CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 22020813065521816

Job options:

ID        	=	 22020813065521816
JOBID     	=	 
USERID    	=	 zob
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


data_7KOO
# 
_entry.id   7KOO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7KOO         
WWPDB D_1000252581 
EMDB  EMD-22979    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Alpha-7 nicotinic acetylcholine receptor bound to alpha-bungarotoxin' 
_pdbx_database_related.db_id          EMD-22979 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7KOO 
_pdbx_database_status.recvd_initial_deposition_date   2020-11-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Noviello, C.M.'   1 0000-0002-0055-1019 
'Hibbs, R.E.'      2 0000-0003-4283-1147 
'Gharpure, A.'     3 0000-0002-4458-359X 
'Mukhtasimova, N.' 4 0000-0001-6652-1974 
'Cabuco, R.'       5 0000-0001-5545-6206 
'Baxter, L.'       6 0000-0002-1762-3218 
'Borek, D.'        7 0000-0002-4321-6253 
'Sine, S.'         8 0000-0002-0594-6052 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure and gating mechanism of the alpha 7 nicotinic acetylcholine receptor.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2021.02.049 
_citation.pdbx_database_id_PubMed   33735609 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Noviello, C.M.'   1 ? 
primary 'Gharpure, A.'     2 ? 
primary 'Mukhtasimova, N.' 3 ? 
primary 'Cabuco, R.'       4 ? 
primary 'Baxter, L.'       5 ? 
primary 'Borek, D.'        6 ? 
primary 'Sine, S.M.'       7 ? 
primary 'Hibbs, R.E.'      8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7KOO 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7KOO 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Neuronal acetylcholine receptor subunit alpha-7,Soluble cytochrome b562 fusion' 63869.355 5 ? ? ? ? 
2 polymer     syn 'Alpha-bungarotoxin isoform V31' 7721.973  5 ? ? ? ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   5 ? ? ? ? 
4 branched    man 
;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   5 ? ? ? ? 
5 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   5 ? ? ? ? 
6 non-polymer nat 'CALCIUM ION' 40.078    5 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cytochrome b-562'           
2 'BGTX V31,Long neurotoxin 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLNLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFP
DGQIWKPDILLYNSADERFDATFHTNVLVNPSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ
EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKIS
LGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFL
RMKRPGEDKVRPACQHKQRRCSLASVEMAGAMADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKL
EDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLCGRMACSPTHDEHLLHGGQPPE
GDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFAWSHPQF
EK
;
;EFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLNLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFP
DGQIWKPDILLYNSADERFDATFHTNVLVNPSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ
EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKIS
LGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFL
RMKRPGEDKVRPACQHKQRRCSLASVEMAGAMADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKL
EDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLCGRMACSPTHDEHLLHGGQPPE
GDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFAWSHPQF
EK
;
A,B,C,D,E ? 
2 'polypeptide(L)' no no IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQ 
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQ F,J,G,I,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   PHE n 
1 3   GLN n 
1 4   ARG n 
1 5   LYS n 
1 6   LEU n 
1 7   TYR n 
1 8   LYS n 
1 9   GLU n 
1 10  LEU n 
1 11  VAL n 
1 12  LYS n 
1 13  ASN n 
1 14  TYR n 
1 15  ASN n 
1 16  PRO n 
1 17  LEU n 
1 18  GLU n 
1 19  ARG n 
1 20  PRO n 
1 21  VAL n 
1 22  ALA n 
1 23  ASN n 
1 24  ASP n 
1 25  SER n 
1 26  GLN n 
1 27  PRO n 
1 28  LEU n 
1 29  THR n 
1 30  VAL n 
1 31  TYR n 
1 32  PHE n 
1 33  SER n 
1 34  LEU n 
1 35  ASN n 
1 36  LEU n 
1 37  LEU n 
1 38  GLN n 
1 39  ILE n 
1 40  MET n 
1 41  ASP n 
1 42  VAL n 
1 43  ASP n 
1 44  GLU n 
1 45  LYS n 
1 46  ASN n 
1 47  GLN n 
1 48  VAL n 
1 49  LEU n 
1 50  THR n 
1 51  THR n 
1 52  ASN n 
1 53  ILE n 
1 54  TRP n 
1 55  LEU n 
1 56  GLN n 
1 57  MET n 
1 58  SER n 
1 59  TRP n 
1 60  THR n 
1 61  ASP n 
1 62  HIS n 
1 63  TYR n 
1 64  LEU n 
1 65  GLN n 
1 66  TRP n 
1 67  ASN n 
1 68  VAL n 
1 69  SER n 
1 70  GLU n 
1 71  TYR n 
1 72  PRO n 
1 73  GLY n 
1 74  VAL n 
1 75  LYS n 
1 76  THR n 
1 77  VAL n 
1 78  ARG n 
1 79  PHE n 
1 80  PRO n 
1 81  ASP n 
1 82  GLY n 
1 83  GLN n 
1 84  ILE n 
1 85  TRP n 
1 86  LYS n 
1 87  PRO n 
1 88  ASP n 
1 89  ILE n 
1 90  LEU n 
1 91  LEU n 
1 92  TYR n 
1 93  ASN n 
1 94  SER n 
1 95  ALA n 
1 96  ASP n 
1 97  GLU n 
1 98  ARG n 
1 99  PHE n 
1 100 ASP n 
1 101 ALA n 
1 102 THR n 
1 103 PHE n 
1 104 HIS n 
1 105 THR n 
1 106 ASN n 
1 107 VAL n 
1 108 LEU n 
1 109 VAL n 
1 110 ASN n 
1 111 PRO n 
1 112 SER n 
1 113 GLY n 
1 114 HIS n 
1 115 CYS n 
1 116 GLN n 
1 117 TYR n 
1 118 LEU n 
1 119 PRO n 
1 120 PRO n 
1 121 GLY n 
1 122 ILE n 
1 123 PHE n 
1 124 LYS n 
1 125 SER n 
1 126 SER n 
1 127 CYS n 
1 128 TYR n 
1 129 ILE n 
1 130 ASP n 
1 131 VAL n 
1 132 ARG n 
1 133 TRP n 
1 134 PHE n 
1 135 PRO n 
1 136 PHE n 
1 137 ASP n 
1 138 VAL n 
1 139 GLN n 
1 140 HIS n 
1 141 CYS n 
1 142 LYS n 
1 143 LEU n 
1 144 LYS n 
1 145 PHE n 
1 146 GLY n 
1 147 SER n 
1 148 TRP n 
1 149 SER n 
1 150 TYR n 
1 151 GLY n 
1 152 GLY n 
1 153 TRP n 
1 154 SER n 
1 155 LEU n 
1 156 ASP n 
1 157 LEU n 
1 158 GLN n 
1 159 MET n 
1 160 GLN n 
1 161 GLU n 
1 162 ALA n 
1 163 ASP n 
1 164 ILE n 
1 165 SER n 
1 166 GLY n 
1 167 TYR n 
1 168 ILE n 
1 169 PRO n 
1 170 ASN n 
1 171 GLY n 
1 172 GLU n 
1 173 TRP n 
1 174 ASP n 
1 175 LEU n 
1 176 VAL n 
1 177 GLY n 
1 178 ILE n 
1 179 PRO n 
1 180 GLY n 
1 181 LYS n 
1 182 ARG n 
1 183 SER n 
1 184 GLU n 
1 185 ARG n 
1 186 PHE n 
1 187 TYR n 
1 188 GLU n 
1 189 CYS n 
1 190 CYS n 
1 191 LYS n 
1 192 GLU n 
1 193 PRO n 
1 194 TYR n 
1 195 PRO n 
1 196 ASP n 
1 197 VAL n 
1 198 THR n 
1 199 PHE n 
1 200 THR n 
1 201 VAL n 
1 202 THR n 
1 203 MET n 
1 204 ARG n 
1 205 ARG n 
1 206 ARG n 
1 207 THR n 
1 208 LEU n 
1 209 TYR n 
1 210 TYR n 
1 211 GLY n 
1 212 LEU n 
1 213 ASN n 
1 214 LEU n 
1 215 LEU n 
1 216 ILE n 
1 217 PRO n 
1 218 CYS n 
1 219 VAL n 
1 220 LEU n 
1 221 ILE n 
1 222 SER n 
1 223 ALA n 
1 224 LEU n 
1 225 ALA n 
1 226 LEU n 
1 227 LEU n 
1 228 VAL n 
1 229 PHE n 
1 230 LEU n 
1 231 LEU n 
1 232 PRO n 
1 233 ALA n 
1 234 ASP n 
1 235 SER n 
1 236 GLY n 
1 237 GLU n 
1 238 LYS n 
1 239 ILE n 
1 240 SER n 
1 241 LEU n 
1 242 GLY n 
1 243 ILE n 
1 244 THR n 
1 245 VAL n 
1 246 LEU n 
1 247 LEU n 
1 248 SER n 
1 249 LEU n 
1 250 THR n 
1 251 VAL n 
1 252 PHE n 
1 253 MET n 
1 254 LEU n 
1 255 LEU n 
1 256 VAL n 
1 257 ALA n 
1 258 GLU n 
1 259 ILE n 
1 260 MET n 
1 261 PRO n 
1 262 ALA n 
1 263 THR n 
1 264 SER n 
1 265 ASP n 
1 266 SER n 
1 267 VAL n 
1 268 PRO n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 GLN n 
1 273 TYR n 
1 274 PHE n 
1 275 ALA n 
1 276 SER n 
1 277 THR n 
1 278 MET n 
1 279 ILE n 
1 280 ILE n 
1 281 VAL n 
1 282 GLY n 
1 283 LEU n 
1 284 SER n 
1 285 VAL n 
1 286 VAL n 
1 287 VAL n 
1 288 THR n 
1 289 VAL n 
1 290 ILE n 
1 291 VAL n 
1 292 LEU n 
1 293 GLN n 
1 294 TYR n 
1 295 HIS n 
1 296 HIS n 
1 297 HIS n 
1 298 ASP n 
1 299 PRO n 
1 300 ASP n 
1 301 GLY n 
1 302 GLY n 
1 303 LYS n 
1 304 MET n 
1 305 PRO n 
1 306 LYS n 
1 307 TRP n 
1 308 THR n 
1 309 ARG n 
1 310 VAL n 
1 311 ILE n 
1 312 LEU n 
1 313 LEU n 
1 314 ASN n 
1 315 TRP n 
1 316 CYS n 
1 317 ALA n 
1 318 TRP n 
1 319 PHE n 
1 320 LEU n 
1 321 ARG n 
1 322 MET n 
1 323 LYS n 
1 324 ARG n 
1 325 PRO n 
1 326 GLY n 
1 327 GLU n 
1 328 ASP n 
1 329 LYS n 
1 330 VAL n 
1 331 ARG n 
1 332 PRO n 
1 333 ALA n 
1 334 CYS n 
1 335 GLN n 
1 336 HIS n 
1 337 LYS n 
1 338 GLN n 
1 339 ARG n 
1 340 ARG n 
1 341 CYS n 
1 342 SER n 
1 343 LEU n 
1 344 ALA n 
1 345 SER n 
1 346 VAL n 
1 347 GLU n 
1 348 MET n 
1 349 ALA n 
1 350 GLY n 
1 351 ALA n 
1 352 MET n 
1 353 ALA n 
1 354 ASP n 
1 355 LEU n 
1 356 GLU n 
1 357 ASP n 
1 358 ASN n 
1 359 TRP n 
1 360 GLU n 
1 361 THR n 
1 362 LEU n 
1 363 ASN n 
1 364 ASP n 
1 365 ASN n 
1 366 LEU n 
1 367 LYS n 
1 368 VAL n 
1 369 ILE n 
1 370 GLU n 
1 371 LYS n 
1 372 ALA n 
1 373 ASP n 
1 374 ASN n 
1 375 ALA n 
1 376 ALA n 
1 377 GLN n 
1 378 VAL n 
1 379 LYS n 
1 380 ASP n 
1 381 ALA n 
1 382 LEU n 
1 383 THR n 
1 384 LYS n 
1 385 MET n 
1 386 ARG n 
1 387 ALA n 
1 388 ALA n 
1 389 ALA n 
1 390 LEU n 
1 391 ASP n 
1 392 ALA n 
1 393 GLN n 
1 394 LYS n 
1 395 ALA n 
1 396 THR n 
1 397 PRO n 
1 398 PRO n 
1 399 LYS n 
1 400 LEU n 
1 401 GLU n 
1 402 ASP n 
1 403 LYS n 
1 404 SER n 
1 405 PRO n 
1 406 ASP n 
1 407 SER n 
1 408 PRO n 
1 409 GLU n 
1 410 MET n 
1 411 LYS n 
1 412 ASP n 
1 413 PHE n 
1 414 ARG n 
1 415 HIS n 
1 416 GLY n 
1 417 PHE n 
1 418 ASP n 
1 419 ILE n 
1 420 LEU n 
1 421 VAL n 
1 422 GLY n 
1 423 GLN n 
1 424 ILE n 
1 425 ASP n 
1 426 ASP n 
1 427 ALA n 
1 428 LEU n 
1 429 LYS n 
1 430 LEU n 
1 431 ALA n 
1 432 ASN n 
1 433 GLU n 
1 434 GLY n 
1 435 LYS n 
1 436 VAL n 
1 437 LYS n 
1 438 GLU n 
1 439 ALA n 
1 440 GLN n 
1 441 ALA n 
1 442 ALA n 
1 443 ALA n 
1 444 GLU n 
1 445 GLN n 
1 446 LEU n 
1 447 LYS n 
1 448 THR n 
1 449 THR n 
1 450 ARG n 
1 451 ASN n 
1 452 ALA n 
1 453 TYR n 
1 454 ILE n 
1 455 GLN n 
1 456 LYS n 
1 457 TYR n 
1 458 LEU n 
1 459 CYS n 
1 460 GLY n 
1 461 ARG n 
1 462 MET n 
1 463 ALA n 
1 464 CYS n 
1 465 SER n 
1 466 PRO n 
1 467 THR n 
1 468 HIS n 
1 469 ASP n 
1 470 GLU n 
1 471 HIS n 
1 472 LEU n 
1 473 LEU n 
1 474 HIS n 
1 475 GLY n 
1 476 GLY n 
1 477 GLN n 
1 478 PRO n 
1 479 PRO n 
1 480 GLU n 
1 481 GLY n 
1 482 ASP n 
1 483 PRO n 
1 484 ASP n 
1 485 LEU n 
1 486 ALA n 
1 487 LYS n 
1 488 ILE n 
1 489 LEU n 
1 490 GLU n 
1 491 GLU n 
1 492 VAL n 
1 493 ARG n 
1 494 TYR n 
1 495 ILE n 
1 496 ALA n 
1 497 ASN n 
1 498 ARG n 
1 499 PHE n 
1 500 ARG n 
1 501 CYS n 
1 502 GLN n 
1 503 ASP n 
1 504 GLU n 
1 505 SER n 
1 506 GLU n 
1 507 ALA n 
1 508 VAL n 
1 509 CYS n 
1 510 SER n 
1 511 GLU n 
1 512 TRP n 
1 513 LYS n 
1 514 PHE n 
1 515 ALA n 
1 516 ALA n 
1 517 CYS n 
1 518 VAL n 
1 519 VAL n 
1 520 ASP n 
1 521 ARG n 
1 522 LEU n 
1 523 CYS n 
1 524 LEU n 
1 525 MET n 
1 526 ALA n 
1 527 PHE n 
1 528 SER n 
1 529 VAL n 
1 530 PHE n 
1 531 THR n 
1 532 ILE n 
1 533 ILE n 
1 534 CYS n 
1 535 THR n 
1 536 ILE n 
1 537 GLY n 
1 538 ILE n 
1 539 LEU n 
1 540 MET n 
1 541 SER n 
1 542 ALA n 
1 543 PRO n 
1 544 ASN n 
1 545 PHE n 
1 546 VAL n 
1 547 GLU n 
1 548 ALA n 
1 549 VAL n 
1 550 SER n 
1 551 LYS n 
1 552 ASP n 
1 553 PHE n 
1 554 ALA n 
1 555 TRP n 
1 556 SER n 
1 557 HIS n 
1 558 PRO n 
1 559 GLN n 
1 560 PHE n 
1 561 GLU n 
1 562 LYS n 
2 1   ILE n 
2 2   VAL n 
2 3   CYS n 
2 4   HIS n 
2 5   THR n 
2 6   THR n 
2 7   ALA n 
2 8   THR n 
2 9   SER n 
2 10  PRO n 
2 11  ILE n 
2 12  SER n 
2 13  ALA n 
2 14  VAL n 
2 15  THR n 
2 16  CYS n 
2 17  PRO n 
2 18  PRO n 
2 19  GLY n 
2 20  GLU n 
2 21  ASN n 
2 22  LEU n 
2 23  CYS n 
2 24  TYR n 
2 25  ARG n 
2 26  LYS n 
2 27  MET n 
2 28  TRP n 
2 29  CYS n 
2 30  ASP n 
2 31  VAL n 
2 32  PHE n 
2 33  CYS n 
2 34  SER n 
2 35  SER n 
2 36  ARG n 
2 37  GLY n 
2 38  LYS n 
2 39  VAL n 
2 40  VAL n 
2 41  GLU n 
2 42  LEU n 
2 43  GLY n 
2 44  CYS n 
2 45  ALA n 
2 46  ALA n 
2 47  THR n 
2 48  CYS n 
2 49  PRO n 
2 50  SER n 
2 51  LYS n 
2 52  LYS n 
2 53  PRO n 
2 54  TYR n 
2 55  GLU n 
2 56  GLU n 
2 57  VAL n 
2 58  THR n 
2 59  CYS n 
2 60  CYS n 
2 61  SER n 
2 62  THR n 
2 63  ASP n 
2 64  LYS n 
2 65  CYS n 
2 66  ASN n 
2 67  PRO n 
2 68  HIS n 
2 69  PRO n 
2 70  LYS n 
2 71  GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   352 Human ? 'CHRNA7, NACHRA7' ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? Human 
'Homo sapiens' 9606 ? ? ? ? ? ? HEK 293 GnTi- CRL3022 ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 353 458 ?     ? cybC              ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? Human 
'Homo sapiens' 9606 ? ? ? ? ? ? HEK 293 GnTi- CRL3022 ? ? ? ? ? ? ? ? ? ? ? 
1 3 sample 'Biological sequence' 459 562 Human ? 'CHRNA7, NACHRA7' ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? Human 
'Homo sapiens' 9606 ? ? ? ? ? ? HEK 293 GnTi- CRL3022 ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       71 
_pdbx_entity_src_syn.organism_scientific    'Bungarus multicinctus' 
_pdbx_entity_src_syn.organism_common_name   'Many-banded krait' 
_pdbx_entity_src_syn.ncbi_taxonomy_id       8616 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ACHA7_HUMAN P36544 ? 1 
;EFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFP
DGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ
EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKIS
LGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFL
RMKRPGEDKVRPACQHKQRRCSLASVEM
;
24  
2 UNP C562_ECOLX  P0ABE7 ? 1 
;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYHQKYR
;
23  
3 UNP ACHA7_HUMAN P36544 ? 1 
;CGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGI
LMSAPNFVEAVSKDFA
;
407 
4 UNP 3L21V_BUNMU P60616 ? 2 IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQ 22  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 7KOO A 1   ? 348 A P36544 24  ? 371 ? 1   322 
2  2 7KOO A 353 F 458 G P0ABE7 23  ? 128 ? 322 326 
3  3 7KOO A 459 H 554 ? P36544 407 ? 502 ? 326 479 
4  4 7KOO F 1   ? 71  ? P60616 22  ? 92  ? 1   71  
5  4 7KOO J 1   ? 71  ? P60616 22  ? 92  ? 1   71  
6  4 7KOO G 1   ? 71  ? P60616 22  ? 92  ? 1   71  
7  4 7KOO I 1   ? 71  ? P60616 22  ? 92  ? 1   71  
8  4 7KOO H 1   ? 71  ? P60616 22  ? 92  ? 1   71  
9  1 7KOO B 1   ? 348 A P36544 24  ? 371 ? 1   322 
10 2 7KOO B 353 F 458 G P0ABE7 23  ? 128 ? 322 326 
11 3 7KOO B 459 H 554 ? P36544 407 ? 502 ? 326 479 
12 1 7KOO C 1   ? 348 A P36544 24  ? 371 ? 1   322 
13 2 7KOO C 353 F 458 G P0ABE7 23  ? 128 ? 322 326 
14 3 7KOO C 459 H 554 ? P36544 407 ? 502 ? 326 479 
15 1 7KOO D 1   ? 348 A P36544 24  ? 371 ? 1   322 
16 2 7KOO D 353 F 458 G P0ABE7 23  ? 128 ? 322 326 
17 3 7KOO D 459 H 554 ? P36544 407 ? 502 ? 326 479 
18 1 7KOO E 1   ? 348 A P36544 24  ? 371 ? 1   322 
19 2 7KOO E 353 F 458 G P0ABE7 23  ? 128 ? 322 326 
20 3 7KOO E 459 H 554 ? P36544 407 ? 502 ? 326 479 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  7KOO ASN A 35  ? UNP P36544 SER 58  variant          35  1  
1  7KOO PRO A 111 ? UNP P36544 SER 134 variant          111 2  
1  7KOO ALA A 349 B UNP P36544 ?   ?   linker           322 3  
1  7KOO GLY A 350 C UNP P36544 ?   ?   linker           322 4  
1  7KOO ALA A 351 D UNP P36544 ?   ?   linker           322 5  
1  7KOO MET A 352 E UNP P36544 ?   ?   linker           322 6  
2  7KOO TRP A 359 L UNP P0ABE7 MET 29  variant          322 7  
2  7KOO ILE A 454 C UNP P0ABE7 HIS 124 variant          326 8  
2  7KOO LEU A 458 G UNP P0ABE7 ARG 128 variant          326 9  
3  7KOO TRP A 555 ? UNP P36544 ?   ?   'expression tag' 480 10 
3  7KOO SER A 556 ? UNP P36544 ?   ?   'expression tag' 481 11 
3  7KOO HIS A 557 ? UNP P36544 ?   ?   'expression tag' 482 12 
3  7KOO PRO A 558 ? UNP P36544 ?   ?   'expression tag' 483 13 
3  7KOO GLN A 559 ? UNP P36544 ?   ?   'expression tag' 484 14 
3  7KOO PHE A 560 ? UNP P36544 ?   ?   'expression tag' 485 15 
3  7KOO GLU A 561 ? UNP P36544 ?   ?   'expression tag' 486 16 
3  7KOO LYS A 562 ? UNP P36544 ?   ?   'expression tag' 487 17 
9  7KOO ASN B 35  ? UNP P36544 SER 58  variant          35  18 
9  7KOO PRO B 111 ? UNP P36544 SER 134 variant          111 19 
9  7KOO ALA B 349 B UNP P36544 ?   ?   linker           322 20 
9  7KOO GLY B 350 C UNP P36544 ?   ?   linker           322 21 
9  7KOO ALA B 351 D UNP P36544 ?   ?   linker           322 22 
9  7KOO MET B 352 E UNP P36544 ?   ?   linker           322 23 
10 7KOO TRP B 359 L UNP P0ABE7 MET 29  variant          322 24 
10 7KOO ILE B 454 C UNP P0ABE7 HIS 124 variant          326 25 
10 7KOO LEU B 458 G UNP P0ABE7 ARG 128 variant          326 26 
11 7KOO TRP B 555 ? UNP P36544 ?   ?   'expression tag' 480 27 
11 7KOO SER B 556 ? UNP P36544 ?   ?   'expression tag' 481 28 
11 7KOO HIS B 557 ? UNP P36544 ?   ?   'expression tag' 482 29 
11 7KOO PRO B 558 ? UNP P36544 ?   ?   'expression tag' 483 30 
11 7KOO GLN B 559 ? UNP P36544 ?   ?   'expression tag' 484 31 
11 7KOO PHE B 560 ? UNP P36544 ?   ?   'expression tag' 485 32 
11 7KOO GLU B 561 ? UNP P36544 ?   ?   'expression tag' 486 33 
11 7KOO LYS B 562 ? UNP P36544 ?   ?   'expression tag' 487 34 
12 7KOO ASN C 35  ? UNP P36544 SER 58  variant          35  35 
12 7KOO PRO C 111 ? UNP P36544 SER 134 variant          111 36 
12 7KOO ALA C 349 B UNP P36544 ?   ?   linker           322 37 
12 7KOO GLY C 350 C UNP P36544 ?   ?   linker           322 38 
12 7KOO ALA C 351 D UNP P36544 ?   ?   linker           322 39 
12 7KOO MET C 352 E UNP P36544 ?   ?   linker           322 40 
13 7KOO TRP C 359 L UNP P0ABE7 MET 29  variant          322 41 
13 7KOO ILE C 454 C UNP P0ABE7 HIS 124 variant          326 42 
13 7KOO LEU C 458 G UNP P0ABE7 ARG 128 variant          326 43 
14 7KOO TRP C 555 ? UNP P36544 ?   ?   'expression tag' 480 44 
14 7KOO SER C 556 ? UNP P36544 ?   ?   'expression tag' 481 45 
14 7KOO HIS C 557 ? UNP P36544 ?   ?   'expression tag' 482 46 
14 7KOO PRO C 558 ? UNP P36544 ?   ?   'expression tag' 483 47 
14 7KOO GLN C 559 ? UNP P36544 ?   ?   'expression tag' 484 48 
14 7KOO PHE C 560 ? UNP P36544 ?   ?   'expression tag' 485 49 
14 7KOO GLU C 561 ? UNP P36544 ?   ?   'expression tag' 486 50 
14 7KOO LYS C 562 ? UNP P36544 ?   ?   'expression tag' 487 51 
15 7KOO ASN D 35  ? UNP P36544 SER 58  variant          35  52 
15 7KOO PRO D 111 ? UNP P36544 SER 134 variant          111 53 
15 7KOO ALA D 349 B UNP P36544 ?   ?   linker           322 54 
15 7KOO GLY D 350 C UNP P36544 ?   ?   linker           322 55 
15 7KOO ALA D 351 D UNP P36544 ?   ?   linker           322 56 
15 7KOO MET D 352 E UNP P36544 ?   ?   linker           322 57 
16 7KOO TRP D 359 L UNP P0ABE7 MET 29  variant          322 58 
16 7KOO ILE D 454 C UNP P0ABE7 HIS 124 variant          326 59 
16 7KOO LEU D 458 G UNP P0ABE7 ARG 128 variant          326 60 
17 7KOO TRP D 555 ? UNP P36544 ?   ?   'expression tag' 480 61 
17 7KOO SER D 556 ? UNP P36544 ?   ?   'expression tag' 481 62 
17 7KOO HIS D 557 ? UNP P36544 ?   ?   'expression tag' 482 63 
17 7KOO PRO D 558 ? UNP P36544 ?   ?   'expression tag' 483 64 
17 7KOO GLN D 559 ? UNP P36544 ?   ?   'expression tag' 484 65 
17 7KOO PHE D 560 ? UNP P36544 ?   ?   'expression tag' 485 66 
17 7KOO GLU D 561 ? UNP P36544 ?   ?   'expression tag' 486 67 
17 7KOO LYS D 562 ? UNP P36544 ?   ?   'expression tag' 487 68 
18 7KOO ASN E 35  ? UNP P36544 SER 58  variant          35  69 
18 7KOO PRO E 111 ? UNP P36544 SER 134 variant          111 70 
18 7KOO ALA E 349 B UNP P36544 ?   ?   linker           322 71 
18 7KOO GLY E 350 C UNP P36544 ?   ?   linker           322 72 
18 7KOO ALA E 351 D UNP P36544 ?   ?   linker           322 73 
18 7KOO MET E 352 E UNP P36544 ?   ?   linker           322 74 
19 7KOO TRP E 359 L UNP P0ABE7 MET 29  variant          322 75 
19 7KOO ILE E 454 C UNP P0ABE7 HIS 124 variant          326 76 
19 7KOO LEU E 458 G UNP P0ABE7 ARG 128 variant          326 77 
20 7KOO TRP E 555 ? UNP P36544 ?   ?   'expression tag' 480 78 
20 7KOO SER E 556 ? UNP P36544 ?   ?   'expression tag' 481 79 
20 7KOO HIS E 557 ? UNP P36544 ?   ?   'expression tag' 482 80 
20 7KOO PRO E 558 ? UNP P36544 ?   ?   'expression tag' 483 81 
20 7KOO GLN E 559 ? UNP P36544 ?   ?   'expression tag' 484 82 
20 7KOO PHE E 560 ? UNP P36544 ?   ?   'expression tag' 485 83 
20 7KOO GLU E 561 ? UNP P36544 ?   ?   'expression tag' 486 84 
20 7KOO LYS E 562 ? UNP P36544 ?   ?   'expression tag' 487 85 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6'      
180.156 
CA  non-polymer                   . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 
180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7KOO 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7KOO 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.0 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.009  ? 19435 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.095  ? 26485 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 22.074 ? 7095  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.226  ? 3090  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.007  ? 3260  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     7KOO 
_struct.title                        'Alpha-7 nicotinic acetylcholine receptor bound to alpha-bungarotoxin in a resting state' 
_struct.pdbx_descriptor              ? 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7KOO 
_struct_keywords.text            'Cys-loop receptor, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 3 ? 
P  N N 4 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 6 ? 
W  N N 5 ? 
X  N N 6 ? 
Y  N N 5 ? 
Z  N N 6 ? 
AA N N 5 ? 
BA N N 6 ? 
CA N N 5 ? 
DA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 1   ? VAL A 11  ? GLU A 1   VAL A 11  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 80  ? ILE A 84  ? PRO A 80  ILE A 84  5 ? 5  
HELX_P HELX_P3  AA3 THR A 207 ? LEU A 214 ? THR A 207 LEU A 214 1 ? 8  
HELX_P HELX_P4  AA4 LEU A 215 ? LEU A 227 ? LEU A 215 LEU A 227 1 ? 13 
HELX_P HELX_P5  AA5 VAL A 228 ? LEU A 231 ? VAL A 228 LEU A 231 5 ? 4  
HELX_P HELX_P6  AA6 GLU A 237 ? MET A 260 ? GLU A 237 MET A 260 1 ? 24 
HELX_P HELX_P7  AA7 PRO A 268 ? HIS A 296 ? PRO A 268 HIS A 296 1 ? 29 
HELX_P HELX_P8  AA8 PRO A 305 ? ARG A 321 ? PRO A 305 ARG A 321 1 ? 17 
HELX_P HELX_P9  AA9 ASP A 484 ? MET A 540 ? ASP A 409 MET A 465 1 ? 57 
HELX_P HELX_P10 AB1 ASN A 544 ? PHE A 553 ? ASN A 469 PHE A 478 1 ? 10 
HELX_P HELX_P11 AB2 PHE G 2   ? VAL G 11  ? PHE B 2   VAL B 11  1 ? 10 
HELX_P HELX_P12 AB3 PRO G 80  ? ILE G 84  ? PRO B 80  ILE B 84  5 ? 5  
HELX_P HELX_P13 AB4 THR G 207 ? LEU G 214 ? THR B 207 LEU B 214 1 ? 8  
HELX_P HELX_P14 AB5 LEU G 215 ? LEU G 227 ? LEU B 215 LEU B 227 1 ? 13 
HELX_P HELX_P15 AB6 VAL G 228 ? LEU G 231 ? VAL B 228 LEU B 231 5 ? 4  
HELX_P HELX_P16 AB7 GLU G 237 ? MET G 260 ? GLU B 237 MET B 260 1 ? 24 
HELX_P HELX_P17 AB8 PRO G 268 ? HIS G 296 ? PRO B 268 HIS B 296 1 ? 29 
HELX_P HELX_P18 AB9 PRO G 305 ? ARG G 321 ? PRO B 305 ARG B 321 1 ? 17 
HELX_P HELX_P19 AC1 ASP G 484 ? MET G 540 ? ASP B 409 MET B 465 1 ? 57 
HELX_P HELX_P20 AC2 ASN G 544 ? PHE G 553 ? ASN B 469 PHE B 478 1 ? 10 
HELX_P HELX_P21 AC3 PHE H 2   ? VAL H 11  ? PHE C 2   VAL C 11  1 ? 10 
HELX_P HELX_P22 AC4 PRO H 80  ? ILE H 84  ? PRO C 80  ILE C 84  5 ? 5  
HELX_P HELX_P23 AC5 THR H 207 ? LEU H 214 ? THR C 207 LEU C 214 1 ? 8  
HELX_P HELX_P24 AC6 LEU H 215 ? LEU H 227 ? LEU C 215 LEU C 227 1 ? 13 
HELX_P HELX_P25 AC7 VAL H 228 ? LEU H 231 ? VAL C 228 LEU C 231 5 ? 4  
HELX_P HELX_P26 AC8 GLU H 237 ? MET H 260 ? GLU C 237 MET C 260 1 ? 24 
HELX_P HELX_P27 AC9 PRO H 268 ? HIS H 296 ? PRO C 268 HIS C 296 1 ? 29 
HELX_P HELX_P28 AD1 PRO H 305 ? ARG H 321 ? PRO C 305 ARG C 321 1 ? 17 
HELX_P HELX_P29 AD2 ASP H 484 ? MET H 540 ? ASP C 409 MET C 465 1 ? 57 
HELX_P HELX_P30 AD3 ASN H 544 ? PHE H 553 ? ASN C 469 PHE C 478 1 ? 10 
HELX_P HELX_P31 AD4 PHE I 2   ? VAL I 11  ? PHE D 2   VAL D 11  1 ? 10 
HELX_P HELX_P32 AD5 PRO I 80  ? ILE I 84  ? PRO D 80  ILE D 84  5 ? 5  
HELX_P HELX_P33 AD6 THR I 207 ? LEU I 214 ? THR D 207 LEU D 214 1 ? 8  
HELX_P HELX_P34 AD7 LEU I 215 ? LEU I 227 ? LEU D 215 LEU D 227 1 ? 13 
HELX_P HELX_P35 AD8 VAL I 228 ? LEU I 231 ? VAL D 228 LEU D 231 5 ? 4  
HELX_P HELX_P36 AD9 GLU I 237 ? MET I 260 ? GLU D 237 MET D 260 1 ? 24 
HELX_P HELX_P37 AE1 PRO I 268 ? HIS I 296 ? PRO D 268 HIS D 296 1 ? 29 
HELX_P HELX_P38 AE2 PRO I 305 ? ARG I 321 ? PRO D 305 ARG D 321 1 ? 17 
HELX_P HELX_P39 AE3 ASP I 484 ? MET I 540 ? ASP D 409 MET D 465 1 ? 57 
HELX_P HELX_P40 AE4 ASN I 544 ? PHE I 553 ? ASN D 469 PHE D 478 1 ? 10 
HELX_P HELX_P41 AE5 PHE J 2   ? VAL J 11  ? PHE E 2   VAL E 11  1 ? 10 
HELX_P HELX_P42 AE6 PRO J 80  ? ILE J 84  ? PRO E 80  ILE E 84  5 ? 5  
HELX_P HELX_P43 AE7 THR J 207 ? LEU J 214 ? THR E 207 LEU E 214 1 ? 8  
HELX_P HELX_P44 AE8 LEU J 215 ? LEU J 227 ? LEU E 215 LEU E 227 1 ? 13 
HELX_P HELX_P45 AE9 VAL J 228 ? LEU J 231 ? VAL E 228 LEU E 231 5 ? 4  
HELX_P HELX_P46 AF1 GLU J 237 ? MET J 260 ? GLU E 237 MET E 260 1 ? 24 
HELX_P HELX_P47 AF2 PRO J 268 ? HIS J 296 ? PRO E 268 HIS E 296 1 ? 29 
HELX_P HELX_P48 AF3 PRO J 305 ? ARG J 321 ? PRO E 305 ARG E 321 1 ? 17 
HELX_P HELX_P49 AF4 ASP J 484 ? MET J 540 ? ASP E 409 MET E 465 1 ? 57 
HELX_P HELX_P50 AF5 ASN J 544 ? PHE J 553 ? ASN E 469 PHE E 478 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 127 SG  ? ? ? 1_555 A  CYS 141 SG ? ? A CYS 127 A CYS 141 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf2  disulf ?    ? B CYS 3   SG  ? ? ? 1_555 B  CYS 23  SG ? ? F CYS 3   F CYS 23  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf3  disulf ?    ? B CYS 16  SG  ? ? ? 1_555 B  CYS 44  SG ? ? F CYS 16  F CYS 44  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf4  disulf ?    ? B CYS 29  SG  ? ? ? 1_555 B  CYS 33  SG ? ? F CYS 29  F CYS 33  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf5  disulf ?    ? B CYS 48  SG  ? ? ? 1_555 B  CYS 59  SG ? ? F CYS 48  F CYS 59  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf6  disulf ?    ? B CYS 60  SG  ? ? ? 1_555 B  CYS 65  SG ? ? F CYS 60  F CYS 65  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf7  disulf ?    ? C CYS 3   SG  ? ? ? 1_555 C  CYS 23  SG ? ? J CYS 3   J CYS 23  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf8  disulf ?    ? C CYS 16  SG  ? ? ? 1_555 C  CYS 44  SG ? ? J CYS 16  J CYS 44  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf9  disulf ?    ? C CYS 29  SG  ? ? ? 1_555 C  CYS 33  SG ? ? J CYS 29  J CYS 33  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf10 disulf ?    ? C CYS 48  SG  ? ? ? 1_555 C  CYS 59  SG ? ? J CYS 48  J CYS 59  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf11 disulf ?    ? C CYS 60  SG  ? ? ? 1_555 C  CYS 65  SG ? ? J CYS 60  J CYS 65  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf12 disulf ?    ? D CYS 3   SG  ? ? ? 1_555 D  CYS 23  SG ? ? G CYS 3   G CYS 23  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf13 disulf ?    ? D CYS 16  SG  ? ? ? 1_555 D  CYS 44  SG ? ? G CYS 16  G CYS 44  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf14 disulf ?    ? D CYS 29  SG  ? ? ? 1_555 D  CYS 33  SG ? ? G CYS 29  G CYS 33  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf15 disulf ?    ? D CYS 48  SG  ? ? ? 1_555 D  CYS 59  SG ? ? G CYS 48  G CYS 59  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf16 disulf ?    ? D CYS 60  SG  ? ? ? 1_555 D  CYS 65  SG ? ? G CYS 60  G CYS 65  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf17 disulf ?    ? E CYS 3   SG  ? ? ? 1_555 E  CYS 23  SG ? ? I CYS 3   I CYS 23  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf18 disulf ?    ? E CYS 16  SG  ? ? ? 1_555 E  CYS 44  SG ? ? I CYS 16  I CYS 44  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf19 disulf ?    ? E CYS 29  SG  ? ? ? 1_555 E  CYS 33  SG ? ? I CYS 29  I CYS 33  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf20 disulf ?    ? E CYS 48  SG  ? ? ? 1_555 E  CYS 59  SG ? ? I CYS 48  I CYS 59  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf21 disulf ?    ? E CYS 60  SG  ? ? ? 1_555 E  CYS 65  SG ? ? I CYS 60  I CYS 65  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf22 disulf ?    ? F CYS 3   SG  ? ? ? 1_555 F  CYS 23  SG ? ? H CYS 3   H CYS 23  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf23 disulf ?    ? F CYS 16  SG  ? ? ? 1_555 F  CYS 44  SG ? ? H CYS 16  H CYS 44  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf24 disulf ?    ? F CYS 29  SG  ? ? ? 1_555 F  CYS 33  SG ? ? H CYS 29  H CYS 33  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf25 disulf ?    ? F CYS 48  SG  ? ? ? 1_555 F  CYS 59  SG ? ? H CYS 48  H CYS 59  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf26 disulf ?    ? F CYS 60  SG  ? ? ? 1_555 F  CYS 65  SG ? ? H CYS 60  H CYS 65  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf27 disulf ?    ? G CYS 127 SG  ? ? ? 1_555 G  CYS 141 SG ? ? B CYS 127 B CYS 141 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf28 disulf ?    ? H CYS 127 SG  ? ? ? 1_555 H  CYS 141 SG ? ? C CYS 127 C CYS 141 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf29 disulf ?    ? I CYS 127 SG  ? ? ? 1_555 I  CYS 141 SG ? ? D CYS 127 D CYS 141 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf30 disulf ?    ? J CYS 127 SG  ? ? ? 1_555 J  CYS 141 SG ? ? E CYS 127 E CYS 141 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
covale1  covale one  ? A ASN 23  ND2 ? ? ? 1_555 K  NAG .   C1 ? ? A ASN 23  K NAG 1   1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale2  covale one  ? A ASN 67  ND2 ? ? ? 1_555 U  NAG .   C1 ? ? A ASN 67  A NAG 501 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale3  covale one  ? A ASN 110 ND2 ? ? ? 1_555 L  NAG .   C1 ? ? A ASN 110 L NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale4  covale one  ? G ASN 23  ND2 ? ? ? 1_555 M  NAG .   C1 ? ? B ASN 23  M NAG 1   1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale5  covale one  ? G ASN 67  ND2 ? ? ? 1_555 W  NAG .   C1 ? ? B ASN 67  B NAG 501 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale6  covale one  ? G ASN 110 ND2 ? ? ? 1_555 N  NAG .   C1 ? ? B ASN 110 N NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale7  covale one  ? H ASN 23  ND2 ? ? ? 1_555 O  NAG .   C1 ? ? C ASN 23  O NAG 1   1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale8  covale one  ? H ASN 67  ND2 ? ? ? 1_555 Y  NAG .   C1 ? ? C ASN 67  C NAG 501 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale9  covale one  ? H ASN 110 ND2 ? ? ? 1_555 P  NAG .   C1 ? ? C ASN 110 P NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale10 covale one  ? I ASN 23  ND2 ? ? ? 1_555 Q  NAG .   C1 ? ? D ASN 23  Q NAG 1   1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale11 covale one  ? I ASN 67  ND2 ? ? ? 1_555 AA NAG .   C1 ? ? D ASN 67  D NAG 501 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale12 covale one  ? I ASN 110 ND2 ? ? ? 1_555 R  NAG .   C1 ? ? D ASN 110 R NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale13 covale one  ? J ASN 23  ND2 ? ? ? 1_555 S  NAG .   C1 ? ? E ASN 23  S NAG 1   1_555 ? ? ? ? ? ? ? 1.436 ? N-Glycosylation 
covale14 covale one  ? J ASN 67  ND2 ? ? ? 1_555 CA NAG .   C1 ? ? E ASN 67  E NAG 501 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale15 covale one  ? J ASN 110 ND2 ? ? ? 1_555 T  NAG .   C1 ? ? E ASN 110 T NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale16 covale both ? K NAG .   O4  ? ? ? 1_555 K  NAG .   C1 ? ? K NAG 1   K NAG 2   1_555 ? ? ? ? ? ? ? 1.457 ? ?               
covale17 covale both ? L NAG .   O4  ? ? ? 1_555 L  NAG .   C1 ? ? L NAG 1   L NAG 2   1_555 ? ? ? ? ? ? ? 1.433 ? ?               
covale18 covale both ? L NAG .   O4  ? ? ? 1_555 L  BMA .   C1 ? ? L NAG 2   L BMA 3   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale19 covale both ? L BMA .   O3  ? ? ? 1_555 L  MAN .   C1 ? ? L BMA 3   L MAN 4   1_555 ? ? ? ? ? ? ? 1.435 ? ?               
covale20 covale both ? M NAG .   O4  ? ? ? 1_555 M  NAG .   C1 ? ? M NAG 1   M NAG 2   1_555 ? ? ? ? ? ? ? 1.457 ? ?               
covale21 covale both ? N NAG .   O4  ? ? ? 1_555 N  NAG .   C1 ? ? N NAG 1   N NAG 2   1_555 ? ? ? ? ? ? ? 1.434 ? ?               
covale22 covale both ? N NAG .   O4  ? ? ? 1_555 N  BMA .   C1 ? ? N NAG 2   N BMA 3   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale23 covale both ? N BMA .   O3  ? ? ? 1_555 N  MAN .   C1 ? ? N BMA 3   N MAN 4   1_555 ? ? ? ? ? ? ? 1.435 ? ?               
covale24 covale both ? O NAG .   O4  ? ? ? 1_555 O  NAG .   C1 ? ? O NAG 1   O NAG 2   1_555 ? ? ? ? ? ? ? 1.457 ? ?               
covale25 covale both ? P NAG .   O4  ? ? ? 1_555 P  NAG .   C1 ? ? P NAG 1   P NAG 2   1_555 ? ? ? ? ? ? ? 1.433 ? ?               
covale26 covale both ? P NAG .   O4  ? ? ? 1_555 P  BMA .   C1 ? ? P NAG 2   P BMA 3   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale27 covale both ? P BMA .   O3  ? ? ? 1_555 P  MAN .   C1 ? ? P BMA 3   P MAN 4   1_555 ? ? ? ? ? ? ? 1.435 ? ?               
covale28 covale both ? Q NAG .   O4  ? ? ? 1_555 Q  NAG .   C1 ? ? Q NAG 1   Q NAG 2   1_555 ? ? ? ? ? ? ? 1.457 ? ?               
covale29 covale both ? R NAG .   O4  ? ? ? 1_555 R  NAG .   C1 ? ? R NAG 1   R NAG 2   1_555 ? ? ? ? ? ? ? 1.432 ? ?               
covale30 covale both ? R NAG .   O4  ? ? ? 1_555 R  BMA .   C1 ? ? R NAG 2   R BMA 3   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale31 covale both ? R BMA .   O3  ? ? ? 1_555 R  MAN .   C1 ? ? R BMA 3   R MAN 4   1_555 ? ? ? ? ? ? ? 1.435 ? ?               
covale32 covale both ? S NAG .   O4  ? ? ? 1_555 S  NAG .   C1 ? ? S NAG 1   S NAG 2   1_555 ? ? ? ? ? ? ? 1.458 ? ?               
covale33 covale both ? T NAG .   O4  ? ? ? 1_555 T  NAG .   C1 ? ? T NAG 1   T NAG 2   1_555 ? ? ? ? ? ? ? 1.433 ? ?               
covale34 covale both ? T NAG .   O4  ? ? ? 1_555 T  BMA .   C1 ? ? T NAG 2   T BMA 3   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale35 covale both ? T BMA .   O3  ? ? ? 1_555 T  MAN .   C1 ? ? T BMA 3   T MAN 4   1_555 ? ? ? ? ? ? ? 1.436 ? ?               
metalc1  metalc ?    ? G GLU 44  OE1 ? ? ? 1_555 X  CA  .   CA ? ? B GLU 44  B CA  502 1_555 ? ? ? ? ? ? ? 3.125 ? ?               
metalc2  metalc ?    ? G GLU 44  OE2 ? ? ? 1_555 X  CA  .   CA ? ? B GLU 44  B CA  502 1_555 ? ? ? ? ? ? ? 3.196 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 134 A . ? PHE 134 A PRO 135 A ? PRO 135 A 1 -4.45 
2  SER 9   B . ? SER 9   F PRO 10  B ? PRO 10  F 1 1.88  
3  SER 9   C . ? SER 9   J PRO 10  C ? PRO 10  J 1 1.86  
4  SER 9   D . ? SER 9   G PRO 10  D ? PRO 10  G 1 1.89  
5  SER 9   E . ? SER 9   I PRO 10  E ? PRO 10  I 1 1.87  
6  SER 9   F . ? SER 9   H PRO 10  F ? PRO 10  H 1 1.94  
7  PHE 134 G . ? PHE 134 B PRO 135 G ? PRO 135 B 1 -4.48 
8  PHE 134 H . ? PHE 134 C PRO 135 H ? PRO 135 C 1 -4.56 
9  PHE 134 I . ? PHE 134 D PRO 135 I ? PRO 135 D 1 -4.43 
10 PHE 134 J . ? PHE 134 E PRO 135 J ? PRO 135 E 1 -4.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 7 ? 
AA5 ? 7 ? 
AA6 ? 6 ? 
AA7 ? 7 ? 
AA8 ? 6 ? 
AA9 ? 7 ? 
AB1 ? 6 ? 
AB2 ? 7 ? 
AB3 ? 6 ? 
AB4 ? 5 ? 
AB5 ? 6 ? 
AB6 ? 5 ? 
AB7 ? 6 ? 
AB8 ? 5 ? 
AB9 ? 6 ? 
AC1 ? 5 ? 
AC2 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA5 6 7 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA7 6 7 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AA9 5 6 ? anti-parallel 
AA9 6 7 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB7 5 6 ? parallel      
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? parallel      
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC2 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 77  ? PHE A 79  ? VAL A 77  PHE A 79  
AA1 2 VAL A 107 ? VAL A 109 ? VAL A 107 VAL A 109 
AA1 3 HIS A 114 ? TYR A 117 ? HIS A 114 TYR A 117 
AA1 4 VAL A 48  ? THR A 60  ? VAL A 48  THR A 60  
AA1 5 PRO A 120 ? SER A 126 ? PRO A 120 SER A 126 
AA2 1 VAL A 77  ? PHE A 79  ? VAL A 77  PHE A 79  
AA2 2 VAL A 107 ? VAL A 109 ? VAL A 107 VAL A 109 
AA2 3 HIS A 114 ? TYR A 117 ? HIS A 114 TYR A 117 
AA2 4 VAL A 48  ? THR A 60  ? VAL A 48  THR A 60  
AA2 5 LEU A 28  ? ASP A 43  ? LEU A 28  ASP A 43  
AA2 6 LEU A 155 ? MET A 159 ? LEU A 155 MET A 159 
AA3 1 ILE A 89  ? LEU A 91  ? ILE A 89  LEU A 91  
AA3 2 VAL A 138 ? SER A 147 ? VAL A 138 SER A 147 
AA3 3 TYR A 194 ? ARG A 205 ? TYR A 194 ARG A 205 
AA3 4 TRP A 173 ? GLY A 177 ? TRP A 173 GLY A 177 
AA4 1 ILE A 89  ? LEU A 91  ? ILE A 89  LEU A 91  
AA4 2 VAL A 138 ? SER A 147 ? VAL A 138 SER A 147 
AA4 3 TYR A 194 ? ARG A 205 ? TYR A 194 ARG A 205 
AA4 4 GLY A 180 ? TYR A 187 ? GLY A 180 TYR A 187 
AA4 5 VAL B 39  ? ALA B 45  ? VAL F 39  ALA F 45  
AA4 6 LEU B 22  ? MET B 27  ? LEU F 22  MET F 27  
AA4 7 GLU B 56  ? VAL B 57  ? GLU F 56  VAL F 57  
AA5 1 GLU C 56  ? VAL C 57  ? GLU J 56  VAL J 57  
AA5 2 LEU C 22  ? MET C 27  ? LEU J 22  MET J 27  
AA5 3 VAL C 39  ? ALA C 45  ? VAL J 39  ALA J 45  
AA5 4 GLY J 180 ? TYR J 187 ? GLY E 180 TYR E 187 
AA5 5 TYR J 194 ? ARG J 205 ? TYR E 194 ARG E 205 
AA5 6 VAL J 138 ? SER J 147 ? VAL E 138 SER E 147 
AA5 7 ILE J 89  ? LEU J 91  ? ILE E 89  LEU E 91  
AA6 1 GLU C 56  ? VAL C 57  ? GLU J 56  VAL J 57  
AA6 2 LEU C 22  ? MET C 27  ? LEU J 22  MET J 27  
AA6 3 VAL C 39  ? ALA C 45  ? VAL J 39  ALA J 45  
AA6 4 GLY J 180 ? TYR J 187 ? GLY E 180 TYR E 187 
AA6 5 TYR J 194 ? ARG J 205 ? TYR E 194 ARG E 205 
AA6 6 TRP J 173 ? GLY J 177 ? TRP E 173 GLY E 177 
AA7 1 GLU D 56  ? VAL D 57  ? GLU G 56  VAL G 57  
AA7 2 LEU D 22  ? MET D 27  ? LEU G 22  MET G 27  
AA7 3 VAL D 39  ? ALA D 45  ? VAL G 39  ALA G 45  
AA7 4 GLY G 180 ? TYR G 187 ? GLY B 180 TYR B 187 
AA7 5 TYR G 194 ? ARG G 205 ? TYR B 194 ARG B 205 
AA7 6 VAL G 138 ? SER G 147 ? VAL B 138 SER B 147 
AA7 7 ILE G 89  ? LEU G 91  ? ILE B 89  LEU B 91  
AA8 1 GLU D 56  ? VAL D 57  ? GLU G 56  VAL G 57  
AA8 2 LEU D 22  ? MET D 27  ? LEU G 22  MET G 27  
AA8 3 VAL D 39  ? ALA D 45  ? VAL G 39  ALA G 45  
AA8 4 GLY G 180 ? TYR G 187 ? GLY B 180 TYR B 187 
AA8 5 TYR G 194 ? ARG G 205 ? TYR B 194 ARG B 205 
AA8 6 TRP G 173 ? GLY G 177 ? TRP B 173 GLY B 177 
AA9 1 GLU E 56  ? VAL E 57  ? GLU I 56  VAL I 57  
AA9 2 LEU E 22  ? MET E 27  ? LEU I 22  MET I 27  
AA9 3 VAL E 39  ? ALA E 45  ? VAL I 39  ALA I 45  
AA9 4 GLY I 180 ? TYR I 187 ? GLY D 180 TYR D 187 
AA9 5 TYR I 194 ? ARG I 205 ? TYR D 194 ARG D 205 
AA9 6 VAL I 138 ? SER I 147 ? VAL D 138 SER D 147 
AA9 7 ILE I 89  ? LEU I 91  ? ILE D 89  LEU D 91  
AB1 1 GLU E 56  ? VAL E 57  ? GLU I 56  VAL I 57  
AB1 2 LEU E 22  ? MET E 27  ? LEU I 22  MET I 27  
AB1 3 VAL E 39  ? ALA E 45  ? VAL I 39  ALA I 45  
AB1 4 GLY I 180 ? TYR I 187 ? GLY D 180 TYR D 187 
AB1 5 TYR I 194 ? ARG I 205 ? TYR D 194 ARG D 205 
AB1 6 TRP I 173 ? GLY I 177 ? TRP D 173 GLY D 177 
AB2 1 GLU F 56  ? VAL F 57  ? GLU H 56  VAL H 57  
AB2 2 LEU F 22  ? MET F 27  ? LEU H 22  MET H 27  
AB2 3 VAL F 39  ? ALA F 45  ? VAL H 39  ALA H 45  
AB2 4 GLY H 180 ? TYR H 187 ? GLY C 180 TYR C 187 
AB2 5 TYR H 194 ? ARG H 205 ? TYR C 194 ARG C 205 
AB2 6 VAL H 138 ? SER H 147 ? VAL C 138 SER C 147 
AB2 7 ILE H 89  ? LEU H 91  ? ILE C 89  LEU C 91  
AB3 1 GLU F 56  ? VAL F 57  ? GLU H 56  VAL H 57  
AB3 2 LEU F 22  ? MET F 27  ? LEU H 22  MET H 27  
AB3 3 VAL F 39  ? ALA F 45  ? VAL H 39  ALA H 45  
AB3 4 GLY H 180 ? TYR H 187 ? GLY C 180 TYR C 187 
AB3 5 TYR H 194 ? ARG H 205 ? TYR C 194 ARG C 205 
AB3 6 TRP H 173 ? GLY H 177 ? TRP C 173 GLY C 177 
AB4 1 VAL G 77  ? PHE G 79  ? VAL B 77  PHE B 79  
AB4 2 VAL G 107 ? VAL G 109 ? VAL B 107 VAL B 109 
AB4 3 HIS G 114 ? TYR G 117 ? HIS B 114 TYR B 117 
AB4 4 VAL G 48  ? THR G 60  ? VAL B 48  THR B 60  
AB4 5 PRO G 120 ? SER G 126 ? PRO B 120 SER B 126 
AB5 1 VAL G 77  ? PHE G 79  ? VAL B 77  PHE B 79  
AB5 2 VAL G 107 ? VAL G 109 ? VAL B 107 VAL B 109 
AB5 3 HIS G 114 ? TYR G 117 ? HIS B 114 TYR B 117 
AB5 4 VAL G 48  ? THR G 60  ? VAL B 48  THR B 60  
AB5 5 LEU G 28  ? ASP G 43  ? LEU B 28  ASP B 43  
AB5 6 LEU G 155 ? MET G 159 ? LEU B 155 MET B 159 
AB6 1 VAL H 77  ? PHE H 79  ? VAL C 77  PHE C 79  
AB6 2 VAL H 107 ? VAL H 109 ? VAL C 107 VAL C 109 
AB6 3 HIS H 114 ? TYR H 117 ? HIS C 114 TYR C 117 
AB6 4 VAL H 48  ? THR H 60  ? VAL C 48  THR C 60  
AB6 5 PRO H 120 ? SER H 126 ? PRO C 120 SER C 126 
AB7 1 VAL H 77  ? PHE H 79  ? VAL C 77  PHE C 79  
AB7 2 VAL H 107 ? VAL H 109 ? VAL C 107 VAL C 109 
AB7 3 HIS H 114 ? TYR H 117 ? HIS C 114 TYR C 117 
AB7 4 VAL H 48  ? THR H 60  ? VAL C 48  THR C 60  
AB7 5 LEU H 28  ? ASP H 43  ? LEU C 28  ASP C 43  
AB7 6 LEU H 155 ? MET H 159 ? LEU C 155 MET C 159 
AB8 1 VAL I 77  ? PHE I 79  ? VAL D 77  PHE D 79  
AB8 2 VAL I 107 ? VAL I 109 ? VAL D 107 VAL D 109 
AB8 3 HIS I 114 ? TYR I 117 ? HIS D 114 TYR D 117 
AB8 4 VAL I 48  ? THR I 60  ? VAL D 48  THR D 60  
AB8 5 PRO I 120 ? SER I 126 ? PRO D 120 SER D 126 
AB9 1 VAL I 77  ? PHE I 79  ? VAL D 77  PHE D 79  
AB9 2 VAL I 107 ? VAL I 109 ? VAL D 107 VAL D 109 
AB9 3 HIS I 114 ? TYR I 117 ? HIS D 114 TYR D 117 
AB9 4 VAL I 48  ? THR I 60  ? VAL D 48  THR D 60  
AB9 5 LEU I 28  ? ASP I 43  ? LEU D 28  ASP D 43  
AB9 6 LEU I 155 ? MET I 159 ? LEU D 155 MET D 159 
AC1 1 VAL J 77  ? PHE J 79  ? VAL E 77  PHE E 79  
AC1 2 VAL J 107 ? VAL J 109 ? VAL E 107 VAL E 109 
AC1 3 HIS J 114 ? TYR J 117 ? HIS E 114 TYR E 117 
AC1 4 VAL J 48  ? THR J 60  ? VAL E 48  THR E 60  
AC1 5 PRO J 120 ? SER J 126 ? PRO E 120 SER E 126 
AC2 1 VAL J 77  ? PHE J 79  ? VAL E 77  PHE E 79  
AC2 2 VAL J 107 ? VAL J 109 ? VAL E 107 VAL E 109 
AC2 3 HIS J 114 ? TYR J 117 ? HIS E 114 TYR E 117 
AC2 4 VAL J 48  ? THR J 60  ? VAL E 48  THR E 60  
AC2 5 LEU J 28  ? ASP J 43  ? LEU E 28  ASP E 43  
AC2 6 LEU J 155 ? MET J 159 ? LEU E 155 MET E 159 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 79  ? N PHE A 79  O VAL A 107 ? O VAL A 107 
AA1 2 3 N LEU A 108 ? N LEU A 108 O GLN A 116 ? O GLN A 116 
AA1 3 4 O CYS A 115 ? O CYS A 115 N TRP A 59  ? N TRP A 59  
AA1 4 5 N LEU A 49  ? N LEU A 49  O SER A 125 ? O SER A 125 
AA2 1 2 N PHE A 79  ? N PHE A 79  O VAL A 107 ? O VAL A 107 
AA2 2 3 N LEU A 108 ? N LEU A 108 O GLN A 116 ? O GLN A 116 
AA2 3 4 O CYS A 115 ? O CYS A 115 N TRP A 59  ? N TRP A 59  
AA2 4 5 O SER A 58  ? O SER A 58  N TYR A 31  ? N TYR A 31  
AA2 5 6 N PHE A 32  ? N PHE A 32  O GLN A 158 ? O GLN A 158 
AA3 1 2 N LEU A 90  ? N LEU A 90  O GLY A 146 ? O GLY A 146 
AA3 2 3 N PHE A 145 ? N PHE A 145 O VAL A 197 ? O VAL A 197 
AA3 3 4 O ARG A 204 ? O ARG A 204 N ASP A 174 ? N ASP A 174 
AA4 1 2 N LEU A 90  ? N LEU A 90  O GLY A 146 ? O GLY A 146 
AA4 2 3 N PHE A 145 ? N PHE A 145 O VAL A 197 ? O VAL A 197 
AA4 3 4 O TYR A 194 ? O TYR A 194 N ARG A 185 ? N ARG A 185 
AA4 4 5 N PHE A 186 ? N PHE A 186 O VAL B 40  ? O VAL F 40  
AA4 5 6 O GLY B 43  ? O GLY F 43  N TYR B 24  ? N TYR F 24  
AA4 6 7 N MET B 27  ? N MET F 27  O GLU B 56  ? O GLU F 56  
AA5 1 2 O GLU C 56  ? O GLU J 56  N MET C 27  ? N MET J 27  
AA5 2 3 N TYR C 24  ? N TYR J 24  O GLY C 43  ? O GLY J 43  
AA5 3 4 N VAL C 40  ? N VAL J 40  O PHE J 186 ? O PHE E 186 
AA5 4 5 N ARG J 185 ? N ARG E 185 O TYR J 194 ? O TYR E 194 
AA5 5 6 O VAL J 197 ? O VAL E 197 N PHE J 145 ? N PHE E 145 
AA5 6 7 O GLY J 146 ? O GLY E 146 N LEU J 90  ? N LEU E 90  
AA6 1 2 O GLU C 56  ? O GLU J 56  N MET C 27  ? N MET J 27  
AA6 2 3 N TYR C 24  ? N TYR J 24  O GLY C 43  ? O GLY J 43  
AA6 3 4 N VAL C 40  ? N VAL J 40  O PHE J 186 ? O PHE E 186 
AA6 4 5 N ARG J 185 ? N ARG E 185 O TYR J 194 ? O TYR E 194 
AA6 5 6 O ARG J 204 ? O ARG E 204 N ASP J 174 ? N ASP E 174 
AA7 1 2 O GLU D 56  ? O GLU G 56  N MET D 27  ? N MET G 27  
AA7 2 3 N TYR D 24  ? N TYR G 24  O GLY D 43  ? O GLY G 43  
AA7 3 4 N VAL D 40  ? N VAL G 40  O PHE G 186 ? O PHE B 186 
AA7 4 5 N ARG G 185 ? N ARG B 185 O TYR G 194 ? O TYR B 194 
AA7 5 6 O VAL G 197 ? O VAL B 197 N PHE G 145 ? N PHE B 145 
AA7 6 7 O GLY G 146 ? O GLY B 146 N LEU G 90  ? N LEU B 90  
AA8 1 2 O GLU D 56  ? O GLU G 56  N MET D 27  ? N MET G 27  
AA8 2 3 N TYR D 24  ? N TYR G 24  O GLY D 43  ? O GLY G 43  
AA8 3 4 N VAL D 40  ? N VAL G 40  O PHE G 186 ? O PHE B 186 
AA8 4 5 N ARG G 185 ? N ARG B 185 O TYR G 194 ? O TYR B 194 
AA8 5 6 O ARG G 204 ? O ARG B 204 N ASP G 174 ? N ASP B 174 
AA9 1 2 O GLU E 56  ? O GLU I 56  N MET E 27  ? N MET I 27  
AA9 2 3 N TYR E 24  ? N TYR I 24  O GLY E 43  ? O GLY I 43  
AA9 3 4 N VAL E 40  ? N VAL I 40  O PHE I 186 ? O PHE D 186 
AA9 4 5 N ARG I 185 ? N ARG D 185 O TYR I 194 ? O TYR D 194 
AA9 5 6 O VAL I 197 ? O VAL D 197 N PHE I 145 ? N PHE D 145 
AA9 6 7 O GLY I 146 ? O GLY D 146 N LEU I 90  ? N LEU D 90  
AB1 1 2 O GLU E 56  ? O GLU I 56  N MET E 27  ? N MET I 27  
AB1 2 3 N TYR E 24  ? N TYR I 24  O GLY E 43  ? O GLY I 43  
AB1 3 4 N VAL E 40  ? N VAL I 40  O PHE I 186 ? O PHE D 186 
AB1 4 5 N ARG I 185 ? N ARG D 185 O TYR I 194 ? O TYR D 194 
AB1 5 6 O ARG I 204 ? O ARG D 204 N ASP I 174 ? N ASP D 174 
AB2 1 2 O GLU F 56  ? O GLU H 56  N MET F 27  ? N MET H 27  
AB2 2 3 N TYR F 24  ? N TYR H 24  O GLY F 43  ? O GLY H 43  
AB2 3 4 N VAL F 40  ? N VAL H 40  O PHE H 186 ? O PHE C 186 
AB2 4 5 N ARG H 185 ? N ARG C 185 O TYR H 194 ? O TYR C 194 
AB2 5 6 O VAL H 197 ? O VAL C 197 N PHE H 145 ? N PHE C 145 
AB2 6 7 O GLY H 146 ? O GLY C 146 N LEU H 90  ? N LEU C 90  
AB3 1 2 O GLU F 56  ? O GLU H 56  N MET F 27  ? N MET H 27  
AB3 2 3 N TYR F 24  ? N TYR H 24  O GLY F 43  ? O GLY H 43  
AB3 3 4 N VAL F 40  ? N VAL H 40  O PHE H 186 ? O PHE C 186 
AB3 4 5 N ARG H 185 ? N ARG C 185 O TYR H 194 ? O TYR C 194 
AB3 5 6 O ARG H 204 ? O ARG C 204 N ASP H 174 ? N ASP C 174 
AB4 1 2 N PHE G 79  ? N PHE B 79  O VAL G 107 ? O VAL B 107 
AB4 2 3 N LEU G 108 ? N LEU B 108 O GLN G 116 ? O GLN B 116 
AB4 3 4 O CYS G 115 ? O CYS B 115 N TRP G 59  ? N TRP B 59  
AB4 4 5 N LEU G 49  ? N LEU B 49  O SER G 125 ? O SER B 125 
AB5 1 2 N PHE G 79  ? N PHE B 79  O VAL G 107 ? O VAL B 107 
AB5 2 3 N LEU G 108 ? N LEU B 108 O GLN G 116 ? O GLN B 116 
AB5 3 4 O CYS G 115 ? O CYS B 115 N TRP G 59  ? N TRP B 59  
AB5 4 5 O SER G 58  ? O SER B 58  N TYR G 31  ? N TYR B 31  
AB5 5 6 N PHE G 32  ? N PHE B 32  O GLN G 158 ? O GLN B 158 
AB6 1 2 N PHE H 79  ? N PHE C 79  O VAL H 107 ? O VAL C 107 
AB6 2 3 N LEU H 108 ? N LEU C 108 O GLN H 116 ? O GLN C 116 
AB6 3 4 O CYS H 115 ? O CYS C 115 N TRP H 59  ? N TRP C 59  
AB6 4 5 N LEU H 49  ? N LEU C 49  O SER H 125 ? O SER C 125 
AB7 1 2 N PHE H 79  ? N PHE C 79  O VAL H 107 ? O VAL C 107 
AB7 2 3 N LEU H 108 ? N LEU C 108 O GLN H 116 ? O GLN C 116 
AB7 3 4 O CYS H 115 ? O CYS C 115 N TRP H 59  ? N TRP C 59  
AB7 4 5 O SER H 58  ? O SER C 58  N TYR H 31  ? N TYR C 31  
AB7 5 6 N PHE H 32  ? N PHE C 32  O GLN H 158 ? O GLN C 158 
AB8 1 2 N PHE I 79  ? N PHE D 79  O VAL I 107 ? O VAL D 107 
AB8 2 3 N LEU I 108 ? N LEU D 108 O GLN I 116 ? O GLN D 116 
AB8 3 4 O CYS I 115 ? O CYS D 115 N TRP I 59  ? N TRP D 59  
AB8 4 5 N LEU I 49  ? N LEU D 49  O SER I 125 ? O SER D 125 
AB9 1 2 N PHE I 79  ? N PHE D 79  O VAL I 107 ? O VAL D 107 
AB9 2 3 N LEU I 108 ? N LEU D 108 O GLN I 116 ? O GLN D 116 
AB9 3 4 O CYS I 115 ? O CYS D 115 N TRP I 59  ? N TRP D 59  
AB9 4 5 O SER I 58  ? O SER D 58  N TYR I 31  ? N TYR D 31  
AB9 5 6 N PHE I 32  ? N PHE D 32  O GLN I 158 ? O GLN D 158 
AC1 1 2 N PHE J 79  ? N PHE E 79  O VAL J 107 ? O VAL E 107 
AC1 2 3 N LEU J 108 ? N LEU E 108 O GLN J 116 ? O GLN E 116 
AC1 3 4 O CYS J 115 ? O CYS E 115 N TRP J 59  ? N TRP E 59  
AC1 4 5 N LEU J 49  ? N LEU E 49  O SER J 125 ? O SER E 125 
AC2 1 2 N PHE J 79  ? N PHE E 79  O VAL J 107 ? O VAL E 107 
AC2 2 3 N LEU J 108 ? N LEU E 108 O GLN J 116 ? O GLN E 116 
AC2 3 4 O CYS J 115 ? O CYS E 115 N TRP J 59  ? N TRP E 59  
AC2 4 5 O SER J 58  ? O SER E 58  N TYR J 31  ? N TYR E 31  
AC2 5 6 N PHE J 32  ? N PHE E 32  O GLN J 158 ? O GLN E 158 
# 
_atom_sites.entry_id                    7KOO 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLU A  1 1   ? 141.998 112.474 68.100  1.00 19.60  ? 1   GLU A N    1 
ATOM   2     C  CA   . GLU A  1 1   ? 141.563 112.567 66.673  1.00 19.60  ? 1   GLU A CA   1 
ATOM   3     C  C    . GLU A  1 1   ? 140.075 112.865 66.556  1.00 19.60  ? 1   GLU A C    1 
ATOM   4     O  O    . GLU A  1 1   ? 139.675 113.917 66.065  1.00 19.60  ? 1   GLU A O    1 
ATOM   5     C  CB   . GLU A  1 1   ? 141.878 111.269 65.933  1.00 19.60  ? 1   GLU A CB   1 
ATOM   6     C  CG   . GLU A  1 1   ? 141.534 111.302 64.450  1.00 19.60  ? 1   GLU A CG   1 
ATOM   7     C  CD   . GLU A  1 1   ? 141.354 109.919 63.859  1.00 19.60  ? 1   GLU A CD   1 
ATOM   8     O  OE1  . GLU A  1 1   ? 142.369 109.284 63.503  1.00 19.60  ? 1   GLU A OE1  1 
ATOM   9     O  OE2  . GLU A  1 1   ? 140.196 109.468 63.739  1.00 19.60  ? 1   GLU A OE2  1 
ATOM   10    H  H1   . GLU A  1 1   ? 142.880 112.373 68.139  1.00 19.60  ? 1   GLU A H1   1 
ATOM   11    H  H2   . GLU A  1 1   ? 141.774 113.218 68.529  1.00 19.60  ? 1   GLU A H2   1 
ATOM   12    H  H3   . GLU A  1 1   ? 141.606 111.780 68.490  1.00 19.60  ? 1   GLU A H3   1 
ATOM   13    H  HA   . GLU A  1 1   ? 142.048 113.284 66.241  1.00 19.60  ? 1   GLU A HA   1 
ATOM   14    H  HB2  . GLU A  1 1   ? 142.824 111.080 66.017  1.00 19.60  ? 1   GLU A HB2  1 
ATOM   15    H  HB3  . GLU A  1 1   ? 141.367 110.553 66.337  1.00 19.60  ? 1   GLU A HB3  1 
ATOM   16    H  HG2  . GLU A  1 1   ? 140.707 111.788 64.322  1.00 19.60  ? 1   GLU A HG2  1 
ATOM   17    H  HG3  . GLU A  1 1   ? 142.250 111.745 63.971  1.00 19.60  ? 1   GLU A HG3  1 
ATOM   18    N  N    . PHE A  1 2   ? 139.261 111.908 67.001  1.00 17.34  ? 2   PHE A N    1 
ATOM   19    C  CA   . PHE A  1 2   ? 137.815 112.043 66.898  1.00 17.34  ? 2   PHE A CA   1 
ATOM   20    C  C    . PHE A  1 2   ? 137.286 113.099 67.853  1.00 17.34  ? 2   PHE A C    1 
ATOM   21    O  O    . PHE A  1 2   ? 136.257 113.730 67.584  1.00 17.34  ? 2   PHE A O    1 
ATOM   22    C  CB   . PHE A  1 2   ? 137.165 110.701 67.193  1.00 17.34  ? 2   PHE A CB   1 
ATOM   23    C  CG   . PHE A  1 2   ? 137.338 109.698 66.100  1.00 17.34  ? 2   PHE A CG   1 
ATOM   24    C  CD1  . PHE A  1 2   ? 136.731 109.880 64.877  1.00 17.34  ? 2   PHE A CD1  1 
ATOM   25    C  CD2  . PHE A  1 2   ? 138.118 108.577 66.294  1.00 17.34  ? 2   PHE A CD2  1 
ATOM   26    C  CE1  . PHE A  1 2   ? 136.892 108.962 63.871  1.00 17.34  ? 2   PHE A CE1  1 
ATOM   27    C  CE2  . PHE A  1 2   ? 138.284 107.656 65.292  1.00 17.34  ? 2   PHE A CE2  1 
ATOM   28    C  CZ   . PHE A  1 2   ? 137.669 107.848 64.078  1.00 17.34  ? 2   PHE A CZ   1 
ATOM   29    H  H    . PHE A  1 2   ? 139.519 111.179 67.368  1.00 17.34  ? 2   PHE A H    1 
ATOM   30    H  HA   . PHE A  1 2   ? 137.590 112.300 65.995  1.00 17.34  ? 2   PHE A HA   1 
ATOM   31    H  HB2  . PHE A  1 2   ? 137.571 110.342 67.994  1.00 17.34  ? 2   PHE A HB2  1 
ATOM   32    H  HB3  . PHE A  1 2   ? 136.219 110.838 67.333  1.00 17.34  ? 2   PHE A HB3  1 
ATOM   33    H  HD1  . PHE A  1 2   ? 136.206 110.631 64.734  1.00 17.34  ? 2   PHE A HD1  1 
ATOM   34    H  HD2  . PHE A  1 2   ? 138.536 108.444 67.114  1.00 17.34  ? 2   PHE A HD2  1 
ATOM   35    H  HE1  . PHE A  1 2   ? 136.476 109.095 63.052  1.00 17.34  ? 2   PHE A HE1  1 
ATOM   36    H  HE2  . PHE A  1 2   ? 138.809 106.905 65.436  1.00 17.34  ? 2   PHE A HE2  1 
ATOM   37    H  HZ   . PHE A  1 2   ? 137.778 107.228 63.398  1.00 17.34  ? 2   PHE A HZ   1 
ATOM   38    N  N    . GLN A  1 3   ? 137.979 113.291 68.971  1.00 14.78  ? 3   GLN A N    1 
ATOM   39    C  CA   . GLN A  1 3   ? 137.611 114.311 69.940  1.00 14.78  ? 3   GLN A CA   1 
ATOM   40    C  C    . GLN A  1 3   ? 137.634 115.702 69.333  1.00 14.78  ? 3   GLN A C    1 
ATOM   41    O  O    . GLN A  1 3   ? 136.723 116.503 69.561  1.00 14.78  ? 3   GLN A O    1 
ATOM   42    C  CB   . GLN A  1 3   ? 138.595 114.258 71.089  1.00 14.78  ? 3   GLN A CB   1 
ATOM   43    C  CG   . GLN A  1 3   ? 138.421 113.165 72.073  1.00 14.78  ? 3   GLN A CG   1 
ATOM   44    C  CD   . GLN A  1 3   ? 139.590 113.126 73.021  1.00 14.78  ? 3   GLN A CD   1 
ATOM   45    O  OE1  . GLN A  1 3   ? 140.744 113.161 72.601  1.00 14.78  ? 3   GLN A OE1  1 
ATOM   46    N  NE2  . GLN A  1 3   ? 139.303 113.163 74.299  1.00 14.78  ? 3   GLN A NE2  1 
ATOM   47    H  H    . GLN A  1 3   ? 138.668 112.839 69.194  1.00 14.78  ? 3   GLN A H    1 
ATOM   48    H  HA   . GLN A  1 3   ? 136.719 114.138 70.273  1.00 14.78  ? 3   GLN A HA   1 
ATOM   49    H  HB2  . GLN A  1 3   ? 139.477 114.164 70.708  1.00 14.78  ? 3   GLN A HB2  1 
ATOM   50    H  HB3  . GLN A  1 3   ? 138.519 115.088 71.574  1.00 14.78  ? 3   GLN A HB3  1 
ATOM   51    H  HG2  . GLN A  1 3   ? 137.620 113.321 72.591  1.00 14.78  ? 3   GLN A HG2  1 
ATOM   52    H  HG3  . GLN A  1 3   ? 138.367 112.320 71.601  1.00 14.78  ? 3   GLN A HG3  1 
ATOM   53    H  HE21 . GLN A  1 3   ? 138.506 113.159 74.592  1.00 14.78  ? 3   GLN A HE21 1 
ATOM   54    H  HE22 . GLN A  1 3   ? 139.975 113.143 74.838  1.00 14.78  ? 3   GLN A HE22 1 
ATOM   55    N  N    . ARG A  1 4   ? 138.704 116.028 68.610  1.00 13.39  ? 4   ARG A N    1 
ATOM   56    C  CA   . ARG A  1 4   ? 138.796 117.330 67.964  1.00 13.39  ? 4   ARG A CA   1 
ATOM   57    C  C    . ARG A  1 4   ? 137.602 117.563 67.058  1.00 13.39  ? 4   ARG A C    1 
ATOM   58    O  O    . ARG A  1 4   ? 136.949 118.613 67.114  1.00 13.39  ? 4   ARG A O    1 
ATOM   59    C  CB   . ARG A  1 4   ? 140.084 117.406 67.155  1.00 13.39  ? 4   ARG A CB   1 
ATOM   60    C  CG   . ARG A  1 4   ? 141.330 117.547 67.968  1.00 13.39  ? 4   ARG A CG   1 
ATOM   61    C  CD   . ARG A  1 4   ? 142.458 118.013 67.094  1.00 13.39  ? 4   ARG A CD   1 
ATOM   62    N  NE   . ARG A  1 4   ? 143.595 118.493 67.862  1.00 13.39  ? 4   ARG A NE   1 
ATOM   63    C  CZ   . ARG A  1 4   ? 144.742 118.871 67.317  1.00 13.39  ? 4   ARG A CZ   1 
ATOM   64    N  NH1  . ARG A  1 4   ? 145.731 119.297 68.083  1.00 13.39  ? 4   ARG A NH1  1 
ATOM   65    N  NH2  . ARG A  1 4   ? 144.892 118.829 66.002  1.00 13.39  ? 4   ARG A NH2  1 
ATOM   66    H  H    . ARG A  1 4   ? 139.382 115.521 68.490  1.00 13.39  ? 4   ARG A H    1 
ATOM   67    H  HA   . ARG A  1 4   ? 138.814 118.025 68.635  1.00 13.39  ? 4   ARG A HA   1 
ATOM   68    H  HB2  . ARG A  1 4   ? 140.163 116.591 66.641  1.00 13.39  ? 4   ARG A HB2  1 
ATOM   69    H  HB3  . ARG A  1 4   ? 140.030 118.167 66.561  1.00 13.39  ? 4   ARG A HB3  1 
ATOM   70    H  HG2  . ARG A  1 4   ? 141.186 118.209 68.658  1.00 13.39  ? 4   ARG A HG2  1 
ATOM   71    H  HG3  . ARG A  1 4   ? 141.564 116.690 68.352  1.00 13.39  ? 4   ARG A HG3  1 
ATOM   72    H  HD2  . ARG A  1 4   ? 142.755 117.279 66.539  1.00 13.39  ? 4   ARG A HD2  1 
ATOM   73    H  HD3  . ARG A  1 4   ? 142.148 118.742 66.538  1.00 13.39  ? 4   ARG A HD3  1 
ATOM   74    H  HE   . ARG A  1 4   ? 143.469 118.678 68.690  1.00 13.39  ? 4   ARG A HE   1 
ATOM   75    H  HH11 . ARG A  1 4   ? 145.626 119.326 68.934  1.00 13.39  ? 4   ARG A HH11 1 
ATOM   76    H  HH12 . ARG A  1 4   ? 146.471 119.546 67.727  1.00 13.39  ? 4   ARG A HH12 1 
ATOM   77    H  HH21 . ARG A  1 4   ? 144.247 118.554 65.504  1.00 13.39  ? 4   ARG A HH21 1 
ATOM   78    H  HH22 . ARG A  1 4   ? 145.633 119.077 65.647  1.00 13.39  ? 4   ARG A HH22 1 
ATOM   79    N  N    . LYS A  1 5   ? 137.303 116.579 66.217  1.00 16.03  ? 5   LYS A N    1 
ATOM   80    C  CA   . LYS A  1 5   ? 136.209 116.716 65.271  1.00 16.03  ? 5   LYS A CA   1 
ATOM   81    C  C    . LYS A  1 5   ? 134.888 116.897 65.999  1.00 16.03  ? 5   LYS A C    1 
ATOM   82    O  O    . LYS A  1 5   ? 134.077 117.756 65.634  1.00 16.03  ? 5   LYS A O    1 
ATOM   83    C  CB   . LYS A  1 5   ? 136.174 115.485 64.373  1.00 16.03  ? 5   LYS A CB   1 
ATOM   84    C  CG   . LYS A  1 5   ? 135.202 115.578 63.240  1.00 16.03  ? 5   LYS A CG   1 
ATOM   85    C  CD   . LYS A  1 5   ? 135.209 114.315 62.421  1.00 16.03  ? 5   LYS A CD   1 
ATOM   86    C  CE   . LYS A  1 5   ? 133.825 114.013 61.894  1.00 16.03  ? 5   LYS A CE   1 
ATOM   87    N  NZ   . LYS A  1 5   ? 133.869 113.214 60.647  1.00 16.03  ? 5   LYS A NZ   1 
ATOM   88    H  H    . LYS A  1 5   ? 137.712 115.828 66.179  1.00 16.03  ? 5   LYS A H    1 
ATOM   89    H  HA   . LYS A  1 5   ? 136.362 117.494 64.719  1.00 16.03  ? 5   LYS A HA   1 
ATOM   90    H  HB2  . LYS A  1 5   ? 137.057 115.343 64.002  1.00 16.03  ? 5   LYS A HB2  1 
ATOM   91    H  HB3  . LYS A  1 5   ? 135.926 114.721 64.913  1.00 16.03  ? 5   LYS A HB3  1 
ATOM   92    H  HG2  . LYS A  1 5   ? 134.311 115.709 63.595  1.00 16.03  ? 5   LYS A HG2  1 
ATOM   93    H  HG3  . LYS A  1 5   ? 135.455 116.317 62.668  1.00 16.03  ? 5   LYS A HG3  1 
ATOM   94    H  HD2  . LYS A  1 5   ? 135.810 114.423 61.670  1.00 16.03  ? 5   LYS A HD2  1 
ATOM   95    H  HD3  . LYS A  1 5   ? 135.497 113.575 62.978  1.00 16.03  ? 5   LYS A HD3  1 
ATOM   96    H  HE2  . LYS A  1 5   ? 133.337 113.510 62.563  1.00 16.03  ? 5   LYS A HE2  1 
ATOM   97    H  HE3  . LYS A  1 5   ? 133.370 114.848 61.705  1.00 16.03  ? 5   LYS A HE3  1 
ATOM   98    H  HZ1  . LYS A  1 5   ? 133.279 113.533 60.062  1.00 16.03  ? 5   LYS A HZ1  1 
ATOM   99    H  HZ2  . LYS A  1 5   ? 134.683 113.256 60.290  1.00 16.03  ? 5   LYS A HZ2  1 
ATOM   100   H  HZ3  . LYS A  1 5   ? 133.675 112.364 60.824  1.00 16.03  ? 5   LYS A HZ3  1 
ATOM   101   N  N    . LEU A  1 6   ? 134.666 116.109 67.047  1.00 12.18  ? 6   LEU A N    1 
ATOM   102   C  CA   . LEU A  1 6   ? 133.421 116.197 67.795  1.00 12.18  ? 6   LEU A CA   1 
ATOM   103   C  C    . LEU A  1 6   ? 133.266 117.562 68.447  1.00 12.18  ? 6   LEU A C    1 
ATOM   104   O  O    . LEU A  1 6   ? 132.220 118.210 68.324  1.00 12.18  ? 6   LEU A O    1 
ATOM   105   C  CB   . LEU A  1 6   ? 133.386 115.093 68.843  1.00 12.18  ? 6   LEU A CB   1 
ATOM   106   C  CG   . LEU A  1 6   ? 132.166 115.055 69.742  1.00 12.18  ? 6   LEU A CG   1 
ATOM   107   C  CD1  . LEU A  1 6   ? 130.938 114.803 68.927  1.00 12.18  ? 6   LEU A CD1  1 
ATOM   108   C  CD2  . LEU A  1 6   ? 132.361 113.981 70.756  1.00 12.18  ? 6   LEU A CD2  1 
ATOM   109   H  H    . LEU A  1 6   ? 135.216 115.522 67.340  1.00 12.18  ? 6   LEU A H    1 
ATOM   110   H  HA   . LEU A  1 6   ? 132.677 116.067 67.194  1.00 12.18  ? 6   LEU A HA   1 
ATOM   111   H  HB2  . LEU A  1 6   ? 133.437 114.240 68.394  1.00 12.18  ? 6   LEU A HB2  1 
ATOM   112   H  HB3  . LEU A  1 6   ? 134.157 115.203 69.415  1.00 12.18  ? 6   LEU A HB3  1 
ATOM   113   H  HG   . LEU A  1 6   ? 132.067 115.897 70.203  1.00 12.18  ? 6   LEU A HG   1 
ATOM   114   H  HD11 . LEU A  1 6   ? 130.180 114.716 69.519  1.00 12.18  ? 6   LEU A HD11 1 
ATOM   115   H  HD12 . LEU A  1 6   ? 130.807 115.550 68.326  1.00 12.18  ? 6   LEU A HD12 1 
ATOM   116   H  HD13 . LEU A  1 6   ? 131.066 113.988 68.424  1.00 12.18  ? 6   LEU A HD13 1 
ATOM   117   H  HD21 . LEU A  1 6   ? 131.530 113.842 71.226  1.00 12.18  ? 6   LEU A HD21 1 
ATOM   118   H  HD22 . LEU A  1 6   ? 132.628 113.174 70.296  1.00 12.18  ? 6   LEU A HD22 1 
ATOM   119   H  HD23 . LEU A  1 6   ? 133.055 114.257 71.372  1.00 12.18  ? 6   LEU A HD23 1 
ATOM   120   N  N    . TYR A  1 7   ? 134.301 118.013 69.153  1.00 10.19  ? 7   TYR A N    1 
ATOM   121   C  CA   . TYR A  1 7   ? 134.235 119.305 69.819  1.00 10.19  ? 7   TYR A CA   1 
ATOM   122   C  C    . TYR A  1 7   ? 134.007 120.428 68.818  1.00 10.19  ? 7   TYR A C    1 
ATOM   123   O  O    . TYR A  1 7   ? 133.293 121.392 69.112  1.00 10.19  ? 7   TYR A O    1 
ATOM   124   C  CB   . TYR A  1 7   ? 135.513 119.546 70.616  1.00 10.19  ? 7   TYR A CB   1 
ATOM   125   C  CG   . TYR A  1 7   ? 135.503 118.967 72.009  1.00 10.19  ? 7   TYR A CG   1 
ATOM   126   C  CD1  . TYR A  1 7   ? 134.719 119.517 73.006  1.00 10.19  ? 7   TYR A CD1  1 
ATOM   127   C  CD2  . TYR A  1 7   ? 136.292 117.879 72.332  1.00 10.19  ? 7   TYR A CD2  1 
ATOM   128   C  CE1  . TYR A  1 7   ? 134.715 118.994 74.276  1.00 10.19  ? 7   TYR A CE1  1 
ATOM   129   C  CE2  . TYR A  1 7   ? 136.291 117.351 73.600  1.00 10.19  ? 7   TYR A CE2  1 
ATOM   130   C  CZ   . TYR A  1 7   ? 135.503 117.913 74.567  1.00 10.19  ? 7   TYR A CZ   1 
ATOM   131   O  OH   . TYR A  1 7   ? 135.503 117.388 75.835  1.00 10.19  ? 7   TYR A OH   1 
ATOM   132   H  H    . TYR A  1 7   ? 135.036 117.592 69.269  1.00 10.19  ? 7   TYR A H    1 
ATOM   133   H  HA   . TYR A  1 7   ? 133.495 119.298 70.439  1.00 10.19  ? 7   TYR A HA   1 
ATOM   134   H  HB2  . TYR A  1 7   ? 136.251 119.142 70.141  1.00 10.19  ? 7   TYR A HB2  1 
ATOM   135   H  HB3  . TYR A  1 7   ? 135.650 120.501 70.693  1.00 10.19  ? 7   TYR A HB3  1 
ATOM   136   H  HD1  . TYR A  1 7   ? 134.184 120.249 72.812  1.00 10.19  ? 7   TYR A HD1  1 
ATOM   137   H  HD2  . TYR A  1 7   ? 136.828 117.497 71.679  1.00 10.19  ? 7   TYR A HD2  1 
ATOM   138   H  HE1  . TYR A  1 7   ? 134.184 119.369 74.935  1.00 10.19  ? 7   TYR A HE1  1 
ATOM   139   H  HE2  . TYR A  1 7   ? 136.823 116.620 73.803  1.00 10.19  ? 7   TYR A HE2  1 
ATOM   140   H  HH   . TYR A  1 7   ? 136.171 116.889 75.935  1.00 10.19  ? 7   TYR A HH   1 
ATOM   141   N  N    . LYS A  1 8   ? 134.612 120.333 67.633  1.00 13.65  ? 8   LYS A N    1 
ATOM   142   C  CA   . LYS A  1 8   ? 134.340 121.322 66.596  1.00 13.65  ? 8   LYS A CA   1 
ATOM   143   C  C    . LYS A  1 8   ? 132.878 121.295 66.177  1.00 13.65  ? 8   LYS A C    1 
ATOM   144   O  O    . LYS A  1 8   ? 132.229 122.341 66.072  1.00 13.65  ? 8   LYS A O    1 
ATOM   145   C  CB   . LYS A  1 8   ? 135.233 121.078 65.386  1.00 13.65  ? 8   LYS A CB   1 
ATOM   146   C  CG   . LYS A  1 8   ? 136.636 121.577 65.544  1.00 13.65  ? 8   LYS A CG   1 
ATOM   147   C  CD   . LYS A  1 8   ? 137.420 121.415 64.256  1.00 13.65  ? 8   LYS A CD   1 
ATOM   148   C  CE   . LYS A  1 8   ? 137.722 119.949 63.987  1.00 13.65  ? 8   LYS A CE   1 
ATOM   149   N  NZ   . LYS A  1 8   ? 138.954 119.744 63.193  1.00 13.65  ? 8   LYS A NZ   1 
ATOM   150   H  H    . LYS A  1 8   ? 135.175 119.726 67.414  1.00 13.65  ? 8   LYS A H    1 
ATOM   151   H  HA   . LYS A  1 8   ? 134.538 122.202 66.942  1.00 13.65  ? 8   LYS A HA   1 
ATOM   152   H  HB2  . LYS A  1 8   ? 135.270 120.125 65.220  1.00 13.65  ? 8   LYS A HB2  1 
ATOM   153   H  HB3  . LYS A  1 8   ? 134.847 121.531 64.623  1.00 13.65  ? 8   LYS A HB3  1 
ATOM   154   H  HG2  . LYS A  1 8   ? 136.606 122.519 65.764  1.00 13.65  ? 8   LYS A HG2  1 
ATOM   155   H  HG3  . LYS A  1 8   ? 137.075 121.077 66.248  1.00 13.65  ? 8   LYS A HG3  1 
ATOM   156   H  HD2  . LYS A  1 8   ? 136.890 121.759 63.521  1.00 13.65  ? 8   LYS A HD2  1 
ATOM   157   H  HD3  . LYS A  1 8   ? 138.257 121.898 64.320  1.00 13.65  ? 8   LYS A HD3  1 
ATOM   158   H  HE2  . LYS A  1 8   ? 137.830 119.483 64.829  1.00 13.65  ? 8   LYS A HE2  1 
ATOM   159   H  HE3  . LYS A  1 8   ? 136.985 119.566 63.487  1.00 13.65  ? 8   LYS A HE3  1 
ATOM   160   H  HZ1  . LYS A  1 8   ? 139.094 118.874 63.072  1.00 13.65  ? 8   LYS A HZ1  1 
ATOM   161   H  HZ2  . LYS A  1 8   ? 138.871 120.137 62.400  1.00 13.65  ? 8   LYS A HZ2  1 
ATOM   162   H  HZ3  . LYS A  1 8   ? 139.652 120.093 63.620  1.00 13.65  ? 8   LYS A HZ3  1 
ATOM   163   N  N    . GLU A  1 9   ? 132.341 120.102 65.923  1.00 14.17  ? 9   GLU A N    1 
ATOM   164   C  CA   . GLU A  1 9   ? 130.974 120.007 65.424  1.00 14.17  ? 9   GLU A CA   1 
ATOM   165   C  C    . GLU A  1 9   ? 129.973 120.527 66.445  1.00 14.17  ? 9   GLU A C    1 
ATOM   166   O  O    . GLU A  1 9   ? 128.989 121.183 66.085  1.00 14.17  ? 9   GLU A O    1 
ATOM   167   C  CB   . GLU A  1 9   ? 130.644 118.564 65.053  1.00 14.17  ? 9   GLU A CB   1 
ATOM   168   C  CG   . GLU A  1 9   ? 131.587 117.943 64.047  1.00 14.17  ? 9   GLU A CG   1 
ATOM   169   C  CD   . GLU A  1 9   ? 131.176 118.205 62.615  1.00 14.17  ? 9   GLU A CD   1 
ATOM   170   O  OE1  . GLU A  1 9   ? 131.872 117.718 61.700  1.00 14.17  ? 9   GLU A OE1  1 
ATOM   171   O  OE2  . GLU A  1 9   ? 130.160 118.899 62.402  1.00 14.17  ? 9   GLU A OE2  1 
ATOM   172   H  H    . GLU A  1 9   ? 132.736 119.350 66.031  1.00 14.17  ? 9   GLU A H    1 
ATOM   173   H  HA   . GLU A  1 9   ? 130.899 120.546 64.626  1.00 14.17  ? 9   GLU A HA   1 
