300     123.579  35.294 128.405  1.00  0.99           N  
ATOM   2386  CA  ASP A 300     123.082  36.535 127.830  1.00  0.99           C  
ATOM   2387  C   ASP A 300     123.133  36.537 126.306  1.00  0.99           C  
ATOM   2388  O   ASP A 300     122.313  37.155 125.629  1.00  0.99           O  
ATOM   2389  CB  ASP A 300     123.869  37.746 128.375  1.00  0.99           C  
ATOM   2390  CG  ASP A 300     123.565  37.973 129.843  1.00  0.99           C  
ATOM   2391  OD1 ASP A 300     123.722  37.020 130.649  1.00  0.99           O  
ATOM   2392  OD2 ASP A 300     123.196  39.125 130.190  1.00  0.99           O  
ATOM   2393  N   PHE A 301     124.078  35.780 125.723  1.00  0.98           N  
ATOM   2394  CA  PHE A 301     124.212  35.609 124.285  1.00  0.98           C  
ATOM   2395  C   PHE A 301     123.032  34.962 123.582  1.00  0.98           C  
ATOM   2396  O   PHE A 301     122.841  35.189 122.388  1.00  0.98           O  
ATOM   2397  CB  PHE A 301     125.435  34.751 123.900  1.00  0.98           C  
ATOM   2398  CG  PHE A 301     126.688  35.392 124.379  1.00  0.98           C  
ATOM   2399  CD1 PHE A 301     127.320  36.402 123.639  1.00  0.98           C  
ATOM   2400  CD2 PHE A 301     127.228  35.006 125.610  1.00  0.98           C  
ATOM   2401  CE1 PHE A 301     128.461  37.031 124.141  1.00  0.98           C  
ATOM   2402  CE2 PHE A 301     128.378  35.618 126.106  1.00  0.98           C  
ATOM   2403  CZ  PHE A 301     128.989  36.631 125.369  1.00  0.98           C  
ATOM   2404  N   ILE A 302     122.257  34.112 124.290  1.00  0.98           N  
ATOM   2405  CA  ILE A 302     121.071  33.468 123.754  1.00  0.98           C  
ATOM   2406  C   ILE A 302     119.770  34.010 124.366  1.00  0.98           C  
ATOM   2407  O   ILE A 302     118.758  34.131 123.673  1.00  0.98           O  
ATOM   2408  CB  ILE A 302     121.150  31.946 123.911  1.00  0.98           C  
ATOM   2409  CG1 ILE A 302     121.602  31.485 125.319  1.00  0.98           C  
ATOM   2410  CG2 ILE A 302     122.105  31.411 122.818  1.00  0.98           C  
ATOM   2411  CD1 ILE A 302     121.145  30.058 125.637  1.00  0.98           C  
ATOM   2412  N   TRP A 303     119.760  34.409 125.664  1.00  0.95           N  
ATOM   2413  CA  TRP A 303     118.542  34.791 126.375  1.00  0.95           C  
ATOM   2414  C   TRP A 303     118.578  36.181 126.978  1.00  0.95           C  
ATOM   2415  O   TRP A 303     117.691  36.546 127.756  1.00  0.95           O  
ATOM   2416  CB  TRP A 303     118.236  33.789 127.516  1.00  0.95           C  
ATOM   2417  CG  TRP A 303     117.921  32.402 127.018  1.00  0.95           C  
ATOM   2418  CD1 TRP A 303     117.255  32.070 125.879  1.00  0.95           C  
ATOM   2419  CD2 TRP A 303     118.260  31.160 127.661  1.00  0.95           C  
ATOM   2420  NE1 TRP A 303     117.177  30.711 125.744  1.00  0.95           N  
ATOM   2421  CE2 TRP A 303     117.771  30.129 126.844  1.00  0.95           C  
ATOM   2422  CE3 TRP A 303     118.943  30.886 128.841  1.00  0.95           C  
ATOM   2423  CZ2 TRP A 303     117.949  28.791 127.191  1.00  0.95           C  
ATOM   2424  CZ3 TRP A 303     119.126  29.542 129.191  1.00  0.95           C  
ATOM   2425  CH2 TRP A 303     118.641  28.510 128.382  1.00  0.95           C  
ATOM   2426  N   GLY A 304     119.586  37.013 126.651  1.00  1.00           N  
ATOM   2427  CA  GLY A 304     119.622  38.399 127.099  1.00  1.00           C  
ATOM   2428  C   GLY A 304     118.510  39.251 126.540  1.00  1.00           C  