ATOM   174   H  HB2  . GLU A  1 9   ? 130.678 118.030 65.859  1.00 14.17  ? 9   GLU A HB2  1 
ATOM   175   H  HB3  . GLU A  1 9   ? 129.752 118.535 64.681  1.00 14.17  ? 9   GLU A HB3  1 
ATOM   176   H  HG2  . GLU A  1 9   ? 132.468 118.321 64.164  1.00 14.17  ? 9   GLU A HG2  1 
ATOM   177   H  HG3  . GLU A  1 9   ? 131.611 116.984 64.188  1.00 14.17  ? 9   GLU A HG3  1 
ATOM   178   N  N    . LEU A  1 10  ? 130.204 120.240 67.724  1.00 9.94   ? 10  LEU A N    1 
ATOM   179   C  CA   . LEU A  1 10  ? 129.202 120.536 68.739  1.00 9.94   ? 10  LEU A CA   1 
ATOM   180   C  C    . LEU A  1 10  ? 129.039 122.032 68.980  1.00 9.94   ? 10  LEU A C    1 
ATOM   181   O  O    . LEU A  1 10  ? 127.945 122.479 69.336  1.00 9.94   ? 10  LEU A O    1 
ATOM   182   C  CB   . LEU A  1 10  ? 129.570 119.833 70.039  1.00 9.94   ? 10  LEU A CB   1 
ATOM   183   C  CG   . LEU A  1 10  ? 129.463 118.310 70.059  1.00 9.94   ? 10  LEU A CG   1 
ATOM   184   C  CD1  . LEU A  1 10  ? 129.651 117.816 71.460  1.00 9.94   ? 10  LEU A CD1  1 
ATOM   185   C  CD2  . LEU A  1 10  ? 128.146 117.821 69.513  1.00 9.94   ? 10  LEU A CD2  1 
ATOM   186   H  H    . LEU A  1 10  ? 130.918 119.873 68.022  1.00 9.94   ? 10  LEU A H    1 
ATOM   187   H  HA   . LEU A  1 10  ? 128.349 120.197 68.441  1.00 9.94   ? 10  LEU A HA   1 
ATOM   188   H  HB2  . LEU A  1 10  ? 130.488 120.051 70.246  1.00 9.94   ? 10  LEU A HB2  1 
ATOM   189   H  HB3  . LEU A  1 10  ? 128.991 120.170 70.735  1.00 9.94   ? 10  LEU A HB3  1 
ATOM   190   H  HG   . LEU A  1 10  ? 130.166 117.937 69.514  1.00 9.94   ? 10  LEU A HG   1 
ATOM   191   H  HD11 . LEU A  1 10  ? 129.484 116.866 71.476  1.00 9.94   ? 10  LEU A HD11 1 
ATOM   192   H  HD12 . LEU A  1 10  ? 130.557 118.005 71.740  1.00 9.94   ? 10  LEU A HD12 1 
ATOM   193   H  HD13 . LEU A  1 10  ? 129.023 118.274 72.035  1.00 9.94   ? 10  LEU A HD13 1 
ATOM   194   H  HD21 . LEU A  1 10  ? 128.052 116.882 69.728  1.00 9.94   ? 10  LEU A HD21 1 
ATOM   195   H  HD22 . LEU A  1 10  ? 127.432 118.325 69.925  1.00 9.94   ? 10  LEU A HD22 1 
ATOM   196   H  HD23 . LEU A  1 10  ? 128.130 117.946 68.554  1.00 9.94   ? 10  LEU A HD23 1 
ATOM   197   N  N    . VAL A  1 11  ? 130.096 122.816 68.798  1.00 10.91  ? 11  VAL A N    1 
ATOM   198   C  CA   . VAL A  1 11  ? 130.061 124.249 69.058  1.00 10.91  ? 11  VAL A CA   1 
ATOM   199   C  C    . VAL A  1 11  ? 130.001 125.050 67.760  1.00 10.91  ? 11  VAL A C    1 
ATOM   200   O  O    . VAL A  1 11  ? 130.355 126.225 67.744  1.00 10.91  ? 11  VAL A O    1 
ATOM   201   C  CB   . VAL A  1 11  ? 131.257 124.688 69.916  1.00 10.91  ? 11  VAL A CB   1 
ATOM   202   C  CG1  . VAL A  1 11  ? 131.305 123.901 71.204  1.00 10.91  ? 11  VAL A CG1  1 
ATOM   203   C  CG2  . VAL A  1 11  ? 132.546 124.519 69.152  1.00 10.91  ? 11  VAL A CG2  1 
ATOM   204   H  H    . VAL A  1 11  ? 130.856 122.536 68.522  1.00 10.91  ? 11  VAL A H    1 
ATOM   205   H  HA   . VAL A  1 11  ? 129.259 124.452 69.556  1.00 10.91  ? 11  VAL A HA   1 
ATOM   206   H  HB   . VAL A  1 11  ? 131.160 125.624 70.136  1.00 10.91  ? 11  VAL A HB   1 
ATOM   207   H  HG11 . VAL A  1 11  ? 132.035 124.235 71.745  1.00 10.91  ? 11  VAL A HG11 1 
ATOM   208   H  HG12 . VAL A  1 11  ? 130.466 124.015 71.673  1.00 10.91  ? 11  VAL A HG12 1 
ATOM   209   H  HG13 . VAL A  1 11  ? 131.448 122.967 70.993  1.00 10.91  ? 11  VAL A HG13 1 
ATOM   210   H  HG21 . VAL A  1 11  ? 133.288 124.690 69.750  1.00 10.91  ? 11  VAL A HG21 1 
ATOM   211   H  HG22 . VAL A  1 11  ? 132.593 123.613 68.819  1.00 10.91  ? 11  VAL A HG22 1 
ATOM   212   H  HG23 . VAL A  1 11  ? 132.564 125.146 68.414  1.00 10.91  ? 11  VAL A HG23 1 
ATOM   213   N  N    . LYS A  1 12  ? 129.552 124.431 66.669  1.00 12.95  ? 12  LYS A N    1 
ATOM   214   C  CA   . LYS A  1 12  ? 129.579 125.103 65.375  1.00 12.95  ? 12  LYS A CA   1 
ATOM   215   C  C    . LYS A  1 12  ? 128.672 126.328 65.373  1.00 12.95  ? 12  LYS A C    1 
ATOM   216   O  O    . LYS A  1 12  ? 129.054 127.396 64.882  1.00 12.95  ? 12  LYS A O    1 
ATOM   217   C  CB   . LYS A  1 12  ? 129.180 124.120 64.278  1.00 12.95  ? 12  LYS A CB   1 
ATOM   218   C  CG   . LYS A  1 12  ? 129.517 124.584 62.878  1.00 12.95  ? 12  LYS A CG   1 
ATOM   219   C  CD   . LYS A  1 12  ? 128.944 123.654 61.818  1.00 12.95  ? 12  LYS A CD   1 
ATOM   220   C  CE   . LYS A  1 12  ? 129.646 122.306 61.786  1.00 12.95  ? 12  LYS A CE   1 
ATOM   221   N  NZ   . LYS A  1 12  ? 131.120 122.425 61.618  1.00 12.95  ? 12  LYS A NZ   1 
ATOM   222   H  H    . LYS A  1 12  ? 129.230 123.637 66.651  1.00 12.95  ? 12  LYS A H    1 
ATOM   223   H  HA   . LYS A  1 12  ? 130.481 125.402 65.190  1.00 12.95  ? 12  LYS A HA   1 
ATOM   224   H  HB2  . LYS A  1 12  ? 129.653 123.290 64.430  1.00 12.95  ? 12  LYS A HB2  1 
ATOM   225   H  HB3  . LYS A  1 12  ? 128.225 123.971 64.326  1.00 12.95  ? 12  LYS A HB3  1 
ATOM   226   H  HG2  . LYS A  1 12  ? 129.146 125.467 62.739  1.00 12.95  ? 12  LYS A HG2  1 
ATOM   227   H  HG3  . LYS A  1 12  ? 130.480 124.607 62.777  1.00 12.95  ? 12  LYS A HG3  1 
ATOM   228   H  HD2  . LYS A  1 12  ? 128.008 123.496 62.014  1.00 12.95  ? 12  LYS A HD2  1 
ATOM   229   H  HD3  . LYS A  1 12  ? 129.038 124.066 60.945  1.00 12.95  ? 12  LYS A HD3  1 
ATOM   230   H  HE2  . LYS A  1 12  ? 129.473 121.839 62.616  1.00 12.95  ? 12  LYS A HE2  1 
ATOM   231   H  HE3  . LYS A  1 12  ? 129.303 121.790 61.040  1.00 12.95  ? 12  LYS A HE3  1 
ATOM   232   H  HZ1  . LYS A  1 12  ? 131.482 121.618 61.518  1.00 12.95  ? 12  LYS A HZ1  1 
ATOM   233   H  HZ2  . LYS A  1 12  ? 131.303 122.913 60.898  1.00 12.95  ? 12  LYS A HZ2  1 
ATOM   234   H  HZ3  . LYS A  1 12  ? 131.479 122.817 62.331  1.00 12.95  ? 12  LYS A HZ3  1 
ATOM   235   N  N    . ASN A  1 13  ? 127.464 126.195 65.926  1.00 19.91  ? 13  ASN A N    1 
ATOM   236   C  CA   . ASN A  1 13  ? 126.517 127.303 65.999  1.00 19.91  ? 13  ASN A CA   1 
ATOM   237   C  C    . ASN A  1 13  ? 125.877 127.413 67.378  1.00 19.91  ? 13  ASN A C    1 
ATOM   238   O  O    . ASN A  1 13  ? 124.848 128.077 67.529  1.00 19.91  ? 13  ASN A O    1 
ATOM   239   C  CB   . ASN A  1 13  ? 125.435 127.152 64.928  1.00 19.91  ? 13  ASN A CB   1 
ATOM   240   C  CG   . ASN A  1 13  ? 125.898 127.613 63.566  1.00 19.91  ? 13  ASN A CG   1 
ATOM   241   O  OD1  . ASN A  1 13  ? 126.176 128.793 63.357  1.00 19.91  ? 13  ASN A OD1  1 
ATOM   242   N  ND2  . ASN A  1 13  ? 125.987 126.681 62.631  1.00 19.91  ? 13  ASN A ND2  1 
ATOM   243   H  H    . ASN A  1 13  ? 127.168 125.463 66.263  1.00 19.91  ? 13  ASN A H    1 
ATOM   244   H  HA   . ASN A  1 13  ? 126.986 128.132 65.826  1.00 19.91  ? 13  ASN A HA   1 
ATOM   245   H  HB2  . ASN A  1 13  ? 125.187 126.219 64.855  1.00 19.91  ? 13  ASN A HB2  1 
ATOM   246   H  HB3  . ASN A  1 13  ? 124.665 127.684 65.175  1.00 19.91  ? 13  ASN A HB3  1 
ATOM   247   H  HD21 . ASN A  1 13  ? 126.246 126.889 61.839  1.00 19.91  ? 13  ASN A HD21 1 
ATOM   248   H  HD22 . ASN A  1 13  ? 125.784 125.867 62.816  1.00 19.91  ? 13  ASN A HD22 1 
ATOM   249   N  N    . TYR A  1 14  ? 126.472 126.785 68.386  1.00 15.67  ? 14  TYR A N    1 
ATOM   250   C  CA   . TYR A  1 14  ? 125.861 126.715 69.704  1.00 15.67  ? 14  TYR A CA   1 
ATOM   251   C  C    . TYR A  1 14  ? 125.826 128.085 70.367  1.00 15.67  ? 14  TYR A C    1 
ATOM   252   O  O    . TYR A  1 14  ? 126.789 128.853 70.300  1.00 15.67  ? 14  TYR A O    1 
ATOM   253   C  CB   . TYR A  1 14  ? 126.631 125.729 70.575  1.00 15.67  ? 14  TYR A CB   1 
ATOM   254   C  CG   . TYR A  1 14  ? 125.866 125.199 71.759  1.00 15.67  ? 14  TYR A CG   1 
ATOM   255   C  CD1  . TYR A  1 14  ? 125.785 125.916 72.936  1.00 15.67  ? 14  TYR A CD1  1 
ATOM   256   C  CD2  . TYR A  1 14  ? 125.221 123.980 71.696  1.00 15.67  ? 14  TYR A CD2  1 
ATOM   257   C  CE1  . TYR A  1 14  ? 125.088 125.432 74.014  1.00 15.67  ? 14  TYR A CE1  1 
ATOM   258   C  CE2  . TYR A  1 14  ? 124.522 123.492 72.769  1.00 15.67  ? 14  TYR A CE2  1 
ATOM   259   C  CZ   . TYR A  1 14  ? 124.461 124.221 73.926  1.00 15.67  ? 14  TYR A CZ   1 
ATOM   260   O  OH   . TYR A  1 14  ? 123.758 123.735 74.999  1.00 15.67  ? 14  TYR A OH   1 
ATOM   261   H  H    . TYR A  1 14  ? 127.229 126.386 68.330  1.00 15.67  ? 14  TYR A H    1 
ATOM   262   H  HA   . TYR A  1 14  ? 124.952 126.400 69.617  1.00 15.67  ? 14  TYR A HA   1 
ATOM   263   H  HB2  . TYR A  1 14  ? 126.884 124.973 70.028  1.00 15.67  ? 14  TYR A HB2  1 
ATOM   264   H  HB3  . TYR A  1 14  ? 127.420 126.174 70.912  1.00 15.67  ? 14  TYR A HB3  1 
ATOM   265   H  HD1  . TYR A  1 14  ? 126.214 126.735 72.996  1.00 15.67  ? 14  TYR A HD1  1 
ATOM   266   H  HD2  . TYR A  1 14  ? 125.261 123.484 70.914  1.00 15.67  ? 14  TYR A HD2  1 
ATOM   267   H  HE1  . TYR A  1 14  ? 125.041 125.919 74.800  1.00 15.67  ? 14  TYR A HE1  1 
ATOM   268   H  HE2  . TYR A  1 14  ? 124.093 122.673 72.715  1.00 15.67  ? 14  TYR A HE2  1 
ATOM   269   H  HH   . TYR A  1 14  ? 123.322 124.358 75.351  1.00 15.67  ? 14  TYR A HH   1 
ATOM   270   N  N    . ASN A  1 15  ? 124.702 128.382 71.012  1.00 23.32  ? 15  ASN A N    1 
ATOM   271   C  CA   . ASN A  1 15  ? 124.506 129.604 71.764  1.00 23.32  ? 15  ASN A CA   1 
ATOM   272   C  C    . ASN A  1 15  ? 124.229 129.265 73.222  1.00 23.32  ? 15  ASN A C    1 
ATOM   273   O  O    . ASN A  1 15  ? 123.274 128.530 73.507  1.00 23.32  ? 15  ASN A O    1 
ATOM   274   C  CB   . ASN A  1 15  ? 123.341 130.406 71.188  1.00 23.32  ? 15  ASN A CB   1 
ATOM   275   C  CG   . ASN A  1 15  ? 123.452 131.881 71.471  1.00 23.32  ? 15  ASN A CG   1 
ATOM   276   O  OD1  . ASN A  1 15  ? 124.183 132.305 72.361  1.00 23.32  ? 15  ASN A OD1  1 
ATOM   277   N  ND2  . ASN A  1 15  ? 122.728 132.675 70.706  1.00 23.32  ? 15  ASN A ND2  1 
ATOM   278   H  H    . ASN A  1 15  ? 124.011 127.875 71.019  1.00 23.32  ? 15  ASN A H    1 
ATOM   279   H  HA   . ASN A  1 15  ? 125.304 130.142 71.703  1.00 23.32  ? 15  ASN A HA   1 
ATOM   280   H  HB2  . ASN A  1 15  ? 123.317 130.287 70.229  1.00 23.32  ? 15  ASN A HB2  1 
ATOM   281   H  HB3  . ASN A  1 15  ? 122.518 130.086 71.584  1.00 23.32  ? 15  ASN A HB3  1 
ATOM   282   H  HD21 . ASN A  1 15  ? 122.753 133.523 70.824  1.00 23.32  ? 15  ASN A HD21 1 
ATOM   283   H  HD22 . ASN A  1 15  ? 122.230 132.337 70.094  1.00 23.32  ? 15  ASN A HD22 1 
ATOM   284   N  N    . PRO A  1 16  ? 125.023 129.770 74.171  1.00 18.94  ? 16  PRO A N    1 
ATOM   285   C  CA   . PRO A  1 16  ? 124.802 129.417 75.577  1.00 18.94  ? 16  PRO A CA   1 
ATOM   286   C  C    . PRO A  1 16  ? 123.661 130.161 76.244  1.00 18.94  ? 16  PRO A C    1 
ATOM   287   O  O    . PRO A  1 16  ? 123.372 129.885 77.415  1.00 18.94  ? 16  PRO A O    1 
ATOM   288   C  CB   . PRO A  1 16  ? 126.139 129.770 76.230  1.00 18.94  ? 16  PRO A CB   1 
ATOM   289   C  CG   . PRO A  1 16  ? 126.687 130.828 75.402  1.00 18.94  ? 16  PRO A CG   1 
ATOM   290   C  CD   . PRO A  1 16  ? 126.242 130.573 74.002  1.00 18.94  ? 16  PRO A CD   1 
ATOM   291   H  HA   . PRO A  1 16  ? 124.648 128.468 75.655  1.00 18.94  ? 16  PRO A HA   1 
ATOM   292   H  HB2  . PRO A  1 16  ? 125.987 130.083 77.132  1.00 18.94  ? 16  PRO A HB2  1 
ATOM   293   H  HB3  . PRO A  1 16  ? 126.720 128.999 76.217  1.00 18.94  ? 16  PRO A HB3  1 
ATOM   294   H  HG2  . PRO A  1 16  ? 126.348 131.680 75.712  1.00 18.94  ? 16  PRO A HG2  1 
ATOM   295   H  HG3  . PRO A  1 16  ? 127.651 130.808 75.457  1.00 18.94  ? 16  PRO A HG3  1 
ATOM   296   H  HD2  . PRO A  1 16  ? 126.034 131.407 73.559  1.00 18.94  ? 16  PRO A HD2  1 
ATOM   297   H  HD3  . PRO A  1 16  ? 126.912 130.070 73.521  1.00 18.94  ? 16  PRO A HD3  1 
ATOM   298   N  N    . LEU A  1 17  ? 123.015 131.092 75.554  1.00 17.29  ? 17  LEU A N    1 
ATOM   299   C  CA   . LEU A  1 17  ? 121.851 131.782 76.083  1.00 17.29  ? 17  LEU A CA   1 
ATOM   300   C  C    . LEU A  1 17  ? 120.545 131.104 75.707  1.00 17.29  ? 17  LEU A C    1 
ATOM   301   O  O    . LEU A  1 17  ? 119.490 131.511 76.199  1.00 17.29  ? 17  LEU A O    1 
ATOM   302   C  CB   . LEU A  1 17  ? 121.818 133.219 75.575  1.00 17.29  ? 17  LEU A CB   1 
ATOM   303   C  CG   . LEU A  1 17  ? 123.082 134.056 75.694  1.00 17.29  ? 17  LEU A CG   1 
ATOM   304   C  CD1  . LEU A  1 17  ? 122.869 135.341 74.965  1.00 17.29  ? 17  LEU A CD1  1 
ATOM   305   C  CD2  . LEU A  1 17  ? 123.424 134.334 77.133  1.00 17.29  ? 17  LEU A CD2  1 
ATOM   306   H  H    . LEU A  1 17  ? 123.231 131.341 74.765  1.00 17.29  ? 17  LEU A H    1 
ATOM   307   H  HA   . LEU A  1 17  ? 121.904 131.808 77.047  1.00 17.29  ? 17  LEU A HA   1 
ATOM   308   H  HB2  . LEU A  1 17  ? 121.591 133.191 74.636  1.00 17.29  ? 17  LEU A HB2  1 
ATOM   309   H  HB3  . LEU A  1 17  ? 121.129 133.688 76.063  1.00 17.29  ? 17  LEU A HB3  1 
ATOM   310   H  HG   . LEU A  1 17  ? 123.818 133.586 75.282  1.00 17.29  ? 17  LEU A HG   1 
ATOM   311   H  HD11 . LEU A  1 17  ? 123.663 135.884 75.044  1.00 17.29  ? 17  LEU A HD11 1 
ATOM   312   H  HD12 . LEU A  1 17  ? 122.686 135.143 74.036  1.00 17.29  ? 17  LEU A HD12 1 
ATOM   313   H  HD13 . LEU A  1 17  ? 122.111 135.792 75.361  1.00 17.29  ? 17  LEU A HD13 1 
ATOM   314   H  HD21 . LEU A  1 17  ? 124.203 134.908 77.160  1.00 17.29  ? 17  LEU A HD21 1 
ATOM   315   H  HD22 . LEU A  1 17  ? 122.671 134.781 77.547  1.00 17.29  ? 17  LEU A HD22 1 
ATOM   316   H  HD23 . LEU A  1 17  ? 123.609 133.501 77.589  1.00 17.29  ? 17  LEU A HD23 1 
ATOM   317   N  N    . GLU A  1 18  ? 120.595 130.086 74.859  1.00 17.91  ? 18  GLU A N    1 
ATOM   318   C  CA   . GLU A  1 18  ? 119.411 129.454 74.304  1.00 17.91  ? 18  GLU A CA   1 
ATOM   319   C  C    . GLU A  1 18  ? 119.081 128.215 75.120  1.00 17.91  ? 18  GLU A C    1 
ATOM   320   O  O    . GLU A  1 18  ? 119.916 127.317 75.256  1.00 17.91  ? 18  GLU A O    1 
ATOM   321   C  CB   . GLU A  1 18  ? 119.643 129.094 72.838  1.00 17.91  ? 18  GLU A CB   1 
ATOM   322   C  CG   . GLU A  1 18  ? 118.571 128.234 72.201  1.00 17.91  ? 18  GLU A CG   1 
ATOM   323   C  CD   . GLU A  1 18  ? 119.048 127.539 70.949  1.00 17.91  ? 18  GLU A CD   1 
ATOM   324   O  OE1  . GLU A  1 18  ? 120.215 127.746 70.560  1.00 17.91  ? 18  GLU A OE1  1 
ATOM   325   O  OE2  . GLU A  1 18  ? 118.254 126.784 70.353  1.00 17.91  ? 18  GLU A OE2  1 
ATOM   326   H  H    . GLU A  1 18  ? 121.324 129.732 74.584  1.00 17.91  ? 18  GLU A H    1 
ATOM   327   H  HA   . GLU A  1 18  ? 118.663 130.062 74.358  1.00 17.91  ? 18  GLU A HA   1 
ATOM   328   H  HB2  . GLU A  1 18  ? 119.693 129.916 72.329  1.00 17.91  ? 18  GLU A HB2  1 
ATOM   329   H  HB3  . GLU A  1 18  ? 120.479 128.615 72.775  1.00 17.91  ? 18  GLU A HB3  1 
ATOM   330   H  HG2  . GLU A  1 18  ? 118.286 127.548 72.818  1.00 17.91  ? 18  GLU A HG2  1 
ATOM   331   H  HG3  . GLU A  1 18  ? 117.821 128.795 71.960  1.00 17.91  ? 18  GLU A HG3  1 
ATOM   332   N  N    . ARG A  1 19  ? 117.871 128.170 75.654  1.00 13.20  ? 19  ARG A N    1 
ATOM   333   C  CA   . ARG A  1 19  ? 117.415 126.978 76.341  1.00 13.20  ? 19  ARG A CA   1 
ATOM   334   C  C    . ARG A  1 19  ? 117.372 125.814 75.356  1.00 13.20  ? 19  ARG A C    1 
ATOM   335   O  O    . ARG A  1 19  ? 116.722 125.920 74.308  1.00 13.20  ? 19  ARG A O    1 
ATOM   336   C  CB   . ARG A  1 19  ? 116.042 127.216 76.953  1.00 13.20  ? 19  ARG A CB   1 
ATOM   337   C  CG   . ARG A  1 19  ? 115.692 126.266 78.060  1.00 13.20  ? 19  ARG A CG   1 
ATOM   338   C  CD   . ARG A  1 19  ? 114.432 126.688 78.763  1.00 13.20  ? 19  ARG A CD   1 
ATOM   339   N  NE   . ARG A  1 19  ? 113.246 126.126 78.128  1.00 13.20  ? 19  ARG A NE   1 
ATOM   340   C  CZ   . ARG A  1 19  ? 112.542 126.731 77.181  1.00 13.20  ? 19  ARG A CZ   1 
ATOM   341   N  NH1  . ARG A  1 19  ? 111.484 126.133 76.669  1.00 13.20  ? 19  ARG A NH1  1 
ATOM   342   N  NH2  . ARG A  1 19  ? 112.888 127.927 76.742  1.00 13.20  ? 19  ARG A NH2  1 
ATOM   343   H  H    . ARG A  1 19  ? 117.302 128.810 75.639  1.00 13.20  ? 19  ARG A H    1 
ATOM   344   H  HA   . ARG A  1 19  ? 118.025 126.780 77.058  1.00 13.20  ? 19  ARG A HA   1 
ATOM   345   H  HB2  . ARG A  1 19  ? 116.020 128.110 77.316  1.00 13.20  ? 19  ARG A HB2  1 
ATOM   346   H  HB3  . ARG A  1 19  ? 115.374 127.121 76.262  1.00 13.20  ? 19  ARG A HB3  1 
ATOM   347   H  HG2  . ARG A  1 19  ? 115.552 125.386 77.688  1.00 13.20  ? 19  ARG A HG2  1 
ATOM   348   H  HG3  . ARG A  1 19  ? 116.409 126.250 78.706  1.00 13.20  ? 19  ARG A HG3  1 
ATOM   349   H  HD2  . ARG A  1 19  ? 114.466 126.363 79.673  1.00 13.20  ? 19  ARG A HD2  1 
ATOM   350   H  HD3  . ARG A  1 19  ? 114.366 127.651 78.759  1.00 13.20  ? 19  ARG A HD3  1 
ATOM   351   H  HE   . ARG A  1 19  ? 112.997 125.341 78.363  1.00 13.20  ? 19  ARG A HE   1 
ATOM   352   H  HH11 . ARG A  1 19  ? 111.256 125.357 76.952  1.00 13.20  ? 19  ARG A HH11 1 
ATOM   353   H  HH12 . ARG A  1 19  ? 111.028 126.525 76.058  1.00 13.20  ? 19  ARG A HH12 1 
ATOM   354   H  HH21 . ARG A  1 19  ? 113.573 128.324 77.068  1.00 13.20  ? 19  ARG A HH21 1 
ATOM   355   H  HH22 . ARG A  1 19  ? 112.421 128.305 76.130  1.00 13.20  ? 19  ARG A HH22 1 
ATOM   356   N  N    . PRO A  1 20  ? 118.039 124.700 75.646  1.00 11.77  ? 20  PRO A N    1 
ATOM   357   C  CA   . PRO A  1 20  ? 118.213 123.636 74.642  1.00 11.77  ? 20  PRO A CA   1 
ATOM   358   C  C    . PRO A  1 20  ? 117.032 122.678 74.523  1.00 11.77  ? 20  PRO A C    1 
ATOM   359   O  O    . PRO A  1 20  ? 117.017 121.563 75.038  1.00 11.77  ? 20  PRO A O    1 
ATOM   360   C  CB   . PRO A  1 20  ? 119.463 122.918 75.145  1.00 11.77  ? 20  PRO A CB   1 
ATOM   361   C  CG   . PRO A  1 20  ? 119.384 123.068 76.600  1.00 11.77  ? 20  PRO A CG   1 
ATOM   362   C  CD   . PRO A  1 20  ? 118.795 124.401 76.871  1.00 11.77  ? 20  PRO A CD   1 
ATOM   363   H  HA   . PRO A  1 20  ? 118.401 124.020 73.776  1.00 11.77  ? 20  PRO A HA   1 
ATOM   364   H  HB2  . PRO A  1 20  ? 119.420 121.989 74.886  1.00 11.77  ? 20  PRO A HB2  1 
ATOM   365   H  HB3  . PRO A  1 20  ? 120.251 123.353 74.792  1.00 11.77  ? 20  PRO A HB3  1 
ATOM   366   H  HG2  . PRO A  1 20  ? 118.808 122.380 76.958  1.00 11.77  ? 20  PRO A HG2  1 
ATOM   367   H  HG3  . PRO A  1 20  ? 120.268 123.008 76.986  1.00 11.77  ? 20  PRO A HG3  1 
ATOM   368   H  HD2  . PRO A  1 20  ? 118.195 124.349 77.627  1.00 11.77  ? 20  PRO A HD2  1 
ATOM   369   H  HD3  . PRO A  1 20  ? 119.494 125.053 77.009  1.00 11.77  ? 20  PRO A HD3  1 
ATOM   370   N  N    . VAL A  1 21  ? 116.008 123.125 73.810  1.00 14.41  ? 21  VAL A N    1 
ATOM   371   C  CA   . VAL A  1 21  ? 114.834 122.318 73.522  1.00 14.41  ? 21  VAL A CA   1 
ATOM   372   C  C    . VAL A  1 21  ? 114.583 122.356 72.025  1.00 14.41  ? 21  VAL A C    1 
ATOM   373   O  O    . VAL A  1 21  ? 114.854 123.364 71.364  1.00 14.41  ? 21  VAL A O    1 
ATOM   374   C  CB   . VAL A  1 21  ? 113.596 122.810 74.294  1.00 14.41  ? 21  VAL A CB   1 
ATOM   375   C  CG1  . VAL A  1 21  ? 113.712 122.456 75.741  1.00 14.41  ? 21  VAL A CG1  1 
ATOM   376   C  CG2  . VAL A  1 21  ? 113.453 124.288 74.154  1.00 14.41  ? 21  VAL A CG2  1 
ATOM   377   H  H    . VAL A  1 21  ? 115.964 123.913 73.475  1.00 14.41  ? 21  VAL A H    1 
ATOM   378   H  HA   . VAL A  1 21  ? 115.006 121.402 73.777  1.00 14.41  ? 21  VAL A HA   1 
ATOM   379   H  HB   . VAL A  1 21  ? 112.801 122.389 73.939  1.00 14.41  ? 21  VAL A HB   1 
ATOM   380   H  HG11 . VAL A  1 21  ? 112.994 122.895 76.218  1.00 14.41  ? 21  VAL A HG11 1 
ATOM   381   H  HG12 . VAL A  1 21  ? 113.641 121.496 75.837  1.00 14.41  ? 21  VAL A HG12 1 
ATOM   382   H  HG13 . VAL A  1 21  ? 114.568 122.765 76.066  1.00 14.41  ? 21  VAL A HG13 1 
ATOM   383   H  HG21 . VAL A  1 21  ? 112.636 124.560 74.594  1.00 14.41  ? 21  VAL A HG21 1 
ATOM   384   H  HG22 . VAL A  1 21  ? 114.213 124.710 74.575  1.00 14.41  ? 21  VAL A HG22 1 
ATOM   385   H  HG23 . VAL A  1 21  ? 113.424 124.515 73.215  1.00 14.41  ? 21  VAL A HG23 1 
ATOM   386   N  N    . ALA A  1 22  ? 114.079 121.247 71.490  1.00 15.07  ? 22  ALA A N    1 
ATOM   387   C  CA   . ALA A  1 22  ? 113.726 121.204 70.078  1.00 15.07  ? 22  ALA A CA   1 
ATOM   388   C  C    . ALA A  1 22  ? 112.552 122.125 69.786  1.00 15.07  ? 22  ALA A C    1 
ATOM   389   O  O    . ALA A  1 22  ? 112.578 122.897 68.820  1.00 15.07  ? 22  ALA A O    1 
ATOM   390   C  CB   . ALA A  1 22  ? 113.400 119.772 69.674  1.00 15.07  ? 22  ALA A CB   1 
ATOM   391   H  H    . ALA A  1 22  ? 113.929 120.517 71.915  1.00 15.07  ? 22  ALA A H    1 
ATOM   392   H  HA   . ALA A  1 22  ? 114.479 121.503 69.553  1.00 15.07  ? 22  ALA A HA   1 
ATOM   393   H  HB1  . ALA A  1 22  ? 113.181 119.752 68.731  1.00 15.07  ? 22  ALA A HB1  1 
ATOM   394   H  HB2  . ALA A  1 22  ? 114.173 119.216 69.853  1.00 15.07  ? 22  ALA A HB2  1 
ATOM   395   H  HB3  . ALA A  1 22  ? 112.647 119.468 70.201  1.00 15.07  ? 22  ALA A HB3  1 
ATOM   396   N  N    . ASN A  1 23  ? 111.516 122.059 70.614  1.00 23.70  ? 23  ASN A N    1 
ATOM   397   C  CA   . ASN A  1 23  ? 110.338 122.903 70.487  1.00 23.70  ? 23  ASN A CA   1 
ATOM   398   C  C    . ASN A  1 23  ? 110.362 123.928 71.610  1.00 23.70  ? 23  ASN A C    1 
ATOM   399   O  O    . ASN A  1 23  ? 110.293 123.567 72.789  1.00 23.70  ? 23  ASN A O    1 
ATOM   400   C  CB   . ASN A  1 23  ? 109.066 122.062 70.538  1.00 23.70  ? 23  ASN A CB   1 
ATOM   401   C  CG   . ASN A  1 23  ? 107.857 122.804 70.032  1.00 23.70  ? 23  ASN A CG   1 
ATOM   402   O  OD1  . ASN A  1 23  ? 107.892 124.012 69.814  1.00 23.70  ? 23  ASN A OD1  1 
ATOM   403   N  ND2  . ASN A  1 23  ? 106.774 122.076 69.837  1.00 23.70  ? 23  ASN A ND2  1 
ATOM   404   H  H    . ASN A  1 23  ? 111.470 121.513 71.275  1.00 23.70  ? 23  ASN A H    1 
ATOM   405   H  HA   . ASN A  1 23  ? 110.358 123.373 69.643  1.00 23.70  ? 23  ASN A HA   1 
ATOM   406   H  HB2  . ASN A  1 23  ? 109.183 121.275 69.989  1.00 23.70  ? 23  ASN A HB2  1 
ATOM   407   H  HB3  . ASN A  1 23  ? 108.894 121.802 71.456  1.00 23.70  ? 23  ASN A HB3  1 
ATOM   408   N  N    . ASP A  1 24  ? 110.457 125.204 71.238  1.00 22.19  ? 24  ASP A N    1 
ATOM   409   C  CA   . ASP A  1 24  ? 110.599 126.266 72.224  1.00 22.19  ? 24  ASP A CA   1 
ATOM   410   C  C    . ASP A  1 24  ? 109.382 126.388 73.127  1.00 22.19  ? 24  ASP A C    1 
ATOM   411   O  O    . ASP A  1 24  ? 109.492 126.953 74.219  1.00 22.19  ? 24  ASP A O    1 
ATOM   412   C  CB   . ASP A  1 24  ? 110.854 127.592 71.517  1.00 22.19  ? 24  ASP A CB   1 
ATOM   413   C  CG   . ASP A  1 24  ? 112.144 127.594 70.730  1.00 22.19  ? 24  ASP A CG   1 
ATOM   414   O  OD1  . ASP A  1 24  ? 112.952 126.659 70.905  1.00 22.19  ? 24  ASP A OD1  1 
ATOM   415   O  OD2  . ASP A  1 24  ? 112.350 128.529 69.931  1.00 22.19  ? 24  ASP A OD2  1 
ATOM   416   H  H    . ASP A  1 24  ? 110.440 125.478 70.424  1.00 22.19  ? 24  ASP A H    1 
ATOM   417   H  HA   . ASP A  1 24  ? 111.364 126.074 72.781  1.00 22.19  ? 24  ASP A HA   1 
ATOM   418   H  HB2  . ASP A  1 24  ? 110.129 127.758 70.897  1.00 22.19  ? 24  ASP A HB2  1 
ATOM   419   H  HB3  . ASP A  1 24  ? 110.901 128.297 72.177  1.00 22.19  ? 24  ASP A HB3  1 
ATOM   420   N  N    . SER A  1 25  ? 108.226 125.886 72.695  1.00 20.55  ? 25  SER A N    1 
ATOM   421   C  CA   . SER A  1 25  ? 107.027 125.948 73.520  1.00 20.55  ? 25  SER A CA   1 
ATOM   422   C  C    . SER A  1 25  ? 107.034 124.908 74.630  1.00 20.55  ? 25  SER A C    1 
ATOM   423   O  O    . SER A  1 25  ? 106.500 125.165 75.714  1.00 20.55  ? 25  SER A O    1 
ATOM   424   C  CB   . SER A  1 25  ? 105.790 125.760 72.649  1.00 20.55  ? 25  SER A CB   1 
ATOM   425   O  OG   . SER A  1 25  ? 105.856 126.576 71.496  1.00 20.55  ? 25  SER A OG   1 
ATOM   426   H  H    . SER A  1 25  ? 108.109 125.513 71.933  1.00 20.55  ? 25  SER A H    1 
ATOM   427   H  HA   . SER A  1 25  ? 106.973 126.820 73.934  1.00 20.55  ? 25  SER A HA   1 
ATOM   428   H  HB2  . SER A  1 25  ? 105.741 124.832 72.379  1.00 20.55  ? 25  SER A HB2  1 
ATOM   429   H  HB3  . SER A  1 25  ? 105.007 125.998 73.166  1.00 20.55  ? 25  SER A HB3  1 
ATOM   430   H  HG   . SER A  1 25  ? 105.193 126.426 71.005  1.00 20.55  ? 25  SER A HG   1 
ATOM   431   N  N    . GLN A  1 26  ? 107.615 123.741 74.387  1.00 20.69  ? 26  GLN A N    1 
ATOM   432   C  CA   . GLN A  1 26  ? 107.624 122.708 75.404  1.00 20.69  ? 26  GLN A CA   1 
ATOM   433   C  C    . GLN A  1 26  ? 108.667 123.024 76.471  1.00 20.69  ? 26  GLN A C    1 
ATOM   434   O  O    . GLN A  1 26  ? 109.654 123.712 76.201  1.00 20.69  ? 26  GLN A O    1 
ATOM   435   C  CB   . GLN A  1 26  ? 107.916 121.346 74.785  1.00 20.69  ? 26  GLN A CB   1 
ATOM   436   C  CG   . GLN A  1 26  ? 106.926 120.899 73.717  1.00 20.69  ? 26  GLN A CG   1 
ATOM   437   C  CD   . GLN A  1 26  ? 105.481 121.144 74.105  1.00 20.69  ? 26  GLN A CD   1 
ATOM   438   O  OE1  . GLN A  1 26  ? 104.731 121.790 73.375  1.00 20.69  ? 26  GLN A OE1  1 
ATOM   439   N  NE2  . GLN A  1 26  ? 105.084 120.627 75.259  1.00 20.69  ? 26  GLN A NE2  1 
ATOM   440   H  H    . GLN A  1 26  ? 108.010 123.529 73.656  1.00 20.69  ? 26  GLN A H    1 
ATOM   441   H  HA   . GLN A  1 26  ? 106.756 122.682 75.826  1.00 20.69  ? 26  GLN A HA   1 
ATOM   442   H  HB2  . GLN A  1 26  ? 108.794 121.373 74.379  1.00 20.69  ? 26  GLN A HB2  1 
ATOM   443   H  HB3  . GLN A  1 26  ? 107.903 120.681 75.489  1.00 20.69  ? 26  GLN A HB3  1 
ATOM   444   H  HG2  . GLN A  1 26  ? 107.105 121.380 72.896  1.00 20.69  ? 26  GLN A HG2  1 
ATOM   445   H  HG3  . GLN A  1 26  ? 107.035 119.947 73.574  1.00 20.69  ? 26  GLN A HG3  1 
ATOM   446   H  HE21 . GLN A  1 26  ? 105.637 120.180 75.742  1.00 20.69  ? 26  GLN A HE21 1 
ATOM   447   H  HE22 . GLN A  1 26  ? 104.274 120.738 75.522  1.00 20.69  ? 26  GLN A HE22 1 
ATOM   448   N  N    . PRO A  1 27  ? 108.470 122.540 77.691  1.00 15.58  ? 27  PRO A N    1 
ATOM   449   C  CA   . PRO A  1 27  ? 109.410 122.846 78.768  1.00 15.58  ? 27  PRO A CA   1 
ATOM   450   C  C    . PRO A  1 27  ? 110.619 121.928 78.770  1.00 15.58  ? 27  PRO A C    1 
ATOM   451   O  O    . PRO A  1 27  ? 110.636 120.858 78.161  1.00 15.58  ? 27  PRO A O    1 
ATOM   452   C  CB   . PRO A  1 27  ? 108.571 122.639 80.030  1.00 15.58  ? 27  PRO A CB   1 
ATOM   453   C  CG   . PRO A  1 27  ? 107.583 121.644 79.648  1.00 15.58  ? 27  PRO A CG   1 
ATOM   454   C  CD   . PRO A  1 27  ? 107.264 121.875 78.205  1.00 15.58  ? 27  PRO A CD   1 
ATOM   455   H  HA   . PRO A  1 27  ? 109.704 123.765 78.713  1.00 15.58  ? 27  PRO A HA   1 
ATOM   456   H  HB2  . PRO A  1 27  ? 109.134 122.299 80.740  1.00 15.58  ? 27  PRO A HB2  1 
ATOM   457   H  HB3  . PRO A  1 27  ? 108.146 123.468 80.286  1.00 15.58  ? 27  PRO A HB3  1 
ATOM   458   H  HG2  . PRO A  1 27  ? 107.963 120.764 79.772  1.00 15.58  ? 27  PRO A HG2  1 
ATOM   459   H  HG3  . PRO A  1 27  ? 106.792 121.756 80.193  1.00 15.58  ? 27  PRO A HG3  1 
ATOM   460   H  HD2  . PRO A  1 27  ? 107.124 121.033 77.749  1.00 15.58  ? 27  PRO A HD2  1 
ATOM   461   H  HD3  . PRO A  1 27  ? 106.498 122.461 78.120  1.00 15.58  ? 27  PRO A HD3  1 
ATOM   462   N  N    . LEU A  1 28  ? 111.643 122.383 79.481  1.00 13.01  ? 28  LEU A N    1 
ATOM   463   C  CA   . LEU A  1 28  ? 112.846 121.606 79.729  1.00 13.01  ? 28  LEU A CA   1 
ATOM   464   C  C    . LEU A  1 28  ? 112.796 121.081 81.154  1.00 13.01  ? 28  LEU A C    1 
ATOM   465   O  O    . LEU A  1 28  ? 112.639 121.857 82.101  1.00 13.01  ? 28  LEU A O    1 
ATOM   466   C  CB   . LEU A  1 28  ? 114.093 122.454 79.512  1.00 13.01  ? 28  LEU A CB   1 
ATOM   467   C  CG   . LEU A  1 28  ? 115.418 121.726 79.645  1.00 13.01  ? 28  LEU A CG   1 
ATOM   468   C  CD1  . LEU A  1 28  ? 115.635 120.826 78.472  1.00 13.01  ? 28  LEU A CD1  1 
ATOM   469   C  CD2  . LEU A  1 28  ? 116.511 122.725 79.725  1.00 13.01  ? 28  LEU A CD2  1 
ATOM   470   H  H    . LEU A  1 28  ? 111.664 123.161 79.837  1.00 13.01  ? 28  LEU A H    1 
ATOM   471   H  HA   . LEU A  1 28  ? 112.880 120.851 79.127  1.00 13.01  ? 28  LEU A HA   1 
ATOM   472   H  HB2  . LEU A  1 28  ? 114.063 122.830 78.621  1.00 13.01  ? 28  LEU A HB2  1 
ATOM   473   H  HB3  . LEU A  1 28  ? 114.096 123.162 80.169  1.00 13.01  ? 28  LEU A HB3  1 
ATOM   474   H  HG   . LEU A  1 28  ? 115.422 121.201 80.454  1.00 13.01  ? 28  LEU A HG   1 
ATOM   475   H  HD11 . LEU A  1 28  ? 116.553 120.522 78.486  1.00 13.01  ? 28  LEU A HD11 1 
ATOM   476   H  HD12 . LEU A  1 28  ? 115.029 120.074 78.538  1.00 13.01  ? 28  LEU A HD12 1 
ATOM   477   H  HD13 . LEU A  1 28  ? 115.461 121.328 77.664  1.00 13.01  ? 28  LEU A HD13 1 
ATOM   478   H  HD21 . LEU A  1 28  ? 117.357 122.260 79.710  1.00 13.01  ? 28  LEU A HD21 1 
ATOM   479   H  HD22 . LEU A  1 28  ? 116.436 123.310 78.960  1.00 13.01  ? 28  LEU A HD22 1 
ATOM   480   H  HD23 . LEU A  1 28  ? 116.414 123.228 80.545  1.00 13.01  ? 28  LEU A HD23 1 
ATOM   481   N  N    . THR A  1 29  ? 112.928 119.771 81.301  1.00 15.21  ? 29  THR A N    1 
ATOM   482   C  CA   . THR A  1 29  ? 112.866 119.132 82.603  1.00 15.21  ? 29  THR A CA   1 
ATOM   483   C  C    . THR A  1 29  ? 114.245 119.135 83.246  1.00 15.21  ? 29  THR A C    1 
ATOM   484   O  O    . THR A  1 29  ? 115.234 118.751 82.616  1.00 15.21  ? 29  THR A O    1 
ATOM   485   C  CB   . THR A  1 29  ? 112.348 117.705 82.472  1.00 15.21  ? 29  THR A CB   1 
ATOM   486   O  OG1  . THR A  1 29  ? 111.066 117.718 81.837  1.00 15.21  ? 29  THR A OG1  1 
ATOM   487   C  CG2  . THR A  1 29  ? 112.215 117.074 83.825  1.00 15.21  ? 29  THR A CG2  1 
ATOM   488   H  H    . THR A  1 29  ? 113.050 119.223 80.653  1.00 15.21  ? 29  THR A H    1 
ATOM   489   H  HA   . THR A  1 29  ? 112.260 119.620 83.173  1.00 15.21  ? 29  THR A HA   1 
ATOM   490   H  HB   . THR A  1 29  ? 112.970 117.184 81.947  1.00 15.21  ? 29  THR A HB   1 
ATOM   491   H  HG1  . THR A  1 29  ? 110.752 116.940 81.821  1.00 15.21  ? 29  THR A HG1  1 
ATOM   492   H  HG21 . THR A  1 29  ? 111.844 116.185 83.738  1.00 15.21  ? 29  THR A HG21 1 
ATOM   493   H  HG22 . THR A  1 29  ? 113.081 117.015 84.248  1.00 15.21  ? 29  THR A HG22 1 
ATOM   494   H  HG23 . THR A  1 29  ? 111.631 117.612 84.377  1.00 15.21  ? 29  THR A HG23 1 
ATOM   495   N  N    . VAL A  1 30  ? 114.300 119.567 84.501  1.00 10.64  ? 30  VAL A N    1 
ATOM   496   C  CA   . VAL A  1 30  ? 115.530 119.625 85.276  1.00 10.64  ? 30  VAL A CA   1 
ATOM   497   C  C    . VAL A  1 30  ? 115.307 118.900 86.587  1.00 10.64  ? 30  VAL A C    1 
ATOM   498   O  O    . VAL A  1 30  ? 114.420 119.266 87.364  1.00 10.64  ? 30  VAL A O    1 
ATOM   499   C  CB   . VAL A  1 30  ? 115.991 121.070 85.516  1.00 10.64  ? 30  VAL A CB   1 
ATOM   500   C  CG1  . VAL A  1 30  ? 117.251 121.123 86.325  1.00 10.64  ? 30  VAL A CG1  1 
ATOM   501   C  CG2  . VAL A  1 30  ? 116.282 121.697 84.208  1.00 10.64  ? 30  VAL A CG2  1 
ATOM   502   H  H    . VAL A  1 30  ? 113.616 119.830 84.941  1.00 10.64  ? 30  VAL A H    1 
ATOM   503   H  HA   . VAL A  1 30  ? 116.223 119.161 84.795  1.00 10.64  ? 30  VAL A HA   1 
ATOM   504   H  HB   . VAL A  1 30  ? 115.300 121.570 85.969  1.00 10.64  ? 30  VAL A HB   1 
ATOM   505   H  HG11 . VAL A  1 30  ? 117.425 122.051 86.539  1.00 10.64  ? 30  VAL A HG11 1 
ATOM   506   H  HG12 . VAL A  1 30  ? 117.139 120.617 87.139  1.00 10.64  ? 30  VAL A HG12 1 
ATOM   507   H  HG13 . VAL A  1 30  ? 117.978 120.768 85.800  1.00 10.64  ? 30  VAL A HG13 1 
ATOM   508   H  HG21 . VAL A  1 30  ? 116.673 122.562 84.369  1.00 10.64  ? 30  VAL A HG21 1 
ATOM   509   H  HG22 . VAL A  1 30  ? 116.929 121.151 83.745  1.00 10.64  ? 30  VAL A HG22 1 
ATOM   510   H  HG23 . VAL A  1 30  ? 115.461 121.765 83.699  1.00 10.64  ? 30  VAL A HG23 1 
ATOM   511   N  N    . TYR A  1 31  ? 116.113 117.879 86.827  1.00 9.74   ? 31  TYR A N    1 
ATOM   512   C  CA   . TYR A  1 31  ? 116.088 117.108 88.054  1.00 9.74   ? 31  TYR A CA   1 
ATOM   513   C  C    . TYR A  1 31  ? 117.098 117.724 89.003  1.00 9.74   ? 31  TYR A C    1 
ATOM   514   O  O    . TYR A  1 31  ? 118.295 117.773 88.694  1.00 9.74   ? 31  TYR A O    1 
ATOM   515   C  CB   . TYR A  1 31  ? 116.427 115.657 87.751  1.00 9.74   ? 31  TYR A CB   1 
ATOM   516   C  CG   . TYR A  1 31  ? 115.443 115.026 86.812  1.00 9.74   ? 31  TYR A CG   1 
ATOM   517   C  CD1  . TYR A  1 31  ? 114.180 114.664 87.232  1.00 9.74   ? 31  TYR A CD1  1 
ATOM   518   C  CD2  . TYR A  1 31  ? 115.734 114.916 85.467  1.00 9.74   ? 31  TYR A CD2  1 
ATOM   519   C  CE1  . TYR A  1 31  ? 113.278 114.110 86.361  1.00 9.74   ? 31  TYR A CE1  1 
ATOM   520   C  CE2  . TYR A  1 31  ? 114.837 114.382 84.588  1.00 9.74   ? 31  TYR A CE2  1 
ATOM   521   C  CZ   . TYR A  1 31  ? 113.604 113.981 85.036  1.00 9.74   ? 31  TYR A CZ   1 
ATOM   522   O  OH   . TYR A  1 31  ? 112.701 113.446 84.145  1.00 9.74   ? 31  TYR A OH   1 
ATOM   523   H  H    . TYR A  1 31  ? 116.706 117.606 86.275  1.00 9.74   ? 31  TYR A H    1 
ATOM   524   H  HA   . TYR A  1 31  ? 115.214 117.147 88.457  1.00 9.74   ? 31  TYR A HA   1 
ATOM   525   H  HB2  . TYR A  1 31  ? 117.303 115.616 87.349  1.00 9.74   ? 31  TYR A HB2  1 
ATOM   526   H  HB3  . TYR A  1 31  ? 116.407 115.162 88.578  1.00 9.74   ? 31  TYR A HB3  1 
ATOM   527   H  HD1  . TYR A  1 31  ? 113.962 114.733 88.129  1.00 9.74   ? 31  TYR A HD1  1 
ATOM   528   H  HD2  . TYR A  1 31  ? 116.559 115.182 85.156  1.00 9.74   ? 31  TYR A HD2  1 
ATOM   529   H  HE1  . TYR A  1 31  ? 112.444 113.844 86.669  1.00 9.74   ? 31  TYR A HE1  1 
ATOM   530   H  HE2  . TYR A  1 31  ? 115.057 114.301 83.694  1.00 9.74   ? 31  TYR A HE2  1 
ATOM   531   H  HH   . TYR A  1 31  ? 113.092 113.309 83.418  1.00 9.74   ? 31  TYR A HH   1 
ATOM   532   N  N    . PHE A  1 32  ? 116.612 118.214 90.134  1.00 7.52   ? 32  PHE A N    1 
ATOM   533   C  CA   . PHE A  1 32  ? 117.427 118.911 91.109  1.00 7.52   ? 32  PHE A CA   1 
ATOM   534   C  C    . PHE A  1 32  ? 117.407 118.129 92.408  1.00 7.52   ? 32  PHE A C    1 
ATOM   535   O  O    . PHE A  1 32  ? 116.336 117.768 92.903  1.00 7.52   ? 32  PHE A O    1 
ATOM   536   C  CB   . PHE A  1 32  ? 116.926 120.334 91.346  1.00 7.52   ? 32  PHE A CB   1 
ATOM   537   C  CG   . PHE A  1 32  ? 117.678 121.057 92.410  1.00 7.52   ? 32  PHE A CG   1 
ATOM   538   C  CD1  . PHE A  1 32  ? 118.883 121.658 92.136  1.00 7.52   ? 32  PHE A CD1  1 
ATOM   539   C  CD2  . PHE A  1 32  ? 117.189 121.117 93.693  1.00 7.52   ? 32  PHE A CD2  1 
ATOM   540   C  CE1  . PHE A  1 32  ? 119.575 122.308 93.117  1.00 7.52   ? 32  PHE A CE1  1 
ATOM   541   C  CE2  . PHE A  1 32  ? 117.881 121.766 94.672  1.00 7.52   ? 32  PHE A CE2  1 
ATOM   542   C  CZ   . PHE A  1 32  ? 119.075 122.360 94.383  1.00 7.52   ? 32  PHE A CZ   1 
ATOM   543   H  H    . PHE A  1 32  ? 115.792 118.146 90.370  1.00 7.52   ? 32  PHE A H    1 
ATOM   544   H  HA   . PHE A  1 32  ? 118.335 118.952 90.793  1.00 7.52   ? 32  PHE A HA   1 
ATOM   545   H  HB2  . PHE A  1 32  ? 117.016 120.841 90.529  1.00 7.52   ? 32  PHE A HB2  1 
ATOM   546   H  HB3  . PHE A  1 32  ? 115.999 120.296 91.617  1.00 7.52   ? 32  PHE A HB3  1 
ATOM   547   H  HD1  . PHE A  1 32  ? 119.226 121.623 91.276  1.00 7.52   ? 32  PHE A HD1  1 
ATOM   548   H  HD2  . PHE A  1 32  ? 116.380 120.712 93.892  1.00 7.52   ? 32  PHE A HD2  1 
ATOM   549   H  HE1  . PHE A  1 32  ? 120.385 122.712 92.922  1.00 7.52   ? 32  PHE A HE1  1 
ATOM   550   H  HE2  . PHE A  1 32  ? 117.541 121.801 95.532  1.00 7.52   ? 32  PHE A HE2  1 
ATOM   551   H  HZ   . PHE A  1 32  ? 119.545 122.800 95.046  1.00 7.52   ? 32  PHE A HZ   1 
ATOM   552   N  N    . SER A  1 33  ? 118.589 117.879 92.955  1.00 7.91   ? 33  SER A N    1 
ATOM   553   C  CA   . SER A  1 33  ? 118.723 117.133 94.192  1.00 7.91   ? 33  SER A CA   1 
ATOM   554   C  C    . SER A  1 33  ? 119.818 117.788 95.015  1.00 7.91   ? 33  SER A C    1 
ATOM   555   O  O    . SER A  1 33  ? 120.240 118.913 94.742  1.00 7.91   ? 33  SER A O    1 
ATOM   556   C  CB   . SER A  1 33  ? 119.010 115.654 93.916  1.00 7.91   ? 33  SER A CB   1 
ATOM   557   O  OG   . SER A  1 33  ? 119.396 114.993 95.102  1.00 7.91   ? 33  SER A OG   1 
ATOM   558   H  H    . SER A  1 33  ? 119.335 118.144 92.631  1.00 7.91   ? 33  SER A H    1 
ATOM   559   H  HA   . SER A  1 33  ? 117.902 117.195 94.691  1.00 7.91   ? 33  SER A HA   1 
ATOM   560   H  HB2  . SER A  1 33  ? 118.206 115.243 93.574  1.00 7.91   ? 33  SER A HB2  1 
ATOM   561   H  HB3  . SER A  1 33  ? 119.723 115.583 93.267  1.00 7.91   ? 33  SER A HB3  1 
ATOM   562   H  HG   . SER A  1 33  ? 118.803 115.105 95.684  1.00 7.91   ? 33  SER A HG   1 
ATOM   563   N  N    . LEU A  1 34  ? 120.286 117.076 96.030  1.00 10.00  ? 34  LEU A N    1 
ATOM   564   C  CA   . LEU A  1 34  ? 121.203 117.666 96.985  1.00 10.00  ? 34  LEU A CA   1 
ATOM   565   C  C    . LEU A  1 34  ? 122.034 116.580 97.649  1.00 10.00  ? 34  LEU A C    1 
ATOM   566   O  O    . LEU A  1 34  ? 121.606 115.430 97.756  1.00 10.00  ? 34  LEU A O    1 
ATOM   567   C  CB   . LEU A  1 34  ? 120.420 118.450 98.031  1.00 10.00  ? 34  LEU A CB   1 
ATOM   568   C  CG   . LEU A  1 34  ? 121.215 119.233 99.046  1.00 10.00  ? 34  LEU A CG   1 
ATOM   569   C  CD1  . LEU A  1 34  ? 121.749 120.419 98.358  1.00 10.00  ? 34  LEU A CD1  1 
ATOM   570   C  CD2  . LEU A  1 34  ? 120.346 119.656 100.177 1.00 10.00  ? 34  LEU A CD2  1 
ATOM   571   H  H    . LEU A  1 34  ? 120.085 116.261 96.187  1.00 10.00  ? 34  LEU A H    1 
ATOM   572   H  HA   . LEU A  1 34  ? 121.793 118.275 96.528  1.00 10.00  ? 34  LEU A HA   1 
ATOM   573   H  HB2  . LEU A  1 34  ? 119.864 119.091 97.566  1.00 10.00  ? 34  LEU A HB2  1 
ATOM   574   H  HB3  . LEU A  1 34  ? 119.869 117.829 98.525  1.00 10.00  ? 34  LEU A HB3  1 
ATOM   575   H  HG   . LEU A  1 34  ? 121.938 118.694 99.387  1.00 10.00  ? 34  LEU A HG   1 
ATOM   576   H  HD11 . LEU A  1 34  ? 122.401 120.827 98.940  1.00 10.00  ? 34  LEU A HD11 1 
ATOM   577   H  HD12 . LEU A  1 34  ? 122.158 120.140 97.528  1.00 10.00  ? 34  LEU A HD12 1 
ATOM   578   H  HD13 . LEU A  1 34  ? 121.013 121.022 98.182  1.00 10.00  ? 34  LEU A HD13 1 
ATOM   579   H  HD21 . LEU A  1 34  ? 120.896 120.083 100.847 1.00 10.00  ? 34  LEU A HD21 1 
ATOM   580   H  HD22 . LEU A  1 34  ? 119.692 120.281 99.835  1.00 10.00  ? 34  LEU A HD22 1 
ATOM   581   H  HD23 . LEU A  1 34  ? 119.914 118.875 100.549 1.00 10.00  ? 34  LEU A HD23 1 
ATOM   582   N  N    . ASN A  1 35  ? 123.229 116.955 98.092  1.00 12.91  ? 35  ASN A N    1 
ATOM   583   C  CA   . ASN A  1 35  ? 123.972 116.153 99.052  1.00 12.91  ? 35  ASN A CA   1 
ATOM   584   C  C    . ASN A  1 35  ? 124.507 117.062 100.139 1.00 12.91  ? 35  ASN A C    1 
ATOM   585   O  O    . ASN A  1 35  ? 125.185 118.052 99.852  1.00 12.91  ? 35  ASN A O    1 
ATOM   586   C  CB   . ASN A  1 35  ? 125.134 115.384 98.435  1.00 12.91  ? 35  ASN A CB   1 
ATOM   587   C  CG   . ASN A  1 35  ? 125.808 114.471 99.454  1.00 12.91  ? 35  ASN A CG   1 
ATOM   588   O  OD1  . ASN A  1 35  ? 125.504 114.518 100.647 1.00 12.91  ? 35  ASN A OD1  1 
ATOM   589   N  ND2  . ASN A  1 35  ? 126.748 113.670 98.996  1.00 12.91  ? 35  ASN A ND2  1 
ATOM   590   H  H    . ASN A  1 35  ? 123.625 117.669 97.848  1.00 12.91  ? 35  ASN A H    1 
ATOM   591   H  HA   . ASN A  1 35  ? 123.373 115.518 99.457  1.00 12.91  ? 35  ASN A HA   1 
ATOM   592   H  HB2  . ASN A  1 35  ? 124.806 114.848 97.702  1.00 12.91  ? 35  ASN A HB2  1 
ATOM   593   H  HB3  . ASN A  1 35  ? 125.794 116.020 98.113  1.00 12.91  ? 35  ASN A HB3  1 
ATOM   594   H  HD21 . ASN A  1 35  ? 126.937 113.662 98.158  1.00 12.91  ? 35  ASN A HD21 1 
ATOM   595   H  HD22 . ASN A  1 35  ? 127.165 113.148 99.535  1.00 12.91  ? 35  ASN A HD22 1 
ATOM   596   N  N    . LEU A  1 36  ? 124.221 116.696 101.376 1.00 12.18  ? 36  LEU A N    1 
ATOM   597   C  CA   . LEU A  1 36  ? 124.757 117.357 102.548 1.00 12.18  ? 36  LEU A CA   1 
ATOM   598   C  C    . LEU A  1 36  ? 125.997 116.625 103.029 1.00 12.18  ? 36  LEU A C    1 
ATOM   599   O  O    . LEU A  1 36  ? 126.034 115.393 103.036 1.00 12.18  ? 36  LEU A O    1 
ATOM   600   C  CB   . LEU A  1 36  ? 123.694 117.378 103.639 1.00 12.18  ? 36  LEU A CB   1 
ATOM   601   C  CG   . LEU A  1 36  ? 123.960 118.162 104.908 1.00 12.18  ? 36  LEU A CG   1 
ATOM   602   C  CD1  . LEU A  1 36  ? 123.949 119.627 104.627 1.00 12.18  ? 36  LEU A CD1  1 
ATOM   603   C  CD2  . LEU A  1 36  ? 122.889 117.812 105.897 1.00 12.18  ? 36  LEU A CD2  1 
ATOM   604   H  H    . LEU A  1 36  ? 123.697 116.045 101.568 1.00 12.18  ? 36  LEU A H    1 
ATOM   605   H  HA   . LEU A  1 36  ? 124.997 118.264 102.330 1.00 12.18  ? 36  LEU A HA   1 
ATOM   606   H  HB2  . LEU A  1 36  ? 122.885 117.742 103.252 1.00 12.18  ? 36  LEU A HB2  1 
ATOM   607   H  HB3  . LEU A  1 36  ? 123.537 116.461 103.901 1.00 12.18  ? 36  LEU A HB3  1 
ATOM   608   H  HG   . LEU A  1 36  ? 124.821 117.914 105.269 1.00 12.18  ? 36  LEU A HG   1 
ATOM   609   H  HD11 . LEU A  1 36  ? 123.954 120.104 105.467 1.00 12.18  ? 36  LEU A HD11 1 
ATOM   610   H  HD12 . LEU A  1 36  ? 124.738 119.846 104.115 1.00 12.18  ? 36  LEU A HD12 1 
ATOM   611   H  HD13 . LEU A  1 36  ? 123.152 119.838 104.124 1.00 12.18  ? 36  LEU A HD13 1 
ATOM   612   H  HD21 . LEU A  1 36  ? 123.039 118.310 106.713 1.00 12.18  ? 36  LEU A HD21 1 
ATOM   613   H  HD22 . LEU A  1 36  ? 122.033 118.048 105.514 1.00 12.18  ? 36  LEU A HD22 1 
ATOM   614   H  HD23 . LEU A  1 36  ? 122.922 116.860 106.070 1.00 12.18  ? 36  LEU A HD23 1 
ATOM   615   N  N    . LEU A  1 37  ? 127.013 117.383 103.439 1.00 11.56  ? 37  LEU A N    1 
ATOM   616   C  CA   . LEU A  1 37  ? 128.226 116.775 103.964 1.00 11.56  ? 37  LEU A CA   1 
ATOM   617   C  C    . LEU A  1 37  ? 128.470 117.086 105.427 1.00 11.56  ? 37  LEU A C    1 
ATOM   618   O  O    . LEU A  1 37  ? 128.974 116.228 106.153 1.00 11.56  ? 37  LEU A O    1 
ATOM   619   C  CB   . LEU A  1 37  ? 129.439 117.210 103.148 1.00 11.56  ? 37  LEU A CB   1 
ATOM   620   C  CG   . LEU A  1 37  ? 129.351 117.062 101.637 1.00 11.56  ? 37  LEU A CG   1 
ATOM   621   C  CD1  . LEU A  1 37  ? 130.582 117.622 101.043 1.00 11.56  ? 37  LEU A CD1  1 
ATOM   622   C  CD2  . LEU A  1 37  ? 129.244 115.629 101.247 1.00 11.56  ? 37  LEU A CD2  1 
ATOM   623   H  H    . LEU A  1 37  ? 127.020 118.239 103.430 1.00 11.56  ? 37  LEU A H    1 
ATOM   624   H  HA   . LEU A  1 37  ? 128.150 115.818 103.881 1.00 11.56  ? 37  LEU A HA   1 
ATOM   625   H  HB2  . LEU A  1 37  ? 129.606 118.141 103.336 1.00 11.56  ? 37  LEU A HB2  1 
ATOM   626   H  HB3  . LEU A  1 37  ? 130.194 116.681 103.435 1.00 11.56  ? 37  LEU A HB3  1 
ATOM   627   H  HG   . LEU A  1 37  ? 128.585 117.539 101.294 1.00 11.56  ? 37  LEU A HG   1 
ATOM   628   H  HD11 . LEU A  1 37  ? 130.522 117.527 100.085 1.00 11.56  ? 37  LEU A HD11 1 
ATOM   629   H  HD12 . LEU A  1 37  ? 130.659 118.553 101.293 1.00 11.56  ? 37  LEU A HD12 1 
ATOM   630   H  HD13 . LEU A  1 37  ? 131.333 117.120 101.387 1.00 11.56  ? 37  LEU A HD13 1 
ATOM   631   H  HD21 . LEU A  1 37  ? 129.193 115.576 100.282 1.00 11.56  ? 37  LEU A HD21 1 
ATOM   632   H  HD22 . LEU A  1 37  ? 130.040 115.176 101.561 1.00 11.56  ? 37  LEU A HD22 1 
ATOM   633   H  HD23 . LEU A  1 37  ? 128.454 115.245 101.650 1.00 11.56  ? 37  LEU A HD23 1 
ATOM   634   N  N    . GLN A  1 38  ? 128.139 118.286 105.888 1.00 14.10  ? 38  GLN A N    1 
ATOM   635   C  CA   . GLN A  1 38  ? 128.183 118.549 107.315 1.00 14.10  ? 38  GLN A CA   1 
ATOM   636   C  C    . GLN A  1 38  ? 127.562 119.899 107.615 1.00 14.10  ? 38  GLN A C    1 
ATOM   637   O  O    . GLN A  1 38  ? 127.424 120.754 106.740 1.00 14.10  ? 38  GLN A O    1 
ATOM   638   C  CB   . GLN A  1 38  ? 129.609 118.495 107.862 1.00 14.10  ? 38  GLN A CB   1 
ATOM   639   C  CG   . GLN A  1 38  ? 130.599 119.389 107.173 1.00 14.10  ? 38  GLN A CG   1 
ATOM   640   C  CD   . GLN A  1 38  ? 131.907 119.463 107.927 1.00 14.10  ? 38  GLN A CD   1 
ATOM   641   O  OE1  . GLN A  1 38  ? 131.952 119.238 109.135 1.00 14.10  ? 38  GLN A OE1  1 
ATOM   642   N  NE2  . GLN A  1 38  ? 132.984 119.756 107.218 1.00 14.10  ? 38  GLN A NE2  1 
ATOM   643   H  H    . GLN A  1 38  ? 127.901 118.955 105.408 1.00 14.10  ? 38  GLN A H    1 
ATOM   644   H  HA   . GLN A  1 38  ? 127.657 117.879 107.769 1.00 14.10  ? 38  GLN A HA   1 
ATOM   645   H  HB2  . GLN A  1 38  ? 129.584 118.760 108.794 1.00 14.10  ? 38  GLN A HB2  1 
ATOM   646   H  HB3  . GLN A  1 38  ? 129.937 117.592 107.781 1.00 14.10  ? 38  GLN A HB3  1 
ATOM   647   H  HG2  . GLN A  1 38  ? 130.781 119.032 106.293 1.00 14.10  ? 38  GLN A HG2  1 
ATOM   648   H  HG3  . GLN A  1 38  ? 130.231 120.281 107.101 1.00 14.10  ? 38  GLN A HG3  1 
ATOM   649   H  HE21 . GLN A  1 38  ? 132.916 119.900 106.375 1.00 14.10  ? 38  GLN A HE21 1 
ATOM   650   H  HE22 . GLN A  1 38  ? 133.749 119.806 107.605 1.00 14.10  ? 38  GLN A HE22 1 
ATOM   651   N  N    . ILE A  1 39  ? 127.186 120.066 108.876 1.00 15.86  ? 39  ILE A N    1 
ATOM   652   C  CA   . ILE A  1 39  ? 126.779 121.356 109.405 1.00 15.86  ? 39  ILE A CA   1 
ATOM   653   C  C    . ILE A  1 39  ? 128.013 122.061 109.936 1.00 15.86  ? 39  ILE A C    1 
ATOM   654   O  O    . ILE A  1 39  ? 128.800 121.499 110.703 1.00 15.86  ? 39  ILE A O    1 
ATOM   655   C  CB   . ILE A  1 39  ? 125.709 121.209 110.496 1.00 15.86  ? 39  ILE A CB   1 
ATOM   656   C  CG1  . ILE A  1 39  ? 124.566 120.318 110.017 1.00 15.86  ? 39  ILE A CG1  1 
ATOM   657   C  CG2  . ILE A  1 39  ? 125.159 122.562 110.865 1.00 15.86  ? 39  ILE A CG2  1 
ATOM   658   C  CD1  . ILE A  1 39  ? 124.067 120.641 108.649 1.00 15.86  ? 39  ILE A CD1  1 
ATOM   659   H  H    . ILE A  1 39  ? 127.162 119.433 109.455 1.00 15.86  ? 39  ILE A H    1 
ATOM   660   H  HA   . ILE A  1 39  ? 126.425 121.899 108.693 1.00 15.86  ? 39  ILE A HA   1 
ATOM   661   H  HB   . ILE A  1 39  ? 126.106 120.814 111.285 1.00 15.86  ? 39  ILE A HB   1 
ATOM   662   H  HG12 . ILE A  1 39  ? 124.864 119.399 110.006 1.00 15.86  ? 39  ILE A HG12 1 
ATOM   663   H  HG13 . ILE A  1 39  ? 123.819 120.418 110.625 1.00 15.86  ? 39  ILE A HG13 1 
ATOM   664   H  HG21 . ILE A  1 39  ? 124.454 122.453 111.516 1.00 15.86  ? 39  ILE A HG21 1 
ATOM   665   H  HG22 . ILE A  1 39  ? 125.870 123.105 111.232 1.00 15.86  ? 39  ILE A HG22 1 
ATOM   666   H  HG23 . ILE A  1 39  ? 124.812 122.976 110.063 1.00 15.86  ? 39  ILE A HG23 1 
ATOM   667   H  HD11 . ILE A  1 39  ? 123.298 120.084 108.464 1.00 15.86  ? 39  ILE A HD11 1 
ATOM   668   H  HD12 . ILE A  1 39  ? 123.815 121.573 108.620 1.00 15.86  ? 39  ILE A HD12 1 
ATOM   669   H  HD13 . ILE A  1 39  ? 124.767 120.463 108.006 1.00 15.86  ? 39  ILE A HD13 1 
ATOM   670   N  N    . MET A  1 40  ? 128.171 123.302 109.519 1.00 13.72  ? 40  MET A N    1 
ATOM   671   C  CA   . MET A  1 40  ? 129.366 124.104 109.700 1.00 13.72  ? 40  MET A CA   1 
ATOM   672   C  C    . MET A  1 40  ? 129.188 125.183 110.745 1.00 13.72  ? 40  MET A C    1 
ATOM   673   O  O    . MET A  1 40  ? 130.134 125.474 111.484 1.00 13.72  ? 40  MET A O    1 
ATOM   674   C  CB   . MET A  1 40  ? 129.719 124.730 108.364 1.00 13.72  ? 40  MET A CB   1 
ATOM   675   C  CG   . MET A  1 40  ? 130.139 123.729 107.344 1.00 13.72  ? 40  MET A CG   1 
ATOM   676   S  SD   . MET A  1 40  ? 131.068 124.520 106.019 1.00 13.72  ? 40  MET A SD   1 
ATOM   677   C  CE   . MET A  1 40  ? 132.723 124.409 106.624 1.00 13.72  ? 40  MET A CE   1 
ATOM   678   H  H    . MET A  1 40  ? 127.560 123.720 109.099 1.00 13.72  ? 40  MET A H    1 
ATOM   679   H  HA   . MET A  1 40  ? 130.105 123.535 109.955 1.00 13.72  ? 40  MET A HA   1 
ATOM   680   H  HB2  . MET A  1 40  ? 128.960 125.233 108.021 1.00 13.72  ? 40  MET A HB2  1 
ATOM   681   H  HB3  . MET A  1 40  ? 130.474 125.319 108.491 1.00 13.72  ? 40  MET A HB3  1 
ATOM   682   H  HG2  . MET A  1 40  ? 130.767 123.134 107.799 1.00 13.72  ? 40  MET A HG2  1 
ATOM   683   H  HG3  . MET A  1 40  ? 129.383 123.207 107.037 1.00 13.72  ? 40  MET A HG3  1 
ATOM   684   H  HE1  . MET A  1 40  ? 133.380 124.733 105.963 1.00 13.72  ? 40  MET A HE1  1 
ATOM   685   H  HE2  . MET A  1 40  ? 132.678 125.153 107.252 1.00 13.72  ? 40  MET A HE2  1 
ATOM   686   H  HE3  . MET A  1 40  ? 132.924 123.508 106.955 1.00 13.72  ? 40  MET A HE3  1 
ATOM   687   N  N    . ASP A  1 41  ? 128.006 125.784 110.825 1.00 16.89  ? 41  ASP A N    1 
ATOM   688   C  CA   . ASP A  1 41  ? 127.770 126.767 111.866 1.00 16.89  ? 41  ASP A CA   1 
ATOM   689   C  C    . ASP A  1 41  ? 126.290 127.086 111.940 1.00 16.89  ? 41  ASP A C    1 
ATOM   690   O  O    . ASP A  1 41  ? 125.565 126.980 110.949 1.00 16.89  ? 41  ASP A O    1 
ATOM   691   C  CB   . ASP A  1 41  ? 128.564 128.054 111.619 1.00 16.89  ? 41  ASP A CB   1 
ATOM   692   C  CG   . ASP A  1 41  ? 128.959 128.754 112.902 1.00 16.89  ? 41  ASP A CG   1 
ATOM   693   O  OD1  . ASP A  1 41  ? 128.425 128.393 113.969 1.00 16.89  ? 41  ASP A OD1  1 
ATOM   694   O  OD2  . ASP A  1 41  ? 129.808 129.667 112.841 1.00 16.89  ? 41  ASP A OD2  1 
ATOM   695   H  H    . ASP A  1 41  ? 127.342 125.631 110.307 1.00 16.89  ? 41  ASP A H    1 
ATOM   696   H  HA   . ASP A  1 41  ? 128.047 126.399 112.714 1.00 16.89  ? 41  ASP A HA   1 
ATOM   697   H  HB2  . ASP A  1 41  ? 129.376 127.837 111.138 1.00 16.89  ? 41  ASP A HB2  1 
ATOM   698   H  HB3  . ASP A  1 41  ? 128.016 128.661 111.103 1.00 16.89  ? 41  ASP A HB3  1 
ATOM   699   N  N    . VAL A  1 42  ? 125.743 127.352 113.134 1.00 24.62  ? 42  VAL A N    1 
ATOM   700   C  CA   . VAL A  1 42  ? 124.297 127.696 113.328 1.00 24.62  ? 42  VAL A CA   1 
ATOM   701   C  C    . VAL A  1 42  ? 124.240 128.956 114.196 1.00 24.62  ? 42  VAL A C    1 
ATOM   702   O  O    . VAL A  1 42  ? 123.868 128.840 115.372 1.00 24.62  ? 42  VAL A O    1 
ATOM   703   C  CB   . VAL A  1 42  ? 123.484 126.526 113.920 1.00 24.62  ? 42  VAL A CB   1 
ATOM   704   C  CG1  . VAL A  1 42  ? 121.983 126.783 113.864 1.00 24.62  ? 42  VAL A CG1  1 
ATOM   705   C  CG2  . VAL A  1 42  ? 123.808 125.205 113.238 1.00 24.62  ? 42  VAL A CG2  1 
ATOM   706   H  H    . VAL A  1 42  ? 126.211 127.324 113.919 1.00 24.62  ? 42  VAL A H    1 
ATOM   707   H  HA   . VAL A  1 42  ? 123.913 127.918 112.463 1.00 24.62  ? 42  VAL A HA   1 
ATOM   708   H  HB   . VAL A  1 42  ? 123.739 126.432 114.871 1.00 24.62  ? 42  VAL A HB   1 
ATOM   709   H  HG11 . VAL A  1 42  ? 121.521 126.129 114.418 1.00 24.62  ? 42  VAL A HG11 1 
ATOM   710   H  HG12 . VAL A  1 42  ? 121.786 127.677 114.192 1.00 24.62  ? 42  VAL A HG12 1 
ATOM   711   H  HG13 . VAL A  1 42  ? 121.674 126.703 112.944 1.00 24.62  ? 42  VAL A HG13 1 
ATOM   712   H  HG21 . VAL A  1 42  ? 123.154 124.535 113.500 1.00 24.62  ? 42  VAL A HG21 1 
ATOM   713   H  HG22 . VAL A  1 42  ? 123.780 125.321 112.273 1.00 24.62  ? 42  VAL A HG22 1 
ATOM   714   H  HG23 . VAL A  1 42  ? 124.696 124.909 113.503 1.00 24.62  ? 42  VAL A HG23 1 
ATOM   715   N  N    . ASP A  1 43  ? 124.589 130.117 113.638 1.00 33.75  ? 43  ASP A N    1 
ATOM   716   C  CA   . ASP A  1 43  ? 124.629 131.410 114.373 1.00 33.75  ? 43  ASP A CA   1 
ATOM   717   C  C    . ASP A  1 43  ? 123.213 131.848 114.749 1.00 33.75  ? 43  ASP A C    1 
ATOM   718   O  O    . ASP A  1 43  ? 122.310 131.628 113.931 1.00 33.75  ? 43  ASP A O    1 
ATOM   719   C  CB   . ASP A  1 43  ? 125.313 132.485 113.521 1.00 33.75  ? 43  ASP A CB   1 
ATOM   720   C  CG   . ASP A  1 43  ? 125.903 133.658 114.285 1.00 33.75  ? 43  ASP A CG   1 
ATOM   721   O  OD1  . ASP A  1 43  ? 126.042 133.562 115.519 1.00 33.75  ? 43  ASP A OD1  1 
ATOM   722   O  OD2  . ASP A  1 43  ? 126.240 134.659 113.627 1.00 33.75  ? 43  ASP A OD2  1 
ATOM   723   H  H    . ASP A  1 43  ? 124.782 130.190 112.750 1.00 33.75  ? 43  ASP A H    1 
ATOM   724   H  HA   . ASP A  1 43  ? 125.151 131.273 115.196 1.00 33.75  ? 43  ASP A HA   1 
ATOM   725   H  HB2  . ASP A  1 43  ? 126.040 132.072 113.011 1.00 33.75  ? 43  ASP A HB2  1 
ATOM   726   H  HB3  . ASP A  1 43  ? 124.660 132.840 112.883 1.00 33.75  ? 43  ASP A HB3  1 
ATOM   727   N  N    . GLU A  1 44  ? 123.014 132.416 115.942 1.00 47.09  ? 44  GLU A N    1 
ATOM   728   C  CA   . GLU A  1 44  ? 121.703 132.965 116.386 1.00 47.09  ? 44  GLU A CA   1 
ATOM   729   C  C    . GLU A  1 44  ? 121.794 134.496 116.428 1.00 47.09  ? 44  GLU A C    1 
ATOM   730   O  O    . GLU A  1 44  ? 120.727 135.129 116.494 1.00 47.09  ? 44  GLU A O    1 
ATOM   731   C  CB   . GLU A  1 44  ? 121.316 132.405 117.754 1.00 47.09  ? 44  GLU A CB   1 
ATOM   732   C  CG   . GLU A  1 44  ? 121.474 130.898 117.882 1.00 47.09  ? 44  GLU A CG   1 
ATOM   733   C  CD   . GLU A  1 44  ? 122.787 130.374 118.442 1.00 47.09  ? 44  GLU A CD   1 
ATOM   734   O  OE1  . GLU A  1 44  ? 123.661 131.190 118.791 1.00 47.09  ? 44  GLU A OE1  1 
ATOM   735   O  OE2  . GLU A  1 44  ? 122.929 129.140 118.530 1.00 47.09  ? 44  GLU A OE2  1 
ATOM   736   H  H    . GLU A  1 44  ? 123.661 132.441 116.582 1.00 47.09  ? 44  GLU A H    1 
ATOM   737   H  HA   . GLU A  1 44  ? 121.011 132.710 115.734 1.00 47.09  ? 44  GLU A HA   1 
ATOM   738   H  HB2  . GLU A  1 44  ? 121.855 132.851 118.439 1.00 47.09  ? 44  GLU A HB2  1 
ATOM   739   H  HB3  . GLU A  1 44  ? 120.378 132.633 117.923 1.00 47.09  ? 44  GLU A HB3  1 
ATOM   740   H  HG2  . GLU A  1 44  ? 120.753 130.563 118.455 1.00 47.09  ? 44  GLU A HG2  1 
ATOM   741   H  HG3  . GLU A  1 44  ? 121.347 130.498 116.995 1.00 47.09  ? 44  GLU A HG3  1 
ATOM   742   N  N    . LYS A  1 45  ? 122.999 135.073 116.381 1.00 45.76  ? 45  LYS A N    1 
ATOM   743   C  CA   . LYS A  1 45  ? 123.240 136.538 116.398 1.00 45.76  ? 45  LYS A CA   1 
ATOM   744   C  C    . LYS A  1 45  ? 122.824 137.161 115.061 1.00 45.76  ? 45  LYS A C    1 
ATOM   745   O  O    . LYS A  1 45  ? 122.063 138.142 115.085 1.00 45.76  ? 45  LYS A O    1 
ATOM   746   C  CB   . LYS A  1 45  ? 124.715 136.794 116.712 1.00 45.76  ? 45  LYS A CB   1 
ATOM   747   C  CG   . LYS A  1 45  ? 125.095 138.251 116.915 1.00 45.76  ? 45  LYS A CG   1 
ATOM   748   C  CD   . LYS A  1 45  ? 124.431 138.884 118.109 1.00 45.76  ? 45  LYS A CD   1 
ATOM   749   C  CE   . LYS A  1 45  ? 124.764 140.353 118.241 1.00 45.76  ? 45  LYS A CE   1 
ATOM   750   N  NZ   . LYS A  1 45  ? 123.631 141.117 118.809 1.00 45.76  ? 45  LYS A NZ   1 
ATOM   751   H  H    . LYS A  1 45  ? 123.763 134.588 116.310 1.00 45.76  ? 45  LYS A H    1 
ATOM   752   H  HA   . LYS A  1 45  ? 122.690 136.933 117.114 1.00 45.76  ? 45  LYS A HA   1 
ATOM   753   H  HB2  . LYS A  1 45  ? 124.947 136.297 117.524 1.00 45.76  ? 45  LYS A HB2  1 
ATOM   754   H  HB3  . LYS A  1 45  ? 125.253 136.432 115.978 1.00 45.76  ? 45  LYS A HB3  1 
ATOM   755   H  HG2  . LYS A  1 45  ? 126.069 138.312 117.023 1.00 45.76  ? 45  LYS A HG2  1 
ATOM   756   H  HG3  . LYS A  1 45  ? 124.851 138.756 116.110 1.00 45.76  ? 45  LYS A HG3  1 
ATOM   757   H  HD2  . LYS A  1 45  ? 123.458 138.783 118.027 1.00 45.76  ? 45  LYS A HD2  1 
ATOM   758   H  HD3  . LYS A  1 45  ? 124.718 138.417 118.922 1.00 45.76  ? 45  LYS A HD3  1 
ATOM   759   H  HE2  . LYS A  1 45  ? 125.543 140.461 118.819 1.00 45.76  ? 45  LYS A HE2  1 
ATOM   760   H  HE3  . LYS A  1 45  ? 124.986 140.718 117.363 1.00 45.76  ? 45  LYS A HE3  1 
ATOM   761   H  HZ1  . LYS A  1 45  ? 123.818 142.004 118.789 1.00 45.76  ? 45  LYS A HZ1  1 
ATOM   762   H  HZ2  . LYS A  1 45  ? 122.881 140.960 118.324 1.00 45.76  ? 45  LYS A HZ2  1 
ATOM   763   H  HZ3  . LYS A  1 45  ? 123.488 140.862 119.667 1.00 45.76  ? 45  LYS A HZ3  1 
ATOM   764   N  N    . ASN A  1 46  ? 123.242 136.555 113.947 1.00 30.68  ? 46  ASN A N    1 
ATOM   765   C  CA   . ASN A  1 46  ? 122.944 136.974 112.549 1.00 30.68  ? 46  ASN A CA   1 
ATOM   766   C  C    . ASN A  1 46  ? 121.826 136.152 111.887 1.00 30.68  ? 46  ASN A C    1 
ATOM   767   O  O    . ASN A  1 46  ? 121.487 136.493 110.760 1.00 30.68  ? 46  ASN A O    1 
ATOM   768   C  CB   . ASN A  1 46  ? 124.160 136.776 111.647 1.00 30.68  ? 46  ASN A CB   1 
ATOM   769   C  CG   . ASN A  1 46  ? 125.238 137.817 111.823 1.00 30.68  ? 46  ASN A CG   1 
ATOM   770   O  OD1  . ASN A  1 46  ? 126.327 137.513 112.298 1.00 30.68  ? 46  ASN A OD1  1 
ATOM   771   N  ND2  . ASN A  1 46  ? 124.955 139.038 111.410 1.00 30.68  ? 46  ASN A ND2  1 
ATOM   772   H  H    . ASN A  1 46  ? 123.792 135.827 113.986 1.00 30.68  ? 46  ASN A H    1 
ATOM   773   H  HA   . ASN A  1 46  ? 122.699 137.929 112.541 1.00 30.68  ? 46  ASN A HA   1 
ATOM   774   H  HB2  . ASN A  1 46  ? 124.542 135.893 111.828 1.00 30.68  ? 46  ASN A HB2  1 
ATOM   775   H  HB3  . ASN A  1 46  ? 123.862 136.786 110.714 1.00 30.68  ? 46  ASN A HB3  1 
ATOM   776   H  HD21 . ASN A  1 46  ? 125.540 139.691 111.524 1.00 30.68  ? 46  ASN A HD21 1 
ATOM   777   H  HD22 . ASN A  1 46  ? 124.180 139.204 111.018 1.00 30.68  ? 46  ASN A HD22 1 
ATOM   778   N  N    . GLN A  1 47  ? 121.338 135.095 112.542 1.00 29.84  ? 47  GLN A N    1 
ATOM   779   C  CA   . GLN A  1 47  ? 120.355 134.125 112.091 1.00 29.84  ? 47  GLN A CA   1 
ATOM   780   C  C    . GLN A  1 47  ? 120.767 133.542 110.742 1.00 29.84  ? 47  GLN A C    1 
ATOM   781   O  O    . GLN A  1 47  ? 120.094 133.707 109.726 1.00 29.84  ? 47  GLN A O    1 
ATOM   782   C  CB   . GLN A  1 47  ? 118.966 134.756 112.039 1.00 29.84  ? 47  GLN A CB   1 
ATOM   783   C  CG   . GLN A  1 47  ? 118.429 135.054 113.412 1.00 29.84  ? 47  GLN A CG   1 
ATOM   784   C  CD   . GLN A  1 47  ? 116.959 135.348 113.420 1.00 29.84  ? 47  GLN A CD   1 
ATOM   785   O  OE1  . GLN A  1 47  ? 116.451 136.106 112.600 1.00 29.84  ? 47  GLN A OE1  1 
ATOM   786   N  NE2  . GLN A  1 47  ? 116.258 134.748 114.370 1.00 29.84  ? 47  GLN A NE2  1 
ATOM   787   H  H    . GLN A  1 47  ? 121.717 134.877 113.281 1.00 29.84  ? 47  GLN A H    1 
ATOM   788   H  HA   . GLN A  1 47  ? 120.327 133.403 112.733 1.00 29.84  ? 47  GLN A HA   1 
ATOM   789   H  HB2  . GLN A  1 47  ? 118.994 135.582 111.542 1.00 29.84  ? 47  GLN A HB2  1 
ATOM   790   H  HB3  . GLN A  1 47  ? 118.363 134.130 111.606 1.00 29.84  ? 47  GLN A HB3  1 
ATOM   791   H  HG2  . GLN A  1 47  ? 118.578 134.282 113.976 1.00 29.84  ? 47  GLN A HG2  1 
ATOM   792   H  HG3  . GLN A  1 47  ? 118.888 135.824 113.769 1.00 29.84  ? 47  GLN A HG3  1 
ATOM   793   H  HE21 . GLN A  1 47  ? 116.650 134.226 114.926 1.00 29.84  ? 47  GLN A HE21 1 
ATOM   794   H  HE22 . GLN A  1 47  ? 115.419 134.884 114.423 1.00 29.84  ? 47  GLN A HE22 1 
ATOM   795   N  N    . VAL A  1 48  ? 121.902 132.847 110.760 1.00 17.52  ? 48  VAL A N    1 
ATOM   796   C  CA   . VAL A  1 48  ? 122.518 132.302 109.558 1.00 17.52  ? 48  VAL A CA   1 
ATOM   797   C  C    . VAL A  1 48  ? 122.936 130.861 109.812 1.00 17.52  ? 48  VAL A C    1 
ATOM   798   O  O    . VAL A  1 48  ? 123.556 130.558 110.834 1.00 17.52  ? 48  VAL A O    1 
ATOM   799   C  CB   . VAL A  1 48  ? 123.725 133.148 109.111 1.00 17.52  ? 48  VAL A CB   1 
ATOM   800   C  CG1  . VAL A  1 48  ? 124.567 132.401 108.122 1.00 17.52  ? 48  VAL A CG1  1 
ATOM   801   C  CG2  . VAL A  1 48  ? 123.255 134.431 108.488 1.00 17.52  ? 48  VAL A CG2  1 
ATOM   802   H  H    . VAL A  1 48  ? 122.343 132.671 111.474 1.00 17.52  ? 48  VAL A H    1 
ATOM   803   H  HA   . VAL A  1 48  ? 121.871 132.304 108.843 1.00 17.52  ? 48  VAL A HA   1 
ATOM   804   H  HB   . VAL A  1 48  ? 124.274 133.362 109.876 1.00 17.52  ? 48  VAL A HB   1 
ATOM   805   H  HG11 . VAL A  1 48  ? 125.107 133.041 107.634 1.00 17.52  ? 48  VAL A HG11 1 
ATOM   806   H  HG12 . VAL A  1 48  ? 125.142 131.781 108.595 1.00 17.52  ? 48  VAL A HG12 1 
ATOM   807   H  HG13 . VAL A  1 48  ? 123.986 131.930 107.510 1.00 17.52  ? 48  VAL A HG13 1 
ATOM   808   H  HG21 . VAL A  1 48  ? 124.026 134.987 108.298 1.00 17.52  ? 48  VAL A HG21 1 
ATOM   809   H  HG22 . VAL A  1 48  ? 122.792 134.221 107.665 1.00 17.52  ? 48  VAL A HG22 1 
ATOM   810   H  HG23 . VAL A  1 48  ? 122.658 134.879 109.103 1.00 17.52  ? 48  VAL A HG23 1 
ATOM   811   N  N    . LEU A  1 49  ? 122.609 129.984 108.873 1.00 13.75  ? 49  LEU A N    1 
ATOM   812   C  CA   . LEU A  1 49  ? 123.011 128.586 108.893 1.00 13.75  ? 49  LEU A CA   1 
ATOM   813   C  C    . LEU A  1 49  ? 124.065 128.379 107.819 1.00 13.75  ? 49  LEU A C    1 
ATOM   814   O  O    . LEU A  1 49  ? 123.828 128.693 106.649 1.00 13.75  ? 49  LEU A O    1 
ATOM   815   C  CB   . LEU A  1 49  ? 121.809 127.674 108.660 1.00 13.75  ? 49  LEU A CB   1 
ATOM   816   C  CG   . LEU A  1 49  ? 122.100 126.209 108.346 1.00 13.75  ? 49  LEU A CG   1 
ATOM   817   C  CD1  . LEU A  1 49  ? 122.581 125.512 109.574 1.00 13.75  ? 49  LEU A CD1  1 
ATOM   818   C  CD2  . LEU A  1 49  ? 120.878 125.511 107.799 1.00 13.75  ? 49  LEU A CD2  1 
ATOM   819   H  H    . LEU A  1 49  ? 122.135 130.184 108.188 1.00 13.75  ? 49  LEU A H    1 
ATOM   820   H  HA   . LEU A  1 49  ? 123.400 128.370 109.749 1.00 13.75  ? 49  LEU A HA   1 
ATOM   821   H  HB2  . LEU A  1 49  ? 121.265 127.689 109.458 1.00 13.75  ? 49  LEU A HB2  1 
ATOM   822   H  HB3  . LEU A  1 49  ? 121.301 128.029 107.919 1.00 13.75  ? 49  LEU A HB3  1 
ATOM   823   H  HG   . LEU A  1 49  ? 122.791 126.153 107.678 1.00 13.75  ? 49  LEU A HG   1 
ATOM   824   H  HD11 . LEU A  1 49  ? 122.647 124.565 109.388 1.00 13.75  ? 49  LEU A HD11 1 
ATOM   825   H  HD12 . LEU A  1 49  ? 123.446 125.868 109.818 1.00 13.75  ? 49  LEU A HD12 1 
ATOM   826   H  HD13 . LEU A  1 49  ? 121.946 125.670 110.283 1.00 13.75  ? 49  LEU A HD13 1 
ATOM   827   H  HD21 . LEU A  1 49  ? 121.109 124.592 107.603 1.00 13.75  ? 49  LEU A HD21 1 
ATOM   828   H  HD22 . LEU A  1 49  ? 120.178 125.540 108.465 1.00 13.75  ? 49  LEU A HD22 1 
ATOM   829   H  HD23 . LEU A  1 49  ? 120.588 125.960 106.993 1.00 13.75  ? 49  LEU A HD23 1 
ATOM   830   N  N    . THR A  1 50  ? 125.219 127.853 108.217 1.00 10.89  ? 50  THR A N    1 
ATOM   831   C  CA   . THR A  1 50  ? 126.330 127.593 107.318 1.00 10.89  ? 50  THR A CA   1 
ATOM   832   C  C    . THR A  1 50  ? 126.471 126.088 107.144 1.00 10.89  ? 50  THR A C    1 
ATOM   833   O  O    . THR A  1 50  ? 126.724 125.368 108.120 1.00 10.89  ? 50  THR A O    1 
ATOM   834   C  CB   . THR A  1 50  ? 127.623 128.198 107.857 1.00 10.89  ? 50  THR A CB   1 
ATOM   835   O  OG1  . THR A  1 50  ? 127.392 129.556 108.242 1.00 10.89  ? 50  THR A OG1  1 
ATOM   836   C  CG2  . THR A  1 50  ? 128.703 128.168 106.812 1.00 10.89  ? 50  THR A CG2  1 
ATOM   837   H  H    . THR A  1 50  ? 125.384 127.635 109.029 1.00 10.89  ? 50  THR A H    1 
ATOM   838   H  HA   . THR A  1 50  ? 126.146 127.984 106.457 1.00 10.89  ? 50  THR A HA   1 
ATOM   839   H  HB   . THR A  1 50  ? 127.924 127.689 108.621 1.00 10.89  ? 50  THR A HB   1 
ATOM   840   H  HG1  . THR A  1 50  ? 128.116 129.979 108.222 1.00 10.89  ? 50  THR A HG1  1 
ATOM   841   H  HG21 . THR A  1 50  ? 129.533 128.485 107.194 1.00 10.89  ? 50  THR A HG21 1 
ATOM   842   H  HG22 . THR A  1 50  ? 128.828 127.268 106.482 1.00 10.89  ? 50  THR A HG22 1 
ATOM   843   H  HG23 . THR A  1 50  ? 128.459 128.745 106.077 1.00 10.89  ? 50  THR A HG23 1 
ATOM   844   N  N    . THR A  1 51  ? 126.319 125.633 105.898 1.00 9.85   ? 51  THR A N    1 
ATOM   845   C  CA   . THR A  1 51  ? 126.336 124.229 105.516 1.00 9.85   ? 51  THR A CA   1 
ATOM   846   C  C    . THR A  1 51  ? 127.363 123.998 104.419 1.00 9.85   ? 51  THR A C    1 
ATOM   847   O  O    . THR A  1 51  ? 127.804 124.929 103.746 1.00 9.85   ? 51  THR A O    1 
ATOM   848   C  CB   . THR A  1 51  ? 124.980 123.758 104.980 1.00 9.85   ? 51  THR A CB   1 
ATOM   849   O  OG1  . THR A  1 51  ? 124.637 124.519 103.818 1.00 9.85   ? 51  THR A OG1  1 
ATOM   850   C  CG2  . THR A  1 51  ? 123.901 123.911 105.994 1.00 9.85   ? 51  THR A CG2  1 
ATOM   851   H  H    . THR A  1 51  ? 126.196 126.150 105.229 1.00 9.85   ? 51  THR A H    1 
ATOM   852   H  HA   . THR A  1 51  ? 126.566 123.691 106.283 1.00 9.85   ? 51  THR A HA   1 
ATOM   853   H  HB   . THR A  1 51  ? 125.039 122.825 104.741 1.00 9.85   ? 51  THR A HB   1 
ATOM   854   H  HG1  . THR A  1 51  ? 123.832 124.391 103.626 1.00 9.85   ? 51  THR A HG1  1 
ATOM   855   H  HG21 . THR A  1 51  ? 123.066 123.592 105.622 1.00 9.85   ? 51  THR A HG21 1 
ATOM   856   H  HG22 . THR A  1 51  ? 124.112 123.396 106.784 1.00 9.85   ? 51  THR A HG22 1 
ATOM   857   H  HG23 . THR A  1 51  ? 123.810 124.844 106.224 1.00 9.85   ? 51  THR A HG23 1 
ATOM   858   N  N    . ASN A  1 52  ? 127.713 122.730 104.227 1.00 9.05   ? 52  ASN A N    1 
ATOM   859   C  CA   . ASN A  1 52  ? 128.489 122.278 103.078 1.00 9.05   ? 52  ASN A CA   1 
ATOM   860   C  C    . ASN A  1 52  ? 127.639 121.314 102.268 1.00 9.05   ? 52  ASN A C    1 
ATOM   861   O  O    . ASN A  1 52  ? 127.207 120.275 102.784 1.00 9.05   ? 52  ASN A O    1 
ATOM   862   C  CB   . ASN A  1 52  ? 129.781 121.595 103.507 1.00 9.05   ? 52  ASN A CB   1 
ATOM   863   C  CG   . ASN A  1 52  ? 130.622 121.160 102.334 1.00 9.05   ? 52  ASN A CG   1 
ATOM   864   O  OD1  . ASN A  1 52  ? 130.214 121.275 101.183 1.00 9.05   ? 52  ASN A OD1  1 
ATOM   865   N  ND2  . ASN A  1 52  ? 131.788 120.622 102.623 1.00 9.05   ? 52  ASN A ND2  1 
ATOM   866   H  H    . ASN A  1 52  ? 127.503 122.097 104.763 1.00 9.05   ? 52  ASN A H    1 
ATOM   867   H  HA   . ASN A  1 52  ? 128.712 123.039 102.531 1.00 9.05   ? 52  ASN A HA   1 
ATOM   868   H  HB2  . ASN A  1 52  ? 130.298 122.211 104.040 1.00 9.05   ? 52  ASN A HB2  1 
ATOM   869   H  HB3  . ASN A  1 52  ? 129.562 120.811 104.016 1.00 9.05   ? 52  ASN A HB3  1 
ATOM   870   H  HD21 . ASN A  1 52  ? 132.054 120.537 103.438 1.00 9.05   ? 52  ASN A HD21 1 
ATOM   871   H  HD22 . ASN A  1 52  ? 132.281 120.354 101.974 1.00 9.05   ? 52  ASN A HD22 1 
ATOM   872   N  N    . ILE A  1 53  ? 127.417 121.641 100.997 1.00 8.10   ? 53  ILE A N    1 
ATOM   873   C  CA   . ILE A  1 53  ? 126.520 120.847 100.173 1.00 8.10   ? 53  ILE A CA   1 
ATOM   874   C  C    . ILE A  1 53  ? 127.010 120.844 98.738  1.00 8.10   ? 53  ILE A C    1 
ATOM   875   O  O    . ILE A  1 53  ? 127.621 121.805 98.261  1.00 8.10   ? 53  ILE A O    1 
ATOM   876   C  CB   . ILE A  1 53  ? 125.062 121.357 100.224 1.00 8.10   ? 53  ILE A CB   1 
ATOM   877   C  CG1  . ILE A  1 53  ? 124.980 122.768 99.680  1.00 8.10   ? 53  ILE A CG1  1 
ATOM   878   C  CG2  . ILE A  1 53  ? 124.543 121.362 101.630 1.00 8.10   ? 53  ILE A CG2  1 
ATOM   879   C  CD1  . ILE A  1 53  ? 123.591 123.257 99.475  1.00 8.10   ? 53  ILE A CD1  1 
ATOM   880   H  H    . ILE A  1 53  ? 127.781 122.298 100.588 1.00 8.10   ? 53  ILE A H    1 
ATOM   881   H  HA   . ILE A  1 53  ? 126.538 119.936 100.491 1.00 8.10   ? 53  ILE A HA   1 
ATOM   882   H  HB   . ILE A  1 53  ? 124.505 120.782 99.685  1.00 8.10   ? 53  ILE A HB   1 
ATOM   883   H  HG12 . ILE A  1 53  ? 125.405 123.347 100.324 1.00 8.10   ? 53  ILE A HG12 1 
ATOM   884   H  HG13 . ILE A  1 53  ? 125.437 122.814 98.830  1.00 8.10   ? 53  ILE A HG13 1 
ATOM   885   H  HG21 . ILE A  1 53  ? 123.622 121.655 101.627 1.00 8.10   ? 53  ILE A HG21 1 
ATOM   886   H  HG22 . ILE A  1 53  ? 124.605 120.470 101.994 1.00 8.10   ? 53  ILE A HG22 1 
ATOM   887   H  HG23 . ILE A  1 53  ? 125.077 121.977 102.149 1.00 8.10   ? 53  ILE A HG23 1 
ATOM   888   H  HD11 . ILE A  1 53  ? 123.624 124.166 99.146  1.00 8.10   ? 53  ILE A HD11 1 
ATOM   889   H  HD12 . ILE A  1 53  ? 123.164 122.692 98.820  1.00 8.10   ? 53  ILE A HD12 1 
ATOM   890   H  HD13 . ILE A  1 53  ? 123.113 123.224 100.317 1.00 8.10   ? 53  ILE A HD13 1 
ATOM   891   N  N    . TRP A  1 54  ? 126.715 119.750 98.051  1.00 6.60   ? 54  TRP A N    1 
ATOM   892   C  CA   . TRP A  1 54  ? 126.916 119.628 96.618  1.00 6.60   ? 54  TRP A CA   1 
ATOM   893   C  C    . TRP A  1 54  ? 125.554 119.543 95.954  1.00 6.60   ? 54  TRP A C    1 
ATOM   894   O  O    . TRP A  1 54  ? 124.755 118.658 96.276  1.00 6.60   ? 54  TRP A O    1 
ATOM   895   C  CB   . TRP A  1 54  ? 127.750 118.402 96.264  1.00 6.60   ? 54  TRP A CB   1 
ATOM   896   C  CG   . TRP A  1 54  ? 129.101 118.374 96.863  1.00 6.60   ? 54  TRP A CG   1 
ATOM   897   C  CD1  . TRP A  1 54  ? 129.614 119.235 97.778  1.00 6.60   ? 54  TRP A CD1  1 
ATOM   898   C  CD2  . TRP A  1 54  ? 130.126 117.425 96.587  1.00 6.60   ? 54  TRP A CD2  1 
ATOM   899   N  NE1  . TRP A  1 54  ? 130.898 118.886 98.090  1.00 6.60   ? 54  TRP A NE1  1 
ATOM   900   C  CE2  . TRP A  1 54  ? 131.236 117.772 97.371  1.00 6.60   ? 54  TRP A CE2  1 
ATOM   901   C  CE3  . TRP A  1 54  ? 130.214 116.314 95.752  1.00 6.60   ? 54  TRP A CE3  1 
ATOM   902   C  CZ2  . TRP A  1 54  ? 132.413 117.049 97.345  1.00 6.60   ? 54  TRP A CZ2  1 
ATOM   903   C  CZ3  . TRP A  1 54  ? 131.379 115.601 95.729  1.00 6.60   ? 54  TRP A CZ3  1 
ATOM   904   C  CH2  . TRP A  1 54  ? 132.464 115.968 96.517  1.00 6.60   ? 54  TRP A CH2  1 
ATOM   905   H  H    . TRP A  1 54  ? 126.385 119.043 98.403  1.00 6.60   ? 54  TRP A H    1 
ATOM   906   H  HA   . TRP A  1 54  ? 127.365 120.412 96.287  1.00 6.60   ? 54  TRP A HA   1 
ATOM   907   H  HB2  . TRP A  1 54  ? 127.279 117.613 96.559  1.00 6.60   ? 54  TRP A HB2  1 
ATOM   908   H  HB3  . TRP A  1 54  ? 127.863 118.377 95.305  1.00 6.60   ? 54  TRP A HB3  1 
ATOM   909   H  HD1  . TRP A  1 54  ? 129.160 119.958 98.137  1.00 6.60   ? 54  TRP A HD1  1 
ATOM   910   H  HE1  . TRP A  1 54  ? 131.405 119.295 98.648  1.00 6.60   ? 54  TRP A HE1  1 
ATOM   911   H  HE3  . TRP A  1 54  ? 129.494 116.063 95.223  1.00 6.60   ? 54  TRP A HE3  1 
ATOM   912   H  HZ2  . TRP A  1 54  ? 133.136 117.294 97.870  1.00 6.60   ? 54  TRP A HZ2  1 
ATOM   913   H  HZ3  . TRP A  1 54  ? 131.447 114.861 95.177  1.00 6.60   ? 54  TRP A HZ3  1 
ATOM   914   H  HH2  . TRP A  1 54  ? 133.239 115.464 96.477  1.00 6.60   ? 54  TRP A HH2  1 
ATOM   915   N  N    . LEU A  1 55  ? 125.294 120.464 95.040  1.00 6.29   ? 55  LEU A N    1 
ATOM   916   C  CA   . LEU A  1 55  ? 124.080 120.412 94.256  1.00 6.29   ? 55  LEU A CA   1 
ATOM   917   C  C    . LEU A  1 55  ? 124.181 119.314 93.210  1.00 6.29   ? 55  LEU A C    1 
ATOM   918   O  O    . LEU A  1 55  ? 125.256 118.789 92.919  1.00 6.29   ? 55  LEU A O    1 
ATOM   919   C  CB   . LEU A  1 55  ? 123.829 121.750 93.578  1.00 6.29   ? 55  LEU A CB   1 
ATOM   920   C  CG   . LEU A  1 55  ? 123.040 122.811 94.331  1.00 6.29   ? 55  LEU A CG   1 
ATOM   921   C  CD1  . LEU A  1 55  ? 123.590 123.013 95.696  1.00 6.29   ? 55  LEU A CD1  1 
ATOM   922   C  CD2  . LEU A  1 55  ? 123.124 124.095 93.563  1.00 6.29   ? 55  LEU A CD2  1 
ATOM   923   H  H    . LEU A  1 55  ? 125.802 121.128 94.858  1.00 6.29   ? 55  LEU A H    1 
ATOM   924   H  HA   . LEU A  1 55  ? 123.335 120.217 94.835  1.00 6.29   ? 55  LEU A HA   1 
ATOM   925   H  HB2  . LEU A  1 55  ? 124.690 122.138 93.390  1.00 6.29   ? 55  LEU A HB2  1 
ATOM   926   H  HB3  . LEU A  1 55  ? 123.361 121.576 92.750  1.00 6.29   ? 55  LEU A HB3  1 
ATOM   927   H  HG   . LEU A  1 55  ? 122.113 122.548 94.406  1.00 6.29   ? 55  LEU A HG   1 
ATOM   928   H  HD11 . LEU A  1 55  ? 123.098 123.724 96.124  1.00 6.29   ? 55  LEU A HD11 1 
ATOM   929   H  HD12 . LEU A  1 55  ? 123.493 122.194 96.199  1.00 6.29   ? 55  LEU A HD12 1 
ATOM   930   H  HD13 . LEU A  1 55  ? 124.522 123.255 95.613  1.00 6.29   ? 55  LEU A HD13 1 
ATOM   931   H  HD21 . LEU A  1 55  ? 122.591 124.767 94.011  1.00 6.29   ? 55  LEU A HD21 1 
ATOM   932   H  HD22 . LEU A  1 55  ? 124.051 124.368 93.544  1.00 6.29   ? 55  LEU A HD22 1 
ATOM   933   H  HD23 . LEU A  1 55  ? 122.800 123.950 92.662  1.00 6.29   ? 55  LEU A HD23 1 
ATOM   934   N  N    . GLN A  1 56  ? 123.034 118.962 92.647  1.00 8.16   ? 56  GLN A N    1 
ATOM   935   C  CA   . GLN A  1 56  ? 122.976 117.962 91.591  1.00 8.16   ? 56  GLN A CA   1 
ATOM   936   C  C    . GLN A  1 56  ? 121.886 118.385 90.626  1.00 8.16   ? 56  GLN A C    1 
ATOM   937   O  O    . GLN A  1 56  ? 120.701 118.312 90.964  1.00 8.16   ? 56  GLN A O    1 
ATOM   938   C  CB   . GLN A  1 56  ? 122.695 116.574 92.144  1.00 8.16   ? 56  GLN A CB   1 
ATOM   939   C  CG   . GLN A  1 56  ? 123.541 116.183 93.320  1.00 8.16   ? 56  GLN A CG   1 
ATOM   940   C  CD   . GLN A  1 56  ? 123.090 114.898 93.952  1.00 8.16   ? 56  GLN A CD   1 
ATOM   941   O  OE1  . GLN A  1 56  ? 122.127 114.278 93.511  1.00 8.16   ? 56  GLN A OE1  1 
ATOM   942   N  NE2  . GLN A  1 56  ? 123.785 114.486 94.995  1.00 8.16   ? 56  GLN A NE2  1 
ATOM   943   H  H    . GLN A  1 56  ? 122.273 119.294 92.851  1.00 8.16   ? 56  GLN A H    1 
ATOM   944   H  HA   . GLN A  1 56  ? 123.813 117.945 91.116  1.00 8.16   ? 56  GLN A HA   1 
ATOM   945   H  HB2  . GLN A  1 56  ? 121.772 116.542 92.420  1.00 8.16   ? 56  GLN A HB2  1 
ATOM   946   H  HB3  . GLN A  1 56  ? 122.851 115.930 91.440  1.00 8.16   ? 56  GLN A HB3  1 
ATOM   947   H  HG2  . GLN A  1 56  ? 124.453 116.067 93.027  1.00 8.16   ? 56  GLN A HG2  1 
ATOM   948   H  HG3  . GLN A  1 56  ? 123.492 116.872 93.992  1.00 8.16   ? 56  GLN A HG3  1 
ATOM   949   H  HE21 . GLN A  1 56  ? 124.452 114.950 95.270  1.00 8.16   ? 56  GLN A HE21 1 
ATOM   950   H  HE22 . GLN A  1 56  ? 123.568 113.758 95.392  1.00 8.16   ? 56  GLN A HE22 1 
ATOM   951   N  N    . MET A  1 57  ? 122.286 118.829 89.442  1.00 5.89   ? 57  MET A N    1 
ATOM   952   C  CA   . MET A  1 57  ? 121.355 119.136 88.373  1.00 5.89   ? 57  MET A CA   1 
ATOM   953   C  C    . MET A  1 57  ? 121.556 118.161 87.229  1.00 5.89   ? 57  MET A C    1 
ATOM   954   O  O    . MET A  1 57  ? 122.690 117.827 86.870  1.00 5.89   ? 57  MET A O    1 
ATOM   955   C  CB   . MET A  1 57  ? 121.528 120.557 87.859  1.00 5.89   ? 57  MET A CB   1 
ATOM   956   C  CG   . MET A  1 57  ? 121.356 121.607 88.901  1.00 5.89   ? 57  MET A CG   1 
ATOM   957   S  SD   . MET A  1 57  ? 121.773 123.234 88.298  1.00 5.89   ? 57  MET A SD   1 
ATOM   958   C  CE   . MET A  1 57  ? 122.310 123.927 89.839  1.00 5.89   ? 57  MET A CE   1 
ATOM   959   H  H    . MET A  1 57  ? 123.104 118.960 89.230  1.00 5.89   ? 57  MET A H    1 
ATOM   960   H  HA   . MET A  1 57  ? 120.455 119.049 88.703  1.00 5.89   ? 57  MET A HA   1 
ATOM   961   H  HB2  . MET A  1 57  ? 122.415 120.644 87.488  1.00 5.89   ? 57  MET A HB2  1 
ATOM   962   H  HB3  . MET A  1 57  ? 120.861 120.714 87.177  1.00 5.89   ? 57  MET A HB3  1 
ATOM   963   H  HG2  . MET A  1 57  ? 120.433 121.623 89.185  1.00 5.89   ? 57  MET A HG2  1 
ATOM   964   H  HG3  . MET A  1 57  ? 121.935 121.413 89.649  1.00 5.89   ? 57  MET A HG3  1 
ATOM   965   H  HE1  . MET A  1 57  ? 122.521 124.862 89.712  1.00 5.89   ? 57  MET A HE1  1 
ATOM   966   H  HE2  . MET A  1 57  ? 121.597 123.821 90.482  1.00 5.89   ? 57  MET A HE2  1 
ATOM   967   H  HE3  . MET A  1 57  ? 123.090 123.438 90.136  1.00 5.89   ? 57  MET A HE3  1 
ATOM   968   N  N    . SER A  1 58  ? 120.444 117.712 86.665  1.00 8.00   ? 58  SER A N    1 
ATOM   969   C  CA   . SER A  1 58  ? 120.466 116.804 85.532  1.00 8.00   ? 58  SER A CA   1 
ATOM   970   C  C    . SER A  1 58  ? 119.420 117.270 84.539  1.00 8.00   ? 58  SER A C    1 
ATOM   971   O  O    . SER A  1 58  ? 118.250 117.429 84.898  1.00 8.00   ? 58  SER A O    1 
ATOM   972   C  CB   . SER A  1 58  ? 120.199 115.367 85.974  1.00 8.00   ? 58  SER A CB   1 
ATOM   973   O  OG   . SER A  1 58  ? 120.301 114.469 84.887  1.00 8.00   ? 58  SER A OG   1 
ATOM   974   H  H    . SER A  1 58  ? 119.656 117.933 86.913  1.00 8.00   ? 58  SER A H    1 
ATOM   975   H  HA   . SER A  1 58  ? 121.331 116.842 85.110  1.00 8.00   ? 58  SER A HA   1 
ATOM   976   H  HB2  . SER A  1 58  ? 120.853 115.129 86.645  1.00 8.00   ? 58  SER A HB2  1 
ATOM   977   H  HB3  . SER A  1 58  ? 119.309 115.313 86.348  1.00 8.00   ? 58  SER A HB3  1 
ATOM   978   H  HG   . SER A  1 58  ? 120.024 113.713 85.119  1.00 8.00   ? 58  SER A HG   1 
ATOM   979   N  N    . TRP A  1 59  ? 119.838 117.503 83.301  1.00 6.64   ? 59  TRP A N    1 
ATOM   980   C  CA   . TRP A  1 59  ? 118.902 117.887 82.256  1.00 6.64   ? 59  TRP A CA   1 
ATOM   981   C  C    . TRP A  1 59  ? 119.314 117.208 80.961  1.00 6.64   ? 59  TRP A C    1 
ATOM   982   O  O    . TRP A  1 59  ? 120.200 116.353 80.935  1.00 6.64   ? 59  TRP A O    1 
ATOM   983   C  CB   . TRP A  1 59  ? 118.805 119.411 82.104  1.00 6.64   ? 59  TRP A CB   1 
ATOM   984   C  CG   . TRP A  1 59  ? 120.022 120.119 81.615  1.00 6.64   ? 59  TRP A CG   1 
ATOM   985   C  CD1  . TRP A  1 59  ? 120.259 120.554 80.350  1.00 6.64   ? 59  TRP A CD1  1 
ATOM   986   C  CD2  . TRP A  1 59  ? 121.143 120.531 82.395  1.00 6.64   ? 59  TRP A CD2  1 
ATOM   987   N  NE1  . TRP A  1 59  ? 121.470 121.188 80.287  1.00 6.64   ? 59  TRP A NE1  1 
ATOM   988   C  CE2  . TRP A  1 59  ? 122.033 121.187 81.533  1.00 6.64   ? 59  TRP A CE2  1 
ATOM   989   C  CE3  . TRP A  1 59  ? 121.488 120.398 83.737  1.00 6.64   ? 59  TRP A CE3  1 
ATOM   990   C  CZ2  . TRP A  1 59  ? 123.241 121.704 81.970  1.00 6.64   ? 59  TRP A CZ2  1 
ATOM   991   C  CZ3  . TRP A  1 59  ? 122.682 120.909 84.162  1.00 6.64   ? 59  TRP A CZ3  1 
ATOM   992   C  CH2  . TRP A  1 59  ? 123.544 121.553 83.286  1.00 6.64   ? 59  TRP A CH2  1 
ATOM   993   H  H    . TRP A  1 59  ? 120.649 117.439 83.043  1.00 6.64   ? 59  TRP A H    1 
ATOM   994   H  HA   . TRP A  1 59  ? 118.027 117.558 82.493  1.00 6.64   ? 59  TRP A HA   1 
ATOM   995   H  HB2  . TRP A  1 59  ? 118.100 119.602 81.471  1.00 6.64   ? 59  TRP A HB2  1 
ATOM   996   H  HB3  . TRP A  1 59  ? 118.586 119.785 82.966  1.00 6.64   ? 59  TRP A HB3  1 
ATOM   997   H  HD1  . TRP A  1 59  ? 119.688 120.430 79.632  1.00 6.64   ? 59  TRP A HD1  1 
ATOM   998   H  HE1  . TRP A  1 59  ? 121.818 121.532 79.583  1.00 6.64   ? 59  TRP A HE1  1 
ATOM   999   H  HE3  . TRP A  1 59  ? 120.920 119.967 84.327  1.00 6.64   ? 59  TRP A HE3  1 
ATOM   1000  H  HZ2  . TRP A  1 59  ? 123.821 122.137 81.392  1.00 6.64   ? 59  TRP A HZ2  1 
ATOM   1001  H  HZ3  . TRP A  1 59  ? 122.922 120.826 85.050  1.00 6.64   ? 59  TRP A HZ3  1 
ATOM   1002  H  HH2  . TRP A  1 59  ? 124.343 121.889 83.605  1.00 6.64   ? 59  TRP A HH2  1 
ATOM   1003  N  N    . THR A  1 60  ? 118.638 117.578 79.881  1.00 7.98   ? 60  THR A N    1 
ATOM   1004  C  CA   . THR A  1 60  ? 118.869 117.002 78.567  1.00 7.98   ? 60  THR A CA   1 
ATOM   1005  C  C    . THR A  1 60  ? 119.071 118.122 77.562  1.00 7.98   ? 60  THR A C    1 
ATOM   1006  O  O    . THR A  1 60  ? 118.275 119.064 77.511  1.00 7.98   ? 60  THR A O    1 
ATOM   1007  C  CB   . THR A  1 60  ? 117.698 116.119 78.148  1.00 7.98   ? 60  THR A CB   1 
ATOM   1008  O  OG1  . THR A  1 60  ? 117.532 115.063 79.098  1.00 7.98   ? 60  THR A OG1  1 
ATOM   1009  C  CG2  . THR A  1 60  ? 117.943 115.524 76.794  1.00 7.98   ? 60  THR A CG2  1 
ATOM   1010  H  H    . THR A  1 60  ? 118.023 118.173 79.889  1.00 7.98   ? 60  THR A H    1 
ATOM   1011  H  HA   . THR A  1 60  ? 119.665 116.458 78.592  1.00 7.98   ? 60  THR A HA   1 
ATOM   1012  H  HB   . THR A  1 60  ? 116.894 116.653 78.110  1.00 7.98   ? 60  THR A HB   1 
ATOM   1013  H  HG1  . THR A  1 60  ? 117.045 114.465 78.768  1.00 7.98   ? 60  THR A HG1  1 
ATOM   1014  H  HG21 . THR A  1 60  ? 117.235 114.900 76.580  1.00 7.98   ? 60  THR A HG21 1 
ATOM   1015  H  HG22 . THR A  1 60  ? 117.965 116.219 76.122  1.00 7.98   ? 60  THR A HG22 1 
ATOM   1016  H  HG23 . THR A  1 60  ? 118.788 115.055 76.796  1.00 7.98   ? 60  THR A HG23 1 
ATOM   1017  N  N    . ASP A  1 61  ? 120.126 118.015 76.762  1.00 10.73  ? 61  ASP A N    1 
ATOM   1018  C  CA   . ASP A  1 61  ? 120.447 118.997 75.737  1.00 10.73  ? 61  ASP A CA   1 
ATOM   1019  C  C    . ASP A  1 61  ? 120.252 118.361 74.369  1.00 10.73  ? 61  ASP A C    1 
ATOM   1020  O  O    . ASP A  1 61  ? 120.841 117.318 74.073  1.00 10.73  ? 61  ASP A O    1 
ATOM   1021  C  CB   . ASP A  1 61  ? 121.874 119.508 75.903  1.00 10.73  ? 61  ASP A CB   1 
ATOM   1022  C  CG   . ASP A  1 61  ? 122.145 120.754 75.093  1.00 10.73  ? 61  ASP A CG   1 
ATOM   1023  O  OD1  . ASP A  1 61  ? 121.423 120.990 74.104  1.00 10.73  ? 61  ASP A OD1  1 
ATOM   1024  O  OD2  . ASP A  1 61  ? 123.072 121.508 75.452  1.00 10.73  ? 61  ASP A OD2  1 
ATOM   1025  H  H    . ASP A  1 61  ? 120.686 117.368 76.796  1.00 10.73  ? 61  ASP A H    1 
ATOM   1026  H  HA   . ASP A  1 61  ? 119.847 119.747 75.813  1.00 10.73  ? 61  ASP A HA   1 
ATOM   1027  H  HB2  . ASP A  1 61  ? 122.021 119.718 76.835  1.00 10.73  ? 61  ASP A HB2  1 
ATOM   1028  H  HB3  . ASP A  1 61  ? 122.485 118.820 75.615  1.00 10.73  ? 61  ASP A HB3  1 
ATOM   1029  N  N    . HIS A  1 62  ? 119.423 118.996 73.544  1.00 13.40  ? 62  HIS A N    1 
ATOM   1030  C  CA   . HIS A  1 62  ? 119.091 118.468 72.229  1.00 13.40  ? 62  HIS A CA   1 
ATOM   1031  C  C    . HIS A  1 62  ? 120.218 118.669 71.231  1.00 13.40  ? 62  HIS A C    1 
ATOM   1032  O  O    . HIS A  1 62  ? 120.388 117.854 70.318  1.00 13.40  ? 62  HIS A O    1 
ATOM   1033  C  CB   . HIS A  1 62  ? 117.818 119.147 71.729  1.00 13.40  ? 62  HIS A CB   1 
ATOM   1034  C  CG   . HIS A  1 62  ? 117.475 118.839 70.308  1.00 13.40  ? 62  HIS A CG   1 
ATOM   1035  N  ND1  . HIS A  1 62  ? 116.976 117.620 69.907  1.00 13.40  ? 62  HIS A ND1  1 
ATOM   1036  C  CD2  . HIS A  1 62  ? 117.541 119.604 69.194  1.00 13.40  ? 62  HIS A CD2  1 
ATOM   1037  C  CE1  . HIS A  1 62  ? 116.760 117.643 68.605  1.00 13.40  ? 62  HIS A CE1  1 
ATOM   1038  N  NE2  . HIS A  1 62  ? 117.094 118.836 68.148  1.00 13.40  ? 62  HIS A NE2  1 
ATOM   1039  H  H    . HIS A  1 62  ? 119.041 119.741 73.721  1.00 13.40  ? 62  HIS A H    1 
ATOM   1040  H  HA   . HIS A  1 62  ? 118.921 117.519 72.304  1.00 13.40  ? 62  HIS A HA   1 
ATOM   1041  H  HB2  . HIS A  1 62  ? 117.079 118.860 72.282  1.00 13.40  ? 62  HIS A HB2  1 
ATOM   1042  H  HB3  . HIS A  1 62  ? 117.940 120.103 71.799  1.00 13.40  ? 62  HIS A HB3  1 
ATOM   1043  H  HD2  . HIS A  1 62  ? 117.838 120.483 69.147  1.00 13.40  ? 62  HIS A HD2  1 
ATOM   1044  H  HE1  . HIS A  1 62  ? 116.427 116.941 68.096  1.00 13.40  ? 62  HIS A HE1  1 
ATOM   1045  N  N    . TYR A  1 63  ? 120.990 119.735 71.391  1.00 15.20  ? 63  TYR A N    1 
ATOM   1046  C  CA   . TYR A  1 63  ? 122.005 120.105 70.419  1.00 15.20  ? 63  TYR A CA   1 
ATOM   1047  C  C    . TYR A  1 63  ? 123.332 119.405 70.653  1.00 15.20  ? 63  TYR A C    1 
ATOM   1048  O  O    . TYR A  1 63  ? 124.169 119.370 69.744  1.00 15.20  ? 63  TYR A O    1 
ATOM   1049  C  CB   . TYR A  1 63  ? 122.205 121.620 70.453  1.00 15.20  ? 63  TYR A CB   1 
ATOM   1050  C  CG   . TYR A  1 63  ? 121.063 122.391 69.843  1.00 15.20  ? 63  TYR A CG   1 
ATOM   1051  C  CD1  . TYR A  1 63  ? 120.727 122.230 68.511  1.00 15.20  ? 63  TYR A CD1  1 
ATOM   1052  C  CD2  . TYR A  1 63  ? 120.312 123.273 70.603  1.00 15.20  ? 63  TYR A CD2  1 
ATOM   1053  C  CE1  . TYR A  1 63  ? 119.683 122.928 67.951  1.00 15.20  ? 63  TYR A CE1  1 
ATOM   1054  C  CE2  . TYR A  1 63  ? 119.267 123.974 70.051  1.00 15.20  ? 63  TYR A CE2  1 
ATOM   1055  C  CZ   . TYR A  1 63  ? 118.956 123.799 68.723  1.00 15.20  ? 63  TYR A CZ   1 
ATOM   1056  O  OH   . TYR A  1 63  ? 117.914 124.494 68.156  1.00 15.20  ? 63  TYR A OH   1 
ATOM   1057  H  H    . TYR A  1 63  ? 120.947 120.262 72.065  1.00 15.20  ? 63  TYR A H    1 
ATOM   1058  H  HA   . TYR A  1 63  ? 121.698 119.864 69.535  1.00 15.20  ? 63  TYR A HA   1 
ATOM   1059  H  HB2  . TYR A  1 63  ? 122.284 121.900 71.376  1.00 15.20  ? 63  TYR A HB2  1 
ATOM   1060  H  HB3  . TYR A  1 63  ? 123.010 121.839 69.967  1.00 15.20  ? 63  TYR A HB3  1 
ATOM   1061  H  HD1  . TYR A  1 63  ? 121.217 121.643 67.987  1.00 15.20  ? 63  TYR A HD1  1 
ATOM   1062  H  HD2  . TYR A  1 63  ? 120.519 123.394 71.499  1.00 15.20  ? 63  TYR A HD2  1 
ATOM   1063  H  HE1  . TYR A  1 63  ? 119.471 122.811 67.055  1.00 15.20  ? 63  TYR A HE1  1 
ATOM   1064  H  HE2  . TYR A  1 63  ? 118.774 124.563 70.572  1.00 15.20  ? 63  TYR A HE2  1 
ATOM   1065  H  HH   . TYR A  1 63  ? 117.847 124.298 67.342  1.00 15.20  ? 63  TYR A HH   1 
ATOM   1066  N  N    . LEU A  1 64  ? 123.542 118.852 71.843  1.00 10.39  ? 64  LEU A N    1 
ATOM   1067  C  CA   . LEU A  1 64  ? 124.752 118.100 72.154  1.00 10.39  ? 64  LEU A CA   1 
ATOM   1068  C  C    . LEU A  1 64  ? 124.458 116.604 72.071  1.00 10.39  ? 64  LEU A C    1 
ATOM   1069  O  O    . LEU A  1 64  ? 124.326 115.901 73.070  1.00 10.39  ? 64  LEU A O    1 
ATOM   1070  C  CB   . LEU A  1 64  ? 125.274 118.493 73.528  1.00 10.39  ? 64  LEU A CB   1 
ATOM   1071  C  CG   . LEU A  1 64  ? 125.591 119.972 73.729  1.00 10.39  ? 64  LEU A CG   1 
ATOM   1072  C  CD1  . LEU A  1 64  ? 126.064 120.203 75.122  1.00 10.39  ? 64  LEU A CD1  1 
ATOM   1073  C  CD2  . LEU A  1 64  ? 126.644 120.432 72.762  1.00 10.39  ? 64  LEU A CD2  1 
ATOM   1074  H  H    . LEU A  1 64  ? 122.988 118.895 72.493  1.00 10.39  ? 64  LEU A H    1 
ATOM   1075  H  HA   . LEU A  1 64  ? 125.429 118.309 71.499  1.00 10.39  ? 64  LEU A HA   1 
ATOM   1076  H  HB2  . LEU A  1 64  ? 124.603 118.252 74.180  1.00 10.39  ? 64  LEU A HB2  1 
ATOM   1077  H  HB3  . LEU A  1 64  ? 126.085 117.995 73.701  1.00 10.39  ? 64  LEU A HB3  1 
ATOM   1078  H  HG   . LEU A  1 64  ? 124.792 120.494 73.586  1.00 10.39  ? 64  LEU A HG   1 
ATOM   1079  H  HD11 . LEU A  1 64  ? 126.280 121.138 75.225  1.00 10.39  ? 64  LEU A HD11 1 
ATOM   1080  H  HD12 . LEU A  1 64  ? 125.359 119.950 75.733  1.00 10.39  ? 64  LEU A HD12 1 
ATOM   1081  H  HD13 . LEU A  1 64  ? 126.850 119.660 75.269  1.00 10.39  ? 64  LEU A HD13 1 
ATOM   1082  H  HD21 . LEU A  1 64  ? 126.872 121.349 72.967  1.00 10.39  ? 64  LEU A HD21 1 
ATOM   1083  H  HD22 . LEU A  1 64  ? 127.423 119.868 72.867  1.00 10.39  ? 64  LEU A HD22 1 
ATOM   1084  H  HD23 . LEU A  1 64  ? 126.298 120.368 71.861  1.00 10.39  ? 64  LEU A HD23 1 
ATOM   1085  N  N    . GLN A  1 65  ? 124.362 116.128 70.836  1.00 9.51   ? 65  GLN A N    1 
ATOM   1086  C  CA   . GLN A  1 65  ? 124.123 114.725 70.550  1.00 9.51   ? 65  GLN A CA   1 
ATOM   1087  C  C    . GLN A  1 65  ? 125.061 114.277 69.445  1.00 9.51   ? 65  GLN A C    1 
ATOM   1088  O  O    . GLN A  1 65  ? 125.406 115.052 68.550  1.00 9.51   ? 65  GLN A O    1 
ATOM   1089  C  CB   . GLN A  1 65  ? 122.682 114.472 70.127  1.00 9.51   ? 65  GLN A CB   1 
ATOM   1090  C  CG   . GLN A  1 65  ? 121.674 114.744 71.208  1.00 9.51   ? 65  GLN A CG   1 
ATOM   1091  C  CD   . GLN A  1 65  ? 120.329 114.134 70.918  1.00 9.51   ? 65  GLN A CD   1 
ATOM   1092  O  OE1  . GLN A  1 65  ? 120.168 113.374 69.964  1.00 9.51   ? 65  GLN A OE1  1 
ATOM   1093  N  NE2  . GLN A  1 65  ? 119.348 114.462 71.742  1.00 9.51   ? 65  GLN A NE2  1 
ATOM   1094  H  H    . GLN A  1 65  ? 124.436 116.611 70.131  1.00 9.51   ? 65  GLN A H    1 
ATOM   1095  H  HA   . GLN A  1 65  ? 124.304 114.201 71.339  1.00 9.51   ? 65  GLN A HA   1 
ATOM   1096  H  HB2  . GLN A  1 65  ? 122.474 115.043 69.373  1.00 9.51   ? 65  GLN A HB2  1 
ATOM   1097  H  HB3  . GLN A  1 65  ? 122.597 113.544 69.870  1.00 9.51   ? 65  GLN A HB3  1 
ATOM   1098  H  HG2  . GLN A  1 65  ? 122.000 114.375 72.039  1.00 9.51   ? 65  GLN A HG2  1 
ATOM   1099  H  HG3  . GLN A  1 65  ? 121.552 115.699 71.290  1.00 9.51   ? 65  GLN A HG3  1 
ATOM   1100  H  HE21 . GLN A  1 65  ? 119.503 114.996 72.396  1.00 9.51   ? 65  GLN A HE21 1 
ATOM   1101  H  HE22 . GLN A  1 65  ? 118.560 114.143 71.622  1.00 9.51   ? 65  GLN A HE22 1 
ATOM   1102  N  N    . TRP A  1 66  ? 125.472 113.017 69.512  1.00 10.12  ? 66  TRP A N    1 
ATOM   1103  C  CA   . TRP A  1 66  ? 126.335 112.475 68.479  1.00 10.12  ? 66  TRP A CA   1 
ATOM   1104  C  C    . TRP A  1 66  ? 126.220 110.962 68.453  1.00 10.12  ? 66  TRP A C    1 
ATOM   1105  O  O    . TRP A  1 66  ? 125.700 110.335 69.378  1.00 10.12  ? 66  TRP A O    1 
ATOM   1106  C  CB   . TRP A  1 66  ? 127.789 112.898 68.678  1.00 10.12  ? 66  TRP A CB   1 
ATOM   1107  C  CG   . TRP A  1 66  ? 128.472 112.278 69.845  1.00 10.12  ? 66  TRP A CG   1 
ATOM   1108  C  CD1  . TRP A  1 66  ? 129.170 111.113 69.861  1.00 10.12  ? 66  TRP A CD1  1 
ATOM   1109  C  CD2  . TRP A  1 66  ? 128.549 112.808 71.168  1.00 10.12  ? 66  TRP A CD2  1 
ATOM   1110  N  NE1  . TRP A  1 66  ? 129.667 110.876 71.113  1.00 10.12  ? 66  TRP A NE1  1 
ATOM   1111  C  CE2  . TRP A  1 66  ? 129.300 111.905 71.935  1.00 10.12  ? 66  TRP A CE2  1 
ATOM   1112  C  CE3  . TRP A  1 66  ? 128.052 113.957 71.781  1.00 10.12  ? 66  TRP A CE3  1 
ATOM   1113  C  CZ2  . TRP A  1 66  ? 129.562 112.116 73.277  1.00 10.12  ? 66  TRP A CZ2  1 
ATOM   1114  C  CZ3  . TRP A  1 66  ? 128.313 114.159 73.106  1.00 10.12  ? 66  TRP A CZ3  1 
ATOM   1115  C  CH2  . TRP A  1 66  ? 129.060 113.247 73.841  1.00 10.12  ? 66  TRP A CH2  1 
ATOM   1116  H  H    . TRP A  1 66  ? 125.265 112.466 70.135  1.00 10.12  ? 66  TRP A H    1 
ATOM   1117  H  HA   . TRP A  1 66  ? 126.043 112.810 67.623  1.00 10.12  ? 66  TRP A HA   1 
ATOM   1118  H  HB2  . TRP A  1 66  ? 128.284 112.657 67.884  1.00 10.12  ? 66  TRP A HB2  1 
ATOM   1119  H  HB3  . TRP A  1 66  ? 127.808 113.856 68.801  1.00 10.12  ? 66  TRP A HB3  1 
ATOM   1120  H  HD1  . TRP A  1 66  ? 129.290 110.556 69.131  1.00 10.12  ? 66  TRP A HD1  1 
ATOM   1121  H  HE1  . TRP A  1 66  ? 130.135 110.195 71.344  1.00 10.12  ? 66  TRP A HE1  1 
ATOM   1122  H  HE3  . TRP A  1 66  ? 127.552 114.572 71.302  1.00 10.12  ? 66  TRP A HE3  1 
ATOM   1123  H  HZ2  . TRP A  1 66  ? 130.060 111.512 73.774  1.00 10.12  ? 66  TRP A HZ2  1 
ATOM   1124  H  HZ3  . TRP A  1 66  ? 127.986 114.918 73.521  1.00 10.12  ? 66  TRP A HZ3  1 
ATOM   1125  H  HH2  . TRP A  1 66  ? 129.219 113.414 74.736  1.00 10.12  ? 66  TRP A HH2  1 
ATOM   1126  N  N    . ASN A  1 67  ? 126.722 110.396 67.364  1.00 27.64  ? 67  ASN A N    1 
ATOM   1127  C  CA   . ASN A  1 67  ? 126.710 108.964 67.120  1.00 27.64  ? 67  ASN A CA   1 
ATOM   1128  C  C    . ASN A  1 67  ? 128.013 108.366 67.629  1.00 27.64  ? 67  ASN A C    1 
ATOM   1129  O  O    . ASN A  1 67  ? 129.096 108.800 67.225  1.00 27.64  ? 67  ASN A O    1 
ATOM   1130  C  CB   . ASN A  1 67  ? 126.551 108.719 65.626  1.00 27.64  ? 67  ASN A CB   1 
ATOM   1131  C  CG   . ASN A  1 67  ? 125.860 107.425 65.300  1.00 27.64  ? 67  ASN A CG   1 
ATOM   1132  O  OD1  . ASN A  1 67  ? 125.838 106.477 66.086  1.00 27.64  ? 67  ASN A OD1  1 
ATOM   1133  N  ND2  . ASN A  1 67  ? 125.291 107.386 64.107  1.00 27.64  ? 67  ASN A ND2  1 
ATOM   1134  H  H    . ASN A  1 67  ? 127.076 110.843 66.723  1.00 27.64  ? 67  ASN A H    1 
ATOM   1135  H  HA   . ASN A  1 67  ? 125.973 108.555 67.591  1.00 27.64  ? 67  ASN A HA   1 
ATOM   1136  H  HB2  . ASN A  1 67  ? 126.019 109.436 65.254  1.00 27.64  ? 67  ASN A HB2  1 
ATOM   1137  H  HB3  . ASN A  1 67  ? 127.429 108.709 65.217  1.00 27.64  ? 67  ASN A HB3  1 
ATOM   1138  H  HD22 . ASN A  1 67  ? 125.331 108.071 63.592  1.00 27.64  ? 67  ASN A HD22 1 
ATOM   1139  N  N    . VAL A  1 68  ? 127.913 107.386 68.523  1.00 21.36  ? 68  VAL A N    1 
ATOM   1140  C  CA   . VAL A  1 68  ? 129.117 106.777 69.073  1.00 21.36  ? 68  VAL A CA   1 
ATOM   1141  C  C    . VAL A  1 68  ? 129.877 106.028 67.989  1.00 21.36  ? 68  VAL A C    1 
ATOM   1142  O  O    . VAL A  1 68  ? 131.116 106.010 67.981  1.00 21.36  ? 68  VAL A O    1 
ATOM   1143  C  CB   . VAL A  1 68  ? 128.764 105.853 70.249  1.00 21.36  ? 68  VAL A CB   1 
ATOM   1144  C  CG1  . VAL A  1 68  ? 130.022 105.307 70.865  1.00 21.36  ? 68  VAL A CG1  1 
ATOM   1145  C  CG2  . VAL A  1 68  ? 127.963 106.595 71.284  1.00 21.36  ? 68  VAL A CG2  1 
ATOM   1146  H  H    . VAL A  1 68  ? 127.174 107.060 68.810  1.00 21.36  ? 68  VAL A H    1 
ATOM   1147  H  HA   . VAL A  1 68  ? 129.693 107.473 69.411  1.00 21.36  ? 68  VAL A HA   1 
ATOM   1148  H  HB   . VAL A  1 68  ? 128.229 105.113 69.923  1.00 21.36  ? 68  VAL A HB   1 
ATOM   1149  H  HG11 . VAL A  1 68  ? 129.793 104.835 71.679  1.00 21.36  ? 68  VAL A HG11 1 
ATOM   1150  H  HG12 . VAL A  1 68  ? 130.446 104.707 70.235  1.00 21.36  ? 68  VAL A HG12 1 
ATOM   1151  H  HG13 . VAL A  1 68  ? 130.611 106.050 71.065  1.00 21.36  ? 68  VAL A HG13 1 
ATOM   1152  H  HG21 . VAL A  1 68  ? 127.699 105.973 71.980  1.00 21.36  ? 68  VAL A HG21 1 
ATOM   1153  H  HG22 . VAL A  1 68  ? 128.517 107.295 71.661  1.00 21.36  ? 68  VAL A HG22 1 
ATOM   1154  H  HG23 . VAL A  1 68  ? 127.173 106.979 70.870  1.00 21.36  ? 68  VAL A HG23 1 
ATOM   1155  N  N    . SER A  1 69  ? 129.155 105.386 67.071  1.00 25.86  ? 69  SER A N    1 
ATOM   1156  C  CA   . SER A  1 69  ? 129.810 104.564 66.063  1.00 25.86  ? 69  SER A CA   1 
ATOM   1157  C  C    . SER A  1 69  ? 130.690 105.395 65.147  1.00 25.86  ? 69  SER A C    1 
ATOM   1158  O  O    . SER A  1 69  ? 131.705 104.897 64.648  1.00 25.86  ? 69  SER A O    1 
ATOM   1159  C  CB   . SER A  1 69  ? 128.757 103.803 65.257  1.00 25.86  ? 69  SER A CB   1 
ATOM   1160  O  OG   . SER A  1 69  ? 128.246 102.716 66.009  1.00 25.86  ? 69  SER A OG   1 
ATOM   1161  H  H    . SER A  1 69  ? 128.299 105.415 67.007  1.00 25.86  ? 69  SER A H    1 
ATOM   1162  H  HA   . SER A  1 69  ? 130.371 103.918 66.508  1.00 25.86  ? 69  SER A HA   1 
ATOM   1163  H  HB2  . SER A  1 69  ? 128.031 104.416 65.051  1.00 25.86  ? 69  SER A HB2  1 
ATOM   1164  H  HB3  . SER A  1 69  ? 129.157 103.471 64.444  1.00 25.86  ? 69  SER A HB3  1 
ATOM   1165  H  HG   . SER A  1 69  ? 127.593 102.373 65.603  1.00 25.86  ? 69  SER A HG   1 
ATOM   1166  N  N    . GLU A  1 70  ? 130.331 106.656 64.926  1.00 26.83  ? 70  GLU A N    1 
ATOM   1167  C  CA   . GLU A  1 70  ? 131.134 107.555 64.114  1.00 26.83  ? 70  GLU A CA   1 
ATOM   1168  C  C    . GLU A  1 70  ? 132.282 108.207 64.882  1.00 26.83  ? 70  GLU A C    1 
ATOM   1169  O  O    . GLU A  1 70  ? 133.202 108.746 64.255  1.00 26.83  ? 70  GLU A O    1 
ATOM   1170  C  CB   . GLU A  1 70  ? 130.222 108.629 63.512  1.00 26.83  ? 70  GLU A CB   1 
ATOM   1171  C  CG   . GLU A  1 70  ? 130.938 109.630 62.620  1.00 26.83  ? 70  GLU A CG   1 
ATOM   1172  C  CD   . GLU A  1 70  ? 129.987 110.702 62.084  1.00 26.83  ? 70  GLU A CD   1 
ATOM   1173  O  OE1  . GLU A  1 70  ? 128.778 110.448 61.790  1.00 26.83  ? 70  GLU A OE1  1 
ATOM   1174  O  OE2  . GLU A  1 70  ? 130.463 111.843 61.981  1.00 26.83  ? 70  GLU A OE2  1 
ATOM   1175  H  H    . GLU A  1 70  ? 129.615 107.025 65.240  1.00 26.83  ? 70  GLU A H    1 
ATOM   1176  H  HA   . GLU A  1 70  ? 131.517 107.054 63.366  1.00 26.83  ? 70  GLU A HA   1 
ATOM   1177  H  HB2  . GLU A  1 70  ? 129.538 108.203 62.974  1.00 26.83  ? 70  GLU A HB2  1 
ATOM   1178  H  HB3  . GLU A  1 70  ? 129.834 109.139 64.246  1.00 26.83  ? 70  GLU A HB3  1 
ATOM   1179  H  HG2  . GLU A  1 70  ? 131.637 110.112 63.161  1.00 26.83  ? 70  GLU A HG2  1 
ATOM   1180  H  HG3  . GLU A  1 70  ? 131.358 109.174 61.867  1.00 26.83  ? 70  GLU A HG3  1 
ATOM   1181  N  N    . TYR A  1 71  ? 132.273 108.145 66.206  1.00 17.54  ? 71  TYR A N    1 
ATOM   1182  C  CA   . TYR A  1 71  ? 133.339 108.695 67.040  1.00 17.54  ? 71  TYR A CA   1 
ATOM   1183  C  C    . TYR A  1 71  ? 133.763 107.644 68.054  1.00 17.54  ? 71  TYR A C    1 
ATOM   1184  O  O    . TYR A  1 71  ? 133.450 107.744 69.248  1.00 17.54  ? 71  TYR A O    1 
ATOM   1185  C  CB   . TYR A  1 71  ? 132.886 109.970 67.747  1.00 17.54  ? 71  TYR A CB   1 
ATOM   1186  C  CG   . TYR A  1 71  ? 132.467 111.084 66.820  1.00 17.54  ? 71  TYR A CG   1 
ATOM   1187  C  CD1  . TYR A  1 71  ? 133.403 111.856 66.155  1.00 17.54  ? 71  TYR A CD1  1 
ATOM   1188  C  CD2  . TYR A  1 71  ? 131.131 111.372 66.623  1.00 17.54  ? 71  TYR A CD2  1 
ATOM   1189  C  CE1  . TYR A  1 71  ? 133.014 112.868 65.310  1.00 17.54  ? 71  TYR A CE1  1 
ATOM   1190  C  CE2  . TYR A  1 71  ? 130.737 112.383 65.785  1.00 17.54  ? 71  TYR A CE2  1 
ATOM   1191  C  CZ   . TYR A  1 71  ? 131.679 113.129 65.132  1.00 17.54  ? 71  TYR A CZ   1 
ATOM   1192  O  OH   . TYR A  1 71  ? 131.279 114.140 64.294  1.00 17.54  ? 71  TYR A OH   1 
ATOM   1193  H  H    . TYR A  1 71  ? 131.651 107.771 66.664  1.00 17.54  ? 71  TYR A H    1 
ATOM   1194  H  HA   . TYR A  1 71  ? 134.111 108.912 66.496  1.00 17.54  ? 71  TYR A HA   1 
ATOM   1195  H  HB2  . TYR A  1 71  ? 132.132 109.762 68.314  1.00 17.54  ? 71  TYR A HB2  1 
ATOM   1196  H  HB3  . TYR A  1 71  ? 133.617 110.303 68.292  1.00 17.54  ? 71  TYR A HB3  1 
ATOM   1197  H  HD1  . TYR A  1 71  ? 134.306 111.678 66.274  1.00 17.54  ? 71  TYR A HD1  1 
ATOM   1198  H  HD2  . TYR A  1 71  ? 130.487 110.870 67.065  1.00 17.54  ? 71  TYR A HD2  1 
ATOM   1199  H  HE1  . TYR A  1 71  ? 133.651 113.377 64.865  1.00 17.54  ? 71  TYR A HE1  1 
ATOM   1200  H  HE2  . TYR A  1 71  ? 129.837 112.565 65.660  1.00 17.54  ? 71  TYR A HE2  1 
ATOM   1201  H  HH   . TYR A  1 71  ? 130.454 114.266 64.385  1.00 17.54  ? 71  TYR A HH   1 
ATOM   1202  N  N    . PRO A  1 72  ? 134.472 106.609 67.610  1.00 19.13  ? 72  PRO A N    1 
ATOM   1203  C  CA   . PRO A  1 72  ? 134.793 105.495 68.513  1.00 19.13  ? 72  PRO A CA   1 
ATOM   1204  C  C    . PRO A  1 72  ? 135.681 105.938 69.666  1.00 19.13  ? 72  PRO A C    1 
ATOM   1205  O  O    . PRO A  1 72  ? 136.740 106.539 69.464  1.00 19.13  ? 72  PRO A O    1 
ATOM   1206  C  CB   . PRO A  1 72  ? 135.506 104.489 67.603  1.00 19.13  ? 72  PRO A CB   1 
ATOM   1207  C  CG   . PRO A  1 72  ? 135.226 104.918 66.221  1.00 19.13  ? 72  PRO A CG   1 
ATOM   1208  C  CD   . PRO A  1 72  ? 134.988 106.380 66.257  1.00 19.13  ? 72  PRO A CD   1 
ATOM   1209  H  HA   . PRO A  1 72  ? 133.987 105.099 68.865  1.00 19.13  ? 72  PRO A HA   1 
ATOM   1210  H  HB2  . PRO A  1 72  ? 136.460 104.513 67.781  1.00 19.13  ? 72  PRO A HB2  1 
ATOM   1211  H  HB3  . PRO A  1 72  ? 135.152 103.599 67.764  1.00 19.13  ? 72  PRO A HB3  1 
ATOM   1212  H  HG2  . PRO A  1 72  ? 135.987 104.720 65.656  1.00 19.13  ? 72  PRO A HG2  1 
ATOM   1213  H  HG3  . PRO A  1 72  ? 134.434 104.464 65.895  1.00 19.13  ? 72  PRO A HG3  1 
ATOM   1214  H  HD2  . PRO A  1 72  ? 135.822 106.855 66.126  1.00 19.13  ? 72  PRO A HD2  1 
ATOM   1215  H  HD3  . PRO A  1 72  ? 134.329 106.629 65.595  1.00 19.13  ? 72  PRO A HD3  1 
ATOM   1216  N  N    . GLY A  1 73  ? 135.248 105.613 70.881  1.00 21.95  ? 73  GLY A N    1 
ATOM   1217  C  CA   . GLY A  1 73  ? 135.976 105.894 72.089  1.00 21.95  ? 73  GLY A CA   1 
ATOM   1218  C  C    . GLY A  1 73  ? 135.519 107.147 72.804  1.00 21.95  ? 73  GLY A C    1 
ATOM   1219  O  O    . GLY A  1 73  ? 135.698 107.258 74.021  1.00 21.95  ? 73  GLY A O    1 
ATOM   1220  H  H    . GLY A  1 73  ? 134.496 105.222 71.027  1.00 21.95  ? 73  GLY A H    1 
ATOM   1221  H  HA2  . GLY A  1 73  ? 135.888 105.150 72.703  1.00 21.95  ? 73  GLY A HA2  1 
ATOM   1222  H  HA3  . GLY A  1 73  ? 136.913 106.003 71.872  1.00 21.95  ? 73  GLY A HA3  1 
ATOM   1223  N  N    . VAL A  1 74  ? 134.927 108.088 72.075  1.00 16.48  ? 74  VAL A N    1 
ATOM   1224  C  CA   . VAL A  1 74  ? 134.454 109.334 72.658  1.00 16.48  ? 74  VAL A CA   1 
ATOM   1225  C  C    . VAL A  1 74  ? 133.034 109.145 73.166  1.00 16.48  ? 74  VAL A C    1 
ATOM   1226  O  O    . VAL A  1 74  ? 132.063 109.386 72.442  1.00 16.48  ? 74  VAL A O    1 
ATOM   1227  C  CB   . VAL A  1 74  ? 134.537 110.482 71.641  1.00 16.48  ? 74  VAL A CB   1 
ATOM   1228  C  CG1  . VAL A  1 74  ? 134.148 111.779 72.288  1.00 16.48  ? 74  VAL A CG1  1 
ATOM   1229  C  CG2  . VAL A  1 74  ? 135.931 110.580 71.089  1.00 16.48  ? 74  VAL A CG2  1 
ATOM   1230  H  H    . VAL A  1 74  ? 134.794 108.028 71.229  1.00 16.48  ? 74  VAL A H    1 
ATOM   1231  H  HA   . VAL A  1 74  ? 135.014 109.563 73.411  1.00 16.48  ? 74  VAL A HA   1 
ATOM   1232  H  HB   . VAL A  1 74  ? 133.930 110.311 70.908  1.00 16.48  ? 74  VAL A HB   1 
ATOM   1233  H  HG11 . VAL A  1 74  ? 134.434 112.507 71.720  1.00 16.48  ? 74  VAL A HG11 1 
ATOM   1234  H  HG12 . VAL A  1 74  ? 133.188 111.798 72.395  1.00 16.48  ? 74  VAL A HG12 1 
ATOM   1235  H  HG13 . VAL A  1 74  ? 134.585 111.843 73.149  1.00 16.48  ? 74  VAL A HG13 1 
ATOM   1236  H  HG21 . VAL A  1 74  ? 135.972 111.323 70.470  1.00 16.48  ? 74  VAL A HG21 1 
ATOM   1237  H  HG22 . VAL A  1 74  ? 136.539 110.727 71.828  1.00 16.48  ? 74  VAL A HG22 1 
ATOM   1238  H  HG23 . VAL A  1 74  ? 136.154 109.756 70.635  1.00 16.48  ? 74  VAL A HG23 1 
ATOM   1239  N  N    . LYS A  1 75  ? 132.909 108.708 74.416  1.00 16.26  ? 75  LYS A N    1 
ATOM   1240  C  CA   . LYS A  1 75  ? 131.613 108.505 75.042  1.00 16.26  ? 75  LYS A CA   1 
ATOM   1241  C  C    . LYS A  1 75  ? 131.139 109.695 75.852  1.00 16.26  ? 75  LYS A C    1 
ATOM   1242  O  O    . LYS A  1 75  ? 129.970 109.724 76.242  1.00 16.26  ? 75  LYS A O    1 
ATOM   1243  C  CB   . LYS A  1 75  ? 131.652 107.301 75.976  1.00 16.26  ? 75  LYS A CB   1 
ATOM   1244  C  CG   . LYS A  1 75  ? 131.990 106.006 75.316  1.00 16.26  ? 75  LYS A CG   1 
ATOM   1245  C  CD   . LYS A  1 75  ? 131.812 104.869 76.284  1.00 16.26  ? 75  LYS A CD   1 
ATOM   1246  C  CE   . LYS A  1 75  ? 132.580 103.658 75.831  1.00 16.26  ? 75  LYS A CE   1 
ATOM   1247  N  NZ   . LYS A  1 75  ? 131.957 103.075 74.620  1.00 16.26  ? 75  LYS A NZ   1 
ATOM   1248  H  H    . LYS A  1 75  ? 133.570 108.519 74.926  1.00 16.26  ? 75  LYS A H    1 
ATOM   1249  H  HA   . LYS A  1 75  ? 130.959 108.331 74.354  1.00 16.26  ? 75  LYS A HA   1 
ATOM   1250  H  HB2  . LYS A  1 75  ? 132.321 107.468 76.656  1.00 16.26  ? 75  LYS A HB2  1 
ATOM   1251  H  HB3  . LYS A  1 75  ? 130.781 107.207 76.384  1.00 16.26  ? 75  LYS A HB3  1 
ATOM   1252  H  HG2  . LYS A  1 75  ? 131.396 105.862 74.565  1.00 16.26  ? 75  LYS A HG2  1 
ATOM   1253  H  HG3  . LYS A  1 75  ? 132.913 106.024 75.024  1.00 16.26  ? 75  LYS A HG3  1 
ATOM   1254  H  HD2  . LYS A  1 75  ? 132.143 105.138 77.154  1.00 16.26  ? 75  LYS A HD2  1 
ATOM   1255  H  HD3  . LYS A  1 75  ? 130.874 104.639 76.335  1.00 16.26  ? 75  LYS A HD3  1 
ATOM   1256  H  HE2  . LYS A  1 75  ? 133.489 103.917 75.616  1.00 16.26  ? 75  LYS A HE2  1 
ATOM   1257  H  HE3  . LYS A  1 75  ? 132.576 102.993 76.536  1.00 16.26  ? 75  LYS A HE3  1 
ATOM   1258  H  HZ1  . LYS A  1 75  ? 132.465 102.418 74.301  1.00 16.26  ? 75  LYS A HZ1  1 
ATOM   1259  H  HZ2  . LYS A  1 75  ? 131.152 102.753 74.819  1.00 16.26  ? 75  LYS A HZ2  1 
ATOM   1260  H  HZ3  . LYS A  1 75  ? 131.871 103.705 73.998  1.00 16.26  ? 75  LYS A HZ3  1 
ATOM   1261  N  N    . THR A  1 76  ? 132.014 110.644 76.160  1.00 9.26   ? 76  THR A N    1 
ATOM   1262  C  CA   . THR A  1 76  ? 131.603 111.804 76.926  1.00 9.26   ? 76  THR A CA   1 
ATOM   1263  C  C    . THR A  1 76  ? 132.416 113.008 76.501  1.00 9.26   ? 76  THR A C    1 
ATOM   1264  O  O    . THR A  1 76  ? 133.507 112.888 75.939  1.00 9.26   ? 76  THR A O    1 
ATOM   1265  C  CB   . THR A  1 76  ? 131.765 111.592 78.431  1.00 9.26   ? 76  THR A CB   1 
ATOM   1266  O  OG1  . THR A  1 76  ? 133.121 111.257 78.730  1.00 9.26   ? 76  THR A OG1  1 
ATOM   1267  C  CG2  . THR A  1 76  ? 130.872 110.497 78.918  1.00 9.26   ? 76  THR A CG2  1 
ATOM   1268  H  H    . THR A  1 76  ? 132.843 110.642 75.943  1.00 9.26   ? 76  THR A H    1 
ATOM   1269  H  HA   . THR A  1 76  ? 130.676 111.988 76.744  1.00 9.26   ? 76  THR A HA   1 
ATOM   1270  H  HB   . THR A  1 76  ? 131.522 112.405 78.888  1.00 9.26   ? 76  THR A HB   1 
ATOM   1271  H  HG1  . THR A  1 76  ? 133.150 110.881 79.480  1.00 9.26   ? 76  THR A HG1  1 
ATOM   1272  H  HG21 . THR A  1 76  ? 131.004 110.374 79.869  1.00 9.26   ? 76  THR A HG21 1 
ATOM   1273  H  HG22 . THR A  1 76  ? 129.946 110.727 78.752  1.00 9.26   ? 76  THR A HG22 1 
ATOM   1274  H  HG23 . THR A  1 76  ? 131.085 109.673 78.461  1.00 9.26   ? 76  THR A HG23 1 
ATOM   1275  N  N    . VAL A  1 77  ? 131.857 114.179 76.782  1.00 7.72   ? 77  VAL A N    1 
ATOM   1276  C  CA   . VAL A  1 77  ? 132.555 115.442 76.625  1.00 7.72   ? 77  VAL A CA   1 
ATOM   1277  C  C    . VAL A  1 77  ? 132.291 116.285 77.860  1.00 7.72   ? 77  VAL A C    1 
ATOM   1278  O  O    . VAL A  1 77  ? 131.351 116.046 78.619  1.00 7.72   ? 77  VAL A O    1 
ATOM   1279  C  CB   . VAL A  1 77  ? 132.142 116.198 75.347  1.00 7.72   ? 77  VAL A CB   1 
ATOM   1280  C  CG1  . VAL A  1 77  ? 132.487 115.390 74.135  1.00 7.72   ? 77  VAL A CG1  1 
ATOM   1281  C  CG2  . VAL A  1 77  ? 130.678 116.503 75.351  1.00 7.72   ? 77  VAL A CG2  1 
ATOM   1282  H  H    . VAL A  1 77  ? 131.059 114.267 77.079  1.00 7.72   ? 77  VAL A H    1 
ATOM   1283  H  HA   . VAL A  1 77  ? 133.503 115.271 76.573  1.00 7.72   ? 77  VAL A HA   1 
ATOM   1284  H  HB   . VAL A  1 77  ? 132.623 117.033 75.306  1.00 7.72   ? 77  VAL A HB   1 
ATOM   1285  H  HG11 . VAL A  1 77  ? 132.208 115.879 73.347  1.00 7.72   ? 77  VAL A HG11 1 
ATOM   1286  H  HG12 . VAL A  1 77  ? 133.442 115.242 74.117  1.00 7.72   ? 77  VAL A HG12 1 
ATOM   1287  H  HG13 . VAL A  1 77  ? 132.023 114.545 74.190  1.00 7.72   ? 77  VAL A HG13 1 
ATOM   1288  H  HG21 . VAL A  1 77  ? 130.434 116.840 74.477  1.00 7.72   ? 77  VAL A HG21 1 
ATOM   1289  H  HG22 . VAL A  1 77  ? 130.191 115.691 75.540  1.00 7.72   ? 77  VAL A HG22 1 
ATOM   1290  H  HG23 . VAL A  1 77  ? 130.498 117.171 76.025  1.00 7.72   ? 77  VAL A HG23 1 
ATOM   1291  N  N    . ARG A  1 78  ? 133.156 117.269 78.066  1.00 6.76   ? 78  ARG A N    1 
ATOM   1292  C  CA   . ARG A  1 78  ? 133.077 118.155 79.213  1.00 6.76   ? 78  ARG A CA   1 
ATOM   1293  C  C    . ARG A  1 78  ? 133.202 119.588 78.742  1.00 6.76   ? 78  ARG A C    1 
ATOM   1294  O  O    . ARG A  1 78  ? 134.082 119.908 77.938  1.00 6.76   ? 78  ARG A O    1 
ATOM   1295  C  CB   . ARG A  1 78  ? 134.162 117.840 80.230  1.00 6.76   ? 78  ARG A CB   1 
ATOM   1296  C  CG   . ARG A  1 78  ? 133.905 116.573 80.965  1.00 6.76   ? 78  ARG A CG   1 
ATOM   1297  C  CD   . ARG A  1 78  ? 135.154 115.780 81.171  1.00 6.76   ? 78  ARG A CD   1 
ATOM   1298  N  NE   . ARG A  1 78  ? 134.848 114.380 81.423  1.00 6.76   ? 78  ARG A NE   1 
ATOM   1299  C  CZ   . ARG A  1 78  ? 134.959 113.408 80.528  1.00 6.76   ? 78  ARG A CZ   1 
ATOM   1300  N  NH1  . ARG A  1 78  ? 135.369 113.658 79.298  1.00 6.76   ? 78  ARG A NH1  1 
ATOM   1301  N  NH2  . ARG A  1 78  ? 134.652 112.173 80.872  1.00 6.76   ? 78  ARG A NH2  1 
ATOM   1302  H  H    . ARG A  1 78  ? 133.807 117.452 77.542  1.00 6.76   ? 78  ARG A H    1 
ATOM   1303  H  HA   . ARG A  1 78  ? 132.221 118.048 79.640  1.00 6.76   ? 78  ARG A HA   1 
ATOM   1304  H  HB2  . ARG A  1 78  ? 135.008 117.762 79.773  1.00 6.76   ? 78  ARG A HB2  1 
ATOM   1305  H  HB3  . ARG A  1 78  ? 134.198 118.556 80.877  1.00 6.76   ? 78  ARG A HB3  1 
ATOM   1306  H  HG2  . ARG A  1 78  ? 133.534 116.786 81.832  1.00 6.76   ? 78  ARG A HG2  1 
ATOM   1307  H  HG3  . ARG A  1 78  ? 133.288 116.038 80.449  1.00 6.76   ? 78  ARG A HG3  1 
ATOM   1308  H  HD2  . ARG A  1 78  ? 135.712 115.845 80.387  1.00 6.76   ? 78  ARG A HD2  1 
ATOM   1309  H  HD3  . ARG A  1 78  ? 135.618 116.133 81.940  1.00 6.76   ? 78  ARG A HD3  1 
ATOM   1310  H  HE   . ARG A  1 78  ? 134.806 114.136 82.240  1.00 6.76   ? 78  ARG A HE   1 
ATOM   1311  H  HH11 . ARG A  1 78  ? 135.571 114.456 79.063  1.00 6.76   ? 78  ARG A HH11 1 
ATOM   1312  H  HH12 . ARG A  1 78  ? 135.433 113.016 78.735  1.00 6.76   ? 78  ARG A HH12 1 
ATOM   1313  H  HH21 . ARG A  1 78  ? 134.383 112.008 81.670  1.00 6.76   ? 78  ARG A HH21 1 
ATOM   1314  H  HH22 . ARG A  1 78  ? 134.719 111.540 80.298  1.00 6.76   ? 78  ARG A HH22 1 
ATOM   1315  N  N    . PHE A  1 79  ? 132.326 120.440 79.251  1.00 7.93   ? 79  PHE A N    1 
ATOM   1316  C  CA   . PHE A  1 79  ? 132.313 121.822 78.843  1.00 7.93   ? 79  PHE A CA   1 
ATOM   1317  C  C    . PHE A  1 79  ? 132.402 122.741 80.053  1.00 7.93   ? 79  PHE A C    1 
ATOM   1318  O  O    . PHE A  1 79  ? 131.744 122.496 81.070  1.00 7.93   ? 79  PHE A O    1 
ATOM   1319  C  CB   . PHE A  1 79  ? 131.055 122.148 78.046  1.00 7.93   ? 79  PHE A CB   1 
ATOM   1320  C  CG   . PHE A  1 79  ? 131.088 121.634 76.645  1.00 7.93   ? 79  PHE A CG   1 
ATOM   1321  C  CD1  . PHE A  1 79  ? 131.834 122.277 75.683  1.00 7.93   ? 79  PHE A CD1  1 
ATOM   1322  C  CD2  . PHE A  1 79  ? 130.382 120.507 76.290  1.00 7.93   ? 79  PHE A CD2  1 
ATOM   1323  C  CE1  . PHE A  1 79  ? 131.872 121.806 74.398  1.00 7.93   ? 79  PHE A CE1  1 
ATOM   1324  C  CE2  . PHE A  1 79  ? 130.418 120.037 75.007  1.00 7.93   ? 79  PHE A CE2  1 
ATOM   1325  C  CZ   . PHE A  1 79  ? 131.163 120.686 74.061  1.00 7.93   ? 79  PHE A CZ   1 
ATOM   1326  H  H    . PHE A  1 79  ? 131.735 120.240 79.836  1.00 7.93   ? 79  PHE A H    1 
ATOM   1327  H  HA   . PHE A  1 79  ? 133.061 121.972 78.260  1.00 7.93   ? 79  PHE A HA   1 
ATOM   1328  H  HB2  . PHE A  1 79  ? 130.295 121.752 78.490  1.00 7.93   ? 79  PHE A HB2  1 
ATOM   1329  H  HB3  . PHE A  1 79  ? 130.958 123.108 78.010  1.00 7.93   ? 79  PHE A HB3  1 
ATOM   1330  H  HD1  . PHE A  1 79  ? 132.316 123.035 75.910  1.00 7.93   ? 79  PHE A HD1  1 
ATOM   1331  H  HD2  . PHE A  1 79  ? 129.875 120.063 76.927  1.00 7.93   ? 79  PHE A HD2  1 
ATOM   1332  H  HE1  . PHE A  1 79  ? 132.376 122.247 73.757  1.00 7.93   ? 79  PHE A HE1  1 
ATOM   1333  H  HE2  . PHE A  1 79  ? 129.938 119.278 74.778  1.00 7.93   ? 79  PHE A HE2  1 
ATOM   1334  H  HZ   . PHE A  1 79  ? 131.187 120.368 73.190  1.00 7.93   ? 79  PHE A HZ   1 
ATOM   1335  N  N    . PRO A  1 80  ? 133.211 123.794 79.979  1.00 5.62   ? 80  PRO A N    1 
ATOM   1336  C  CA   . PRO A  1 80  ? 133.288 124.749 81.087  1.00 5.62   ? 80  PRO A CA   1 
ATOM   1337  C  C    . PRO A  1 80  ? 132.028 125.575 81.267  1.00 5.62   ? 80  PRO A C    1 
ATOM   1338  O  O    . PRO A  1 80  ? 131.003 125.330 80.625  1.00 5.62   ? 80  PRO A O    1 
ATOM   1339  C  CB   . PRO A  1 80  ? 134.475 125.630 80.697  1.00 5.62   ? 80  PRO A CB   1 
ATOM   1340  C  CG   . PRO A  1 80  ? 135.263 124.812 79.801  1.00 5.62   ? 80  PRO A CG   1 
ATOM   1341  C  CD   . PRO A  1 80  ? 134.298 124.024 79.017  1.00 5.62   ? 80  PRO A CD   1 
ATOM   1342  H  HA   . PRO A  1 80  ? 133.490 124.285 81.910  1.00 5.62   ? 80  PRO A HA   1 
ATOM   1343  H  HB2  . PRO A  1 80  ? 134.147 126.417 80.242  1.00 5.62   ? 80  PRO A HB2  1 
ATOM   1344  H  HB3  . PRO A  1 80  ? 134.981 125.863 81.486  1.00 5.62   ? 80  PRO A HB3  1 
ATOM   1345  H  HG2  . PRO A  1 80  ? 135.785 125.382 79.221  1.00 5.62   ? 80  PRO A HG2  1 
ATOM   1346  H  HG3  . PRO A  1 80  ? 135.832 124.227 80.317  1.00 5.62   ? 80  PRO A HG3  1 
ATOM   1347  H  HD2  . PRO A  1 80  ? 133.980 124.536 78.262  1.00 5.62   ? 80  PRO A HD2  1 
ATOM   1348  H  HD3  . PRO A  1 80  ? 134.706 123.191 78.746  1.00 5.62   ? 80  PRO A HD3  1 
ATOM   1349  N  N    . ASP A  1 81  ? 132.108 126.556 82.164  1.00 1.57   ? 81  ASP A N    1 
ATOM   1350  C  CA   . ASP A  1 81  ? 130.930 127.315 82.561  1.00 1.57   ? 81  ASP A CA   1 
ATOM   1351  C  C    . ASP A  1 81  ? 130.246 127.964 81.363  1.00 1.57   ? 81  ASP A C    1 
ATOM   1352  O  O    . ASP A  1 81  ? 129.095 127.649 81.040  1.00 1.57   ? 81  ASP A O    1 
ATOM   1353  C  CB   . ASP A  1 81  ? 131.326 128.373 83.588  1.00 1.57   ? 81  ASP A CB   1 
ATOM   1354  C  CG   . ASP A  1 81  ? 130.143 128.894 84.375  1.00 1.57   ? 81  ASP A CG   1 
ATOM   1355  O  OD1  . ASP A  1 81  ? 129.546 128.113 85.144  1.00 1.57   ? 81  ASP A OD1  1 
ATOM   1356  O  OD2  . ASP A  1 81  ? 129.806 130.085 84.223  1.00 1.57   ? 81  ASP A OD2  1 
ATOM   1357  H  H    . ASP A  1 81  ? 132.833 126.800 82.552  1.00 1.57   ? 81  ASP A H    1 
ATOM   1358  H  HA   . ASP A  1 81  ? 130.304 126.710 82.977  1.00 1.57   ? 81  ASP A HA   1 
ATOM   1359  H  HB2  . ASP A  1 81  ? 131.961 127.988 84.209  1.00 1.57   ? 81  ASP A HB2  1 
ATOM   1360  H  HB3  . ASP A  1 81  ? 131.730 129.118 83.122  1.00 1.57   ? 81  ASP A HB3  1 
ATOM   1361  N  N    . GLY A  1 82  ? 130.941 128.874 80.691  1.00 18.79  ? 82  GLY A N    1 
ATOM   1362  C  CA   . GLY A  1 82  ? 130.294 129.759 79.745  1.00 18.79  ? 82  GLY A CA   1 
ATOM   1363  C  C    . GLY A  1 82  ? 130.223 129.271 78.317  1.00 18.79  ? 82  GLY A C    1 
ATOM   1364  O  O    . GLY A  1 82  ? 129.974 130.065 77.406  1.00 18.79  ? 82  GLY A O    1 
ATOM   1365  H  H    . GLY A  1 82  ? 131.787 128.995 80.769  1.00 18.79  ? 82  GLY A H    1 
ATOM   1366  H  HA2  . GLY A  1 82  ? 129.388 129.921 80.041  1.00 18.79  ? 82  GLY A HA2  1 
ATOM   1367  H  HA3  . GLY A  1 82  ? 130.764 130.603 79.741  1.00 18.79  ? 82  GLY A HA3  1 
ATOM   1368  N  N    . GLN A  1 83  ? 130.436 127.976 78.099  1.00 20.72  ? 83  GLN A N    1 
ATOM   1369  C  CA   . GLN A  1 83  ? 130.409 127.423 76.755  1.00 20.72  ? 83  GLN A CA   1 
ATOM   1370  C  C    . GLN A  1 83  ? 129.110 126.714 76.419  1.00 20.72  ? 83  GLN A C    1 
ATOM   1371  O  O    . GLN A  1 83  ? 128.835 126.495 75.235  1.00 20.72  ? 83  GLN A O    1 
ATOM   1372  C  CB   . GLN A  1 83  ? 131.572 126.454 76.565  1.00 20.72  ? 83  GLN A CB   1 
ATOM   1373  C  CG   . GLN A  1 83  ? 132.908 127.142 76.566  1.00 20.72  ? 83  GLN A CG   1 
ATOM   1374  C  CD   . GLN A  1 83  ? 133.926 126.474 75.683  1.00 20.72  ? 83  GLN A CD   1 
ATOM   1375  O  OE1  . GLN A  1 83  ? 133.586 125.819 74.699  1.00 20.72  ? 83  GLN A OE1  1 
ATOM   1376  N  NE2  . GLN A  1 83  ? 135.192 126.643 76.026  1.00 20.72  ? 83  GLN A NE2  1 
ATOM   1377  H  H    . GLN A  1 83  ? 130.597 127.399 78.710  1.00 20.72  ? 83  GLN A H    1 
ATOM   1378  H  HA   . GLN A  1 83  ? 130.522 128.142 76.121  1.00 20.72  ? 83  GLN A HA   1 
ATOM   1379  H  HB2  . GLN A  1 83  ? 131.559 125.814 77.289  1.00 20.72  ? 83  GLN A HB2  1 
ATOM   1380  H  HB3  . GLN A  1 83  ? 131.463 126.004 75.716  1.00 20.72  ? 83  GLN A HB3  1 
ATOM   1381  H  HG2  . GLN A  1 83  ? 132.786 128.045 76.240  1.00 20.72  ? 83  GLN A HG2  1 
ATOM   1382  H  HG3  . GLN A  1 83  ? 133.258 127.157 77.467  1.00 20.72  ? 83  GLN A HG3  1 
ATOM   1383  H  HE21 . GLN A  1 83  ? 135.383 127.112 76.720  1.00 20.72  ? 83  GLN A HE21 1 
ATOM   1384  H  HE22 . GLN A  1 83  ? 135.818 126.289 75.559  1.00 20.72  ? 83  GLN A HE22 1 
ATOM   1385  N  N    . ILE A  1 84  ? 128.309 126.349 77.417  1.00 13.56  ? 84  ILE A N    1 
ATOM   1386  C  CA   . ILE A  1 84  ? 127.001 125.758 77.190  1.00 13.56  ? 84  ILE A CA   1 
ATOM   1387  C  C    . ILE A  1 84  ? 126.031 126.273 78.242  1.00 13.56  ? 84  ILE A C    1 
ATOM   1388  O  O    . ILE A  1 84  ? 126.413 126.904 79.228  1.00 13.56  ? 84  ILE A O    1 
ATOM   1389  C  CB   . ILE A  1 84  ? 127.039 124.216 77.192  1.00 13.56  ? 84  ILE A CB   1 
ATOM   1390  C  CG1  . ILE A  1 84  ? 127.470 123.665 78.545  1.00 13.56  ? 84  ILE A CG1  1 
ATOM   1391  C  CG2  . ILE A  1 84  ? 127.968 123.714 76.120  1.00 13.56  ? 84  ILE A CG2  1 
ATOM   1392  C  CD1  . ILE A  1 84  ? 126.869 122.337 78.816  1.00 13.56  ? 84  ILE A CD1  1 
ATOM   1393  H  H    . ILE A  1 84  ? 128.504 126.437 78.246  1.00 13.56  ? 84  ILE A H    1 
ATOM   1394  H  HA   . ILE A  1 84  ? 126.676 126.043 76.327  1.00 13.56  ? 84  ILE A HA   1 
ATOM   1395  H  HB   . ILE A  1 84  ? 126.150 123.887 77.007  1.00 13.56  ? 84  ILE A HB   1 
ATOM   1396  H  HG12 . ILE A  1 84  ? 128.431 123.559 78.548  1.00 13.56  ? 84  ILE A HG12 1 
ATOM   1397  H  HG13 . ILE A  1 84  ? 127.206 124.266 79.252  1.00 13.56  ? 84  ILE A HG13 1 
ATOM   1398  H  HG21 . ILE A  1 84  ? 127.956 122.747 76.131  1.00 13.56  ? 84  ILE A HG21 1 
ATOM   1399  H  HG22 . ILE A  1 84  ? 127.665 124.041 75.262  1.00 13.56  ? 84  ILE A HG22 1 
ATOM   1400  H  HG23 . ILE A  1 84  ? 128.859 124.041 76.301  1.00 13.56  ? 84  ILE A HG23 1 
ATOM   1401  H  HD11 . ILE A  1 84  ? 127.121 122.045 79.702  1.00 13.56  ? 84  ILE A HD11 1 
ATOM   1402  H  HD12 . ILE A  1 84  ? 125.908 122.418 78.750  1.00 13.56  ? 84  ILE A HD12 1 
ATOM   1403  H  HD13 . ILE A  1 84  ? 127.187 121.713 78.151  1.00 13.56  ? 84  ILE A HD13 1 
ATOM   1404  N  N    . TRP A  1 85  ? 124.757 125.987 78.009  1.00 9.53   ? 85  TRP A N    1 
ATOM   1405  C  CA   . TRP A  1 85  ? 123.677 126.477 78.844  1.00 9.53   ? 85  TRP A CA   1 
ATOM   1406  C  C    . TRP A  1 85  ? 123.619 125.724 80.165  1.00 9.53   ? 85  TRP A C    1 
ATOM   1407  O  O    . TRP A  1 85  ? 123.665 124.491 80.193  1.00 9.53   ? 85  TRP A O    1 
ATOM   1408  C  CB   . TRP A  1 85  ? 122.359 126.334 78.089  1.00 9.53   ? 85  TRP A CB   1 
ATOM   1409  C  CG   . TRP A  1 85  ? 121.177 126.920 78.765  1.00 9.53   ? 85  TRP A CG   1 
ATOM   1410  C  CD1  . TRP A  1 85  ? 120.722 128.190 78.652  1.00 9.53   ? 85  TRP A CD1  1 
ATOM   1411  C  CD2  . TRP A  1 85  ? 120.275 126.248 79.646  1.00 9.53   ? 85  TRP A CD2  1 
ATOM   1412  N  NE1  . TRP A  1 85  ? 119.600 128.362 79.415  1.00 9.53   ? 85  TRP A NE1  1 
ATOM   1413  C  CE2  . TRP A  1 85  ? 119.305 127.179 80.036  1.00 9.53   ? 85  TRP A CE2  1 
ATOM   1414  C  CE3  . TRP A  1 85  ? 120.197 124.949 80.146  1.00 9.53   ? 85  TRP A CE3  1 
ATOM   1415  C  CZ2  . TRP A  1 85  ? 118.274 126.855 80.901  1.00 9.53   ? 85  TRP A CZ2  1 
ATOM   1416  C  CZ3  . TRP A  1 85  ? 119.177 124.634 81.001  1.00 9.53   ? 85  TRP A CZ3  1 
ATOM   1417  C  CH2  . TRP A  1 85  ? 118.228 125.579 81.371  1.00 9.53   ? 85  TRP A CH2  1 
ATOM   1418  H  H    . TRP A  1 85  ? 124.487 125.509 77.353  1.00 9.53   ? 85  TRP A H    1 
ATOM   1419  H  HA   . TRP A  1 85  ? 123.824 127.411 79.035  1.00 9.53   ? 85  TRP A HA   1 
ATOM   1420  H  HB2  . TRP A  1 85  ? 122.449 126.769 77.231  1.00 9.53   ? 85  TRP A HB2  1 
ATOM   1421  H  HB3  . TRP A  1 85  ? 122.187 125.392 77.961  1.00 9.53   ? 85  TRP A HB3  1 
ATOM   1422  H  HD1  . TRP A  1 85  ? 121.119 128.848 78.137  1.00 9.53   ? 85  TRP A HD1  1 
ATOM   1423  H  HE1  . TRP A  1 85  ? 119.155 129.090 79.489  1.00 9.53   ? 85  TRP A HE1  1 
ATOM   1424  H  HE3  . TRP A  1 85  ? 120.824 124.310 79.908  1.00 9.53   ? 85  TRP A HE3  1 
ATOM   1425  H  HZ2  . TRP A  1 85  ? 117.639 127.481 81.151  1.00 9.53   ? 85  TRP A HZ2  1 
ATOM   1426  H  HZ3  . TRP A  1 85  ? 119.116 123.776 81.340  1.00 9.53   ? 85  TRP A HZ3  1 
ATOM   1427  H  HH2  . TRP A  1 85  ? 117.549 125.335 81.951  1.00 9.53   ? 85  TRP A HH2  1 
ATOM   1428  N  N    . LYS A  1 86  ? 123.520 126.474 81.257  1.00 7.23   ? 86  LYS A N    1 
ATOM   1429  C  CA   . LYS A  1 86  ? 123.205 125.946 82.566  1.00 7.23   ? 86  LYS A CA   1 
ATOM   1430  C  C    . LYS A  1 86  ? 121.991 126.675 83.119  1.00 7.23   ? 86  LYS A C    1 
ATOM   1431  O  O    . LYS A  1 86  ? 121.787 127.857 82.827  1.00 7.23   ? 86  LYS A O    1 
ATOM   1432  C  CB   . LYS A  1 86  ? 124.356 126.103 83.563  1.00 7.23   ? 86  LYS A CB   1 
ATOM   1433  C  CG   . LYS A  1 86  ? 125.655 125.513 83.149  1.00 7.23   ? 86  LYS A CG   1 
ATOM   1434  C  CD   . LYS A  1 86  ? 126.765 126.157 83.922  1.00 7.23   ? 86  LYS A CD   1 
ATOM   1435  C  CE   . LYS A  1 86  ? 128.048 125.399 83.753  1.00 7.23   ? 86  LYS A CE   1 
ATOM   1436  N  NZ   . LYS A  1 86  ? 129.023 125.706 84.831  1.00 7.23   ? 86  LYS A NZ   1 
ATOM   1437  H  H    . LYS A  1 86  ? 123.626 127.323 81.260  1.00 7.23   ? 86  LYS A H    1 
ATOM   1438  H  HA   . LYS A  1 86  ? 123.004 125.009 82.480  1.00 7.23   ? 86  LYS A HA   1 
ATOM   1439  H  HB2  . LYS A  1 86  ? 124.508 127.044 83.717  1.00 7.23   ? 86  LYS A HB2  1 
ATOM   1440  H  HB3  . LYS A  1 86  ? 124.104 125.675 84.392  1.00 7.23   ? 86  LYS A HB3  1 
ATOM   1441  H  HG2  . LYS A  1 86  ? 125.653 124.568 83.345  1.00 7.23   ? 86  LYS A HG2  1 
ATOM   1442  H  HG3  . LYS A  1 86  ? 125.800 125.670 82.208  1.00 7.23   ? 86  LYS A HG3  1 
ATOM   1443  H  HD2  . LYS A  1 86  ? 126.898 127.057 83.596  1.00 7.23   ? 86  LYS A HD2  1 
ATOM   1444  H  HD3  . LYS A  1 86  ? 126.533 126.173 84.860  1.00 7.23   ? 86  LYS A HD3  1 
ATOM   1445  H  HE2  . LYS A  1 86  ? 127.855 124.452 83.781  1.00 7.23   ? 86  LYS A HE2  1 
ATOM   1446  H  HE3  . LYS A  1 86  ? 128.437 125.634 82.898  1.00 7.23   ? 86  LYS A HE3  1 
ATOM   1447  H  HZ1  . LYS A  1 86  ? 129.826 125.386 84.616  1.00 7.23   ? 86  LYS A HZ1  1 
ATOM   1448  H  HZ2  . LYS A  1 86  ? 129.079 126.586 84.941  1.00 7.23   ? 86  LYS A HZ2  1 
ATOM   1449  H  HZ3  . LYS A  1 86  ? 128.759 125.338 85.595  1.00 7.23   ? 86  LYS A HZ3  1 
ATOM   1450  N  N    . PRO A  1 87  ? 121.168 126.005 83.915  1.00 9.10   ? 87  PRO A N    1 
ATOM   1451  C  CA   . PRO A  1 87  ? 120.006 126.679 84.487  1.00 9.10   ? 87  PRO A CA   1 
ATOM   1452  C  C    . PRO A  1 87  ? 120.390 127.609 85.622  1.00 9.10   ? 87  PRO A C    1 
ATOM   1453  O  O    . PRO A  1 87  ? 121.394 127.418 86.312  1.00 9.10   ? 87  PRO A O    1 
ATOM   1454  C  CB   . PRO A  1 87  ? 119.137 125.519 84.976  1.00 9.10   ? 87  PRO A CB   1 
ATOM   1455  C  CG   . PRO A  1 87  ? 120.071 124.419 85.173  1.00 9.10   ? 87  PRO A CG   1 
ATOM   1456  C  CD   . PRO A  1 87  ? 121.098 124.555 84.126  1.00 9.10   ? 87  PRO A CD   1 
ATOM   1457  H  HA   . PRO A  1 87  ? 119.537 127.183 83.810  1.00 9.10   ? 87  PRO A HA   1 
ATOM   1458  H  HB2  . PRO A  1 87  ? 118.699 125.761 85.801  1.00 9.10   ? 87  PRO A HB2  1 
ATOM   1459  H  HB3  . PRO A  1 87  ? 118.495 125.289 84.291  1.00 9.10   ? 87  PRO A HB3  1 
ATOM   1460  H  HG2  . PRO A  1 87  ? 120.470 124.483 86.050  1.00 9.10   ? 87  PRO A HG2  1 
ATOM   1461  H  HG3  . PRO A  1 87  ? 119.601 123.582 85.068  1.00 9.10   ? 87  PRO A HG3  1 
ATOM   1462  H  HD2  . PRO A  1 87  ? 121.948 124.219 84.440  1.00 9.10   ? 87  PRO A HD2  1 
ATOM   1463  H  HD3  . PRO A  1 87  ? 120.804 124.118 83.318  1.00 9.10   ? 87  PRO A HD3  1 
ATOM   1464  N  N    . ASP A  1 88  ? 119.563 128.631 85.804  1.00 11.94  ? 88  ASP A N    1 
ATOM   1465  C  CA   . ASP A  1 88  ? 119.778 129.660 86.815  1.00 11.94  ? 88  ASP A CA   1 
ATOM   1466  C  C    . ASP A  1 88  ? 119.156 129.277 88.152  1.00 11.94  ? 88  ASP A C    1 
ATOM   1467  O  O    . ASP A  1 88  ? 118.389 130.026 88.751  1.00 11.94  ? 88  ASP A O    1 
ATOM   1468  C  CB   . ASP A  1 88  ? 119.236 130.986 86.299  1.00 11.94  ? 88  ASP A CB   1 
ATOM   1469  C  CG   . ASP A  1 88  ? 117.751 130.951 86.047  1.00 11.94  ? 88  ASP A CG   1 
ATOM   1470  O  OD1  . ASP A  1 88  ? 117.142 129.880 86.235  1.00 11.94  ? 88  ASP A OD1  1 
ATOM   1471  O  OD2  . ASP A  1 88  ? 117.195 131.990 85.638  1.00 11.94  ? 88  ASP A OD2  1 
ATOM   1472  H  H    . ASP A  1 88  ? 118.846 128.750 85.348  1.00 11.94  ? 88  ASP A H    1 
ATOM   1473  H  HA   . ASP A  1 88  ? 120.728 129.766 86.956  1.00 11.94  ? 88  ASP A HA   1 
ATOM   1474  H  HB2  . ASP A  1 88  ? 119.405 131.673 86.958  1.00 11.94  ? 88  ASP A HB2  1 
ATOM   1475  H  HB3  . ASP A  1 88  ? 119.673 131.202 85.464  1.00 11.94  ? 88  ASP A HB3  1 
ATOM   1476  N  N    . ILE A  1 89  ? 119.510 128.090 88.630  1.00 10.59  ? 89  ILE A N    1 
ATOM   1477  C  CA   . ILE A  1 89  ? 119.055 127.611 89.930  1.00 10.59  ? 89  ILE A CA   1 
ATOM   1478  C  C    . ILE A  1 89  ? 119.972 128.194 90.991  1.00 10.59  ? 89  ILE A C    1 
ATOM   1479  O  O    . ILE A  1 89  ? 121.191 128.006 90.942  1.00 10.59  ? 89  ILE A O    1 
ATOM   1480  C  CB   . ILE A  1 89  ? 119.060 126.080 89.997  1.00 10.59  ? 89  ILE A CB   1 
ATOM   1481  C  CG1  . ILE A  1 89  ? 118.356 125.468 88.791  1.00 10.59  ? 89  ILE A CG1  1 
ATOM   1482  C  CG2  . ILE A  1 89  ? 118.394 125.623 91.260  1.00 10.59  ? 89  ILE A CG2  1 
ATOM   1483  C  CD1  . ILE A  1 89  ? 116.923 125.746 88.722  1.00 10.59  ? 89  ILE A CD1  1 
ATOM   1484  H  H    . ILE A  1 89  ? 120.020 127.541 88.217  1.00 10.59  ? 89  ILE A H    1 
ATOM   1485  H  HA   . ILE A  1 89  ? 118.157 127.923 90.099  1.00 10.59  ? 89  ILE A HA   1 
ATOM   1486  H  HB   . ILE A  1 89  ? 119.979 125.782 90.012  1.00 10.59  ? 89  ILE A HB   1 
ATOM   1487  H  HG12 . ILE A  1 89  ? 118.760 125.808 87.984  1.00 10.59  ? 89  ILE A HG12 1 
ATOM   1488  H  HG13 . ILE A  1 89  ? 118.452 124.506 88.833  1.00 10.59  ? 89  ILE A HG13 1 
ATOM   1489  H  HG21 . ILE A  1 89  ? 118.300 124.662 91.236  1.00 10.59  ? 89  ILE A HG21 1 
ATOM   1490  H  HG22 . ILE A  1 89  ? 118.937 125.889 92.015  1.00 10.59  ? 89  ILE A HG22 1 
ATOM   1491  H  HG23 . ILE A  1 89  ? 117.523 126.035 91.314  1.00 10.59  ? 89  ILE A HG23 1 
ATOM   1492  H  HD11 . ILE A  1 89  ? 116.592 125.436 87.869  1.00 10.59  ? 89  ILE A HD11 1 
ATOM   1493  H  HD12 . ILE A  1 89  ? 116.487 125.271 89.441  1.00 10.59  ? 89  ILE A HD12 1 
ATOM   1494  H  HD13 . ILE A  1 89  ? 116.783 126.697 88.808  1.00 10.59  ? 89  ILE A HD13 1 
ATOM   1495  N  N    . LEU A  1 90  ? 119.393 128.897 91.956  1.00 9.66   ? 90  LEU A N    1 
ATOM   1496  C  CA   . LEU A  1 90  ? 120.199 129.448 93.028  1.00 9.66   ? 90  LEU A CA   1 
ATOM   1497  C  C    . LEU A  1 90  ? 119.324 129.712 94.240  1.00 9.66   ? 90  LEU A C    1 
ATOM   1498  O  O    . LEU A  1 90  ? 118.096 129.760 94.152  1.00 9.66   ? 90  LEU A O    1 
ATOM   1499  C  CB   . LEU A  1 90  ? 120.940 130.711 92.576  1.00 9.66   ? 90  LEU A CB   1 
ATOM   1500  C  CG   . LEU A  1 90  ? 120.198 132.008 92.305  1.00 9.66   ? 90  LEU A CG   1 
ATOM   1501  C  CD1  . LEU A  1 90  ? 121.209 133.088 92.179  1.00 9.66   ? 90  LEU A CD1  1 
ATOM   1502  C  CD2  . LEU A  1 90  ? 119.449 131.927 91.032  1.00 9.66   ? 90  LEU A CD2  1 
ATOM   1503  H  H    . LEU A  1 90  ? 118.555 129.064 92.017  1.00 9.66   ? 90  LEU A H    1 
ATOM   1504  H  HA   . LEU A  1 90  ? 120.857 128.787 93.284  1.00 9.66   ? 90  LEU A HA   1 
ATOM   1505  H  HB2  . LEU A  1 90  ? 121.605 130.920 93.249  1.00 9.66   ? 90  LEU A HB2  1 
ATOM   1506  H  HB3  . LEU A  1 90  ? 121.392 130.499 91.747  1.00 9.66   ? 90  LEU A HB3  1 
ATOM   1507  H  HG   . LEU A  1 90  ? 119.584 132.207 93.024  1.00 9.66   ? 90  LEU A HG   1 
ATOM   1508  H  HD11 . LEU A  1 90  ? 120.758 133.913 91.952  1.00 9.66   ? 90  LEU A HD11 1 
ATOM   1509  H  HD12 . LEU A  1 90  ? 121.682 133.176 93.019  1.00 9.66   ? 90  LEU A HD12 1 
ATOM   1510  H  HD13 . LEU A  1 90  ? 121.822 132.837 91.474  1.00 9.66   ? 90  LEU A HD13 1 
ATOM   1511  H  HD21 . LEU A  1 90  ? 118.984 132.765 90.899  1.00 9.66   ? 90  LEU A HD21 1 
ATOM   1512  H  HD22 . LEU A  1 90  ? 120.090 131.793 90.319  1.00 9.66   ? 90  LEU A HD22 1 
ATOM   1513  H  HD23 . LEU A  1 90  ? 118.825 131.190 91.075  1.00 9.66   ? 90  LEU A HD23 1 
ATOM   1514  N  N    . LEU A  1 91  ? 119.992 129.877 95.374  1.00 8.08   ? 91  LEU A N    1 
ATOM   1515  C  CA   . LEU A  1 91  ? 119.343 129.936 96.674  1.00 8.08   ? 91  LEU A CA   1 
ATOM   1516  C  C    . LEU A  1 91  ? 118.682 131.293 96.869  1.00 8.08   ? 91  LEU A C    1 
ATOM   1517  O  O    . LEU A  1 91  ? 119.356 132.327 96.871  1.00 8.08   ? 91  LEU A O    1 
ATOM   1518  C  CB   . LEU A  1 91  ? 120.383 129.659 97.753  1.00 8.08   ? 91  LEU A CB   1 
ATOM   1519  C  CG   . LEU A  1 91  ? 119.990 129.426 99.202  1.00 8.08   ? 91  LEU A CG   1 
ATOM   1520  C  CD1  . LEU A  1 91  ? 119.118 128.236 99.331  1.00 8.08   ? 91  LEU A CD1  1 
ATOM   1521  C  CD2  . LEU A  1 91  ? 121.230 129.213 100.004 1.00 8.08   ? 91  LEU A CD2  1 