ATOM   2429  O   GLY A 304     118.225  39.214 125.345  1.00  1.00           O  
ATOM   2430  N   LEU A 305     117.885  40.095 127.384  1.00  0.96           N  
ATOM   2431  CA  LEU A 305     116.865  41.052 126.983  1.00  0.96           C  
ATOM   2432  C   LEU A 305     117.390  42.065 125.982  1.00  0.96           C  
ATOM   2433  O   LEU A 305     116.701  42.411 125.021  1.00  0.96           O  
ATOM   2434  CB  LEU A 305     116.278  41.815 128.201  1.00  0.96           C  
ATOM   2435  CG  LEU A 305     115.432  40.968 129.173  1.00  0.96           C  
ATOM   2436  CD1 LEU A 305     115.323  41.675 130.534  1.00  0.96           C  
ATOM   2437  CD2 LEU A 305     114.030  40.685 128.610  1.00  0.96           C  
ATOM   2438  N   ASP A 306     118.639  42.535 126.157  1.00  0.96           N  
ATOM   2439  CA  ASP A 306     119.244  43.501 125.276  1.00  0.96           C  
ATOM   2440  C   ASP A 306     119.997  42.890 124.094  1.00  0.96           C  
ATOM   2441  O   ASP A 306     120.392  43.597 123.163  1.00  0.96           O  
ATOM   2442  CB  ASP A 306     120.115  44.482 126.109  1.00  0.96           C  
ATOM   2443  CG  ASP A 306     121.341  43.848 126.747  1.00  0.96           C  
ATOM   2444  OD1 ASP A 306     121.518  42.611 126.636  1.00  0.96           O  
ATOM   2445  OD2 ASP A 306     122.164  44.612 127.311  1.00  0.96           O  
ATOM   2446  N   ALA A 307     120.127  41.546 124.029  1.00  1.00           N  
ATOM   2447  CA  ALA A 307     120.768  40.845 122.931  1.00  1.00           C  
ATOM   2448  C   ALA A 307     120.268  41.183 121.521  1.00  1.00           C  
ATOM   2449  O   ALA A 307     121.120  41.252 120.630  1.00  1.00           O  
ATOM   2450  CB  ALA A 307     120.738  39.317 123.150  1.00  1.00           C  
ATOM   2451  N   PRO A 308     118.994  41.438 121.193  1.00  0.98           N  
ATOM   2452  CA  PRO A 308     118.604  41.922 119.878  1.00  0.98           C  
ATOM   2453  C   PRO A 308     119.322  43.172 119.390  1.00  0.98           C  
ATOM   2454  O   PRO A 308     119.746  43.185 118.236  1.00  0.98           O  
ATOM   2455  CB  PRO A 308     117.068  42.024 119.924  1.00  0.98           C  
ATOM   2456  CG  PRO A 308     116.675  41.092 121.077  1.00  0.98           C  
ATOM   2457  CD  PRO A 308     117.827  41.264 122.057  1.00  0.98           C  
ATOM   2458  N   TRP A 309     119.506  44.217 120.232  1.00  0.93           N  
ATOM   2459  CA  TRP A 309     120.093  45.465 119.774  1.00  0.93           C  
ATOM   2460  C   TRP A 309     121.605  45.582 119.992  1.00  0.93           C  
ATOM   2461  O   TRP A 309     122.267  46.272 119.219  1.00  0.93           O  
ATOM   2462  CB  TRP A 309     119.333  46.709 120.330  1.00  0.93           C  
ATOM   2463  CG  TRP A 309     119.265  46.883 121.843  1.00  0.93           C  
ATOM   2464  CD1 TRP A 309     120.091  47.601 122.663  1.00  0.93           C  
ATOM   2465  CD2 TRP A 309     118.203  46.388 122.680  1.00  0.93           C  
ATOM   2466  NE1 TRP A 309     119.619  47.581 123.960  1.00  0.93           N  
ATOM   2467  CE2 TRP A 309     118.455  46.850 123.986  1.00  0.93           C  
ATOM   2468  CE3 TRP A 309     117.085  45.610 122.396  1.00  0.93           C  
ATOM   2469  CZ2 TRP A 309     117.584  46.558 125.030  1.00  0.93           C  
ATOM   2470  CZ3 TRP A 309     116.230  45.282 123.456  1.00  0.93           C  
ATOM   2471  CH2 TRP A 309     116.465  45.759 124.752  1.00  0.93           C  
ATOM   2472  N   ARG A 310     122.218  44.879 120.981  1.00  0.89           N  
ATOM   2473  CA  ARG A 310     123.677  44.907 121.140  1.00  0.89           C  
ATOM   2474  C   ARG A 310     124.391  43.761 120.447  1.00  0.89           C  
ATOM   2475  O   ARG A 310     125.595  43.837 120.217  1.00  0.89           O  
ATOM   2476  CB  ARG A 310     124.213  45.064 122.606  1.00  0.89           C  
ATOM   2477  CG  ARG A 310     123.216  44.947 123.776  1.00  0.89           C  
ATOM   2478  CD  ARG A 310     123.323  46.087 124.791  1.00  0.89           C  
ATOM   2479  NE  ARG A 310     124.678  46.039 125.408  1.00  0.89           N  
ATOM   2480  CZ  ARG A 310     125.120  47.003 126.222  1.00  0.89           C  
ATOM   2481  NH1 ARG A 310     126.301  46.887 126.814  1.00  0.89           N  
ATOM   2482  NH2 ARG A 310     124.369  48.071 126.474  1.00  0.89           N  
ATOM   2483  N   LEU A 311     123.690  42.698 120.020  1.00  0.96           N  
ATOM   2484  CA  LEU A 311     124.380  41.548 119.481  1.00  0.96           C  
ATOM   2485  C   LEU A 311     123.799  41.181 118.139  1.00  0.96           C  
ATOM   2486  O   LEU A 311     124.482  41.211 117.113  1.00  0.96           O  
ATOM   2487  CB  LEU A 311     124.251  40.382 120.481  1.00  0.96           C  
ATOM   2488  CG  LEU A 311     125.359  39.307 120.442  1.00  0.96           C  
ATOM   2489  CD1 LEU A 311     124.795  37.969 120.942  1.00  0.96           C  
ATOM   2490  CD2 LEU A 311     126.027  39.116 119.073  1.00  0.96           C  
ATOM   2491  N   TYR A 312     122.500  40.833 118.106  1.00  0.95           N  
ATOM   2492  CA  TYR A 312     121.864  40.263 116.937  1.00  0.95           C  
ATOM   2493  C   TYR A 312     121.870  41.200 115.742  1.00  0.95           C  
ATOM   2494  O   TYR A 312     122.242  40.786 114.648  1.00  0.95           O  
ATOM   2495  CB  TYR A 312     120.443  39.720 117.244  1.00  0.95           C  
ATOM   2496  CG  TYR A 312     120.369  38.727 118.391  1.00  0.95           C  
ATOM   2497  CD1 TYR A 312     121.442  37.887 118.746  1.00  0.95           C  
ATOM   2498  CD2 TYR A 312     119.157  38.568 119.089  1.00  0.95           C  
ATOM   2499  CE1 TYR A 312     121.300  36.921 119.754  1.00  0.95           C  
ATOM   2500  CE2 TYR A 312     119.032  37.648 120.138  1.00  0.95           C  
ATOM   2501  CZ  TYR A 312     120.095  36.801 120.444  1.00  0.95           C  
ATOM   2502  OH  TYR A 312     119.940  35.783 121.399  1.00  0.95           O  
ATOM   2503  N   ASN A 313     121.581  42.507 115.930  1.00  0.95           N  
ATOM   2504  CA  ASN A 313     121.716  43.494 114.864  1.00  0.95           C  
ATOM   2505  C   ASN A 313     123.109  43.538 114.233  1.00  0.95           C  
ATOM   2506  O   ASN A 313     123.251  43.572 113.011  1.00  0.95           O  
ATOM   2507  CB  ASN A 313     121.336  44.905 115.386  1.00  0.95           C  
ATOM   2508  CG  ASN A 313     119.821  45.029 115.483  1.00  0.95           C  
ATOM   2509  OD1 ASN A 313     119.059  44.184 114.999  1.00  0.95           O  
ATOM   2510  ND2 ASN A 313     119.332  46.139 116.077  1.00  0.95           N  
ATOM   2511  N   LYS A 314     124.182  43.474 115.046  1.00  0.92           N  
ATOM   2512  CA  LYS A 314     125.548  43.479 114.559  1.00  0.92           C  
ATOM   2513  C   LYS A 314     125.895  42.244 113.741  1.00  0.92           C  
ATOM   2514  O   LYS A 314     126.546  42.349 112.701  1.00  0.92           O  
ATOM   2515  CB  LYS A 314     126.531  43.724 115.730  1.00  0.92           C  