ATOM   1522  H  H    . LEU A  1 91  ? 120.844 129.955 95.419  1.00 8.08   ? 91  LEU A H    1 
ATOM   1523  H  HA   . LEU A  1 91  ? 118.658 129.259 96.722  1.00 8.08   ? 91  LEU A HA   1 
ATOM   1524  H  HB2  . LEU A  1 91  ? 120.860 128.863 97.487  1.00 8.08   ? 91  LEU A HB2  1 
ATOM   1525  H  HB3  . LEU A  1 91  ? 120.996 130.404 97.757  1.00 8.08   ? 91  LEU A HB3  1 
ATOM   1526  H  HG   . LEU A  1 91  ? 119.526 130.198 99.544  1.00 8.08   ? 91  LEU A HG   1 
ATOM   1527  H  HD11 . LEU A  1 91  ? 118.934 128.087 100.268 1.00 8.08   ? 91  LEU A HD11 1 
ATOM   1528  H  HD12 . LEU A  1 91  ? 118.297 128.398 98.849  1.00 8.08   ? 91  LEU A HD12 1 
ATOM   1529  H  HD13 . LEU A  1 91  ? 119.586 127.477 98.959  1.00 8.08   ? 91  LEU A HD13 1 
ATOM   1530  H  HD21 . LEU A  1 91  ? 120.983 129.042 100.922 1.00 8.08   ? 91  LEU A HD21 1 
ATOM   1531  H  HD22 . LEU A  1 91  ? 121.691 128.447 99.639  1.00 8.08   ? 91  LEU A HD22 1 
ATOM   1532  H  HD23 . LEU A  1 91  ? 121.787 130.000 99.944  1.00 8.08   ? 91  LEU A HD23 1 
ATOM   1533  N  N    . TYR A  1 92  ? 117.359 131.283 97.029  1.00 10.80  ? 92  TYR A N    1 
ATOM   1534  C  CA   . TYR A  1 92  ? 116.621 132.520 97.244  1.00 10.80  ? 92  TYR A CA   1 
ATOM   1535  C  C    . TYR A  1 92  ? 117.005 133.170 98.562  1.00 10.80  ? 92  TYR A C    1 
ATOM   1536  O  O    . TYR A  1 92  ? 117.104 134.397 98.657  1.00 10.80  ? 92  TYR A O    1 
ATOM   1537  C  CB   . TYR A  1 92  ? 115.124 132.237 97.227  1.00 10.80  ? 92  TYR A CB   1 
ATOM   1538  C  CG   . TYR A  1 92  ? 114.482 132.323 95.874  1.00 10.80  ? 92  TYR A CG   1 
ATOM   1539  C  CD1  . TYR A  1 92  ? 114.976 131.602 94.812  1.00 10.80  ? 92  TYR A CD1  1 
ATOM   1540  C  CD2  . TYR A  1 92  ? 113.369 133.115 95.665  1.00 10.80  ? 92  TYR A CD2  1 
ATOM   1541  C  CE1  . TYR A  1 92  ? 114.394 131.670 93.577  1.00 10.80  ? 92  TYR A CE1  1 
ATOM   1542  C  CE2  . TYR A  1 92  ? 112.777 133.191 94.431  1.00 10.80  ? 92  TYR A CE2  1 
ATOM   1543  C  CZ   . TYR A  1 92  ? 113.295 132.464 93.389  1.00 10.80  ? 92  TYR A CZ   1 
ATOM   1544  O  OH   . TYR A  1 92  ? 112.714 132.528 92.148  1.00 10.80  ? 92  TYR A OH   1 
ATOM   1545  H  H    . TYR A  1 92  ? 116.873 130.577 97.012  1.00 10.80  ? 92  TYR A H    1 
ATOM   1546  H  HA   . TYR A  1 92  ? 116.818 133.136 96.527  1.00 10.80  ? 92  TYR A HA   1 
ATOM   1547  H  HB2  . TYR A  1 92  ? 114.984 131.340 97.554  1.00 10.80  ? 92  TYR A HB2  1 
ATOM   1548  H  HB3  . TYR A  1 92  ? 114.686 132.873 97.805  1.00 10.80  ? 92  TYR A HB3  1 
ATOM   1549  H  HD1  . TYR A  1 92  ? 115.719 131.067 94.942  1.00 10.80  ? 92  TYR A HD1  1 
ATOM   1550  H  HD2  . TYR A  1 92  ? 113.020 133.606 96.372  1.00 10.80  ? 92  TYR A HD2  1 
ATOM   1551  H  HE1  . TYR A  1 92  ? 114.742 131.181 92.872  1.00 10.80  ? 92  TYR A HE1  1 
ATOM   1552  H  HE2  . TYR A  1 92  ? 112.032 133.729 94.304  1.00 10.80  ? 92  TYR A HE2  1 
ATOM   1553  H  HH   . TYR A  1 92  ? 113.092 131.982 91.636  1.00 10.80  ? 92  TYR A HH   1 
ATOM   1554  N  N    . ASN A  1 93  ? 117.223 132.356 99.588  1.00 9.47   ? 93  ASN A N    1 
ATOM   1555  C  CA   . ASN A  1 93  ? 117.422 132.816 100.958 1.00 9.47   ? 93  ASN A CA   1 
ATOM   1556  C  C    . ASN A  1 93  ? 118.885 132.796 101.368 1.00 9.47   ? 93  ASN A C    1 
ATOM   1557  O  O    . ASN A  1 93  ? 119.226 132.430 102.493 1.00 9.47   ? 93  ASN A O    1 
ATOM   1558  C  CB   . ASN A  1 93  ? 116.568 131.979 101.902 1.00 9.47   ? 93  ASN A CB   1 
ATOM   1559  C  CG   . ASN A  1 93  ? 116.887 130.508 101.833 1.00 9.47   ? 93  ASN A CG   1 
ATOM   1560  O  OD1  . ASN A  1 93  ? 117.050 129.938 100.749 1.00 9.47   ? 93  ASN A OD1  1 
ATOM   1561  N  ND2  . ASN A  1 93  ? 116.933 129.868 102.993 1.00 9.47   ? 93  ASN A ND2  1 
ATOM   1562  H  H    . ASN A  1 93  ? 117.251 131.501 99.512  1.00 9.47   ? 93  ASN A H    1 
ATOM   1563  H  HA   . ASN A  1 93  ? 117.114 133.732 101.017 1.00 9.47   ? 93  ASN A HA   1 
ATOM   1564  H  HB2  . ASN A  1 93  ? 116.732 132.274 102.812 1.00 9.47   ? 93  ASN A HB2  1 
ATOM   1565  H  HB3  . ASN A  1 93  ? 115.636 132.092 101.678 1.00 9.47   ? 93  ASN A HB3  1 
ATOM   1566  H  HD21 . ASN A  1 93  ? 116.792 130.306 103.721 1.00 9.47   ? 93  ASN A HD21 1 
ATOM   1567  H  HD22 . ASN A  1 93  ? 117.102 129.024 103.036 1.00 9.47   ? 93  ASN A HD22 1 
ATOM   1568  N  N    . SER A  1 94  ? 119.740 133.202 100.436 1.00 7.75   ? 94  SER A N    1 
ATOM   1569  C  CA   . SER A  1 94  ? 121.213 133.259 100.570 1.00 7.75   ? 94  SER A CA   1 
ATOM   1570  C  C    . SER A  1 94  ? 121.614 134.513 101.354 1.00 7.75   ? 94  SER A C    1 
ATOM   1571  O  O    . SER A  1 94  ? 121.115 135.570 100.994 1.00 7.75   ? 94  SER A O    1 
ATOM   1572  C  CB   . SER A  1 94  ? 121.838 133.253 99.219  1.00 7.75   ? 94  SER A CB   1 
ATOM   1573  O  OG   . SER A  1 94  ? 123.214 132.944 99.292  1.00 7.75   ? 94  SER A OG   1 
ATOM   1574  H  H    . SER A  1 94  ? 119.460 133.565 99.649  1.00 7.75   ? 94  SER A H    1 
ATOM   1575  H  HA   . SER A  1 94  ? 121.502 132.442 101.055 1.00 7.75   ? 94  SER A HA   1 
ATOM   1576  H  HB2  . SER A  1 94  ? 121.383 132.593 98.653  1.00 7.75   ? 94  SER A HB2  1 
ATOM   1577  H  HB3  . SER A  1 94  ? 121.725 134.137 98.806  1.00 7.75   ? 94  SER A HB3  1 
ATOM   1578  H  HG   . SER A  1 94  ? 123.507 132.839 98.506  1.00 7.75   ? 94  SER A HG   1 
ATOM   1579  N  N    . ALA A  1 95  ? 122.651 134.387 102.297 1.00 7.36   ? 95  ALA A N    1 
ATOM   1580  C  CA   . ALA A  1 95  ? 123.236 135.492 103.043 1.00 7.36   ? 95  ALA A CA   1 
ATOM   1581  C  C    . ALA A  1 95  ? 124.760 135.463 102.954 1.00 7.36   ? 95  ALA A C    1 
ATOM   1582  O  O    . ALA A  1 95  ? 125.451 135.650 103.957 1.00 7.36   ? 95  ALA A O    1 
ATOM   1583  C  CB   . ALA A  1 95  ? 122.777 135.449 104.496 1.00 7.36   ? 95  ALA A CB   1 
ATOM   1584  H  H    . ALA A  1 95  ? 123.052 133.646 102.435 1.00 7.36   ? 95  ALA A H    1 
ATOM   1585  H  HA   . ALA A  1 95  ? 122.924 136.322 102.667 1.00 7.36   ? 95  ALA A HA   1 
ATOM   1586  H  HB1  . ALA A  1 95  ? 123.149 136.200 104.968 1.00 7.36   ? 95  ALA A HB1  1 
ATOM   1587  H  HB2  . ALA A  1 95  ? 121.810 135.484 104.517 1.00 7.36   ? 95  ALA A HB2  1 
ATOM   1588  H  HB3  . ALA A  1 95  ? 123.078 134.622 104.893 1.00 7.36   ? 95  ALA A HB3  1 
ATOM   1589  N  N    . ASP A  1 96  ? 125.295 135.250 101.749 1.00 5.53   ? 96  ASP A N    1 
ATOM   1590  C  CA   . ASP A  1 96  ? 126.694 134.858 101.598 1.00 5.53   ? 96  ASP A CA   1 
ATOM   1591  C  C    . ASP A  1 96  ? 127.628 136.055 101.446 1.00 5.53   ? 96  ASP A C    1 
ATOM   1592  O  O    . ASP A  1 96  ? 128.795 135.984 101.841 1.00 5.53   ? 96  ASP A O    1 
ATOM   1593  C  CB   . ASP A  1 96  ? 126.841 133.935 100.396 1.00 5.53   ? 96  ASP A CB   1 
ATOM   1594  C  CG   . ASP A  1 96  ? 128.047 133.036 100.496 1.00 5.53   ? 96  ASP A CG   1 
ATOM   1595  O  OD1  . ASP A  1 96  ? 128.415 132.647 101.621 1.00 5.53   ? 96  ASP A OD1  1 
ATOM   1596  O  OD2  . ASP A  1 96  ? 128.643 132.730 99.446  1.00 5.53   ? 96  ASP A OD2  1 
ATOM   1597  H  H    . ASP A  1 96  ? 124.869 135.313 101.011 1.00 5.53   ? 96  ASP A H    1 
ATOM   1598  H  HA   . ASP A  1 96  ? 126.952 134.364 102.384 1.00 5.53   ? 96  ASP A HA   1 
ATOM   1599  H  HB2  . ASP A  1 96  ? 126.055 133.379 100.326 1.00 5.53   ? 96  ASP A HB2  1 
ATOM   1600  H  HB3  . ASP A  1 96  ? 126.934 134.484 99.608  1.00 5.53   ? 96  ASP A HB3  1 
ATOM   1601  N  N    . GLU A  1 97  ? 127.129 137.160 100.882 1.00 4.34   ? 97  GLU A N    1 
ATOM   1602  C  CA   . GLU A  1 97  ? 127.900 138.335 100.457 1.00 4.34   ? 97  GLU A CA   1 
ATOM   1603  C  C    . GLU A  1 97  ? 128.507 138.204 99.067  1.00 4.34   ? 97  GLU A C    1 
ATOM   1604  O  O    . GLU A  1 97  ? 129.142 139.144 98.583  1.00 4.34   ? 97  GLU A O    1 
ATOM   1605  C  CB   . GLU A  1 97  ? 129.054 138.672 101.405 1.00 4.34   ? 97  GLU A CB   1 
ATOM   1606  C  CG   . GLU A  1 97  ? 128.681 139.350 102.697 1.00 4.34   ? 97  GLU A CG   1 
ATOM   1607  C  CD   . GLU A  1 97  ? 129.802 140.218 103.234 1.00 4.34   ? 97  GLU A CD   1 
ATOM   1608  O  OE1  . GLU A  1 97  ? 130.973 139.962 102.881 1.00 4.34   ? 97  GLU A OE1  1 
ATOM   1609  O  OE2  . GLU A  1 97  ? 129.515 141.157 104.006 1.00 4.34   ? 97  GLU A OE2  1 
ATOM   1610  H  H    . GLU A  1 97  ? 126.292 137.240 100.709 1.00 4.34   ? 97  GLU A H    1 
ATOM   1611  H  HA   . GLU A  1 97  ? 127.305 139.092 100.433 1.00 4.34   ? 97  GLU A HA   1 
ATOM   1612  H  HB2  . GLU A  1 97  ? 129.586 137.898 101.598 1.00 4.34   ? 97  GLU A HB2  1 
ATOM   1613  H  HB3  . GLU A  1 97  ? 129.608 139.304 100.930 1.00 4.34   ? 97  GLU A HB3  1 
ATOM   1614  H  HG2  . GLU A  1 97  ? 127.911 139.917 102.542 1.00 4.34   ? 97  GLU A HG2  1 
ATOM   1615  H  HG3  . GLU A  1 97  ? 128.480 138.675 103.362 1.00 4.34   ? 97  GLU A HG3  1 
ATOM   1616  N  N    . ARG A  1 98  ? 128.337 137.062 98.415  1.00 4.89   ? 98  ARG A N    1 
ATOM   1617  C  CA   . ARG A  1 98  ? 128.564 136.940 96.983  1.00 4.89   ? 98  ARG A CA   1 
ATOM   1618  C  C    . ARG A  1 98  ? 127.368 136.302 96.289  1.00 4.89   ? 98  ARG A C    1 
ATOM   1619  O  O    . ARG A  1 98  ? 127.318 136.248 95.057  1.00 4.89   ? 98  ARG A O    1 
ATOM   1620  C  CB   . ARG A  1 98  ? 129.856 136.164 96.731  1.00 4.89   ? 98  ARG A CB   1 
ATOM   1621  C  CG   . ARG A  1 98  ? 129.920 134.829 97.394  1.00 4.89   ? 98  ARG A CG   1 
ATOM   1622  C  CD   . ARG A  1 98  ? 131.303 134.220 97.316  1.00 4.89   ? 98  ARG A CD   1 
ATOM   1623  N  NE   . ARG A  1 98  ? 131.307 132.890 97.912  1.00 4.89   ? 98  ARG A NE   1 
ATOM   1624  C  CZ   . ARG A  1 98  ? 132.318 132.036 97.845  1.00 4.89   ? 98  ARG A CZ   1 
ATOM   1625  N  NH1  . ARG A  1 98  ? 133.429 132.345 97.191  1.00 4.89   ? 98  ARG A NH1  1 
ATOM   1626  N  NH2  . ARG A  1 98  ? 132.200 130.857 98.431  1.00 4.89   ? 98  ARG A NH2  1 
ATOM   1627  H  H    . ARG A  1 98  ? 128.105 136.328 98.786  1.00 4.89   ? 98  ARG A H    1 
ATOM   1628  H  HA   . ARG A  1 98  ? 128.687 137.822 96.612  1.00 4.89   ? 98  ARG A HA   1 
ATOM   1629  H  HB2  . ARG A  1 98  ? 129.967 136.027 95.780  1.00 4.89   ? 98  ARG A HB2  1 
ATOM   1630  H  HB3  . ARG A  1 98  ? 130.595 136.680 97.079  1.00 4.89   ? 98  ARG A HB3  1 
ATOM   1631  H  HG2  . ARG A  1 98  ? 129.697 134.927 98.329  1.00 4.89   ? 98  ARG A HG2  1 
ATOM   1632  H  HG3  . ARG A  1 98  ? 129.302 134.233 96.953  1.00 4.89   ? 98  ARG A HG3  1 
ATOM   1633  H  HD2  . ARG A  1 98  ? 131.582 134.152 96.391  1.00 4.89   ? 98  ARG A HD2  1 
ATOM   1634  H  HD3  . ARG A  1 98  ? 131.920 134.775 97.814  1.00 4.89   ? 98  ARG A HD3  1 
ATOM   1635  H  HE   . ARG A  1 98  ? 130.543 132.552 98.098  1.00 4.89   ? 98  ARG A HE   1 
ATOM   1636  H  HH11 . ARG A  1 98  ? 133.507 133.109 96.809  1.00 4.89   ? 98  ARG A HH11 1 
ATOM   1637  H  HH12 . ARG A  1 98  ? 134.075 131.781 97.151  1.00 4.89   ? 98  ARG A HH12 1 
ATOM   1638  H  HH21 . ARG A  1 98  ? 131.475 130.663 98.848  1.00 4.89   ? 98  ARG A HH21 1 
ATOM   1639  H  HH22 . ARG A  1 98  ? 132.835 130.290 98.391  1.00 4.89   ? 98  ARG A HH22 1 
ATOM   1640  N  N    . PHE A  1 99  ? 126.421 135.801 97.076  1.00 6.61   ? 99  PHE A N    1 
ATOM   1641  C  CA   . PHE A  1 99  ? 125.092 135.330 96.706  1.00 6.61   ? 99  PHE A CA   1 
ATOM   1642  C  C    . PHE A  1 99  ? 125.082 134.055 95.882  1.00 6.61   ? 99  PHE A C    1 
ATOM   1643  O  O    . PHE A  1 99  ? 124.056 133.375 95.807  1.00 6.61   ? 99  PHE A O    1 
ATOM   1644  C  CB   . PHE A  1 99  ? 124.312 136.368 95.914  1.00 6.61   ? 99  PHE A CB   1 
ATOM   1645  C  CG   . PHE A  1 99  ? 122.855 136.064 95.862  1.00 6.61   ? 99  PHE A CG   1 
ATOM   1646  C  CD1  . PHE A  1 99  ? 122.049 136.338 96.938  1.00 6.61   ? 99  PHE A CD1  1 
ATOM   1647  C  CD2  . PHE A  1 99  ? 122.312 135.400 94.789  1.00 6.61   ? 99  PHE A CD2  1 
ATOM   1648  C  CE1  . PHE A  1 99  ? 120.725 136.025 96.909  1.00 6.61   ? 99  PHE A CE1  1 
ATOM   1649  C  CE2  . PHE A  1 99  ? 120.992 135.083 94.767  1.00 6.61   ? 99  PHE A CE2  1 
ATOM   1650  C  CZ   . PHE A  1 99  ? 120.200 135.390 95.824  1.00 6.61   ? 99  PHE A CZ   1 
ATOM   1651  H  H    . PHE A  1 99  ? 126.532 135.744 97.921  1.00 6.61   ? 99  PHE A H    1 
ATOM   1652  H  HA   . PHE A  1 99  ? 124.602 135.159 97.518  1.00 6.61   ? 99  PHE A HA   1 
ATOM   1653  H  HB2  . PHE A  1 99  ? 124.429 137.240 96.316  1.00 6.61   ? 99  PHE A HB2  1 
ATOM   1654  H  HB3  . PHE A  1 99  ? 124.641 136.366 95.006  1.00 6.61   ? 99  PHE A HB3  1 
ATOM   1655  H  HD1  . PHE A  1 99  ? 122.406 136.777 97.672  1.00 6.61   ? 99  PHE A HD1  1 
ATOM   1656  H  HD2  . PHE A  1 99  ? 122.844 135.184 94.063  1.00 6.61   ? 99  PHE A HD2  1 
ATOM   1657  H  HE1  . PHE A  1 99  ? 120.184 136.234 97.630  1.00 6.61   ? 99  PHE A HE1  1 
ATOM   1658  H  HE2  . PHE A  1 99  ? 120.632 134.650 94.035  1.00 6.61   ? 99  PHE A HE2  1 
ATOM   1659  H  HZ   . PHE A  1 99  ? 119.301 135.171 95.802  1.00 6.61   ? 99  PHE A HZ   1 
ATOM   1660  N  N    . ASP A  1 100 ? 126.211 133.693 95.299  1.00 7.04   ? 100 ASP A N    1 
ATOM   1661  C  CA   . ASP A  1 100 ? 126.349 132.389 94.673  1.00 7.04   ? 100 ASP A CA   1 
ATOM   1662  C  C    . ASP A  1 100 ? 127.599 131.748 95.241  1.00 7.04   ? 100 ASP A C    1 
ATOM   1663  O  O    . ASP A  1 100 ? 128.720 132.085 94.849  1.00 7.04   ? 100 ASP A O    1 
ATOM   1664  C  CB   . ASP A  1 100 ? 126.406 132.502 93.156  1.00 7.04   ? 100 ASP A CB   1 
ATOM   1665  C  CG   . ASP A  1 100 ? 126.038 131.210 92.462  1.00 7.04   ? 100 ASP A CG   1 
ATOM   1666  O  OD1  . ASP A  1 100 ? 125.224 130.443 93.013  1.00 7.04   ? 100 ASP A OD1  1 
ATOM   1667  O  OD2  . ASP A  1 100 ? 126.563 130.960 91.360  1.00 7.04   ? 100 ASP A OD2  1 
ATOM   1668  H  H    . ASP A  1 100 ? 126.896 134.196 95.214  1.00 7.04   ? 100 ASP A H    1 
ATOM   1669  H  HA   . ASP A  1 100 ? 125.589 131.849 94.910  1.00 7.04   ? 100 ASP A HA   1 
ATOM   1670  H  HB2  . ASP A  1 100 ? 125.767 133.171 92.874  1.00 7.04   ? 100 ASP A HB2  1 
ATOM   1671  H  HB3  . ASP A  1 100 ? 127.300 132.747 92.890  1.00 7.04   ? 100 ASP A HB3  1 
ATOM   1672  N  N    . ALA A  1 101 ? 127.401 130.832 96.173  1.00 5.61   ? 101 ALA A N    1 
ATOM   1673  C  CA   . ALA A  1 101 ? 128.483 130.210 96.902  1.00 5.61   ? 101 ALA A CA   1 
ATOM   1674  C  C    . ALA A  1 101 ? 129.043 129.004 96.180  1.00 5.61   ? 101 ALA A C    1 
ATOM   1675  O  O    . ALA A  1 101 ? 129.836 128.260 96.761  1.00 5.61   ? 101 ALA A O    1 
ATOM   1676  C  CB   . ALA A  1 101 ? 127.993 129.805 98.285  1.00 5.61   ? 101 ALA A CB   1 
ATOM   1677  H  H    . ALA A  1 101 ? 126.629 130.545 96.403  1.00 5.61   ? 101 ALA A H    1 
ATOM   1678  H  HA   . ALA A  1 101 ? 129.187 130.861 97.003  1.00 5.61   ? 101 ALA A HA   1 
ATOM   1679  H  HB1  . ALA A  1 101 ? 128.697 129.322 98.738  1.00 5.61   ? 101 ALA A HB1  1 
ATOM   1680  H  HB2  . ALA A  1 101 ? 127.752 130.605 98.775  1.00 5.61   ? 101 ALA A HB2  1 
ATOM   1681  H  HB3  . ALA A  1 101 ? 127.214 129.244 98.172  1.00 5.61   ? 101 ALA A HB3  1 
ATOM   1682  N  N    . THR A  1 102 ? 128.593 128.811 95.041  1.00 5.36   ? 102 THR A N    1 
ATOM   1683  C  CA   . THR A  1 102 ? 128.980 127.612 94.283  1.00 5.36   ? 102 THR A CA   1 
ATOM   1684  C  C    . THR A  1 102 ? 130.295 127.755 93.511  1.00 5.36   ? 102 THR A C    1 
ATOM   1685  O  O    . THR A  1 102 ? 130.569 128.847 93.034  1.00 5.36   ? 102 THR A O    1 
ATOM   1686  C  CB   . THR A  1 102 ? 127.937 127.386 93.203  1.00 5.36   ? 102 THR A CB   1 
ATOM   1687  O  OG1  . THR A  1 102 ? 127.737 128.625 92.544  1.00 5.36   ? 102 THR A OG1  1 
ATOM   1688  C  CG2  . THR A  1 102 ? 126.624 126.906 93.760  1.00 5.36   ? 102 THR A CG2  1 
ATOM   1689  H  H    . THR A  1 102 ? 128.187 129.395 94.504  1.00 5.36   ? 102 THR A H    1 
ATOM   1690  H  HA   . THR A  1 102 ? 128.990 126.849 94.906  1.00 5.36   ? 102 THR A HA   1 
ATOM   1691  H  HB   . THR A  1 102 ? 128.299 126.765 92.562  1.00 5.36   ? 102 THR A HB   1 
ATOM   1692  H  HG1  . THR A  1 102 ? 127.209 128.517 91.889  1.00 5.36   ? 102 THR A HG1  1 
ATOM   1693  H  HG21 . THR A  1 102 ? 125.939 126.956 93.070  1.00 5.36   ? 102 THR A HG21 1 
ATOM   1694  H  HG22 . THR A  1 102 ? 126.722 125.992 94.053  1.00 5.36   ? 102 THR A HG22 1 
ATOM   1695  H  HG23 . THR A  1 102 ? 126.366 127.464 94.515  1.00 5.36   ? 102 THR A HG23 1 
ATOM   1696  N  N    . PHE A  1 103 ? 131.011 126.648 93.323  1.00 3.62   ? 103 PHE A N    1 
ATOM   1697  C  CA   . PHE A  1 103 ? 132.220 126.533 92.529  1.00 3.62   ? 103 PHE A CA   1 
ATOM   1698  C  C    . PHE A  1 103 ? 131.832 125.940 91.184  1.00 3.62   ? 103 PHE A C    1 
ATOM   1699  O  O    . PHE A  1 103 ? 131.301 124.828 91.122  1.00 3.62   ? 103 PHE A O    1 
ATOM   1700  C  CB   . PHE A  1 103 ? 133.245 125.659 93.244  1.00 3.62   ? 103 PHE A CB   1 
ATOM   1701  C  CG   . PHE A  1 103 ? 134.428 125.303 92.407  1.00 3.62   ? 103 PHE A CG   1 
ATOM   1702  C  CD1  . PHE A  1 103 ? 135.342 126.261 92.033  1.00 3.62   ? 103 PHE A CD1  1 
ATOM   1703  C  CD2  . PHE A  1 103 ? 134.628 124.003 91.999  1.00 3.62   ? 103 PHE A CD2  1 
ATOM   1704  C  CE1  . PHE A  1 103 ? 136.424 125.928 91.265  1.00 3.62   ? 103 PHE A CE1  1 
ATOM   1705  C  CE2  . PHE A  1 103 ? 135.709 123.671 91.232  1.00 3.62   ? 103 PHE A CE2  1 
ATOM   1706  C  CZ   . PHE A  1 103 ? 136.606 124.632 90.866  1.00 3.62   ? 103 PHE A CZ   1 
ATOM   1707  H  H    . PHE A  1 103 ? 130.765 125.904 93.663  1.00 3.62   ? 103 PHE A H    1 
ATOM   1708  H  HA   . PHE A  1 103 ? 132.598 127.408 92.381  1.00 3.62   ? 103 PHE A HA   1 
ATOM   1709  H  HB2  . PHE A  1 103 ? 133.557 126.128 94.030  1.00 3.62   ? 103 PHE A HB2  1 
ATOM   1710  H  HB3  . PHE A  1 103 ? 132.813 124.835 93.501  1.00 3.62   ? 103 PHE A HB3  1 
ATOM   1711  H  HD1  . PHE A  1 103 ? 135.222 127.140 92.301  1.00 3.62   ? 103 PHE A HD1  1 
ATOM   1712  H  HD2  . PHE A  1 103 ? 134.020 123.345 92.244  1.00 3.62   ? 103 PHE A HD2  1 
ATOM   1713  H  HE1  . PHE A  1 103 ? 137.033 126.580 91.017  1.00 3.62   ? 103 PHE A HE1  1 
ATOM   1714  H  HE2  . PHE A  1 103 ? 135.832 122.794 90.962  1.00 3.62   ? 103 PHE A HE2  1 
ATOM   1715  H  HZ   . PHE A  1 103 ? 137.338 124.407 90.347  1.00 3.62   ? 103 PHE A HZ   1 
ATOM   1716  N  N    . HIS A  1 104 ? 132.089 126.683 90.117  1.00 3.32   ? 104 HIS A N    1 
ATOM   1717  C  CA   . HIS A  1 104 ? 131.592 126.323 88.795  1.00 3.32   ? 104 HIS A CA   1 
ATOM   1718  C  C    . HIS A  1 104 ? 132.489 125.248 88.205  1.00 3.32   ? 104 HIS A C    1 
ATOM   1719  O  O    . HIS A  1 104 ? 133.519 125.540 87.596  1.00 3.32   ? 104 HIS A O    1 
ATOM   1720  C  CB   . HIS A  1 104 ? 131.527 127.551 87.900  1.00 3.32   ? 104 HIS A CB   1 
ATOM   1721  C  CG   . HIS A  1 104 ? 130.553 128.581 88.372  1.00 3.32   ? 104 HIS A CG   1 
ATOM   1722  N  ND1  . HIS A  1 104 ? 129.346 128.251 88.945  1.00 3.32   ? 104 HIS A ND1  1 
ATOM   1723  C  CD2  . HIS A  1 104 ? 130.609 129.932 88.363  1.00 3.32   ? 104 HIS A CD2  1 
ATOM   1724  C  CE1  . HIS A  1 104 ? 128.697 129.355 89.265  1.00 3.32   ? 104 HIS A CE1  1 
ATOM   1725  N  NE2  . HIS A  1 104 ? 129.442 130.390 88.923  1.00 3.32   ? 104 HIS A NE2  1 
ATOM   1726  H  H    . HIS A  1 104 ? 132.550 127.405 90.130  1.00 3.32   ? 104 HIS A H    1 
ATOM   1727  H  HA   . HIS A  1 104 ? 130.701 125.964 88.878  1.00 3.32   ? 104 HIS A HA   1 
ATOM   1728  H  HB2  . HIS A  1 104 ? 132.402 127.959 87.867  1.00 3.32   ? 104 HIS A HB2  1 
ATOM   1729  H  HB3  . HIS A  1 104 ? 131.256 127.272 87.016  1.00 3.32   ? 104 HIS A HB3  1 
ATOM   1730  H  HD2  . HIS A  1 104 ? 131.306 130.452 88.037  1.00 3.32   ? 104 HIS A HD2  1 
ATOM   1731  H  HE1  . HIS A  1 104 ? 127.862 129.396 89.664  1.00 3.32   ? 104 HIS A HE1  1 
ATOM   1732  N  N    . THR A  1 105 ? 132.089 123.996 88.387  1.00 4.67   ? 105 THR A N    1 
ATOM   1733  C  CA   . THR A  1 105 ? 132.791 122.869 87.799  1.00 4.67   ? 105 THR A CA   1 
ATOM   1734  C  C    . THR A  1 105 ? 132.398 122.742 86.332  1.00 4.67   ? 105 THR A C    1 
ATOM   1735  O  O    . THR A  1 105 ? 131.743 123.613 85.755  1.00 4.67   ? 105 THR A O    1 
ATOM   1736  C  CB   . THR A  1 105 ? 132.485 121.590 88.569  1.00 4.67   ? 105 THR A CB   1 
ATOM   1737  O  OG1  . THR A  1 105 ? 131.069 121.409 88.654  1.00 4.67   ? 105 THR A OG1  1 
ATOM   1738  C  CG2  . THR A  1 105 ? 133.065 121.641 89.955  1.00 4.67   ? 105 THR A CG2  1 
ATOM   1739  H  H    . THR A  1 105 ? 131.408 123.769 88.855  1.00 4.67   ? 105 THR A H    1 
ATOM   1740  H  HA   . THR A  1 105 ? 133.742 123.028 87.840  1.00 4.67   ? 105 THR A HA   1 
ATOM   1741  H  HB   . THR A  1 105 ? 132.878 120.839 88.109  1.00 4.67   ? 105 THR A HB   1 
ATOM   1742  H  HG1  . THR A  1 105 ? 130.902 120.725 89.108  1.00 4.67   ? 105 THR A HG1  1 
ATOM   1743  H  HG21 . THR A  1 105 ? 132.968 120.778 90.379  1.00 4.67   ? 105 THR A HG21 1 
ATOM   1744  H  HG22 . THR A  1 105 ? 134.005 121.863 89.914  1.00 4.67   ? 105 THR A HG22 1 
ATOM   1745  H  HG23 . THR A  1 105 ? 132.602 122.308 90.478  1.00 4.67   ? 105 THR A HG23 1 
ATOM   1746  N  N    . ASN A  1 106 ? 132.801 121.642 85.716  1.00 5.19   ? 106 ASN A N    1 
ATOM   1747  C  CA   . ASN A  1 106 ? 132.510 121.379 84.321  1.00 5.19   ? 106 ASN A CA   1 
ATOM   1748  C  C    . ASN A  1 106 ? 131.262 120.520 84.187  1.00 5.19   ? 106 ASN A C    1 
ATOM   1749  O  O    . ASN A  1 106 ? 130.875 119.790 85.100  1.00 5.19   ? 106 ASN A O    1 
ATOM   1750  C  CB   . ASN A  1 106 ? 133.694 120.690 83.653  1.00 5.19   ? 106 ASN A CB   1 
ATOM   1751  C  CG   . ASN A  1 106 ? 134.820 121.639 83.350  1.00 5.19   ? 106 ASN A CG   1 
ATOM   1752  O  OD1  . ASN A  1 106 ? 134.774 122.814 83.706  1.00 5.19   ? 106 ASN A OD1  1 
ATOM   1753  N  ND2  . ASN A  1 106 ? 135.842 121.136 82.686  1.00 5.19   ? 106 ASN A ND2  1 
ATOM   1754  H  H    . ASN A  1 106 ? 133.257 121.024 86.093  1.00 5.19   ? 106 ASN A H    1 
ATOM   1755  H  HA   . ASN A  1 106 ? 132.347 122.214 83.866  1.00 5.19   ? 106 ASN A HA   1 
ATOM   1756  H  HB2  . ASN A  1 106 ? 134.033 120.005 84.246  1.00 5.19   ? 106 ASN A HB2  1 
ATOM   1757  H  HB3  . ASN A  1 106 ? 133.402 120.297 82.821  1.00 5.19   ? 106 ASN A HB3  1 
ATOM   1758  H  HD21 . ASN A  1 106 ? 136.510 121.635 82.486  1.00 5.19   ? 106 ASN A HD21 1 
ATOM   1759  H  HD22 . ASN A  1 106 ? 135.833 120.310 82.457  1.00 5.19   ? 106 ASN A HD22 1 
ATOM   1760  N  N    . VAL A  1 107 ? 130.635 120.619 83.022  1.00 7.42   ? 107 VAL A N    1 
ATOM   1761  C  CA   . VAL A  1 107 ? 129.401 119.909 82.726  1.00 7.42   ? 107 VAL A CA   1 
ATOM   1762  C  C    . VAL A  1 107 ? 129.718 118.736 81.818  1.00 7.42   ? 107 VAL A C    1 
ATOM   1763  O  O    . VAL A  1 107 ? 130.377 118.898 80.785  1.00 7.42   ? 107 VAL A O    1 
ATOM   1764  C  CB   . VAL A  1 107 ? 128.364 120.842 82.089  1.00 7.42   ? 107 VAL A CB   1 
ATOM   1765  C  CG1  . VAL A  1 107 ? 127.118 120.091 81.745  1.00 7.42   ? 107 VAL A CG1  1 
ATOM   1766  C  CG2  . VAL A  1 107 ? 128.033 121.939 83.042  1.00 7.42   ? 107 VAL A CG2  1 
ATOM   1767  H  H    . VAL A  1 107 ? 130.913 121.101 82.373  1.00 7.42   ? 107 VAL A H    1 
ATOM   1768  H  HA   . VAL A  1 107 ? 129.029 119.561 83.545  1.00 7.42   ? 107 VAL A HA   1 
ATOM   1769  H  HB   . VAL A  1 107 ? 128.727 121.227 81.282  1.00 7.42   ? 107 VAL A HB   1 
ATOM   1770  H  HG11 . VAL A  1 107 ? 126.436 120.727 81.489  1.00 7.42   ? 107 VAL A HG11 1 
ATOM   1771  H  HG12 . VAL A  1 107 ? 127.305 119.495 81.009  1.00 7.42   ? 107 VAL A HG12 1 
ATOM   1772  H  HG13 . VAL A  1 107 ? 126.833 119.594 82.522  1.00 7.42   ? 107 VAL A HG13 1 
ATOM   1773  H  HG21 . VAL A  1 107 ? 127.401 122.539 82.624  1.00 7.42   ? 107 VAL A HG21 1 
ATOM   1774  H  HG22 . VAL A  1 107 ? 127.645 121.544 83.834  1.00 7.42   ? 107 VAL A HG22 1 
ATOM   1775  H  HG23 . VAL A  1 107 ? 128.845 122.410 83.271  1.00 7.42   ? 107 VAL A HG23 1 
ATOM   1776  N  N    . LEU A  1 108 ? 129.241 117.561 82.207  1.00 6.85   ? 108 LEU A N    1 
ATOM   1777  C  CA   . LEU A  1 108 ? 129.535 116.306 81.539  1.00 6.85   ? 108 LEU A CA   1 
ATOM   1778  C  C    . LEU A  1 108 ? 128.349 115.885 80.685  1.00 6.85   ? 108 LEU A C    1 
ATOM   1779  O  O    . LEU A  1 108 ? 127.204 115.929 81.142  1.00 6.85   ? 108 LEU A O    1 
ATOM   1780  C  CB   . LEU A  1 108 ? 129.864 115.242 82.582  1.00 6.85   ? 108 LEU A CB   1 
ATOM   1781  C  CG   . LEU A  1 108 ? 129.979 113.788 82.163  1.00 6.85   ? 108 LEU A CG   1 
ATOM   1782  C  CD1  . LEU A  1 108 ? 131.235 113.578 81.396  1.00 6.85   ? 108 LEU A CD1  1 
ATOM   1783  C  CD2  . LEU A  1 108 ? 129.992 112.949 83.394  1.00 6.85   ? 108 LEU A CD2  1 
ATOM   1784  H  H    . LEU A  1 108 ? 128.732 117.460 82.887  1.00 6.85   ? 108 LEU A H    1 
ATOM   1785  H  HA   . LEU A  1 108 ? 130.299 116.417 80.962  1.00 6.85   ? 108 LEU A HA   1 
ATOM   1786  H  HB2  . LEU A  1 108 ? 130.712 115.474 82.984  1.00 6.85   ? 108 LEU A HB2  1 
ATOM   1787  H  HB3  . LEU A  1 108 ? 129.177 115.280 83.259  1.00 6.85   ? 108 LEU A HB3  1 
ATOM   1788  H  HG   . LEU A  1 108 ? 129.222 113.533 81.620  1.00 6.85   ? 108 LEU A HG   1 
ATOM   1789  H  HD11 . LEU A  1 108 ? 131.275 112.657 81.104  1.00 6.85   ? 108 LEU A HD11 1 
ATOM   1790  H  HD12 . LEU A  1 108 ? 131.234 114.175 80.635  1.00 6.85   ? 108 LEU A HD12 1 
ATOM   1791  H  HD13 . LEU A  1 108 ? 131.980 113.781 81.976  1.00 6.85   ? 108 LEU A HD13 1 
ATOM   1792  H  HD21 . LEU A  1 108 ? 130.203 112.038 83.152  1.00 6.85   ? 108 LEU A HD21 1 
ATOM   1793  H  HD22 . LEU A  1 108 ? 130.669 113.303 83.986  1.00 6.85   ? 108 LEU A HD22 1 
ATOM   1794  H  HD23 . LEU A  1 108 ? 129.124 112.996 83.817  1.00 6.85   ? 108 LEU A HD23 1 
ATOM   1795  N  N    . VAL A  1 109 ? 128.626 115.479 79.450  1.00 6.84   ? 109 VAL A N    1 
ATOM   1796  C  CA   . VAL A  1 109 ? 127.598 115.163 78.468  1.00 6.84   ? 109 VAL A CA   1 
ATOM   1797  C  C    . VAL A  1 109 ? 127.925 113.824 77.829  1.00 6.84   ? 109 VAL A C    1 
ATOM   1798  O  O    . VAL A  1 109 ? 129.069 113.587 77.428  1.00 6.84   ? 109 VAL A O    1 
ATOM   1799  C  CB   . VAL A  1 109 ? 127.493 116.254 77.388  1.00 6.84   ? 109 VAL A CB   1 
ATOM   1800  C  CG1  . VAL A  1 109 ? 126.389 115.939 76.426  1.00 6.84   ? 109 VAL A CG1  1 
ATOM   1801  C  CG2  . VAL A  1 109 ? 127.244 117.579 78.011  1.00 6.84   ? 109 VAL A CG2  1 
ATOM   1802  H  H    . VAL A  1 109 ? 129.423 115.372 79.153  1.00 6.84   ? 109 VAL A H    1 
ATOM   1803  H  HA   . VAL A  1 109 ? 126.746 115.089 78.915  1.00 6.84   ? 109 VAL A HA   1 
ATOM   1804  H  HB   . VAL A  1 109 ? 128.323 116.300 76.897  1.00 6.84   ? 109 VAL A HB   1 
ATOM   1805  H  HG11 . VAL A  1 109 ? 126.301 116.681 75.812  1.00 6.84   ? 109 VAL A HG11 1 
ATOM   1806  H  HG12 . VAL A  1 109 ? 126.605 115.128 75.943  1.00 6.84   ? 109 VAL A HG12 1 
ATOM   1807  H  HG13 . VAL A  1 109 ? 125.570 115.827 76.926  1.00 6.84   ? 109 VAL A HG13 1 
ATOM   1808  H  HG21 . VAL A  1 109 ? 127.205 118.245 77.312  1.00 6.84   ? 109 VAL A HG21 1 
ATOM   1809  H  HG22 . VAL A  1 109 ? 126.398 117.532 78.472  1.00 6.84   ? 109 VAL A HG22 1 
ATOM   1810  H  HG23 . VAL A  1 109 ? 127.957 117.781 78.630  1.00 6.84   ? 109 VAL A HG23 1 
ATOM   1811  N  N    . ASN A  1 110 ? 126.925 112.963 77.728  1.00 5.91   ? 110 ASN A N    1 
ATOM   1812  C  CA   . ASN A  1 110 ? 127.008 111.683 77.048  1.00 5.91   ? 110 ASN A CA   1 
ATOM   1813  C  C    . ASN A  1 110 ? 126.182 111.711 75.768  1.00 5.91   ? 110 ASN A C    1 
ATOM   1814  O  O    . ASN A  1 110 ? 125.454 112.670 75.505  1.00 5.91   ? 110 ASN A O    1 
ATOM   1815  C  CB   . ASN A  1 110 ? 126.569 110.566 77.999  1.00 5.91   ? 110 ASN A CB   1 
ATOM   1816  C  CG   . ASN A  1 110 ? 125.073 110.432 78.132  1.00 5.91   ? 110 ASN A CG   1 
ATOM   1817  O  OD1  . ASN A  1 110 ? 124.301 111.253 77.650  1.00 5.91   ? 110 ASN A OD1  1 
ATOM   1818  N  ND2  . ASN A  1 110 ? 124.659 109.374 78.815  1.00 5.91   ? 110 ASN A ND2  1 
ATOM   1819  H  H    . ASN A  1 110 ? 126.154 113.098 78.070  1.00 5.91   ? 110 ASN A H    1 
ATOM   1820  H  HA   . ASN A  1 110 ? 127.927 111.518 76.805  1.00 5.91   ? 110 ASN A HA   1 
ATOM   1821  H  HB2  . ASN A  1 110 ? 126.924 109.719 77.710  1.00 5.91   ? 110 ASN A HB2  1 
ATOM   1822  H  HB3  . ASN A  1 110 ? 126.905 110.773 78.882  1.00 5.91   ? 110 ASN A HB3  1 
ATOM   1823  N  N    . PRO A  1 111 ? 126.281 110.671 74.930  1.00 7.76   ? 111 PRO A N    1 
ATOM   1824  C  CA   . PRO A  1 111 ? 125.755 110.790 73.558  1.00 7.76   ? 111 PRO A CA   1 
ATOM   1825  C  C    . PRO A  1 111 ? 124.308 111.231 73.467  1.00 7.76   ? 111 PRO A C    1 
ATOM   1826  O  O    . PRO A  1 111 ? 123.957 111.985 72.553  1.00 7.76   ? 111 PRO A O    1 
ATOM   1827  C  CB   . PRO A  1 111 ? 125.935 109.377 72.994  1.00 7.76   ? 111 PRO A CB   1 
ATOM   1828  C  CG   . PRO A  1 111 ? 126.995 108.760 73.783  1.00 7.76   ? 111 PRO A CG   1 
ATOM   1829  C  CD   . PRO A  1 111 ? 127.122 109.475 75.088  1.00 7.76   ? 111 PRO A CD   1 
ATOM   1830  H  HA   . PRO A  1 111 ? 126.302 111.399 73.049  1.00 7.76   ? 111 PRO A HA   1 
ATOM   1831  H  HB2  . PRO A  1 111 ? 125.110 108.882 73.084  1.00 7.76   ? 111 PRO A HB2  1 
ATOM   1832  H  HB3  . PRO A  1 111 ? 126.197 109.436 72.065  1.00 7.76   ? 111 PRO A HB3  1 
ATOM   1833  H  HG2  . PRO A  1 111 ? 126.774 107.830 73.938  1.00 7.76   ? 111 PRO A HG2  1 
ATOM   1834  H  HG3  . PRO A  1 111 ? 127.825 108.822 73.291  1.00 7.76   ? 111 PRO A HG3  1 
ATOM   1835  H  HD2  . PRO A  1 111 ? 126.797 108.908 75.800  1.00 7.76   ? 111 PRO A HD2  1 
ATOM   1836  H  HD3  . PRO A  1 111 ? 128.036 109.738 75.232  1.00 7.76   ? 111 PRO A HD3  1 
ATOM   1837  N  N    . SER A  1 112 ? 123.450 110.780 74.378  1.00 5.37   ? 112 SER A N    1 
ATOM   1838  C  CA   . SER A  1 112 ? 122.048 111.156 74.323  1.00 5.37   ? 112 SER A CA   1 
ATOM   1839  C  C    . SER A  1 112 ? 121.822 112.628 74.623  1.00 5.37   ? 112 SER A C    1 
ATOM   1840  O  O    . SER A  1 112 ? 120.722 113.131 74.372  1.00 5.37   ? 112 SER A O    1 
ATOM   1841  C  CB   . SER A  1 112 ? 121.249 110.308 75.305  1.00 5.37   ? 112 SER A CB   1 
ATOM   1842  O  OG   . SER A  1 112 ? 121.252 108.949 74.918  1.00 5.37   ? 112 SER A OG   1 
ATOM   1843  H  H    . SER A  1 112 ? 123.650 110.263 75.031  1.00 5.37   ? 112 SER A H    1 
ATOM   1844  H  HA   . SER A  1 112 ? 121.718 110.978 73.433  1.00 5.37   ? 112 SER A HA   1 
ATOM   1845  H  HB2  . SER A  1 112 ? 121.656 110.383 76.179  1.00 5.37   ? 112 SER A HB2  1 
ATOM   1846  H  HB3  . SER A  1 112 ? 120.338 110.632 75.331  1.00 5.37   ? 112 SER A HB3  1 
ATOM   1847  H  HG   . SER A  1 112 ? 120.901 108.486 75.522  1.00 5.37   ? 112 SER A HG   1 
ATOM   1848  N  N    . GLY A  1 113 ? 122.825 113.324 75.144  1.00 5.54   ? 113 GLY A N    1 
ATOM   1849  C  CA   . GLY A  1 113 ? 122.688 114.708 75.528  1.00 5.54   ? 113 GLY A CA   1 
ATOM   1850  C  C    . GLY A  1 113 ? 122.425 114.931 76.995  1.00 5.54   ? 113 GLY A C    1 
ATOM   1851  O  O    . GLY A  1 113 ? 122.247 116.082 77.405  1.00 5.54   ? 113 GLY A O    1 
ATOM   1852  H  H    . GLY A  1 113 ? 123.608 113.007 75.285  1.00 5.54   ? 113 GLY A H    1 
ATOM   1853  H  HA2  . GLY A  1 113 ? 123.498 115.181 75.296  1.00 5.54   ? 113 GLY A HA2  1 
ATOM   1854  H  HA3  . GLY A  1 113 ? 121.954 115.098 75.036  1.00 5.54   ? 113 GLY A HA3  1 
ATOM   1855  N  N    . HIS A  1 114 ? 122.391 113.875 77.797  1.00 5.27   ? 114 HIS A N    1 
ATOM   1856  C  CA   . HIS A  1 114 ? 122.114 114.031 79.214  1.00 5.27   ? 114 HIS A CA   1 
ATOM   1857  C  C    . HIS A  1 114 ? 123.282 114.720 79.898  1.00 5.27   ? 114 HIS A C    1 
ATOM   1858  O  O    . HIS A  1 114 ? 124.427 114.271 79.807  1.00 5.27   ? 114 HIS A O    1 
ATOM   1859  C  CB   . HIS A  1 114 ? 121.827 112.676 79.848  1.00 5.27   ? 114 HIS A CB   1 
ATOM   1860  C  CG   . HIS A  1 114 ? 120.511 112.093 79.434  1.00 5.27   ? 114 HIS A CG   1 
ATOM   1861  N  ND1  . HIS A  1 114 ? 120.332 111.436 78.237  1.00 5.27   ? 114 HIS A ND1  1 
ATOM   1862  C  CD2  . HIS A  1 114 ? 119.307 112.085 80.052  1.00 5.27   ? 114 HIS A CD2  1 
ATOM   1863  C  CE1  . HIS A  1 114 ? 119.076 111.040 78.138  1.00 5.27   ? 114 HIS A CE1  1 
ATOM   1864  N  NE2  . HIS A  1 114 ? 118.433 111.422 79.226  1.00 5.27   ? 114 HIS A NE2  1 
ATOM   1865  H  H    . HIS A  1 114 ? 122.522 113.068 77.549  1.00 5.27   ? 114 HIS A H    1 
ATOM   1866  H  HA   . HIS A  1 114 ? 121.335 114.588 79.320  1.00 5.27   ? 114 HIS A HA   1 
ATOM   1867  N  N    . CYS A  1 115 ? 122.981 115.812 80.592  1.00 5.55   ? 115 CYS A N    1 
ATOM   1868  C  CA   . CYS A  1 115 ? 123.972 116.697 81.171  1.00 5.55   ? 115 CYS A CA   1 
ATOM   1869  C  C    . CYS A  1 115 ? 123.827 116.709 82.681  1.00 5.55   ? 115 CYS A C    1 
ATOM   1870  O  O    . CYS A  1 115 ? 122.711 116.721 83.211  1.00 5.55   ? 115 CYS A O    1 
ATOM   1871  C  CB   . CYS A  1 115 ? 123.833 118.104 80.624  1.00 5.55   ? 115 CYS A CB   1 
ATOM   1872  S  SG   . CYS A  1 115 ? 123.714 118.214 78.844  1.00 5.55   ? 115 CYS A SG   1 
ATOM   1873  H  H    . CYS A  1 115 ? 122.179 116.062 80.754  1.00 5.55   ? 115 CYS A H    1 
ATOM   1874  H  HA   . CYS A  1 115 ? 124.853 116.371 80.963  1.00 5.55   ? 115 CYS A HA   1 
ATOM   1875  H  HB2  . CYS A  1 115 ? 123.029 118.484 80.991  1.00 5.55   ? 115 CYS A HB2  1 
ATOM   1876  H  HB3  . CYS A  1 115 ? 124.602 118.617 80.897  1.00 5.55   ? 115 CYS A HB3  1 
ATOM   1877  H  HG   . CYS A  1 115 ? 123.647 119.380 78.590  1.00 5.55   ? 115 CYS A HG   1 
ATOM   1878  N  N    . GLN A  1 116 ? 124.975 116.738 83.348  1.00 9.89   ? 116 GLN A N    1 
ATOM   1879  C  CA   . GLN A  1 116 ? 125.121 116.394 84.752  1.00 9.89   ? 116 GLN A CA   1 
ATOM   1880  C  C    . GLN A  1 116 ? 126.068 117.387 85.409  1.00 9.89   ? 116 GLN A C    1 
ATOM   1881  O  O    . GLN A  1 116 ? 127.224 117.508 84.994  1.00 9.89   ? 116 GLN A O    1 
ATOM   1882  C  CB   . GLN A  1 116 ? 125.618 114.950 84.823  1.00 9.89   ? 116 GLN A CB   1 
ATOM   1883  C  CG   . GLN A  1 116 ? 125.698 114.264 86.135  1.00 9.89   ? 116 GLN A CG   1 
ATOM   1884  C  CD   . GLN A  1 116 ? 126.993 114.507 86.842  1.00 9.89   ? 116 GLN A CD   1 
ATOM   1885  O  OE1  . GLN A  1 116 ? 128.029 114.730 86.219  1.00 9.89   ? 116 GLN A OE1  1 
ATOM   1886  N  NE2  . GLN A  1 116 ? 126.980 114.308 88.130  1.00 9.89   ? 116 GLN A NE2  1 
ATOM   1887  H  H    . GLN A  1 116 ? 125.720 116.936 82.982  1.00 9.89   ? 116 GLN A H    1 
ATOM   1888  H  HA   . GLN A  1 116 ? 124.263 116.448 85.183  1.00 9.89   ? 116 GLN A HA   1 
ATOM   1889  H  HB2  . GLN A  1 116 ? 125.057 114.407 84.256  1.00 9.89   ? 116 GLN A HB2  1 
ATOM   1890  H  HB3  . GLN A  1 116 ? 126.516 114.952 84.472  1.00 9.89   ? 116 GLN A HB3  1 
ATOM   1891  H  HG2  . GLN A  1 116 ? 125.003 114.633 86.698  1.00 9.89   ? 116 GLN A HG2  1 
ATOM   1892  H  HG3  . GLN A  1 116 ? 125.570 113.312 86.027  1.00 9.89   ? 116 GLN A HG3  1 
ATOM   1893  H  HE21 . GLN A  1 116 ? 126.243 114.139 88.535  1.00 9.89   ? 116 GLN A HE21 1 
ATOM   1894  H  HE22 . GLN A  1 116 ? 127.706 114.417 88.572  1.00 9.89   ? 116 GLN A HE22 1 
ATOM   1895  N  N    . TYR A  1 117 ? 125.580 118.099 86.429  1.00 18.79  ? 117 TYR A N    1 
ATOM   1896  C  CA   . TYR A  1 117 ? 126.263 119.275 86.957  1.00 18.79  ? 117 TYR A CA   1 
ATOM   1897  C  C    . TYR A  1 117 ? 126.271 119.253 88.481  1.00 18.79  ? 117 TYR A C    1 
ATOM   1898  O  O    . TYR A  1 117 ? 125.211 119.162 89.111  1.00 18.79  ? 117 TYR A O    1 
ATOM   1899  C  CB   . TYR A  1 117 ? 125.586 120.548 86.436  1.00 18.79  ? 117 TYR A CB   1 
ATOM   1900  C  CG   . TYR A  1 117 ? 126.229 121.845 86.850  1.00 18.79  ? 117 TYR A CG   1 
ATOM   1901  C  CD1  . TYR A  1 117 ? 127.598 122.010 86.814  1.00 18.79  ? 117 TYR A CD1  1 
ATOM   1902  C  CD2  . TYR A  1 117 ? 125.459 122.911 87.273  1.00 18.79  ? 117 TYR A CD2  1 
ATOM   1903  C  CE1  . TYR A  1 117 ? 128.176 123.193 87.192  1.00 18.79  ? 117 TYR A CE1  1 
ATOM   1904  C  CE2  . TYR A  1 117 ? 126.029 124.090 87.652  1.00 18.79  ? 117 TYR A CE2  1 
ATOM   1905  C  CZ   . TYR A  1 117 ? 127.387 124.229 87.611  1.00 18.79  ? 117 TYR A CZ   1 
ATOM   1906  O  OH   . TYR A  1 117 ? 127.950 125.418 87.991  1.00 18.79  ? 117 TYR A OH   1 
ATOM   1907  H  H    . TYR A  1 117 ? 124.849 117.919 86.833  1.00 18.79  ? 117 TYR A H    1 
ATOM   1908  H  HA   . TYR A  1 117 ? 127.176 119.280 86.648  1.00 18.79  ? 117 TYR A HA   1 
ATOM   1909  H  HB2  . TYR A  1 117 ? 125.592 120.518 85.471  1.00 18.79  ? 117 TYR A HB2  1 
ATOM   1910  H  HB3  . TYR A  1 117 ? 124.676 120.566 86.754  1.00 18.79  ? 117 TYR A HB3  1 
ATOM   1911  H  HD1  . TYR A  1 117 ? 128.131 121.309 86.531  1.00 18.79  ? 117 TYR A HD1  1 
ATOM   1912  H  HD2  . TYR A  1 117 ? 124.538 122.823 87.302  1.00 18.79  ? 117 TYR A HD2  1 
ATOM   1913  H  HE1  . TYR A  1 117 ? 129.096 123.294 87.166  1.00 18.79  ? 117 TYR A HE1  1 
ATOM   1914  H  HE2  . TYR A  1 117 ? 125.499 124.796 87.935  1.00 18.79  ? 117 TYR A HE2  1 
ATOM   1915  H  HH   . TYR A  1 117 ? 127.350 125.926 88.284  1.00 18.79  ? 117 TYR A HH   1 
ATOM   1916  N  N    . LEU A  1 118 ? 127.477 119.333 89.060  1.00 8.85   ? 118 LEU A N    1 
ATOM   1917  C  CA   . LEU A  1 118 ? 127.727 119.353 90.505  1.00 8.85   ? 118 LEU A CA   1 
ATOM   1918  C  C    . LEU A  1 118 ? 128.474 120.603 90.926  1.00 8.85   ? 118 LEU A C    1 
ATOM   1919  O  O    . LEU A  1 118 ? 129.713 120.625 90.927  1.00 8.85   ? 118 LEU A O    1 
ATOM   1920  C  CB   . LEU A  1 118 ? 128.543 118.152 90.948  1.00 8.85   ? 118 LEU A CB   1 
ATOM   1921  C  CG   . LEU A  1 118 ? 127.846 116.836 91.106  1.00 8.85   ? 118 LEU A CG   1 
ATOM   1922  C  CD1  . LEU A  1 118 ? 127.510 116.384 89.823  1.00 8.85   ? 118 LEU A CD1  1 
ATOM   1923  C  CD2  . LEU A  1 118 ? 128.834 115.870 91.641  1.00 8.85   ? 118 LEU A CD2  1 
ATOM   1924  H  H    . LEU A  1 118 ? 128.204 119.368 88.608  1.00 8.85   ? 118 LEU A H    1 
ATOM   1925  H  HA   . LEU A  1 118 ? 126.882 119.323 90.966  1.00 8.85   ? 118 LEU A HA   1 
ATOM   1926  H  HB2  . LEU A  1 118 ? 129.258 118.029 90.310  1.00 8.85   ? 118 LEU A HB2  1 
ATOM   1927  H  HB3  . LEU A  1 118 ? 128.920 118.365 91.813  1.00 8.85   ? 118 LEU A HB3  1 
ATOM   1928  H  HG   . LEU A  1 118 ? 127.068 116.891 91.672  1.00 8.85   ? 118 LEU A HG   1 
ATOM   1929  H  HD11 . LEU A  1 118 ? 127.011 115.575 89.958  1.00 8.85   ? 118 LEU A HD11 1 
ATOM   1930  H  HD12 . LEU A  1 118 ? 126.958 117.046 89.397  1.00 8.85   ? 118 LEU A HD12 1 
ATOM   1931  H  HD13 . LEU A  1 118 ? 128.331 116.237 89.327  1.00 8.85   ? 118 LEU A HD13 1 
ATOM   1932  H  HD21 . LEU A  1 118 ? 128.468 114.987 91.539  1.00 8.85   ? 118 LEU A HD21 1 
ATOM   1933  H  HD22 . LEU A  1 118 ? 129.631 115.927 91.097  1.00 8.85   ? 118 LEU A HD22 1 
ATOM   1934  H  HD23 . LEU A  1 118 ? 129.045 116.085 92.558  1.00 8.85   ? 118 LEU A HD23 1 
ATOM   1935  N  N    . PRO A  1 119 ? 127.773 121.659 91.285  1.00 7.40   ? 119 PRO A N    1 
ATOM   1936  C  CA   . PRO A  1 119 ? 128.420 122.770 91.938  1.00 7.40   ? 119 PRO A CA   1 
ATOM   1937  C  C    . PRO A  1 119 ? 128.463 122.563 93.441  1.00 7.40   ? 119 PRO A C    1 
ATOM   1938  O  O    . PRO A  1 119 ? 127.423 122.626 94.112  1.00 7.40   ? 119 PRO A O    1 
ATOM   1939  C  CB   . PRO A  1 119 ? 127.540 123.959 91.550  1.00 7.40   ? 119 PRO A CB   1 
ATOM   1940  C  CG   . PRO A  1 119 ? 126.225 123.376 91.232  1.00 7.40   ? 119 PRO A CG   1 
ATOM   1941  C  CD   . PRO A  1 119 ? 126.403 121.961 90.863  1.00 7.40   ? 119 PRO A CD   1 
ATOM   1942  H  HA   . PRO A  1 119 ? 129.309 122.890 91.585  1.00 7.40   ? 119 PRO A HA   1 
ATOM   1943  H  HB2  . PRO A  1 119 ? 127.479 124.573 92.291  1.00 7.40   ? 119 PRO A HB2  1 
ATOM   1944  H  HB3  . PRO A  1 119 ? 127.921 124.381 90.768  1.00 7.40   ? 119 PRO A HB3  1 
ATOM   1945  H  HG2  . PRO A  1 119 ? 125.649 123.450 92.001  1.00 7.40   ? 119 PRO A HG2  1 
ATOM   1946  H  HG3  . PRO A  1 119 ? 125.842 123.847 90.480  1.00 7.40   ? 119 PRO A HG3  1 
ATOM   1947  H  HD2  . PRO A  1 119 ? 125.779 121.405 91.348  1.00 7.40   ? 119 PRO A HD2  1 
ATOM   1948  H  HD3  . PRO A  1 119 ? 126.314 121.834 89.912  1.00 7.40   ? 119 PRO A HD3  1 
ATOM   1949  N  N    . PRO A  1 120 ? 129.638 122.313 94.010  1.00 4.14   ? 120 PRO A N    1 
ATOM   1950  C  CA   . PRO A  1 120 ? 129.760 122.273 95.466  1.00 4.14   ? 120 PRO A CA   1 
ATOM   1951  C  C    . PRO A  1 120 ? 129.864 123.666 96.056  1.00 4.14   ? 120 PRO A C    1 
ATOM   1952  O  O    . PRO A  1 120 ? 130.180 124.638 95.371  1.00 4.14   ? 120 PRO A O    1 
ATOM   1953  C  CB   . PRO A  1 120 ? 131.059 121.498 95.682  1.00 4.14   ? 120 PRO A CB   1 
ATOM   1954  C  CG   . PRO A  1 120 ? 131.811 121.722 94.474  1.00 4.14   ? 120 PRO A CG   1 
ATOM   1955  C  CD   . PRO A  1 120 ? 130.838 121.757 93.372  1.00 4.14   ? 120 PRO A CD   1 
ATOM   1956  H  HA   . PRO A  1 120 ? 129.018 121.801 95.861  1.00 4.14   ? 120 PRO A HA   1 
ATOM   1957  H  HB2  . PRO A  1 120 ? 131.523 121.866 96.444  1.00 4.14   ? 120 PRO A HB2  1 
ATOM   1958  H  HB3  . PRO A  1 120 ? 130.880 120.558 95.800  1.00 4.14   ? 120 PRO A HB3  1 
ATOM   1959  H  HG2  . PRO A  1 120 ? 132.265 122.570 94.538  1.00 4.14   ? 120 PRO A HG2  1 
ATOM   1960  H  HG3  . PRO A  1 120 ? 132.437 120.999 94.348  1.00 4.14   ? 120 PRO A HG3  1 
ATOM   1961  H  HD2  . PRO A  1 120 ? 131.155 122.336 92.668  1.00 4.14   ? 120 PRO A HD2  1 
ATOM   1962  H  HD3  . PRO A  1 120 ? 130.669 120.860 93.061  1.00 4.14   ? 120 PRO A HD3  1 
ATOM   1963  N  N    . GLY A  1 121 ? 129.700 123.829 97.360  1.00 4.90   ? 121 GLY A N    1 
ATOM   1964  C  CA   . GLY A  1 121 ? 129.924 125.159 97.949  1.00 4.90   ? 121 GLY A CA   1 
ATOM   1965  C  C    . GLY A  1 121 ? 129.659 125.199 99.431  1.00 4.90   ? 121 GLY A C    1 
ATOM   1966  O  O    . GLY A  1 121 ? 129.133 124.239 99.940  1.00 4.90   ? 121 GLY A O    1 
ATOM   1967  H  H    . GLY A  1 121 ? 129.315 123.207 97.901  1.00 4.90   ? 121 GLY A H    1 
ATOM   1968  H  HA2  . GLY A  1 121 ? 130.862 125.429 97.779  1.00 4.90   ? 121 GLY A HA2  1 
ATOM   1969  H  HA3  . GLY A  1 121 ? 129.334 125.812 97.495  1.00 4.90   ? 121 GLY A HA3  1 
ATOM   1970  N  N    . ILE A  1 122 ? 130.086 126.263 100.105 1.00 6.10   ? 122 ILE A N    1 
ATOM   1971  C  CA   . ILE A  1 122 ? 129.769 126.512 101.536 1.00 6.10   ? 122 ILE A CA   1 
ATOM   1972  C  C    . ILE A  1 122 ? 128.632 127.529 101.469 1.00 6.10   ? 122 ILE A C    1 
ATOM   1973  O  O    . ILE A  1 122 ? 128.934 128.687 101.240 1.00 6.10   ? 122 ILE A O    1 
ATOM   1974  C  CB   . ILE A  1 122 ? 130.982 127.048 102.319 1.00 6.10   ? 122 ILE A CB   1 
ATOM   1975  C  CG1  . ILE A  1 122 ? 132.165 126.086 102.275 1.00 6.10   ? 122 ILE A CG1  1 
ATOM   1976  C  CG2  . ILE A  1 122 ? 130.601 127.373 103.748 1.00 6.10   ? 122 ILE A CG2  1 
ATOM   1977  C  CD1  . ILE A  1 122 ? 131.995 124.876 103.117 1.00 6.10   ? 122 ILE A CD1  1 
ATOM   1978  H  H    . ILE A  1 122 ? 130.565 126.933 99.715  1.00 6.10   ? 122 ILE A H    1 
ATOM   1979  H  HA   . ILE A  1 122 ? 129.462 125.685 101.947 1.00 6.10   ? 122 ILE A HA   1 
ATOM   1980  H  HB   . ILE A  1 122 ? 131.268 127.889 101.885 1.00 6.10   ? 122 ILE A HB   1 
ATOM   1981  H  HG12 . ILE A  1 122 ? 132.306 125.805 101.346 1.00 6.10   ? 122 ILE A HG12 1 
ATOM   1982  H  HG13 . ILE A  1 122 ? 132.969 126.562 102.570 1.00 6.10   ? 122 ILE A HG13 1 
ATOM   1983  H  HG21 . ILE A  1 122 ? 131.397 127.614 104.252 1.00 6.10   ? 122 ILE A HG21 1 
ATOM   1984  H  HG22 . ILE A  1 122 ? 129.976 128.119 103.757 1.00 6.10   ? 122 ILE A HG22 1 
ATOM   1985  H  HG23 . ILE A  1 122 ? 130.182 126.597 104.159 1.00 6.10   ? 122 ILE A HG23 1 
ATOM   1986  H  HD11 . ILE A  1 122 ? 132.656 124.208 102.864 1.00 6.10   ? 122 ILE A HD11 1 
ATOM   1987  H  HD12 . ILE A  1 122 ? 132.116 125.111 104.053 1.00 6.10   ? 122 ILE A HD12 1 
ATOM   1988  H  HD13 . ILE A  1 122 ? 131.102 124.512 102.987 1.00 6.10   ? 122 ILE A HD13 1 
ATOM   1989  N  N    . PHE A  1 123 ? 127.382 127.123 101.668 1.00 6.04   ? 123 PHE A N    1 
ATOM   1990  C  CA   . PHE A  1 123 ? 126.206 128.003 101.500 1.00 6.04   ? 123 PHE A CA   1 
ATOM   1991  C  C    . PHE A  1 123 ? 125.784 128.594 102.840 1.00 6.04   ? 123 PHE A C    1 
ATOM   1992  O  O    . PHE A  1 123 ? 125.702 127.832 103.757 1.00 6.04   ? 123 PHE A O    1 
ATOM   1993  C  CB   . PHE A  1 123 ? 125.030 127.216 100.925 1.00 6.04   ? 123 PHE A CB   1 
ATOM   1994  C  CG   . PHE A  1 123 ? 125.206 126.696 99.522  1.00 6.04   ? 123 PHE A CG   1 
ATOM   1995  C  CD1  . PHE A  1 123 ? 126.247 125.861 99.205  1.00 6.04   ? 123 PHE A CD1  1 
ATOM   1996  C  CD2  . PHE A  1 123 ? 124.354 127.065 98.505  1.00 6.04   ? 123 PHE A CD2  1 
ATOM   1997  C  CE1  . PHE A  1 123 ? 126.391 125.365 97.923  1.00 6.04   ? 123 PHE A CE1  1 
ATOM   1998  C  CE2  . PHE A  1 123 ? 124.508 126.588 97.223  1.00 6.04   ? 123 PHE A CE2  1 
ATOM   1999  C  CZ   . PHE A  1 123 ? 125.525 125.729 96.939  1.00 6.04   ? 123 PHE A CZ   1 
ATOM   2000  H  H    . PHE A  1 123 ? 127.154 126.298 101.980 1.00 6.04   ? 123 PHE A H    1 
ATOM   2001  H  HA   . PHE A  1 123 ? 126.444 128.730 100.871 1.00 6.04   ? 123 PHE A HA   1 
ATOM   2002  H  HB2  . PHE A  1 123 ? 124.855 126.455 101.518 1.00 6.04   ? 123 PHE A HB2  1 
ATOM   2003  H  HB3  . PHE A  1 123 ? 124.238 127.793 100.946 1.00 6.04   ? 123 PHE A HB3  1 
ATOM   2004  H  HD1  . PHE A  1 123 ? 126.825 125.567 99.888  1.00 6.04   ? 123 PHE A HD1  1 
ATOM   2005  H  HD2  . PHE A  1 123 ? 123.683 127.657 98.675  1.00 6.04   ? 123 PHE A HD2  1 
ATOM   2006  H  HE1  . PHE A  1 123 ? 127.076 124.755 97.732  1.00 6.04   ? 123 PHE A HE1  1 
ATOM   2007  H  HE2  . PHE A  1 123 ? 123.909 126.855 96.543  1.00 6.04   ? 123 PHE A HE2  1 
ATOM   2008  H  HZ   . PHE A  1 123 ? 125.626 125.389 96.076  1.00 6.04   ? 123 PHE A HZ   1 
ATOM   2009  N  N    . LYS A  1 124 ? 125.525 129.895 102.943 1.00 7.88   ? 124 LYS A N    1 
ATOM   2010  C  CA   . LYS A  1 124 ? 125.012 130.516 104.180 1.00 7.88   ? 124 LYS A CA   1 
ATOM   2011  C  C    . LYS A  1 124 ? 123.568 130.905 103.900 1.00 7.88   ? 124 LYS A C    1 
ATOM   2012  O  O    . LYS A  1 124 ? 123.385 131.712 103.021 1.00 7.88   ? 124 LYS A O    1 
ATOM   2013  C  CB   . LYS A  1 124 ? 125.787 131.776 104.541 1.00 7.88   ? 124 LYS A CB   1 
ATOM   2014  C  CG   . LYS A  1 124 ? 127.276 131.594 104.710 1.00 7.88   ? 124 LYS A CG   1 
ATOM   2015  C  CD   . LYS A  1 124 ? 127.952 132.856 105.120 1.00 7.88   ? 124 LYS A CD   1 
ATOM   2016  C  CE   . LYS A  1 124 ? 129.350 132.601 105.615 1.00 7.88   ? 124 LYS A CE   1 
ATOM   2017  N  NZ   . LYS A  1 124 ? 130.116 131.779 104.648 1.00 7.88   ? 124 LYS A NZ   1 
ATOM   2018  H  H    . LYS A  1 124 ? 125.611 130.486 102.255 1.00 7.88   ? 124 LYS A H    1 
ATOM   2019  H  HA   . LYS A  1 124 ? 125.058 129.867 104.918 1.00 7.88   ? 124 LYS A HA   1 
ATOM   2020  H  HB2  . LYS A  1 124 ? 125.634 132.443 103.839 1.00 7.88   ? 124 LYS A HB2  1 
ATOM   2021  H  HB3  . LYS A  1 124 ? 125.421 132.135 105.377 1.00 7.88   ? 124 LYS A HB3  1 
ATOM   2022  H  HG2  . LYS A  1 124 ? 127.439 130.905 105.388 1.00 7.88   ? 124 LYS A HG2  1 
ATOM   2023  H  HG3  . LYS A  1 124 ? 127.659 131.282 103.861 1.00 7.88   ? 124 LYS A HG3  1 
ATOM   2024  H  HD2  . LYS A  1 124 ? 127.989 133.468 104.355 1.00 7.88   ? 124 LYS A HD2  1 
ATOM   2025  H  HD3  . LYS A  1 124 ? 127.431 133.286 105.832 1.00 7.88   ? 124 LYS A HD3  1 
ATOM   2026  H  HE2  . LYS A  1 124 ? 129.811 133.450 105.750 1.00 7.88   ? 124 LYS A HE2  1 
ATOM   2027  H  HE3  . LYS A  1 124 ? 129.314 132.134 106.472 1.00 7.88   ? 124 LYS A HE3  1 
ATOM   2028  H  HZ1  . LYS A  1 124 ? 130.333 132.280 103.924 1.00 7.88   ? 124 LYS A HZ1  1 
ATOM   2029  H  HZ2  . LYS A  1 124 ? 130.878 131.482 105.039 1.00 7.88   ? 124 LYS A HZ2  1 
ATOM   2030  H  HZ3  . LYS A  1 124 ? 129.627 131.066 104.383 1.00 7.88   ? 124 LYS A HZ3  1 
ATOM   2031  N  N    . SER A  1 125 ? 122.588 130.396 104.635 1.00 10.05  ? 125 SER A N    1 
ATOM   2032  C  CA   . SER A  1 125 ? 121.169 130.710 104.374 1.00 10.05  ? 125 SER A CA   1 
ATOM   2033  C  C    . SER A  1 125 ? 120.547 131.331 105.618 1.00 10.05  ? 125 SER A C    1 
ATOM   2034  O  O    . SER A  1 125 ? 121.090 131.165 106.682 1.00 10.05  ? 125 SER A O    1 
ATOM   2035  C  CB   . SER A  1 125 ? 120.437 129.501 103.902 1.00 10.05  ? 125 SER A CB   1 
ATOM   2036  O  OG   . SER A  1 125 ? 120.021 128.704 104.987 1.00 10.05  ? 125 SER A OG   1 
ATOM   2037  H  H    . SER A  1 125 ? 122.701 129.814 105.327 1.00 10.05  ? 125 SER A H    1 
ATOM   2038  H  HA   . SER A  1 125 ? 121.145 131.389 103.646 1.00 10.05  ? 125 SER A HA   1 
ATOM   2039  H  HB2  . SER A  1 125 ? 119.652 129.778 103.377 1.00 10.05  ? 125 SER A HB2  1 
ATOM   2040  H  HB3  . SER A  1 125 ? 121.025 128.973 103.318 1.00 10.05  ? 125 SER A HB3  1 
ATOM   2041  H  HG   . SER A  1 125 ? 119.703 127.981 104.684 1.00 10.05  ? 125 SER A HG   1 
ATOM   2042  N  N    . SER A  1 126 ? 119.461 132.069 105.450 1.00 14.22  ? 126 SER A N    1 
ATOM   2043  C  CA   . SER A  1 126 ? 118.755 132.750 106.522 1.00 14.22  ? 126 SER A CA   1 
ATOM   2044  C  C    . SER A  1 126 ? 117.720 131.814 107.129 1.00 14.22  ? 126 SER A C    1 
ATOM   2045  O  O    . SER A  1 126 ? 116.843 131.309 106.420 1.00 14.22  ? 126 SER A O    1 
ATOM   2046  C  CB   . SER A  1 126 ? 118.087 134.006 105.981 1.00 14.22  ? 126 SER A CB   1 
ATOM   2047  O  OG   . SER A  1 126 ? 119.047 134.940 105.533 1.00 14.22  ? 126 SER A OG   1 
ATOM   2048  H  H    . SER A  1 126 ? 119.155 132.243 104.669 1.00 14.22  ? 126 SER A H    1 
ATOM   2049  H  HA   . SER A  1 126 ? 119.384 133.005 107.208 1.00 14.22  ? 126 SER A HA   1 
ATOM   2050  H  HB2  . SER A  1 126 ? 117.523 133.752 105.237 1.00 14.22  ? 126 SER A HB2  1 
ATOM   2051  H  HB3  . SER A  1 126 ? 117.553 134.400 106.683 1.00 14.22  ? 126 SER A HB3  1 
ATOM   2052  H  HG   . SER A  1 126 ? 118.662 135.565 105.126 1.00 14.22  ? 126 SER A HG   1 
ATOM   2053  N  N    . CYS A  1 127 ? 117.814 131.581 108.435 1.00 24.31  ? 127 CYS A N    1 
ATOM   2054  C  CA   . CYS A  1 127 ? 116.825 130.766 109.125 1.00 24.31  ? 127 CYS A CA   1 
ATOM   2055  C  C    . CYS A  1 127 ? 116.617 131.306 110.530 1.00 24.31  ? 127 CYS A C    1 
ATOM   2056  O  O    . CYS A  1 127 ? 117.583 131.550 111.258 1.00 24.31  ? 127 CYS A O    1 
ATOM   2057  C  CB   . CYS A  1 127 ? 117.246 129.291 109.162 1.00 24.31  ? 127 CYS A CB   1 
ATOM   2058  S  SG   . CYS A  1 127 ? 118.427 128.818 110.435 1.00 24.31  ? 127 CYS A SG   1 
ATOM   2059  H  H    . CYS A  1 127 ? 118.436 131.880 108.944 1.00 24.31  ? 127 CYS A H    1 
ATOM   2060  H  HA   . CYS A  1 127 ? 115.982 130.827 108.655 1.00 24.31  ? 127 CYS A HA   1 
ATOM   2061  H  HB2  . CYS A  1 127 ? 116.451 128.756 109.301 1.00 24.31  ? 127 CYS A HB2  1 
ATOM   2062  H  HB3  . CYS A  1 127 ? 117.644 129.071 108.307 1.00 24.31  ? 127 CYS A HB3  1 
ATOM   2063  N  N    . TYR A  1 128 ? 115.351 131.497 110.892 1.00 38.81  ? 128 TYR A N    1 
ATOM   2064  C  CA   . TYR A  1 128 ? 114.991 131.973 112.219 1.00 38.81  ? 128 TYR A CA   1 
ATOM   2065  C  C    . TYR A  1 128 ? 115.323 130.922 113.269 1.00 38.81  ? 128 TYR A C    1 
ATOM   2066  O  O    . TYR A  1 128 ? 114.880 129.774 113.174 1.00 38.81  ? 128 TYR A O    1 
ATOM   2067  C  CB   . TYR A  1 128 ? 113.499 132.298 112.259 1.00 38.81  ? 128 TYR A CB   1 
ATOM   2068  C  CG   . TYR A  1 128 ? 112.998 132.847 113.573 1.00 38.81  ? 128 TYR A CG   1 
ATOM   2069  C  CD1  . TYR A  1 128 ? 113.246 134.159 113.939 1.00 38.81  ? 128 TYR A CD1  1 
ATOM   2070  C  CD2  . TYR A  1 128 ? 112.265 132.055 114.442 1.00 38.81  ? 128 TYR A CD2  1 
ATOM   2071  C  CE1  . TYR A  1 128 ? 112.793 134.665 115.137 1.00 38.81  ? 128 TYR A CE1  1 
ATOM   2072  C  CE2  . TYR A  1 128 ? 111.804 132.552 115.642 1.00 38.81  ? 128 TYR A CE2  1 
ATOM   2073  C  CZ   . TYR A  1 128 ? 112.070 133.858 115.985 1.00 38.81  ? 128 TYR A CZ   1 
ATOM   2074  O  OH   . TYR A  1 128 ? 111.610 134.360 117.181 1.00 38.81  ? 128 TYR A OH   1 
ATOM   2075  H  H    . TYR A  1 128 ? 114.679 131.364 110.375 1.00 38.81  ? 128 TYR A H    1 
ATOM   2076  H  HA   . TYR A  1 128 ? 115.491 132.776 112.424 1.00 38.81  ? 128 TYR A HA   1 
ATOM   2077  H  HB2  . TYR A  1 128 ? 113.307 132.954 111.572 1.00 38.81  ? 128 TYR A HB2  1 
ATOM   2078  H  HB3  . TYR A  1 128 ? 113.011 131.480 112.084 1.00 38.81  ? 128 TYR A HB3  1 
ATOM   2079  H  HD1  . TYR A  1 128 ? 113.738 134.707 113.371 1.00 38.81  ? 128 TYR A HD1  1 
ATOM   2080  H  HD2  . TYR A  1 128 ? 112.085 131.174 114.211 1.00 38.81  ? 128 TYR A HD2  1 
ATOM   2081  H  HE1  . TYR A  1 128 ? 112.973 135.547 115.370 1.00 38.81  ? 128 TYR A HE1  1 
ATOM   2082  H  HE2  . TYR A  1 128 ? 111.315 132.010 116.215 1.00 38.81  ? 128 TYR A HE2  1 
ATOM   2083  H  HH   . TYR A  1 128 ? 111.188 133.768 117.600 1.00 38.81  ? 128 TYR A HH   1 
ATOM   2084  N  N    . ILE A  1 129 ? 116.099 131.318 114.274 1.00 41.16  ? 129 ILE A N    1 
ATOM   2085  C  CA   . ILE A  1 129 ? 116.447 130.446 115.389 1.00 41.16  ? 129 ILE A CA   1 
ATOM   2086  C  C    . ILE A  1 129 ? 115.619 130.854 116.597 1.00 41.16  ? 129 ILE A C    1 
ATOM   2087  O  O    . ILE A  1 129 ? 115.477 132.048 116.889 1.00 41.16  ? 129 ILE A O    1 
ATOM   2088  C  CB   . ILE A  1 129 ? 117.946 130.518 115.717 1.00 41.16  ? 129 ILE A CB   1 
ATOM   2089  C  CG1  . ILE A  1 129 ? 118.794 130.130 114.507 1.00 41.16  ? 129 ILE A CG1  1 
ATOM   2090  C  CG2  . ILE A  1 129 ? 118.250 129.589 116.872 1.00 41.16  ? 129 ILE A CG2  1 
ATOM   2091  C  CD1  . ILE A  1 129 ? 118.573 128.733 114.016 1.00 41.16  ? 129 ILE A CD1  1 
ATOM   2092  H  H    . ILE A  1 129 ? 116.451 132.099 114.330 1.00 41.16  ? 129 ILE A H    1 
ATOM   2093  H  HA   . ILE A  1 129 ? 116.225 129.532 115.163 1.00 41.16  ? 129 ILE A HA   1 
ATOM   2094  H  HB   . ILE A  1 129 ? 118.165 131.425 115.976 1.00 41.16  ? 129 ILE A HB   1 
ATOM   2095  H  HG12 . ILE A  1 129 ? 118.595 130.733 113.779 1.00 41.16  ? 129 ILE A HG12 1 
ATOM   2096  H  HG13 . ILE A  1 129 ? 119.729 130.206 114.748 1.00 41.16  ? 129 ILE A HG13 1 
ATOM   2097  H  HG21 . ILE A  1 129 ? 119.197 129.564 117.035 1.00 41.16  ? 129 ILE A HG21 1 
ATOM   2098  H  HG22 . ILE A  1 129 ? 117.783 129.893 117.665 1.00 41.16  ? 129 ILE A HG22 1 
ATOM   2099  H  HG23 . ILE A  1 129 ? 117.953 128.702 116.634 1.00 41.16  ? 129 ILE A HG23 1 
ATOM   2100  H  HD11 . ILE A  1 129 ? 119.144 128.583 113.248 1.00 41.16  ? 129 ILE A HD11 1 
ATOM   2101  H  HD12 . ILE A  1 129 ? 118.800 128.108 114.721 1.00 41.16  ? 129 ILE A HD12 1 
ATOM   2102  H  HD13 . ILE A  1 129 ? 117.644 128.629 113.765 1.00 41.16  ? 129 ILE A HD13 1 
ATOM   2103  N  N    . ASP A  1 130 ? 115.074 129.866 117.301 1.00 48.44  ? 130 ASP A N    1 
ATOM   2104  C  CA   . ASP A  1 130 ? 114.339 130.084 118.542 1.00 48.44  ? 130 ASP A CA   1 
ATOM   2105  C  C    . ASP A  1 130 ? 115.145 129.477 119.683 1.00 48.44  ? 130 ASP A C    1 
ATOM   2106  O  O    . ASP A  1 130 ? 115.326 128.256 119.741 1.00 48.44  ? 130 ASP A O    1 
ATOM   2107  C  CB   . ASP A  1 130 ? 112.943 129.473 118.467 1.00 48.44  ? 130 ASP A CB   1 
ATOM   2108  C  CG   . ASP A  1 130 ? 112.043 129.940 119.590 1.00 48.44  ? 130 ASP A CG   1 
ATOM   2109  O  OD1  . ASP A  1 130 ? 112.226 131.080 120.065 1.00 48.44  ? 130 ASP A OD1  1 
ATOM   2110  O  OD2  . ASP A  1 130 ? 111.153 129.167 120.002 1.00 48.44  ? 130 ASP A OD2  1 
ATOM   2111  H  H    . ASP A  1 130 ? 115.120 129.039 117.074 1.00 48.44  ? 130 ASP A H    1 
ATOM   2112  H  HA   . ASP A  1 130 ? 114.250 131.033 118.705 1.00 48.44  ? 130 ASP A HA   1 
ATOM   2113  H  HB2  . ASP A  1 130 ? 112.532 129.726 117.627 1.00 48.44  ? 130 ASP A HB2  1 
ATOM   2114  H  HB3  . ASP A  1 130 ? 113.020 128.509 118.526 1.00 48.44  ? 130 ASP A HB3  1 
ATOM   2115  N  N    . VAL A  1 131 ? 115.617 130.328 120.587 1.00 53.41  ? 131 VAL A N    1 
ATOM   2116  C  CA   . VAL A  1 131 ? 116.428 129.908 121.720 1.00 53.41  ? 131 VAL A CA   1 
ATOM   2117  C  C    . VAL A  1 131 ? 115.620 129.927 123.015 1.00 53.41  ? 131 VAL A C    1 
ATOM   2118  O  O    . VAL A  1 131 ? 116.190 129.983 124.100 1.00 53.41  ? 131 VAL A O    1 
ATOM   2119  C  CB   . VAL A  1 131 ? 117.693 130.769 121.849 1.00 53.41  ? 131 VAL A CB   1 
ATOM   2120  C  CG1  . VAL A  1 131 ? 118.609 130.536 120.673 1.00 53.41  ? 131 VAL A CG1  1 
ATOM   2121  C  CG2  . VAL A  1 131 ? 117.329 132.236 121.958 1.00 53.41  ? 131 VAL A CG2  1 
ATOM   2122  H  H    . VAL A  1 131 ? 115.470 131.172 120.564 1.00 53.41  ? 131 VAL A H    1 
ATOM   2123  H  HA   . VAL A  1 131 ? 116.715 128.996 121.573 1.00 53.41  ? 131 VAL A HA   1 
ATOM   2124  H  HB   . VAL A  1 131 ? 118.165 130.517 122.655 1.00 53.41  ? 131 VAL A HB   1 
ATOM   2125  H  HG11 . VAL A  1 131 ? 119.404 131.077 120.784 1.00 53.41  ? 131 VAL A HG11 1 
ATOM   2126  H  HG12 . VAL A  1 131 ? 118.846 129.598 120.641 1.00 53.41  ? 131 VAL A HG12 1 
ATOM   2127  H  HG13 . VAL A  1 131 ? 118.144 130.789 119.863 1.00 53.41  ? 131 VAL A HG13 1 
ATOM   2128  H  HG21 . VAL A  1 131 ? 118.141 132.749 122.079 1.00 53.41  ? 131 VAL A HG21 1 
ATOM   2129  H  HG22 . VAL A  1 131 ? 116.882 132.513 121.144 1.00 53.41  ? 131 VAL A HG22 1 
ATOM   2130  H  HG23 . VAL A  1 131 ? 116.743 132.362 122.718 1.00 53.41  ? 131 VAL A HG23 1 
ATOM   2131  N  N    . ARG A  1 132 ? 114.294 129.879 122.910 1.00 57.10  ? 132 ARG A N    1 
ATOM   2132  C  CA   . ARG A  1 132 ? 113.457 129.927 124.102 1.00 57.10  ? 132 ARG A CA   1 
ATOM   2133  C  C    . ARG A  1 132 ? 113.708 128.723 124.999 1.00 57.10  ? 132 ARG A C    1 
ATOM   2134  O  O    . ARG A  1 132 ? 113.710 128.845 126.229 1.00 57.10  ? 132 ARG A O    1 
ATOM   2135  C  CB   . ARG A  1 132 ? 111.988 130.001 123.692 1.00 57.10  ? 132 ARG A CB   1 
ATOM   2136  C  CG   . ARG A  1 132 ? 111.057 130.449 124.792 1.00 57.10  ? 132 ARG A CG   1 
ATOM   2137  C  CD   . ARG A  1 132 ? 110.364 129.262 125.419 1.00 57.10  ? 132 ARG A CD   1 
ATOM   2138  N  NE   . ARG A  1 132 ? 109.541 129.651 126.560 1.00 57.10  ? 132 ARG A NE   1 
ATOM   2139  C  CZ   . ARG A  1 132 ? 109.951 129.636 127.823 1.00 57.10  ? 132 ARG A CZ   1 
ATOM   2140  N  NH1  . ARG A  1 132 ? 109.121 130.010 128.785 1.00 57.10  ? 132 ARG A NH1  1 
ATOM   2141  N  NH2  . ARG A  1 132 ? 111.184 129.256 128.130 1.00 57.10  ? 132 ARG A NH2  1 
ATOM   2142  H  H    . ARG A  1 132 ? 113.862 129.817 122.173 1.00 57.10  ? 132 ARG A H    1 
ATOM   2143  H  HA   . ARG A  1 132 ? 113.672 130.725 124.605 1.00 57.10  ? 132 ARG A HA   1 
ATOM   2144  H  HB2  . ARG A  1 132 ? 111.898 130.625 122.958 1.00 57.10  ? 132 ARG A HB2  1 
ATOM   2145  H  HB3  . ARG A  1 132 ? 111.702 129.120 123.411 1.00 57.10  ? 132 ARG A HB3  1 
ATOM   2146  H  HG2  . ARG A  1 132 ? 111.566 130.905 125.479 1.00 57.10  ? 132 ARG A HG2  1 
ATOM   2147  H  HG3  . ARG A  1 132 ? 110.383 131.039 124.422 1.00 57.10  ? 132 ARG A HG3  1 
ATOM   2148  H  HD2  . ARG A  1 132 ? 109.785 128.856 124.755 1.00 57.10  ? 132 ARG A HD2  1 
ATOM   2149  H  HD3  . ARG A  1 132 ? 111.030 128.623 125.712 1.00 57.10  ? 132 ARG A HD3  1 
ATOM   2150  H  HE   . ARG A  1 132 ? 108.700 129.769 126.421 1.00 57.10  ? 132 ARG A HE   1 
ATOM   2151  H  HH11 . ARG A  1 132 ? 108.322 130.257 128.588 1.00 57.10  ? 132 ARG A HH11 1 
ATOM   2152  H  HH12 . ARG A  1 132 ? 109.382 130.003 129.604 1.00 57.10  ? 132 ARG A HH12 1 
ATOM   2153  H  HH21 . ARG A  1 132 ? 111.730 129.013 127.515 1.00 57.10  ? 132 ARG A HH21 1 
ATOM   2154  H  HH22 . ARG A  1 132 ? 111.438 129.251 128.950 1.00 57.10  ? 132 ARG A HH22 1 
ATOM   2155  N  N    . TRP A  1 133 ? 113.928 127.545 124.414 1.00 57.91  ? 133 TRP A N    1 
ATOM   2156  C  CA   . TRP A  1 133 ? 114.111 126.291 125.190 1.00 57.91  ? 133 TRP A CA   1 
ATOM   2157  C  C    . TRP A  1 133 ? 115.589 125.935 125.254 1.00 57.91  ? 133 TRP A C    1 
ATOM   2158  O  O    . TRP A  1 133 ? 115.874 124.763 125.472 1.00 57.91  ? 133 TRP A O    1 
ATOM   2159  C  CB   . TRP A  1 133 ? 113.250 125.169 124.600 1.00 57.91  ? 133 TRP A CB   1 
ATOM   2160  C  CG   . TRP A  1 133 ? 111.788 125.467 124.706 1.00 57.91  ? 133 TRP A CG   1 
ATOM   2161  C  CD1  . TRP A  1 133 ? 110.907 125.658 123.683 1.00 57.91  ? 133 TRP A CD1  1 
ATOM   2162  C  CD2  . TRP A  1 133 ? 111.040 125.647 125.921 1.00 57.91  ? 133 TRP A CD2  1 
ATOM   2163  N  NE1  . TRP A  1 133 ? 109.659 125.925 124.178 1.00 57.91  ? 133 TRP A NE1  1 
ATOM   2164  C  CE2  . TRP A  1 133 ? 109.709 125.923 125.547 1.00 57.91  ? 133 TRP A CE2  1 
ATOM   2165  C  CE3  . TRP A  1 133 ? 111.359 125.589 127.282 1.00 57.91  ? 133 TRP A CE3  1 
ATOM   2166  C  CZ2  . TRP A  1 133 ? 108.705 126.144 126.486 1.00 57.91  ? 133 TRP A CZ2  1 
ATOM   2167  C  CZ3  . TRP A  1 133 ? 110.365 125.803 128.210 1.00 57.91  ? 133 TRP A CZ3  1 
ATOM   2168  C  CH2  . TRP A  1 133 ? 109.057 126.079 127.814 1.00 57.91  ? 133 TRP A CH2  1 
ATOM   2169  H  H    . TRP A  1 133 ? 114.003 127.429 123.511 1.00 57.91  ? 133 TRP A H    1 
ATOM   2170  H  HA   . TRP A  1 133 ? 113.798 126.448 126.105 1.00 57.91  ? 133 TRP A HA   1 
ATOM   2171  H  HB2  . TRP A  1 133 ? 113.494 125.044 123.660 1.00 57.91  ? 133 TRP A HB2  1 
ATOM   2172  H  HB3  . TRP A  1 133 ? 113.440 124.337 125.079 1.00 57.91  ? 133 TRP A HB3  1 
ATOM   2173  H  HD1  . TRP A  1 133 ? 111.119 125.605 122.765 1.00 57.91  ? 133 TRP A HD1  1 
ATOM   2174  H  HE1  . TRP A  1 133 ? 108.944 126.073 123.694 1.00 57.91  ? 133 TRP A HE1  1 
ATOM   2175  H  HE3  . TRP A  1 133 ? 112.241 125.401 127.561 1.00 57.91  ? 133 TRP A HE3  1 
ATOM   2176  H  HZ2  . TRP A  1 133 ? 107.822 126.330 126.220 1.00 57.91  ? 133 TRP A HZ2  1 
ATOM   2177  H  HZ3  . TRP A  1 133 ? 110.573 125.767 129.130 1.00 57.91  ? 133 TRP A HZ3  1 
ATOM   2178  H  HH2  . TRP A  1 133 ? 108.400 126.224 128.471 1.00 57.91  ? 133 TRP A HH2  1 
ATOM   2179  N  N    . PHE A  1 134 ? 116.486 126.913 125.116 1.00 55.70  ? 134 PHE A N    1 
ATOM   2180  C  CA   . PHE A  1 134 ? 117.915 126.673 125.204 1.00 55.70  ? 134 PHE A CA   1 
ATOM   2181  C  C    . PHE A  1 134 ? 118.248 125.960 126.513 1.00 55.70  ? 134 PHE A C    1 
ATOM   2182  O  O    . PHE A  1 134 ? 117.710 126.325 127.567 1.00 55.70  ? 134 PHE A O    1 
ATOM   2183  C  CB   . PHE A  1 134 ? 118.648 128.013 125.130 1.00 55.70  ? 134 PHE A CB   1 
ATOM   2184  C  CG   . PHE A  1 134 ? 120.136 127.903 125.005 1.00 55.70  ? 134 PHE A CG   1 
ATOM   2185  C  CD1  . PHE A  1 134 ? 120.909 127.496 126.074 1.00 55.70  ? 134 PHE A CD1  1 
ATOM   2186  C  CD2  . PHE A  1 134 ? 120.766 128.257 123.832 1.00 55.70  ? 134 PHE A CD2  1 
ATOM   2187  C  CE1  . PHE A  1 134 ? 122.278 127.414 125.959 1.00 55.70  ? 134 PHE A CE1  1 
ATOM   2188  C  CE2  . PHE A  1 134 ? 122.131 128.178 123.717 1.00 55.70  ? 134 PHE A CE2  1 
ATOM   2189  C  CZ   . PHE A  1 134 ? 122.886 127.758 124.781 1.00 55.70  ? 134 PHE A CZ   1 
ATOM   2190  H  H    . PHE A  1 134 ? 116.278 127.733 124.980 1.00 55.70  ? 134 PHE A H    1 
ATOM   2191  H  HA   . PHE A  1 134 ? 118.189 126.131 124.457 1.00 55.70  ? 134 PHE A HA   1 
ATOM   2192  H  HB2  . PHE A  1 134 ? 118.324 128.493 124.355 1.00 55.70  ? 134 PHE A HB2  1 
ATOM   2193  H  HB3  . PHE A  1 134 ? 118.456 128.514 125.935 1.00 55.70  ? 134 PHE A HB3  1 
ATOM   2194  H  HD1  . PHE A  1 134 ? 120.496 127.258 126.873 1.00 55.70  ? 134 PHE A HD1  1 
ATOM   2195  H  HD2  . PHE A  1 134 ? 120.260 128.543 123.109 1.00 55.70  ? 134 PHE A HD2  1 
ATOM   2196  H  HE1  . PHE A  1 134 ? 122.790 127.130 126.679 1.00 55.70  ? 134 PHE A HE1  1 
ATOM   2197  H  HE2  . PHE A  1 134 ? 122.543 128.413 122.920 1.00 55.70  ? 134 PHE A HE2  1 
ATOM   2198  H  HZ   . PHE A  1 134 ? 123.808 127.705 124.703 1.00 55.70  ? 134 PHE A HZ   1 
ATOM   2199  N  N    . PRO A  1 135 ? 119.130 124.946 126.498 1.00 54.14  ? 135 PRO A N    1 
ATOM   2200  C  CA   . PRO A  1 135 ? 119.801 124.322 125.356 1.00 54.14  ? 135 PRO A CA   1 
ATOM   2201  C  C    . PRO A  1 135 ? 119.041 123.134 124.779 1.00 54.14  ? 135 PRO A C    1 
ATOM   2202  O  O    . PRO A  1 135 ? 119.580 122.412 123.944 1.00 54.14  ? 135 PRO A O    1 
ATOM   2203  C  CB   . PRO A  1 135 ? 121.129 123.869 125.948 1.00 54.14  ? 135 PRO A CB   1 
ATOM   2204  C  CG   . PRO A  1 135 ? 120.820 123.566 127.353 1.00 54.14  ? 135 PRO A CG   1 
ATOM   2205  C  CD   . PRO A  1 135 ? 119.689 124.465 127.772 1.00 54.14  ? 135 PRO A CD   1 
ATOM   2206  H  HA   . PRO A  1 135 ? 119.972 124.970 124.660 1.00 54.14  ? 135 PRO A HA   1 
ATOM   2207  H  HB2  . PRO A  1 135 ? 121.438 123.077 125.485 1.00 54.14  ? 135 PRO A HB2  1 
ATOM   2208  H  HB3  . PRO A  1 135 ? 121.775 124.587 125.884 1.00 54.14  ? 135 PRO A HB3  1 
ATOM   2209  H  HG2  . PRO A  1 135 ? 120.561 122.637 127.428 1.00 54.14  ? 135 PRO A HG2  1 
ATOM   2210  H  HG3  . PRO A  1 135 ? 121.603 123.738 127.895 1.00 54.14  ? 135 PRO A HG3  1 
ATOM   2211  H  HD2  . PRO A  1 135 ? 119.021 123.964 128.264 1.00 54.14  ? 135 PRO A HD2  1 
ATOM   2212  H  HD3  . PRO A  1 135 ? 120.028 125.212 128.287 1.00 54.14  ? 135 PRO A HD3  1 
ATOM   2213  N  N    . PHE A  1 136 ? 117.811 122.894 125.208 1.00 59.30  ? 136 PHE A N    1 
ATOM   2214  C  CA   . PHE A  1 136 ? 116.982 121.752 124.756 1.00 59.30  ? 136 PHE A CA   1 
ATOM   2215  C  C    . PHE A  1 136 ? 116.160 122.237 123.562 1.00 59.30  ? 136 PHE A C    1 
ATOM   2216  O  O    . PHE A  1 136 ? 114.924 122.176 123.684 1.00 59.30  ? 136 PHE A O    1 
ATOM   2217  C  CB   . PHE A  1 136 ? 116.166 121.233 125.944 1.00 59.30  ? 136 PHE A CB   1 
ATOM   2218  C  CG   . PHE A  1 136 ? 116.972 121.036 127.204 1.00 59.30  ? 136 PHE A CG   1 
ATOM   2219  C  CD1  . PHE A  1 136 ? 117.805 119.941 127.343 1.00 59.30  ? 136 PHE A CD1  1 
ATOM   2220  C  CD2  . PHE A  1 136 ? 116.917 121.957 128.238 1.00 59.30  ? 136 PHE A CD2  1 
ATOM   2221  C  CE1  . PHE A  1 136 ? 118.564 119.767 128.488 1.00 59.30  ? 136 PHE A CE1  1 
ATOM   2222  C  CE2  . PHE A  1 136 ? 117.670 121.777 129.387 1.00 59.30  ? 136 PHE A CE2  1 
ATOM   2223  C  CZ   . PHE A  1 136 ? 118.495 120.685 129.508 1.00 59.30  ? 136 PHE A CZ   1 
ATOM   2224  H  H    . PHE A  1 136 ? 117.361 123.439 125.781 1.00 59.30  ? 136 PHE A H    1 
ATOM   2225  H  HA   . PHE A  1 136 ? 117.577 121.024 124.448 1.00 59.30  ? 136 PHE A HA   1 
ATOM   2226  H  HB2  . PHE A  1 136 ? 115.449 121.871 126.129 1.00 59.30  ? 136 PHE A HB2  1 
ATOM   2227  H  HB3  . PHE A  1 136 ? 115.754 120.380 125.694 1.00 59.30  ? 136 PHE A HB3  1 
ATOM   2228  H  HD1  . PHE A  1 136 ? 117.859 119.308 126.646 1.00 59.30  ? 136 PHE A HD1  1 
ATOM   2229  H  HD2  . PHE A  1 136 ? 116.359 122.714 128.160 1.00 59.30  ? 136 PHE A HD2  1 
ATOM   2230  H  HE1  . PHE A  1 136 ? 119.122 119.010 128.572 1.00 59.30  ? 136 PHE A HE1  1 
ATOM   2231  H  HE2  . PHE A  1 136 ? 117.622 122.412 130.085 1.00 59.30  ? 136 PHE A HE2  1 
ATOM   2232  H  HZ   . PHE A  1 136 ? 119.004 120.561 130.293 1.00 59.30  ? 136 PHE A HZ   1 
ATOM   2233  N  N    . ASP A  1 137 ? 116.780 122.750 122.492 1.00 46.38  ? 137 ASP A N    1 
ATOM   2234  C  CA   . ASP A  1 137 ? 116.040 123.382 121.362 1.00 46.38  ? 137 ASP A CA   1 
ATOM   2235  C  C    . ASP A  1 137 ? 116.239 122.636 120.038 1.00 46.38  ? 137 ASP A C    1 
ATOM   2236  O  O    . ASP A  1 137 ? 117.369 122.189 119.797 1.00 46.38  ? 137 ASP A O    1 
ATOM   2237  C  CB   . ASP A  1 137 ? 116.411 124.860 121.236 1.00 46.38  ? 137 ASP A CB   1 
ATOM   2238  C  CG   . ASP A  1 137 ? 117.881 125.122 120.993 1.00 46.38  ? 137 ASP A CG   1 
ATOM   2239  O  OD1  . ASP A  1 137 ? 118.369 124.727 119.924 1.00 46.38  ? 137 ASP A OD1  1 
ATOM   2240  O  OD2  . ASP A  1 137 ? 118.519 125.720 121.876 1.00 46.38  ? 137 ASP A OD2  1 
ATOM   2241  H  H    . ASP A  1 137 ? 117.682 122.720 122.379 1.00 46.38  ? 137 ASP A H    1 
ATOM   2242  H  HA   . ASP A  1 137 ? 115.081 123.351 121.577 1.00 46.38  ? 137 ASP A HA   1 
ATOM   2243  H  HB2  . ASP A  1 137 ? 115.905 125.253 120.496 1.00 46.38  ? 137 ASP A HB2  1 
ATOM   2244  H  HB3  . ASP A  1 137 ? 116.152 125.321 122.061 1.00 46.38  ? 137 ASP A HB3  1 
ATOM   2245  N  N    . VAL A  1 138 ? 115.168 122.442 119.253 1.00 40.78  ? 138 VAL A N    1 
ATOM   2246  C  CA   . VAL A  1 138 ? 115.233 121.819 117.897 1.00 40.78  ? 138 VAL A CA   1 
ATOM   2247  C  C    . VAL A  1 138 ? 114.960 122.925 116.873 1.00 40.78  ? 138 VAL A C    1 
ATOM   2248  O  O    . VAL A  1 138 ? 113.971 123.648 117.074 1.00 40.78  ? 138 VAL A O    1 
ATOM   2249  C  CB   . VAL A  1 138 ? 114.267 120.627 117.747 1.00 40.78  ? 138 VAL A CB   1 
ATOM   2250  C  CG1  . VAL A  1 138 ? 114.460 119.889 116.430 1.00 40.78  ? 138 VAL A CG1  1 
ATOM   2251  C  CG2  . VAL A  1 138 ? 114.391 119.661 118.914 1.00 40.78  ? 138 VAL A CG2  1 
ATOM   2252  H  H    . VAL A  1 138 ? 114.326 122.690 119.495 1.00 40.78  ? 138 VAL A H    1 
ATOM   2253  H  HA   . VAL A  1 138 ? 116.134 121.492 117.758 1.00 40.78  ? 138 VAL A HA   1 
ATOM   2254  H  HB   . VAL A  1 138 ? 113.347 120.990 117.755 1.00 40.78  ? 138 VAL A HB   1 
ATOM   2255  H  HG11 . VAL A  1 138 ? 113.711 119.285 116.283 1.00 40.78  ? 138 VAL A HG11 1 
ATOM   2256  H  HG12 . VAL A  1 138 ? 114.507 120.526 115.697 1.00 40.78  ? 138 VAL A HG12 1 
ATOM   2257  H  HG13 . VAL A  1 138 ? 115.286 119.375 116.464 1.00 40.78  ? 138 VAL A HG13 1 
ATOM   2258  H  HG21 . VAL A  1 138 ? 113.998 118.804 118.671 1.00 40.78  ? 138 VAL A HG21 1 
ATOM   2259  H  HG22 . VAL A  1 138 ? 115.330 119.535 119.134 1.00 40.78  ? 138 VAL A HG22 1 
ATOM   2260  H  HG23 . VAL A  1 138 ? 113.924 120.022 119.686 1.00 40.78  ? 138 VAL A HG23 1 
ATOM   2261  N  N    . GLN A  1 139 ? 115.781 123.056 115.828 1.00 34.94  ? 139 GLN A N    1 
ATOM   2262  C  CA   . GLN A  1 139 ? 115.682 124.059 114.783 1.00 34.94  ? 139 GLN A CA   1 
ATOM   2263  C  C    . GLN A  1 139 ? 115.315 123.413 113.456 1.00 34.94  ? 139 GLN A C    1 
ATOM   2264  O  O    . GLN A  1 139 ? 115.766 122.302 113.140 1.00 34.94  ? 139 GLN A O    1 
ATOM   2265  C  CB   . GLN A  1 139 ? 116.988 124.835 114.641 1.00 34.94  ? 139 GLN A CB   1 
ATOM   2266  C  CG   . GLN A  1 139 ? 117.545 125.345 115.948 1.00 34.94  ? 139 GLN A CG   1 
ATOM   2267  C  CD   . GLN A  1 139 ? 116.619 126.315 116.650 1.00 34.94  ? 139 GLN A CD   1 
ATOM   2268  O  OE1  . GLN A  1 139 ? 115.527 126.612 116.172 1.00 34.94  ? 139 GLN A OE1  1 
ATOM   2269  N  NE2  . GLN A  1 139 ? 117.049 126.807 117.802 1.00 34.94  ? 139 GLN A NE2  1 
ATOM   2270  H  H    . GLN A  1 139 ? 116.436 122.515 115.716 1.00 34.94  ? 139 GLN A H    1 
ATOM   2271  H  HA   . GLN A  1 139 ? 114.985 124.688 115.006 1.00 34.94  ? 139 GLN A HA   1 
ATOM   2272  H  HB2  . GLN A  1 139 ? 117.650 124.255 114.245 1.00 34.94  ? 139 GLN A HB2  1 
ATOM   2273  H  HB3  . GLN A  1 139 ? 116.832 125.601 114.069 1.00 34.94  ? 139 GLN A HB3  1 
ATOM   2274  H  HG2  . GLN A  1 139 ? 117.699 124.596 116.540 1.00 34.94  ? 139 GLN A HG2  1 
ATOM   2275  H  HG3  . GLN A  1 139 ? 118.378 125.808 115.774 1.00 34.94  ? 139 GLN A HG3  1 
ATOM   2276  H  HE21 . GLN A  1 139 ? 117.819 126.579 118.105 1.00 34.94  ? 139 GLN A HE21 1 
ATOM   2277  H  HE22 . GLN A  1 139 ? 116.561 127.364 118.238 1.00 34.94  ? 139 GLN A HE22 1 
ATOM   2278  N  N    . HIS A  1 140 ? 114.486 124.124 112.695 1.00 25.42  ? 140 HIS A N    1 
ATOM   2279  C  CA   . HIS A  1 140 ? 113.999 123.715 111.384 1.00 25.42  ? 140 HIS A CA   1 
ATOM   2280  C  C    . HIS A  1 140 ? 114.419 124.810 110.413 1.00 25.42  ? 140 HIS A C    1 
ATOM   2281  O  O    . HIS A  1 140 ? 113.647 125.731 110.133 1.00 25.42  ? 140 HIS A O    1 
ATOM   2282  C  CB   . HIS A  1 140 ? 112.487 123.539 111.378 1.00 25.42  ? 140 HIS A CB   1 
ATOM   2283  C  CG   . HIS A  1 140 ? 111.983 122.538 112.371 1.00 25.42  ? 140 HIS A CG   1 
ATOM   2284  N  ND1  . HIS A  1 140 ? 111.763 121.217 112.051 1.00 25.42  ? 140 HIS A ND1  1 
ATOM   2285  C  CD2  . HIS A  1 140 ? 111.629 122.675 113.670 1.00 25.42  ? 140 HIS A CD2  1 
ATOM   2286  C  CE1  . HIS A  1 140 ? 111.306 120.580 113.114 1.00 25.42  ? 140 HIS A CE1  1 
ATOM   2287  N  NE2  . HIS A  1 140 ? 111.219 121.442 114.110 1.00 25.42  ? 140 HIS A NE2  1 
ATOM   2288  H  H    . HIS A  1 140 ? 114.186 124.893 112.926 1.00 25.42  ? 140 HIS A H    1 
ATOM   2289  H  HA   . HIS A  1 140 ? 114.415 122.884 111.121 1.00 25.42  ? 140 HIS A HA   1 
ATOM   2290  H  HB2  . HIS A  1 140 ? 112.081 124.390 111.590 1.00 25.42  ? 140 HIS A HB2  1 
ATOM   2291  H  HB3  . HIS A  1 140 ? 112.212 123.249 110.498 1.00 25.42  ? 140 HIS A HB3  1 
ATOM   2292  H  HD2  . HIS A  1 140 ? 111.664 123.456 114.172 1.00 25.42  ? 140 HIS A HD2  1 
ATOM   2293  H  HE1  . HIS A  1 140 ? 111.087 119.678 113.154 1.00 25.42  ? 140 HIS A HE1  1 
ATOM   2294  N  N    . CYS A  1 141 ? 115.635 124.710 109.889 1.00 20.91  ? 141 CYS A N    1 
ATOM   2295  C  CA   . CYS A  1 141 ? 116.190 125.736 109.020 1.00 20.91  ? 141 CYS A CA   1 
ATOM   2296  C  C    . CYS A  1 141 ? 116.088 125.254 107.581 1.00 20.91  ? 141 CYS A C    1 
ATOM   2297  O  O    . CYS A  1 141 ? 116.545 124.156 107.260 1.00 20.91  ? 141 CYS A O    1 
ATOM   2298  C  CB   . CYS A  1 141 ? 117.644 126.035 109.396 1.00 20.91  ? 141 CYS A CB   1 
ATOM   2299  S  SG   . CYS A  1 141 ? 117.856 126.936 110.957 1.00 20.91  ? 141 CYS A SG   1 
ATOM   2300  H  H    . CYS A  1 141 ? 116.163 124.048 110.022 1.00 20.91  ? 141 CYS A H    1 
ATOM   2301  H  HA   . CYS A  1 141 ? 115.676 126.548 109.109 1.00 20.91  ? 141 CYS A HA   1 
ATOM   2302  H  HB2  . CYS A  1 141 ? 118.109 125.190 109.481 1.00 20.91  ? 141 CYS A HB2  1 
ATOM   2303  H  HB3  . CYS A  1 141 ? 118.043 126.559 108.690 1.00 20.91  ? 141 CYS A HB3  1 
ATOM   2304  N  N    . LYS A  1 142 ? 115.475 126.058 106.724 1.00 15.78  ? 142 LYS A N    1 
ATOM   2305  C  CA   . LYS A  1 142 ? 115.177 125.627 105.370 1.00 15.78  ? 142 LYS A CA   1 
ATOM   2306  C  C    . LYS A  1 142 ? 116.039 126.310 104.325 1.00 15.78  ? 142 LYS A C    1 
ATOM   2307  O  O    . LYS A  1 142 ? 116.607 127.382 104.546 1.00 15.78  ? 142 LYS A O    1 
ATOM   2308  C  CB   . LYS A  1 142 ? 113.718 125.857 105.009 1.00 15.78  ? 142 LYS A CB   1 
ATOM   2309  C  CG   . LYS A  1 142 ? 113.303 127.308 104.995 1.00 15.78  ? 142 LYS A CG   1 
ATOM   2310  C  CD   . LYS A  1 142 ? 111.879 127.435 104.488 1.00 15.78  ? 142 LYS A CD   1 
ATOM   2311  C  CE   . LYS A  1 142 ? 110.950 126.780 105.494 1.00 15.78  ? 142 LYS A CE   1 
ATOM   2312  N  NZ   . LYS A  1 142 ? 110.009 127.414 106.456 1.00 15.78  ? 142 LYS A NZ   1 
ATOM   2313  H  H    . LYS A  1 142 ? 115.208 126.852 106.903 1.00 15.78  ? 142 LYS A H    1 
ATOM   2314  H  HA   . LYS A  1 142 ? 115.329 124.679 105.305 1.00 15.78  ? 142 LYS A HA   1 
ATOM   2315  H  HB2  . LYS A  1 142 ? 113.535 125.492 104.137 1.00 15.78  ? 142 LYS A HB2  1 
ATOM   2316  H  HB3  . LYS A  1 142 ? 113.211 125.416 105.686 1.00 15.78  ? 142 LYS A HB3  1 
ATOM   2317  H  HG2  . LYS A  1 142 ? 113.332 127.661 105.894 1.00 15.78  ? 142 LYS A HG2  1 
ATOM   2318  H  HG3  . LYS A  1 142 ? 113.883 127.816 104.401 1.00 15.78  ? 142 LYS A HG3  1 
ATOM   2319  H  HD2  . LYS A  1 142 ? 111.641 128.358 104.398 1.00 15.78  ? 142 LYS A HD2  1 
ATOM   2320  H  HD3  . LYS A  1 142 ? 111.814 126.972 103.641 1.00 15.78  ? 142 LYS A HD3  1 
ATOM   2321  H  HE2  . LYS A  1 142 ? 110.323 126.405 104.851 1.00 15.78  ? 142 LYS A HE2  1 
ATOM   2322  H  HE3  . LYS A  1 142 ? 111.356 126.001 105.903 1.00 15.78  ? 142 LYS A HE3  1 
ATOM   2323  H  HZ1  . LYS A  1 142 ? 109.404 126.769 106.732 1.00 15.78  ? 142 LYS A HZ1  1 
ATOM   2324  H  HZ2  . LYS A  1 142 ? 110.464 127.714 107.170 1.00 15.78  ? 142 LYS A HZ2  1 
ATOM   2325  H  HZ3  . LYS A  1 142 ? 109.526 128.099 106.078 1.00 15.78  ? 142 LYS A HZ3  1 
ATOM   2326  N  N    . LEU A  1 143 ? 116.116 125.641 103.183 1.00 10.94  ? 143 LEU A N    1 
ATOM   2327  C  CA   . LEU A  1 143 ? 116.896 126.061 102.040 1.00 10.94  ? 143 LEU A CA   1 
ATOM   2328  C  C    . LEU A  1 143 ? 115.976 126.019 100.836 1.00 10.94  ? 143 LEU A C    1 
ATOM   2329  O  O    . LEU A  1 143 ? 115.496 124.943 100.462 1.00 10.94  ? 143 LEU A O    1 
ATOM   2330  C  CB   . LEU A  1 143 ? 118.089 125.132 101.835 1.00 10.94  ? 143 LEU A CB   1 
ATOM   2331  C  CG   . LEU A  1 143 ? 119.297 125.327 102.740 1.00 10.94  ? 143 LEU A CG   1 
ATOM   2332  C  CD1  . LEU A  1 143 ? 119.042 124.724 104.080 1.00 10.94  ? 143 LEU A CD1  1 
ATOM   2333  C  CD2  . LEU A  1 143 ? 120.474 124.656 102.126 1.00 10.94  ? 143 LEU A CD2  1 
ATOM   2334  H  H    . LEU A  1 143 ? 115.698 124.906 103.046 1.00 10.94  ? 143 LEU A H    1 
ATOM   2335  H  HA   . LEU A  1 143 ? 117.204 126.967 102.167 1.00 10.94  ? 143 LEU A HA   1 
ATOM   2336  H  HB2  . LEU A  1 143 ? 117.779 124.230 101.981 1.00 10.94  ? 143 LEU A HB2  1 
ATOM   2337  H  HB3  . LEU A  1 143 ? 118.386 125.228 100.923 1.00 10.94  ? 143 LEU A HB3  1 
ATOM   2338  H  HG   . LEU A  1 143 ? 119.487 126.266 102.851 1.00 10.94  ? 143 LEU A HG   1 
ATOM   2339  H  HD11 . LEU A  1 143 ? 119.821 124.859 104.635 1.00 10.94  ? 143 LEU A HD11 1 
ATOM   2340  H  HD12 . LEU A  1 143 ? 118.275 125.150 104.475 1.00 10.94  ? 143 LEU A HD12 1 
ATOM   2341  H  HD13 . LEU A  1 143 ? 118.876 123.778 103.959 1.00 10.94  ? 143 LEU A HD13 1 
ATOM   2342  H  HD21 . LEU A  1 143 ? 121.238 124.798 102.699 1.00 10.94  ? 143 LEU A HD21 1 
ATOM   2343  H  HD22 . LEU A  1 143 ? 120.275 123.709 102.062 1.00 10.94  ? 143 LEU A HD22 1 
ATOM   2344  H  HD23 . LEU A  1 143 ? 120.633 125.030 101.248 1.00 10.94  ? 143 LEU A HD23 1 
ATOM   2345  N  N    . LYS A  1 144 ? 115.725 127.176 100.237 1.00 9.20   ? 144 LYS A N    1 
ATOM   2346  C  CA   . LYS A  1 144 ? 114.777 127.311 99.146  1.00 9.20   ? 144 LYS A CA   1 
ATOM   2347  C  C    . LYS A  1 144 ? 115.535 127.558 97.854  1.00 9.20   ? 144 LYS A C    1 
ATOM   2348  O  O    . LYS A  1 144 ? 116.233 128.568 97.722  1.00 9.20   ? 144 LYS A O    1 
ATOM   2349  C  CB   . LYS A  1 144 ? 113.798 128.446 99.416  1.00 9.20   ? 144 LYS A CB   1 
ATOM   2350  C  CG   . LYS A  1 144 ? 112.636 128.472 98.472  1.00 9.20   ? 144 LYS A CG   1 
ATOM   2351  C  CD   . LYS A  1 144 ? 111.950 129.798 98.487  1.00 9.20   ? 144 LYS A CD   1 
ATOM   2352  C  CE   . LYS A  1 144 ? 111.021 129.918 97.315  1.00 9.20   ? 144 LYS A CE   1 
ATOM   2353  N  NZ   . LYS A  1 144 ? 110.005 130.974 97.515  1.00 9.20   ? 144 LYS A NZ   1 
ATOM   2354  H  H    . LYS A  1 144 ? 116.100 127.914 100.455 1.00 9.20   ? 144 LYS A H    1 
ATOM   2355  H  HA   . LYS A  1 144 ? 114.278 126.494 99.049  1.00 9.20   ? 144 LYS A HA   1 
ATOM   2356  H  HB2  . LYS A  1 144 ? 113.446 128.353 100.313 1.00 9.20   ? 144 LYS A HB2  1 
ATOM   2357  H  HB3  . LYS A  1 144 ? 114.262 129.286 99.330  1.00 9.20   ? 144 LYS A HB3  1 
ATOM   2358  H  HG2  . LYS A  1 144 ? 112.952 128.307 97.574  1.00 9.20   ? 144 LYS A HG2  1 
ATOM   2359  H  HG3  . LYS A  1 144 ? 111.994 127.799 98.735  1.00 9.20   ? 144 LYS A HG3  1 
ATOM   2360  H  HD2  . LYS A  1 144 ? 111.431 129.879 99.299  1.00 9.20   ? 144 LYS A HD2  1 
ATOM   2361  H  HD3  . LYS A  1 144 ? 112.610 130.502 98.432  1.00 9.20   ? 144 LYS A HD3  1 
ATOM   2362  H  HE2  . LYS A  1 144 ? 111.534 130.127 96.522  1.00 9.20   ? 144 LYS A HE2  1 
ATOM   2363  H  HE3  . LYS A  1 144 ? 110.565 129.074 97.203  1.00 9.20   ? 144 LYS A HE3  1 
ATOM   2364  H  HZ1  . LYS A  1 144 ? 109.460 131.005 96.813  1.00 9.20   ? 144 LYS A HZ1  1 
ATOM   2365  H  HZ2  . LYS A  1 144 ? 109.530 130.798 98.245  1.00 9.20   ? 144 LYS A HZ2  1 
ATOM   2366  H  HZ3  . LYS A  1 144 ? 110.401 131.763 97.611  1.00 9.20   ? 144 LYS A HZ3  1 
ATOM   2367  N  N    . PHE A  1 145 ? 115.385 126.646 96.903  1.00 8.05   ? 145 PHE A N    1 
ATOM   2368  C  CA   . PHE A  1 145 ? 116.030 126.730 95.608  1.00 8.05   ? 145 PHE A CA   1 
ATOM   2369  C  C    . PHE A  1 145 ? 114.972 126.914 94.537  1.00 8.05   ? 145 PHE A C    1 
ATOM   2370  O  O    . PHE A  1 145 ? 113.875 126.357 94.626  1.00 8.05   ? 145 PHE A O    1 
ATOM   2371  C  CB   . PHE A  1 145 ? 116.836 125.472 95.308  1.00 8.05   ? 145 PHE A CB   1 
ATOM   2372  C  CG   . PHE A  1 145 ? 118.030 125.290 96.186  1.00 8.05   ? 145 PHE A CG   1 
ATOM   2373  C  CD1  . PHE A  1 145 ? 119.251 125.818 95.836  1.00 8.05   ? 145 PHE A CD1  1 
ATOM   2374  C  CD2  . PHE A  1 145 ? 117.934 124.572 97.355  1.00 8.05   ? 145 PHE A CD2  1 
ATOM   2375  C  CE1  . PHE A  1 145 ? 120.341 125.645 96.642  1.00 8.05   ? 145 PHE A CE1  1 
ATOM   2376  C  CE2  . PHE A  1 145 ? 119.023 124.399 98.159  1.00 8.05   ? 145 PHE A CE2  1 
ATOM   2377  C  CZ   . PHE A  1 145 ? 120.225 124.933 97.805  1.00 8.05   ? 145 PHE A CZ   1 
ATOM   2378  H  H    . PHE A  1 145 ? 114.895 125.949 96.988  1.00 8.05   ? 145 PHE A H    1 
ATOM   2379  H  HA   . PHE A  1 145 ? 116.619 127.492 95.589  1.00 8.05   ? 145 PHE A HA   1 
ATOM   2380  H  HB2  . PHE A  1 145 ? 116.260 124.707 95.430  1.00 8.05   ? 145 PHE A HB2  1 
ATOM   2381  H  HB3  . PHE A  1 145 ? 117.140 125.516 94.392  1.00 8.05   ? 145 PHE A HB3  1 
ATOM   2382  H  HD1  . PHE A  1 145 ? 119.334 126.302 95.051  1.00 8.05   ? 145 PHE A HD1  1 
ATOM   2383  H  HD2  . PHE A  1 145 ? 117.119 124.207 97.602  1.00 8.05   ? 145 PHE A HD2  1 
ATOM   2384  H  HE1  . PHE A  1 145 ? 121.157 126.009 96.399  1.00 8.05   ? 145 PHE A HE1  1 
ATOM   2385  H  HE2  . PHE A  1 145 ? 118.945 123.916 98.945  1.00 8.05   ? 145 PHE A HE2  1 
ATOM   2386  H  HZ   . PHE A  1 145 ? 120.961 124.812 98.354  1.00 8.05   ? 145 PHE A HZ   1 
ATOM   2387  N  N    . GLY A  1 146 ? 115.302 127.704 93.534  1.00 11.78  ? 146 GLY A N    1 
ATOM   2388  C  CA   . GLY A  1 146 ? 114.424 127.861 92.402  1.00 11.78  ? 146 GLY A CA   1 
ATOM   2389  C  C    . GLY A  1 146 ? 115.099 128.669 91.325  1.00 11.78  ? 146 GLY A C    1 
ATOM   2390  O  O    . GLY A  1 146 ? 116.118 129.326 91.557  1.00 11.78  ? 146 GLY A O    1 
ATOM   2391  H  H    . GLY A  1 146 ? 116.023 128.164 93.489  1.00 11.78  ? 146 GLY A H    1 
ATOM   2392  H  HA2  . GLY A  1 146 ? 114.192 126.994 92.044  1.00 11.78  ? 146 GLY A HA2  1 
ATOM   2393  H  HA3  . GLY A  1 146 ? 113.618 128.315 92.674  1.00 11.78  ? 146 GLY A HA3  1 
ATOM   2394  N  N    . SER A  1 147 ? 114.518 128.605 90.139  1.00 12.16  ? 147 SER A N    1 
ATOM   2395  C  CA   . SER A  1 147 ? 115.008 129.418 89.049  1.00 12.16  ? 147 SER A CA   1 
ATOM   2396  C  C    . SER A  1 147 ? 114.734 130.889 89.321  1.00 12.16  ? 147 SER A C    1 
ATOM   2397  O  O    . SER A  1 147 ? 113.859 131.260 90.108  1.00 12.16  ? 147 SER A O    1 
ATOM   2398  C  CB   . SER A  1 147 ? 114.367 128.996 87.737  1.00 12.16  ? 147 SER A CB   1 
ATOM   2399  O  OG   . SER A  1 147 ? 114.966 129.655 86.644  1.00 12.16  ? 147 SER A OG   1 
ATOM   2400  H  H    . SER A  1 147 ? 113.857 128.097 89.942  1.00 12.16  ? 147 SER A H    1 
ATOM   2401  H  HA   . SER A  1 147 ? 115.963 129.304 88.975  1.00 12.16  ? 147 SER A HA   1 
ATOM   2402  H  HB2  . SER A  1 147 ? 114.495 128.046 87.642  1.00 12.16  ? 147 SER A HB2  1 
ATOM   2403  H  HB3  . SER A  1 147 ? 113.425 129.208 87.757  1.00 12.16  ? 147 SER A HB3  1 
ATOM   2404  H  HG   . SER A  1 147 ? 115.726 129.332 86.513  1.00 12.16  ? 147 SER A HG   1 
ATOM   2405  N  N    . TRP A  1 148 ? 115.508 131.731 88.651  1.00 10.25  ? 148 TRP A N    1 
ATOM   2406  C  CA   . TRP A  1 148 ? 115.465 133.167 88.849  1.00 10.25  ? 148 TRP A CA   1 
ATOM   2407  C  C    . TRP A  1 148 ? 114.672 133.896 87.778  1.00 10.25  ? 148 TRP A C    1 
ATOM   2408  O  O    . TRP A  1 148 ? 114.170 134.993 88.040  1.00 10.25  ? 148 TRP A O    1 
ATOM   2409  C  CB   . TRP A  1 148 ? 116.895 133.707 88.882  1.00 10.25  ? 148 TRP A CB   1 
ATOM   2410  C  CG   . TRP A  1 148 ? 117.046 135.033 89.508  1.00 10.25  ? 148 TRP A CG   1 
ATOM   2411  C  CD1  . TRP A  1 148 ? 117.138 136.225 88.870  1.00 10.25  ? 148 TRP A CD1  1 
ATOM   2412  C  CD2  . TRP A  1 148 ? 117.135 135.316 90.905  1.00 10.25  ? 148 TRP A CD2  1 
ATOM   2413  N  NE1  . TRP A  1 148 ? 117.278 137.238 89.778  1.00 10.25  ? 148 TRP A NE1  1 
ATOM   2414  C  CE2  . TRP A  1 148 ? 117.278 136.704 91.038  1.00 10.25  ? 148 TRP A CE2  1 
ATOM   2415  C  CE3  . TRP A  1 148 ? 117.106 134.529 92.058  1.00 10.25  ? 148 TRP A CE3  1 
ATOM   2416  C  CZ2  . TRP A  1 148 ? 117.391 137.322 92.268  1.00 10.25  ? 148 TRP A CZ2  1 
ATOM   2417  C  CZ3  . TRP A  1 148 ? 117.218 135.147 93.276  1.00 10.25  ? 148 TRP A CZ3  1 
ATOM   2418  C  CH2  . TRP A  1 148 ? 117.359 136.528 93.374  1.00 10.25  ? 148 TRP A CH2  1 
ATOM   2419  H  H    . TRP A  1 148 ? 116.079 131.485 88.064  1.00 10.25  ? 148 TRP A H    1 
ATOM   2420  H  HA   . TRP A  1 148 ? 115.056 133.352 89.703  1.00 10.25  ? 148 TRP A HA   1 
ATOM   2421  H  HB2  . TRP A  1 148 ? 117.435 133.082 89.381  1.00 10.25  ? 148 TRP A HB2  1 
ATOM   2422  H  HB3  . TRP A  1 148 ? 117.222 133.771 87.975  1.00 10.25  ? 148 TRP A HB3  1 
ATOM   2423  H  HD1  . TRP A  1 148 ? 117.113 136.335 87.949  1.00 10.25  ? 148 TRP A HD1  1 
ATOM   2424  H  HE1  . TRP A  1 148 ? 117.352 138.070 89.589  1.00 10.25  ? 148 TRP A HE1  1 
ATOM   2425  H  HE3  . TRP A  1 148 ? 117.012 133.607 92.003  1.00 10.25  ? 148 TRP A HE3  1 
ATOM   2426  H  HZ2  . TRP A  1 148 ? 117.484 138.240 92.337  1.00 10.25  ? 148 TRP A HZ2  1 
ATOM   2427  H  HZ3  . TRP A  1 148 ? 117.200 134.636 94.049  1.00 10.25  ? 148 TRP A HZ3  1 
ATOM   2428  H  HH2  . TRP A  1 148 ? 117.431 136.916 94.210  1.00 10.25  ? 148 TRP A HH2  1 
ATOM   2429  N  N    . SER A  1 149 ? 114.540 133.312 86.590  1.00 14.89  ? 149 SER A N    1 
ATOM   2430  C  CA   . SER A  1 149 ? 113.896 133.991 85.478  1.00 14.89  ? 149 SER A CA   1 
ATOM   2431  C  C    . SER A  1 149 ? 113.015 133.074 84.643  1.00 14.89  ? 149 SER A C    1 
ATOM   2432  O  O    . SER A  1 149 ? 112.489 133.521 83.618  1.00 14.89  ? 149 SER A O    1 
ATOM   2433  C  CB   . SER A  1 149 ? 114.952 134.631 84.578  1.00 14.89  ? 149 SER A CB   1 
ATOM   2434  O  OG   . SER A  1 149 ? 115.890 133.669 84.134  1.00 14.89  ? 149 SER A OG   1 
ATOM   2435  H  H    . SER A  1 149 ? 114.808 132.521 86.407  1.00 14.89  ? 149 SER A H    1 
ATOM   2436  H  HA   . SER A  1 149 ? 113.336 134.696 85.828  1.00 14.89  ? 149 SER A HA   1 
ATOM   2437  H  HB2  . SER A  1 149 ? 114.509 135.013 83.809  1.00 14.89  ? 149 SER A HB2  1 
ATOM   2438  H  HB3  . SER A  1 149 ? 115.417 135.322 85.071  1.00 14.89  ? 149 SER A HB3  1 
ATOM   2439  H  HG   . SER A  1 149 ? 116.311 133.353 84.788  1.00 14.89  ? 149 SER A HG   1 
ATOM   2440  N  N    . TYR A  1 150 ? 112.831 131.820 85.041  1.00 14.71  ? 150 TYR A N    1 
ATOM   2441  C  CA   . TYR A  1 150 ? 112.118 130.835 84.247  1.00 14.71  ? 150 TYR A CA   1 
ATOM   2442  C  C    . TYR A  1 150 ? 110.888 130.353 85.000  1.00 14.71  ? 150 TYR A C    1 
ATOM   2443  O  O    . TYR A  1 150 ? 110.897 130.235 86.228  1.00 14.71  ? 150 TYR A O    1 
ATOM   2444  C  CB   . TYR A  1 150 ? 113.002 129.635 83.922  1.00 14.71  ? 150 TYR A CB   1 
ATOM   2445  C  CG   . TYR A  1 150 ? 113.994 129.845 82.804  1.00 14.71  ? 150 TYR A CG   1 
ATOM   2446  C  CD1  . TYR A  1 150 ? 113.583 129.898 81.487  1.00 14.71  ? 150 TYR A CD1  1 
ATOM   2447  C  CD2  . TYR A  1 150 ? 115.348 129.958 83.068  1.00 14.71  ? 150 TYR A CD2  1 
ATOM   2448  C  CE1  . TYR A  1 150 ? 114.490 130.079 80.467  1.00 14.71  ? 150 TYR A CE1  1 
ATOM   2449  C  CE2  . TYR A  1 150 ? 116.256 130.137 82.058  1.00 14.71  ? 150 TYR A CE2  1 
ATOM   2450  C  CZ   . TYR A  1 150 ? 115.826 130.197 80.760  1.00 14.71  ? 150 TYR A CZ   1 
ATOM   2451  O  OH   . TYR A  1 150 ? 116.743 130.378 79.754  1.00 14.71  ? 150 TYR A OH   1 
ATOM   2452  H  H    . TYR A  1 150 ? 113.111 131.512 85.791  1.00 14.71  ? 150 TYR A H    1 
ATOM   2453  H  HA   . TYR A  1 150 ? 111.826 131.232 83.417  1.00 14.71  ? 150 TYR A HA   1 
ATOM   2454  H  HB2  . TYR A  1 150 ? 113.496 129.395 84.717  1.00 14.71  ? 150 TYR A HB2  1 
ATOM   2455  H  HB3  . TYR A  1 150 ? 112.428 128.905 83.659  1.00 14.71  ? 150 TYR A HB3  1 
ATOM   2456  H  HD1  . TYR A  1 150 ? 112.681 129.820 81.290  1.00 14.71  ? 150 TYR A HD1  1 
ATOM   2457  H  HD2  . TYR A  1 150 ? 115.648 129.919 83.944  1.00 14.71  ? 150 TYR A HD2  1 
ATOM   2458  H  HE1  . TYR A  1 150 ? 114.202 130.120 79.587  1.00 14.71  ? 150 TYR A HE1  1 
ATOM   2459  H  HE2  . TYR A  1 150 ? 117.159 130.216 82.251  1.00 14.71  ? 150 TYR A HE2  1 
ATOM   2460  H  HH   . TYR A  1 150 ? 117.513 130.444 80.081  1.00 14.71  ? 150 TYR A HH   1 
ATOM   2461  N  N    . GLY A  1 151 ? 109.826 130.069 84.247  1.00 14.70  ? 151 GLY A N    1 
ATOM   2462  C  CA   . GLY A  1 151 ? 108.615 129.513 84.800  1.00 14.70  ? 151 GLY A CA   1 
ATOM   2463  C  C    . GLY A  1 151 ? 108.538 128.003 84.639  1.00 14.70  ? 151 GLY A C    1 
ATOM   2464  O  O    . GLY A  1 151 ? 109.424 127.351 84.097  1.00 14.70  ? 151 GLY A O    1 
ATOM   2465  H  H    . GLY A  1 151 ? 109.788 130.201 83.402  1.00 14.70  ? 151 GLY A H    1 
ATOM   2466  H  HA2  . GLY A  1 151 ? 108.571 129.720 85.742  1.00 14.70  ? 151 GLY A HA2  1 
ATOM   2467  H  HA3  . GLY A  1 151 ? 107.849 129.901 84.357  1.00 14.70  ? 151 GLY A HA3  1 
ATOM   2468  N  N    . GLY A  1 152 ? 107.429 127.452 85.125  1.00 10.13  ? 152 GLY A N    1 
ATOM   2469  C  CA   . GLY A  1 152 ? 107.219 126.017 85.074  1.00 10.13  ? 152 GLY A CA   1 
ATOM   2470  C  C    . GLY A  1 152 ? 106.904 125.482 83.699  1.00 10.13  ? 152 GLY A C    1 
ATOM   2471  O  O    . GLY A  1 152 ? 106.950 124.264 83.502  1.00 10.13  ? 152 GLY A O    1 
ATOM   2472  H  H    . GLY A  1 152 ? 106.787 127.890 85.483  1.00 10.13  ? 152 GLY A H    1 
ATOM   2473  H  HA2  . GLY A  1 152 ? 108.014 125.572 85.396  1.00 10.13  ? 152 GLY A HA2  1 
ATOM   2474  H  HA3  . GLY A  1 152 ? 106.485 125.781 85.656  1.00 10.13  ? 152 GLY A HA3  1 
ATOM   2475  N  N    . TRP A  1 153 ? 106.579 126.354 82.755  1.00 13.20  ? 153 TRP A N    1 
ATOM   2476  C  CA   . TRP A  1 153 ? 106.364 125.977 81.369  1.00 13.20  ? 153 TRP A CA   1 
ATOM   2477  C  C    . TRP A  1 153 ? 107.618 126.116 80.526  1.00 13.20  ? 153 TRP A C    1 
ATOM   2478  O  O    . TRP A  1 153 ? 107.565 125.886 79.315  1.00 13.20  ? 153 TRP A O    1 
ATOM   2479  C  CB   . TRP A  1 153 ? 105.249 126.828 80.772  1.00 13.20  ? 153 TRP A CB   1 
ATOM   2480  C  CG   . TRP A  1 153 ? 103.919 126.549 81.375  1.00 13.20  ? 153 TRP A CG   1 
ATOM   2481  C  CD1  . TRP A  1 153 ? 103.635 125.621 82.329  1.00 13.20  ? 153 TRP A CD1  1 
ATOM   2482  C  CD2  . TRP A  1 153 ? 102.688 127.210 81.079  1.00 13.20  ? 153 TRP A CD2  1 
ATOM   2483  N  NE1  . TRP A  1 153 ? 102.303 125.655 82.642  1.00 13.20  ? 153 TRP A NE1  1 
ATOM   2484  C  CE2  . TRP A  1 153 ? 101.698 126.625 81.888  1.00 13.20  ? 153 TRP A CE2  1 
ATOM   2485  C  CE3  . TRP A  1 153 ? 102.325 128.238 80.207  1.00 13.20  ? 153 TRP A CE3  1 
ATOM   2486  C  CZ2  . TRP A  1 153 ? 100.372 127.030 81.850  1.00 13.20  ? 153 TRP A CZ2  1 
ATOM   2487  C  CZ3  . TRP A  1 153 ? 101.010 128.640 80.171  1.00 13.20  ? 153 TRP A CZ3  1 
ATOM   2488  C  CH2  . TRP A  1 153 ? 100.048 128.037 80.986  1.00 13.20  ? 153 TRP A CH2  1 
ATOM   2489  H  H    . TRP A  1 153 ? 106.470 127.190 82.901  1.00 13.20  ? 153 TRP A H    1 
ATOM   2490  H  HA   . TRP A  1 153 ? 106.090 125.051 81.337  1.00 13.20  ? 153 TRP A HA   1 
ATOM   2491  H  HB2  . TRP A  1 153 ? 105.458 127.760 80.927  1.00 13.20  ? 153 TRP A HB2  1 
ATOM   2492  H  HB3  . TRP A  1 153 ? 105.197 126.653 79.821  1.00 13.20  ? 153 TRP A HB3  1 
ATOM   2493  H  HD1  . TRP A  1 153 ? 104.256 125.046 82.708  1.00 13.20  ? 153 TRP A HD1  1 
ATOM   2494  H  HE1  . TRP A  1 153 ? 101.914 125.152 83.217  1.00 13.20  ? 153 TRP A HE1  1 
ATOM   2495  H  HE3  . TRP A  1 153 ? 102.957 128.643 79.660  1.00 13.20  ? 153 TRP A HE3  1 
ATOM   2496  H  HZ2  . TRP A  1 153 ? 99.733  126.632 82.392  1.00 13.20  ? 153 TRP A HZ2  1 
ATOM   2497  H  HZ3  . TRP A  1 153 ? 100.759 129.322 79.594  1.00 13.20  ? 153 TRP A HZ3  1 
ATOM   2498  H  HH2  . TRP A  1 153 ? 99.168  128.329 80.941  1.00 13.20  ? 153 TRP A HH2  1 
ATOM   2499  N  N    . SER A  1 154 ? 108.736 126.491 81.138  1.00 13.23  ? 154 SER A N    1 
ATOM   2500  C  CA   . SER A  1 154 ? 110.001 126.623 80.438  1.00 13.23  ? 154 SER A CA   1 
ATOM   2501  C  C    . SER A  1 154 ? 111.076 125.843 81.173  1.00 13.23  ? 154 SER A C    1 
ATOM   2502  O  O    . SER A  1 154 ? 112.020 125.339 80.560  1.00 13.23  ? 154 SER A O    1 
ATOM   2503  C  CB   . SER A  1 154 ? 110.390 128.091 80.320  1.00 13.23  ? 154 SER A CB   1 
ATOM   2504  O  OG   . SER A  1 154 ? 109.517 128.779 79.451  1.00 13.23  ? 154 SER A OG   1 
ATOM   2505  H  H    . SER A  1 154 ? 108.790 126.670 81.974  1.00 13.23  ? 154 SER A H    1 
ATOM   2506  H  HA   . SER A  1 154 ? 109.916 126.258 79.551  1.00 13.23  ? 154 SER A HA   1 
ATOM   2507  H  HB2  . SER A  1 154 ? 110.336 128.490 81.198  1.00 13.23  ? 154 SER A HB2  1 
ATOM   2508  H  HB3  . SER A  1 154 ? 111.293 128.153 79.983  1.00 13.23  ? 154 SER A HB3  1 
ATOM   2509  H  HG   . SER A  1 154 ? 109.746 129.584 79.405  1.00 13.23  ? 154 SER A HG   1 
ATOM   2510  N  N    . LEU A  1 155 ? 110.939 125.740 82.491  1.00 13.48  ? 155 LEU A N    1 
ATOM   2511  C  CA   . LEU A  1 155 ? 111.871 124.982 83.321  1.00 13.48  ? 155 LEU A CA   1 
ATOM   2512  C  C    . LEU A  1 155 ? 111.054 124.192 84.340  1.00 13.48  ? 155 LEU A C    1 
ATOM   2513  O  O    . LEU A  1 155 ? 110.732 124.696 85.418  1.00 13.48  ? 155 LEU A O    1 
ATOM   2514  C  CB   . LEU A  1 155 ? 112.869 125.906 83.994  1.00 13.48  ? 155 LEU A CB   1 
ATOM   2515  C  CG   . LEU A  1 155 ? 113.925 125.202 84.827  1.00 13.48  ? 155 LEU A CG   1 
ATOM   2516  C  CD1  . LEU A  1 155 ? 114.713 124.363 83.944  1.00 13.48  ? 155 LEU A CD1  1 
ATOM   2517  C  CD2  . LEU A  1 155 ? 114.866 126.144 85.486  1.00 13.48  ? 155 LEU A CD2  1 
ATOM   2518  H  H    . LEU A  1 155 ? 110.316 126.117 82.937  1.00 13.48  ? 155 LEU A H    1 
ATOM   2519  H  HA   . LEU A  1 155 ? 112.344 124.359 82.759  1.00 13.48  ? 155 LEU A HA   1 
ATOM   2520  H  HB2  . LEU A  1 155 ? 113.332 126.409 83.310  1.00 13.48  ? 155 LEU A HB2  1 
ATOM   2521  H  HB3  . LEU A  1 155 ? 112.385 126.501 84.581  1.00 13.48  ? 155 LEU A HB3  1 
ATOM   2522  H  HG   . LEU A  1 155 ? 113.505 124.645 85.498  1.00 13.48  ? 155 LEU A HG   1 
ATOM   2523  H  HD11 . LEU A  1 155 ? 115.420 124.023 84.492  1.00 13.48  ? 155 LEU A HD11 1 
ATOM   2524  H  HD12 . LEU A  1 155 ? 114.168 123.646 83.589  1.00 13.48  ? 155 LEU A HD12 1 
ATOM   2525  H  HD13 . LEU A  1 155 ? 115.074 124.919 83.240  1.00 13.48  ? 155 LEU A HD13 1 
ATOM   2526  H  HD21 . LEU A  1 155 ? 115.498 125.623 86.002  1.00 13.48  ? 155 LEU A HD21 1 
ATOM   2527  H  HD22 . LEU A  1 155 ? 115.335 126.638 84.797  1.00 13.48  ? 155 LEU A HD22 1 
ATOM   2528  H  HD23 . LEU A  1 155 ? 114.370 126.735 86.060  1.00 13.48  ? 155 LEU A HD23 1 
ATOM   2529  N  N    . ASP A  1 156 ? 110.732 122.950 83.995  1.00 19.14  ? 156 ASP A N    1 
ATOM   2530  C  CA   . ASP A  1 156 ? 109.945 122.073 84.858  1.00 19.14  ? 156 ASP A CA   1 
ATOM   2531  C  C    . ASP A  1 156 ? 110.878 121.422 85.867  1.00 19.14  ? 156 ASP A C    1 
ATOM   2532  O  O    . ASP A  1 156 ? 111.454 120.363 85.624  1.00 19.14  ? 156 ASP A O    1 
ATOM   2533  C  CB   . ASP A  1 156 ? 109.205 121.029 84.031  1.00 19.14  ? 156 ASP A CB   1 
ATOM   2534  C  CG   . ASP A  1 156 ? 108.367 120.102 84.879  1.00 19.14  ? 156 ASP A CG   1 
ATOM   2535  O  OD1  . ASP A  1 156 ? 108.024 120.481 86.017  1.00 19.14  ? 156 ASP A OD1  1 
ATOM   2536  O  OD2  . ASP A  1 156 ? 108.051 118.991 84.406  1.00 19.14  ? 156 ASP A OD2  1 
ATOM   2537  H  H    . ASP A  1 156 ? 110.960 122.587 83.255  1.00 19.14  ? 156 ASP A H    1 
ATOM   2538  H  HA   . ASP A  1 156 ? 109.295 122.596 85.341  1.00 19.14  ? 156 ASP A HA   1 
ATOM   2539  H  HB2  . ASP A  1 156 ? 108.621 121.471 83.400  1.00 19.14  ? 156 ASP A HB2  1 
ATOM   2540  H  HB3  . ASP A  1 156 ? 109.850 120.486 83.561  1.00 19.14  ? 156 ASP A HB3  1 
ATOM   2541  N  N    . LEU A  1 157 ? 111.028 122.061 87.021  1.00 13.75  ? 157 LEU A N    1 
ATOM   2542  C  CA   . LEU A  1 157 ? 111.834 121.486 88.083  1.00 13.75  ? 157 LEU A CA   1 
ATOM   2543  C  C    . LEU A  1 157 ? 111.209 120.203 88.602  1.00 13.75  ? 157 LEU A C    1 
ATOM   2544  O  O    . LEU A  1 157 ? 109.993 120.007 88.549  1.00 13.75  ? 157 LEU A O    1 
ATOM   2545  C  CB   . LEU A  1 157 ? 111.996 122.462 89.243  1.00 13.75  ? 157 LEU A CB   1 
ATOM   2546  C  CG   . LEU A  1 157 ? 113.063 123.545 89.153  1.00 13.75  ? 157 LEU A CG   1 
ATOM   2547  C  CD1  . LEU A  1 157 ? 113.005 124.403 90.374  1.00 13.75  ? 157 LEU A CD1  1 
ATOM   2548  C  CD2  . LEU A  1 157 ? 114.423 122.929 89.067  1.00 13.75  ? 157 LEU A CD2  1 
ATOM   2549  H  H    . LEU A  1 157 ? 110.676 122.818 87.209  1.00 13.75  ? 157 LEU A H    1 
ATOM   2550  H  HA   . LEU A  1 157 ? 112.705 121.273 87.732  1.00 13.75  ? 157 LEU A HA   1 
ATOM   2551  H  HB2  . LEU A  1 157 ? 111.148 122.907 89.372  1.00 13.75  ? 157 LEU A HB2  1 
ATOM   2552  H  HB3  . LEU A  1 157 ? 112.204 121.942 90.031  1.00 13.75  ? 157 LEU A HB3  1 
ATOM   2553  H  HG   . LEU A  1 157 ? 112.911 124.092 88.371  1.00 13.75  ? 157 LEU A HG   1 
ATOM   2554  H  HD11 . LEU A  1 157 ? 113.483 125.226 90.206  1.00 13.75  ? 157 LEU A HD11 1 
ATOM   2555  H  HD12 . LEU A  1 157 ? 112.080 124.590 90.578  1.00 13.75  ? 157 LEU A HD12 1 
ATOM   2556  H  HD13 . LEU A  1 157 ? 113.418 123.920 91.105  1.00 13.75  ? 157 LEU A HD13 1 
ATOM   2557  H  HD21 . LEU A  1 157 ? 115.075 123.630 88.937  1.00 13.75  ? 157 LEU A HD21 1 
ATOM   2558  H  HD22 . LEU A  1 157 ? 114.599 122.468 89.900  1.00 13.75  ? 157 LEU A HD22 1 
ATOM   2559  H  HD23 . LEU A  1 157 ? 114.451 122.309 88.328  1.00 13.75  ? 157 LEU A HD23 1 
ATOM   2560  N  N    . GLN A  1 158 ? 112.039 119.252 89.012  1.00 13.37  ? 158 GLN A N    1 
ATOM   2561  C  CA   . GLN A  1 158 ? 111.575 117.956 89.519  1.00 13.37  ? 158 GLN A CA   1 
ATOM   2562  C  C    . GLN A  1 158 ? 112.428 117.743 90.747  1.00 13.37  ? 158 GLN A C    1 
ATOM   2563  O  O    . GLN A  1 158 ? 113.608 117.881 90.628  1.00 13.37  ? 158 GLN A O    1 
ATOM   2564  C  CB   . GLN A  1 158 ? 111.769 116.871 88.469  1.00 13.37  ? 158 GLN A CB   1 
ATOM   2565  C  CG   . GLN A  1 158 ? 110.756 116.952 87.343  1.00 13.37  ? 158 GLN A CG   1 
ATOM   2566  C  CD   . GLN A  1 158 ? 109.344 116.950 87.869  1.00 13.37  ? 158 GLN A CD   1 
ATOM   2567  O  OE1  . GLN A  1 158 ? 109.058 116.412 88.931  1.00 13.37  ? 158 GLN A OE1  1 
ATOM   2568  N  NE2  . GLN A  1 158 ? 108.458 117.614 87.151  1.00 13.37  ? 158 GLN A NE2  1 
ATOM   2569  H  H    . GLN A  1 158 ? 112.949 119.321 89.042  1.00 13.37  ? 158 GLN A H    1 
ATOM   2570  H  HA   . GLN A  1 158 ? 110.624 118.024 89.764  1.00 13.37  ? 158 GLN A HA   1 
ATOM   2571  H  HB2  . GLN A  1 158 ? 112.672 116.951 88.098  1.00 13.37  ? 158 GLN A HB2  1 
ATOM   2572  H  HB3  . GLN A  1 158 ? 111.697 115.996 88.905  1.00 13.37  ? 158 GLN A HB3  1 
ATOM   2573  H  HG2  . GLN A  1 158 ? 110.908 117.772 86.827  1.00 13.37  ? 158 GLN A HG2  1 
ATOM   2574  H  HG3  . GLN A  1 158 ? 110.877 116.187 86.741  1.00 13.37  ? 158 GLN A HG3  1 
ATOM   2575  H  HE21 . GLN A  1 158 ? 108.704 118.008 86.398  1.00 13.37  ? 158 GLN A HE21 1 
ATOM   2576  H  HE22 . GLN A  1 158 ? 107.618 117.665 87.422  1.00 13.37  ? 158 GLN A HE22 1 
ATOM   2577  N  N    . MET A  1 159 ? 111.859 117.498 91.901  1.00 11.78  ? 159 MET A N    1 
ATOM   2578  C  CA   . MET A  1 159 ? 112.710 117.304 93.072  1.00 11.78  ? 159 MET A CA   1 
ATOM   2579  C  C    . MET A  1 159 ? 112.950 115.815 93.231  1.00 11.78  ? 159 MET A C    1 
ATOM   2580  O  O    . MET A  1 159 ? 111.980 115.095 93.435  1.00 11.78  ? 159 MET A O    1 
ATOM   2581  C  CB   . MET A  1 159 ? 112.040 117.803 94.351  1.00 11.78  ? 159 MET A CB   1 
ATOM   2582  C  CG   . MET A  1 159 ? 112.800 117.447 95.603  1.00 11.78  ? 159 MET A CG   1 
ATOM   2583  S  SD   . MET A  1 159 ? 111.775 117.467 97.060  1.00 11.78  ? 159 MET A SD   1 
ATOM   2584  C  CE   . MET A  1 159 ? 111.139 115.794 97.037  1.00 11.78  ? 159 MET A CE   1 
ATOM   2585  H  H    . MET A  1 159 ? 110.969 117.354 92.032  1.00 11.78  ? 159 MET A H    1 
ATOM   2586  H  HA   . MET A  1 159 ? 113.558 117.783 92.933  1.00 11.78  ? 159 MET A HA   1 
ATOM   2587  H  HB2  . MET A  1 159 ? 111.948 118.775 94.299  1.00 11.78  ? 159 MET A HB2  1 
ATOM   2588  H  HB3  . MET A  1 159 ? 111.141 117.420 94.405  1.00 11.78  ? 159 MET A HB3  1 
ATOM   2589  H  HG2  . MET A  1 159 ? 113.185 116.551 95.520  1.00 11.78  ? 159 MET A HG2  1 
ATOM   2590  H  HG3  . MET A  1 159 ? 113.542 118.072 95.725  1.00 11.78  ? 159 MET A HG3  1 
ATOM   2591  H  HE1  . MET A  1 159 ? 110.626 115.635 97.838  1.00 11.78  ? 159 MET A HE1  1 
ATOM   2592  H  HE2  . MET A  1 159 ? 110.575 115.676 96.263  1.00 11.78  ? 159 MET A HE2  1 
ATOM   2593  H  HE3  . MET A  1 159 ? 111.876 115.172 96.996  1.00 11.78  ? 159 MET A HE3  1 
ATOM   2594  N  N    . GLN A  1 160 ? 114.181 115.357 93.090  1.00 11.03  ? 160 GLN A N    1 
ATOM   2595  C  CA   . GLN A  1 160 ? 114.529 114.012 93.587  1.00 11.03  ? 160 GLN A CA   1 
ATOM   2596  C  C    . GLN A  1 160 ? 115.083 114.201 95.000  1.00 11.03  ? 160 GLN A C    1 
ATOM   2597  O  O    . GLN A  1 160 ? 115.235 115.352 95.429  1.00 11.03  ? 160 GLN A O    1 
ATOM   2598  C  CB   . GLN A  1 160 ? 115.607 113.311 92.773  1.00 11.03  ? 160 GLN A CB   1 
ATOM   2599  C  CG   . GLN A  1 160 ? 115.417 113.378 91.276  1.00 11.03  ? 160 GLN A CG   1 
ATOM   2600  C  CD   . GLN A  1 160 ? 116.700 112.953 90.619  1.00 11.03  ? 160 GLN A CD   1 
ATOM   2601  O  OE1  . GLN A  1 160 ? 117.781 113.359 91.029  1.00 11.03  ? 160 GLN A OE1  1 
ATOM   2602  N  NE2  . GLN A  1 160 ? 116.592 112.100 89.618  1.00 11.03  ? 160 GLN A NE2  1 
ATOM   2603  H  H    . GLN A  1 160 ? 114.878 115.814 92.719  1.00 11.03  ? 160 GLN A H    1 
ATOM   2604  H  HA   . GLN A  1 160 ? 113.717 113.454 93.621  1.00 11.03  ? 160 GLN A HA   1 
ATOM   2605  H  HB2  . GLN A  1 160 ? 116.468 113.704 92.999  1.00 11.03  ? 160 GLN A HB2  1 
ATOM   2606  H  HB3  . GLN A  1 160 ? 115.632 112.370 93.045  1.00 11.03  ? 160 GLN A HB3  1 
ATOM   2607  H  HG2  . GLN A  1 160 ? 114.688 112.781 91.003  1.00 11.03  ? 160 GLN A HG2  1 
ATOM   2608  H  HG3  . GLN A  1 160 ? 115.191 114.293 91.006  1.00 11.03  ? 160 GLN A HG3  1 
ATOM   2609  H  HE21 . GLN A  1 160 ? 115.803 111.757 89.413  1.00 11.03  ? 160 GLN A HE21 1 
ATOM   2610  H  HE22 . GLN A  1 160 ? 117.307 111.872 89.152  1.00 11.03  ? 160 GLN A HE22 1 
ATOM   2611  N  N    . GLU A  1 161 ? 115.230 113.116 95.774  1.00 18.79  ? 161 GLU A N    1 
ATOM   2612  C  CA   . GLU A  1 161 ? 115.615 113.070 97.225  1.00 18.79  ? 161 GLU A CA   1 
ATOM   2613  C  C    . GLU A  1 161 ? 117.058 113.476 97.534  1.00 18.79  ? 161 GLU A C    1 
ATOM   2614  O  O    . GLU A  1 161 ? 117.918 113.209 96.711  1.00 18.79  ? 161 GLU A O    1 
ATOM   2615  C  CB   . GLU A  1 161 ? 115.529 111.635 97.737  1.00 18.79  ? 161 GLU A CB   1 
ATOM   2616  C  CG   . GLU A  1 161 ? 114.329 111.371 98.618  1.00 18.79  ? 161 GLU A CG   1 
ATOM   2617  C  CD   . GLU A  1 161 ? 113.025 111.212 97.860  1.00 18.79  ? 161 GLU A CD   1 
ATOM   2618  O  OE1  . GLU A  1 161 ? 113.079 111.041 96.627  1.00 18.79  ? 161 GLU A OE1  1 
ATOM   2619  O  OE2  . GLU A  1 161 ? 111.960 111.263 98.505  1.00 18.79  ? 161 GLU A OE2  1 
ATOM   2620  H  H    . GLU A  1 161 ? 114.968 112.298 95.473  1.00 18.79  ? 161 GLU A H    1 
ATOM   2621  H  HA   . GLU A  1 161 ? 114.998 113.639 97.739  1.00 18.79  ? 161 GLU A HA   1 
ATOM   2622  H  HB2  . GLU A  1 161 ? 115.495 111.031 96.966  1.00 18.79  ? 161 GLU A HB2  1 
ATOM   2623  H  HB3  . GLU A  1 161 ? 116.344 111.431 98.241  1.00 18.79  ? 161 GLU A HB3  1 
ATOM   2624  H  HG2  . GLU A  1 161 ? 114.488 110.554 99.138  1.00 18.79  ? 161 GLU A HG2  1 
ATOM   2625  H  HG3  . GLU A  1 161 ? 114.230 112.112 99.253  1.00 18.79  ? 161 GLU A HG3  1 
ATOM   2626  N  N    . ALA A  1 162 ? 117.316 113.948 98.761  1.00 14.23  ? 162 ALA A N    1 
ATOM   2627  C  CA   . ALA A  1 162 ? 118.642 114.384 99.266  1.00 14.23  ? 162 ALA A CA   1 
ATOM   2628  C  C    . ALA A  1 162 ? 119.509 113.168 99.614  1.00 14.23  ? 162 ALA A C    1 
ATOM   2629  O  O    . ALA A  1 162 ? 118.977 112.066 99.694  1.00 14.23  ? 162 ALA A O    1 
ATOM   2630  C  CB   . ALA A  1 162 ? 118.493 115.319 100.433 1.00 14.23  ? 162 ALA A CB   1 
ATOM   2631  H  H    . ALA A  1 162 ? 116.687 113.956 99.418  1.00 14.23  ? 162 ALA A H    1 
ATOM   2632  H  HA   . ALA A  1 162 ? 119.093 114.875 98.539  1.00 14.23  ? 162 ALA A HA   1 
ATOM   2633  H  HB1  . ALA A  1 162 ? 119.372 115.593 100.745 1.00 14.23  ? 162 ALA A HB1  1 
ATOM   2634  H  HB2  . ALA A  1 162 ? 117.988 116.103 100.160 1.00 14.23  ? 162 ALA A HB2  1 
ATOM   2635  H  HB3  . ALA A  1 162 ? 118.022 114.867 101.154 1.00 14.23  ? 162 ALA A HB3  1 
ATOM   2636  N  N    . ASP A  1 163 ? 120.809 113.378 99.801  1.00 16.22  ? 163 ASP A N    1 
ATOM   2637  C  CA   . ASP A  1 163 ? 121.832 112.328 100.041 1.00 16.22  ? 163 ASP A CA   1 
ATOM   2638  C  C    . ASP A  1 163 ? 122.568 112.563 101.361 1.00 16.22  ? 163 ASP A C    1 
ATOM   2639  O  O    . ASP A  1 163 ? 123.106 113.643 101.494 1.00 16.22  ? 163 ASP A O    1 
ATOM   2640  C  CB   . ASP A  1 163 ? 122.860 112.437 98.922  1.00 16.22  ? 163 ASP A CB   1 
ATOM   2641  C  CG   . ASP A  1 163 ? 123.404 111.136 98.392  1.00 16.22  ? 163 ASP A CG   1 
ATOM   2642  O  OD1  . ASP A  1 163 ? 122.610 110.206 98.210  1.00 16.22  ? 163 ASP A OD1  1 
ATOM   2643  O  OD2  . ASP A  1 163 ? 124.611 111.090 98.145  1.00 16.22  ? 163 ASP A OD2  1 
ATOM   2644  H  H    . ASP A  1 163 ? 121.163 114.217 99.793  1.00 16.22  ? 163 ASP A H    1 
ATOM   2645  H  HA   . ASP A  1 163 ? 121.409 111.437 100.037 1.00 16.22  ? 163 ASP A HA   1 
ATOM   2646  H  HB2  . ASP A  1 163 ? 122.454 112.920 98.174  1.00 16.22  ? 163 ASP A HB2  1 
ATOM   2647  H  HB3  . ASP A  1 163 ? 123.616 112.968 99.247  1.00 16.22  ? 163 ASP A HB3  1 
ATOM   2648  N  N    . ILE A  1 164 ? 122.637 111.595 102.285 1.00 20.50  ? 164 ILE A N    1 
ATOM   2649  C  CA   . ILE A  1 164 ? 123.365 111.771 103.533 1.00 20.50  ? 164 ILE A CA   1 
ATOM   2650  C  C    . ILE A  1 164 ? 124.503 110.770 103.673 1.00 20.50  ? 164 ILE A C    1 
ATOM   2651  O  O    . ILE A  1 164 ? 125.106 110.670 104.740 1.00 20.50  ? 164 ILE A O    1 
ATOM   2652  C  CB   . ILE A  1 164 ? 122.423 111.687 104.748 1.00 20.50  ? 164 ILE A CB   1 
ATOM   2653  C  CG1  . ILE A  1 164 ? 121.731 110.325 104.784 1.00 20.50  ? 164 ILE A CG1  1 
ATOM   2654  C  CG2  . ILE A  1 164 ? 121.406 112.790 104.693 1.00 20.50  ? 164 ILE A CG2  1 
ATOM   2655  C  CD1  . ILE A  1 164 ? 121.102 110.001 106.112 1.00 20.50  ? 164 ILE A CD1  1 
ATOM   2656  H  H    . ILE A  1 164 ? 122.337 110.798 102.183 1.00 20.50  ? 164 ILE A H    1 
ATOM   2657  H  HA   . ILE A  1 164 ? 123.755 112.655 103.536 1.00 20.50  ? 164 ILE A HA   1 
ATOM   2658  H  HB   . ILE A  1 164 ? 122.947 111.791 105.552 1.00 20.50  ? 164 ILE A HB   1 
ATOM   2659  H  HG12 . ILE A  1 164 ? 121.039 110.303 104.108 1.00 20.50  ? 164 ILE A HG12 1 
ATOM   2660  H  HG13 . ILE A  1 164 ? 122.388 109.637 104.606 1.00 20.50  ? 164 ILE A HG13 1 
ATOM   2661  H  HG21 . ILE A  1 164 ? 120.846 112.738 105.481 1.00 20.50  ? 164 ILE A HG21 1 
ATOM   2662  H  HG22 . ILE A  1 164 ? 121.875 113.635 104.675 1.00 20.50  ? 164 ILE A HG22 1 
ATOM   2663  H  HG23 . ILE A  1 164 ? 120.873 112.687 103.891 1.00 20.50  ? 164 ILE A HG23 1 
ATOM   2664  H  HD11 . ILE A  1 164 ? 120.766 109.092 106.078 1.00 20.50  ? 164 ILE A HD11 1 
ATOM   2665  H  HD12 . ILE A  1 164 ? 121.788 110.072 106.794 1.00 20.50  ? 164 ILE A HD12 1 
ATOM   2666  H  HD13 . ILE A  1 164 ? 120.379 110.622 106.301 1.00 20.50  ? 164 ILE A HD13 1 
ATOM   2667  N  N    . SER A  1 165 ? 124.806 110.023 102.611 1.00 22.02  ? 165 SER A N    1 
ATOM   2668  C  CA   . SER A  1 165 ? 125.872 109.033 102.678 1.00 22.02  ? 165 SER A CA   1 
ATOM   2669  C  C    . SER A  1 165 ? 127.203 109.657 103.069 1.00 22.02  ? 165 SER A C    1 
ATOM   2670  O  O    . SER A  1 165 ? 128.072 108.970 103.615 1.00 22.02  ? 165 SER A O    1 
ATOM   2671  C  CB   . SER A  1 165 ? 125.995 108.321 101.337 1.00 22.02  ? 165 SER A CB   1 
ATOM   2672  O  OG   . SER A  1 165 ? 126.008 109.246 100.269 1.00 22.02  ? 165 SER A OG   1 
ATOM   2673  H  H    . SER A  1 165 ? 124.411 110.065 101.853 1.00 22.02  ? 165 SER A H    1 
ATOM   2674  H  HA   . SER A  1 165 ? 125.645 108.374 103.346 1.00 22.02  ? 165 SER A HA   1 
ATOM   2675  H  HB2  . SER A  1 165 ? 126.819 107.815 101.325 1.00 22.02  ? 165 SER A HB2  1 
ATOM   2676  H  HB3  . SER A  1 165 ? 125.237 107.731 101.226 1.00 22.02  ? 165 SER A HB3  1 
ATOM   2677  H  HG   . SER A  1 165 ? 125.241 109.569 100.167 1.00 22.02  ? 165 SER A HG   1 
ATOM   2678  N  N    . GLY A  1 166 ? 127.383 110.945 102.801 1.00 18.08  ? 166 GLY A N    1 
ATOM   2679  C  CA   . GLY A  1 166 ? 128.608 111.646 103.107 1.00 18.08  ? 166 GLY A CA   1 
ATOM   2680  C  C    . GLY A  1 166 ? 128.555 112.520 104.337 1.00 18.08  ? 166 GLY A C    1 
ATOM   2681  O  O    . GLY A  1 166 ? 129.500 113.282 104.574 1.00 18.08  ? 166 GLY A O    1 
ATOM   2682  H  H    . GLY A  1 166 ? 126.788 111.444 102.441 1.00 18.08  ? 166 GLY A H    1 
ATOM   2683  H  HA2  . GLY A  1 166 ? 129.318 111.001 103.226 1.00 18.08  ? 166 GLY A HA2  1 
ATOM   2684  H  HA3  . GLY A  1 166 ? 128.839 112.211 102.358 1.00 18.08  ? 166 GLY A HA3  1 
ATOM   2685  N  N    . TYR A  1 167 ? 127.494 112.436 105.130 1.00 16.76  ? 167 TYR A N    1 
ATOM   2686  C  CA   . TYR A  1 167 ? 127.356 113.313 106.280 1.00 16.76  ? 167 TYR A CA   1 
ATOM   2687  C  C    . TYR A  1 167 ? 128.472 113.065 107.286 1.00 16.76  ? 167 TYR A C    1 
ATOM   2688  O  O    . TYR A  1 167 ? 128.935 111.938 107.477 1.00 16.76  ? 167 TYR A O    1 
ATOM   2689  C  CB   . TYR A  1 167 ? 125.993 113.116 106.937 1.00 16.76  ? 167 TYR A CB   1 
ATOM   2690  C  CG   . TYR A  1 167 ? 125.683 114.139 108.000 1.00 16.76  ? 167 TYR A CG   1 
ATOM   2691  C  CD1  . TYR A  1 167 ? 125.691 115.487 107.707 1.00 16.76  ? 167 TYR A CD1  1 
ATOM   2692  C  CD2  . TYR A  1 167 ? 125.384 113.756 109.295 1.00 16.76  ? 167 TYR A CD2  1 
ATOM   2693  C  CE1  . TYR A  1 167 ? 125.417 116.425 108.666 1.00 16.76  ? 167 TYR A CE1  1 
ATOM   2694  C  CE2  . TYR A  1 167 ? 125.107 114.691 110.263 1.00 16.76  ? 167 TYR A CE2  1 
ATOM   2695  C  CZ   . TYR A  1 167 ? 125.126 116.025 109.942 1.00 16.76  ? 167 TYR A CZ   1 
ATOM   2696  O  OH   . TYR A  1 167 ? 124.849 116.968 110.901 1.00 16.76  ? 167 TYR A OH   1 
ATOM   2697  H  H    . TYR A  1 167 ? 126.845 111.886 105.023 1.00 16.76  ? 167 TYR A H    1 
ATOM   2698  H  HA   . TYR A  1 167 ? 127.418 114.230 105.990 1.00 16.76  ? 167 TYR A HA   1 
ATOM   2699  H  HB2  . TYR A  1 167 ? 125.312 113.188 106.254 1.00 16.76  ? 167 TYR A HB2  1 
ATOM   2700  H  HB3  . TYR A  1 167 ? 125.967 112.240 107.344 1.00 16.76  ? 167 TYR A HB3  1 
ATOM   2701  H  HD1  . TYR A  1 167 ? 125.891 115.758 106.845 1.00 16.76  ? 167 TYR A HD1  1 
ATOM   2702  H  HD2  . TYR A  1 167 ? 125.372 112.855 109.513 1.00 16.76  ? 167 TYR A HD2  1 
ATOM   2703  H  HE1  . TYR A  1 167 ? 125.428 117.326 108.454 1.00 16.76  ? 167 TYR A HE1  1 
ATOM   2704  H  HE2  . TYR A  1 167 ? 124.907 114.424 111.129 1.00 16.76  ? 167 TYR A HE2  1 
ATOM   2705  H  HH   . TYR A  1 167 ? 124.925 116.627 111.663 1.00 16.76  ? 167 TYR A HH   1 
ATOM   2706  N  N    . ILE A  1 168 ? 128.908 114.146 107.923 1.00 18.73  ? 168 ILE A N    1 
ATOM   2707  C  CA   . ILE A  1 168 ? 129.986 114.125 108.905 1.00 18.73  ? 168 ILE A CA   1 
ATOM   2708  C  C    . ILE A  1 168 ? 129.488 114.816 110.168 1.00 18.73  ? 168 ILE A C    1 
ATOM   2709  O  O    . ILE A  1 168 ? 129.441 116.053 110.211 1.00 18.73  ? 168 ILE A O    1 
ATOM   2710  C  CB   . ILE A  1 168 ? 131.245 114.805 108.349 1.00 18.73  ? 168 ILE A CB   1 
ATOM   2711  C  CG1  . ILE A  1 168 ? 131.813 113.982 107.201 1.00 18.73  ? 168 ILE A CG1  1 
ATOM   2712  C  CG2  . ILE A  1 168 ? 132.294 115.001 109.435 1.00 18.73  ? 168 ILE A CG2  1 
ATOM   2713  C  CD1  . ILE A  1 168 ? 132.814 114.723 106.378 1.00 18.73  ? 168 ILE A CD1  1 
ATOM   2714  H  H    . ILE A  1 168 ? 128.584 114.928 107.799 1.00 18.73  ? 168 ILE A H    1 
ATOM   2715  H  HA   . ILE A  1 168 ? 130.214 113.210 109.109 1.00 18.73  ? 168 ILE A HA   1 
ATOM   2716  H  HB   . ILE A  1 168 ? 130.994 115.670 108.005 1.00 18.73  ? 168 ILE A HB   1 
ATOM   2717  H  HG12 . ILE A  1 168 ? 132.250 113.199 107.566 1.00 18.73  ? 168 ILE A HG12 1 
ATOM   2718  H  HG13 . ILE A  1 168 ? 131.084 113.715 106.622 1.00 18.73  ? 168 ILE A HG13 1 
ATOM   2719  H  HG21 . ILE A  1 168 ? 133.114 115.320 109.027 1.00 18.73  ? 168 ILE A HG21 1 
ATOM   2720  H  HG22 . ILE A  1 168 ? 131.975 115.656 110.074 1.00 18.73  ? 168 ILE A HG22 1 
ATOM   2721  H  HG23 . ILE A  1 168 ? 132.454 114.154 109.875 1.00 18.73  ? 168 ILE A HG23 1 
ATOM   2722  H  HD11 . ILE A  1 168 ? 133.037 114.193 105.598 1.00 18.73  ? 168 ILE A HD11 1 
ATOM   2723  H  HD12 . ILE A  1 168 ? 132.428 115.569 106.108 1.00 18.73  ? 168 ILE A HD12 1 
ATOM   2724  H  HD13 . ILE A  1 168 ? 133.604 114.878 106.916 1.00 18.73  ? 168 ILE A HD13 1 
ATOM   2725  N  N    . PRO A  1 169 ? 129.105 114.078 111.209 1.00 22.87  ? 169 PRO A N    1 
ATOM   2726  C  CA   . PRO A  1 169 ? 128.605 114.734 112.421 1.00 22.87  ? 169 PRO A CA   1 
ATOM   2727  C  C    . PRO A  1 169 ? 129.648 115.677 113.000 1.00 22.87  ? 169 PRO A C    1 
ATOM   2728  O  O    . PRO A  1 169 ? 130.849 115.407 112.954 1.00 22.87  ? 169 PRO A O    1 
ATOM   2729  C  CB   . PRO A  1 169 ? 128.312 113.563 113.362 1.00 22.87  ? 169 PRO A CB   1 
ATOM   2730  C  CG   . PRO A  1 169 ? 128.182 112.382 112.478 1.00 22.87  ? 169 PRO A CG   1 
ATOM   2731  C  CD   . PRO A  1 169 ? 129.104 112.613 111.344 1.00 22.87  ? 169 PRO A CD   1 
ATOM   2732  H  HA   . PRO A  1 169 ? 127.787 115.218 112.242 1.00 22.87  ? 169 PRO A HA   1 
ATOM   2733  H  HB2  . PRO A  1 169 ? 129.052 113.449 113.975 1.00 22.87  ? 169 PRO A HB2  1 
ATOM   2734  H  HB3  . PRO A  1 169 ? 127.485 113.729 113.838 1.00 22.87  ? 169 PRO A HB3  1 
ATOM   2735  H  HG2  . PRO A  1 169 ? 128.442 111.587 112.963 1.00 22.87  ? 169 PRO A HG2  1 
ATOM   2736  H  HG3  . PRO A  1 169 ? 127.270 112.309 112.164 1.00 22.87  ? 169 PRO A HG3  1 
ATOM   2737  H  HD2  . PRO A  1 169 ? 129.991 112.295 111.564 1.00 22.87  ? 169 PRO A HD2  1 
ATOM   2738  H  HD3  . PRO A  1 169 ? 128.760 112.194 110.543 1.00 22.87  ? 169 PRO A HD3  1 
ATOM   2739  N  N    . ASN A  1 170 ? 129.175 116.794 113.553 1.00 29.26  ? 170 ASN A N    1 
ATOM   2740  C  CA   . ASN A  1 170 ? 130.065 117.871 113.962 1.00 29.26  ? 170 ASN A CA   1 
ATOM   2741  C  C    . ASN A  1 170 ? 130.284 117.940 115.465 1.00 29.26  ? 170 ASN A C    1 
ATOM   2742  O  O    . ASN A  1 170 ? 131.313 118.470 115.899 1.00 29.26  ? 170 ASN A O    1 
ATOM   2743  C  CB   . ASN A  1 170 ? 129.527 119.220 113.467 1.00 29.26  ? 170 ASN A CB   1 
ATOM   2744  C  CG   . ASN A  1 170 ? 128.092 119.453 113.857 1.00 29.26  ? 170 ASN A CG   1 
ATOM   2745  O  OD1  . ASN A  1 170 ? 127.302 118.517 113.958 1.00 29.26  ? 170 ASN A OD1  1 
ATOM   2746  N  ND2  . ASN A  1 170 ? 127.741 120.711 114.070 1.00 29.26  ? 170 ASN A ND2  1 
ATOM   2747  H  H    . ASN A  1 170 ? 128.345 116.945 113.713 1.00 29.26  ? 170 ASN A H    1 
ATOM   2748  H  HA   . ASN A  1 170 ? 130.928 117.728 113.546 1.00 29.26  ? 170 ASN A HA   1 
ATOM   2749  H  HB2  . ASN A  1 170 ? 130.057 119.937 113.846 1.00 29.26  ? 170 ASN A HB2  1 
ATOM   2750  H  HB3  . ASN A  1 170 ? 129.577 119.244 112.501 1.00 29.26  ? 170 ASN A HB3  1 
ATOM   2751  H  HD21 . ASN A  1 170 ? 126.936 120.901 114.292 1.00 29.26  ? 170 ASN A HD21 1 
ATOM   2752  H  HD22 . ASN A  1 170 ? 128.324 121.336 113.986 1.00 29.26  ? 170 ASN A HD22 1 
ATOM   2753  N  N    . GLY A  1 171 ? 129.356 117.425 116.264 1.00 38.18  ? 171 GLY A N    1 
ATOM   2754  C  CA   . GLY A  1 171 ? 129.533 117.359 117.697 1.00 38.18  ? 171 GLY A CA   1 
ATOM   2755  C  C    . GLY A  1 171 ? 128.779 118.396 118.495 1.00 38.18  ? 171 GLY A C    1 
ATOM   2756  O  O    . GLY A  1 171 ? 128.975 118.475 119.713 1.00 38.18  ? 171 GLY A O    1 
ATOM   2757  H  H    . GLY A  1 171 ? 128.607 117.109 115.989 1.00 38.18  ? 171 GLY A H    1 
ATOM   2758  H  HA2  . GLY A  1 171 ? 129.250 116.486 118.003 1.00 38.18  ? 171 GLY A HA2  1 
ATOM   2759  H  HA3  . GLY A  1 171 ? 130.474 117.461 117.899 1.00 38.18  ? 171 GLY A HA3  1 
ATOM   2760  N  N    . GLU A  1 172 ? 127.935 119.197 117.853 1.00 35.96  ? 172 GLU A N    1 
ATOM   2761  C  CA   . GLU A  1 172 ? 127.054 120.112 118.557 1.00 35.96  ? 172 GLU A CA   1 
ATOM   2762  C  C    . GLU A  1 172 ? 125.618 120.055 118.071 1.00 35.96  ? 172 GLU A C    1 
ATOM   2763  O  O    . GLU A  1 172 ? 124.752 120.671 118.699 1.00 35.96  ? 172 GLU A O    1 
ATOM   2764  C  CB   . GLU A  1 172 ? 127.561 121.553 118.429 1.00 35.96  ? 172 GLU A CB   1 
ATOM   2765  C  CG   . GLU A  1 172 ? 126.984 122.495 119.465 1.00 35.96  ? 172 GLU A CG   1 
ATOM   2766  C  CD   . GLU A  1 172 ? 127.569 123.887 119.375 1.00 35.96  ? 172 GLU A CD   1 
ATOM   2767  O  OE1  . GLU A  1 172 ? 128.739 124.014 118.958 1.00 35.96  ? 172 GLU A OE1  1 
ATOM   2768  O  OE2  . GLU A  1 172 ? 126.858 124.854 119.718 1.00 35.96  ? 172 GLU A OE2  1 
ATOM   2769  H  H    . GLU A  1 172 ? 127.858 119.230 117.000 1.00 35.96  ? 172 GLU A H    1 
ATOM   2770  H  HA   . GLU A  1 172 ? 127.053 119.887 119.495 1.00 35.96  ? 172 GLU A HA   1 
ATOM   2771  H  HB2  . GLU A  1 172 ? 128.524 121.554 118.521 1.00 35.96  ? 172 GLU A HB2  1 
ATOM   2772  H  HB3  . GLU A  1 172 ? 127.315 121.888 117.556 1.00 35.96  ? 172 GLU A HB3  1 
ATOM   2773  H  HG2  . GLU A  1 172 ? 126.027 122.561 119.335 1.00 35.96  ? 172 GLU A HG2  1 
ATOM   2774  H  HG3  . GLU A  1 172 ? 127.172 122.146 120.348 1.00 35.96  ? 172 GLU A HG3  1 
ATOM   2775  N  N    . TRP A  1 173 ? 125.335 119.334 116.990 1.00 30.13  ? 173 TRP A N    1 
ATOM   2776  C  CA   . TRP A  1 173 ? 123.998 119.228 116.436 1.00 30.13  ? 173 TRP A CA   1 
ATOM   2777  C  C    . TRP A  1 173 ? 123.791 117.827 115.893 1.00 30.13  ? 173 TRP A C    1 
ATOM   2778  O  O    . TRP A  1 173 ? 124.679 117.264 115.248 1.00 30.13  ? 173 TRP A O    1 
ATOM   2779  C  CB   . TRP A  1 173 ? 123.770 120.253 115.327 1.00 30.13  ? 173 TRP A CB   1 
ATOM   2780  C  CG   . TRP A  1 173 ? 123.826 121.657 115.797 1.00 30.13  ? 173 TRP A CG   1 
ATOM   2781  C  CD1  . TRP A  1 173 ? 124.918 122.463 115.836 1.00 30.13  ? 173 TRP A CD1  1 
ATOM   2782  C  CD2  . TRP A  1 173 ? 122.737 122.431 116.299 1.00 30.13  ? 173 TRP A CD2  1 
ATOM   2783  N  NE1  . TRP A  1 173 ? 124.579 123.694 116.334 1.00 30.13  ? 173 TRP A NE1  1 
ATOM   2784  C  CE2  . TRP A  1 173 ? 123.242 123.697 116.626 1.00 30.13  ? 173 TRP A CE2  1 
ATOM   2785  C  CE3  . TRP A  1 173 ? 121.383 122.175 116.503 1.00 30.13  ? 173 TRP A CE3  1 
ATOM   2786  C  CZ2  . TRP A  1 173 ? 122.443 124.701 117.145 1.00 30.13  ? 173 TRP A CZ2  1 
ATOM   2787  C  CZ3  . TRP A  1 173 ? 120.594 123.172 117.017 1.00 30.13  ? 173 TRP A CZ3  1 
ATOM   2788  C  CH2  . TRP A  1 173 ? 121.122 124.418 117.332 1.00 30.13  ? 173 TRP A CH2  1 
ATOM   2789  H  H    . TRP A  1 173 ? 125.915 118.882 116.552 1.00 30.13  ? 173 TRP A H    1 
ATOM   2790  H  HA   . TRP A  1 173 ? 123.347 119.383 117.132 1.00 30.13  ? 173 TRP A HA   1 
ATOM   2791  H  HB2  . TRP A  1 173 ? 124.455 120.137 114.655 1.00 30.13  ? 173 TRP A HB2  1 
ATOM   2792  H  HB3  . TRP A  1 173 ? 122.896 120.104 114.941 1.00 30.13  ? 173 TRP A HB3  1 
ATOM   2793  H  HD1  . TRP A  1 173 ? 125.770 122.216 115.567 1.00 30.13  ? 173 TRP A HD1  1 
ATOM   2794  H  HE1  . TRP A  1 173 ? 125.116 124.354 116.445 1.00 30.13  ? 173 TRP A HE1  1 
ATOM   2795  H  HE3  . TRP A  1 173 ? 121.022 121.346 116.296 1.00 30.13  ? 173 TRP A HE3  1 
ATOM   2796  H  HZ2  . TRP A  1 173 ? 122.794 125.532 117.355 1.00 30.13  ? 173 TRP A HZ2  1 
ATOM   2797  H  HZ3  . TRP A  1 173 ? 119.693 123.014 117.157 1.00 30.13  ? 173 TRP A HZ3  1 
ATOM   2798  H  HH2  . TRP A  1 173 ? 120.561 125.068 117.678 1.00 30.13  ? 173 TRP A HH2  1 
ATOM   2799  N  N    . ASP A  1 174 ? 122.617 117.270 116.159 1.00 31.87  ? 174 ASP A N    1 
ATOM   2800  C  CA   . ASP A  1 174 ? 122.231 115.959 115.668 1.00 31.87  ? 174 ASP A CA   1 
ATOM   2801  C  C    . ASP A  1 174 ? 121.219 116.141 114.548 1.00 31.87  ? 174 ASP A C    1 
ATOM   2802  O  O    . ASP A  1 174 ? 120.218 116.842 114.721 1.00 31.87  ? 174 ASP A O    1 
ATOM   2803  C  CB   . ASP A  1 174 ? 121.642 115.110 116.794 1.00 31.87  ? 174 ASP A CB   1 
ATOM   2804  C  CG   . ASP A  1 174 ? 121.369 113.683 116.373 1.00 31.87  ? 174 ASP A CG   1 
ATOM   2805  O  OD1  . ASP A  1 174 ? 122.338 112.908 116.229 1.00 31.87  ? 174 ASP A OD1  1 
ATOM   2806  O  OD2  . ASP A  1 174 ? 120.184 113.331 116.196 1.00 31.87  ? 174 ASP A OD2  1 
ATOM   2807  H  H    . ASP A  1 174 ? 122.013 117.643 116.638 1.00 31.87  ? 174 ASP A H    1 
ATOM   2808  H  HA   . ASP A  1 174 ? 123.008 115.508 115.311 1.00 31.87  ? 174 ASP A HA   1 
ATOM   2809  H  HB2  . ASP A  1 174 ? 122.269 115.090 117.532 1.00 31.87  ? 174 ASP A HB2  1 
ATOM   2810  H  HB3  . ASP A  1 174 ? 120.805 115.504 117.074 1.00 31.87  ? 174 ASP A HB3  1 
ATOM   2811  N  N    . LEU A  1 175 ? 121.481 115.514 113.406 1.00 19.96  ? 175 LEU A N    1 
ATOM   2812  C  CA   . LEU A  1 175 ? 120.638 115.685 112.230 1.00 19.96  ? 175 LEU A CA   1 
ATOM   2813  C  C    . LEU A  1 175 ? 119.448 114.743 112.319 1.00 19.96  ? 175 LEU A C    1 
ATOM   2814  O  O    . LEU A  1 175 ? 119.596 113.523 112.200 1.00 19.96  ? 175 LEU A O    1 
ATOM   2815  C  CB   . LEU A  1 175 ? 121.438 115.438 110.957 1.00 19.96  ? 175 LEU A CB   1 
ATOM   2816  C  CG   . LEU A  1 175 ? 120.666 115.648 109.658 1.00 19.96  ? 175 LEU A CG   1 
ATOM   2817  C  CD1  . LEU A  1 175 ? 120.671 117.094 109.268 1.00 19.96  ? 175 LEU A CD1  1 
ATOM   2818  C  CD2  . LEU A  1 175 ? 121.257 114.815 108.557 1.00 19.96  ? 175 LEU A CD2  1 
ATOM   2819  H  H    . LEU A  1 175 ? 122.146 114.984 113.284 1.00 19.96  ? 175 LEU A H    1 
ATOM   2820  H  HA   . LEU A  1 175 ? 120.303 116.591 112.208 1.00 19.96  ? 175 LEU A HA   1 
ATOM   2821  H  HB2  . LEU A  1 175 ? 122.190 116.048 110.946 1.00 19.96  ? 175 LEU A HB2  1 
ATOM   2822  H  HB3  . LEU A  1 175 ? 121.758 114.525 110.965 1.00 19.96  ? 175 LEU A HB3  1 
ATOM   2823  H  HG   . LEU A  1 175 ? 119.748 115.375 109.780 1.00 19.96  ? 175 LEU A HG   1 
ATOM   2824  H  HD11 . LEU A  1 175 ? 120.162 117.197 108.452 1.00 19.96  ? 175 LEU A HD11 1 
ATOM   2825  H  HD12 . LEU A  1 175 ? 120.272 117.613 109.980 1.00 19.96  ? 175 LEU A HD12 1 
ATOM   2826  H  HD13 . LEU A  1 175 ? 121.585 117.372 109.126 1.00 19.96  ? 175 LEU A HD13 1 
ATOM   2827  H  HD21 . LEU A  1 175 ? 120.733 114.946 107.755 1.00 19.96  ? 175 LEU A HD21 1 
ATOM   2828  H  HD22 . LEU A  1 175 ? 122.167 115.105 108.409 1.00 19.96  ? 175 LEU A HD22 1 
ATOM   2829  H  HD23 . LEU A  1 175 ? 121.244 113.884 108.819 1.00 19.96  ? 175 LEU A HD23 1 
ATOM   2830  N  N    . VAL A  1 176 ? 118.265 115.313 112.532 1.00 21.35  ? 176 VAL A N    1 
ATOM   2831  C  CA   . VAL A  1 176 ? 117.039 114.529 112.482 1.00 21.35  ? 176 VAL A CA   1 
ATOM   2832  C  C    . VAL A  1 176 ? 116.735 114.117 111.050 1.00 21.35  ? 176 VAL A C    1 
ATOM   2833  O  O    . VAL A  1 176 ? 116.491 112.940 110.762 1.00 21.35  ? 176 VAL A O    1 
ATOM   2834  C  CB   . VAL A  1 176 ? 115.876 115.325 113.096 1.00 21.35  ? 176 VAL A CB   1 
ATOM   2835  C  CG1  . VAL A  1 176 ? 114.615 114.509 113.087 1.00 21.35  ? 176 VAL A CG1  1 
ATOM   2836  C  CG2  . VAL A  1 176 ? 116.216 115.746 114.504 1.00 21.35  ? 176 VAL A CG2  1 
ATOM   2837  H  H    . VAL A  1 176 ? 118.149 116.144 112.706 1.00 21.35  ? 176 VAL A H    1 
ATOM   2838  H  HA   . VAL A  1 176 ? 117.161 113.725 113.005 1.00 21.35  ? 176 VAL A HA   1 
ATOM   2839  H  HB   . VAL A  1 176 ? 115.724 116.122 112.570 1.00 21.35  ? 176 VAL A HB   1 
ATOM   2840  H  HG11 . VAL A  1 176 ? 113.913 115.021 113.514 1.00 21.35  ? 176 VAL A HG11 1 
ATOM   2841  H  HG12 . VAL A  1 176 ? 114.371 114.313 112.170 1.00 21.35  ? 176 VAL A HG12 1 
ATOM   2842  H  HG13 . VAL A  1 176 ? 114.775 113.687 113.573 1.00 21.35  ? 176 VAL A HG13 1 
ATOM   2843  H  HG21 . VAL A  1 176 ? 115.450 116.196 114.888 1.00 21.35  ? 176 VAL A HG21 1 
ATOM   2844  H  HG22 . VAL A  1 176 ? 116.430 114.954 115.016 1.00 21.35  ? 176 VAL A HG22 1 
ATOM   2845  H  HG23 . VAL A  1 176 ? 116.978 116.342 114.486 1.00 21.35  ? 176 VAL A HG23 1 
ATOM   2846  N  N    . GLY A  1 177 ? 116.750 115.075 110.132 1.00 17.19  ? 177 GLY A N    1 
ATOM   2847  C  CA   . GLY A  1 177 ? 116.478 114.768 108.744 1.00 17.19  ? 177 GLY A CA   1 
ATOM   2848  C  C    . GLY A  1 177 ? 116.610 116.000 107.880 1.00 17.19  ? 177 GLY A C    1 
ATOM   2849  O  O    . GLY A  1 177 ? 116.875 117.109 108.360 1.00 17.19  ? 177 GLY A O    1 
ATOM   2850  H  H    . GLY A  1 177 ? 116.909 115.903 110.288 1.00 17.19  ? 177 GLY A H    1 
ATOM   2851  H  HA2  . GLY A  1 177 ? 117.104 114.102 108.427 1.00 17.19  ? 177 GLY A HA2  1 
ATOM   2852  H  HA3  . GLY A  1 177 ? 115.579 114.423 108.656 1.00 17.19  ? 177 GLY A HA3  1 
ATOM   2853  N  N    . ILE A  1 178 ? 116.420 115.779 106.585 1.00 12.61  ? 178 ILE A N    1 
ATOM   2854  C  CA   . ILE A  1 178 ? 116.482 116.838 105.585 1.00 12.61  ? 178 ILE A CA   1 
ATOM   2855  C  C    . ILE A  1 178 ? 115.488 116.505 104.479 1.00 12.61  ? 178 ILE A C    1 
ATOM   2856  O  O    . ILE A  1 178 ? 115.889 116.175 103.355 1.00 12.61  ? 178 ILE A O    1 
ATOM   2857  C  CB   . ILE A  1 178 ? 117.912 117.012 105.050 1.00 12.61  ? 178 ILE A CB   1 
ATOM   2858  C  CG1  . ILE A  1 178 ? 117.954 118.077 103.963 1.00 12.61  ? 178 ILE A CG1  1 
ATOM   2859  C  CG2  . ILE A  1 178 ? 118.471 115.704 104.530 1.00 12.61  ? 178 ILE A CG2  1 
ATOM   2860  C  CD1  . ILE A  1 178 ? 119.318 118.594 103.713 1.00 12.61  ? 178 ILE A CD1  1 
ATOM   2861  H  H    . ILE A  1 178 ? 116.247 115.008 106.253 1.00 12.61  ? 178 ILE A H    1 
ATOM   2862  H  HA   . ILE A  1 178 ? 116.211 117.672 105.992 1.00 12.61  ? 178 ILE A HA   1 
ATOM   2863  H  HB   . ILE A  1 178 ? 118.471 117.305 105.781 1.00 12.61  ? 178 ILE A HB   1 
ATOM   2864  H  HG12 . ILE A  1 178 ? 117.633 117.694 103.136 1.00 12.61  ? 178 ILE A HG12 1 
ATOM   2865  H  HG13 . ILE A  1 178 ? 117.397 118.821 104.225 1.00 12.61  ? 178 ILE A HG13 1 
ATOM   2866  H  HG21 . ILE A  1 178 ? 119.399 115.842 104.288 1.00 12.61  ? 178 ILE A HG21 1 
ATOM   2867  H  HG22 . ILE A  1 178 ? 118.407 115.033 105.224 1.00 12.61  ? 178 ILE A HG22 1 
ATOM   2868  H  HG23 . ILE A  1 178 ? 117.971 115.427 103.753 1.00 12.61  ? 178 ILE A HG23 1 
ATOM   2869  H  HD11 . ILE A  1 178 ? 119.257 119.409 103.195 1.00 12.61  ? 178 ILE A HD11 1 
ATOM   2870  H  HD12 . ILE A  1 178 ? 119.742 118.769 104.563 1.00 12.61  ? 178 ILE A HD12 1 