ATOM   2516  CG  LYS A 314     127.481  44.920 115.523  1.00  0.92           C  
ATOM   2517  CD  LYS A 314     127.878  45.568 116.865  1.00  0.92           C  
ATOM   2518  CE  LYS A 314     128.871  46.731 116.760  1.00  0.92           C  
ATOM   2519  NZ  LYS A 314     128.157  47.981 116.415  1.00  0.92           N  
ATOM   2520  N   ILE A 315     125.408  41.051 114.152  1.00  0.97           N  
ATOM   2521  CA  ILE A 315     125.522  39.828 113.360  1.00  0.97           C  
ATOM   2522  C   ILE A 315     124.878  39.960 111.986  1.00  0.97           C  
ATOM   2523  O   ILE A 315     125.505  39.661 110.970  1.00  0.97           O  
ATOM   2524  CB  ILE A 315     124.915  38.633 114.092  1.00  0.97           C  
ATOM   2525  CG1 ILE A 315     125.743  38.312 115.353  1.00  0.97           C  
ATOM   2526  CG2 ILE A 315     124.829  37.386 113.177  1.00  0.97           C  
ATOM   2527  CD1 ILE A 315     125.112  37.209 116.210  1.00  0.97           C  
ATOM   2528  N   ILE A 316     123.635  40.487 111.915  1.00  0.96           N  
ATOM   2529  CA  ILE A 316     122.923  40.717 110.662  1.00  0.96           C  
ATOM   2530  C   ILE A 316     123.680  41.681 109.757  1.00  0.96           C  
ATOM   2531  O   ILE A 316     123.874  41.440 108.565  1.00  0.96           O  
ATOM   2532  CB  ILE A 316     121.530  41.307 110.922  1.00  0.96           C  
ATOM   2533  CG1 ILE A 316     120.663  40.423 111.853  1.00  0.96           C  
ATOM   2534  CG2 ILE A 316     120.771  41.615 109.608  1.00  0.96           C  
ATOM   2535  CD1 ILE A 316     120.106  39.166 111.191  1.00  0.96           C  
ATOM   2536  N   ASN A 317     124.161  42.812 110.308  1.00  0.91           N  
ATOM   2537  CA  ASN A 317     124.902  43.801 109.550  1.00  0.91           C  
ATOM   2538  C   ASN A 317     126.254  43.335 109.029  1.00  0.91           C  
ATOM   2539  O   ASN A 317     126.609  43.648 107.895  1.00  0.91           O  
ATOM   2540  CB  ASN A 317     125.030  45.138 110.319  1.00  0.91           C  
ATOM   2541  CG  ASN A 317     123.679  45.792 110.616  1.00  0.91           C  
ATOM   2542  OD1 ASN A 317     123.526  46.479 111.629  1.00  0.91           O  
ATOM   2543  ND2 ASN A 317     122.681  45.628 109.721  1.00  0.91           N  
ATOM   2544  N   LEU A 318     127.034  42.556 109.800  1.00  0.95           N  
ATOM   2545  CA  LEU A 318     128.253  41.937 109.302  1.00  0.95           C  
ATOM   2546  C   LEU A 318     128.031  40.922 108.183  1.00  0.95           C  
ATOM   2547  O   LEU A 318     128.783  40.894 107.210  1.00  0.95           O  
ATOM   2548  CB  LEU A 318     129.040  41.293 110.459  1.00  0.95           C  
ATOM   2549  CG  LEU A 318     129.714  42.315 111.400  1.00  0.95           C  
ATOM   2550  CD1 LEU A 318     130.101  41.653 112.731  1.00  0.95           C  
ATOM   2551  CD2 LEU A 318     130.947  42.971 110.754  1.00  0.95           C  
ATOM   2552  N   MET A 319     126.964  40.098 108.258  1.00  0.94           N  
ATOM   2553  CA  MET A 319     126.547  39.233 107.161  1.00  0.94           C  
ATOM   2554  C   MET A 319     126.186  39.988 105.892  1.00  0.94           C  
ATOM   2555  O   MET A 319     126.546  39.574 104.790  1.00  0.94           O  
ATOM   2556  CB  MET A 319     125.302  38.408 107.553  1.00  0.94           C  
ATOM   2557  CG  MET A 319     125.559  37.321 108.606  1.00  0.94           C  
ATOM   2558  SD  MET A 319     124.035  36.495 109.144  1.00  0.94           S  
ATOM   2559  CE  MET A 319     124.864  35.304 110.228  1.00  0.94           C  