ATOM   2871  H  HD13 . ILE A  1 178 ? 119.817 117.921 103.229 1.00 12.61  ? 178 ILE A HD13 1 
ATOM   2872  N  N    . PRO A  1 179 ? 114.191 116.567 104.750 1.00 10.96  ? 179 PRO A N    1 
ATOM   2873  C  CA   . PRO A  1 179 ? 113.205 116.257 103.718 1.00 10.96  ? 179 PRO A CA   1 
ATOM   2874  C  C    . PRO A  1 179 ? 112.964 117.426 102.780 1.00 10.96  ? 179 PRO A C    1 
ATOM   2875  O  O    . PRO A  1 179 ? 113.171 118.594 103.114 1.00 10.96  ? 179 PRO A O    1 
ATOM   2876  C  CB   . PRO A  1 179 ? 111.946 115.938 104.526 1.00 10.96  ? 179 PRO A CB   1 
ATOM   2877  C  CG   . PRO A  1 179 ? 112.100 116.730 105.750 1.00 10.96  ? 179 PRO A CG   1 
ATOM   2878  C  CD   . PRO A  1 179 ? 113.560 116.734 106.067 1.00 10.96  ? 179 PRO A CD   1 
ATOM   2879  H  HA   . PRO A  1 179 ? 113.481 115.482 103.211 1.00 10.96  ? 179 PRO A HA   1 
ATOM   2880  H  HB2  . PRO A  1 179 ? 111.160 116.207 104.032 1.00 10.96  ? 179 PRO A HB2  1 
ATOM   2881  H  HB3  . PRO A  1 179 ? 111.923 114.993 104.729 1.00 10.96  ? 179 PRO A HB3  1 
ATOM   2882  H  HG2  . PRO A  1 179 ? 111.788 117.631 105.591 1.00 10.96  ? 179 PRO A HG2  1 
ATOM   2883  H  HG3  . PRO A  1 179 ? 111.600 116.318 106.468 1.00 10.96  ? 179 PRO A HG3  1 
ATOM   2884  H  HD2  . PRO A  1 179 ? 113.813 117.578 106.460 1.00 10.96  ? 179 PRO A HD2  1 
ATOM   2885  H  HD3  . PRO A  1 179 ? 113.785 115.990 106.643 1.00 10.96  ? 179 PRO A HD3  1 
ATOM   2886  N  N    . GLY A  1 180 ? 112.489 117.081 101.589 1.00 5.88   ? 180 GLY A N    1 
ATOM   2887  C  CA   . GLY A  1 180 ? 112.241 118.066 100.562 1.00 5.88   ? 180 GLY A CA   1 
ATOM   2888  C  C    . GLY A  1 180 ? 110.791 118.176 100.154 1.00 5.88   ? 180 GLY A C    1 
ATOM   2889  O  O    . GLY A  1 180 ? 109.991 117.264 100.374 1.00 5.88   ? 180 GLY A O    1 
ATOM   2890  H  H    . GLY A  1 180 ? 112.301 116.279 101.354 1.00 5.88   ? 180 GLY A H    1 
ATOM   2891  H  HA2  . GLY A  1 180 ? 112.521 118.933 100.883 1.00 5.88   ? 180 GLY A HA2  1 
ATOM   2892  H  HA3  . GLY A  1 180 ? 112.762 117.846 99.780  1.00 5.88   ? 180 GLY A HA3  1 
ATOM   2893  N  N    . LYS A  1 181 ? 110.453 119.310 99.552  1.00 6.29   ? 181 LYS A N    1 
ATOM   2894  C  CA   . LYS A  1 181 ? 109.097 119.585 99.110  1.00 6.29   ? 181 LYS A CA   1 
ATOM   2895  C  C    . LYS A  1 181 ? 109.145 120.484 97.888  1.00 6.29   ? 181 LYS A C    1 
ATOM   2896  O  O    . LYS A  1 181 ? 109.777 121.543 97.915  1.00 6.29   ? 181 LYS A O    1 
ATOM   2897  C  CB   . LYS A  1 181 ? 108.287 120.247 100.221 1.00 6.29   ? 181 LYS A CB   1 
ATOM   2898  C  CG   . LYS A  1 181 ? 106.794 120.218 100.007 1.00 6.29   ? 181 LYS A CG   1 
ATOM   2899  C  CD   . LYS A  1 181 ? 106.099 121.064 101.045 1.00 6.29   ? 181 LYS A CD   1 
ATOM   2900  C  CE   . LYS A  1 181 ? 104.618 121.177 100.766 1.00 6.29   ? 181 LYS A CE   1 
ATOM   2901  N  NZ   . LYS A  1 181 ? 104.359 121.747 99.416  1.00 6.29   ? 181 LYS A NZ   1 
ATOM   2902  H  H    . LYS A  1 181 ? 111.000 119.946 99.389  1.00 6.29   ? 181 LYS A H    1 
ATOM   2903  H  HA   . LYS A  1 181 ? 108.662 118.757 98.865  1.00 6.29   ? 181 LYS A HA   1 
ATOM   2904  H  HB2  . LYS A  1 181 ? 108.474 119.789 101.051 1.00 6.29   ? 181 LYS A HB2  1 
ATOM   2905  H  HB3  . LYS A  1 181 ? 108.556 121.174 100.286 1.00 6.29   ? 181 LYS A HB3  1 
ATOM   2906  H  HG2  . LYS A  1 181 ? 106.588 120.574 99.131  1.00 6.29   ? 181 LYS A HG2  1 
ATOM   2907  H  HG3  . LYS A  1 181 ? 106.472 119.308 100.086 1.00 6.29   ? 181 LYS A HG3  1 
ATOM   2908  H  HD2  . LYS A  1 181 ? 106.214 120.653 101.914 1.00 6.29   ? 181 LYS A HD2  1 
ATOM   2909  H  HD3  . LYS A  1 181 ? 106.481 121.953 101.039 1.00 6.29   ? 181 LYS A HD3  1 
ATOM   2910  H  HE2  . LYS A  1 181 ? 104.223 120.292 100.803 1.00 6.29   ? 181 LYS A HE2  1 
ATOM   2911  H  HE3  . LYS A  1 181 ? 104.213 121.756 101.430 1.00 6.29   ? 181 LYS A HE3  1 
ATOM   2912  H  HZ1  . LYS A  1 181 ? 103.646 122.280 99.439  1.00 6.29   ? 181 LYS A HZ1  1 
ATOM   2913  H  HZ2  . LYS A  1 181 ? 105.063 122.222 99.150  1.00 6.29   ? 181 LYS A HZ2  1 
ATOM   2914  H  HZ3  . LYS A  1 181 ? 104.217 121.093 98.831  1.00 6.29   ? 181 LYS A HZ3  1 
ATOM   2915  N  N    . ARG A  1 182 ? 108.488 120.048 96.820  1.00 8.47   ? 182 ARG A N    1 
ATOM   2916  C  CA   . ARG A  1 182 ? 108.298 120.868 95.638  1.00 8.47   ? 182 ARG A CA   1 
ATOM   2917  C  C    . ARG A  1 182 ? 107.004 121.654 95.779  1.00 8.47   ? 182 ARG A C    1 
ATOM   2918  O  O    . ARG A  1 182 ? 105.949 121.082 96.068  1.00 8.47   ? 182 ARG A O    1 
ATOM   2919  C  CB   . ARG A  1 182 ? 108.259 120.004 94.383  1.00 8.47   ? 182 ARG A CB   1 
ATOM   2920  C  CG   . ARG A  1 182 ? 108.267 120.783 93.097  1.00 8.47   ? 182 ARG A CG   1 
ATOM   2921  C  CD   . ARG A  1 182 ? 107.866 119.903 91.953  1.00 8.47   ? 182 ARG A CD   1 
ATOM   2922  N  NE   . ARG A  1 182 ? 107.875 120.606 90.678  1.00 8.47   ? 182 ARG A NE   1 
ATOM   2923  C  CZ   . ARG A  1 182 ? 106.798 121.100 90.082  1.00 8.47   ? 182 ARG A CZ   1 
ATOM   2924  N  NH1  . ARG A  1 182 ? 106.915 121.719 88.919  1.00 8.47   ? 182 ARG A NH1  1 
ATOM   2925  N  NH2  . ARG A  1 182 ? 105.604 120.988 90.644  1.00 8.47   ? 182 ARG A NH2  1 
ATOM   2926  H  H    . ARG A  1 182 ? 108.148 119.266 96.753  1.00 8.47   ? 182 ARG A H    1 
ATOM   2927  H  HA   . ARG A  1 182 ? 109.030 121.491 95.560  1.00 8.47   ? 182 ARG A HA   1 
ATOM   2928  H  HB2  . ARG A  1 182 ? 109.035 119.431 94.382  1.00 8.47   ? 182 ARG A HB2  1 
ATOM   2929  H  HB3  . ARG A  1 182 ? 107.452 119.476 94.400  1.00 8.47   ? 182 ARG A HB3  1 
ATOM   2930  H  HG2  . ARG A  1 182 ? 107.633 121.510 93.154  1.00 8.47   ? 182 ARG A HG2  1 
ATOM   2931  H  HG3  . ARG A  1 182 ? 109.159 121.113 92.926  1.00 8.47   ? 182 ARG A HG3  1 
ATOM   2932  H  HD2  . ARG A  1 182 ? 108.499 119.173 91.893  1.00 8.47   ? 182 ARG A HD2  1 
ATOM   2933  H  HD3  . ARG A  1 182 ? 106.981 119.556 92.116  1.00 8.47   ? 182 ARG A HD3  1 
ATOM   2934  H  HE   . ARG A  1 182 ? 108.627 120.689 90.276  1.00 8.47   ? 182 ARG A HE   1 
ATOM   2935  H  HH11 . ARG A  1 182 ? 107.686 121.794 88.552  1.00 8.47   ? 182 ARG A HH11 1 
ATOM   2936  H  HH12 . ARG A  1 182 ? 106.220 122.043 88.532  1.00 8.47   ? 182 ARG A HH12 1 
ATOM   2937  H  HH21 . ARG A  1 182 ? 105.516 120.589 91.399  1.00 8.47   ? 182 ARG A HH21 1 
ATOM   2938  H  HH22 . ARG A  1 182 ? 104.915 121.313 90.250  1.00 8.47   ? 182 ARG A HH22 1 
ATOM   2939  N  N    . SER A  1 183 ? 107.090 122.961 95.579  1.00 7.07   ? 183 SER A N    1 
ATOM   2940  C  CA   . SER A  1 183 ? 105.954 123.851 95.732  1.00 7.07   ? 183 SER A CA   1 
ATOM   2941  C  C    . SER A  1 183 ? 105.860 124.751 94.512  1.00 7.07   ? 183 SER A C    1 
ATOM   2942  O  O    . SER A  1 183 ? 106.801 124.862 93.727  1.00 7.07   ? 183 SER A O    1 
ATOM   2943  C  CB   . SER A  1 183 ? 106.068 124.685 97.011  1.00 7.07   ? 183 SER A CB   1 
ATOM   2944  O  OG   . SER A  1 183 ? 107.282 125.406 97.047  1.00 7.07   ? 183 SER A OG   1 
ATOM   2945  H  H    . SER A  1 183 ? 107.810 123.360 95.342  1.00 7.07   ? 183 SER A H    1 
ATOM   2946  H  HA   . SER A  1 183 ? 105.143 123.327 95.781  1.00 7.07   ? 183 SER A HA   1 
ATOM   2947  H  HB2  . SER A  1 183 ? 105.331 125.311 97.042  1.00 7.07   ? 183 SER A HB2  1 
ATOM   2948  H  HB3  . SER A  1 183 ? 106.033 124.089 97.773  1.00 7.07   ? 183 SER A HB3  1 
ATOM   2949  H  HG   . SER A  1 183 ? 107.290 125.933 97.699  1.00 7.07   ? 183 SER A HG   1 
ATOM   2950  N  N    . GLU A  1 184 ? 104.699 125.377 94.347  1.00 9.37   ? 184 GLU A N    1 
ATOM   2951  C  CA   . GLU A  1 184 ? 104.416 126.153 93.154  1.00 9.37   ? 184 GLU A CA   1 
ATOM   2952  C  C    . GLU A  1 184 ? 103.702 127.429 93.570  1.00 9.37   ? 184 GLU A C    1 
ATOM   2953  O  O    . GLU A  1 184 ? 102.913 127.430 94.518  1.00 9.37   ? 184 GLU A O    1 
ATOM   2954  C  CB   . GLU A  1 184 ? 103.567 125.338 92.171  1.00 9.37   ? 184 GLU A CB   1 
ATOM   2955  C  CG   . GLU A  1 184 ? 104.296 124.098 91.675  1.00 9.37   ? 184 GLU A CG   1 
ATOM   2956  C  CD   . GLU A  1 184 ? 103.951 123.660 90.271  1.00 9.37   ? 184 GLU A CD   1 
ATOM   2957  O  OE1  . GLU A  1 184 ? 104.016 124.474 89.339  1.00 9.37   ? 184 GLU A OE1  1 
ATOM   2958  O  OE2  . GLU A  1 184 ? 103.615 122.472 90.109  1.00 9.37   ? 184 GLU A OE2  1 
ATOM   2959  H  H    . GLU A  1 184 ? 104.056 125.361 94.915  1.00 9.37   ? 184 GLU A H    1 
ATOM   2960  H  HA   . GLU A  1 184 ? 105.247 126.400 92.710  1.00 9.37   ? 184 GLU A HA   1 
ATOM   2961  H  HB2  . GLU A  1 184 ? 102.747 125.071 92.604  1.00 9.37   ? 184 GLU A HB2  1 
ATOM   2962  H  HB3  . GLU A  1 184 ? 103.361 125.902 91.406  1.00 9.37   ? 184 GLU A HB3  1 
ATOM   2963  H  HG2  . GLU A  1 184 ? 105.245 124.262 91.723  1.00 9.37   ? 184 GLU A HG2  1 
ATOM   2964  H  HG3  . GLU A  1 184 ? 104.081 123.363 92.285  1.00 9.37   ? 184 GLU A HG3  1 
ATOM   2965  N  N    . ARG A  1 185 ? 103.982 128.517 92.856  1.00 14.00  ? 185 ARG A N    1 
ATOM   2966  C  CA   . ARG A  1 185 ? 103.419 129.821 93.166  1.00 14.00  ? 185 ARG A CA   1 
ATOM   2967  C  C    . ARG A  1 185 ? 102.837 130.446 91.912  1.00 14.00  ? 185 ARG A C    1 
ATOM   2968  O  O    . ARG A  1 185 ? 103.433 130.368 90.839  1.00 14.00  ? 185 ARG A O    1 
ATOM   2969  C  CB   . ARG A  1 185 ? 104.468 130.744 93.755  1.00 14.00  ? 185 ARG A CB   1 
ATOM   2970  C  CG   . ARG A  1 185 ? 103.898 131.873 94.560  1.00 14.00  ? 185 ARG A CG   1 
ATOM   2971  C  CD   . ARG A  1 185 ? 104.991 132.745 95.096  1.00 14.00  ? 185 ARG A CD   1 
ATOM   2972  N  NE   . ARG A  1 185 ? 105.396 132.332 96.432  1.00 14.00  ? 185 ARG A NE   1 
ATOM   2973  C  CZ   . ARG A  1 185 ? 105.743 133.162 97.409  1.00 14.00  ? 185 ARG A CZ   1 
ATOM   2974  N  NH1  . ARG A  1 185 ? 106.089 132.677 98.589  1.00 14.00  ? 185 ARG A NH1  1 
ATOM   2975  N  NH2  . ARG A  1 185 ? 105.761 134.470 97.209  1.00 14.00  ? 185 ARG A NH2  1 
ATOM   2976  H  H    . ARG A  1 185 ? 104.496 128.521 92.170  1.00 14.00  ? 185 ARG A H    1 
ATOM   2977  H  HA   . ARG A  1 185 ? 102.706 129.723 93.810  1.00 14.00  ? 185 ARG A HA   1 
ATOM   2978  H  HB2  . ARG A  1 185 ? 105.041 130.229 94.339  1.00 14.00  ? 185 ARG A HB2  1 
ATOM   2979  H  HB3  . ARG A  1 185 ? 104.980 131.127 93.034  1.00 14.00  ? 185 ARG A HB3  1 
ATOM   2980  H  HG2  . ARG A  1 185 ? 103.319 132.405 93.999  1.00 14.00  ? 185 ARG A HG2  1 
ATOM   2981  H  HG3  . ARG A  1 185 ? 103.408 131.510 95.310  1.00 14.00  ? 185 ARG A HG3  1 
ATOM   2982  H  HD2  . ARG A  1 185 ? 105.760 132.693 94.512  1.00 14.00  ? 185 ARG A HD2  1 
ATOM   2983  H  HD3  . ARG A  1 185 ? 104.658 133.651 95.135  1.00 14.00  ? 185 ARG A HD3  1 
ATOM   2984  H  HE   . ARG A  1 185 ? 105.375 131.494 96.610  1.00 14.00  ? 185 ARG A HE   1 
ATOM   2985  H  HH11 . ARG A  1 185 ? 106.081 131.829 98.719  1.00 14.00  ? 185 ARG A HH11 1 
ATOM   2986  H  HH12 . ARG A  1 185 ? 106.319 133.211 99.222  1.00 14.00  ? 185 ARG A HH12 1 
ATOM   2987  H  HH21 . ARG A  1 185 ? 105.539 134.795 96.449  1.00 14.00  ? 185 ARG A HH21 1 
ATOM   2988  H  HH22 . ARG A  1 185 ? 105.990 134.995 97.848  1.00 14.00  ? 185 ARG A HH22 1 
ATOM   2989  N  N    . PHE A  1 186 ? 101.585 130.931 91.977  1.00 21.10  ? 186 PHE A N    1 
ATOM   2990  C  CA   . PHE A  1 186 ? 100.851 131.503 90.826  1.00 21.10  ? 186 PHE A CA   1 
ATOM   2991  C  C    . PHE A  1 186 ? 100.870 133.016 90.969  1.00 21.10  ? 186 PHE A C    1 
ATOM   2992  O  O    . PHE A  1 186 ? 101.069 133.505 92.066  1.00 21.10  ? 186 PHE A O    1 
ATOM   2993  C  CB   . PHE A  1 186 ? 99.430  130.946 90.754  1.00 21.10  ? 186 PHE A CB   1 
ATOM   2994  C  CG   . PHE A  1 186 ? 99.356  129.446 90.710  1.00 21.10  ? 186 PHE A CG   1 
ATOM   2995  C  CD1  . PHE A  1 186 ? 99.469  128.705 91.867  1.00 21.10  ? 186 PHE A CD1  1 
ATOM   2996  C  CD2  . PHE A  1 186 ? 99.186  128.777 89.516  1.00 21.10  ? 186 PHE A CD2  1 
ATOM   2997  C  CE1  . PHE A  1 186 ? 99.411  127.325 91.833  1.00 21.10  ? 186 PHE A CE1  1 
ATOM   2998  C  CE2  . PHE A  1 186 ? 99.097  127.400 89.491  1.00 21.10  ? 186 PHE A CE2  1 
ATOM   2999  C  CZ   . PHE A  1 186 ? 99.236  126.676 90.642  1.00 21.10  ? 186 PHE A CZ   1 
ATOM   3000  H  H    . PHE A  1 186 ? 101.101 131.061 92.741  1.00 21.10  ? 186 PHE A H    1 
ATOM   3001  H  HA   . PHE A  1 186 ? 101.330 131.261 89.993  1.00 21.10  ? 186 PHE A HA   1 
ATOM   3002  H  HB2  . PHE A  1 186 ? 98.932  131.266 91.535  1.00 21.10  ? 186 PHE A HB2  1 
ATOM   3003  H  HB3  . PHE A  1 186 ? 98.996  131.308 89.953  1.00 21.10  ? 186 PHE A HB3  1 
ATOM   3004  H  HD1  . PHE A  1 186 ? 99.599  129.147 92.690  1.00 21.10  ? 186 PHE A HD1  1 
ATOM   3005  H  HD2  . PHE A  1 186 ? 99.094  129.269 88.716  1.00 21.10  ? 186 PHE A HD2  1 
ATOM   3006  H  HE1  . PHE A  1 186 ? 99.490  126.831 92.633  1.00 21.10  ? 186 PHE A HE1  1 
ATOM   3007  H  HE2  . PHE A  1 186 ? 98.986  126.954 88.666  1.00 21.10  ? 186 PHE A HE2  1 
ATOM   3008  H  HZ   . PHE A  1 186 ? 99.183  125.734 90.619  1.00 21.10  ? 186 PHE A HZ   1 
ATOM   3009  N  N    . TYR A  1 187 ? 100.717 133.729 89.866  1.00 19.18  ? 187 TYR A N    1 
ATOM   3010  C  CA   . TYR A  1 187 ? 100.800 135.203 89.835  1.00 19.18  ? 187 TYR A CA   1 
ATOM   3011  C  C    . TYR A  1 187 ? 99.682  135.754 88.956  1.00 19.18  ? 187 TYR A C    1 
ATOM   3012  O  O    . TYR A  1 187 ? 99.105  134.994 88.202  1.00 19.18  ? 187 TYR A O    1 
ATOM   3013  C  CB   . TYR A  1 187 ? 102.194 135.587 89.352  1.00 19.18  ? 187 TYR A CB   1 
ATOM   3014  C  CG   . TYR A  1 187 ? 103.320 135.317 90.316  1.00 19.18  ? 187 TYR A CG   1 
ATOM   3015  C  CD1  . TYR A  1 187 ? 104.010 134.124 90.317  1.00 19.18  ? 187 TYR A CD1  1 
ATOM   3016  C  CD2  . TYR A  1 187 ? 103.787 136.321 91.131  1.00 19.18  ? 187 TYR A CD2  1 
ATOM   3017  C  CE1  . TYR A  1 187 ? 105.059 133.899 91.183  1.00 19.18  ? 187 TYR A CE1  1 
ATOM   3018  C  CE2  . TYR A  1 187 ? 104.843 136.123 91.993  1.00 19.18  ? 187 TYR A CE2  1 
ATOM   3019  C  CZ   . TYR A  1 187 ? 105.480 134.906 92.020  1.00 19.18  ? 187 TYR A CZ   1 
ATOM   3020  O  OH   . TYR A  1 187 ? 106.512 134.714 92.877  1.00 19.18  ? 187 TYR A OH   1 
ATOM   3021  H  H    . TYR A  1 187 ? 100.604 133.364 89.039  1.00 19.18  ? 187 TYR A H    1 
ATOM   3022  H  HA   . TYR A  1 187 ? 100.675 135.547 90.755  1.00 19.18  ? 187 TYR A HA   1 
ATOM   3023  H  HB2  . TYR A  1 187 ? 102.373 135.101 88.520  1.00 19.18  ? 187 TYR A HB2  1 
ATOM   3024  H  HB3  . TYR A  1 187 ? 102.189 136.544 89.139  1.00 19.18  ? 187 TYR A HB3  1 
ATOM   3025  H  HD1  . TYR A  1 187 ? 103.719 133.424 89.756  1.00 19.18  ? 187 TYR A HD1  1 
ATOM   3026  H  HD2  . TYR A  1 187 ? 103.349 137.156 91.127  1.00 19.18  ? 187 TYR A HD2  1 
ATOM   3027  H  HE1  . TYR A  1 187 ? 105.494 133.062 91.195  1.00 19.18  ? 187 TYR A HE1  1 
ATOM   3028  H  HE2  . TYR A  1 187 ? 105.120 136.815 92.571  1.00 19.18  ? 187 TYR A HE2  1 
ATOM   3029  H  HH   . TYR A  1 187 ? 106.973 134.033 92.632  1.00 19.18  ? 187 TYR A HH   1 
ATOM   3030  N  N    . GLU A  1 188 ? 99.357  137.031 89.109  1.00 37.02  ? 188 GLU A N    1 
ATOM   3031  C  CA   . GLU A  1 188 ? 98.282  137.731 88.368  1.00 37.02  ? 188 GLU A CA   1 
ATOM   3032  C  C    . GLU A  1 188 ? 98.538  137.732 86.862  1.00 37.02  ? 188 GLU A C    1 
ATOM   3033  O  O    . GLU A  1 188 ? 97.576  137.575 86.125  1.00 37.02  ? 188 GLU A O    1 
ATOM   3034  C  CB   . GLU A  1 188 ? 98.223  139.191 88.798  1.00 37.02  ? 188 GLU A CB   1 
ATOM   3035  C  CG   . GLU A  1 188 ? 97.410  139.425 90.044  1.00 37.02  ? 188 GLU A CG   1 
ATOM   3036  C  CD   . GLU A  1 188 ? 96.893  140.845 90.149  1.00 37.02  ? 188 GLU A CD   1 
ATOM   3037  O  OE1  . GLU A  1 188 ? 95.785  141.108 89.652  1.00 37.02  ? 188 GLU A OE1  1 
ATOM   3038  O  OE2  . GLU A  1 188 ? 97.609  141.686 90.703  1.00 37.02  ? 188 GLU A OE2  1 
ATOM   3039  H  H    . GLU A  1 188 ? 99.706  137.533 89.783  1.00 37.02  ? 188 GLU A H    1 
ATOM   3040  H  HA   . GLU A  1 188 ? 97.419  137.295 88.557  1.00 37.02  ? 188 GLU A HA   1 
ATOM   3041  H  HB2  . GLU A  1 188 ? 99.138  139.508 88.951  1.00 37.02  ? 188 GLU A HB2  1 
ATOM   3042  H  HB3  . GLU A  1 188 ? 97.841  139.717 88.065  1.00 37.02  ? 188 GLU A HB3  1 
ATOM   3043  H  HG2  . GLU A  1 188 ? 96.645  138.810 90.053  1.00 37.02  ? 188 GLU A HG2  1 
ATOM   3044  H  HG3  . GLU A  1 188 ? 97.961  139.231 90.833  1.00 37.02  ? 188 GLU A HG3  1 
ATOM   3045  N  N    . CYS A  1 189 ? 99.788  137.850 86.416  1.00 36.91  ? 189 CYS A N    1 
ATOM   3046  C  CA   . CYS A  1 189 ? 100.062 138.004 84.961  1.00 36.91  ? 189 CYS A CA   1 
ATOM   3047  C  C    . CYS A  1 189 ? 99.496  136.851 84.136  1.00 36.91  ? 189 CYS A C    1 
ATOM   3048  O  O    . CYS A  1 189 ? 98.914  137.139 83.089  1.00 36.91  ? 189 CYS A O    1 
ATOM   3049  C  CB   . CYS A  1 189 ? 101.555 137.986 84.665  1.00 36.91  ? 189 CYS A CB   1 
ATOM   3050  S  SG   . CYS A  1 189 ? 102.408 136.474 85.198  1.00 36.91  ? 189 CYS A SG   1 
ATOM   3051  N  N    . CYS A  1 190 ? 99.648  135.605 84.578  1.00 36.21  ? 190 CYS A N    1 
ATOM   3052  C  CA   . CYS A  1 190 ? 99.167  134.488 83.733  1.00 36.21  ? 190 CYS A CA   1 
ATOM   3053  C  C    . CYS A  1 190 ? 98.972  133.226 84.572  1.00 36.21  ? 190 CYS A C    1 
ATOM   3054  O  O    . CYS A  1 190 ? 99.395  133.214 85.730  1.00 36.21  ? 190 CYS A O    1 
ATOM   3055  C  CB   . CYS A  1 190 ? 100.165 134.218 82.619  1.00 36.21  ? 190 CYS A CB   1 
ATOM   3056  S  SG   . CYS A  1 190 ? 101.579 133.258 83.201  1.00 36.21  ? 190 CYS A SG   1 
ATOM   3057  N  N    . LYS A  1 191 ? 98.354  132.210 83.963  1.00 34.55  ? 191 LYS A N    1 
ATOM   3058  C  CA   . LYS A  1 191 ? 98.019  130.870 84.504  1.00 34.55  ? 191 LYS A CA   1 
ATOM   3059  C  C    . LYS A  1 191 ? 99.260  130.005 84.777  1.00 34.55  ? 191 LYS A C    1 
ATOM   3060  O  O    . LYS A  1 191 ? 99.111  129.052 85.533  1.00 34.55  ? 191 LYS A O    1 
ATOM   3061  C  CB   . LYS A  1 191 ? 97.094  130.204 83.484  1.00 34.55  ? 191 LYS A CB   1 
ATOM   3062  C  CG   . LYS A  1 191 ? 96.085  129.222 84.047  1.00 34.55  ? 191 LYS A CG   1 
ATOM   3063  C  CD   . LYS A  1 191 ? 94.896  129.879 84.701  1.00 34.55  ? 191 LYS A CD   1 
ATOM   3064  C  CE   . LYS A  1 191 ? 93.777  128.888 84.929  1.00 34.55  ? 191 LYS A CE   1 
ATOM   3065  N  NZ   . LYS A  1 191 ? 92.624  129.519 85.604  1.00 34.55  ? 191 LYS A NZ   1 
ATOM   3066  H  H    . LYS A  1 191 ? 98.102  132.264 83.089  1.00 34.55  ? 191 LYS A H    1 
ATOM   3067  H  HA   . LYS A  1 191 ? 97.527  130.991 85.348  1.00 34.55  ? 191 LYS A HA   1 
ATOM   3068  H  HB2  . LYS A  1 191 ? 96.606  130.908 83.007  1.00 34.55  ? 191 LYS A HB2  1 
ATOM   3069  H  HB3  . LYS A  1 191 ? 97.650  129.733 82.828  1.00 34.55  ? 191 LYS A HB3  1 
ATOM   3070  H  HG2  . LYS A  1 191 ? 95.768  128.645 83.320  1.00 34.55  ? 191 LYS A HG2  1 
ATOM   3071  H  HG3  . LYS A  1 191 ? 96.535  128.652 84.706  1.00 34.55  ? 191 LYS A HG3  1 
ATOM   3072  H  HD2  . LYS A  1 191 ? 95.168  130.261 85.563  1.00 34.55  ? 191 LYS A HD2  1 
ATOM   3073  H  HD3  . LYS A  1 191 ? 94.571  130.607 84.130  1.00 34.55  ? 191 LYS A HD3  1 
ATOM   3074  H  HE2  . LYS A  1 191 ? 93.483  128.525 84.072  1.00 34.55  ? 191 LYS A HE2  1 
ATOM   3075  H  HE3  . LYS A  1 191 ? 94.101  128.148 85.476  1.00 34.55  ? 191 LYS A HE3  1 
ATOM   3076  H  HZ1  . LYS A  1 191 ? 92.045  128.880 85.884  1.00 34.55  ? 191 LYS A HZ1  1 
ATOM   3077  H  HZ2  . LYS A  1 191 ? 92.198  130.077 85.031  1.00 34.55  ? 191 LYS A HZ2  1 
ATOM   3078  H  HZ3  . LYS A  1 191 ? 92.912  129.992 86.323  1.00 34.55  ? 191 LYS A HZ3  1 
ATOM   3079  N  N    . GLU A  1 192 ? 100.407 130.264 84.137  1.00 16.01  ? 192 GLU A N    1 
ATOM   3080  C  CA   . GLU A  1 192 ? 101.651 129.459 84.284  1.00 16.01  ? 192 GLU A CA   1 
ATOM   3081  C  C    . GLU A  1 192 ? 102.160 129.493 85.722  1.00 16.01  ? 192 GLU A C    1 
ATOM   3082  O  O    . GLU A  1 192 ? 102.254 130.579 86.279  1.00 16.01  ? 192 GLU A O    1 
ATOM   3083  C  CB   . GLU A  1 192 ? 102.751 129.982 83.368  1.00 16.01  ? 192 GLU A CB   1 
ATOM   3084  C  CG   . GLU A  1 192 ? 104.146 129.546 83.747  1.00 16.01  ? 192 GLU A CG   1 
ATOM   3085  C  CD   . GLU A  1 192 ? 105.184 130.164 82.836  1.00 16.01  ? 192 GLU A CD   1 
ATOM   3086  O  OE1  . GLU A  1 192 ? 105.392 131.368 82.935  1.00 16.01  ? 192 GLU A OE1  1 
ATOM   3087  O  OE2  . GLU A  1 192 ? 105.745 129.449 82.001  1.00 16.01  ? 192 GLU A OE2  1 
ATOM   3088  H  H    . GLU A  1 192 ? 100.525 130.992 83.612  1.00 16.01  ? 192 GLU A H    1 
ATOM   3089  H  HA   . GLU A  1 192 ? 101.445 128.547 84.022  1.00 16.01  ? 192 GLU A HA   1 
ATOM   3090  H  HB2  . GLU A  1 192 ? 102.563 129.681 82.455  1.00 16.01  ? 192 GLU A HB2  1 
ATOM   3091  H  HB3  . GLU A  1 192 ? 102.716 130.962 83.372  1.00 16.01  ? 192 GLU A HB3  1 
ATOM   3092  H  HG2  . GLU A  1 192 ? 104.334 129.812 84.672  1.00 16.01  ? 192 GLU A HG2  1 
ATOM   3093  H  HG3  . GLU A  1 192 ? 104.211 128.569 83.690  1.00 16.01  ? 192 GLU A HG3  1 
ATOM   3094  N  N    . PRO A  1 193 ? 102.539 128.355 86.329  1.00 11.34  ? 193 PRO A N    1 
ATOM   3095  C  CA   . PRO A  1 193 ? 103.047 128.341 87.706  1.00 11.34  ? 193 PRO A CA   1 
ATOM   3096  C  C    . PRO A  1 193 ? 104.571 128.411 87.874  1.00 11.34  ? 193 PRO A C    1 
ATOM   3097  O  O    . PRO A  1 193 ? 105.243 127.971 87.002  1.00 11.34  ? 193 PRO A O    1 
ATOM   3098  C  CB   . PRO A  1 193 ? 102.544 126.961 88.052  1.00 11.34  ? 193 PRO A CB   1 
ATOM   3099  C  CG   . PRO A  1 193 ? 102.955 126.171 86.871  1.00 11.34  ? 193 PRO A CG   1 
ATOM   3100  C  CD   . PRO A  1 193 ? 102.403 127.010 85.768  1.00 11.34  ? 193 PRO A CD   1 
ATOM   3101  H  HA   . PRO A  1 193 ? 102.589 129.027 88.254  1.00 11.34  ? 193 PRO A HA   1 
ATOM   3102  H  HB2  . PRO A  1 193 ? 102.957 126.621 88.874  1.00 11.34  ? 193 PRO A HB2  1 
ATOM   3103  H  HB3  . PRO A  1 193 ? 101.591 126.950 88.143  1.00 11.34  ? 193 PRO A HB3  1 
ATOM   3104  H  HG2  . PRO A  1 193 ? 103.929 126.094 86.810  1.00 11.34  ? 193 PRO A HG2  1 
ATOM   3105  H  HG3  . PRO A  1 193 ? 102.554 125.278 86.878  1.00 11.34  ? 193 PRO A HG3  1 
ATOM   3106  H  HD2  . PRO A  1 193 ? 102.919 126.904 84.948  1.00 11.34  ? 193 PRO A HD2  1 
ATOM   3107  H  HD3  . PRO A  1 193 ? 101.470 126.775 85.607  1.00 11.34  ? 193 PRO A HD3  1 
ATOM   3108  N  N    . TYR A  1 194 ? 105.084 128.925 88.990  1.00 10.95  ? 194 TYR A N    1 
ATOM   3109  C  CA   . TYR A  1 194 ? 106.510 129.110 89.192  1.00 10.95  ? 194 TYR A CA   1 
ATOM   3110  C  C    . TYR A  1 194 ? 106.956 128.167 90.297  1.00 10.95  ? 194 TYR A C    1 
ATOM   3111  O  O    . TYR A  1 194 ? 106.535 128.339 91.451  1.00 10.95  ? 194 TYR A O    1 
ATOM   3112  C  CB   . TYR A  1 194 ? 106.815 130.560 89.554  1.00 10.95  ? 194 TYR A CB   1 
ATOM   3113  C  CG   . TYR A  1 194 ? 106.778 131.482 88.364  1.00 10.95  ? 194 TYR A CG   1 
ATOM   3114  C  CD1  . TYR A  1 194 ? 105.583 131.800 87.743  1.00 10.95  ? 194 TYR A CD1  1 
ATOM   3115  C  CD2  . TYR A  1 194 ? 107.937 132.019 87.848  1.00 10.95  ? 194 TYR A CD2  1 
ATOM   3116  C  CE1  . TYR A  1 194 ? 105.549 132.632 86.656  1.00 10.95  ? 194 TYR A CE1  1 
ATOM   3117  C  CE2  . TYR A  1 194 ? 107.910 132.853 86.760  1.00 10.95  ? 194 TYR A CE2  1 
ATOM   3118  C  CZ   . TYR A  1 194 ? 106.715 133.157 86.167  1.00 10.95  ? 194 TYR A CZ   1 
ATOM   3119  O  OH   . TYR A  1 194 ? 106.693 133.990 85.078  1.00 10.95  ? 194 TYR A OH   1 
ATOM   3120  H  H    . TYR A  1 194 ? 104.609 129.187 89.651  1.00 10.95  ? 194 TYR A H    1 
ATOM   3121  H  HA   . TYR A  1 194 ? 106.976 128.906 88.376  1.00 10.95  ? 194 TYR A HA   1 
ATOM   3122  H  HB2  . TYR A  1 194 ? 106.152 130.867 90.187  1.00 10.95  ? 194 TYR A HB2  1 
ATOM   3123  H  HB3  . TYR A  1 194 ? 107.696 130.607 89.945  1.00 10.95  ? 194 TYR A HB3  1 
ATOM   3124  H  HD1  . TYR A  1 194 ? 104.791 131.448 88.069  1.00 10.95  ? 194 TYR A HD1  1 
ATOM   3125  H  HD2  . TYR A  1 194 ? 108.746 131.814 88.251  1.00 10.95  ? 194 TYR A HD2  1 
ATOM   3126  H  HE1  . TYR A  1 194 ? 104.740 132.838 86.253  1.00 10.95  ? 194 TYR A HE1  1 
ATOM   3127  H  HE2  . TYR A  1 194 ? 108.695 133.212 86.426  1.00 10.95  ? 194 TYR A HE2  1 
ATOM   3128  H  HH   . TYR A  1 194 ? 105.967 133.900 84.669  1.00 10.95  ? 194 TYR A HH   1 
ATOM   3129  N  N    . PRO A  1 195 ? 107.749 127.144 90.002  1.00 9.50   ? 195 PRO A N    1 
ATOM   3130  C  CA   . PRO A  1 195 ? 108.052 126.123 91.002  1.00 9.50   ? 195 PRO A CA   1 
ATOM   3131  C  C    . PRO A  1 195 ? 109.296 126.429 91.827  1.00 9.50   ? 195 PRO A C    1 
ATOM   3132  O  O    . PRO A  1 195 ? 110.078 127.333 91.529  1.00 9.50   ? 195 PRO A O    1 
ATOM   3133  C  CB   . PRO A  1 195 ? 108.266 124.872 90.152  1.00 9.50   ? 195 PRO A CB   1 
ATOM   3134  C  CG   . PRO A  1 195 ? 108.788 125.378 88.893  1.00 9.50   ? 195 PRO A CG   1 
ATOM   3135  C  CD   . PRO A  1 195 ? 108.165 126.712 88.658  1.00 9.50   ? 195 PRO A CD   1 
ATOM   3136  H  HA   . PRO A  1 195 ? 107.299 125.991 91.590  1.00 9.50   ? 195 PRO A HA   1 
ATOM   3137  H  HB2  . PRO A  1 195 ? 108.907 124.298 90.591  1.00 9.50   ? 195 PRO A HB2  1 
ATOM   3138  H  HB3  . PRO A  1 195 ? 107.422 124.421 90.019  1.00 9.50   ? 195 PRO A HB3  1 
ATOM   3139  H  HG2  . PRO A  1 195 ? 109.748 125.461 88.957  1.00 9.50   ? 195 PRO A HG2  1 
ATOM   3140  H  HG3  . PRO A  1 195 ? 108.545 124.769 88.182  1.00 9.50   ? 195 PRO A HG3  1 
ATOM   3141  H  HD2  . PRO A  1 195 ? 108.820 127.321 88.291  1.00 9.50   ? 195 PRO A HD2  1 
ATOM   3142  H  HD3  . PRO A  1 195 ? 107.394 126.623 88.082  1.00 9.50   ? 195 PRO A HD3  1 
ATOM   3143  N  N    . ASP A  1 196 ? 109.458 125.636 92.878  1.00 10.16  ? 196 ASP A N    1 
ATOM   3144  C  CA   . ASP A  1 196 ? 110.569 125.775 93.802  1.00 10.16  ? 196 ASP A CA   1 
ATOM   3145  C  C    . ASP A  1 196 ? 110.714 124.478 94.577  1.00 10.16  ? 196 ASP A C    1 
ATOM   3146  O  O    . ASP A  1 196 ? 109.778 123.682 94.675  1.00 10.16  ? 196 ASP A O    1 
ATOM   3147  C  CB   . ASP A  1 196 ? 110.370 126.964 94.743  1.00 10.16  ? 196 ASP A CB   1 
ATOM   3148  C  CG   . ASP A  1 196 ? 109.183 126.789 95.667  1.00 10.16  ? 196 ASP A CG   1 
ATOM   3149  O  OD1  . ASP A  1 196 ? 108.551 125.715 95.643  1.00 10.16  ? 196 ASP A OD1  1 
ATOM   3150  O  OD2  . ASP A  1 196 ? 108.863 127.734 96.414  1.00 10.16  ? 196 ASP A OD2  1 
ATOM   3151  H  H    . ASP A  1 196 ? 108.933 124.986 93.068  1.00 10.16  ? 196 ASP A H    1 
ATOM   3152  H  HA   . ASP A  1 196 ? 111.383 125.920 93.302  1.00 10.16  ? 196 ASP A HA   1 
ATOM   3153  H  HB2  . ASP A  1 196 ? 111.159 127.050 95.297  1.00 10.16  ? 196 ASP A HB2  1 
ATOM   3154  H  HB3  . ASP A  1 196 ? 110.236 127.765 94.219  1.00 10.16  ? 196 ASP A HB3  1 
ATOM   3155  N  N    . VAL A  1 197 ? 111.902 124.288 95.139  1.00 9.28   ? 197 VAL A N    1 
ATOM   3156  C  CA   . VAL A  1 197 ? 112.253 123.085 95.878  1.00 9.28   ? 197 VAL A CA   1 
ATOM   3157  C  C    . VAL A  1 197 ? 112.836 123.517 97.210  1.00 9.28   ? 197 VAL A C    1 
ATOM   3158  O  O    . VAL A  1 197 ? 113.822 124.260 97.248  1.00 9.28   ? 197 VAL A O    1 
ATOM   3159  C  CB   . VAL A  1 197 ? 113.249 122.211 95.106  1.00 9.28   ? 197 VAL A CB   1 
ATOM   3160  C  CG1  . VAL A  1 197 ? 113.534 120.957 95.859  1.00 9.28   ? 197 VAL A CG1  1 
ATOM   3161  C  CG2  . VAL A  1 197 ? 112.696 121.875 93.755  1.00 9.28   ? 197 VAL A CG2  1 
ATOM   3162  H  H    . VAL A  1 197 ? 112.533 124.866 95.111  1.00 9.28   ? 197 VAL A H    1 
ATOM   3163  H  HA   . VAL A  1 197 ? 111.460 122.564 96.045  1.00 9.28   ? 197 VAL A HA   1 
ATOM   3164  H  HB   . VAL A  1 197 ? 114.079 122.689 94.988  1.00 9.28   ? 197 VAL A HB   1 
ATOM   3165  H  HG11 . VAL A  1 197 ? 114.198 120.452 95.370  1.00 9.28   ? 197 VAL A HG11 1 
ATOM   3166  H  HG12 . VAL A  1 197 ? 113.871 121.184 96.735  1.00 9.28   ? 197 VAL A HG12 1 
ATOM   3167  H  HG13 . VAL A  1 197 ? 112.717 120.448 95.934  1.00 9.28   ? 197 VAL A HG13 1 
ATOM   3168  H  HG21 . VAL A  1 197 ? 113.269 121.217 93.339  1.00 9.28   ? 197 VAL A HG21 1 
ATOM   3169  H  HG22 . VAL A  1 197 ? 111.808 121.512 93.872  1.00 9.28   ? 197 VAL A HG22 1 
ATOM   3170  H  HG23 . VAL A  1 197 ? 112.658 122.679 93.220  1.00 9.28   ? 197 VAL A HG23 1 
ATOM   3171  N  N    . THR A  1 198 ? 112.244 123.048 98.297  1.00 9.04   ? 198 THR A N    1 
ATOM   3172  C  CA   . THR A  1 198 ? 112.642 123.460 99.630  1.00 9.04   ? 198 THR A CA   1 
ATOM   3173  C  C    . THR A  1 198 ? 113.088 122.244 100.421 1.00 9.04   ? 198 THR A C    1 
ATOM   3174  O  O    . THR A  1 198 ? 112.352 121.260 100.519 1.00 9.04   ? 198 THR A O    1 
ATOM   3175  C  CB   . THR A  1 198 ? 111.495 124.165 100.341 1.00 9.04   ? 198 THR A CB   1 
ATOM   3176  O  OG1  . THR A  1 198 ? 110.897 125.116 99.454  1.00 9.04   ? 198 THR A OG1  1 
ATOM   3177  C  CG2  . THR A  1 198 ? 111.999 124.882 101.549 1.00 9.04   ? 198 THR A CG2  1 
ATOM   3178  H  H    . THR A  1 198 ? 111.602 122.481 98.287  1.00 9.04   ? 198 THR A H    1 
ATOM   3179  H  HA   . THR A  1 198 ? 113.384 124.070 99.563  1.00 9.04   ? 198 THR A HA   1 
ATOM   3180  H  HB   . THR A  1 198 ? 110.837 123.515 100.617 1.00 9.04   ? 198 THR A HB   1 
ATOM   3181  H  HG1  . THR A  1 198 ? 110.499 125.703 99.899  1.00 9.04   ? 198 THR A HG1  1 
ATOM   3182  H  HG21 . THR A  1 198 ? 111.258 125.262 102.040 1.00 9.04   ? 198 THR A HG21 1 
ATOM   3183  H  HG22 . THR A  1 198 ? 112.480 124.266 102.117 1.00 9.04   ? 198 THR A HG22 1 
ATOM   3184  H  HG23 . THR A  1 198 ? 112.593 125.591 101.274 1.00 9.04   ? 198 THR A HG23 1 
ATOM   3185  N  N    . PHE A  1 199 ? 114.288 122.320 100.986 1.00 9.33   ? 199 PHE A N    1 
ATOM   3186  C  CA   . PHE A  1 199 ? 114.840 121.265 101.823 1.00 9.33   ? 199 PHE A CA   1 
ATOM   3187  C  C    . PHE A  1 199 ? 114.917 121.790 103.246 1.00 9.33   ? 199 PHE A C    1 
ATOM   3188  O  O    . PHE A  1 199 ? 115.517 122.839 103.489 1.00 9.33   ? 199 PHE A O    1 
ATOM   3189  C  CB   . PHE A  1 199 ? 116.219 120.828 101.337 1.00 9.33   ? 199 PHE A CB   1 
ATOM   3190  C  CG   . PHE A  1 199 ? 116.194 120.057 100.057 1.00 9.33   ? 199 PHE A CG   1 
ATOM   3191  C  CD1  . PHE A  1 199 ? 115.968 118.700 100.057 1.00 9.33   ? 199 PHE A CD1  1 
ATOM   3192  C  CD2  . PHE A  1 199 ? 116.413 120.687 98.854  1.00 9.33   ? 199 PHE A CD2  1 
ATOM   3193  C  CE1  . PHE A  1 199 ? 115.948 117.993 98.883  1.00 9.33   ? 199 PHE A CE1  1 
ATOM   3194  C  CE2  . PHE A  1 199 ? 116.393 119.981 97.681  1.00 9.33   ? 199 PHE A CE2  1 
ATOM   3195  C  CZ   . PHE A  1 199 ? 116.161 118.632 97.698  1.00 9.33   ? 199 PHE A CZ   1 
ATOM   3196  H  H    . PHE A  1 199 ? 114.808 122.994 100.905 1.00 9.33   ? 199 PHE A H    1 
ATOM   3197  H  HA   . PHE A  1 199 ? 114.252 120.500 101.812 1.00 9.33   ? 199 PHE A HA   1 
ATOM   3198  H  HB2  . PHE A  1 199 ? 116.762 121.613 101.197 1.00 9.33   ? 199 PHE A HB2  1 
ATOM   3199  H  HB3  . PHE A  1 199 ? 116.619 120.264 102.012 1.00 9.33   ? 199 PHE A HB3  1 
ATOM   3200  H  HD1  . PHE A  1 199 ? 115.822 118.262 100.859 1.00 9.33   ? 199 PHE A HD1  1 
ATOM   3201  H  HD2  . PHE A  1 199 ? 116.571 121.599 98.839  1.00 9.33   ? 199 PHE A HD2  1 
ATOM   3202  H  HE1  . PHE A  1 199 ? 115.791 117.080 98.892  1.00 9.33   ? 199 PHE A HE1  1 
ATOM   3203  H  HE2  . PHE A  1 199 ? 116.539 120.416 96.877  1.00 9.33   ? 199 PHE A HE2  1 
ATOM   3204  H  HZ   . PHE A  1 199 ? 116.148 118.150 96.907  1.00 9.33   ? 199 PHE A HZ   1 
ATOM   3205  N  N    . THR A  1 200 ? 114.318 121.066 104.178 1.00 14.29  ? 200 THR A N    1 
ATOM   3206  C  CA   . THR A  1 200 ? 114.158 121.537 105.547 1.00 14.29  ? 200 THR A CA   1 
ATOM   3207  C  C    . THR A  1 200 ? 115.095 120.744 106.450 1.00 14.29  ? 200 THR A C    1 
ATOM   3208  O  O    . THR A  1 200 ? 114.789 119.616 106.839 1.00 14.29  ? 200 THR A O    1 
ATOM   3209  C  CB   . THR A  1 200 ? 112.709 121.399 105.991 1.00 14.29  ? 200 THR A CB   1 
ATOM   3210  O  OG1  . THR A  1 200 ? 111.853 122.029 105.031 1.00 14.29  ? 200 THR A OG1  1 
ATOM   3211  C  CG2  . THR A  1 200 ? 112.509 122.055 107.327 1.00 14.29  ? 200 THR A CG2  1 
ATOM   3212  H  H    . THR A  1 200 ? 113.990 120.285 104.043 1.00 14.29  ? 200 THR A H    1 
ATOM   3213  H  HA   . THR A  1 200 ? 114.402 122.469 105.598 1.00 14.29  ? 200 THR A HA   1 
ATOM   3214  H  HB   . THR A  1 200 ? 112.482 120.463 106.065 1.00 14.29  ? 200 THR A HB   1 
ATOM   3215  H  HG1  . THR A  1 200 ? 111.058 121.992 105.293 1.00 14.29  ? 200 THR A HG1  1 
ATOM   3216  H  HG21 . THR A  1 200 ? 111.588 121.959 107.605 1.00 14.29  ? 200 THR A HG21 1 
ATOM   3217  H  HG22 . THR A  1 200 ? 113.086 121.643 107.985 1.00 14.29  ? 200 THR A HG22 1 
ATOM   3218  H  HG23 . THR A  1 200 ? 112.724 122.996 107.262 1.00 14.29  ? 200 THR A HG23 1 
ATOM   3219  N  N    . VAL A  1 201 ? 116.233 121.340 106.788 1.00 16.42  ? 201 VAL A N    1 
ATOM   3220  C  CA   . VAL A  1 201 ? 117.197 120.711 107.678 1.00 16.42  ? 201 VAL A CA   1 
ATOM   3221  C  C    . VAL A  1 201 ? 116.669 120.815 109.100 1.00 16.42  ? 201 VAL A C    1 
ATOM   3222  O  O    . VAL A  1 201 ? 116.470 121.919 109.620 1.00 16.42  ? 201 VAL A O    1 
ATOM   3223  C  CB   . VAL A  1 201 ? 118.572 121.376 107.555 1.00 16.42  ? 201 VAL A CB   1 
ATOM   3224  C  CG1  . VAL A  1 201 ? 119.542 120.759 108.520 1.00 16.42  ? 201 VAL A CG1  1 
ATOM   3225  C  CG2  . VAL A  1 201 ? 119.088 121.266 106.150 1.00 16.42  ? 201 VAL A CG2  1 
ATOM   3226  H  H    . VAL A  1 201 ? 116.468 122.119 106.519 1.00 16.42  ? 201 VAL A H    1 
ATOM   3227  H  HA   . VAL A  1 201 ? 117.285 119.776 107.451 1.00 16.42  ? 201 VAL A HA   1 
ATOM   3228  H  HB   . VAL A  1 201 ? 118.484 122.314 107.772 1.00 16.42  ? 201 VAL A HB   1 
ATOM   3229  H  HG11 . VAL A  1 201 ? 120.436 121.051 108.291 1.00 16.42  ? 201 VAL A HG11 1 
ATOM   3230  H  HG12 . VAL A  1 201 ? 119.318 121.049 109.415 1.00 16.42  ? 201 VAL A HG12 1 
ATOM   3231  H  HG13 . VAL A  1 201 ? 119.477 119.796 108.451 1.00 16.42  ? 201 VAL A HG13 1 
ATOM   3232  H  HG21 . VAL A  1 201 ? 119.982 121.637 106.113 1.00 16.42  ? 201 VAL A HG21 1 
ATOM   3233  H  HG22 . VAL A  1 201 ? 119.105 120.332 105.903 1.00 16.42  ? 201 VAL A HG22 1 
ATOM   3234  H  HG23 . VAL A  1 201 ? 118.499 121.759 105.561 1.00 16.42  ? 201 VAL A HG23 1 
ATOM   3235  N  N    . THR A  1 202 ? 116.447 119.669 109.734 1.00 20.88  ? 202 THR A N    1 
ATOM   3236  C  CA   . THR A  1 202 ? 115.965 119.605 111.103 1.00 20.88  ? 202 THR A CA   1 
ATOM   3237  C  C    . THR A  1 202 ? 117.084 119.085 111.986 1.00 20.88  ? 202 THR A C    1 
ATOM   3238  O  O    . THR A  1 202 ? 117.717 118.078 111.657 1.00 20.88  ? 202 THR A O    1 
ATOM   3239  C  CB   . THR A  1 202 ? 114.748 118.693 111.211 1.00 20.88  ? 202 THR A CB   1 
ATOM   3240  O  OG1  . THR A  1 202 ? 113.786 119.052 110.213 1.00 20.88  ? 202 THR A OG1  1 
ATOM   3241  C  CG2  . THR A  1 202 ? 114.130 118.816 112.578 1.00 20.88  ? 202 THR A CG2  1 
ATOM   3242  H  H    . THR A  1 202 ? 116.582 118.897 109.386 1.00 20.88  ? 202 THR A H    1 
ATOM   3243  H  HA   . THR A  1 202 ? 115.716 120.487 111.410 1.00 20.88  ? 202 THR A HA   1 
ATOM   3244  H  HB   . THR A  1 202 ? 115.027 117.777 111.079 1.00 20.88  ? 202 THR A HB   1 
ATOM   3245  H  HG1  . THR A  1 202 ? 113.391 118.363 109.939 1.00 20.88  ? 202 THR A HG1  1 
ATOM   3246  H  HG21 . THR A  1 202 ? 113.339 118.261 112.636 1.00 20.88  ? 202 THR A HG21 1 
ATOM   3247  H  HG22 . THR A  1 202 ? 114.767 118.535 113.251 1.00 20.88  ? 202 THR A HG22 1 
ATOM   3248  H  HG23 . THR A  1 202 ? 113.890 119.740 112.739 1.00 20.88  ? 202 THR A HG23 1 
ATOM   3249  N  N    . MET A  1 203 ? 117.335 119.768 113.098 1.00 26.57  ? 203 MET A N    1 
ATOM   3250  C  CA   . MET A  1 203 ? 118.427 119.344 113.959 1.00 26.57  ? 203 MET A CA   1 
ATOM   3251  C  C    . MET A  1 203 ? 118.152 119.726 115.403 1.00 26.57  ? 203 MET A C    1 
ATOM   3252  O  O    . MET A  1 203 ? 117.507 120.737 115.688 1.00 26.57  ? 203 MET A O    1 
ATOM   3253  C  CB   . MET A  1 203 ? 119.752 119.949 113.505 1.00 26.57  ? 203 MET A CB   1 
ATOM   3254  C  CG   . MET A  1 203 ? 119.694 121.424 113.289 1.00 26.57  ? 203 MET A CG   1 
ATOM   3255  S  SD   . MET A  1 203 ? 120.982 122.020 112.204 1.00 26.57  ? 203 MET A SD   1 
ATOM   3256  C  CE   . MET A  1 203 ? 120.508 123.730 112.192 1.00 26.57  ? 203 MET A CE   1 
ATOM   3257  H  H    . MET A  1 203 ? 116.907 120.461 113.364 1.00 26.57  ? 203 MET A H    1 
ATOM   3258  H  HA   . MET A  1 203 ? 118.510 118.384 113.903 1.00 26.57  ? 203 MET A HA   1 
ATOM   3259  H  HB2  . MET A  1 203 ? 120.418 119.777 114.185 1.00 26.57  ? 203 MET A HB2  1 
ATOM   3260  H  HB3  . MET A  1 203 ? 120.011 119.538 112.668 1.00 26.57  ? 203 MET A HB3  1 
ATOM   3261  H  HG2  . MET A  1 203 ? 118.845 121.663 112.895 1.00 26.57  ? 203 MET A HG2  1 
ATOM   3262  H  HG3  . MET A  1 203 ? 119.800 121.867 114.142 1.00 26.57  ? 203 MET A HG3  1 
ATOM   3263  H  HE1  . MET A  1 203 ? 121.121 124.221 111.633 1.00 26.57  ? 203 MET A HE1  1 
ATOM   3264  H  HE2  . MET A  1 203 ? 119.604 123.791 111.847 1.00 26.57  ? 203 MET A HE2  1 
ATOM   3265  H  HE3  . MET A  1 203 ? 120.537 124.066 113.099 1.00 26.57  ? 203 MET A HE3  1 
ATOM   3266  N  N    . ARG A  1 204 ? 118.676 118.909 116.312 1.00 38.73  ? 204 ARG A N    1 
ATOM   3267  C  CA   . ARG A  1 204 ? 118.524 119.107 117.743 1.00 38.73  ? 204 ARG A CA   1 
ATOM   3268  C  C    . ARG A  1 204 ? 119.893 119.238 118.389 1.00 38.73  ? 204 ARG A C    1 
ATOM   3269  O  O    . ARG A  1 204 ? 120.844 118.556 117.999 1.00 38.73  ? 204 ARG A O    1 
ATOM   3270  C  CB   . ARG A  1 204 ? 117.746 117.957 118.385 1.00 38.73  ? 204 ARG A CB   1 
ATOM   3271  C  CG   . ARG A  1 204 ? 118.394 116.606 118.275 1.00 38.73  ? 204 ARG A CG   1 
ATOM   3272  C  CD   . ARG A  1 204 ? 117.958 115.711 119.411 1.00 38.73  ? 204 ARG A CD   1 
ATOM   3273  N  NE   . ARG A  1 204 ? 118.771 115.911 120.605 1.00 38.73  ? 204 ARG A NE   1 
ATOM   3274  C  CZ   . ARG A  1 204 ? 119.887 115.242 120.876 1.00 38.73  ? 204 ARG A CZ   1 
ATOM   3275  N  NH1  . ARG A  1 204 ? 120.556 115.497 121.989 1.00 38.73  ? 204 ARG A NH1  1 
ATOM   3276  N  NH2  . ARG A  1 204 ? 120.340 114.322 120.038 1.00 38.73  ? 204 ARG A NH2  1 
ATOM   3277  H  H    . ARG A  1 204 ? 119.145 118.219 116.115 1.00 38.73  ? 204 ARG A H    1 
ATOM   3278  H  HA   . ARG A  1 204 ? 118.042 119.929 117.901 1.00 38.73  ? 204 ARG A HA   1 
ATOM   3279  H  HB2  . ARG A  1 204 ? 117.639 118.144 119.328 1.00 38.73  ? 204 ARG A HB2  1 
ATOM   3280  H  HB3  . ARG A  1 204 ? 116.882 117.889 117.959 1.00 38.73  ? 204 ARG A HB3  1 
ATOM   3281  H  HG2  . ARG A  1 204 ? 118.129 116.193 117.440 1.00 38.73  ? 204 ARG A HG2  1 
ATOM   3282  H  HG3  . ARG A  1 204 ? 119.355 116.701 118.319 1.00 38.73  ? 204 ARG A HG3  1 
ATOM   3283  H  HD2  . ARG A  1 204 ? 117.042 115.931 119.637 1.00 38.73  ? 204 ARG A HD2  1 
ATOM   3284  H  HD3  . ARG A  1 204 ? 118.021 114.785 119.137 1.00 38.73  ? 204 ARG A HD3  1 
ATOM   3285  H  HE   . ARG A  1 204 ? 118.591 116.594 121.093 1.00 38.73  ? 204 ARG A HE   1 
ATOM   3286  H  HH11 . ARG A  1 204 ? 120.269 116.093 122.535 1.00 38.73  ? 204 ARG A HH11 1 
ATOM   3287  H  HH12 . ARG A  1 204 ? 121.279 115.066 122.164 1.00 38.73  ? 204 ARG A HH12 1 
ATOM   3288  H  HH21 . ARG A  1 204 ? 119.914 114.149 119.313 1.00 38.73  ? 204 ARG A HH21 1 
ATOM   3289  H  HH22 . ARG A  1 204 ? 121.063 113.897 120.222 1.00 38.73  ? 204 ARG A HH22 1 
ATOM   3290  N  N    . ARG A  1 205 ? 119.983 120.120 119.375 1.00 40.50  ? 205 ARG A N    1 
ATOM   3291  C  CA   . ARG A  1 205 ? 121.246 120.386 120.033 1.00 40.50  ? 205 ARG A CA   1 
ATOM   3292  C  C    . ARG A  1 205 ? 121.644 119.237 120.950 1.00 40.50  ? 205 ARG A C    1 
ATOM   3293  O  O    . ARG A  1 205 ? 120.819 118.436 121.395 1.00 40.50  ? 205 ARG A O    1 
ATOM   3294  C  CB   . ARG A  1 205 ? 121.166 121.679 120.832 1.00 40.50  ? 205 ARG A CB   1 
ATOM   3295  C  CG   . ARG A  1 205 ? 122.510 122.298 121.073 1.00 40.50  ? 205 ARG A CG   1 
ATOM   3296  C  CD   . ARG A  1 205 ? 122.412 123.615 121.786 1.00 40.50  ? 205 ARG A CD   1 
ATOM   3297  N  NE   . ARG A  1 205 ? 121.536 124.557 121.098 1.00 40.50  ? 205 ARG A NE   1 
ATOM   3298  C  CZ   . ARG A  1 205 ? 121.863 125.809 120.791 1.00 40.50  ? 205 ARG A CZ   1 
ATOM   3299  N  NH1  . ARG A  1 205 ? 123.063 126.289 121.082 1.00 40.50  ? 205 ARG A NH1  1 
ATOM   3300  N  NH2  . ARG A  1 205 ? 120.988 126.584 120.171 1.00 40.50  ? 205 ARG A NH2  1 
ATOM   3301  H  H    . ARG A  1 205 ? 119.328 120.584 119.677 1.00 40.50  ? 205 ARG A H    1 
ATOM   3302  H  HA   . ARG A  1 205 ? 121.938 120.483 119.367 1.00 40.50  ? 205 ARG A HA   1 
ATOM   3303  H  HB2  . ARG A  1 205 ? 120.622 122.313 120.346 1.00 40.50  ? 205 ARG A HB2  1 
ATOM   3304  H  HB3  . ARG A  1 205 ? 120.766 121.489 121.690 1.00 40.50  ? 205 ARG A HB3  1 
ATOM   3305  H  HG2  . ARG A  1 205 ? 123.037 121.699 121.619 1.00 40.50  ? 205 ARG A HG2  1 
ATOM   3306  H  HG3  . ARG A  1 205 ? 122.949 122.446 120.225 1.00 40.50  ? 205 ARG A HG3  1 
ATOM   3307  H  HD2  . ARG A  1 205 ? 122.037 123.462 122.665 1.00 40.50  ? 205 ARG A HD2  1 
ATOM   3308  H  HD3  . ARG A  1 205 ? 123.299 123.986 121.863 1.00 40.50  ? 205 ARG A HD3  1 
ATOM   3309  H  HE   . ARG A  1 205 ? 120.708 124.341 121.028 1.00 40.50  ? 205 ARG A HE   1 
ATOM   3310  H  HH11 . ARG A  1 205 ? 123.643 125.801 121.481 1.00 40.50  ? 205 ARG A HH11 1 
ATOM   3311  H  HH12 . ARG A  1 205 ? 123.260 127.096 120.871 1.00 40.50  ? 205 ARG A HH12 1 
ATOM   3312  H  HH21 . ARG A  1 205 ? 120.208 126.281 119.976 1.00 40.50  ? 205 ARG A HH21 1 
ATOM   3313  H  HH22 . ARG A  1 205 ? 121.203 127.391 119.967 1.00 40.50  ? 205 ARG A HH22 1 
ATOM   3314  N  N    . ARG A  1 206 ? 122.941 119.170 121.227 1.00 42.99  ? 206 ARG A N    1 
ATOM   3315  C  CA   . ARG A  1 206 ? 123.525 118.174 122.110 1.00 42.99  ? 206 ARG A CA   1 
ATOM   3316  C  C    . ARG A  1 206 ? 123.929 118.846 123.414 1.00 42.99  ? 206 ARG A C    1 
ATOM   3317  O  O    . ARG A  1 206 ? 124.677 119.829 123.406 1.00 42.99  ? 206 ARG A O    1 
ATOM   3318  C  CB   . ARG A  1 206 ? 124.727 117.513 121.445 1.00 42.99  ? 206 ARG A CB   1 
ATOM   3319  C  CG   . ARG A  1 206 ? 124.347 116.640 120.285 1.00 42.99  ? 206 ARG A CG   1 
ATOM   3320  C  CD   . ARG A  1 206 ? 125.554 116.017 119.647 1.00 42.99  ? 206 ARG A CD   1 
ATOM   3321  N  NE   . ARG A  1 206 ? 125.197 114.893 118.793 1.00 42.99  ? 206 ARG A NE   1 
ATOM   3322  C  CZ   . ARG A  1 206 ? 125.959 114.428 117.811 1.00 42.99  ? 206 ARG A CZ   1 
ATOM   3323  N  NH1  . ARG A  1 206 ? 125.550 113.398 117.087 1.00 42.99  ? 206 ARG A NH1  1 
ATOM   3324  N  NH2  . ARG A  1 206 ? 127.127 114.994 117.551 1.00 42.99  ? 206 ARG A NH2  1 
ATOM   3325  H  H    . ARG A  1 206 ? 123.519 119.710 120.898 1.00 42.99  ? 206 ARG A H    1 
ATOM   3326  H  HA   . ARG A  1 206 ? 122.868 117.491 122.305 1.00 42.99  ? 206 ARG A HA   1 
ATOM   3327  H  HB2  . ARG A  1 206 ? 125.312 118.204 121.106 1.00 42.99  ? 206 ARG A HB2  1 
ATOM   3328  H  HB3  . ARG A  1 206 ? 125.199 116.971 122.093 1.00 42.99  ? 206 ARG A HB3  1 
ATOM   3329  H  HG2  . ARG A  1 206 ? 123.763 115.932 120.591 1.00 42.99  ? 206 ARG A HG2  1 
ATOM   3330  H  HG3  . ARG A  1 206 ? 123.900 117.182 119.623 1.00 42.99  ? 206 ARG A HG3  1 
ATOM   3331  H  HD2  . ARG A  1 206 ? 126.001 116.684 119.108 1.00 42.99  ? 206 ARG A HD2  1 
ATOM   3332  H  HD3  . ARG A  1 206 ? 126.148 115.695 120.338 1.00 42.99  ? 206 ARG A HD3  1 
ATOM   3333  H  HE   . ARG A  1 206 ? 124.505 114.434 119.012 1.00 42.99  ? 206 ARG A HE   1 
ATOM   3334  H  HH11 . ARG A  1 206 ? 124.793 113.029 117.254 1.00 42.99  ? 206 ARG A HH11 1 
ATOM   3335  H  HH12 . ARG A  1 206 ? 126.044 113.098 116.451 1.00 42.99  ? 206 ARG A HH12 1 
ATOM   3336  H  HH21 . ARG A  1 206 ? 127.393 115.662 118.018 1.00 42.99  ? 206 ARG A HH21 1 
ATOM   3337  H  HH22 . ARG A  1 206 ? 127.618 114.693 116.915 1.00 42.99  ? 206 ARG A HH22 1 
ATOM   3338  N  N    . THR A  1 207 ? 123.440 118.308 124.527 1.00 55.49  ? 207 THR A N    1 
ATOM   3339  C  CA   . THR A  1 207 ? 123.507 118.977 125.817 1.00 55.49  ? 207 THR A CA   1 
ATOM   3340  C  C    . THR A  1 207 ? 124.605 118.445 126.727 1.00 55.49  ? 207 THR A C    1 
ATOM   3341  O  O    . THR A  1 207 ? 124.719 118.905 127.866 1.00 55.49  ? 207 THR A O    1 
ATOM   3342  C  CB   . THR A  1 207 ? 122.160 118.849 126.526 1.00 55.49  ? 207 THR A CB   1 
ATOM   3343  O  OG1  . THR A  1 207 ? 121.797 117.468 126.612 1.00 55.49  ? 207 THR A OG1  1 
ATOM   3344  C  CG2  . THR A  1 207 ? 121.094 119.573 125.753 1.00 55.49  ? 207 THR A CG2  1 
ATOM   3345  H  H    . THR A  1 207 ? 123.056 117.541 124.560 1.00 55.49  ? 207 THR A H    1 
ATOM   3346  H  HA   . THR A  1 207 ? 123.675 119.920 125.669 1.00 55.49  ? 207 THR A HA   1 
ATOM   3347  H  HB   . THR A  1 207 ? 122.220 119.235 127.411 1.00 55.49  ? 207 THR A HB   1 
ATOM   3348  H  HG1  . THR A  1 207 ? 120.963 117.393 126.568 1.00 55.49  ? 207 THR A HG1  1 
ATOM   3349  H  HG21 . THR A  1 207 ? 120.252 119.514 126.224 1.00 55.49  ? 207 THR A HG21 1 
ATOM   3350  H  HG22 . THR A  1 207 ? 121.335 120.504 125.642 1.00 55.49  ? 207 THR A HG22 1 
ATOM   3351  H  HG23 . THR A  1 207 ? 120.995 119.166 124.882 1.00 55.49  ? 207 THR A HG23 1 
ATOM   3352  N  N    . LEU A  1 208 ? 125.416 117.495 126.262 1.00 61.09  ? 208 LEU A N    1 
ATOM   3353  C  CA   . LEU A  1 208 ? 126.444 116.915 127.117 1.00 61.09  ? 208 LEU A CA   1 
ATOM   3354  C  C    . LEU A  1 208 ? 127.505 117.929 127.518 1.00 61.09  ? 208 LEU A C    1 
ATOM   3355  O  O    . LEU A  1 208 ? 128.227 117.699 128.493 1.00 61.09  ? 208 LEU A O    1 
ATOM   3356  C  CB   . LEU A  1 208 ? 127.097 115.725 126.414 1.00 61.09  ? 208 LEU A CB   1 
ATOM   3357  C  CG   . LEU A  1 208 ? 128.324 115.103 127.082 1.00 61.09  ? 208 LEU A CG   1 
ATOM   3358  C  CD1  . LEU A  1 208 ? 128.016 114.700 128.494 1.00 61.09  ? 208 LEU A CD1  1 
ATOM   3359  C  CD2  . LEU A  1 208 ? 128.799 113.897 126.299 1.00 61.09  ? 208 LEU A CD2  1 
ATOM   3360  H  H    . LEU A  1 208 ? 125.391 117.176 125.467 1.00 61.09  ? 208 LEU A H    1 
ATOM   3361  H  HA   . LEU A  1 208 ? 126.026 116.588 127.926 1.00 61.09  ? 208 LEU A HA   1 
ATOM   3362  H  HB2  . LEU A  1 208 ? 126.433 115.025 126.331 1.00 61.09  ? 208 LEU A HB2  1 
ATOM   3363  H  HB3  . LEU A  1 208 ? 127.370 116.014 125.531 1.00 61.09  ? 208 LEU A HB3  1 
ATOM   3364  H  HG   . LEU A  1 208 ? 129.042 115.751 127.105 1.00 61.09  ? 208 LEU A HG   1 
ATOM   3365  H  HD11 . LEU A  1 208 ? 128.818 114.343 128.905 1.00 61.09  ? 208 LEU A HD11 1 
ATOM   3366  H  HD12 . LEU A  1 208 ? 127.709 115.475 128.985 1.00 61.09  ? 208 LEU A HD12 1 
ATOM   3367  H  HD13 . LEU A  1 208 ? 127.327 114.022 128.470 1.00 61.09  ? 208 LEU A HD13 1 
ATOM   3368  H  HD21 . LEU A  1 208 ? 129.506 113.460 126.796 1.00 61.09  ? 208 LEU A HD21 1 
ATOM   3369  H  HD22 . LEU A  1 208 ? 128.053 113.290 126.179 1.00 61.09  ? 208 LEU A HD22 1 
ATOM   3370  H  HD23 . LEU A  1 208 ? 129.131 114.188 125.438 1.00 61.09  ? 208 LEU A HD23 1 
ATOM   3371  N  N    . TYR A  1 209 ? 127.619 119.041 126.796 1.00 64.86  ? 209 TYR A N    1 
ATOM   3372  C  CA   . TYR A  1 209 ? 128.596 120.070 127.131 1.00 64.86  ? 209 TYR A CA   1 
ATOM   3373  C  C    . TYR A  1 209 ? 128.029 121.056 128.148 1.00 64.86  ? 209 TYR A C    1 
ATOM   3374  O  O    . TYR A  1 209 ? 128.602 121.249 129.224 1.00 64.86  ? 209 TYR A O    1 
ATOM   3375  C  CB   . TYR A  1 209 ? 129.041 120.800 125.862 1.00 64.86  ? 209 TYR A CB   1 
ATOM   3376  C  CG   . TYR A  1 209 ? 129.932 121.988 126.119 1.00 64.86  ? 209 TYR A CG   1 
ATOM   3377  C  CD1  . TYR A  1 209 ? 131.294 121.830 126.300 1.00 64.86  ? 209 TYR A CD1  1 
ATOM   3378  C  CD2  . TYR A  1 209 ? 129.412 123.269 126.165 1.00 64.86  ? 209 TYR A CD2  1 
ATOM   3379  C  CE1  . TYR A  1 209 ? 132.113 122.914 126.531 1.00 64.86  ? 209 TYR A CE1  1 
ATOM   3380  C  CE2  . TYR A  1 209 ? 130.221 124.358 126.394 1.00 64.86  ? 209 TYR A CE2  1 
ATOM   3381  C  CZ   . TYR A  1 209 ? 131.570 124.177 126.577 1.00 64.86  ? 209 TYR A CZ   1 
ATOM   3382  O  OH   . TYR A  1 209 ? 132.376 125.266 126.806 1.00 64.86  ? 209 TYR A OH   1 
ATOM   3383  H  H    . TYR A  1 209 ? 127.140 119.221 126.107 1.00 64.86  ? 209 TYR A H    1 
ATOM   3384  H  HA   . TYR A  1 209 ? 129.375 119.650 127.522 1.00 64.86  ? 209 TYR A HA   1 
ATOM   3385  H  HB2  . TYR A  1 209 ? 129.525 120.182 125.297 1.00 64.86  ? 209 TYR A HB2  1 
ATOM   3386  H  HB3  . TYR A  1 209 ? 128.252 121.123 125.403 1.00 64.86  ? 209 TYR A HB3  1 
ATOM   3387  H  HD1  . TYR A  1 209 ? 131.660 120.974 126.267 1.00 64.86  ? 209 TYR A HD1  1 
ATOM   3388  H  HD2  . TYR A  1 209 ? 128.502 123.392 126.046 1.00 64.86  ? 209 TYR A HD2  1 
ATOM   3389  H  HE1  . TYR A  1 209 ? 133.027 122.787 126.651 1.00 64.86  ? 209 TYR A HE1  1 
ATOM   3390  H  HE2  . TYR A  1 209 ? 129.863 125.212 126.431 1.00 64.86  ? 209 TYR A HE2  1 
ATOM   3391  H  HH   . TYR A  1 209 ? 131.909 125.959 126.809 1.00 64.86  ? 209 TYR A HH   1 
ATOM   3392  N  N    . TYR A  1 210 ? 126.901 121.684 127.819 1.00 62.71  ? 210 TYR A N    1 
ATOM   3393  C  CA   . TYR A  1 210 ? 126.299 122.644 128.735 1.00 62.71  ? 210 TYR A CA   1 
ATOM   3394  C  C    . TYR A  1 210 ? 125.841 121.974 130.020 1.00 62.71  ? 210 TYR A C    1 
ATOM   3395  O  O    . TYR A  1 210 ? 125.848 122.601 131.085 1.00 62.71  ? 210 TYR A O    1 
ATOM   3396  C  CB   . TYR A  1 210 ? 125.124 123.342 128.057 1.00 62.71  ? 210 TYR A CB   1 
ATOM   3397  C  CG   . TYR A  1 210 ? 125.450 123.881 126.688 1.00 62.71  ? 210 TYR A CG   1 
ATOM   3398  C  CD1  . TYR A  1 210 ? 126.163 125.058 126.538 1.00 62.71  ? 210 TYR A CD1  1 
ATOM   3399  C  CD2  . TYR A  1 210 ? 125.050 123.209 125.547 1.00 62.71  ? 210 TYR A CD2  1 
ATOM   3400  C  CE1  . TYR A  1 210 ? 126.465 125.550 125.291 1.00 62.71  ? 210 TYR A CE1  1 
ATOM   3401  C  CE2  . TYR A  1 210 ? 125.348 123.694 124.297 1.00 62.71  ? 210 TYR A CE2  1 
ATOM   3402  C  CZ   . TYR A  1 210 ? 126.057 124.865 124.173 1.00 62.71  ? 210 TYR A CZ   1 
ATOM   3403  O  OH   . TYR A  1 210 ? 126.359 125.356 122.927 1.00 62.71  ? 210 TYR A OH   1 
ATOM   3404  H  H    . TYR A  1 210 ? 126.472 121.571 127.084 1.00 62.71  ? 210 TYR A H    1 
ATOM   3405  H  HA   . TYR A  1 210 ? 126.958 123.315 128.964 1.00 62.71  ? 210 TYR A HA   1 
ATOM   3406  H  HB2  . TYR A  1 210 ? 124.404 122.701 127.956 1.00 62.71  ? 210 TYR A HB2  1 
ATOM   3407  H  HB3  . TYR A  1 210 ? 124.836 124.082 128.611 1.00 62.71  ? 210 TYR A HB3  1 
ATOM   3408  H  HD1  . TYR A  1 210 ? 126.442 125.522 127.292 1.00 62.71  ? 210 TYR A HD1  1 
ATOM   3409  H  HD2  . TYR A  1 210 ? 124.572 122.418 125.629 1.00 62.71  ? 210 TYR A HD2  1 
ATOM   3410  H  HE1  . TYR A  1 210 ? 126.944 126.340 125.202 1.00 62.71  ? 210 TYR A HE1  1 
ATOM   3411  H  HE2  . TYR A  1 210 ? 125.072 123.232 123.540 1.00 62.71  ? 210 TYR A HE2  1 
ATOM   3412  H  HH   . TYR A  1 210 ? 126.139 124.798 122.341 1.00 62.71  ? 210 TYR A HH   1 
ATOM   3413  N  N    . GLY A  1 211 ? 125.440 120.707 129.941 1.00 68.52  ? 211 GLY A N    1 
ATOM   3414  C  CA   . GLY A  1 211 ? 124.934 120.031 131.121 1.00 68.52  ? 211 GLY A CA   1 
ATOM   3415  C  C    . GLY A  1 211 ? 125.949 119.966 132.246 1.00 68.52  ? 211 GLY A C    1 
ATOM   3416  O  O    . GLY A  1 211 ? 125.619 120.227 133.404 1.00 68.52  ? 211 GLY A O    1 
ATOM   3417  H  H    . GLY A  1 211 ? 125.447 120.231 129.227 1.00 68.52  ? 211 GLY A H    1 
ATOM   3418  H  HA2  . GLY A  1 211 ? 124.150 120.499 131.444 1.00 68.52  ? 211 GLY A HA2  1 
ATOM   3419  H  HA3  . GLY A  1 211 ? 124.677 119.127 130.890 1.00 68.52  ? 211 GLY A HA3  1 
ATOM   3420  N  N    . LEU A  1 212 ? 127.198 119.623 131.923 1.00 70.13  ? 212 LEU A N    1 
ATOM   3421  C  CA   . LEU A  1 212 ? 128.223 119.413 132.939 1.00 70.13  ? 212 LEU A CA   1 
ATOM   3422  C  C    . LEU A  1 212 ? 129.352 120.437 132.862 1.00 70.13  ? 212 LEU A C    1 
ATOM   3423  O  O    . LEU A  1 212 ? 130.430 120.206 133.417 1.00 70.13  ? 212 LEU A O    1 
ATOM   3424  C  CB   . LEU A  1 212 ? 128.768 117.986 132.855 1.00 70.13  ? 212 LEU A CB   1 
ATOM   3425  C  CG   . LEU A  1 212 ? 129.463 117.490 131.589 1.00 70.13  ? 212 LEU A CG   1 
ATOM   3426  C  CD1  . LEU A  1 212 ? 130.915 117.895 131.553 1.00 70.13  ? 212 LEU A CD1  1 
ATOM   3427  C  CD2  . LEU A  1 212 ? 129.347 115.983 131.518 1.00 70.13  ? 212 LEU A CD2  1 
ATOM   3428  H  H    . LEU A  1 212 ? 127.475 119.508 131.119 1.00 70.13  ? 212 LEU A H    1 
ATOM   3429  H  HA   . LEU A  1 212 ? 127.812 119.512 133.803 1.00 70.13  ? 212 LEU A HA   1 
ATOM   3430  H  HB2  . LEU A  1 212 ? 129.405 117.876 133.577 1.00 70.13  ? 212 LEU A HB2  1 
ATOM   3431  H  HB3  . LEU A  1 212 ? 128.020 117.387 133.002 1.00 70.13  ? 212 LEU A HB3  1 
ATOM   3432  H  HG   . LEU A  1 212 ? 129.021 117.871 130.815 1.00 70.13  ? 212 LEU A HG   1 
ATOM   3433  H  HD11 . LEU A  1 212 ? 131.318 117.553 130.740 1.00 70.13  ? 212 LEU A HD11 1 
ATOM   3434  H  HD12 . LEU A  1 212 ? 130.965 118.856 131.563 1.00 70.13  ? 212 LEU A HD12 1 
ATOM   3435  H  HD13 . LEU A  1 212 ? 131.367 117.528 132.328 1.00 70.13  ? 212 LEU A HD13 1 
ATOM   3436  H  HD21 . LEU A  1 212 ? 129.798 115.668 130.720 1.00 70.13  ? 212 LEU A HD21 1 
ATOM   3437  H  HD22 . LEU A  1 212 ? 129.767 115.605 132.305 1.00 70.13  ? 212 LEU A HD22 1 
ATOM   3438  H  HD23 . LEU A  1 212 ? 128.409 115.739 131.492 1.00 70.13  ? 212 LEU A HD23 1 
ATOM   3439  N  N    . ASN A  1 213 ? 129.122 121.571 132.200 1.00 73.76  ? 213 ASN A N    1 
ATOM   3440  C  CA   . ASN A  1 213 ? 130.025 122.712 132.270 1.00 73.76  ? 213 ASN A CA   1 
ATOM   3441  C  C    . ASN A  1 213 ? 129.325 124.015 132.617 1.00 73.76  ? 213 ASN A C    1 
ATOM   3442  O  O    . ASN A  1 213 ? 130.010 124.989 132.946 1.00 73.76  ? 213 ASN A O    1 
ATOM   3443  C  CB   . ASN A  1 213 ? 130.781 122.891 130.944 1.00 73.76  ? 213 ASN A CB   1 
ATOM   3444  C  CG   . ASN A  1 213 ? 131.808 121.808 130.713 1.00 73.76  ? 213 ASN A CG   1 
ATOM   3445  O  OD1  . ASN A  1 213 ? 131.883 120.845 131.466 1.00 73.76  ? 213 ASN A OD1  1 
ATOM   3446  N  ND2  . ASN A  1 213 ? 132.606 121.960 129.668 1.00 73.76  ? 213 ASN A ND2  1 
ATOM   3447  H  H    . ASN A  1 213 ? 128.436 121.704 131.702 1.00 73.76  ? 213 ASN A H    1 
ATOM   3448  H  HA   . ASN A  1 213 ? 130.683 122.543 132.960 1.00 73.76  ? 213 ASN A HA   1 
ATOM   3449  H  HB2  . ASN A  1 213 ? 130.149 122.866 130.212 1.00 73.76  ? 213 ASN A HB2  1 
ATOM   3450  H  HB3  . ASN A  1 213 ? 131.243 123.743 130.955 1.00 73.76  ? 213 ASN A HB3  1 
ATOM   3451  H  HD21 . ASN A  1 213 ? 133.205 121.367 129.499 1.00 73.76  ? 213 ASN A HD21 1 
ATOM   3452  H  HD22 . ASN A  1 213 ? 132.524 122.648 129.161 1.00 73.76  ? 213 ASN A HD22 1 
ATOM   3453  N  N    . LEU A  1 214 ? 127.993 124.067 132.558 1.00 76.43  ? 214 LEU A N    1 
ATOM   3454  C  CA   . LEU A  1 214 ? 127.234 125.246 132.941 1.00 76.43  ? 214 LEU A CA   1 
ATOM   3455  C  C    . LEU A  1 214 ? 126.265 125.009 134.085 1.00 76.43  ? 214 LEU A C    1 
ATOM   3456  O  O    . LEU A  1 214 ? 125.902 125.974 134.767 1.00 76.43  ? 214 LEU A O    1 
ATOM   3457  C  CB   . LEU A  1 214 ? 126.434 125.782 131.746 1.00 76.43  ? 214 LEU A CB   1 
ATOM   3458  C  CG   . LEU A  1 214 ? 127.103 126.863 130.902 1.00 76.43  ? 214 LEU A CG   1 
ATOM   3459  C  CD1  . LEU A  1 214 ? 128.349 126.333 130.225 1.00 76.43  ? 214 LEU A CD1  1 
ATOM   3460  C  CD2  . LEU A  1 214 ? 126.123 127.387 129.875 1.00 76.43  ? 214 LEU A CD2  1 
ATOM   3461  H  H    . LEU A  1 214 ? 127.501 123.416 132.293 1.00 76.43  ? 214 LEU A H    1 
ATOM   3462  H  HA   . LEU A  1 214 ? 127.850 125.940 133.213 1.00 76.43  ? 214 LEU A HA   1 
ATOM   3463  H  HB2  . LEU A  1 214 ? 126.231 125.040 131.159 1.00 76.43  ? 214 LEU A HB2  1 
ATOM   3464  H  HB3  . LEU A  1 214 ? 125.609 126.158 132.085 1.00 76.43  ? 214 LEU A HB3  1 
ATOM   3465  H  HG   . LEU A  1 214 ? 127.363 127.598 131.477 1.00 76.43  ? 214 LEU A HG   1 
ATOM   3466  H  HD11 . LEU A  1 214 ? 128.739 127.041 129.693 1.00 76.43  ? 214 LEU A HD11 1 
ATOM   3467  H  HD12 . LEU A  1 214 ? 128.978 126.045 130.903 1.00 76.43  ? 214 LEU A HD12 1 
ATOM   3468  H  HD13 . LEU A  1 214 ? 128.106 125.588 129.655 1.00 76.43  ? 214 LEU A HD13 1 
ATOM   3469  H  HD21 . LEU A  1 214 ? 126.569 128.047 129.322 1.00 76.43  ? 214 LEU A HD21 1 
ATOM   3470  H  HD22 . LEU A  1 214 ? 125.819 126.648 129.329 1.00 76.43  ? 214 LEU A HD22 1 
ATOM   3471  H  HD23 . LEU A  1 214 ? 125.372 127.790 130.336 1.00 76.43  ? 214 LEU A HD23 1 
ATOM   3472  N  N    . LEU A  1 215 ? 125.837 123.768 134.318 1.00 79.76  ? 215 LEU A N    1 
ATOM   3473  C  CA   . LEU A  1 215 ? 124.797 123.477 135.291 1.00 79.76  ? 215 LEU A CA   1 
ATOM   3474  C  C    . LEU A  1 215 ? 125.297 122.738 136.521 1.00 79.76  ? 215 LEU A C    1 
ATOM   3475  O  O    . LEU A  1 215 ? 124.592 122.719 137.534 1.00 79.76  ? 215 LEU A O    1 
ATOM   3476  C  CB   . LEU A  1 215 ? 123.680 122.654 134.632 1.00 79.76  ? 215 LEU A CB   1 
ATOM   3477  C  CG   . LEU A  1 215 ? 123.065 123.288 133.378 1.00 79.76  ? 215 LEU A CG   1 
ATOM   3478  C  CD1  . LEU A  1 215 ? 121.898 122.476 132.856 1.00 79.76  ? 215 LEU A CD1  1 
ATOM   3479  C  CD2  . LEU A  1 215 ? 122.624 124.717 133.640 1.00 79.76  ? 215 LEU A CD2  1 
ATOM   3480  H  H    . LEU A  1 215 ? 126.141 123.071 133.919 1.00 79.76  ? 215 LEU A H    1 
ATOM   3481  H  HA   . LEU A  1 215 ? 124.411 124.311 135.594 1.00 79.76  ? 215 LEU A HA   1 
ATOM   3482  H  HB2  . LEU A  1 215 ? 124.045 121.794 134.376 1.00 79.76  ? 215 LEU A HB2  1 
ATOM   3483  H  HB3  . LEU A  1 215 ? 122.968 122.525 135.277 1.00 79.76  ? 215 LEU A HB3  1 
ATOM   3484  H  HG   . LEU A  1 215 ? 123.737 123.313 132.679 1.00 79.76  ? 215 LEU A HG   1 
ATOM   3485  H  HD11 . LEU A  1 215 ? 121.524 122.935 132.089 1.00 79.76  ? 215 LEU A HD11 1 
ATOM   3486  H  HD12 . LEU A  1 215 ? 122.203 121.591 132.599 1.00 79.76  ? 215 LEU A HD12 1 
ATOM   3487  H  HD13 . LEU A  1 215 ? 121.237 122.411 133.559 1.00 79.76  ? 215 LEU A HD13 1 
ATOM   3488  H  HD21 . LEU A  1 215 ? 122.181 125.060 132.848 1.00 79.76  ? 215 LEU A HD21 1 
ATOM   3489  H  HD22 . LEU A  1 215 ? 122.015 124.722 134.392 1.00 79.76  ? 215 LEU A HD22 1 
ATOM   3490  H  HD23 . LEU A  1 215 ? 123.405 125.254 133.840 1.00 79.76  ? 215 LEU A HD23 1 
ATOM   3491  N  N    . ILE A  1 216 ? 126.476 122.129 136.462 1.00 82.84  ? 216 ILE A N    1 
ATOM   3492  C  CA   . ILE A  1 216 ? 127.077 121.502 137.636 1.00 82.84  ? 216 ILE A CA   1 
ATOM   3493  C  C    . ILE A  1 216 ? 127.702 122.595 138.498 1.00 82.84  ? 216 ILE A C    1 
ATOM   3494  O  O    . ILE A  1 216 ? 127.435 122.648 139.709 1.00 82.84  ? 216 ILE A O    1 
ATOM   3495  C  CB   . ILE A  1 216 ? 128.104 120.430 137.237 1.00 82.84  ? 216 ILE A CB   1 
ATOM   3496  C  CG1  . ILE A  1 216 ? 127.436 119.319 136.427 1.00 82.84  ? 216 ILE A CG1  1 
ATOM   3497  C  CG2  . ILE A  1 216 ? 128.789 119.861 138.465 1.00 82.84  ? 216 ILE A CG2  1 
ATOM   3498  C  CD1  . ILE A  1 216 ? 126.388 118.529 137.156 1.00 82.84  ? 216 ILE A CD1  1 
ATOM   3499  H  H    . ILE A  1 216 ? 126.955 122.069 135.752 1.00 82.84  ? 216 ILE A H    1 
ATOM   3500  H  HA   . ILE A  1 216 ? 126.381 121.074 138.155 1.00 82.84  ? 216 ILE A HA   1 
ATOM   3501  H  HB   . ILE A  1 216 ? 128.780 120.826 136.677 1.00 82.84  ? 216 ILE A HB   1 
ATOM   3502  H  HG12 . ILE A  1 216 ? 126.993 119.732 135.673 1.00 82.84  ? 216 ILE A HG12 1 
ATOM   3503  H  HG13 . ILE A  1 216 ? 128.117 118.700 136.121 1.00 82.84  ? 216 ILE A HG13 1 
ATOM   3504  H  HG21 . ILE A  1 216 ? 129.267 119.057 138.208 1.00 82.84  ? 216 ILE A HG21 1 
ATOM   3505  H  HG22 . ILE A  1 216 ? 129.410 120.520 138.814 1.00 82.84  ? 216 ILE A HG22 1 
ATOM   3506  H  HG23 . ILE A  1 216 ? 128.115 119.650 139.129 1.00 82.84  ? 216 ILE A HG23 1 
ATOM   3507  H  HD11 . ILE A  1 216 ? 126.085 117.814 136.574 1.00 82.84  ? 216 ILE A HD11 1 
ATOM   3508  H  HD12 . ILE A  1 216 ? 126.769 118.156 137.965 1.00 82.84  ? 216 ILE A HD12 1 
ATOM   3509  H  HD13 . ILE A  1 216 ? 125.646 119.115 137.370 1.00 82.84  ? 216 ILE A HD13 1 
ATOM   3510  N  N    . PRO A  1 217 ? 128.539 123.477 137.938 1.00 84.21  ? 217 PRO A N    1 
ATOM   3511  C  CA   . PRO A  1 217 ? 129.085 124.563 138.767 1.00 84.21  ? 217 PRO A CA   1 
ATOM   3512  C  C    . PRO A  1 217 ? 128.014 125.432 139.398 1.00 84.21  ? 217 PRO A C    1 
ATOM   3513  O  O    . PRO A  1 217 ? 128.153 125.831 140.559 1.00 84.21  ? 217 PRO A O    1 
ATOM   3514  C  CB   . PRO A  1 217 ? 129.950 125.358 137.778 1.00 84.21  ? 217 PRO A CB   1 
ATOM   3515  C  CG   . PRO A  1 217 ? 130.253 124.420 136.689 1.00 84.21  ? 217 PRO A CG   1 
ATOM   3516  C  CD   . PRO A  1 217 ? 129.063 123.534 136.563 1.00 84.21  ? 217 PRO A CD   1 
ATOM   3517  H  HA   . PRO A  1 217 ? 129.651 124.197 139.463 1.00 84.21  ? 217 PRO A HA   1 
ATOM   3518  H  HB2  . PRO A  1 217 ? 129.447 126.116 137.445 1.00 84.21  ? 217 PRO A HB2  1 
ATOM   3519  H  HB3  . PRO A  1 217 ? 130.765 125.650 138.213 1.00 84.21  ? 217 PRO A HB3  1 
ATOM   3520  H  HG2  . PRO A  1 217 ? 130.401 124.911 135.867 1.00 84.21  ? 217 PRO A HG2  1 
ATOM   3521  H  HG3  . PRO A  1 217 ? 131.038 123.902 136.921 1.00 84.21  ? 217 PRO A HG3  1 
ATOM   3522  H  HD2  . PRO A  1 217 ? 128.407 123.926 135.967 1.00 84.21  ? 217 PRO A HD2  1 
ATOM   3523  H  HD3  . PRO A  1 217 ? 129.347 122.666 136.255 1.00 84.21  ? 217 PRO A HD3  1 
ATOM   3524  N  N    . CYS A  1 218 ? 126.940 125.732 138.665 1.00 85.02  ? 218 CYS A N    1 
ATOM   3525  C  CA   . CYS A  1 218 ? 125.878 126.559 139.228 1.00 85.02  ? 218 CYS A CA   1 
ATOM   3526  C  C    . CYS A  1 218 ? 125.205 125.862 140.402 1.00 85.02  ? 218 CYS A C    1 
ATOM   3527  O  O    . CYS A  1 218 ? 124.919 126.490 141.427 1.00 85.02  ? 218 CYS A O    1 
ATOM   3528  C  CB   . CYS A  1 218 ? 124.849 126.899 138.152 1.00 85.02  ? 218 CYS A CB   1 
ATOM   3529  S  SG   . CYS A  1 218 ? 123.505 127.955 138.727 1.00 85.02  ? 218 CYS A SG   1 
ATOM   3530  H  H    . CYS A  1 218 ? 126.808 125.477 137.857 1.00 85.02  ? 218 CYS A H    1 
ATOM   3531  H  HA   . CYS A  1 218 ? 126.262 127.389 139.546 1.00 85.02  ? 218 CYS A HA   1 
ATOM   3532  H  HB2  . CYS A  1 218 ? 125.296 127.361 137.428 1.00 85.02  ? 218 CYS A HB2  1 
ATOM   3533  H  HB3  . CYS A  1 218 ? 124.458 126.075 137.825 1.00 85.02  ? 218 CYS A HB3  1 
ATOM   3534  H  HG   . CYS A  1 218 ? 122.751 128.156 137.817 1.00 85.02  ? 218 CYS A HG   1 
ATOM   3535  N  N    . VAL A  1 219 ? 124.942 124.563 140.270 1.00 86.20  ? 219 VAL A N    1 
ATOM   3536  C  CA   . VAL A  1 219 ? 124.298 123.824 141.349 1.00 86.20  ? 219 VAL A CA   1 
ATOM   3537  C  C    . VAL A  1 219 ? 125.208 123.757 142.568 1.00 86.20  ? 219 VAL A C    1 
ATOM   3538  O  O    . VAL A  1 219 ? 124.756 123.929 143.707 1.00 86.20  ? 219 VAL A O    1 
ATOM   3539  C  CB   . VAL A  1 219 ? 123.890 122.426 140.855 1.00 86.20  ? 219 VAL A CB   1 
ATOM   3540  C  CG1  . VAL A  1 219 ? 123.685 121.473 142.018 1.00 86.20  ? 219 VAL A CG1  1 
ATOM   3541  C  CG2  . VAL A  1 219 ? 122.628 122.529 140.039 1.00 86.20  ? 219 VAL A CG2  1 
ATOM   3542  H  H    . VAL A  1 219 ? 125.129 124.092 139.576 1.00 86.20  ? 219 VAL A H    1 
ATOM   3543  H  HA   . VAL A  1 219 ? 123.490 124.294 141.604 1.00 86.20  ? 219 VAL A HA   1 
ATOM   3544  H  HB   . VAL A  1 219 ? 124.589 122.070 140.287 1.00 86.20  ? 219 VAL A HB   1 
ATOM   3545  H  HG11 . VAL A  1 219 ? 123.260 120.668 141.685 1.00 86.20  ? 219 VAL A HG11 1 