ATOM   2560  N   ARG A 320     125.470  41.120 106.021  1.00  0.86           N  
ATOM   2561  CA  ARG A 320     125.170  41.999 104.907  1.00  0.86           C  
ATOM   2562  C   ARG A 320     126.347  42.758 104.327  1.00  0.86           C  
ATOM   2563  O   ARG A 320     126.328  43.115 103.159  1.00  0.86           O  
ATOM   2564  CB  ARG A 320     124.098  43.035 105.282  1.00  0.86           C  
ATOM   2565  CG  ARG A 320     122.731  42.381 105.524  1.00  0.86           C  
ATOM   2566  CD  ARG A 320     121.572  43.353 105.330  1.00  0.86           C  
ATOM   2567  NE  ARG A 320     120.314  42.546 105.514  1.00  0.86           N  
ATOM   2568  CZ  ARG A 320     119.226  42.916 106.203  1.00  0.86           C  
ATOM   2569  NH1 ARG A 320     118.153  42.123 106.221  1.00  0.86           N  
ATOM   2570  NH2 ARG A 320     119.188  44.065 106.871  1.00  0.86           N  
ATOM   2571  N   LYS A 321     127.370  43.063 105.138  1.00  0.88           N  
ATOM   2572  CA  LYS A 321     128.631  43.622 104.686  1.00  0.88           C  
ATOM   2573  C   LYS A 321     129.531  42.661 103.914  1.00  0.88           C  
ATOM   2574  O   LYS A 321     130.348  43.074 103.091  1.00  0.88           O  
ATOM   2575  CB  LYS A 321     129.404  44.120 105.924  1.00  0.88           C  
ATOM   2576  CG  LYS A 321     130.281  45.348 105.652  1.00  0.88           C  
ATOM   2577  CD  LYS A 321     130.919  45.868 106.951  1.00  0.88           C  
ATOM   2578  CE  LYS A 321     131.792  47.112 106.764  1.00  0.88           C  
ATOM   2579  NZ  LYS A 321     132.158  47.678 108.085  1.00  0.88           N  
ATOM   2580  N   TYR A 322     129.441  41.358 104.245  1.00  0.88           N  
ATOM   2581  CA  TYR A 322     130.012  40.246 103.506  1.00  0.88           C  
ATOM   2582  C   TYR A 322     129.300  39.965 102.176  1.00  0.88           C  
ATOM   2583  O   TYR A 322     129.917  39.500 101.217  1.00  0.88           O  
ATOM   2584  CB  TYR A 322     129.965  38.981 104.411  1.00  0.88           C  
ATOM   2585  CG  TYR A 322     130.856  37.879 103.896  1.00  0.88           C  
ATOM   2586  CD1 TYR A 322     130.464  37.063 102.820  1.00  0.88           C  
ATOM   2587  CD2 TYR A 322     132.123  37.681 104.461  1.00  0.88           C  
ATOM   2588  CE1 TYR A 322     131.329  36.096 102.300  1.00  0.88           C  
ATOM   2589  CE2 TYR A 322     132.983  36.695 103.958  1.00  0.88           C  
ATOM   2590  CZ  TYR A 322     132.582  35.900 102.879  1.00  0.88           C  
ATOM   2591  OH  TYR A 322     133.423  34.891 102.375  1.00  0.88           O  
ATOM   2592  N   GLN A 323     127.969  40.158 102.147  1.00  0.69           N  
ATOM   2593  CA  GLN A 323     127.123  39.986 100.975  1.00  0.69           C  
ATOM   2594  C   GLN A 323     127.222  41.072  99.865  1.00  0.69           C  
ATOM   2595  O   GLN A 323     127.905  42.111 100.043  1.00  0.69           O  
ATOM   2596  CB  GLN A 323     125.625  39.910 101.402  1.00  0.69           C  
ATOM   2597  CG  GLN A 323     124.865  38.675 100.875  1.00  0.69           C  
ATOM   2598  CD  GLN A 323     124.674  37.602 101.934  1.00  0.69           C  
ATOM   2599  OE1 GLN A 323     124.007  37.746 102.964  1.00  0.69           O  
ATOM   2600  NE2 GLN A 323     125.265  36.414 101.683  1.00  0.69           N  
ATOM   2601  OXT GLN A 323     126.553  40.847  98.813  1.00  0.69           O  
TER    2602      GLN A 323                                                      
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.