ATOM   3546  H  HG12 . VAL A  1 219 ? 124.543 121.250 142.411 1.00 86.20  ? 219 VAL A HG12 1 
ATOM   3547  H  HG13 . VAL A  1 219 ? 123.113 121.898 142.674 1.00 86.20  ? 219 VAL A HG13 1 
ATOM   3548  H  HG21 . VAL A  1 219 ? 122.387 121.648 139.715 1.00 86.20  ? 219 VAL A HG21 1 
ATOM   3549  H  HG22 . VAL A  1 219 ? 121.925 122.884 140.604 1.00 86.20  ? 219 VAL A HG22 1 
ATOM   3550  H  HG23 . VAL A  1 219 ? 122.789 123.130 139.296 1.00 86.20  ? 219 VAL A HG23 1 
ATOM   3551  N  N    . LEU A  1 220 ? 126.499 123.501 142.356 1.00 87.30  ? 220 LEU A N    1 
ATOM   3552  C  CA   . LEU A  1 220 ? 127.431 123.472 143.478 1.00 87.30  ? 220 LEU A CA   1 
ATOM   3553  C  C    . LEU A  1 220 ? 127.505 124.831 144.165 1.00 87.30  ? 220 LEU A C    1 
ATOM   3554  O  O    . LEU A  1 220 ? 127.535 124.914 145.399 1.00 87.30  ? 220 LEU A O    1 
ATOM   3555  C  CB   . LEU A  1 220 ? 128.813 123.034 142.996 1.00 87.30  ? 220 LEU A CB   1 
ATOM   3556  C  CG   . LEU A  1 220 ? 129.897 122.884 144.064 1.00 87.30  ? 220 LEU A CG   1 
ATOM   3557  C  CD1  . LEU A  1 220 ? 129.543 121.791 145.054 1.00 87.30  ? 220 LEU A CD1  1 
ATOM   3558  C  CD2  . LEU A  1 220 ? 131.237 122.590 143.425 1.00 87.30  ? 220 LEU A CD2  1 
ATOM   3559  H  H    . LEU A  1 220 ? 126.850 123.341 141.589 1.00 87.30  ? 220 LEU A H    1 
ATOM   3560  H  HA   . LEU A  1 220 ? 127.117 122.824 144.126 1.00 87.30  ? 220 LEU A HA   1 
ATOM   3561  H  HB2  . LEU A  1 220 ? 128.724 122.175 142.554 1.00 87.30  ? 220 LEU A HB2  1 
ATOM   3562  H  HB3  . LEU A  1 220 ? 129.130 123.691 142.358 1.00 87.30  ? 220 LEU A HB3  1 
ATOM   3563  H  HG   . LEU A  1 220 ? 129.976 123.718 144.551 1.00 87.30  ? 220 LEU A HG   1 
ATOM   3564  H  HD11 . LEU A  1 220 ? 130.269 121.698 145.689 1.00 87.30  ? 220 LEU A HD11 1 
ATOM   3565  H  HD12 . LEU A  1 220 ? 128.727 122.033 145.517 1.00 87.30  ? 220 LEU A HD12 1 
ATOM   3566  H  HD13 . LEU A  1 220 ? 129.418 120.958 144.572 1.00 87.30  ? 220 LEU A HD13 1 
ATOM   3567  H  HD21 . LEU A  1 220 ? 131.887 122.417 144.123 1.00 87.30  ? 220 LEU A HD21 1 
ATOM   3568  H  HD22 . LEU A  1 220 ? 131.145 121.809 142.857 1.00 87.30  ? 220 LEU A HD22 1 
ATOM   3569  H  HD23 . LEU A  1 220 ? 131.512 123.355 142.897 1.00 87.30  ? 220 LEU A HD23 1 
ATOM   3570  N  N    . ILE A  1 221 ? 127.528 125.908 143.379 1.00 86.51  ? 221 ILE A N    1 
ATOM   3571  C  CA   . ILE A  1 221 ? 127.574 127.253 143.944 1.00 86.51  ? 221 ILE A CA   1 
ATOM   3572  C  C    . ILE A  1 221 ? 126.321 127.532 144.763 1.00 86.51  ? 221 ILE A C    1 
ATOM   3573  O  O    . ILE A  1 221 ? 126.390 128.088 145.865 1.00 86.51  ? 221 ILE A O    1 
ATOM   3574  C  CB   . ILE A  1 221 ? 127.764 128.282 142.814 1.00 86.51  ? 221 ILE A CB   1 
ATOM   3575  C  CG1  . ILE A  1 221 ? 129.230 128.310 142.375 1.00 86.51  ? 221 ILE A CG1  1 
ATOM   3576  C  CG2  . ILE A  1 221 ? 127.297 129.659 143.247 1.00 86.51  ? 221 ILE A CG2  1 
ATOM   3577  C  CD1  . ILE A  1 221 ? 129.476 129.069 141.087 1.00 86.51  ? 221 ILE A CD1  1 
ATOM   3578  H  H    . ILE A  1 221 ? 127.519 125.886 142.521 1.00 86.51  ? 221 ILE A H    1 
ATOM   3579  H  HA   . ILE A  1 221 ? 128.339 127.318 144.534 1.00 86.51  ? 221 ILE A HA   1 
ATOM   3580  H  HB   . ILE A  1 221 ? 127.226 128.004 142.059 1.00 86.51  ? 221 ILE A HB   1 
ATOM   3581  H  HG12 . ILE A  1 221 ? 129.756 128.730 143.073 1.00 86.51  ? 221 ILE A HG12 1 
ATOM   3582  H  HG13 . ILE A  1 221 ? 129.531 127.398 142.243 1.00 86.51  ? 221 ILE A HG13 1 
ATOM   3583  H  HG21 . ILE A  1 221 ? 127.590 130.312 142.593 1.00 86.51  ? 221 ILE A HG21 1 
ATOM   3584  H  HG22 . ILE A  1 221 ? 126.329 129.671 143.303 1.00 86.51  ? 221 ILE A HG22 1 
ATOM   3585  H  HG23 . ILE A  1 221 ? 127.686 129.858 144.109 1.00 86.51  ? 221 ILE A HG23 1 
ATOM   3586  H  HD11 . ILE A  1 221 ? 130.386 128.906 140.792 1.00 86.51  ? 221 ILE A HD11 1 
ATOM   3587  H  HD12 . ILE A  1 221 ? 128.850 128.760 140.415 1.00 86.51  ? 221 ILE A HD12 1 
ATOM   3588  H  HD13 . ILE A  1 221 ? 129.347 130.016 141.248 1.00 86.51  ? 221 ILE A HD13 1 
ATOM   3589  N  N    . SER A  1 222 ? 125.155 127.155 144.238 1.00 87.29  ? 222 SER A N    1 
ATOM   3590  C  CA   . SER A  1 222 ? 123.911 127.379 144.965 1.00 87.29  ? 222 SER A CA   1 
ATOM   3591  C  C    . SER A  1 222 ? 123.885 126.583 146.264 1.00 87.29  ? 222 SER A C    1 
ATOM   3592  O  O    . SER A  1 222 ? 123.444 127.085 147.306 1.00 87.29  ? 222 SER A O    1 
ATOM   3593  C  CB   . SER A  1 222 ? 122.722 127.013 144.077 1.00 87.29  ? 222 SER A CB   1 
ATOM   3594  O  OG   . SER A  1 222 ? 121.492 127.274 144.725 1.00 87.29  ? 222 SER A OG   1 
ATOM   3595  H  H    . SER A  1 222 ? 125.061 126.772 143.476 1.00 87.29  ? 222 SER A H    1 
ATOM   3596  H  HA   . SER A  1 222 ? 123.845 128.320 145.188 1.00 87.29  ? 222 SER A HA   1 
ATOM   3597  H  HB2  . SER A  1 222 ? 122.765 127.538 143.263 1.00 87.29  ? 222 SER A HB2  1 
ATOM   3598  H  HB3  . SER A  1 222 ? 122.769 126.070 143.862 1.00 87.29  ? 222 SER A HB3  1 
ATOM   3599  H  HG   . SER A  1 222 ? 120.861 127.182 144.178 1.00 87.29  ? 222 SER A HG   1 
ATOM   3600  N  N    . ALA A  1 223 ? 124.356 125.336 146.222 1.00 85.46  ? 223 ALA A N    1 
ATOM   3601  C  CA   . ALA A  1 223 ? 124.415 124.528 147.434 1.00 85.46  ? 223 ALA A CA   1 
ATOM   3602  C  C    . ALA A  1 223 ? 125.323 125.171 148.473 1.00 85.46  ? 223 ALA A C    1 
ATOM   3603  O  O    . ALA A  1 223 ? 124.969 125.266 149.654 1.00 85.46  ? 223 ALA A O    1 
ATOM   3604  C  CB   . ALA A  1 223 ? 124.902 123.121 147.097 1.00 85.46  ? 223 ALA A CB   1 
ATOM   3605  H  H    . ALA A  1 223 ? 124.642 124.943 145.514 1.00 85.46  ? 223 ALA A H    1 
ATOM   3606  H  HA   . ALA A  1 223 ? 123.526 124.459 147.809 1.00 85.46  ? 223 ALA A HA   1 
ATOM   3607  H  HB1  . ALA A  1 223 ? 124.960 122.606 147.916 1.00 85.46  ? 223 ALA A HB1  1 
ATOM   3608  H  HB2  . ALA A  1 223 ? 124.275 122.708 146.483 1.00 85.46  ? 223 ALA A HB2  1 
ATOM   3609  H  HB3  . ALA A  1 223 ? 125.777 123.186 146.685 1.00 85.46  ? 223 ALA A HB3  1 
ATOM   3610  N  N    . LEU A  1 224 ? 126.503 125.623 148.049 1.00 88.06  ? 224 LEU A N    1 
ATOM   3611  C  CA   . LEU A  1 224 ? 127.406 126.290 148.979 1.00 88.06  ? 224 LEU A CA   1 
ATOM   3612  C  C    . LEU A  1 224 ? 126.772 127.551 149.550 1.00 88.06  ? 224 LEU A C    1 
ATOM   3613  O  O    . LEU A  1 224 ? 126.981 127.884 150.722 1.00 88.06  ? 224 LEU A O    1 
ATOM   3614  C  CB   . LEU A  1 224 ? 128.727 126.614 148.282 1.00 88.06  ? 224 LEU A CB   1 
ATOM   3615  C  CG   . LEU A  1 224 ? 129.608 125.423 147.889 1.00 88.06  ? 224 LEU A CG   1 
ATOM   3616  C  CD1  . LEU A  1 224 ? 131.043 125.868 147.774 1.00 88.06  ? 224 LEU A CD1  1 
ATOM   3617  C  CD2  . LEU A  1 224 ? 129.498 124.262 148.870 1.00 88.06  ? 224 LEU A CD2  1 
ATOM   3618  H  H    . LEU A  1 224 ? 126.799 125.550 147.247 1.00 88.06  ? 224 LEU A H    1 
ATOM   3619  H  HA   . LEU A  1 224 ? 127.586 125.702 149.726 1.00 88.06  ? 224 LEU A HA   1 
ATOM   3620  H  HB2  . LEU A  1 224 ? 128.528 127.104 147.470 1.00 88.06  ? 224 LEU A HB2  1 
ATOM   3621  H  HB3  . LEU A  1 224 ? 129.249 127.178 148.873 1.00 88.06  ? 224 LEU A HB3  1 
ATOM   3622  H  HG   . LEU A  1 224 ? 129.328 125.103 147.018 1.00 88.06  ? 224 LEU A HG   1 
ATOM   3623  H  HD11 . LEU A  1 224 ? 131.591 125.100 147.554 1.00 88.06  ? 224 LEU A HD11 1 
ATOM   3624  H  HD12 . LEU A  1 224 ? 131.107 126.538 147.076 1.00 88.06  ? 224 LEU A HD12 1 
ATOM   3625  H  HD13 . LEU A  1 224 ? 131.320 126.243 148.623 1.00 88.06  ? 224 LEU A HD13 1 
ATOM   3626  H  HD21 . LEU A  1 224 ? 130.179 123.606 148.657 1.00 88.06  ? 224 LEU A HD21 1 
ATOM   3627  H  HD22 . LEU A  1 224 ? 129.631 124.599 149.770 1.00 88.06  ? 224 LEU A HD22 1 
ATOM   3628  H  HD23 . LEU A  1 224 ? 128.618 123.861 148.795 1.00 88.06  ? 224 LEU A HD23 1 
ATOM   3629  N  N    . ALA A  1 225 ? 125.992 128.268 148.740 1.00 88.27  ? 225 ALA A N    1 
ATOM   3630  C  CA   . ALA A  1 225 ? 125.289 129.439 149.256 1.00 88.27  ? 225 ALA A CA   1 
ATOM   3631  C  C    . ALA A  1 225 ? 124.294 129.045 150.338 1.00 88.27  ? 225 ALA A C    1 
ATOM   3632  O  O    . ALA A  1 225 ? 124.196 129.711 151.375 1.00 88.27  ? 225 ALA A O    1 
ATOM   3633  C  CB   . ALA A  1 225 ? 124.576 130.168 148.124 1.00 88.27  ? 225 ALA A CB   1 
ATOM   3634  H  H    . ALA A  1 225 ? 125.852 128.099 147.911 1.00 88.27  ? 225 ALA A H    1 
ATOM   3635  H  HA   . ALA A  1 225 ? 125.934 130.045 149.649 1.00 88.27  ? 225 ALA A HA   1 
ATOM   3636  H  HB1  . ALA A  1 225 ? 124.119 130.937 148.494 1.00 88.27  ? 225 ALA A HB1  1 
ATOM   3637  H  HB2  . ALA A  1 225 ? 125.233 130.455 147.474 1.00 88.27  ? 225 ALA A HB2  1 
ATOM   3638  H  HB3  . ALA A  1 225 ? 123.940 129.564 147.713 1.00 88.27  ? 225 ALA A HB3  1 
ATOM   3639  N  N    . LEU A  1 226 ? 123.544 127.967 150.114 1.00 91.37  ? 226 LEU A N    1 
ATOM   3640  C  CA   . LEU A  1 226 ? 122.636 127.481 151.149 1.00 91.37  ? 226 LEU A CA   1 
ATOM   3641  C  C    . LEU A  1 226 ? 123.402 127.042 152.386 1.00 91.37  ? 226 LEU A C    1 
ATOM   3642  O  O    . LEU A  1 226 ? 122.862 127.061 153.497 1.00 91.37  ? 226 LEU A O    1 
ATOM   3643  C  CB   . LEU A  1 226 ? 121.798 126.320 150.617 1.00 91.37  ? 226 LEU A CB   1 
ATOM   3644  C  CG   . LEU A  1 226 ? 120.498 126.692 149.911 1.00 91.37  ? 226 LEU A CG   1 
ATOM   3645  C  CD1  . LEU A  1 226 ? 120.770 127.458 148.632 1.00 91.37  ? 226 LEU A CD1  1 
ATOM   3646  C  CD2  . LEU A  1 226 ? 119.711 125.442 149.621 1.00 91.37  ? 226 LEU A CD2  1 
ATOM   3647  H  H    . LEU A  1 226 ? 123.546 127.506 149.389 1.00 91.37  ? 226 LEU A H    1 
ATOM   3648  H  HA   . LEU A  1 226 ? 122.032 128.197 151.397 1.00 91.37  ? 226 LEU A HA   1 
ATOM   3649  H  HB2  . LEU A  1 226 ? 122.335 125.811 149.990 1.00 91.37  ? 226 LEU A HB2  1 
ATOM   3650  H  HB3  . LEU A  1 226 ? 121.561 125.751 151.365 1.00 91.37  ? 226 LEU A HB3  1 
ATOM   3651  H  HG   . LEU A  1 226 ? 119.973 127.256 150.493 1.00 91.37  ? 226 LEU A HG   1 
ATOM   3652  H  HD11 . LEU A  1 226 ? 119.930 127.795 148.289 1.00 91.37  ? 226 LEU A HD11 1 
ATOM   3653  H  HD12 . LEU A  1 226 ? 121.369 128.198 148.822 1.00 91.37  ? 226 LEU A HD12 1 
ATOM   3654  H  HD13 . LEU A  1 226 ? 121.178 126.869 147.967 1.00 91.37  ? 226 LEU A HD13 1 
ATOM   3655  H  HD21 . LEU A  1 226 ? 118.842 125.689 149.268 1.00 91.37  ? 226 LEU A HD21 1 
ATOM   3656  H  HD22 . LEU A  1 226 ? 120.196 124.906 148.968 1.00 91.37  ? 226 LEU A HD22 1 
ATOM   3657  H  HD23 . LEU A  1 226 ? 119.608 124.940 150.443 1.00 91.37  ? 226 LEU A HD23 1 
ATOM   3658  N  N    . LEU A  1 227 ? 124.659 126.646 152.204 1.00 90.25  ? 227 LEU A N    1 
ATOM   3659  C  CA   . LEU A  1 227 ? 125.462 126.119 153.299 1.00 90.25  ? 227 LEU A CA   1 
ATOM   3660  C  C    . LEU A  1 227 ? 125.685 127.130 154.416 1.00 90.25  ? 227 LEU A C    1 
ATOM   3661  O  O    . LEU A  1 227 ? 125.993 126.729 155.543 1.00 90.25  ? 227 LEU A O    1 
ATOM   3662  C  CB   . LEU A  1 227 ? 126.807 125.656 152.746 1.00 90.25  ? 227 LEU A CB   1 
ATOM   3663  C  CG   . LEU A  1 227 ? 127.685 124.762 153.606 1.00 90.25  ? 227 LEU A CG   1 
ATOM   3664  C  CD1  . LEU A  1 227 ? 126.966 123.468 153.871 1.00 90.25  ? 227 LEU A CD1  1 
ATOM   3665  C  CD2  . LEU A  1 227 ? 128.981 124.491 152.882 1.00 90.25  ? 227 LEU A CD2  1 
ATOM   3666  H  H    . LEU A  1 227 ? 125.068 126.670 151.451 1.00 90.25  ? 227 LEU A H    1 
ATOM   3667  H  HA   . LEU A  1 227 ? 124.999 125.361 153.677 1.00 90.25  ? 227 LEU A HA   1 
ATOM   3668  H  HB2  . LEU A  1 227 ? 126.619 125.142 151.948 1.00 90.25  ? 227 LEU A HB2  1 
ATOM   3669  H  HB3  . LEU A  1 227 ? 127.329 126.439 152.514 1.00 90.25  ? 227 LEU A HB3  1 
ATOM   3670  H  HG   . LEU A  1 227 ? 127.880 125.185 154.459 1.00 90.25  ? 227 LEU A HG   1 
ATOM   3671  H  HD11 . LEU A  1 227 ? 127.486 122.889 154.452 1.00 90.25  ? 227 LEU A HD11 1 
ATOM   3672  H  HD12 . LEU A  1 227 ? 126.101 123.674 154.261 1.00 90.25  ? 227 LEU A HD12 1 
ATOM   3673  H  HD13 . LEU A  1 227 ? 126.846 123.062 153.006 1.00 90.25  ? 227 LEU A HD13 1 
ATOM   3674  H  HD21 . LEU A  1 227 ? 129.599 124.062 153.493 1.00 90.25  ? 227 LEU A HD21 1 
ATOM   3675  H  HD22 . LEU A  1 227 ? 128.772 123.900 152.148 1.00 90.25  ? 227 LEU A HD22 1 
ATOM   3676  H  HD23 . LEU A  1 227 ? 129.357 125.324 152.545 1.00 90.25  ? 227 LEU A HD23 1 
ATOM   3677  N  N    . VAL A  1 228 ? 125.534 128.425 154.137 1.00 93.08  ? 228 VAL A N    1 
ATOM   3678  C  CA   . VAL A  1 228 ? 125.881 129.440 155.126 1.00 93.08  ? 228 VAL A CA   1 
ATOM   3679  C  C    . VAL A  1 228 ? 125.044 129.290 156.387 1.00 93.08  ? 228 VAL A C    1 
ATOM   3680  O  O    . VAL A  1 228 ? 125.520 129.571 157.492 1.00 93.08  ? 228 VAL A O    1 
ATOM   3681  C  CB   . VAL A  1 228 ? 125.732 130.849 154.523 1.00 93.08  ? 228 VAL A CB   1 
ATOM   3682  C  CG1  . VAL A  1 228 ? 124.291 131.131 154.163 1.00 93.08  ? 228 VAL A CG1  1 
ATOM   3683  C  CG2  . VAL A  1 228 ? 126.225 131.888 155.503 1.00 93.08  ? 228 VAL A CG2  1 
ATOM   3684  H  H    . VAL A  1 228 ? 125.236 128.734 153.393 1.00 93.08  ? 228 VAL A H    1 
ATOM   3685  H  HA   . VAL A  1 228 ? 126.811 129.325 155.372 1.00 93.08  ? 228 VAL A HA   1 
ATOM   3686  H  HB   . VAL A  1 228 ? 126.266 130.912 153.717 1.00 93.08  ? 228 VAL A HB   1 
ATOM   3687  H  HG11 . VAL A  1 228 ? 124.253 131.959 153.661 1.00 93.08  ? 228 VAL A HG11 1 
ATOM   3688  H  HG12 . VAL A  1 228 ? 123.946 130.402 153.629 1.00 93.08  ? 228 VAL A HG12 1 
ATOM   3689  H  HG13 . VAL A  1 228 ? 123.777 131.218 154.981 1.00 93.08  ? 228 VAL A HG13 1 
ATOM   3690  H  HG21 . VAL A  1 228 ? 126.172 132.762 155.088 1.00 93.08  ? 228 VAL A HG21 1 
ATOM   3691  H  HG22 . VAL A  1 228 ? 125.663 131.864 156.292 1.00 93.08  ? 228 VAL A HG22 1 
ATOM   3692  H  HG23 . VAL A  1 228 ? 127.142 131.682 155.742 1.00 93.08  ? 228 VAL A HG23 1 
ATOM   3693  N  N    . PHE A  1 229 ? 123.793 128.853 156.252 1.00 95.05  ? 229 PHE A N    1 
ATOM   3694  C  CA   . PHE A  1 229 ? 122.898 128.829 157.402 1.00 95.05  ? 229 PHE A CA   1 
ATOM   3695  C  C    . PHE A  1 229 ? 123.392 127.861 158.473 1.00 95.05  ? 229 PHE A C    1 
ATOM   3696  O  O    . PHE A  1 229 ? 123.307 128.156 159.671 1.00 95.05  ? 229 PHE A O    1 
ATOM   3697  C  CB   . PHE A  1 229 ? 121.488 128.457 156.959 1.00 95.05  ? 229 PHE A CB   1 
ATOM   3698  C  CG   . PHE A  1 229 ? 120.918 129.361 155.909 1.00 95.05  ? 229 PHE A CG   1 
ATOM   3699  C  CD1  . PHE A  1 229 ? 120.624 130.682 156.186 1.00 95.05  ? 229 PHE A CD1  1 
ATOM   3700  C  CD2  . PHE A  1 229 ? 120.658 128.877 154.644 1.00 95.05  ? 229 PHE A CD2  1 
ATOM   3701  C  CE1  . PHE A  1 229 ? 120.095 131.501 155.220 1.00 95.05  ? 229 PHE A CE1  1 
ATOM   3702  C  CE2  . PHE A  1 229 ? 120.125 129.692 153.675 1.00 95.05  ? 229 PHE A CE2  1 
ATOM   3703  C  CZ   . PHE A  1 229 ? 119.842 131.006 153.963 1.00 95.05  ? 229 PHE A CZ   1 
ATOM   3704  H  H    . PHE A  1 229 ? 123.447 128.564 155.520 1.00 95.05  ? 229 PHE A H    1 
ATOM   3705  H  HA   . PHE A  1 229 ? 122.867 129.715 157.793 1.00 95.05  ? 229 PHE A HA   1 
ATOM   3706  H  HB2  . PHE A  1 229 ? 121.518 127.577 156.569 1.00 95.05  ? 229 PHE A HB2  1 
ATOM   3707  H  HB3  . PHE A  1 229 ? 120.898 128.465 157.727 1.00 95.05  ? 229 PHE A HB3  1 
ATOM   3708  H  HD1  . PHE A  1 229 ? 120.794 131.024 157.030 1.00 95.05  ? 229 PHE A HD1  1 
ATOM   3709  H  HD2  . PHE A  1 229 ? 120.847 127.988 154.449 1.00 95.05  ? 229 PHE A HD2  1 
ATOM   3710  H  HE1  . PHE A  1 229 ? 119.906 132.388 155.418 1.00 95.05  ? 229 PHE A HE1  1 
ATOM   3711  H  HE2  . PHE A  1 229 ? 119.956 129.354 152.826 1.00 95.05  ? 229 PHE A HE2  1 
ATOM   3712  H  HZ   . PHE A  1 229 ? 119.484 131.559 153.308 1.00 95.05  ? 229 PHE A HZ   1 
ATOM   3713  N  N    . LEU A  1 230 ? 123.907 126.698 158.066 1.00 93.40  ? 230 LEU A N    1 
ATOM   3714  C  CA   . LEU A  1 230 ? 124.426 125.745 159.042 1.00 93.40  ? 230 LEU A CA   1 
ATOM   3715  C  C    . LEU A  1 230 ? 125.551 126.354 159.861 1.00 93.40  ? 230 LEU A C    1 
ATOM   3716  O  O    . LEU A  1 230 ? 125.750 125.984 161.024 1.00 93.40  ? 230 LEU A O    1 
ATOM   3717  C  CB   . LEU A  1 230 ? 124.934 124.485 158.341 1.00 93.40  ? 230 LEU A CB   1 
ATOM   3718  C  CG   . LEU A  1 230 ? 123.908 123.599 157.644 1.00 93.40  ? 230 LEU A CG   1 
ATOM   3719  C  CD1  . LEU A  1 230 ? 124.598 122.456 156.933 1.00 93.40  ? 230 LEU A CD1  1 
ATOM   3720  C  CD2  . LEU A  1 230 ? 122.890 123.069 158.629 1.00 93.40  ? 230 LEU A CD2  1 
ATOM   3721  H  H    . LEU A  1 230 ? 123.972 126.446 157.248 1.00 93.40  ? 230 LEU A H    1 
ATOM   3722  H  HA   . LEU A  1 230 ? 123.716 125.496 159.649 1.00 93.40  ? 230 LEU A HA   1 
ATOM   3723  H  HB2  . LEU A  1 230 ? 125.578 124.753 157.668 1.00 93.40  ? 230 LEU A HB2  1 
ATOM   3724  H  HB3  . LEU A  1 230 ? 125.379 123.931 159.000 1.00 93.40  ? 230 LEU A HB3  1 
ATOM   3725  H  HG   . LEU A  1 230 ? 123.453 124.130 156.979 1.00 93.40  ? 230 LEU A HG   1 
ATOM   3726  H  HD11 . LEU A  1 230 ? 123.926 121.898 156.512 1.00 93.40  ? 230 LEU A HD11 1 
ATOM   3727  H  HD12 . LEU A  1 230 ? 125.197 122.819 156.263 1.00 93.40  ? 230 LEU A HD12 1 
ATOM   3728  H  HD13 . LEU A  1 230 ? 125.098 121.940 157.582 1.00 93.40  ? 230 LEU A HD13 1 
ATOM   3729  H  HD21 . LEU A  1 230 ? 122.259 122.505 158.157 1.00 93.40  ? 230 LEU A HD21 1 
ATOM   3730  H  HD22 . LEU A  1 230 ? 123.354 122.554 159.307 1.00 93.40  ? 230 LEU A HD22 1 
ATOM   3731  H  HD23 . LEU A  1 230 ? 122.425 123.815 159.037 1.00 93.40  ? 230 LEU A HD23 1 
ATOM   3732  N  N    . LEU A  1 231 ? 126.291 127.271 159.272 1.00 96.42  ? 231 LEU A N    1 
ATOM   3733  C  CA   . LEU A  1 231 ? 127.482 127.801 159.907 1.00 96.42  ? 231 LEU A CA   1 
ATOM   3734  C  C    . LEU A  1 231 ? 127.095 128.591 161.156 1.00 96.42  ? 231 LEU A C    1 
ATOM   3735  O  O    . LEU A  1 231 ? 126.214 129.454 161.085 1.00 96.42  ? 231 LEU A O    1 
ATOM   3736  C  CB   . LEU A  1 231 ? 128.207 128.698 158.916 1.00 96.42  ? 231 LEU A CB   1 
ATOM   3737  C  CG   . LEU A  1 231 ? 129.669 128.970 159.201 1.00 96.42  ? 231 LEU A CG   1 
ATOM   3738  C  CD1  . LEU A  1 231 ? 130.369 127.696 158.869 1.00 96.42  ? 231 LEU A CD1  1 
ATOM   3739  C  CD2  . LEU A  1 231 ? 130.230 130.086 158.385 1.00 96.42  ? 231 LEU A CD2  1 
ATOM   3740  H  H    . LEU A  1 231 ? 126.142 127.587 158.488 1.00 96.42  ? 231 LEU A H    1 
ATOM   3741  H  HA   . LEU A  1 231 ? 128.065 127.067 160.151 1.00 96.42  ? 231 LEU A HA   1 
ATOM   3742  H  HB2  . LEU A  1 231 ? 128.161 128.281 158.044 1.00 96.42  ? 231 LEU A HB2  1 
ATOM   3743  H  HB3  . LEU A  1 231 ? 127.757 129.554 158.891 1.00 96.42  ? 231 LEU A HB3  1 
ATOM   3744  H  HG   . LEU A  1 231 ? 129.796 129.166 160.142 1.00 96.42  ? 231 LEU A HG   1 
ATOM   3745  H  HD11 . LEU A  1 231 ? 131.305 127.904 158.727 1.00 96.42  ? 231 LEU A HD11 1 
ATOM   3746  H  HD12 . LEU A  1 231 ? 130.241 127.077 159.606 1.00 96.42  ? 231 LEU A HD12 1 
ATOM   3747  H  HD13 . LEU A  1 231 ? 130.002 127.314 158.060 1.00 96.42  ? 231 LEU A HD13 1 
ATOM   3748  H  HD21 . LEU A  1 231 ? 131.172 130.168 158.598 1.00 96.42  ? 231 LEU A HD21 1 
ATOM   3749  H  HD22 . LEU A  1 231 ? 130.117 129.862 157.450 1.00 96.42  ? 231 LEU A HD22 1 
ATOM   3750  H  HD23 . LEU A  1 231 ? 129.765 130.905 158.601 1.00 96.42  ? 231 LEU A HD23 1 
ATOM   3751  N  N    . PRO A  1 232 ? 127.718 128.335 162.307 1.00 99.67  ? 232 PRO A N    1 
ATOM   3752  C  CA   . PRO A  1 232 ? 127.403 129.120 163.504 1.00 99.67  ? 232 PRO A CA   1 
ATOM   3753  C  C    . PRO A  1 232 ? 127.835 130.571 163.368 1.00 99.67  ? 232 PRO A C    1 
ATOM   3754  O  O    . PRO A  1 232 ? 128.796 130.899 162.668 1.00 99.67  ? 232 PRO A O    1 
ATOM   3755  C  CB   . PRO A  1 232 ? 128.191 128.412 164.612 1.00 99.67  ? 232 PRO A CB   1 
ATOM   3756  C  CG   . PRO A  1 232 ? 129.302 127.738 163.913 1.00 99.67  ? 232 PRO A CG   1 
ATOM   3757  C  CD   . PRO A  1 232 ? 128.756 127.329 162.576 1.00 99.67  ? 232 PRO A CD   1 
ATOM   3758  H  HA   . PRO A  1 232 ? 126.455 129.079 163.705 1.00 99.67  ? 232 PRO A HA   1 
ATOM   3759  H  HB2  . PRO A  1 232 ? 128.531 129.068 165.240 1.00 99.67  ? 232 PRO A HB2  1 
ATOM   3760  H  HB3  . PRO A  1 232 ? 127.622 127.767 165.060 1.00 99.67  ? 232 PRO A HB3  1 
ATOM   3761  H  HG2  . PRO A  1 232 ? 130.039 128.360 163.806 1.00 99.67  ? 232 PRO A HG2  1 
ATOM   3762  H  HG3  . PRO A  1 232 ? 129.584 126.963 164.423 1.00 99.67  ? 232 PRO A HG3  1 
ATOM   3763  H  HD2  . PRO A  1 232 ? 129.427 127.394 161.890 1.00 99.67  ? 232 PRO A HD2  1 
ATOM   3764  H  HD3  . PRO A  1 232 ? 128.374 126.439 162.621 1.00 99.67  ? 232 PRO A HD3  1 
ATOM   3765  N  N    . ALA A  1 233 ? 127.104 131.444 164.063 1.00 103.43 ? 233 ALA A N    1 
ATOM   3766  C  CA   . ALA A  1 233 ? 127.394 132.872 164.011 1.00 103.43 ? 233 ALA A CA   1 
ATOM   3767  C  C    . ALA A  1 233 ? 128.673 133.226 164.757 1.00 103.43 ? 233 ALA A C    1 
ATOM   3768  O  O    . ALA A  1 233 ? 129.339 134.206 164.404 1.00 103.43 ? 233 ALA A O    1 
ATOM   3769  C  CB   . ALA A  1 233 ? 126.221 133.658 164.586 1.00 103.43 ? 233 ALA A CB   1 
ATOM   3770  H  H    . ALA A  1 233 ? 126.437 131.236 164.563 1.00 103.43 ? 233 ALA A H    1 
ATOM   3771  H  HA   . ALA A  1 233 ? 127.508 133.139 163.087 1.00 103.43 ? 233 ALA A HA   1 
ATOM   3772  H  HB1  . ALA A  1 233 ? 126.425 134.605 164.547 1.00 103.43 ? 233 ALA A HB1  1 
ATOM   3773  H  HB2  . ALA A  1 233 ? 125.427 133.462 164.065 1.00 103.43 ? 233 ALA A HB2  1 
ATOM   3774  H  HB3  . ALA A  1 233 ? 126.093 133.381 165.505 1.00 103.43 ? 233 ALA A HB3  1 
ATOM   3775  N  N    . ASP A  1 234 ? 129.024 132.463 165.795 1.00 107.98 ? 234 ASP A N    1 
ATOM   3776  C  CA   . ASP A  1 234 ? 130.259 132.738 166.524 1.00 107.98 ? 234 ASP A CA   1 
ATOM   3777  C  C    . ASP A  1 234 ? 131.438 132.837 165.568 1.00 107.98 ? 234 ASP A C    1 
ATOM   3778  O  O    . ASP A  1 234 ? 132.304 133.707 165.720 1.00 107.98 ? 234 ASP A O    1 
ATOM   3779  C  CB   . ASP A  1 234 ? 130.512 131.650 167.566 1.00 107.98 ? 234 ASP A CB   1 
ATOM   3780  C  CG   . ASP A  1 234 ? 129.399 131.550 168.588 1.00 107.98 ? 234 ASP A CG   1 
ATOM   3781  O  OD1  . ASP A  1 234 ? 128.767 132.586 168.887 1.00 107.98 ? 234 ASP A OD1  1 
ATOM   3782  O  OD2  . ASP A  1 234 ? 129.156 130.434 169.094 1.00 107.98 ? 234 ASP A OD2  1 
ATOM   3783  H  H    . ASP A  1 234 ? 128.573 131.795 166.092 1.00 107.98 ? 234 ASP A H    1 
ATOM   3784  H  HA   . ASP A  1 234 ? 130.174 133.585 166.987 1.00 107.98 ? 234 ASP A HA   1 
ATOM   3785  H  HB2  . ASP A  1 234 ? 130.588 130.793 167.119 1.00 107.98 ? 234 ASP A HB2  1 
ATOM   3786  H  HB3  . ASP A  1 234 ? 131.335 131.853 168.037 1.00 107.98 ? 234 ASP A HB3  1 
ATOM   3787  N  N    . SER A  1 235 ? 131.486 131.953 164.577 1.00 102.79 ? 235 SER A N    1 
ATOM   3788  C  CA   . SER A  1 235 ? 132.481 132.039 163.518 1.00 102.79 ? 235 SER A CA   1 
ATOM   3789  C  C    . SER A  1 235 ? 132.130 133.205 162.604 1.00 102.79 ? 235 SER A C    1 
ATOM   3790  O  O    . SER A  1 235 ? 131.085 133.197 161.948 1.00 102.79 ? 235 SER A O    1 
ATOM   3791  C  CB   . SER A  1 235 ? 132.528 130.730 162.738 1.00 102.79 ? 235 SER A CB   1 
ATOM   3792  O  OG   . SER A  1 235 ? 133.423 130.815 161.646 1.00 102.79 ? 235 SER A OG   1 
ATOM   3793  H  H    . SER A  1 235 ? 130.948 131.289 164.497 1.00 102.79 ? 235 SER A H    1 
ATOM   3794  H  HA   . SER A  1 235 ? 133.356 132.203 163.903 1.00 102.79 ? 235 SER A HA   1 
ATOM   3795  H  HB2  . SER A  1 235 ? 132.815 130.022 163.329 1.00 102.79 ? 235 SER A HB2  1 
ATOM   3796  H  HB3  . SER A  1 235 ? 131.641 130.538 162.402 1.00 102.79 ? 235 SER A HB3  1 
ATOM   3797  H  HG   . SER A  1 235 ? 133.415 130.093 161.220 1.00 102.79 ? 235 SER A HG   1 
ATOM   3798  N  N    . GLY A  1 236 ? 132.998 134.209 162.556 1.00 103.47 ? 236 GLY A N    1 
ATOM   3799  C  CA   . GLY A  1 236 ? 132.756 135.358 161.709 1.00 103.47 ? 236 GLY A CA   1 
ATOM   3800  C  C    . GLY A  1 236 ? 133.029 135.047 160.255 1.00 103.47 ? 236 GLY A C    1 
ATOM   3801  O  O    . GLY A  1 236 ? 133.900 135.662 159.629 1.00 103.47 ? 236 GLY A O    1 
ATOM   3802  H  H    . GLY A  1 236 ? 133.732 134.245 163.003 1.00 103.47 ? 236 GLY A H    1 
ATOM   3803  H  HA2  . GLY A  1 236 ? 131.828 135.632 161.795 1.00 103.47 ? 236 GLY A HA2  1 
ATOM   3804  H  HA3  . GLY A  1 236 ? 133.326 136.091 161.987 1.00 103.47 ? 236 GLY A HA3  1 
ATOM   3805  N  N    . GLU A  1 237 ? 132.284 134.088 159.705 1.00 99.01  ? 237 GLU A N    1 
ATOM   3806  C  CA   . GLU A  1 237 ? 132.533 133.603 158.357 1.00 99.01  ? 237 GLU A CA   1 
ATOM   3807  C  C    . GLU A  1 237 ? 131.266 133.435 157.528 1.00 99.01  ? 237 GLU A C    1 
ATOM   3808  O  O    . GLU A  1 237 ? 131.366 133.013 156.371 1.00 99.01  ? 237 GLU A O    1 
ATOM   3809  C  CB   . GLU A  1 237 ? 133.281 132.259 158.410 1.00 99.01  ? 237 GLU A CB   1 
ATOM   3810  C  CG   . GLU A  1 237 ? 134.644 132.305 159.098 1.00 99.01  ? 237 GLU A CG   1 
ATOM   3811  C  CD   . GLU A  1 237 ? 135.672 133.104 158.309 1.00 99.01  ? 237 GLU A CD   1 
ATOM   3812  O  OE1  . GLU A  1 237 ? 135.411 134.268 157.969 1.00 99.01  ? 237 GLU A OE1  1 
ATOM   3813  O  OE2  . GLU A  1 237 ? 136.767 132.546 158.054 1.00 99.01  ? 237 GLU A OE2  1 
ATOM   3814  H  H    . GLU A  1 237 ? 131.620 133.707 160.102 1.00 99.01  ? 237 GLU A H    1 
ATOM   3815  H  HA   . GLU A  1 237 ? 133.094 134.240 157.888 1.00 99.01  ? 237 GLU A HA   1 
ATOM   3816  H  HB2  . GLU A  1 237 ? 132.737 131.638 158.918 1.00 99.01  ? 237 GLU A HB2  1 
ATOM   3817  H  HB3  . GLU A  1 237 ? 133.408 131.935 157.505 1.00 99.01  ? 237 GLU A HB3  1 
ATOM   3818  H  HG2  . GLU A  1 237 ? 134.550 132.708 159.968 1.00 99.01  ? 237 GLU A HG2  1 
ATOM   3819  H  HG3  . GLU A  1 237 ? 134.974 131.399 159.192 1.00 99.01  ? 237 GLU A HG3  1 
ATOM   3820  N  N    . LYS A  1 238 ? 130.086 133.739 158.070 1.00 95.40  ? 238 LYS A N    1 
ATOM   3821  C  CA   . LYS A  1 238 ? 128.852 133.553 157.311 1.00 95.40  ? 238 LYS A CA   1 
ATOM   3822  C  C    . LYS A  1 238 ? 128.744 134.574 156.188 1.00 95.40  ? 238 LYS A C    1 
ATOM   3823  O  O    . LYS A  1 238 ? 128.486 134.222 155.031 1.00 95.40  ? 238 LYS A O    1 
ATOM   3824  C  CB   . LYS A  1 238 ? 127.653 133.655 158.246 1.00 95.40  ? 238 LYS A CB   1 
ATOM   3825  C  CG   . LYS A  1 238 ? 127.755 132.779 159.471 1.00 95.40  ? 238 LYS A CG   1 
ATOM   3826  C  CD   . LYS A  1 238 ? 126.479 132.811 160.279 1.00 95.40  ? 238 LYS A CD   1 
ATOM   3827  C  CE   . LYS A  1 238 ? 125.371 132.071 159.568 1.00 95.40  ? 238 LYS A CE   1 
ATOM   3828  N  NZ   . LYS A  1 238 ? 124.274 131.684 160.483 1.00 95.40  ? 238 LYS A NZ   1 
ATOM   3829  H  H    . LYS A  1 238 ? 129.974 134.056 158.861 1.00 95.40  ? 238 LYS A H    1 
ATOM   3830  H  HA   . LYS A  1 238 ? 128.854 132.667 156.919 1.00 95.40  ? 238 LYS A HA   1 
ATOM   3831  H  HB2  . LYS A  1 238 ? 127.570 134.572 158.546 1.00 95.40  ? 238 LYS A HB2  1 
ATOM   3832  H  HB3  . LYS A  1 238 ? 126.854 133.397 157.760 1.00 95.40  ? 238 LYS A HB3  1 
ATOM   3833  H  HG2  . LYS A  1 238 ? 127.917 131.867 159.193 1.00 95.40  ? 238 LYS A HG2  1 
ATOM   3834  H  HG3  . LYS A  1 238 ? 128.482 133.098 160.026 1.00 95.40  ? 238 LYS A HG3  1 
ATOM   3835  H  HD2  . LYS A  1 238 ? 126.628 132.386 161.136 1.00 95.40  ? 238 LYS A HD2  1 
ATOM   3836  H  HD3  . LYS A  1 238 ? 126.201 133.730 160.401 1.00 95.40  ? 238 LYS A HD3  1 
ATOM   3837  H  HE2  . LYS A  1 238 ? 125.002 132.648 158.882 1.00 95.40  ? 238 LYS A HE2  1 
ATOM   3838  H  HE3  . LYS A  1 238 ? 125.733 131.265 159.173 1.00 95.40  ? 238 LYS A HE3  1 
ATOM   3839  H  HZ1  . LYS A  1 238 ? 123.487 131.837 160.097 1.00 95.40  ? 238 LYS A HZ1  1 
ATOM   3840  H  HZ2  . LYS A  1 238 ? 124.335 130.819 160.681 1.00 95.40  ? 238 LYS A HZ2  1 
ATOM   3841  H  HZ3  . LYS A  1 238 ? 124.326 132.160 161.231 1.00 95.40  ? 238 LYS A HZ3  1 
ATOM   3842  N  N    . ILE A  1 239 ? 128.938 135.851 156.516 1.00 94.93  ? 239 ILE A N    1 
ATOM   3843  C  CA   . ILE A  1 239 ? 128.929 136.890 155.496 1.00 94.93  ? 239 ILE A CA   1 
ATOM   3844  C  C    . ILE A  1 239 ? 130.052 136.652 154.501 1.00 94.93  ? 239 ILE A C    1 
ATOM   3845  O  O    . ILE A  1 239 ? 129.870 136.797 153.284 1.00 94.93  ? 239 ILE A O    1 
ATOM   3846  C  CB   . ILE A  1 239 ? 129.042 138.275 156.151 1.00 94.93  ? 239 ILE A CB   1 
ATOM   3847  C  CG1  . ILE A  1 239 ? 127.878 138.503 157.119 1.00 94.93  ? 239 ILE A CG1  1 
ATOM   3848  C  CG2  . ILE A  1 239 ? 129.087 139.363 155.096 1.00 94.93  ? 239 ILE A CG2  1 
ATOM   3849  C  CD1  . ILE A  1 239 ? 126.519 138.480 156.469 1.00 94.93  ? 239 ILE A CD1  1 
ATOM   3850  H  H    . ILE A  1 239 ? 129.075 136.137 157.314 1.00 94.93  ? 239 ILE A H    1 
ATOM   3851  H  HA   . ILE A  1 239 ? 128.092 136.850 155.009 1.00 94.93  ? 239 ILE A HA   1 
ATOM   3852  H  HB   . ILE A  1 239 ? 129.868 138.305 156.655 1.00 94.93  ? 239 ILE A HB   1 
ATOM   3853  H  HG12 . ILE A  1 239 ? 127.892 137.804 157.790 1.00 94.93  ? 239 ILE A HG12 1 
ATOM   3854  H  HG13 . ILE A  1 239 ? 127.987 139.367 157.541 1.00 94.93  ? 239 ILE A HG13 1 
ATOM   3855  H  HG21 . ILE A  1 239 ? 129.022 140.226 155.532 1.00 94.93  ? 239 ILE A HG21 1 
ATOM   3856  H  HG22 . ILE A  1 239 ? 129.926 139.301 154.613 1.00 94.93  ? 239 ILE A HG22 1 
ATOM   3857  H  HG23 . ILE A  1 239 ? 128.341 139.243 154.488 1.00 94.93  ? 239 ILE A HG23 1 
ATOM   3858  H  HD11 . ILE A  1 239 ? 125.848 138.677 157.141 1.00 94.93  ? 239 ILE A HD11 1 
ATOM   3859  H  HD12 . ILE A  1 239 ? 126.491 139.150 155.768 1.00 94.93  ? 239 ILE A HD12 1 
ATOM   3860  H  HD13 . ILE A  1 239 ? 126.361 137.601 156.094 1.00 94.93  ? 239 ILE A HD13 1 
ATOM   3861  N  N    . SER A  1 240 ? 131.234 136.296 155.003 1.00 92.83  ? 240 SER A N    1 
ATOM   3862  C  CA   . SER A  1 240 ? 132.353 135.984 154.125 1.00 92.83  ? 240 SER A CA   1 
ATOM   3863  C  C    . SER A  1 240 ? 131.952 134.935 153.100 1.00 92.83  ? 240 SER A C    1 
ATOM   3864  O  O    . SER A  1 240 ? 132.105 135.136 151.889 1.00 92.83  ? 240 SER A O    1 
ATOM   3865  C  CB   . SER A  1 240 ? 133.536 135.496 154.962 1.00 92.83  ? 240 SER A CB   1 
ATOM   3866  O  OG   . SER A  1 240 ? 134.649 135.175 154.151 1.00 92.83  ? 240 SER A OG   1 
ATOM   3867  H  H    . SER A  1 240 ? 131.408 136.226 155.841 1.00 92.83  ? 240 SER A H    1 
ATOM   3868  H  HA   . SER A  1 240 ? 132.624 136.785 153.655 1.00 92.83  ? 240 SER A HA   1 
ATOM   3869  H  HB2  . SER A  1 240 ? 133.790 136.192 155.587 1.00 92.83  ? 240 SER A HB2  1 
ATOM   3870  H  HB3  . SER A  1 240 ? 133.264 134.703 155.447 1.00 92.83  ? 240 SER A HB3  1 
ATOM   3871  H  HG   . SER A  1 240 ? 135.245 134.818 154.622 1.00 92.83  ? 240 SER A HG   1 
ATOM   3872  N  N    . LEU A  1 241 ? 131.397 133.819 153.572 1.00 90.12  ? 241 LEU A N    1 
ATOM   3873  C  CA   . LEU A  1 241 ? 131.029 132.735 152.671 1.00 90.12  ? 241 LEU A CA   1 
ATOM   3874  C  C    . LEU A  1 241 ? 129.971 133.182 151.672 1.00 90.12  ? 241 LEU A C    1 
ATOM   3875  O  O    . LEU A  1 241 ? 130.110 132.961 150.465 1.00 90.12  ? 241 LEU A O    1 
ATOM   3876  C  CB   . LEU A  1 241 ? 130.534 131.535 153.477 1.00 90.12  ? 241 LEU A CB   1 
ATOM   3877  C  CG   . LEU A  1 241 ? 130.354 130.233 152.695 1.00 90.12  ? 241 LEU A CG   1 
ATOM   3878  C  CD1  . LEU A  1 241 ? 130.512 129.048 153.607 1.00 90.12  ? 241 LEU A CD1  1 
ATOM   3879  C  CD2  . LEU A  1 241 ? 128.997 130.185 152.020 1.00 90.12  ? 241 LEU A CD2  1 
ATOM   3880  H  H    . LEU A  1 241 ? 131.228 133.666 154.399 1.00 90.12  ? 241 LEU A H    1 
ATOM   3881  H  HA   . LEU A  1 241 ? 131.815 132.460 152.176 1.00 90.12  ? 241 LEU A HA   1 
ATOM   3882  H  HB2  . LEU A  1 241 ? 131.171 131.361 154.185 1.00 90.12  ? 241 LEU A HB2  1 
ATOM   3883  H  HB3  . LEU A  1 241 ? 129.677 131.765 153.863 1.00 90.12  ? 241 LEU A HB3  1 
ATOM   3884  H  HG   . LEU A  1 241 ? 131.036 130.176 152.009 1.00 90.12  ? 241 LEU A HG   1 
ATOM   3885  H  HD11 . LEU A  1 241 ? 130.345 128.240 153.100 1.00 90.12  ? 241 LEU A HD11 1 
ATOM   3886  H  HD12 . LEU A  1 241 ? 131.416 129.042 153.955 1.00 90.12  ? 241 LEU A HD12 1 
ATOM   3887  H  HD13 . LEU A  1 241 ? 129.874 129.125 154.332 1.00 90.12  ? 241 LEU A HD13 1 
ATOM   3888  H  HD21 . LEU A  1 241 ? 128.820 129.274 151.744 1.00 90.12  ? 241 LEU A HD21 1 
ATOM   3889  H  HD22 . LEU A  1 241 ? 128.319 130.477 152.650 1.00 90.12  ? 241 LEU A HD22 1 
ATOM   3890  H  HD23 . LEU A  1 241 ? 129.002 130.769 151.247 1.00 90.12  ? 241 LEU A HD23 1 
ATOM   3891  N  N    . GLY A  1 242 ? 128.899 133.809 152.155 1.00 87.18  ? 242 GLY A N    1 
ATOM   3892  C  CA   . GLY A  1 242 ? 127.817 134.178 151.255 1.00 87.18  ? 242 GLY A CA   1 
ATOM   3893  C  C    . GLY A  1 242 ? 128.264 135.142 150.174 1.00 87.18  ? 242 GLY A C    1 
ATOM   3894  O  O    . GLY A  1 242 ? 127.974 134.951 148.986 1.00 87.18  ? 242 GLY A O    1 
ATOM   3895  H  H    . GLY A  1 242 ? 128.781 134.027 152.977 1.00 87.18  ? 242 GLY A H    1 
ATOM   3896  H  HA2  . GLY A  1 242 ? 127.466 133.382 150.830 1.00 87.18  ? 242 GLY A HA2  1 
ATOM   3897  H  HA3  . GLY A  1 242 ? 127.106 134.596 151.761 1.00 87.18  ? 242 GLY A HA3  1 
ATOM   3898  N  N    . ILE A  1 243 ? 128.991 136.188 150.566 1.00 87.16  ? 243 ILE A N    1 
ATOM   3899  C  CA   . ILE A  1 243 ? 129.393 137.196 149.597 1.00 87.16  ? 243 ILE A CA   1 
ATOM   3900  C  C    . ILE A  1 243 ? 130.441 136.637 148.643 1.00 87.16  ? 243 ILE A C    1 
ATOM   3901  O  O    . ILE A  1 243 ? 130.446 136.963 147.450 1.00 87.16  ? 243 ILE A O    1 
ATOM   3902  C  CB   . ILE A  1 243 ? 129.880 138.464 150.319 1.00 87.16  ? 243 ILE A CB   1 
ATOM   3903  C  CG1  . ILE A  1 243 ? 129.904 139.635 149.342 1.00 87.16  ? 243 ILE A CG1  1 
ATOM   3904  C  CG2  . ILE A  1 243 ? 131.242 138.243 150.948 1.00 87.16  ? 243 ILE A CG2  1 
ATOM   3905  C  CD1  . ILE A  1 243 ? 128.537 140.202 149.051 1.00 87.16  ? 243 ILE A CD1  1 
ATOM   3906  H  H    . ILE A  1 243 ? 129.259 136.332 151.368 1.00 87.16  ? 243 ILE A H    1 
ATOM   3907  H  HA   . ILE A  1 243 ? 128.618 137.437 149.071 1.00 87.16  ? 243 ILE A HA   1 
ATOM   3908  H  HB   . ILE A  1 243 ? 129.249 138.669 151.025 1.00 87.16  ? 243 ILE A HB   1 
ATOM   3909  H  HG12 . ILE A  1 243 ? 130.447 140.342 149.719 1.00 87.16  ? 243 ILE A HG12 1 
ATOM   3910  H  HG13 . ILE A  1 243 ? 130.286 139.336 148.503 1.00 87.16  ? 243 ILE A HG13 1 
ATOM   3911  H  HG21 . ILE A  1 243 ? 131.444 138.995 151.526 1.00 87.16  ? 243 ILE A HG21 1 
ATOM   3912  H  HG22 . ILE A  1 243 ? 131.219 137.425 151.465 1.00 87.16  ? 243 ILE A HG22 1 
ATOM   3913  H  HG23 . ILE A  1 243 ? 131.908 138.173 150.248 1.00 87.16  ? 243 ILE A HG23 1 
ATOM   3914  H  HD11 . ILE A  1 243 ? 128.622 140.913 148.397 1.00 87.16  ? 243 ILE A HD11 1 
ATOM   3915  H  HD12 . ILE A  1 243 ? 127.973 139.499 148.699 1.00 87.16  ? 243 ILE A HD12 1 
ATOM   3916  H  HD13 . ILE A  1 243 ? 128.160 140.548 149.875 1.00 87.16  ? 243 ILE A HD13 1 
ATOM   3917  N  N    . THR A  1 244 ? 131.342 135.786 149.138 1.00 86.25  ? 244 THR A N    1 
ATOM   3918  C  CA   . THR A  1 244 ? 132.309 135.161 148.245 1.00 86.25  ? 244 THR A CA   1 
ATOM   3919  C  C    . THR A  1 244 ? 131.618 134.253 147.237 1.00 86.25  ? 244 THR A C    1 
ATOM   3920  O  O    . THR A  1 244 ? 132.025 134.180 146.072 1.00 86.25  ? 244 THR A O    1 
ATOM   3921  C  CB   . THR A  1 244 ? 133.334 134.373 149.051 1.00 86.25  ? 244 THR A CB   1 
ATOM   3922  O  OG1  . THR A  1 244 ? 133.959 135.235 150.009 1.00 86.25  ? 244 THR A OG1  1 
ATOM   3923  C  CG2  . THR A  1 244 ? 134.382 133.801 148.131 1.00 86.25  ? 244 THR A CG2  1 
ATOM   3924  H  H    . THR A  1 244 ? 131.414 135.565 149.964 1.00 86.25  ? 244 THR A H    1 
ATOM   3925  H  HA   . THR A  1 244 ? 132.782 135.851 147.757 1.00 86.25  ? 244 THR A HA   1 
ATOM   3926  H  HB   . THR A  1 244 ? 132.888 133.647 149.508 1.00 86.25  ? 244 THR A HB   1 
ATOM   3927  H  HG1  . THR A  1 244 ? 133.378 135.555 150.523 1.00 86.25  ? 244 THR A HG1  1 
ATOM   3928  H  HG21 . THR A  1 244 ? 135.130 133.465 148.643 1.00 86.25  ? 244 THR A HG21 1 
ATOM   3929  H  HG22 . THR A  1 244 ? 134.001 133.080 147.609 1.00 86.25  ? 244 THR A HG22 1 
ATOM   3930  H  HG23 . THR A  1 244 ? 134.698 134.494 147.531 1.00 86.25  ? 244 THR A HG23 1 
ATOM   3931  N  N    . VAL A  1 245 ? 130.578 133.538 147.669 1.00 86.34  ? 245 VAL A N    1 
ATOM   3932  C  CA   . VAL A  1 245 ? 129.819 132.703 146.744 1.00 86.34  ? 245 VAL A CA   1 
ATOM   3933  C  C    . VAL A  1 245 ? 129.150 133.562 145.680 1.00 86.34  ? 245 VAL A C    1 
ATOM   3934  O  O    . VAL A  1 245 ? 129.129 133.207 144.494 1.00 86.34  ? 245 VAL A O    1 
ATOM   3935  C  CB   . VAL A  1 245 ? 128.792 131.857 147.515 1.00 86.34  ? 245 VAL A CB   1 
ATOM   3936  C  CG1  . VAL A  1 245 ? 127.878 131.148 146.553 1.00 86.34  ? 245 VAL A CG1  1 
ATOM   3937  C  CG2  . VAL A  1 245 ? 129.498 130.849 148.385 1.00 86.34  ? 245 VAL A CG2  1 
ATOM   3938  H  H    . VAL A  1 245 ? 130.299 133.517 148.479 1.00 86.34  ? 245 VAL A H    1 
ATOM   3939  H  HA   . VAL A  1 245 ? 130.427 132.095 146.300 1.00 86.34  ? 245 VAL A HA   1 
ATOM   3940  H  HB   . VAL A  1 245 ? 128.260 132.435 148.082 1.00 86.34  ? 245 VAL A HB   1 
ATOM   3941  H  HG11 . VAL A  1 245 ? 127.397 130.457 147.031 1.00 86.34  ? 245 VAL A HG11 1 
ATOM   3942  H  HG12 . VAL A  1 245 ? 127.256 131.785 146.168 1.00 86.34  ? 245 VAL A HG12 1 
ATOM   3943  H  HG13 . VAL A  1 245 ? 128.424 130.751 145.860 1.00 86.34  ? 245 VAL A HG13 1 
ATOM   3944  H  HG21 . VAL A  1 245 ? 128.852 130.434 148.976 1.00 86.34  ? 245 VAL A HG21 1 
ATOM   3945  H  HG22 . VAL A  1 245 ? 129.903 130.180 147.816 1.00 86.34  ? 245 VAL A HG22 1 
ATOM   3946  H  HG23 . VAL A  1 245 ? 130.182 131.298 148.899 1.00 86.34  ? 245 VAL A HG23 1 
ATOM   3947  N  N    . LEU A  1 246 ? 128.579 134.696 146.086 1.00 85.25  ? 246 LEU A N    1 
ATOM   3948  C  CA   . LEU A  1 246 ? 127.993 135.595 145.098 1.00 85.25  ? 246 LEU A CA   1 
ATOM   3949  C  C    . LEU A  1 246 ? 129.045 136.094 144.116 1.00 85.25  ? 246 LEU A C    1 
ATOM   3950  O  O    . LEU A  1 246 ? 128.774 136.226 142.918 1.00 85.25  ? 246 LEU A O    1 
ATOM   3951  C  CB   . LEU A  1 246 ? 127.313 136.773 145.783 1.00 85.25  ? 246 LEU A CB   1 
ATOM   3952  C  CG   . LEU A  1 246 ? 126.346 137.526 144.873 1.00 85.25  ? 246 LEU A CG   1 
ATOM   3953  C  CD1  . LEU A  1 246 ? 125.121 136.699 144.565 1.00 85.25  ? 246 LEU A CD1  1 
ATOM   3954  C  CD2  . LEU A  1 246 ? 125.951 138.836 145.507 1.00 85.25  ? 246 LEU A CD2  1 
ATOM   3955  H  H    . LEU A  1 246 ? 128.518 134.961 146.900 1.00 85.25  ? 246 LEU A H    1 
ATOM   3956  H  HA   . LEU A  1 246 ? 127.327 135.110 144.594 1.00 85.25  ? 246 LEU A HA   1 
ATOM   3957  H  HB2  . LEU A  1 246 ? 126.813 136.447 146.546 1.00 85.25  ? 246 LEU A HB2  1 
ATOM   3958  H  HB3  . LEU A  1 246 ? 127.992 137.399 146.072 1.00 85.25  ? 246 LEU A HB3  1 
ATOM   3959  H  HG   . LEU A  1 246 ? 126.792 137.720 144.034 1.00 85.25  ? 246 LEU A HG   1 
ATOM   3960  H  HD11 . LEU A  1 246 ? 124.504 137.238 144.052 1.00 85.25  ? 246 LEU A HD11 1 
ATOM   3961  H  HD12 . LEU A  1 246 ? 125.382 135.916 144.057 1.00 85.25  ? 246 LEU A HD12 1 
ATOM   3962  H  HD13 . LEU A  1 246 ? 124.710 136.438 145.398 1.00 85.25  ? 246 LEU A HD13 1 
ATOM   3963  H  HD21 . LEU A  1 246 ? 125.438 139.352 144.865 1.00 85.25  ? 246 LEU A HD21 1 
ATOM   3964  H  HD22 . LEU A  1 246 ? 125.412 138.642 146.289 1.00 85.25  ? 246 LEU A HD22 1 
ATOM   3965  H  HD23 . LEU A  1 246 ? 126.752 139.320 145.764 1.00 85.25  ? 246 LEU A HD23 1 
ATOM   3966  N  N    . LEU A  1 247 ? 130.247 136.392 144.606 1.00 82.36  ? 247 LEU A N    1 
ATOM   3967  C  CA   . LEU A  1 247 ? 131.321 136.823 143.718 1.00 82.36  ? 247 LEU A CA   1 
ATOM   3968  C  C    . LEU A  1 247 ? 131.700 135.719 142.735 1.00 82.36  ? 247 LEU A C    1 
ATOM   3969  O  O    . LEU A  1 247 ? 131.955 135.984 141.553 1.00 82.36  ? 247 LEU A O    1 
ATOM   3970  C  CB   . LEU A  1 247 ? 132.528 137.254 144.547 1.00 82.36  ? 247 LEU A CB   1 
ATOM   3971  C  CG   . LEU A  1 247 ? 133.797 137.609 143.782 1.00 82.36  ? 247 LEU A CG   1 
ATOM   3972  C  CD1  . LEU A  1 247 ? 133.599 138.883 142.999 1.00 82.36  ? 247 LEU A CD1  1 
ATOM   3973  C  CD2  . LEU A  1 247 ? 134.941 137.755 144.753 1.00 82.36  ? 247 LEU A CD2  1 
ATOM   3974  H  H    . LEU A  1 247 ? 130.461 136.356 145.437 1.00 82.36  ? 247 LEU A H    1 
ATOM   3975  H  HA   . LEU A  1 247 ? 131.019 137.588 143.207 1.00 82.36  ? 247 LEU A HA   1 
ATOM   3976  H  HB2  . LEU A  1 247 ? 132.277 138.038 145.058 1.00 82.36  ? 247 LEU A HB2  1 
ATOM   3977  H  HB3  . LEU A  1 247 ? 132.750 136.534 145.155 1.00 82.36  ? 247 LEU A HB3  1 
ATOM   3978  H  HG   . LEU A  1 247 ? 134.012 136.899 143.161 1.00 82.36  ? 247 LEU A HG   1 
ATOM   3979  H  HD11 . LEU A  1 247 ? 134.420 139.094 142.530 1.00 82.36  ? 247 LEU A HD11 1 
ATOM   3980  H  HD12 . LEU A  1 247 ? 132.879 138.751 142.365 1.00 82.36  ? 247 LEU A HD12 1 
ATOM   3981  H  HD13 . LEU A  1 247 ? 133.374 139.597 143.614 1.00 82.36  ? 247 LEU A HD13 1 
ATOM   3982  H  HD21 . LEU A  1 247 ? 135.747 137.972 144.261 1.00 82.36  ? 247 LEU A HD21 1 
ATOM   3983  H  HD22 . LEU A  1 247 ? 134.728 138.467 145.374 1.00 82.36  ? 247 LEU A HD22 1 
ATOM   3984  H  HD23 . LEU A  1 247 ? 135.055 136.921 145.233 1.00 82.36  ? 247 LEU A HD23 1 
ATOM   3985  N  N    . SER A  1 248 ? 131.751 134.474 143.209 1.00 83.05  ? 248 SER A N    1 
ATOM   3986  C  CA   . SER A  1 248 ? 132.050 133.359 142.318 1.00 83.05  ? 248 SER A CA   1 
ATOM   3987  C  C    . SER A  1 248 ? 130.976 133.216 141.250 1.00 83.05  ? 248 SER A C    1 
ATOM   3988  O  O    . SER A  1 248 ? 131.277 132.926 140.087 1.00 83.05  ? 248 SER A O    1 
ATOM   3989  C  CB   . SER A  1 248 ? 132.182 132.067 143.120 1.00 83.05  ? 248 SER A CB   1 
ATOM   3990  O  OG   . SER A  1 248 ? 133.256 132.146 144.036 1.00 83.05  ? 248 SER A OG   1 
ATOM   3991  H  H    . SER A  1 248 ? 131.616 134.252 144.027 1.00 83.05  ? 248 SER A H    1 
ATOM   3992  H  HA   . SER A  1 248 ? 132.895 133.525 141.878 1.00 83.05  ? 248 SER A HA   1 
ATOM   3993  H  HB2  . SER A  1 248 ? 131.360 131.919 143.610 1.00 83.05  ? 248 SER A HB2  1 
ATOM   3994  H  HB3  . SER A  1 248 ? 132.342 131.334 142.507 1.00 83.05  ? 248 SER A HB3  1 
ATOM   3995  H  HG   . SER A  1 248 ? 133.176 132.837 144.505 1.00 83.05  ? 248 SER A HG   1 
ATOM   3996  N  N    . LEU A  1 249 ? 129.713 133.413 141.628 1.00 85.63  ? 249 LEU A N    1 
ATOM   3997  C  CA   . LEU A  1 249 ? 128.636 133.396 140.644 1.00 85.63  ? 249 LEU A CA   1 
ATOM   3998  C  C    . LEU A  1 249 ? 128.800 134.525 139.633 1.00 85.63  ? 249 LEU A C    1 
ATOM   3999  O  O    . LEU A  1 249 ? 128.598 134.332 138.426 1.00 85.63  ? 249 LEU A O    1 
ATOM   4000  C  CB   . LEU A  1 249 ? 127.291 133.502 141.356 1.00 85.63  ? 249 LEU A CB   1 
ATOM   4001  C  CG   . LEU A  1 249 ? 126.037 133.413 140.496 1.00 85.63  ? 249 LEU A CG   1 
ATOM   4002  C  CD1  . LEU A  1 249 ? 125.925 132.053 139.831 1.00 85.63  ? 249 LEU A CD1  1 
ATOM   4003  C  CD2  . LEU A  1 249 ? 124.832 133.689 141.356 1.00 85.63  ? 249 LEU A CD2  1 
ATOM   4004  H  H    . LEU A  1 249 ? 129.458 133.561 142.434 1.00 85.63  ? 249 LEU A H    1 
ATOM   4005  H  HA   . LEU A  1 249 ? 128.657 132.555 140.164 1.00 85.63  ? 249 LEU A HA   1 
ATOM   4006  H  HB2  . LEU A  1 249 ? 127.239 132.787 142.008 1.00 85.63  ? 249 LEU A HB2  1 
ATOM   4007  H  HB3  . LEU A  1 249 ? 127.261 134.356 141.811 1.00 85.63  ? 249 LEU A HB3  1 
ATOM   4008  H  HG   . LEU A  1 249 ? 126.077 134.092 139.807 1.00 85.63  ? 249 LEU A HG   1 
ATOM   4009  H  HD11 . LEU A  1 249 ? 125.077 131.997 139.365 1.00 85.63  ? 249 LEU A HD11 1 
ATOM   4010  H  HD12 . LEU A  1 249 ? 126.655 131.947 139.204 1.00 85.63  ? 249 LEU A HD12 1 
ATOM   4011  H  HD13 . LEU A  1 249 ? 125.974 131.366 140.514 1.00 85.63  ? 249 LEU A HD13 1 
ATOM   4012  H  HD21 . LEU A  1 249 ? 124.049 133.762 140.788 1.00 85.63  ? 249 LEU A HD21 1 
ATOM   4013  H  HD22 . LEU A  1 249 ? 124.726 132.958 141.983 1.00 85.63  ? 249 LEU A HD22 1 
ATOM   4014  H  HD23 . LEU A  1 249 ? 124.978 134.518 141.835 1.00 85.63  ? 249 LEU A HD23 1 
ATOM   4015  N  N    . THR A  1 250 ? 129.159 135.715 140.113 1.00 82.85  ? 250 THR A N    1 
ATOM   4016  C  CA   . THR A  1 250 ? 129.416 136.837 139.218 1.00 82.85  ? 250 THR A CA   1 
ATOM   4017  C  C    . THR A  1 250 ? 130.493 136.489 138.200 1.00 82.85  ? 250 THR A C    1 
ATOM   4018  O  O    . THR A  1 250 ? 130.377 136.832 137.019 1.00 82.85  ? 250 THR A O    1 
ATOM   4019  C  CB   . THR A  1 250 ? 129.825 138.063 140.035 1.00 82.85  ? 250 THR A CB   1 
ATOM   4020  O  OG1  . THR A  1 250 ? 128.739 138.462 140.880 1.00 82.85  ? 250 THR A OG1  1 
ATOM   4021  C  CG2  . THR A  1 250 ? 130.211 139.220 139.133 1.00 82.85  ? 250 THR A CG2  1 
ATOM   4022  H  H    . THR A  1 250 ? 129.254 135.897 140.946 1.00 82.85  ? 250 THR A H    1 
ATOM   4023  H  HA   . THR A  1 250 ? 128.603 137.054 138.739 1.00 82.85  ? 250 THR A HA   1 
ATOM   4024  H  HB   . THR A  1 250 ? 130.590 137.837 140.583 1.00 82.85  ? 250 THR A HB   1 
ATOM   4025  H  HG1  . THR A  1 250 ? 128.578 137.857 141.440 1.00 82.85  ? 250 THR A HG1  1 
ATOM   4026  H  HG21 . THR A  1 250 ? 130.384 140.008 139.670 1.00 82.85  ? 250 THR A HG21 1 
ATOM   4027  H  HG22 . THR A  1 250 ? 131.011 139.004 138.632 1.00 82.85  ? 250 THR A HG22 1 
ATOM   4028  H  HG23 . THR A  1 250 ? 129.489 139.411 138.517 1.00 82.85  ? 250 THR A HG23 1 
ATOM   4029  N  N    . VAL A  1 251 ? 131.557 135.819 138.643 1.00 82.49  ? 251 VAL A N    1 
ATOM   4030  C  CA   . VAL A  1 251 ? 132.597 135.387 137.711 1.00 82.49  ? 251 VAL A CA   1 
ATOM   4031  C  C    . VAL A  1 251 ? 132.036 134.366 136.727 1.00 82.49  ? 251 VAL A C    1 
ATOM   4032  O  O    . VAL A  1 251 ? 132.283 134.438 135.518 1.00 82.49  ? 251 VAL A O    1 
ATOM   4033  C  CB   . VAL A  1 251 ? 133.807 134.821 138.472 1.00 82.49  ? 251 VAL A CB   1 
ATOM   4034  C  CG1  . VAL A  1 251 ? 134.850 134.327 137.496 1.00 82.49  ? 251 VAL A CG1  1 
ATOM   4035  C  CG2  . VAL A  1 251 ? 134.403 135.874 139.370 1.00 82.49  ? 251 VAL A CG2  1 
ATOM   4036  H  H    . VAL A  1 251 ? 131.699 135.608 139.463 1.00 82.49  ? 251 VAL A H    1 
ATOM   4037  H  HA   . VAL A  1 251 ? 132.899 136.155 137.205 1.00 82.49  ? 251 VAL A HA   1 
ATOM   4038  H  HB   . VAL A  1 251 ? 133.522 134.073 139.018 1.00 82.49  ? 251 VAL A HB   1 
ATOM   4039  H  HG11 . VAL A  1 251 ? 135.642 134.069 137.990 1.00 82.49  ? 251 VAL A HG11 1 
ATOM   4040  H  HG12 . VAL A  1 251 ? 134.498 133.565 137.011 1.00 82.49  ? 251 VAL A HG12 1 
ATOM   4041  H  HG13 . VAL A  1 251 ? 135.061 135.044 136.880 1.00 82.49  ? 251 VAL A HG13 1 
ATOM   4042  H  HG21 . VAL A  1 251 ? 135.160 135.492 139.841 1.00 82.49  ? 251 VAL A HG21 1 
ATOM   4043  H  HG22 . VAL A  1 251 ? 134.697 136.616 138.820 1.00 82.49  ? 251 VAL A HG22 1 
ATOM   4044  H  HG23 . VAL A  1 251 ? 133.731 136.174 139.999 1.00 82.49  ? 251 VAL A HG23 1 
ATOM   4045  N  N    . PHE A  1 252 ? 131.275 133.395 137.236 1.00 83.42  ? 252 PHE A N    1 
ATOM   4046  C  CA   . PHE A  1 252 ? 130.672 132.383 136.375 1.00 83.42  ? 252 PHE A CA   1 
ATOM   4047  C  C    . PHE A  1 252 ? 129.841 133.022 135.274 1.00 83.42  ? 252 PHE A C    1 
ATOM   4048  O  O    . PHE A  1 252 ? 129.720 132.465 134.172 1.00 83.42  ? 252 PHE A O    1 
ATOM   4049  C  CB   . PHE A  1 252 ? 129.813 131.446 137.224 1.00 83.42  ? 252 PHE A CB   1 
ATOM   4050  C  CG   . PHE A  1 252 ? 129.226 130.298 136.467 1.00 83.42  ? 252 PHE A CG   1 
ATOM   4051  C  CD1  . PHE A  1 252 ? 130.025 129.263 136.021 1.00 83.42  ? 252 PHE A CD1  1 
ATOM   4052  C  CD2  . PHE A  1 252 ? 127.866 130.238 136.226 1.00 83.42  ? 252 PHE A CD2  1 
ATOM   4053  C  CE1  . PHE A  1 252 ? 129.482 128.202 135.333 1.00 83.42  ? 252 PHE A CE1  1 
ATOM   4054  C  CE2  . PHE A  1 252 ? 127.319 129.178 135.541 1.00 83.42  ? 252 PHE A CE2  1 
ATOM   4055  C  CZ   . PHE A  1 252 ? 128.126 128.161 135.094 1.00 83.42  ? 252 PHE A CZ   1 
ATOM   4056  H  H    . PHE A  1 252 ? 131.095 133.305 138.071 1.00 83.42  ? 252 PHE A H    1 
ATOM   4057  H  HA   . PHE A  1 252 ? 131.372 131.857 135.962 1.00 83.42  ? 252 PHE A HA   1 
ATOM   4058  H  HB2  . PHE A  1 252 ? 130.358 131.080 137.936 1.00 83.42  ? 252 PHE A HB2  1 
ATOM   4059  H  HB3  . PHE A  1 252 ? 129.078 131.955 137.595 1.00 83.42  ? 252 PHE A HB3  1 
ATOM   4060  H  HD1  . PHE A  1 252 ? 130.940 129.289 136.181 1.00 83.42  ? 252 PHE A HD1  1 
ATOM   4061  H  HD2  . PHE A  1 252 ? 127.316 130.925 136.525 1.00 83.42  ? 252 PHE A HD2  1 
ATOM   4062  H  HE1  . PHE A  1 252 ? 130.029 127.514 135.033 1.00 83.42  ? 252 PHE A HE1  1 
ATOM   4063  H  HE2  . PHE A  1 252 ? 126.405 129.152 135.379 1.00 83.42  ? 252 PHE A HE2  1 
ATOM   4064  H  HZ   . PHE A  1 252 ? 127.756 127.446 134.631 1.00 83.42  ? 252 PHE A HZ   1 
ATOM   4065  N  N    . MET A  1 253 ? 129.269 134.193 135.555 1.00 84.42  ? 253 MET A N    1 
ATOM   4066  C  CA   . MET A  1 253 ? 128.489 134.894 134.545 1.00 84.42  ? 253 MET A CA   1 
ATOM   4067  C  C    . MET A  1 253 ? 129.307 135.226 133.306 1.00 84.42  ? 253 MET A C    1 
ATOM   4068  O  O    . MET A  1 253 ? 128.727 135.411 132.239 1.00 84.42  ? 253 MET A O    1 
ATOM   4069  C  CB   . MET A  1 253 ? 127.894 136.178 135.117 1.00 84.42  ? 253 MET A CB   1 
ATOM   4070  C  CG   . MET A  1 253 ? 126.886 135.940 136.207 1.00 84.42  ? 253 MET A CG   1 
ATOM   4071  S  SD   . MET A  1 253 ? 125.432 135.055 135.623 1.00 84.42  ? 253 MET A SD   1 
ATOM   4072  C  CE   . MET A  1 253 ? 124.614 134.755 137.179 1.00 84.42  ? 253 MET A CE   1 
ATOM   4073  H  H    . MET A  1 253 ? 129.319 134.596 136.311 1.00 84.42  ? 253 MET A H    1 
ATOM   4074  H  HA   . MET A  1 253 ? 127.749 134.328 134.287 1.00 84.42  ? 253 MET A HA   1 
ATOM   4075  H  HB2  . MET A  1 253 ? 128.606 136.722 135.481 1.00 84.42  ? 253 MET A HB2  1 
ATOM   4076  H  HB3  . MET A  1 253 ? 127.446 136.656 134.403 1.00 84.42  ? 253 MET A HB3  1 
ATOM   4077  H  HG2  . MET A  1 253 ? 127.296 135.408 136.900 1.00 84.42  ? 253 MET A HG2  1 
ATOM   4078  H  HG3  . MET A  1 253 ? 126.600 136.795 136.564 1.00 84.42  ? 253 MET A HG3  1 
ATOM   4079  H  HE1  . MET A  1 253 ? 123.793 134.267 137.024 1.00 84.42  ? 253 MET A HE1  1 
ATOM   4080  H  HE2  . MET A  1 253 ? 125.206 134.239 137.747 1.00 84.42  ? 253 MET A HE2  1 
ATOM   4081  H  HE3  . MET A  1 253 ? 124.422 135.611 137.589 1.00 84.42  ? 253 MET A HE3  1 
ATOM   4082  N  N    . LEU A  1 254 ? 130.635 135.295 133.409 1.00 80.80  ? 254 LEU A N    1 
ATOM   4083  C  CA   . LEU A  1 254 ? 131.446 135.581 132.228 1.00 80.80  ? 254 LEU A CA   1 
ATOM   4084  C  C    . LEU A  1 254 ? 131.409 134.423 131.234 1.00 80.80  ? 254 LEU A C    1 
ATOM   4085  O  O    . LEU A  1 254 ? 131.119 134.618 130.043 1.00 80.80  ? 254 LEU A O    1 
ATOM   4086  C  CB   . LEU A  1 254 ? 132.882 135.882 132.653 1.00 80.80  ? 254 LEU A CB   1 
ATOM   4087  C  CG   . LEU A  1 254 ? 133.111 137.263 133.270 1.00 80.80  ? 254 LEU A CG   1 
ATOM   4088  C  CD1  . LEU A  1 254 ? 134.418 137.327 134.014 1.00 80.80  ? 254 LEU A CD1  1 
ATOM   4089  C  CD2  . LEU A  1 254 ? 133.112 138.313 132.193 1.00 80.80  ? 254 LEU A CD2  1 
ATOM   4090  H  H    . LEU A  1 254 ? 131.079 135.184 134.134 1.00 80.80  ? 254 LEU A H    1 
ATOM   4091  H  HA   . LEU A  1 254 ? 131.087 136.366 131.788 1.00 80.80  ? 254 LEU A HA   1 
ATOM   4092  H  HB2  . LEU A  1 254 ? 133.150 135.219 133.304 1.00 80.80  ? 254 LEU A HB2  1 
ATOM   4093  H  HB3  . LEU A  1 254 ? 133.448 135.816 131.870 1.00 80.80  ? 254 LEU A HB3  1 
ATOM   4094  H  HG   . LEU A  1 254 ? 132.395 137.464 133.890 1.00 80.80  ? 254 LEU A HG   1 
ATOM   4095  H  HD11 . LEU A  1 254 ? 134.469 138.182 134.468 1.00 80.80  ? 254 LEU A HD11 1 
ATOM   4096  H  HD12 . LEU A  1 254 ? 134.455 136.604 134.657 1.00 80.80  ? 254 LEU A HD12 1 
ATOM   4097  H  HD13 . LEU A  1 254 ? 135.142 137.247 133.375 1.00 80.80  ? 254 LEU A HD13 1 
ATOM   4098  H  HD21 . LEU A  1 254 ? 133.222 139.179 132.615 1.00 80.80  ? 254 LEU A HD21 1 
ATOM   4099  H  HD22 . LEU A  1 254 ? 133.848 138.143 131.587 1.00 80.80  ? 254 LEU A HD22 1 
ATOM   4100  H  HD23 . LEU A  1 254 ? 132.269 138.278 131.717 1.00 80.80  ? 254 LEU A HD23 1 
ATOM   4101  N  N    . LEU A  1 255 ? 131.713 133.210 131.703 1.00 80.79  ? 255 LEU A N    1 
ATOM   4102  C  CA   . LEU A  1 255 ? 131.536 132.024 130.871 1.00 80.79  ? 255 LEU A CA   1 
ATOM   4103  C  C    . LEU A  1 255 ? 130.114 131.965 130.349 1.00 80.79  ? 255 LEU A C    1 
ATOM   4104  O  O    . LEU A  1 255 ? 129.867 131.763 129.150 1.00 80.79  ? 255 LEU A O    1 
ATOM   4105  C  CB   . LEU A  1 255 ? 131.822 130.761 131.682 1.00 80.79  ? 255 LEU A CB   1 
ATOM   4106  C  CG   . LEU A  1 255 ? 133.255 130.345 131.984 1.00 80.79  ? 255 LEU A CG   1 
ATOM   4107  C  CD1  . LEU A  1 255 ? 133.853 131.282 133.002 1.00 80.79  ? 255 LEU A CD1  1 
ATOM   4108  C  CD2  . LEU A  1 255 ? 133.278 128.923 132.494 1.00 80.79  ? 255 LEU A CD2  1 
ATOM   4109  H  H    . LEU A  1 255 ? 132.012 133.053 132.490 1.00 80.79  ? 255 LEU A H    1 
ATOM   4110  H  HA   . LEU A  1 255 ? 132.148 132.055 130.123 1.00 80.79  ? 255 LEU A HA   1 
ATOM   4111  H  HB2  . LEU A  1 255 ? 131.382 130.870 132.538 1.00 80.79  ? 255 LEU A HB2  1 
ATOM   4112  H  HB3  . LEU A  1 255 ? 131.411 130.018 131.215 1.00 80.79  ? 255 LEU A HB3  1 
ATOM   4113  H  HG   . LEU A  1 255 ? 133.782 130.389 131.172 1.00 80.79  ? 255 LEU A HG   1 
ATOM   4114  H  HD11 . LEU A  1 255 ? 134.791 131.067 133.109 1.00 80.79  ? 255 LEU A HD11 1 
ATOM   4115  H  HD12 . LEU A  1 255 ? 133.759 132.190 132.684 1.00 80.79  ? 255 LEU A HD12 1 
ATOM   4116  H  HD13 . LEU A  1 255 ? 133.390 131.174 133.847 1.00 80.79  ? 255 LEU A HD13 1 
ATOM   4117  H  HD21 . LEU A  1 255 ? 134.197 128.662 132.657 1.00 80.79  ? 255 LEU A HD21 1 
ATOM   4118  H  HD22 . LEU A  1 255 ? 132.771 128.885 133.319 1.00 80.79  ? 255 LEU A HD22 1 
ATOM   4119  H  HD23 . LEU A  1 255 ? 132.877 128.344 131.829 1.00 80.79  ? 255 LEU A HD23 1 
ATOM   4120  N  N    . VAL A  1 256 ? 129.161 132.148 131.258 1.00 82.07  ? 256 VAL A N    1 
ATOM   4121  C  CA   . VAL A  1 256 ? 127.754 132.040 130.911 1.00 82.07  ? 256 VAL A CA   1 
ATOM   4122  C  C    . VAL A  1 256 ? 127.422 132.984 129.760 1.00 82.07  ? 256 VAL A C    1 
ATOM   4123  O  O    . VAL A  1 256 ? 126.795 132.588 128.773 1.00 82.07  ? 256 VAL A O    1 
ATOM   4124  C  CB   . VAL A  1 256 ? 126.910 132.300 132.172 1.00 82.07  ? 256 VAL A CB   1 
ATOM   4125  C  CG1  . VAL A  1 256 ? 125.520 132.700 131.853 1.00 82.07  ? 256 VAL A CG1  1 
ATOM   4126  C  CG2  . VAL A  1 256 ? 126.898 131.060 133.034 1.00 82.07  ? 256 VAL A CG2  1 
ATOM   4127  H  H    . VAL A  1 256 ? 129.309 132.336 132.082 1.00 82.07  ? 256 VAL A H    1 
ATOM   4128  H  HA   . VAL A  1 256 ? 127.572 131.136 130.618 1.00 82.07  ? 256 VAL A HA   1 
ATOM   4129  H  HB   . VAL A  1 256 ? 127.321 133.011 132.681 1.00 82.07  ? 256 VAL A HB   1 
ATOM   4130  H  HG11 . VAL A  1 256 ? 124.992 132.591 132.656 1.00 82.07  ? 256 VAL A HG11 1 
ATOM   4131  H  HG12 . VAL A  1 256 ? 125.531 133.632 131.600 1.00 82.07  ? 256 VAL A HG12 1 
ATOM   4132  H  HG13 . VAL A  1 256 ? 125.175 132.142 131.140 1.00 82.07  ? 256 VAL A HG13 1 
ATOM   4133  H  HG21 . VAL A  1 256 ? 126.342 131.219 133.812 1.00 82.07  ? 256 VAL A HG21 1 
ATOM   4134  H  HG22 . VAL A  1 256 ? 126.539 130.325 132.514 1.00 82.07  ? 256 VAL A HG22 1 
ATOM   4135  H  HG23 . VAL A  1 256 ? 127.806 130.859 133.310 1.00 82.07  ? 256 VAL A HG23 1 
ATOM   4136  N  N    . ALA A  1 257 ? 127.892 134.228 129.838 1.00 79.14  ? 257 ALA A N    1 
ATOM   4137  C  CA   . ALA A  1 257 ? 127.623 135.200 128.785 1.00 79.14  ? 257 ALA A CA   1 
ATOM   4138  C  C    . ALA A  1 257 ? 128.283 134.795 127.475 1.00 79.14  ? 257 ALA A C    1 
ATOM   4139  O  O    . ALA A  1 257 ? 127.638 134.801 126.420 1.00 79.14  ? 257 ALA A O    1 
ATOM   4140  C  CB   . ALA A  1 257 ? 128.108 136.583 129.213 1.00 79.14  ? 257 ALA A CB   1 
ATOM   4141  H  H    . ALA A  1 257 ? 128.367 134.529 130.486 1.00 79.14  ? 257 ALA A H    1 
ATOM   4142  H  HA   . ALA A  1 257 ? 126.667 135.249 128.637 1.00 79.14  ? 257 ALA A HA   1 
ATOM   4143  H  HB1  . ALA A  1 257 ? 127.934 137.210 128.494 1.00 79.14  ? 257 ALA A HB1  1 
ATOM   4144  H  HB2  . ALA A  1 257 ? 127.636 136.851 130.015 1.00 79.14  ? 257 ALA A HB2  1 
ATOM   4145  H  HB3  . ALA A  1 257 ? 129.061 136.536 129.384 1.00 79.14  ? 257 ALA A HB3  1 
ATOM   4146  N  N    . GLU A  1 258 ? 129.571 134.445 127.513 1.00 80.43  ? 258 GLU A N    1 
ATOM   4147  C  CA   . GLU A  1 258 ? 130.247 134.110 126.264 1.00 80.43  ? 258 GLU A CA   1 
ATOM   4148  C  C    . GLU A  1 258 ? 129.652 132.873 125.609 1.00 80.43  ? 258 GLU A C    1 
ATOM   4149  O  O    . GLU A  1 258 ? 129.908 132.633 124.424 1.00 80.43  ? 258 GLU A O    1 
ATOM   4150  C  CB   . GLU A  1 258 ? 131.747 133.896 126.481 1.00 80.43  ? 258 GLU A CB   1 
ATOM   4151  C  CG   . GLU A  1 258 ? 132.100 132.699 127.333 1.00 80.43  ? 258 GLU A CG   1 
ATOM   4152  C  CD   . GLU A  1 258 ? 133.594 132.572 127.566 1.00 80.43  ? 258 GLU A CD   1 
ATOM   4153  O  OE1  . GLU A  1 258 ? 134.348 133.444 127.085 1.00 80.43  ? 258 GLU A OE1  1 
ATOM   4154  O  OE2  . GLU A  1 258 ? 134.016 131.597 128.224 1.00 80.43  ? 258 GLU A OE2  1 
ATOM   4155  H  H    . GLU A  1 258 ? 130.058 134.402 128.219 1.00 80.43  ? 258 GLU A H    1 
ATOM   4156  H  HA   . GLU A  1 258 ? 130.141 134.847 125.646 1.00 80.43  ? 258 GLU A HA   1 
ATOM   4157  H  HB2  . GLU A  1 258 ? 132.163 133.763 125.616 1.00 80.43  ? 258 GLU A HB2  1 
ATOM   4158  H  HB3  . GLU A  1 258 ? 132.119 134.684 126.905 1.00 80.43  ? 258 GLU A HB3  1 
ATOM   4159  H  HG2  . GLU A  1 258 ? 131.669 132.798 128.191 1.00 80.43  ? 258 GLU A HG2  1 
ATOM   4160  H  HG3  . GLU A  1 258 ? 131.796 131.891 126.893 1.00 80.43  ? 258 GLU A HG3  1 
ATOM   4161  N  N    . ILE A  1 259 ? 128.866 132.082 126.344 1.00 78.81  ? 259 ILE A N    1 
ATOM   4162  C  CA   . ILE A  1 259 ? 128.324 130.840 125.796 1.00 78.81  ? 259 ILE A CA   1 
ATOM   4163  C  C    . ILE A  1 259 ? 126.862 130.948 125.362 1.00 78.81  ? 259 ILE A C    1 
ATOM   4164  O  O    . ILE A  1 259 ? 126.382 130.063 124.634 1.00 78.81  ? 259 ILE A O    1 
ATOM   4165  C  CB   . ILE A  1 259 ? 128.508 129.688 126.809 1.00 78.81  ? 259 ILE A CB   1 
ATOM   4166  C  CG1  . ILE A  1 259 ? 129.973 129.250 126.814 1.00 78.81  ? 259 ILE A CG1  1 
ATOM   4167  C  CG2  . ILE A  1 259 ? 127.619 128.508 126.477 1.00 78.81  ? 259 ILE A CG2  1 
ATOM   4168  C  CD1  . ILE A  1 259 ? 130.349 128.343 127.952 1.00 78.81  ? 259 ILE A CD1  1 
ATOM   4169  H  H    . ILE A  1 259 ? 128.631 132.244 127.154 1.00 78.81  ? 259 ILE A H    1 
ATOM   4170  H  HA   . ILE A  1 259 ? 128.836 130.605 125.007 1.00 78.81  ? 259 ILE A HA   1 
ATOM   4171  H  HB   . ILE A  1 259 ? 128.275 130.009 127.693 1.00 78.81  ? 259 ILE A HB   1 
ATOM   4172  H  HG12 . ILE A  1 259 ? 130.156 128.777 125.988 1.00 78.81  ? 259 ILE A HG12 1 
ATOM   4173  H  HG13 . ILE A  1 259 ? 130.532 130.040 126.869 1.00 78.81  ? 259 ILE A HG13 1 
ATOM   4174  H  HG21 . ILE A  1 259 ? 127.901 127.745 127.003 1.00 78.81  ? 259 ILE A HG21 1 
ATOM   4175  H  HG22 . ILE A  1 259 ? 126.700 128.730 126.691 1.00 78.81  ? 259 ILE A HG22 1 
ATOM   4176  H  HG23 . ILE A  1 259 ? 127.708 128.306 125.533 1.00 78.81  ? 259 ILE A HG23 1 
ATOM   4177  H  HD11 . ILE A  1 259 ? 131.316 128.272 127.991 1.00 78.81  ? 259 ILE A HD11 1 
ATOM   4178  H  HD12 . ILE A  1 259 ? 130.011 128.720 128.779 1.00 78.81  ? 259 ILE A HD12 1 
ATOM   4179  H  HD13 . ILE A  1 259 ? 129.959 127.469 127.801 1.00 78.81  ? 259 ILE A HD13 1 
ATOM   4180  N  N    . MET A  1 260 ? 126.154 132.002 125.738 1.00 76.14  ? 260 MET A N    1 
ATOM   4181  C  CA   . MET A  1 260 ? 124.727 132.113 125.473 1.00 76.14  ? 260 MET A CA   1 
ATOM   4182  C  C    . MET A  1 260 ? 124.448 132.989 124.264 1.00 76.14  ? 260 MET A C    1 
ATOM   4183  O  O    . MET A  1 260 ? 125.344 133.637 123.716 1.00 76.14  ? 260 MET A O    1 
ATOM   4184  C  CB   . MET A  1 260 ? 124.002 132.700 126.679 1.00 76.14  ? 260 MET A CB   1 
ATOM   4185  C  CG   . MET A  1 260 ? 123.956 131.842 127.906 1.00 76.14  ? 260 MET A CG   1 
ATOM   4186  S  SD   . MET A  1 260 ? 122.972 132.731 129.121 1.00 76.14  ? 260 MET A SD   1 
ATOM   4187  C  CE   . MET A  1 260 ? 124.099 134.065 129.498 1.00 76.14  ? 260 MET A CE   1 
ATOM   4188  H  H    . MET A  1 260 ? 126.485 132.681 126.147 1.00 76.14  ? 260 MET A H    1 
ATOM   4189  H  HA   . MET A  1 260 ? 124.373 131.228 125.310 1.00 76.14  ? 260 MET A HA   1 
ATOM   4190  H  HB2  . MET A  1 260 ? 124.467 133.515 126.924 1.00 76.14  ? 260 MET A HB2  1 
ATOM   4191  H  HB3  . MET A  1 260 ? 123.093 132.917 126.441 1.00 76.14  ? 260 MET A HB3  1 
ATOM   4192  H  HG2  . MET A  1 260 ? 123.517 131.004 127.697 1.00 76.14  ? 260 MET A HG2  1 
ATOM   4193  H  HG3  . MET A  1 260 ? 124.845 131.682 128.249 1.00 76.14  ? 260 MET A HG3  1 
ATOM   4194  H  HE1  . MET A  1 260 ? 123.913 134.395 130.388 1.00 76.14  ? 260 MET A HE1  1 
ATOM   4195  H  HE2  . MET A  1 260 ? 124.992 133.714 129.459 1.00 76.14  ? 260 MET A HE2  1 
ATOM   4196  H  HE3  . MET A  1 260 ? 124.005 134.776 128.841 1.00 76.14  ? 260 MET A HE3  1 
ATOM   4197  N  N    . PRO A  1 261 ? 123.193 133.033 123.820 1.00 62.81  ? 261 PRO A N    1 
ATOM   4198  C  CA   . PRO A  1 261 ? 122.782 134.003 122.806 1.00 62.81  ? 261 PRO A CA   1 
ATOM   4199  C  C    . PRO A  1 261 ? 122.279 135.298 123.421 1.00 62.81  ? 261 PRO A C    1 
ATOM   4200  O  O    . PRO A  1 261 ? 121.783 135.339 124.549 1.00 62.81  ? 261 PRO A O    1 
ATOM   4201  C  CB   . PRO A  1 261 ? 121.644 133.267 122.086 1.00 62.81  ? 261 PRO A CB   1 
ATOM   4202  C  CG   . PRO A  1 261 ? 121.019 132.460 123.162 1.00 62.81  ? 261 PRO A CG   1 
ATOM   4203  C  CD   . PRO A  1 261 ? 122.125 132.055 124.096 1.00 62.81  ? 261 PRO A CD   1 
ATOM   4204  H  HA   . PRO A  1 261 ? 123.500 134.192 122.184 1.00 62.81  ? 261 PRO A HA   1 
ATOM   4205  H  HB2  . PRO A  1 261 ? 121.015 133.907 121.722 1.00 62.81  ? 261 PRO A HB2  1 
ATOM   4206  H  HB3  . PRO A  1 261 ? 122.005 132.694 121.394 1.00 62.81  ? 261 PRO A HB3  1 
ATOM   4207  H  HG2  . PRO A  1 261 ? 120.366 132.998 123.634 1.00 62.81  ? 261 PRO A HG2  1 
ATOM   4208  H  HG3  . PRO A  1 261 ? 120.598 131.676 122.779 1.00 62.81  ? 261 PRO A HG3  1 
ATOM   4209  H  HD2  . PRO A  1 261 ? 121.817 132.127 125.011 1.00 62.81  ? 261 PRO A HD2  1 
ATOM   4210  H  HD3  . PRO A  1 261 ? 122.429 131.159 123.891 1.00 62.81  ? 261 PRO A HD3  1 
ATOM   4211  N  N    . ALA A  1 262 ? 122.414 136.371 122.651 1.00 58.75  ? 262 ALA A N    1 
ATOM   4212  C  CA   . ALA A  1 262 ? 121.923 137.692 123.036 1.00 58.75  ? 262 ALA A CA   1 
ATOM   4213  C  C    . ALA A  1 262 ? 120.706 137.993 122.167 1.00 58.75  ? 262 ALA A C    1 
ATOM   4214  O  O    . ALA A  1 262 ? 120.821 138.585 121.092 1.00 58.75  ? 262 ALA A O    1 
ATOM   4215  C  CB   . ALA A  1 262 ? 123.004 138.755 122.881 1.00 58.75  ? 262 ALA A CB   1 
ATOM   4216  H  H    . ALA A  1 262 ? 122.796 136.358 121.882 1.00 58.75  ? 262 ALA A H    1 
ATOM   4217  H  HA   . ALA A  1 262 ? 121.638 137.675 123.962 1.00 58.75  ? 262 ALA A HA   1 
ATOM   4218  H  HB1  . ALA A  1 262 ? 122.654 139.604 123.191 1.00 58.75  ? 262 ALA A HB1  1 
ATOM   4219  H  HB2  . ALA A  1 262 ? 123.775 138.500 123.410 1.00 58.75  ? 262 ALA A HB2  1 
ATOM   4220  H  HB3  . ALA A  1 262 ? 123.250 138.823 121.947 1.00 58.75  ? 262 ALA A HB3  1 
ATOM   4221  N  N    . THR A  1 263 ? 119.536 137.576 122.642 1.00 58.01  ? 263 THR A N    1 
ATOM   4222  C  CA   . THR A  1 263 ? 118.279 137.776 121.939 1.00 58.01  ? 263 THR A CA   1 
ATOM   4223  C  C    . THR A  1 263 ? 117.270 138.415 122.876 1.00 58.01  ? 263 THR A C    1 
ATOM   4224  O  O    . THR A  1 263 ? 117.206 138.075 124.061 1.00 58.01  ? 263 THR A O    1 
ATOM   4225  C  CB   . THR A  1 263 ? 117.716 136.458 121.409 1.00 58.01  ? 263 THR A CB   1 
ATOM   4226  O  OG1  . THR A  1 263 ? 117.717 135.480 122.457 1.00 58.01  ? 263 THR A OG1  1 
ATOM   4227  C  CG2  . THR A  1 263 ? 118.541 135.957 120.234 1.00 58.01  ? 263 THR A CG2  1 
ATOM   4228  H  H    . THR A  1 263 ? 119.444 137.163 123.391 1.00 58.01  ? 263 THR A H    1 
ATOM   4229  H  HA   . THR A  1 263 ? 118.416 138.373 121.189 1.00 58.01  ? 263 THR A HA   1 
ATOM   4230  H  HB   . THR A  1 263 ? 116.807 136.601 121.105 1.00 58.01  ? 263 THR A HB   1 
ATOM   4231  H  HG1  . THR A  1 263 ? 117.270 134.807 122.227 1.00 58.01  ? 263 THR A HG1  1 
ATOM   4232  H  HG21 . THR A  1 263 ? 118.149 135.145 119.876 1.00 58.01  ? 263 THR A HG21 1 
ATOM   4233  H  HG22 . THR A  1 263 ? 118.543 136.633 119.543 1.00 58.01  ? 263 THR A HG22 1 
ATOM   4234  H  HG23 . THR A  1 263 ? 119.457 135.779 120.505 1.00 58.01  ? 263 THR A HG23 1 
ATOM   4235  N  N    . SER A  1 264 ? 116.485 139.343 122.337 1.00 53.83  ? 264 SER A N    1 
ATOM   4236  C  CA   . SER A  1 264 ? 115.423 139.998 123.083 1.00 53.83  ? 264 SER A CA   1 
ATOM   4237  C  C    . SER A  1 264 ? 114.037 139.529 122.664 1.00 53.83  ? 264 SER A C    1 
ATOM   4238  O  O    . SER A  1 264 ? 113.041 140.043 123.180 1.00 53.83  ? 264 SER A O    1 
ATOM   4239  C  CB   . SER A  1 264 ? 115.528 141.514 122.919 1.00 53.83  ? 264 SER A CB   1 
ATOM   4240  O  OG   . SER A  1 264 ? 116.807 141.980 123.310 1.00 53.83  ? 264 SER A OG   1 
ATOM   4241  H  H    . SER A  1 264 ? 116.550 139.612 121.524 1.00 53.83  ? 264 SER A H    1 
ATOM   4242  H  HA   . SER A  1 264 ? 115.533 139.798 124.023 1.00 53.83  ? 264 SER A HA   1 
ATOM   4243  H  HB2  . SER A  1 264 ? 115.379 141.740 121.989 1.00 53.83  ? 264 SER A HB2  1 
ATOM   4244  H  HB3  . SER A  1 264 ? 114.856 141.935 123.474 1.00 53.83  ? 264 SER A HB3  1 
ATOM   4245  H  HG   . SER A  1 264 ? 116.871 142.804 123.164 1.00 53.83  ? 264 SER A HG   1 
ATOM   4246  N  N    . ASP A  1 265 ? 113.948 138.574 121.737 1.00 56.31  ? 265 ASP A N    1 
ATOM   4247  C  CA   . ASP A  1 265 ? 112.657 138.031 121.335 1.00 56.31  ? 265 ASP A CA   1 
ATOM   4248  C  C    . ASP A  1 265 ? 112.090 137.054 122.355 1.00 56.31  ? 265 ASP A C    1 
ATOM   4249  O  O    . ASP A  1 265 ? 110.879 136.809 122.350 1.00 56.31  ? 265 ASP A O    1 
ATOM   4250  C  CB   . ASP A  1 265 ? 112.768 137.333 119.977 1.00 56.31  ? 265 ASP A CB   1 
ATOM   4251  C  CG   . ASP A  1 265 ? 113.967 136.412 119.888 1.00 56.31  ? 265 ASP A CG   1 
ATOM   4252  O  OD1  . ASP A  1 265 ? 114.488 136.013 120.950 1.00 56.31  ? 265 ASP A OD1  1 
ATOM   4253  O  OD2  . ASP A  1 265 ? 114.389 136.087 118.758 1.00 56.31  ? 265 ASP A OD2  1 
ATOM   4254  H  H    . ASP A  1 265 ? 114.622 138.233 121.329 1.00 56.31  ? 265 ASP A H    1 
ATOM   4255  H  HA   . ASP A  1 265 ? 112.027 138.762 121.241 1.00 56.31  ? 265 ASP A HA   1 
ATOM   4256  H  HB2  . ASP A  1 265 ? 111.972 136.798 119.837 1.00 56.31  ? 265 ASP A HB2  1 
ATOM   4257  H  HB3  . ASP A  1 265 ? 112.847 138.000 119.279 1.00 56.31  ? 265 ASP A HB3  1 
ATOM   4258  N  N    . SER A  1 266 ? 112.929 136.494 123.220 1.00 60.84  ? 266 SER A N    1 
ATOM   4259  C  CA   . SER A  1 266 ? 112.479 135.525 124.209 1.00 60.84  ? 266 SER A CA   1 
ATOM   4260  C  C    . SER A  1 266 ? 113.530 135.422 125.302 1.00 60.84  ? 266 SER A C    1 
ATOM   4261  O  O    . SER A  1 266 ? 114.622 135.986 125.199 1.00 60.84  ? 266 SER A O    1 
ATOM   4262  C  CB   . SER A  1 266 ? 112.216 134.160 123.571 1.00 60.84  ? 266 SER A CB   1 
ATOM   4263  O  OG   . SER A  1 266 ? 113.351 133.700 122.861 1.00 60.84  ? 266 SER A OG   1 
ATOM   4264  H  H    . SER A  1 266 ? 113.771 136.662 123.256 1.00 60.84  ? 266 SER A H    1 
ATOM   4265  H  HA   . SER A  1 266 ? 111.653 135.834 124.609 1.00 60.84  ? 266 SER A HA   1 
ATOM   4266  H  HB2  . SER A  1 266 ? 112.007 133.529 124.275 1.00 60.84  ? 266 SER A HB2  1 
ATOM   4267  H  HB3  . SER A  1 266 ? 111.468 134.237 122.960 1.00 60.84  ? 266 SER A HB3  1 
ATOM   4268  H  HG   . SER A  1 266 ? 113.153 133.016 122.415 1.00 60.84  ? 266 SER A HG   1 
ATOM   4269  N  N    . VAL A  1 267 ? 113.182 134.693 126.356 1.00 65.92  ? 267 VAL A N    1 
ATOM   4270  C  CA   . VAL A  1 267 ? 114.047 134.494 127.512 1.00 65.92  ? 267 VAL A CA   1 
ATOM   4271  C  C    . VAL A  1 267 ? 114.545 133.050 127.480 1.00 65.92  ? 267 VAL A C    1 
ATOM   4272  O  O    . VAL A  1 267 ? 113.758 132.120 127.711 1.00 65.92  ? 267 VAL A O    1 
ATOM   4273  C  CB   . VAL A  1 267 ? 113.320 134.797 128.828 1.00 65.92  ? 267 VAL A CB   1 
ATOM   4274  C  CG1  . VAL A  1 267 ? 114.306 134.807 129.979 1.00 65.92  ? 267 VAL A CG1  1 
ATOM   4275  C  CG2  . VAL A  1 267 ? 112.605 136.123 128.739 1.00 65.92  ? 267 VAL A CG2  1 
ATOM   4276  H  H    . VAL A  1 267 ? 112.425 134.292 126.426 1.00 65.92  ? 267 VAL A H    1 
ATOM   4277  H  HA   . VAL A  1 267 ? 114.804 135.092 127.452 1.00 65.92  ? 267 VAL A HA   1 
ATOM   4278  H  HB   . VAL A  1 267 ? 112.661 134.107 128.993 1.00 65.92  ? 267 VAL A HB   1 
ATOM   4279  H  HG11 . VAL A  1 267 ? 113.835 135.023 130.797 1.00 65.92  ? 267 VAL A HG11 1 
ATOM   4280  H  HG12 . VAL A  1 267 ? 114.716 133.933 130.053 1.00 65.92  ? 267 VAL A HG12 1 
ATOM   4281  H  HG13 . VAL A  1 267 ? 114.983 135.476 129.801 1.00 65.92  ? 267 VAL A HG13 1 
ATOM   4282  H  HG21 . VAL A  1 267 ? 112.254 136.350 129.613 1.00 65.92  ? 267 VAL A HG21 1 
ATOM   4283  H  HG22 . VAL A  1 267 ? 113.240 136.796 128.452 1.00 65.92  ? 267 VAL A HG22 1 
ATOM   4284  H  HG23 . VAL A  1 267 ? 111.882 136.052 128.098 1.00 65.92  ? 267 VAL A HG23 1 
ATOM   4285  N  N    . PRO A  1 268 ? 115.825 132.810 127.209 1.00 64.22  ? 268 PRO A N    1 
ATOM   4286  C  CA   . PRO A  1 268 ? 116.338 131.441 127.274 1.00 64.22  ? 268 PRO A CA   1 
ATOM   4287  C  C    . PRO A  1 268 ? 116.152 130.843 128.659 1.00 64.22  ? 268 PRO A C    1 
ATOM   4288  O  O    . PRO A  1 268 ? 116.130 131.545 129.671 1.00 64.22  ? 268 PRO A O    1 
ATOM   4289  C  CB   . PRO A  1 268 ? 117.820 131.597 126.925 1.00 64.22  ? 268 PRO A CB   1 
ATOM   4290  C  CG   . PRO A  1 268 ? 117.902 132.844 126.155 1.00 64.22  ? 268 PRO A CG   1 
ATOM   4291  C  CD   . PRO A  1 268 ? 116.822 133.744 126.665 1.00 64.22  ? 268 PRO A CD   1 
ATOM   4292  H  HA   . PRO A  1 268 ? 115.904 130.881 126.616 1.00 64.22  ? 268 PRO A HA   1 
ATOM   4293  H  HB2  . PRO A  1 268 ? 118.340 131.662 127.738 1.00 64.22  ? 268 PRO A HB2  1 
ATOM   4294  H  HB3  . PRO A  1 268 ? 118.110 130.844 126.389 1.00 64.22  ? 268 PRO A HB3  1 
ATOM   4295  H  HG2  . PRO A  1 268 ? 118.772 133.247 126.296 1.00 64.22  ? 268 PRO A HG2  1 
ATOM   4296  H  HG3  . PRO A  1 268 ? 117.767 132.652 125.217 1.00 64.22  ? 268 PRO A HG3  1 
ATOM   4297  H  HD2  . PRO A  1 268 ? 117.162 134.319 127.366 1.00 64.22  ? 268 PRO A HD2  1 
ATOM   4298  H  HD3  . PRO A  1 268 ? 116.436 134.255 125.938 1.00 64.22  ? 268 PRO A HD3  1 
ATOM   4299  N  N    . LEU A  1 269 ? 116.006 129.520 128.684 1.00 68.20  ? 269 LEU A N    1 
ATOM   4300  C  CA   . LEU A  1 269 ? 115.708 128.819 129.926 1.00 68.20  ? 269 LEU A CA   1 
ATOM   4301  C  C    . LEU A  1 269 ? 116.776 129.068 130.982 1.00 68.20  ? 269 LEU A C    1 
ATOM   4302  O  O    . LEU A  1 269 ? 116.473 129.471 132.112 1.00 68.20  ? 269 LEU A O    1 
ATOM   4303  C  CB   . LEU A  1 269 ? 115.592 127.328 129.638 1.00 68.20  ? 269 LEU A CB   1 
ATOM   4304  C  CG   . LEU A  1 269 ? 114.738 126.470 130.553 1.00 68.20  ? 269 LEU A CG   1 
ATOM   4305  C  CD1  . LEU A  1 269 ? 113.298 126.957 130.577 1.00 68.20  ? 269 LEU A CD1  1 
ATOM   4306  C  CD2  . LEU A  1 269 ? 114.835 125.053 130.050 1.00 68.20  ? 269 LEU A CD2  1 
ATOM   4307  H  H    . LEU A  1 269 ? 116.075 129.010 127.997 1.00 68.20  ? 269 LEU A H    1 
ATOM   4308  H  HA   . LEU A  1 269 ? 114.862 129.138 130.271 1.00 68.20  ? 269 LEU A HA   1 
ATOM   4309  H  HB2  . LEU A  1 269 ? 115.234 127.224 128.746 1.00 68.20  ? 269 LEU A HB2  1 
ATOM   4310  H  HB3  . LEU A  1 269 ? 116.485 126.957 129.668 1.00 68.20  ? 269 LEU A HB3  1 
ATOM   4311  H  HG   . LEU A  1 269 ? 115.100 126.506 131.451 1.00 68.20  ? 269 LEU A HG   1 
ATOM   4312  H  HD11 . LEU A  1 269 ? 112.762 126.344 131.102 1.00 68.20  ? 269 LEU A HD11 1 
ATOM   4313  H  HD12 . LEU A  1 269 ? 113.266 127.841 130.972 1.00 68.20  ? 269 LEU A HD12 1 
ATOM   4314  H  HD13 . LEU A  1 269 ? 112.967 126.991 129.667 1.00 68.20  ? 269 LEU A HD13 1 
ATOM   4315  H  HD21 . LEU A  1 269 ? 114.416 124.454 130.684 1.00 68.20  ? 269 LEU A HD21 1 
ATOM   4316  H  HD22 . LEU A  1 269 ? 114.390 124.998 129.190 1.00 68.20  ? 269 LEU A HD22 1 
ATOM   4317  H  HD23 . LEU A  1 269 ? 115.773 124.829 129.951 1.00 68.20  ? 269 LEU A HD23 1 
ATOM   4318  N  N    . ILE A  1 270 ? 118.041 128.828 130.634 1.00 73.73  ? 270 ILE A N    1 
ATOM   4319  C  CA   . ILE A  1 270 ? 119.093 128.928 131.631 1.00 73.73  ? 270 ILE A CA   1 
ATOM   4320  C  C    . ILE A  1 270 ? 119.288 130.360 132.094 1.00 73.73  ? 270 ILE A C    1 
ATOM   4321  O  O    . ILE A  1 270 ? 119.848 130.583 133.169 1.00 73.73  ? 270 ILE A O    1 
ATOM   4322  C  CB   . ILE A  1 270 ? 120.407 128.340 131.097 1.00 73.73  ? 270 ILE A CB   1 
ATOM   4323  C  CG1  . ILE A  1 270 ? 120.769 128.974 129.760 1.00 73.73  ? 270 ILE A CG1  1 
ATOM   4324  C  CG2  . ILE A  1 270 ? 120.283 126.830 130.977 1.00 73.73  ? 270 ILE A CG2  1 
ATOM   4325  C  CD1  . ILE A  1 270 ? 122.232 128.877 129.447 1.00 73.73  ? 270 ILE A CD1  1 
ATOM   4326  H  H    . ILE A  1 270 ? 118.305 128.607 129.849 1.00 73.73  ? 270 ILE A H    1 
ATOM   4327  H  HA   . ILE A  1 270 ? 118.831 128.403 132.402 1.00 73.73  ? 270 ILE A HA   1 
ATOM   4328  H  HB   . ILE A  1 270 ? 121.113 128.541 131.728 1.00 73.73  ? 270 ILE A HB   1 
ATOM   4329  H  HG12 . ILE A  1 270 ? 120.277 128.527 129.056 1.00 73.73  ? 270 ILE A HG12 1 
ATOM   4330  H  HG13 . ILE A  1 270 ? 120.530 129.913 129.783 1.00 73.73  ? 270 ILE A HG13 1 
ATOM   4331  H  HG21 . ILE A  1 270 ? 121.131 126.463 130.685 1.00 73.73  ? 270 ILE A HG21 1 
ATOM   4332  H  HG22 . ILE A  1 270 ? 120.045 126.463 131.844 1.00 73.73  ? 270 ILE A HG22 1 
ATOM   4333  H  HG23 . ILE A  1 270 ? 119.587 126.623 130.334 1.00 73.73  ? 270 ILE A HG23 1 
ATOM   4334  H  HD11 . ILE A  1 270 ? 122.413 129.373 128.636 1.00 73.73  ? 270 ILE A HD11 1 
ATOM   4335  H  HD12 . ILE A  1 270 ? 122.733 129.253 130.187 1.00 73.73  ? 270 ILE A HD12 1 
ATOM   4336  H  HD13 . ILE A  1 270 ? 122.469 127.944 129.332 1.00 73.73  ? 270 ILE A HD13 1 
ATOM   4337  N  N    . ALA A  1 271 ? 118.829 131.346 131.325 1.00 74.80  ? 271 ALA A N    1 
ATOM   4338  C  CA   . ALA A  1 271 ? 118.808 132.707 131.845 1.00 74.80  ? 271 ALA A CA   1 
ATOM   4339  C  C    . ALA A  1 271 ? 117.890 132.801 133.056 1.00 74.80  ? 271 ALA A C    1 
ATOM   4340  O  O    . ALA A  1 271 ? 118.252 133.398 134.076 1.00 74.80  ? 271 ALA A O    1 
ATOM   4341  C  CB   . ALA A  1 271 ? 118.367 133.681 130.757 1.00 74.80  ? 271 ALA A CB   1 
ATOM   4342  H  H    . ALA A  1 271 ? 118.530 131.255 130.525 1.00 74.80  ? 271 ALA A H    1 
ATOM   4343  H  HA   . ALA A  1 271 ? 119.703 132.952 132.122 1.00 74.80  ? 271 ALA A HA   1 
ATOM   4344  H  HB1  . ALA A  1 271 ? 118.384 134.581 131.117 1.00 74.80  ? 271 ALA A HB1  1 
ATOM   4345  H  HB2  . ALA A  1 271 ? 118.980 133.611 130.009 1.00 74.80  ? 271 ALA A HB2  1 
ATOM   4346  H  HB3  . ALA A  1 271 ? 117.469 133.453 130.475 1.00 74.80  ? 271 ALA A HB3  1 
ATOM   4347  N  N    . GLN A  1 272 ? 116.708 132.188 132.971 1.00 75.64  ? 272 GLN A N    1 
ATOM   4348  C  CA   . GLN A  1 272 ? 115.816 132.125 134.123 1.00 75.64  ? 272 GLN A CA   1 
ATOM   4349  C  C    . GLN A  1 272 ? 116.434 131.303 135.244 1.00 75.64  ? 272 GLN A C    1 
ATOM   4350  O  O    . GLN A  1 272 ? 116.300 131.642 136.424 1.00 75.64  ? 272 GLN A O    1 
ATOM   4351  C  CB   . GLN A  1 272 ? 114.474 131.526 133.713 1.00 75.64  ? 272 GLN A CB   1 
ATOM   4352  C  CG   . GLN A  1 272 ? 113.719 132.328 132.677 1.00 75.64  ? 272 GLN A CG   1 
ATOM   4353  C  CD   . GLN A  1 272 ? 112.681 131.496 131.949 1.00 75.64  ? 272 GLN A CD   1 
ATOM   4354  O  OE1  . GLN A  1 272 ? 112.870 130.300 131.727 1.00 75.64  ? 272 GLN A OE1  1 
ATOM   4355  N  NE2  . GLN A  1 272 ? 111.576 132.125 131.573 1.00 75.64  ? 272 GLN A NE2  1 
ATOM   4356  H  H    . GLN A  1 272 ? 116.406 131.801 132.267 1.00 75.64  ? 272 GLN A H    1 
ATOM   4357  H  HA   . GLN A  1 272 ? 115.661 133.021 134.455 1.00 75.64  ? 272 GLN A HA   1 
ATOM   4358  H  HB2  . GLN A  1 272 ? 114.632 130.643 133.345 1.00 75.64  ? 272 GLN A HB2  1 
ATOM   4359  H  HB3  . GLN A  1 272 ? 113.912 131.457 134.500 1.00 75.64  ? 272 GLN A HB3  1 
ATOM   4360  H  HG2  . GLN A  1 272 ? 113.264 133.063 133.116 1.00 75.64  ? 272 GLN A HG2  1 
ATOM   4361  H  HG3  . GLN A  1 272 ? 114.348 132.670 132.024 1.00 75.64  ? 272 GLN A HG3  1 
ATOM   4362  H  HE21 . GLN A  1 272 ? 111.478 132.963 131.746 1.00 75.64  ? 272 GLN A HE21 1 
ATOM   4363  H  HE22 . GLN A  1 272 ? 110.959 131.695 131.157 1.00 75.64  ? 272 GLN A HE22 1 
ATOM   4364  N  N    . TYR A  1 273 ? 117.100 130.204 134.888 1.00 81.74  ? 273 TYR A N    1 
ATOM   4365  C  CA   . TYR A  1 273 ? 117.773 129.377 135.885 1.00 81.74  ? 273 TYR A CA   1 
ATOM   4366  C  C    . TYR A  1 273 ? 118.773 130.199 136.690 1.00 81.74  ? 273 TYR A C    1 
ATOM   4367  O  O    . TYR A  1 273 ? 118.760 130.192 137.929 1.00 81.74  ? 273 TYR A O    1 
ATOM   4368  C  CB   . TYR A  1 273 ? 118.468 128.215 135.173 1.00 81.74  ? 273 TYR A CB   1 
ATOM   4369  C  CG   . TYR A  1 273 ? 119.083 127.174 136.073 1.00 81.74  ? 273 TYR A CG   1 
ATOM   4370  C  CD1  . TYR A  1 273 ? 118.292 126.349 136.855 1.00 81.74  ? 273 TYR A CD1  1 
ATOM   4371  C  CD2  . TYR A  1 273 ? 120.456 127.000 136.120 1.00 81.74  ? 273 TYR A CD2  1 
ATOM   4372  C  CE1  . TYR A  1 273 ? 118.852 125.392 137.669 1.00 81.74  ? 273 TYR A CE1  1 
ATOM   4373  C  CE2  . TYR A  1 273 ? 121.025 126.046 136.931 1.00 81.74  ? 273 TYR A CE2  1 
ATOM   4374  C  CZ   . TYR A  1 273 ? 120.220 125.244 137.703 1.00 81.74  ? 273 TYR A CZ   1 
ATOM   4375  O  OH   . TYR A  1 273 ? 120.786 124.289 138.514 1.00 81.74  ? 273 TYR A OH   1 
ATOM   4376  H  H    . TYR A  1 273 ? 117.176 129.922 134.082 1.00 81.74  ? 273 TYR A H    1 
ATOM   4377  H  HA   . TYR A  1 273 ? 117.117 129.011 136.496 1.00 81.74  ? 273 TYR A HA   1 
ATOM   4378  H  HB2  . TYR A  1 273 ? 117.824 127.767 134.607 1.00 81.74  ? 273 TYR A HB2  1 
ATOM   4379  H  HB3  . TYR A  1 273 ? 119.182 128.581 134.629 1.00 81.74  ? 273 TYR A HB3  1 
ATOM   4380  H  HD1  . TYR A  1 273 ? 117.369 126.448 136.833 1.00 81.74  ? 273 TYR A HD1  1 
ATOM   4381  H  HD2  . TYR A  1 273 ? 121.001 127.542 135.598 1.00 81.74  ? 273 TYR A HD2  1 
ATOM   4382  H  HE1  . TYR A  1 273 ? 118.311 124.847 138.192 1.00 81.74  ? 273 TYR A HE1  1 
ATOM   4383  H  HE2  . TYR A  1 273 ? 121.948 125.943 136.955 1.00 81.74  ? 273 TYR A HE2  1 
ATOM   4384  H  HH   . TYR A  1 273 ? 120.881 123.573 138.086 1.00 81.74  ? 273 TYR A HH   1 
ATOM   4385  N  N    . PHE A  1 274 ? 119.640 130.930 135.992 1.00 81.85  ? 274 PHE A N    1 
ATOM   4386  C  CA   . PHE A  1 274 ? 120.665 131.724 136.653 1.00 81.85  ? 274 PHE A CA   1 
ATOM   4387  C  C    . PHE A  1 274 ? 120.059 132.897 137.409 1.00 81.85  ? 274 PHE A C    1 
ATOM   4388  O  O    . PHE A  1 274 ? 120.557 133.276 138.473 1.00 81.85  ? 274 PHE A O    1 
ATOM   4389  C  CB   . PHE A  1 274 ? 121.680 132.211 135.624 1.00 81.85  ? 274 PHE A CB   1 
ATOM   4390  C  CG   . PHE A  1 274 ? 122.367 131.101 134.878 1.00 81.85  ? 274 PHE A CG   1 
ATOM   4391  C  CD1  . PHE A  1 274 ? 122.458 129.829 135.417 1.00 81.85  ? 274 PHE A CD1  1 
ATOM   4392  C  CD2  . PHE A  1 274 ? 122.918 131.331 133.633 1.00 81.85  ? 274 PHE A CD2  1 
ATOM   4393  C  CE1  . PHE A  1 274 ? 123.091 128.812 134.729 1.00 81.85  ? 274 PHE A CE1  1 
ATOM   4394  C  CE2  . PHE A  1 274 ? 123.551 130.318 132.942 1.00 81.85  ? 274 PHE A CE2  1 
ATOM   4395  C  CZ   . PHE A  1 274 ? 123.637 129.057 133.491 1.00 81.85  ? 274 PHE A CZ   1 
ATOM   4396  H  H    . PHE A  1 274 ? 119.658 130.975 135.136 1.00 81.85  ? 274 PHE A H    1 
ATOM   4397  H  HA   . PHE A  1 274 ? 121.128 131.171 137.298 1.00 81.85  ? 274 PHE A HA   1 
ATOM   4398  H  HB2  . PHE A  1 274 ? 121.220 132.766 134.978 1.00 81.85  ? 274 PHE A HB2  1 
ATOM   4399  H  HB3  . PHE A  1 274 ? 122.358 132.731 136.080 1.00 81.85  ? 274 PHE A HB3  1 
ATOM   4400  H  HD1  . PHE A  1 274 ? 122.091 129.659 136.253 1.00 81.85  ? 274 PHE A HD1  1 
ATOM   4401  H  HD2  . PHE A  1 274 ? 122.866 132.179 133.258 1.00 81.85  ? 274 PHE A HD2  1 
ATOM   4402  H  HE1  . PHE A  1 274 ? 123.147 127.962 135.100 1.00 81.85  ? 274 PHE A HE1  1 
ATOM   4403  H  HE2  . PHE A  1 274 ? 123.920 130.489 132.106 1.00 81.85  ? 274 PHE A HE2  1 
ATOM   4404  H  HZ   . PHE A  1 274 ? 124.063 128.373 133.026 1.00 81.85  ? 274 PHE A HZ   1 
ATOM   4405  N  N    . ALA A  1 275 ? 118.988 133.493 136.880 1.00 82.97  ? 275 ALA A N    1 
ATOM   4406  C  CA   . ALA A  1 275 ? 118.308 134.547 137.622 1.00 82.97  ? 275 ALA A CA   1 
ATOM   4407  C  C    . ALA A  1 275 ? 117.764 134.017 138.941 1.00 82.97  ? 275 ALA A C    1 
ATOM   4408  O  O    . ALA A  1 275 ? 117.921 134.655 139.988 1.00 82.97  ? 275 ALA A O    1 
ATOM   4409  C  CB   . ALA A  1 275 ? 117.181 135.141 136.781 1.00 82.97  ? 275 ALA A CB   1 
ATOM   4410  H  H    . ALA A  1 275 ? 118.649 133.311 136.113 1.00 82.97  ? 275 ALA A H    1 
ATOM   4411  H  HA   . ALA A  1 275 ? 118.940 135.253 137.820 1.00 82.97  ? 275 ALA A HA   1 
ATOM   4412  H  HB1  . ALA A  1 275 ? 116.725 135.820 137.299 1.00 82.97  ? 275 ALA A HB1  1 
ATOM   4413  H  HB2  . ALA A  1 275 ? 117.558 135.535 135.980 1.00 82.97  ? 275 ALA A HB2  1 
ATOM   4414  H  HB3  . ALA A  1 275 ? 116.561 134.434 136.548 1.00 82.97  ? 275 ALA A HB3  1 
ATOM   4415  N  N    . SER A  1 276 ? 117.129 132.846 138.911 1.00 84.59  ? 276 SER A N    1 
ATOM   4416  C  CA   . SER A  1 276 ? 116.604 132.257 140.136 1.00 84.59  ? 276 SER A CA   1 
ATOM   4417  C  C    . SER A  1 276 ? 117.728 131.966 141.118 1.00 84.59  ? 276 SER A C    1 
ATOM   4418  O  O    . SER A  1 276 ? 117.602 132.234 142.320 1.00 84.59  ? 276 SER A O    1 
ATOM   4419  C  CB   . SER A  1 276 ? 115.833 130.979 139.810 1.00 84.59  ? 276 SER A CB   1 
ATOM   4420  O  OG   . SER A  1 276 ? 115.252 130.415 140.971 1.00 84.59  ? 276 SER A OG   1 
ATOM   4421  H  H    . SER A  1 276 ? 116.995 132.380 138.203 1.00 84.59  ? 276 SER A H    1 
ATOM   4422  H  HA   . SER A  1 276 ? 115.993 132.882 140.553 1.00 84.59  ? 276 SER A HA   1 
ATOM   4423  H  HB2  . SER A  1 276 ? 115.131 131.189 139.175 1.00 84.59  ? 276 SER A HB2  1 
ATOM   4424  H  HB3  . SER A  1 276 ? 116.446 130.335 139.424 1.00 84.59  ? 276 SER A HB3  1 
ATOM   4425  H  HG   . SER A  1 276 ? 114.845 129.708 140.772 1.00 84.59  ? 276 SER A HG   1 
ATOM   4426  N  N    . THR A  1 277 ? 118.841 131.424 140.621 1.00 86.19  ? 277 THR A N    1 
ATOM   4427  C  CA   . THR A  1 277 ? 119.982 131.157 141.491 1.00 86.19  ? 277 THR A CA   1 
ATOM   4428  C  C    . THR A  1 277 ? 120.500 132.442 142.128 1.00 86.19  ? 277 THR A C    1 
ATOM   4429  O  O    . THR A  1 277 ? 120.789 132.480 143.332 1.00 86.19  ? 277 THR A O    1 
ATOM   4430  C  CB   . THR A  1 277 ? 121.088 130.472 140.690 1.00 86.19  ? 277 THR A CB   1 
ATOM   4431  O  OG1  . THR A  1 277 ? 120.615 129.213 140.199 1.00 86.19  ? 277 THR A OG1  1 
ATOM   4432  C  CG2  . THR A  1 277 ? 122.313 130.245 141.544 1.00 86.19  ? 277 THR A CG2  1 
ATOM   4433  H  H    . THR A  1 277 ? 118.957 131.206 139.799 1.00 86.19  ? 277 THR A H    1 
ATOM   4434  H  HA   . THR A  1 277 ? 119.709 130.553 142.196 1.00 86.19  ? 277 THR A HA   1 
ATOM   4435  H  HB   . THR A  1 277 ? 121.338 131.037 139.944 1.00 86.19  ? 277 THR A HB   1 
ATOM   4436  H  HG1  . THR A  1 277 ? 121.227 128.827 139.771 1.00 86.19  ? 277 THR A HG1  1 
ATOM   4437  H  HG21 . THR A  1 277 ? 122.961 129.720 141.051 1.00 86.19  ? 277 THR A HG21 1 
ATOM   4438  H  HG22 . THR A  1 277 ? 122.714 131.093 141.784 1.00 86.19  ? 277 THR A HG22 1 
ATOM   4439  H  HG23 . THR A  1 277 ? 122.069 129.767 142.351 1.00 86.19  ? 277 THR A HG23 1 
ATOM   4440  N  N    . MET A  1 278 ? 120.624 133.505 141.333 1.00 86.79  ? 278 MET A N    1 
ATOM   4441  C  CA   . MET A  1 278 ? 121.113 134.780 141.842 1.00 86.79  ? 278 MET A CA   1 
ATOM   4442  C  C    . MET A  1 278 ? 120.195 135.327 142.926 1.00 86.79  ? 278 MET A C    1 
ATOM   4443  O  O    . MET A  1 278 ? 120.654 135.780 143.982 1.00 86.79  ? 278 MET A O    1 
ATOM   4444  C  CB   . MET A  1 278 ? 121.228 135.772 140.686 1.00 86.79  ? 278 MET A CB   1 
ATOM   4445  C  CG   . MET A  1 278 ? 121.837 137.108 141.048 1.00 86.79  ? 278 MET A CG   1 
ATOM   4446  S  SD   . MET A  1 278 ? 123.545 136.966 141.589 1.00 86.79  ? 278 MET A SD   1 
ATOM   4447  C  CE   . MET A  1 278 ? 124.353 136.604 140.038 1.00 86.79  ? 278 MET A CE   1 
ATOM   4448  H  H    . MET A  1 278 ? 120.430 133.511 140.497 1.00 86.79  ? 278 MET A H    1 
ATOM   4449  H  HA   . MET A  1 278 ? 121.998 134.648 142.211 1.00 86.79  ? 278 MET A HA   1 
ATOM   4450  H  HB2  . MET A  1 278 ? 121.781 135.374 139.998 1.00 86.79  ? 278 MET A HB2  1 
ATOM   4451  H  HB3  . MET A  1 278 ? 120.340 135.938 140.337 1.00 86.79  ? 278 MET A HB3  1 
ATOM   4452  H  HG2  . MET A  1 278 ? 121.816 137.686 140.270 1.00 86.79  ? 278 MET A HG2  1 
ATOM   4453  H  HG3  . MET A  1 278 ? 121.324 137.499 141.769 1.00 86.79  ? 278 MET A HG3  1 
ATOM   4454  H  HE1  . MET A  1 278 ? 125.304 136.499 140.190 1.00 86.79  ? 278 MET A HE1  1 
ATOM   4455  H  HE2  . MET A  1 278 ? 123.983 135.780 139.685 1.00 86.79  ? 278 MET A HE2  1 
ATOM   4456  H  HE3  . MET A  1 278 ? 124.194 137.332 139.418 1.00 86.79  ? 278 MET A HE3  1 
ATOM   4457  N  N    . ILE A  1 279 ? 118.885 135.298 142.676 1.00 87.91  ? 279 ILE A N    1 
ATOM   4458  C  CA   . ILE A  1 279 ? 117.936 135.810 143.659 1.00 87.91  ? 279 ILE A CA   1 
ATOM   4459  C  C    . ILE A  1 279 ? 118.023 134.998 144.942 1.00 87.91  ? 279 ILE A C    1 
ATOM   4460  O  O    . ILE A  1 279 ? 118.020 135.550 146.050 1.00 87.91  ? 279 ILE A O    1 
ATOM   4461  C  CB   . ILE A  1 279 ? 116.509 135.805 143.078 1.00 87.91  ? 279 ILE A CB   1 
ATOM   4462  C  CG1  . ILE A  1 279 ? 116.437 136.633 141.789 1.00 87.91  ? 279 ILE A CG1  1 
ATOM   4463  C  CG2  . ILE A  1 279 ? 115.511 136.333 144.089 1.00 87.91  ? 279 ILE A CG2  1 
ATOM   4464  C  CD1  . ILE A  1 279 ? 116.804 138.090 141.939 1.00 87.91  ? 279 ILE A CD1  1 
ATOM   4465  H  H    . ILE A  1 279 ? 118.527 134.991 141.958 1.00 87.91  ? 279 ILE A H    1 
ATOM   4466  H  HA   . ILE A  1 279 ? 118.171 136.724 143.871 1.00 87.91  ? 279 ILE A HA   1 
ATOM   4467  H  HB   . ILE A  1 279 ? 116.272 134.889 142.869 1.00 87.91  ? 279 ILE A HB   1 
ATOM   4468  H  HG12 . ILE A  1 279 ? 117.047 136.261 141.146 1.00 87.91  ? 279 ILE A HG12 1 
ATOM   4469  H  HG13 . ILE A  1 279 ? 115.532 136.592 141.444 1.00 87.91  ? 279 ILE A HG13 1 
ATOM   4470  H  HG21 . ILE A  1 279 ? 114.632 136.347 143.680 1.00 87.91  ? 279 ILE A HG21 1 
ATOM   4471  H  HG22 . ILE A  1 279 ? 115.502 135.755 144.869 1.00 87.91  ? 279 ILE A HG22 1 
ATOM   4472  H  HG23 . ILE A  1 279 ? 115.769 137.232 144.345 1.00 87.91  ? 279 ILE A HG23 1 
ATOM   4473  H  HD11 . ILE A  1 279 ? 116.734 138.509 141.070 1.00 87.91  ? 279 ILE A HD11 1 
ATOM   4474  H  HD12 . ILE A  1 279 ? 116.201 138.521 142.566 1.00 87.91  ? 279 ILE A HD12 1 
ATOM   4475  H  HD13 . ILE A  1 279 ? 117.718 138.156 142.259 1.00 87.91  ? 279 ILE A HD13 1 
ATOM   4476  N  N    . ILE A  1 280 ? 118.109 133.673 144.815 1.00 88.66  ? 280 ILE A N    1 
ATOM   4477  C  CA   . ILE A  1 280 ? 118.181 132.816 145.993 1.00 88.66  ? 280 ILE A CA   1 
ATOM   4478  C  C    . ILE A  1 280 ? 119.419 133.150 146.818 1.00 88.66  ? 280 ILE A C    1 
ATOM   4479  O  O    . ILE A  1 280 ? 119.349 133.297 148.044 1.00 88.66  ? 280 ILE A O    1 
ATOM   4480  C  CB   . ILE A  1 280 ? 118.150 131.339 145.566 1.00 88.66  ? 280 ILE A CB   1 
ATOM   4481  C  CG1  . ILE A  1 280 ? 116.709 130.935 145.245 1.00 88.66  ? 280 ILE A CG1  1 
ATOM   4482  C  CG2  . ILE A  1 280 ? 118.747 130.448 146.637 1.00 88.66  ? 280 ILE A CG2  1 
ATOM   4483  C  CD1  . ILE A  1 280 ? 116.575 129.696 144.396 1.00 88.66  ? 280 ILE A CD1  1 
ATOM   4484  H  H    . ILE A  1 280 ? 118.124 133.253 144.066 1.00 88.66  ? 280 ILE A H    1 
ATOM   4485  H  HA   . ILE A  1 280 ? 117.401 132.980 146.544 1.00 88.66  ? 280 ILE A HA   1 
ATOM   4486  H  HB   . ILE A  1 280 ? 118.682 131.246 144.763 1.00 88.66  ? 280 ILE A HB   1 
ATOM   4487  H  HG12 . ILE A  1 280 ? 116.239 130.774 146.077 1.00 88.66  ? 280 ILE A HG12 1 
ATOM   4488  H  HG13 . ILE A  1 280 ? 116.287 131.665 144.766 1.00 88.66  ? 280 ILE A HG13 1 
ATOM   4489  H  HG21 . ILE A  1 280 ? 118.536 129.525 146.431 1.00 88.66  ? 280 ILE A HG21 1 
ATOM   4490  H  HG22 . ILE A  1 280 ? 119.709 130.565 146.647 1.00 88.66  ? 280 ILE A HG22 1 
ATOM   4491  H  HG23 . ILE A  1 280 ? 118.370 130.689 147.496 1.00 88.66  ? 280 ILE A HG23 1 
ATOM   4492  H  HD11 . ILE A  1 280 ? 115.631 129.515 144.259 1.00 88.66  ? 280 ILE A HD11 1 
ATOM   4493  H  HD12 . ILE A  1 280 ? 117.011 129.848 143.544 1.00 88.66  ? 280 ILE A HD12 1 
ATOM   4494  H  HD13 . ILE A  1 280 ? 116.988 128.949 144.856 1.00 88.66  ? 280 ILE A HD13 1 
ATOM   4495  N  N    . VAL A  1 281 ? 120.569 133.290 146.156 1.00 87.60  ? 281 VAL A N    1 
ATOM   4496  C  CA   . VAL A  1 281 ? 121.805 133.588 146.879 1.00 87.60  ? 281 VAL A CA   1 
ATOM   4497  C  C    . VAL A  1 281 ? 121.705 134.942 147.578 1.00 87.60  ? 281 VAL A C    1 
ATOM   4498  O  O    . VAL A  1 281 ? 122.093 135.094 148.746 1.00 87.60  ? 281 VAL A O    1 
ATOM   4499  C  CB   . VAL A  1 281 ? 123.009 133.535 145.922 1.00 87.60  ? 281 VAL A CB   1 
ATOM   4500  C  CG1  . VAL A  1 281 ? 124.257 134.018 146.620 1.00 87.60  ? 281 VAL A CG1  1 
ATOM   4501  C  CG2  . VAL A  1 281 ? 123.212 132.126 145.404 1.00 87.60  ? 281 VAL A CG2  1 
ATOM   4502  H  H    . VAL A  1 281 ? 120.660 133.212 145.306 1.00 87.60  ? 281 VAL A H    1 
ATOM   4503  H  HA   . VAL A  1 281 ? 121.938 132.912 147.559 1.00 87.60  ? 281 VAL A HA   1 
ATOM   4504  H  HB   . VAL A  1 281 ? 122.840 134.115 145.166 1.00 87.60  ? 281 VAL A HB   1 
ATOM   4505  H  HG11 . VAL A  1 281 ? 125.022 133.833 146.054 1.00 87.60  ? 281 VAL A HG11 1 
ATOM   4506  H  HG12 . VAL A  1 281 ? 124.183 134.969 146.780 1.00 87.60  ? 281 VAL A HG12 1 
ATOM   4507  H  HG13 . VAL A  1 281 ? 124.346 133.547 147.462 1.00 87.60  ? 281 VAL A HG13 1 
ATOM   4508  H  HG21 . VAL A  1 281 ? 123.981 132.119 144.813 1.00 87.60  ? 281 VAL A HG21 1 
ATOM   4509  H  HG22 . VAL A  1 281 ? 123.368 131.536 146.154 1.00 87.60  ? 281 VAL A HG22 1 
ATOM   4510  H  HG23 . VAL A  1 281 ? 122.420 131.845 144.924 1.00 87.60  ? 281 VAL A HG23 1 
ATOM   4511  N  N    . GLY A  1 282 ? 121.197 135.951 146.869 1.00 88.49  ? 282 GLY A N    1 
ATOM   4512  C  CA   . GLY A  1 282 ? 121.103 137.273 147.466 1.00 88.49  ? 282 GLY A CA   1 
ATOM   4513  C  C    . GLY A  1 282 ? 120.191 137.300 148.677 1.00 88.49  ? 282 GLY A C    1 
ATOM   4514  O  O    . GLY A  1 282 ? 120.517 137.903 149.707 1.00 88.49  ? 282 GLY A O    1 
ATOM   4515  H  H    . GLY A  1 282 ? 120.908 135.895 146.063 1.00 88.49  ? 282 GLY A H    1 
ATOM   4516  H  HA2  . GLY A  1 282 ? 121.986 137.564 147.737 1.00 88.49  ? 282 GLY A HA2  1 
ATOM   4517  H  HA3  . GLY A  1 282 ? 120.760 137.898 146.811 1.00 88.49  ? 282 GLY A HA3  1 
ATOM   4518  N  N    . LEU A  1 283 ? 119.038 136.638 148.578 1.00 90.38  ? 283 LEU A N    1 
ATOM   4519  C  CA   . LEU A  1 283 ? 118.133 136.603 149.718 1.00 90.38  ? 283 LEU A CA   1 
ATOM   4520  C  C    . LEU A  1 283 ? 118.718 135.783 150.861 1.00 90.38  ? 283 LEU A C    1 
ATOM   4521  O  O    . LEU A  1 283 ? 118.441 136.070 152.030 1.00 90.38  ? 283 LEU A O    1 
ATOM   4522  C  CB   . LEU A  1 283 ? 116.770 136.062 149.289 1.00 90.38  ? 283 LEU A CB   1 
ATOM   4523  C  CG   . LEU A  1 283 ? 115.804 137.068 148.643 1.00 90.38  ? 283 LEU A CG   1 
ATOM   4524  C  CD1  . LEU A  1 283 ? 115.390 138.162 149.611 1.00 90.38  ? 283 LEU A CD1  1 
ATOM   4525  C  CD2  . LEU A  1 283 ? 116.390 137.695 147.386 1.00 90.38  ? 283 LEU A CD2  1 
ATOM   4526  H  H    . LEU A  1 283 ? 118.767 136.214 147.883 1.00 90.38  ? 283 LEU A H    1 
ATOM   4527  H  HA   . LEU A  1 283 ? 118.011 137.507 150.042 1.00 90.38  ? 283 LEU A HA   1 
ATOM   4528  H  HB2  . LEU A  1 283 ? 116.917 135.352 148.647 1.00 90.38  ? 283 LEU A HB2  1 
ATOM   4529  H  HB3  . LEU A  1 283 ? 116.329 135.701 150.073 1.00 90.38  ? 283 LEU A HB3  1 
ATOM   4530  H  HG   . LEU A  1 283 ? 115.001 136.593 148.382 1.00 90.38  ? 283 LEU A HG   1 
ATOM   4531  H  HD11 . LEU A  1 283 ? 114.734 138.731 149.179 1.00 90.38  ? 283 LEU A HD11 1 
ATOM   4532  H  HD12 . LEU A  1 283 ? 115.008 137.757 150.404 1.00 90.38  ? 283 LEU A HD12 1 
ATOM   4533  H  HD13 . LEU A  1 283 ? 116.169 138.688 149.846 1.00 90.38  ? 283 LEU A HD13 1 
ATOM   4534  H  HD21 . LEU A  1 283 ? 115.816 138.424 147.106 1.00 90.38  ? 283 LEU A HD21 1 
ATOM   4535  H  HD22 . LEU A  1 283 ? 117.277 138.036 147.574 1.00 90.38  ? 283 LEU A HD22 1 
ATOM   4536  H  HD23 . LEU A  1 283 ? 116.431 137.027 146.689 1.00 90.38  ? 283 LEU A HD23 1 
ATOM   4537  N  N    . SER A  1 284 ? 119.546 134.782 150.551 1.00 90.29  ? 284 SER A N    1 
ATOM   4538  C  CA   . SER A  1 284 ? 120.275 134.084 151.605 1.00 90.29  ? 284 SER A CA   1 
ATOM   4539  C  C    . SER A  1 284 ? 121.188 135.042 152.358 1.00 90.29  ? 284 SER A C    1 
ATOM   4540  O  O    . SER A  1 284 ? 121.253 135.017 153.595 1.00 90.29  ? 284 SER A O    1 
ATOM   4541  C  CB   . SER A  1 284 ? 121.088 132.939 151.003 1.00 90.29  ? 284 SER A CB   1 
ATOM   4542  O  OG   . SER A  1 284 ? 122.061 132.463 151.915 1.00 90.29  ? 284 SER A OG   1 
ATOM   4543  H  H    . SER A  1 284 ? 119.703 134.498 149.756 1.00 90.29  ? 284 SER A H    1 
ATOM   4544  H  HA   . SER A  1 284 ? 119.642 133.708 152.235 1.00 90.29  ? 284 SER A HA   1 
ATOM   4545  H  HB2  . SER A  1 284 ? 120.491 132.213 150.772 1.00 90.29  ? 284 SER A HB2  1 
ATOM   4546  H  HB3  . SER A  1 284 ? 121.538 133.263 150.210 1.00 90.29  ? 284 SER A HB3  1 
ATOM   4547  H  HG   . SER A  1 284 ? 121.693 132.030 152.530 1.00 90.29  ? 284 SER A HG   1 
ATOM   4548  N  N    . VAL A  1 285 ? 121.904 135.891 151.621 1.00 89.75  ? 285 VAL A N    1 
ATOM   4549  C  CA   . VAL A  1 285 ? 122.758 136.891 152.259 1.00 89.75  ? 285 VAL A CA   1 
ATOM   4550  C  C    . VAL A  1 285 ? 121.925 137.796 153.163 1.00 89.75  ? 285 VAL A C    1 
ATOM   4551  O  O    . VAL A  1 285 ? 122.294 138.077 154.312 1.00 89.75  ? 285 VAL A O    1 
ATOM   4552  C  CB   . VAL A  1 285 ? 123.518 137.703 151.194 1.00 89.75  ? 285 VAL A CB   1 
ATOM   4553  C  CG1  . VAL A  1 285 ? 124.116 138.956 151.799 1.00 89.75  ? 285 VAL A CG1  1 
ATOM   4554  C  CG2  . VAL A  1 285 ? 124.606 136.857 150.559 1.00 89.75  ? 285 VAL A CG2  1 
ATOM   4555  H  H    . VAL A  1 285 ? 121.915 135.906 150.763 1.00 89.75  ? 285 VAL A H    1 
ATOM   4556  H  HA   . VAL A  1 285 ? 123.416 136.438 152.806 1.00 89.75  ? 285 VAL A HA   1 
ATOM   4557  H  HB   . VAL A  1 285 ? 122.900 137.970 150.499 1.00 89.75  ? 285 VAL A HB   1 
ATOM   4558  H  HG11 . VAL A  1 285 ? 124.771 139.317 151.182 1.00 89.75  ? 285 VAL A HG11 1 
ATOM   4559  H  HG12 . VAL A  1 285 ? 123.413 139.606 151.949 1.00 89.75  ? 285 VAL A HG12 1 
ATOM   4560  H  HG13 . VAL A  1 285 ? 124.544 138.726 152.637 1.00 89.75  ? 285 VAL A HG13 1 
ATOM   4561  H  HG21 . VAL A  1 285 ? 125.014 137.360 149.837 1.00 89.75  ? 285 VAL A HG21 1 
ATOM   4562  H  HG22 . VAL A  1 285 ? 125.271 136.647 151.231 1.00 89.75  ? 285 VAL A HG22 1 
ATOM   4563  H  HG23 . VAL A  1 285 ? 124.211 136.042 150.215 1.00 89.75  ? 285 VAL A HG23 1 
ATOM   4564  N  N    . VAL A  1 286 ? 120.781 138.256 152.659 1.00 90.83  ? 286 VAL A N    1 
ATOM   4565  C  CA   . VAL A  1 286 ? 119.934 139.153 153.446 1.00 90.83  ? 286 VAL A CA   1 
ATOM   4566  C  C    . VAL A  1 286 ? 119.488 138.471 154.737 1.00 90.83  ? 286 VAL A C    1 
ATOM   4567  O  O    . VAL A  1 286 ? 119.539 139.056 155.829 1.00 90.83  ? 286 VAL A O    1 
ATOM   4568  C  CB   . VAL A  1 286 ? 118.726 139.613 152.612 1.00 90.83  ? 286 VAL A CB   1 
ATOM   4569  C  CG1  . VAL A  1 286 ? 117.803 140.480 153.445 1.00 90.83  ? 286 VAL A CG1  1 
ATOM   4570  C  CG2  . VAL A  1 286 ? 119.186 140.369 151.389 1.00 90.83  ? 286 VAL A CG2  1 
ATOM   4571  H  H    . VAL A  1 286 ? 120.478 138.074 151.877 1.00 90.83  ? 286 VAL A H    1 
ATOM   4572  H  HA   . VAL A  1 286 ? 120.448 139.939 153.682 1.00 90.83  ? 286 VAL A HA   1 
ATOM   4573  H  HB   . VAL A  1 286 ? 118.232 138.833 152.318 1.00 90.83  ? 286 VAL A HB   1 
ATOM   4574  H  HG11 . VAL A  1 286 ? 117.096 140.816 152.873 1.00 90.83  ? 286 VAL A HG11 1 
ATOM   4575  H  HG12 . VAL A  1 286 ? 117.422 139.951 154.163 1.00 90.83  ? 286 VAL A HG12 1 
ATOM   4576  H  HG13 . VAL A  1 286 ? 118.312 141.220 153.809 1.00 90.83  ? 286 VAL A HG13 1 
ATOM   4577  H  HG21 . VAL A  1 286 ? 118.408 140.666 150.893 1.00 90.83  ? 286 VAL A HG21 1 
ATOM   4578  H  HG22 . VAL A  1 286 ? 119.709 141.133 151.676 1.00 90.83  ? 286 VAL A HG22 1 
ATOM   4579  H  HG23 . VAL A  1 286 ? 119.729 139.785 150.841 1.00 90.83  ? 286 VAL A HG23 1 
ATOM   4580  N  N    . VAL A  1 287 ? 119.035 137.223 154.628 1.00 93.38  ? 287 VAL A N    1 
ATOM   4581  C  CA   . VAL A  1 287 ? 118.501 136.516 155.786 1.00 93.38  ? 287 VAL A CA   1 
ATOM   4582  C  C    . VAL A  1 287 ? 119.588 136.280 156.826 1.00 93.38  ? 287 VAL A C    1 
ATOM   4583  O  O    . VAL A  1 287 ? 119.347 136.399 158.038 1.00 93.38  ? 287 VAL A O    1 
ATOM   4584  C  CB   . VAL A  1 287 ? 117.849 135.198 155.340 1.00 93.38  ? 287 VAL A CB   1 
ATOM   4585  C  CG1  . VAL A  1 287 ? 117.503 134.344 156.536 1.00 93.38  ? 287 VAL A CG1  1 
ATOM   4586  C  CG2  . VAL A  1 287 ? 116.605 135.485 154.523 1.00 93.38  ? 287 VAL A CG2  1 
ATOM   4587  H  H    . VAL A  1 287 ? 119.026 136.770 153.899 1.00 93.38  ? 287 VAL A H    1 
ATOM   4588  H  HA   . VAL A  1 287 ? 117.813 137.063 156.193 1.00 93.38  ? 287 VAL A HA   1 
ATOM   4589  H  HB   . VAL A  1 287 ? 118.474 134.707 154.786 1.00 93.38  ? 287 VAL A HB   1 
ATOM   4590  H  HG11 . VAL A  1 287 ? 117.019 133.564 156.229 1.00 93.38  ? 287 VAL A HG11 1 
ATOM   4591  H  HG12 . VAL A  1 287 ? 118.317 134.069 156.984 1.00 93.38  ? 287 VAL A HG12 1 
ATOM   4592  H  HG13 . VAL A  1 287 ? 116.949 134.864 157.137 1.00 93.38  ? 287 VAL A HG13 1 
ATOM   4593  H  HG21 . VAL A  1 287 ? 116.222 134.646 154.226 1.00 93.38  ? 287 VAL A HG21 1 
ATOM   4594  H  HG22 . VAL A  1 287 ? 115.971 135.963 155.080 1.00 93.38  ? 287 VAL A HG22 1 
ATOM   4595  H  HG23 . VAL A  1 287 ? 116.844 136.031 153.759 1.00 93.38  ? 287 VAL A HG23 1 
ATOM   4596  N  N    . THR A  1 288 ? 120.787 135.895 156.383 1.00 93.89  ? 288 THR A N    1 
ATOM   4597  C  CA   . THR A  1 288 ? 121.859 135.708 157.351 1.00 93.89  ? 288 THR A CA   1 
ATOM   4598  C  C    . THR A  1 288 ? 122.228 137.026 158.015 1.00 93.89  ? 288 THR A C    1 
ATOM   4599  O  O    . THR A  1 288 ? 122.553 137.042 159.204 1.00 93.89  ? 288 THR A O    1 
ATOM   4600  C  CB   . THR A  1 288 ? 123.082 135.057 156.701 1.00 93.89  ? 288 THR A CB   1 
ATOM   4601  O  OG1  . THR A  1 288 ? 124.009 134.664 157.721 1.00 93.89  ? 288 THR A OG1  1 
ATOM   4602  C  CG2  . THR A  1 288 ? 123.770 135.990 155.732 1.00 93.89  ? 288 THR A CG2  1 
ATOM   4603  H  H    . THR A  1 288 ? 120.995 135.738 155.565 1.00 93.89  ? 288 THR A H    1 
ATOM   4604  H  HA   . THR A  1 288 ? 121.545 135.106 158.041 1.00 93.89  ? 288 THR A HA   1 
ATOM   4605  H  HB   . THR A  1 288 ? 122.794 134.272 156.211 1.00 93.89  ? 288 THR A HB   1 
ATOM   4606  H  HG1  . THR A  1 288 ? 124.754 134.487 157.379 1.00 93.89  ? 288 THR A HG1  1 
ATOM   4607  H  HG21 . THR A  1 288 ? 124.610 135.600 155.447 1.00 93.89  ? 288 THR A HG21 1 
ATOM   4608  H  HG22 . THR A  1 288 ? 123.207 136.114 154.957 1.00 93.89  ? 288 THR A HG22 1 
ATOM   4609  H  HG23 . THR A  1 288 ? 123.952 136.848 156.142 1.00 93.89  ? 288 THR A HG23 1 
ATOM   4610  N  N    . VAL A  1 289 ? 122.145 138.144 157.288 1.00 92.64  ? 289 VAL A N    1 
ATOM   4611  C  CA   . VAL A  1 289 ? 122.355 139.446 157.920 1.00 92.64  ? 289 VAL A CA   1 
ATOM   4612  C  C    . VAL A  1 289 ? 121.326 139.670 159.021 1.00 92.64  ? 289 VAL A C    1 
ATOM   4613  O  O    . VAL A  1 289 ? 121.643 140.168 160.107 1.00 92.64  ? 289 VAL A O    1 
ATOM   4614  C  CB   . VAL A  1 289 ? 122.304 140.570 156.872 1.00 92.64  ? 289 VAL A CB   1 
ATOM   4615  C  CG1  . VAL A  1 289 ? 122.264 141.926 157.549 1.00 92.64  ? 289 VAL A CG1  1 
ATOM   4616  C  CG2  . VAL A  1 289 ? 123.500 140.487 155.946 1.00 92.64  ? 289 VAL A CG2  1 
ATOM   4617  H  H    . VAL A  1 289 ? 121.969 138.175 156.449 1.00 92.64  ? 289 VAL A H    1 
ATOM   4618  H  HA   . VAL A  1 289 ? 123.235 139.456 158.325 1.00 92.64  ? 289 VAL A HA   1 
ATOM   4619  H  HB   . VAL A  1 289 ? 121.499 140.475 156.343 1.00 92.64  ? 289 VAL A HB   1 
ATOM   4620  H  HG11 . VAL A  1 289 ? 122.550 142.599 156.914 1.00 92.64  ? 289 VAL A HG11 1 
ATOM   4621  H  HG12 . VAL A  1 289 ? 121.361 142.112 157.849 1.00 92.64  ? 289 VAL A HG12 1 
ATOM   4622  H  HG13 . VAL A  1 289 ? 122.869 141.911 158.305 1.00 92.64  ? 289 VAL A HG13 1 
ATOM   4623  H  HG21 . VAL A  1 289 ? 123.451 141.209 155.301 1.00 92.64  ? 289 VAL A HG21 1 
ATOM   4624  H  HG22 . VAL A  1 289 ? 124.312 140.567 156.468 1.00 92.64  ? 289 VAL A HG22 1 
ATOM   4625  H  HG23 . VAL A  1 289 ? 123.484 139.633 155.493 1.00 92.64  ? 289 VAL A HG23 1 
ATOM   4626  N  N    . ILE A  1 290 ? 120.068 139.328 158.741 1.00 94.55  ? 290 ILE A N    1 
ATOM   4627  C  CA   . ILE A  1 290 ? 118.995 139.479 159.729 1.00 94.55  ? 290 ILE A CA   1 
ATOM   4628  C  C    . ILE A  1 290 ? 119.314 138.694 161.002 1.00 94.55  ? 290 ILE A C    1 
ATOM   4629  O  O    . ILE A  1 290 ? 119.353 139.236 162.121 1.00 94.55  ? 290 ILE A O    1 
ATOM   4630  C  CB   . ILE A  1 290 ? 117.660 139.023 159.118 1.00 94.55  ? 290 ILE A CB   1 
ATOM   4631  C  CG1  . ILE A  1 290 ? 117.217 139.985 158.010 1.00 94.55  ? 290 ILE A CG1  1 
ATOM   4632  C  CG2  . ILE A  1 290 ? 116.598 138.860 160.188 1.00 94.55  ? 290 ILE A CG2  1 
ATOM   4633  C  CD1  . ILE A  1 290 ? 116.956 141.394 158.464 1.00 94.55  ? 290 ILE A CD1  1 
ATOM   4634  H  H    . ILE A  1 290 ? 119.809 139.018 157.984 1.00 94.55  ? 290 ILE A H    1 
ATOM   4635  H  HA   . ILE A  1 290 ? 118.915 140.415 159.969 1.00 94.55  ? 290 ILE A HA   1 
ATOM   4636  H  HB   . ILE A  1 290 ? 117.808 138.156 158.716 1.00 94.55  ? 290 ILE A HB   1 
ATOM   4637  H  HG12 . ILE A  1 290 ? 117.921 140.026 157.345 1.00 94.55  ? 290 ILE A HG12 1 
ATOM   4638  H  HG13 . ILE A  1 290 ? 116.404 139.645 157.606 1.00 94.55  ? 290 ILE A HG13 1 
ATOM   4639  H  HG21 . ILE A  1 290 ? 115.734 138.778 159.756 1.00 94.55  ? 290 ILE A HG21 1 
ATOM   4640  H  HG22 . ILE A  1 290 ? 116.786 138.054 160.695 1.00 94.55  ? 290 ILE A HG22 1 
ATOM   4641  H  HG23 . ILE A  1 290 ? 116.612 139.634 160.768 1.00 94.55  ? 290 ILE A HG23 1 
ATOM   4642  H  HD11 . ILE A  1 290 ? 116.498 141.870 157.753 1.00 94.55  ? 290 ILE A HD11 1 
ATOM   4643  H  HD12 . ILE A  1 290 ? 116.400 141.375 159.256 1.00 94.55  ? 290 ILE A HD12 1 
ATOM   4644  H  HD13 . ILE A  1 290 ? 117.802 141.825 158.660 1.00 94.55  ? 290 ILE A HD13 1 
ATOM   4645  N  N    . VAL A  1 291 ? 119.529 137.388 160.851 1.00 99.12  ? 291 VAL A N    1 
ATOM   4646  C  CA   . VAL A  1 291 ? 119.737 136.566 162.041 1.00 99.12  ? 291 VAL A CA   1 
ATOM   4647  C  C    . VAL A  1 291 ? 121.028 136.961 162.738 1.00 99.12  ? 291 VAL A C    1 
ATOM   4648  O  O    . VAL A  1 291 ? 121.170 136.788 163.952 1.00 99.12  ? 291 VAL A O    1 
ATOM   4649  C  CB   . VAL A  1 291 ? 119.728 135.072 161.686 1.00 99.12  ? 291 VAL A CB   1 
ATOM   4650  C  CG1  . VAL A  1 291 ? 118.465 134.732 160.923 1.00 99.12  ? 291 VAL A CG1  1 
ATOM   4651  C  CG2  . VAL A  1 291 ? 120.969 134.709 160.896 1.00 99.12  ? 291 VAL A CG2  1 
ATOM   4652  H  H    . VAL A  1 291 ? 119.564 136.969 160.103 1.00 99.12  ? 291 VAL A H    1 
ATOM   4653  H  HA   . VAL A  1 291 ? 119.009 136.733 162.658 1.00 99.12  ? 291 VAL A HA   1 
ATOM   4654  H  HB   . VAL A  1 291 ? 119.736 134.558 162.507 1.00 99.12  ? 291 VAL A HB   1 
ATOM   4655  H  HG11 . VAL A  1 291 ? 118.416 133.772 160.800 1.00 99.12  ? 291 VAL A HG11 1 
ATOM   4656  H  HG12 . VAL A  1 291 ? 117.702 135.042 161.434 1.00 99.12  ? 291 VAL A HG12 1 
ATOM   4657  H  HG13 . VAL A  1 291 ? 118.489 135.182 160.065 1.00 99.12  ? 291 VAL A HG13 1 
ATOM   4658  H  HG21 . VAL A  1 291 ? 120.873 133.809 160.551 1.00 99.12  ? 291 VAL A HG21 1 
ATOM   4659  H  HG22 . VAL A  1 291 ? 121.064 135.339 160.168 1.00 99.12  ? 291 VAL A HG22 1 
ATOM   4660  H  HG23 . VAL A  1 291 ? 121.741 134.758 161.480 1.00 99.12  ? 291 VAL A HG23 1 
ATOM   4661  N  N    . LEU A  1 292 ? 121.997 137.472 161.984 1.00 99.03  ? 292 LEU A N    1 
ATOM   4662  C  CA   . LEU A  1 292 ? 123.213 138.005 162.575 1.00 99.03  ? 292 LEU A CA   1 
ATOM   4663  C  C    . LEU A  1 292 ? 122.898 139.217 163.445 1.00 99.03  ? 292 LEU A C    1 
ATOM   4664  O  O    . LEU A  1 292 ? 123.450 139.371 164.540 1.00 99.03  ? 292 LEU A O    1 
ATOM   4665  C  CB   . LEU A  1 292 ? 124.169 138.370 161.451 1.00 99.03  ? 292 LEU A CB   1 
ATOM   4666  C  CG   . LEU A  1 292 ? 125.581 138.863 161.770 1.00 99.03  ? 292 LEU A CG   1 
ATOM   4667  C  CD1  . LEU A  1 292 ? 126.696 137.899 162.090 1.00 99.03  ? 292 LEU A CD1  1 
ATOM   4668  C  CD2  . LEU A  1 292 ? 126.027 140.228 161.362 1.00 99.03  ? 292 LEU A CD2  1 
ATOM   4669  H  H    . LEU A  1 292 ? 121.980 137.500 161.124 1.00 99.03  ? 292 LEU A H    1 
ATOM   4670  H  HA   . LEU A  1 292 ? 123.638 137.339 163.132 1.00 99.03  ? 292 LEU A HA   1 
ATOM   4671  H  HB2  . LEU A  1 292 ? 124.288 137.570 160.917 1.00 99.03  ? 292 LEU A HB2  1 
ATOM   4672  H  HB3  . LEU A  1 292 ? 123.735 139.049 160.900 1.00 99.03  ? 292 LEU A HB3  1 
ATOM   4673  H  HG   . LEU A  1 292 ? 125.737 138.629 160.842 1.00 99.03  ? 292 LEU A HG   1 
ATOM   4674  H  HD11 . LEU A  1 292 ? 126.588 137.549 162.989 1.00 99.03  ? 292 LEU A HD11 1 
ATOM   4675  H  HD12 . LEU A  1 292 ? 127.526 138.406 162.006 1.00 99.03  ? 292 LEU A HD12 1 
ATOM   4676  H  HD13 . LEU A  1 292 ? 126.622 137.190 161.425 1.00 99.03  ? 292 LEU A HD13 1 
ATOM   4677  H  HD21 . LEU A  1 292 ? 126.907 140.426 161.729 1.00 99.03  ? 292 LEU A HD21 1 
ATOM   4678  H  HD22 . LEU A  1 292 ? 126.070 140.176 160.407 1.00 99.03  ? 292 LEU A HD22 1 
ATOM   4679  H  HD23 . LEU A  1 292 ? 125.346 140.866 161.638 1.00 99.03  ? 292 LEU A HD23 1 
ATOM   4680  N  N    . GLN A  1 293 ? 122.010 140.095 162.963 1.00 97.18  ? 293 GLN A N    1 
ATOM   4681  C  CA   . GLN A  1 293 ? 121.505 141.180 163.796 1.00 97.18  ? 293 GLN A CA   1 
ATOM   4682  C  C    . GLN A  1 293 ? 120.946 140.638 165.096 1.00 97.18  ? 293 GLN A C    1 
ATOM   4683  O  O    . GLN A  1 293 ? 121.100 141.259 166.153 1.00 97.18  ? 293 GLN A O    1 
ATOM   4684  C  CB   . GLN A  1 293 ? 120.423 141.967 163.051 1.00 97.18  ? 293 GLN A CB   1 
ATOM   4685  C  CG   . GLN A  1 293 ? 120.227 143.391 163.540 1.00 97.18  ? 293 GLN A CG   1 
ATOM   4686  C  CD   . GLN A  1 293 ? 119.504 144.253 162.530 1.00 97.18  ? 293 GLN A CD   1 
ATOM   4687  O  OE1  . GLN A  1 293 ? 118.466 143.864 161.997 1.00 97.18  ? 293 GLN A OE1  1 
ATOM   4688  N  NE2  . GLN A  1 293 ? 120.051 145.431 162.256 1.00 97.18  ? 293 GLN A NE2  1 
ATOM   4689  H  H    . GLN A  1 293 ? 121.681 140.084 162.169 1.00 97.18  ? 293 GLN A H    1 
ATOM   4690  H  HA   . GLN A  1 293 ? 122.228 141.789 164.008 1.00 97.18  ? 293 GLN A HA   1 
ATOM   4691  H  HB2  . GLN A  1 293 ? 120.653 142.011 162.112 1.00 97.18  ? 293 GLN A HB2  1 
ATOM   4692  H  HB3  . GLN A  1 293 ? 119.575 141.508 163.159 1.00 97.18  ? 293 GLN A HB3  1 
ATOM   4693  H  HG2  . GLN A  1 293 ? 119.693 143.375 164.351 1.00 97.18  ? 293 GLN A HG2  1 
ATOM   4694  H  HG3  . GLN A  1 293 ? 121.090 143.793 163.720 1.00 97.18  ? 293 GLN A HG3  1 
ATOM   4695  H  HE21 . GLN A  1 293 ? 120.778 145.670 162.647 1.00 97.18  ? 293 GLN A HE21 1 
ATOM   4696  H  HE22 . GLN A  1 293 ? 119.678 145.956 161.688 1.00 97.18  ? 293 GLN A HE22 1 
ATOM   4697  N  N    . TYR A  1 294 ? 120.285 139.484 165.036 1.00 103.93 ? 294 TYR A N    1 
ATOM   4698  C  CA   . TYR A  1 294 ? 119.784 138.878 166.271 1.00 103.93 ? 294 TYR A CA   1 
ATOM   4699  C  C    . TYR A  1 294 ? 120.923 138.400 167.170 1.00 103.93 ? 294 TYR A C    1 
ATOM   4700  O  O    . TYR A  1 294 ? 120.935 138.685 168.374 1.00 103.93 ? 294 TYR A O    1 
ATOM   4701  C  CB   . TYR A  1 294 ? 118.835 137.718 165.963 1.00 103.93 ? 294 TYR A CB   1 
ATOM   4702  C  CG   . TYR A  1 294 ? 117.406 138.122 165.656 1.00 103.93 ? 294 TYR A CG   1 
ATOM   4703  C  CD1  . TYR A  1 294 ? 116.965 139.425 165.850 1.00 103.93 ? 294 TYR A CD1  1 
ATOM   4704  C  CD2  . TYR A  1 294 ? 116.491 137.189 165.192 1.00 103.93 ? 294 TYR A CD2  1 
ATOM   4705  C  CE1  . TYR A  1 294 ? 115.670 139.788 165.581 1.00 103.93 ? 294 TYR A CE1  1 
ATOM   4706  C  CE2  . TYR A  1 294 ? 115.188 137.544 164.919 1.00 103.93 ? 294 TYR A CE2  1 
ATOM   4707  C  CZ   . TYR A  1 294 ? 114.782 138.846 165.116 1.00 103.93 ? 294 TYR A CZ   1 
ATOM   4708  O  OH   . TYR A  1 294 ? 113.486 139.214 164.848 1.00 103.93 ? 294 TYR A OH   1 
ATOM   4709  H  H    . TYR A  1 294 ? 120.116 139.047 164.316 1.00 103.93 ? 294 TYR A H    1 
ATOM   4710  H  HA   . TYR A  1 294 ? 119.316 139.549 166.785 1.00 103.93 ? 294 TYR A HA   1 
ATOM   4711  H  HB2  . TYR A  1 294 ? 119.170 137.231 165.196 1.00 103.93 ? 294 TYR A HB2  1 
ATOM   4712  H  HB3  . TYR A  1 294 ? 118.813 137.130 166.734 1.00 103.93 ? 294 TYR A HB3  1 
ATOM   4713  H  HD1  . TYR A  1 294 ? 117.556 140.069 166.164 1.00 103.93 ? 294 TYR A HD1  1 
ATOM   4714  H  HD2  . TYR A  1 294 ? 116.766 136.310 165.059 1.00 103.93 ? 294 TYR A HD2  1 
ATOM   4715  H  HE1  . TYR A  1 294 ? 115.397 140.666 165.715 1.00 103.93 ? 294 TYR A HE1  1 
ATOM   4716  H  HE2  . TYR A  1 294 ? 114.589 136.907 164.605 1.00 103.93 ? 294 TYR A HE2  1 
ATOM   4717  H  HH   . TYR A  1 294 ? 113.066 138.563 164.528 1.00 103.93 ? 294 TYR A HH   1 
ATOM   4718  N  N    . HIS A  1 295 ? 121.884 137.662 166.611 1.00 105.71 ? 295 HIS A N    1 
ATOM   4719  C  CA   . HIS A  1 295 ? 122.909 137.051 167.455 1.00 105.71 ? 295 HIS A CA   1 
ATOM   4720  C  C    . HIS A  1 295 ? 123.695 138.112 168.217 1.00 105.71 ? 295 HIS A C    1 
ATOM   4721  O  O    . HIS A  1 295 ? 123.930 137.974 169.421 1.00 105.71 ? 295 HIS A O    1 
ATOM   4722  C  CB   . HIS A  1 295 ? 123.850 136.189 166.607 1.00 105.71 ? 295 HIS A CB   1 
ATOM   4723  C  CG   . HIS A  1 295 ? 124.883 135.446 167.402 1.00 105.71 ? 295 HIS A CG   1 
ATOM   4724  N  ND1  . HIS A  1 295 ? 124.861 134.074 167.555 1.00 105.71 ? 295 HIS A ND1  1 
ATOM   4725  C  CD2  . HIS A  1 295 ? 125.970 135.880 168.084 1.00 105.71 ? 295 HIS A CD2  1 
ATOM   4726  C  CE1  . HIS A  1 295 ? 125.884 133.698 168.301 1.00 105.71 ? 295 HIS A CE1  1 
ATOM   4727  N  NE2  . HIS A  1 295 ? 126.573 134.775 168.634 1.00 105.71 ? 295 HIS A NE2  1 
ATOM   4728  H  H    . HIS A  1 295 ? 121.967 137.506 165.768 1.00 105.71 ? 295 HIS A H    1 
ATOM   4729  H  HA   . HIS A  1 295 ? 122.483 136.471 168.105 1.00 105.71 ? 295 HIS A HA   1 
ATOM   4730  H  HB2  . HIS A  1 295 ? 123.330 135.533 166.113 1.00 105.71 ? 295 HIS A HB2  1 
ATOM   4731  H  HB3  . HIS A  1 295 ? 124.324 136.765 165.987 1.00 105.71 ? 295 HIS A HB3  1 
ATOM   4732  H  HD2  . HIS A  1 295 ? 126.253 136.764 168.167 1.00 105.71 ? 295 HIS A HD2  1 
ATOM   4733  H  HE1  . HIS A  1 295 ? 126.086 132.828 168.544 1.00 105.71 ? 295 HIS A HE1  1 
ATOM   4734  H  HE2  . HIS A  1 295 ? 127.285 134.781 169.115 1.00 105.71 ? 295 HIS A HE2  1 
ATOM   4735  N  N    . HIS A  1 296 ? 124.117 139.170 167.529 1.00 105.55 ? 296 HIS A N    1 
ATOM   4736  C  CA   . HIS A  1 296 ? 124.860 140.265 168.150 1.00 105.55 ? 296 HIS A CA   1 
ATOM   4737  C  C    . HIS A  1 296 ? 123.847 141.279 168.664 1.00 105.55 ? 296 HIS A C    1 
ATOM   4738  O  O    . HIS A  1 296 ? 123.356 142.126 167.916 1.00 105.55 ? 296 HIS A O    1 
ATOM   4739  C  CB   . HIS A  1 296 ? 125.843 140.891 167.171 1.00 105.55 ? 296 HIS A CB   1 
ATOM   4740  C  CG   . HIS A  1 296 ? 126.844 139.919 166.648 1.00 105.55 ? 296 HIS A CG   1 
ATOM   4741  N  ND1  . HIS A  1 296 ? 126.920 139.587 165.315 1.00 105.55 ? 296 HIS A ND1  1 
ATOM   4742  C  CD2  . HIS A  1 296 ? 127.814 139.206 167.268 1.00 105.55 ? 296 HIS A CD2  1 
ATOM   4743  C  CE1  . HIS A  1 296 ? 127.856 138.672 165.152 1.00 105.55 ? 296 HIS A CE1  1 
ATOM   4744  N  NE2  . HIS A  1 296 ? 128.415 138.426 166.318 1.00 105.55 ? 296 HIS A NE2  1 
ATOM   4745  H  H    . HIS A  1 296 ? 123.994 139.269 166.686 1.00 105.55 ? 296 HIS A H    1 
ATOM   4746  H  HA   . HIS A  1 296 ? 125.365 139.923 168.897 1.00 105.55 ? 296 HIS A HA   1 
ATOM   4747  H  HB2  . HIS A  1 296 ? 125.351 141.212 166.412 1.00 105.55 ? 296 HIS A HB2  1 
ATOM   4748  H  HB3  . HIS A  1 296 ? 126.324 141.610 167.603 1.00 105.55 ? 296 HIS A HB3  1 
ATOM   4749  H  HD2  . HIS A  1 296 ? 128.031 139.257 168.214 1.00 105.55 ? 296 HIS A HD2  1 
ATOM   4750  H  HE1  . HIS A  1 296 ? 128.104 138.305 164.406 1.00 105.55 ? 296 HIS A HE1  1 
ATOM   4751  H  HE2  . HIS A  1 296 ? 129.102 137.931 166.471 1.00 105.55 ? 296 HIS A HE2  1 
ATOM   4752  N  N    . HIS A  1 297 ? 123.544 141.202 169.958 1.00 116.24 ? 297 HIS A N    1 
ATOM   4753  C  CA   . HIS A  1 297 ? 122.573 142.105 170.550 1.00 116.24 ? 297 HIS A CA   1 
ATOM   4754  C  C    . HIS A  1 297 ? 122.882 142.263 172.032 1.00 116.24 ? 297 HIS A C    1 
ATOM   4755  O  O    . HIS A  1 297 ? 123.396 141.341 172.672 1.00 116.24 ? 297 HIS A O    1 
ATOM   4756  C  CB   . HIS A  1 297 ? 121.156 141.582 170.349 1.00 116.24 ? 297 HIS A CB   1 
ATOM   4757  C  CG   . HIS A  1 297 ? 120.108 142.642 170.439 1.00 116.24 ? 297 HIS A CG   1 
ATOM   4758  N  ND1  . HIS A  1 297 ? 119.389 142.886 171.589 1.00 116.24 ? 297 HIS A ND1  1 
ATOM   4759  C  CD2  . HIS A  1 297 ? 119.661 143.527 169.517 1.00 116.24 ? 297 HIS A CD2  1 
ATOM   4760  C  CE1  . HIS A  1 297 ? 118.534 143.869 171.367 1.00 116.24 ? 297 HIS A CE1  1 
ATOM   4761  N  NE2  . HIS A  1 297 ? 118.680 144.277 170.119 1.00 116.24 ? 297 HIS A NE2  1 
ATOM   4762  H  H    . HIS A  1 297 ? 123.900 140.649 170.507 1.00 116.24 ? 297 HIS A H    1 
ATOM   4763  H  HA   . HIS A  1 297 ? 122.646 142.977 170.132 1.00 116.24 ? 297 HIS A HA   1 
ATOM   4764  H  HB2  . HIS A  1 297 ? 121.096 141.171 169.469 1.00 116.24 ? 297 HIS A HB2  1 
ATOM   4765  H  HB3  . HIS A  1 297 ? 120.966 140.917 171.030 1.00 116.24 ? 297 HIS A HB3  1 
ATOM   4766  H  HD2  . HIS A  1 297 ? 119.956 143.606 168.636 1.00 116.24 ? 297 HIS A HD2  1 
ATOM   4767  H  HE1  . HIS A  1 297 ? 117.927 144.211 171.980 1.00 116.24 ? 297 HIS A HE1  1 
ATOM   4768  H  HE2  . HIS A  1 297 ? 118.236 144.911 169.736 1.00 116.24 ? 297 HIS A HE2  1 
ATOM   4769  N  N    . ASP A  1 298 ? 122.560 143.442 172.573 1.00 115.42 ? 298 ASP A N    1 
ATOM   4770  C  CA   . ASP A  1 298 ? 122.804 143.749 173.978 1.00 115.42 ? 298 ASP A CA   1 
ATOM   4771  C  C    . ASP A  1 298 ? 121.507 143.601 174.758 1.00 115.42 ? 298 ASP A C    1 
ATOM   4772  O  O    . ASP A  1 298 ? 120.554 144.349 174.489 1.00 115.42 ? 298 ASP A O    1 
ATOM   4773  C  CB   . ASP A  1 298 ? 123.356 145.164 174.126 1.00 115.42 ? 298 ASP A CB   1 
ATOM   4774  C  CG   . ASP A  1 298 ? 123.768 145.492 175.548 1.00 115.42 ? 298 ASP A CG   1 
ATOM   4775  O  OD1  . ASP A  1 298 ? 123.449 144.712 176.466 1.00 115.42 ? 298 ASP A OD1  1 
ATOM   4776  O  OD2  . ASP A  1 298 ? 124.425 146.535 175.746 1.00 115.42 ? 298 ASP A OD2  1 
ATOM   4777  H  H    . ASP A  1 298 ? 122.186 144.084 172.138 1.00 115.42 ? 298 ASP A H    1 
ATOM   4778  H  HA   . ASP A  1 298 ? 123.458 143.133 174.328 1.00 115.42 ? 298 ASP A HA   1 
ATOM   4779  H  HB2  . ASP A  1 298 ? 124.138 145.250 173.558 1.00 115.42 ? 298 ASP A HB2  1 
ATOM   4780  H  HB3  . ASP A  1 298 ? 122.678 145.801 173.852 1.00 115.42 ? 298 ASP A HB3  1 
ATOM   4781  N  N    . PRO A  1 299 ? 121.407 142.667 175.714 1.00 119.68 ? 299 PRO A N    1 
ATOM   4782  C  CA   . PRO A  1 299 ? 120.110 142.449 176.383 1.00 119.68 ? 299 PRO A CA   1 
ATOM   4783  C  C    . PRO A  1 299 ? 119.584 143.670 177.117 1.00 119.68 ? 299 PRO A C    1 
ATOM   4784  O  O    . PRO A  1 299 ? 118.370 143.911 177.120 1.00 119.68 ? 299 PRO A O    1 
ATOM   4785  C  CB   . PRO A  1 299 ? 120.412 141.294 177.348 1.00 119.68 ? 299 PRO A CB   1 
ATOM   4786  C  CG   . PRO A  1 299 ? 121.874 141.384 177.600 1.00 119.68 ? 299 PRO A CG   1 
ATOM   4787  C  CD   . PRO A  1 299 ? 122.480 141.861 176.318 1.00 119.68 ? 299 PRO A CD   1 
ATOM   4788  H  HA   . PRO A  1 299 ? 119.447 142.158 175.737 1.00 119.68 ? 299 PRO A HA   1 
ATOM   4789  H  HB2  . PRO A  1 299 ? 119.913 141.417 178.170 1.00 119.68 ? 299 PRO A HB2  1 
ATOM   4790  H  HB3  . PRO A  1 299 ? 120.187 140.447 176.930 1.00 119.68 ? 299 PRO A HB3  1 
ATOM   4791  H  HG2  . PRO A  1 299 ? 122.040 142.023 178.312 1.00 119.68 ? 299 PRO A HG2  1 
ATOM   4792  H  HG3  . PRO A  1 299 ? 122.220 140.509 177.838 1.00 119.68 ? 299 PRO A HG3  1 
ATOM   4793  H  HD2  . PRO A  1 299 ? 123.261 142.405 176.498 1.00 119.68 ? 299 PRO A HD2  1 
ATOM   4794  H  HD3  . PRO A  1 299 ? 122.695 141.116 175.740 1.00 119.68 ? 299 PRO A HD3  1 
ATOM   4795  N  N    . ASP A  1 300 ? 120.465 144.450 177.746 1.00 123.79 ? 300 ASP A N    1 
ATOM   4796  C  CA   . ASP A  1 300 ? 120.011 145.635 178.467 1.00 123.79 ? 300 ASP A CA   1 
ATOM   4797  C  C    . ASP A  1 300 ? 119.397 146.652 177.514 1.00 123.79 ? 300 ASP A C    1 
ATOM   4798  O  O    . ASP A  1 300 ? 118.399 147.302 177.847 1.00 123.79 ? 300 ASP A O    1 
ATOM   4799  C  CB   . ASP A  1 300 ? 121.176 146.256 179.239 1.00 123.79 ? 300 ASP A CB   1 
ATOM   4800  C  CG   . ASP A  1 300 ? 120.769 147.490 180.019 1.00 123.79 ? 300 ASP A CG   1 
ATOM   4801  O  OD1  . ASP A  1 300 ? 119.552 147.725 180.173 1.00 123.79 ? 300 ASP A OD1  1 
ATOM   4802  O  OD2  . ASP A  1 300 ? 121.668 148.225 180.479 1.00 123.79 ? 300 ASP A OD2  1 
ATOM   4803  H  H    . ASP A  1 300 ? 121.314 144.316 177.770 1.00 123.79 ? 300 ASP A H    1 
ATOM   4804  H  HA   . ASP A  1 300 ? 119.333 145.374 179.110 1.00 123.79 ? 300 ASP A HA   1 
ATOM   4805  H  HB2  . ASP A  1 300 ? 121.522 145.605 179.869 1.00 123.79 ? 300 ASP A HB2  1 
ATOM   4806  H  HB3  . ASP A  1 300 ? 121.869 146.514 178.612 1.00 123.79 ? 300 ASP A HB3  1 
ATOM   4807  N  N    . GLY A  1 301 ? 119.895 146.708 176.273 1.00 123.11 ? 301 GLY A N    1 
ATOM   4808  C  CA   . GLY A  1 301 ? 119.404 147.666 175.263 1.00 123.11 ? 301 GLY A CA   1 
ATOM   4809  C  C    . GLY A  1 301 ? 117.989 147.388 174.779 1.00 123.11 ? 301 GLY A C    1 
ATOM   4810  O  O    . GLY A  1 301 ? 117.236 148.376 174.659 1.00 123.11 ? 301 GLY A O    1 
ATOM   4811  H  H    . GLY A  1 301 ? 120.561 146.159 175.972 1.00 123.11 ? 301 GLY A H    1 
ATOM   4812  H  HA2  . GLY A  1 301 ? 119.440 148.577 175.647 1.00 123.11 ? 301 GLY A HA2  1 
ATOM   4813  H  HA3  . GLY A  1 301 ? 120.018 147.645 174.487 1.00 123.11 ? 301 GLY A HA3  1 
ATOM   4814  N  N    . GLY A  1 302 ? 117.623 146.129 174.491 1.00 122.53 ? 302 GLY A N    1 
ATOM   4815  C  CA   . GLY A  1 302 ? 116.304 145.796 173.903 1.00 122.53 ? 302 GLY A CA   1 
ATOM   4816  C  C    . GLY A  1 302 ? 115.760 144.435 174.302 1.00 122.53 ? 302 GLY A C    1 
ATOM   4817  O  O    . GLY A  1 302 ? 116.524 143.669 174.917 1.00 122.53 ? 302 GLY A O    1 
ATOM   4818  H  H    . GLY A  1 302 ? 118.181 145.418 174.607 1.00 122.53 ? 302 GLY A H    1 
ATOM   4819  H  HA2  . GLY A  1 302 ? 115.651 146.486 174.175 1.00 122.53 ? 302 GLY A HA2  1 
ATOM   4820  H  HA3  . GLY A  1 302 ? 116.380 145.835 172.918 1.00 122.53 ? 302 GLY A HA3  1 
ATOM   4821  N  N    . LYS A  1 303 ? 114.493 144.145 173.975 1.00 123.06 ? 303 LYS A N    1 
ATOM   4822  C  CA   . LYS A  1 303 ? 113.825 142.847 174.284 1.00 123.06 ? 303 LYS A CA   1 
ATOM   4823  C  C    . LYS A  1 303 ? 113.301 142.213 172.990 1.00 123.06 ? 303 LYS A C    1 
ATOM   4824  O  O    . LYS A  1 303 ? 112.851 142.977 172.117 1.00 123.06 ? 303 LYS A O    1 
ATOM   4825  C  CB   . LYS A  1 303 ? 112.661 143.067 175.256 1.00 123.06 ? 303 LYS A CB   1 
ATOM   4826  C  CG   . LYS A  1 303 ? 112.069 141.801 175.862 1.00 123.06 ? 303 LYS A CG   1 
ATOM   4827  C  CD   . LYS A  1 303 ? 110.828 142.050 176.688 1.00 123.06 ? 303 LYS A CD   1 
ATOM   4828  C  CE   . LYS A  1 303 ? 110.199 140.773 177.203 1.00 123.06 ? 303 LYS A CE   1 
ATOM   4829  N  NZ   . LYS A  1 303 ? 108.948 141.042 177.950 1.00 123.06 ? 303 LYS A NZ   1 
ATOM   4830  H  H    . LYS A  1 303 ? 113.954 144.735 173.539 1.00 123.06 ? 303 LYS A H    1 
ATOM   4831  H  HA   . LYS A  1 303 ? 114.479 142.240 174.697 1.00 123.06 ? 303 LYS A HA   1 
ATOM   4832  H  HB2  . LYS A  1 303 ? 112.972 143.643 175.985 1.00 123.06 ? 303 LYS A HB2  1 
ATOM   4833  H  HB3  . LYS A  1 303 ? 111.950 143.546 174.782 1.00 123.06 ? 303 LYS A HB3  1 
ATOM   4834  H  HG2  . LYS A  1 303 ? 111.847 141.177 175.140 1.00 123.06 ? 303 LYS A HG2  1 
ATOM   4835  H  HG3  . LYS A  1 303 ? 112.748 141.375 176.427 1.00 123.06 ? 303 LYS A HG3  1 
ATOM   4836  H  HD2  . LYS A  1 303 ? 111.061 142.621 177.450 1.00 123.06 ? 303 LYS A HD2  1 
ATOM   4837  H  HD3  . LYS A  1 303 ? 110.170 142.530 176.140 1.00 123.06 ? 303 LYS A HD3  1 
ATOM   4838  H  HE2  . LYS A  1 303 ? 109.998 140.181 176.453 1.00 123.06 ? 303 LYS A HE2  1 
ATOM   4839  H  HE3  . LYS A  1 303 ? 110.827 140.314 177.791 1.00 123.06 ? 303 LYS A HE3  1 
ATOM   4840  H  HZ1  . LYS A  1 303 ? 108.604 140.264 178.262 1.00 123.06 ? 303 LYS A HZ1  1 
ATOM   4841  H  HZ2  . LYS A  1 303 ? 109.121 141.592 178.651 1.00 123.06 ? 303 LYS A HZ2  1 
ATOM   4842  H  HZ3  . LYS A  1 303 ? 108.342 141.438 177.404 1.00 123.06 ? 303 LYS A HZ3  1 
ATOM   4843  N  N    . MET A  1 304 ? 113.357 140.880 172.862 1.00 125.48 ? 304 MET A N    1 
ATOM   4844  C  CA   . MET A  1 304 ? 112.848 140.138 171.674 1.00 125.48 ? 304 MET A CA   1 
ATOM   4845  C  C    . MET A  1 304 ? 111.315 140.234 171.635 1.00 125.48 ? 304 MET A C    1 
ATOM   4846  O  O    . MET A  1 304 ? 110.718 140.224 172.727 1.00 125.48 ? 304 MET A O    1 
ATOM   4847  C  CB   . MET A  1 304 ? 113.271 138.666 171.757 1.00 125.48 ? 304 MET A CB   1 
ATOM   4848  C  CG   . MET A  1 304 ? 112.867 137.823 170.559 1.00 125.48 ? 304 MET A CG   1 
ATOM   4849  S  SD   . MET A  1 304 ? 113.654 136.192 170.509 1.00 125.48 ? 304 MET A SD   1 
ATOM   4850  C  CE   . MET A  1 304 ? 113.349 135.594 172.171 1.00 125.48 ? 304 MET A CE   1 
ATOM   4851  H  H    . MET A  1 304 ? 113.697 140.342 173.512 1.00 125.48 ? 304 MET A H    1 
ATOM   4852  H  HA   . MET A  1 304 ? 113.227 140.548 170.868 1.00 125.48 ? 304 MET A HA   1 
ATOM   4853  H  HB2  . MET A  1 304 ? 114.243 138.627 171.856 1.00 125.48 ? 304 MET A HB2  1 
ATOM   4854  H  HB3  . MET A  1 304 ? 112.875 138.280 172.562 1.00 125.48 ? 304 MET A HB3  1 
ATOM   4855  H  HG2  . MET A  1 304 ? 111.894 137.700 170.564 1.00 125.48 ? 304 MET A HG2  1 
ATOM   4856  H  HG3  . MET A  1 304 ? 113.105 138.304 169.739 1.00 125.48 ? 304 MET A HG3  1 
ATOM   4857  H  HE1  . MET A  1 304 ? 113.479 134.638 172.195 1.00 125.48 ? 304 MET A HE1  1 
ATOM   4858  H  HE2  . MET A  1 304 ? 113.963 136.017 172.783 1.00 125.48 ? 304 MET A HE2  1 
ATOM   4859  H  HE3  . MET A  1 304 ? 112.444 135.801 172.425 1.00 125.48 ? 304 MET A HE3  1 
ATOM   4860  N  N    . PRO A  1 305 ? 110.635 140.321 170.463 1.00 129.16 ? 305 PRO A N    1 
ATOM   4861  C  CA   . PRO A  1 305 ? 109.164 140.307 170.417 1.00 129.16 ? 305 PRO A CA   1 
ATOM   4862  C  C    . PRO A  1 305 ? 108.546 139.042 171.027 1.00 129.16 ? 305 PRO A C    1 
ATOM   4863  O  O    . PRO A  1 305 ? 109.257 138.060 171.132 1.00 129.16 ? 305 PRO A O    1 
ATOM   4864  C  CB   . PRO A  1 305 ? 108.807 140.350 168.927 1.00 129.16 ? 305 PRO A CB   1 
ATOM   4865  C  CG   . PRO A  1 305 ? 110.022 140.967 168.278 1.00 129.16 ? 305 PRO A CG   1 
ATOM   4866  C  CD   . PRO A  1 305 ? 111.194 140.499 169.115 1.00 129.16 ? 305 PRO A CD   1 
ATOM   4867  H  HA   . PRO A  1 305 ? 108.811 141.115 170.866 1.00 129.16 ? 305 PRO A HA   1 
ATOM   4868  H  HB2  . PRO A  1 305 ? 108.644 139.447 168.578 1.00 129.16 ? 305 PRO A HB2  1 
ATOM   4869  H  HB3  . PRO A  1 305 ? 108.010 140.899 168.772 1.00 129.16 ? 305 PRO A HB3  1 
ATOM   4870  H  HG2  . PRO A  1 305 ? 110.115 140.661 167.352 1.00 129.16 ? 305 PRO A HG2  1 
ATOM   4871  H  HG3  . PRO A  1 305 ? 109.961 141.944 168.284 1.00 129.16 ? 305 PRO A HG3  1 
ATOM   4872  H  HD2  . PRO A  1 305 ? 111.548 139.659 168.771 1.00 129.16 ? 305 PRO A HD2  1 
ATOM   4873  H  HD3  . PRO A  1 305 ? 111.905 141.166 169.116 1.00 129.16 ? 305 PRO A HD3  1 
ATOM   4874  N  N    . LYS A  1 306 ? 107.255 139.068 171.375 1.00 130.58 ? 306 LYS A N    1 
ATOM   4875  C  CA   . LYS A  1 306 ? 106.592 137.947 172.042 1.00 130.58 ? 306 LYS A CA   1 
ATOM   4876  C  C    . LYS A  1 306 ? 106.080 136.916 171.039 1.00 130.58 ? 306 LYS A C    1 
ATOM   4877  O  O    . LYS A  1 306 ? 106.421 135.729 171.119 1.00 130.58 ? 306 LYS A O    1 
ATOM   4878  C  CB   . LYS A  1 306 ? 105.436 138.475 172.897 1.00 130.58 ? 306 LYS A CB   1 
ATOM   4879  C  CG   . LYS A  1 306 ? 104.641 137.401 173.637 1.00 130.58 ? 306 LYS A CG   1 
ATOM   4880  C  CD   . LYS A  1 306 ? 103.295 137.934 174.122 1.00 130.58 ? 306 LYS A CD   1 
ATOM   4881  C  CE   . LYS A  1 306 ? 102.348 138.204 172.958 1.00 130.58 ? 306 LYS A CE   1 
ATOM   4882  N  NZ   . LYS A  1 306 ? 100.965 138.515 173.406 1.00 130.58 ? 306 LYS A NZ   1 
ATOM   4883  H  H    . LYS A  1 306 ? 106.748 139.749 171.246 1.00 130.58 ? 306 LYS A H    1 
ATOM   4884  H  HA   . LYS A  1 306 ? 107.227 137.508 172.631 1.00 130.58 ? 306 LYS A HA   1 
ATOM   4885  H  HB2  . LYS A  1 306 ? 105.797 139.080 173.566 1.00 130.58 ? 306 LYS A HB2  1 
ATOM   4886  H  HB3  . LYS A  1 306 ? 104.826 138.957 172.319 1.00 130.58 ? 306 LYS A HB3  1 
ATOM   4887  H  HG2  . LYS A  1 306 ? 104.466 136.654 173.045 1.00 130.58 ? 306 LYS A HG2  1 
ATOM   4888  H  HG3  . LYS A  1 306 ? 105.144 137.105 174.411 1.00 130.58 ? 306 LYS A HG3  1 
ATOM   4889  H  HD2  . LYS A  1 306 ? 102.880 137.278 174.704 1.00 130.58 ? 306 LYS A HD2  1 
ATOM   4890  H  HD3  . LYS A  1 306 ? 103.433 138.768 174.597 1.00 130.58 ? 306 LYS A HD3  1 
ATOM   4891  H  HE2  . LYS A  1 306 ? 102.672 138.966 172.455 1.00 130.58 ? 306 LYS A HE2  1 
ATOM   4892  H  HE3  . LYS A  1 306 ? 102.310 137.419 172.390 1.00 130.58 ? 306 LYS A HE3  1 
ATOM   4893  H  HZ1  . LYS A  1 306 ? 100.434 138.622 172.699 1.00 130.58 ? 306 LYS A HZ1  1 
ATOM   4894  H  HZ2  . LYS A  1 306 ? 100.651 137.849 173.905 1.00 130.58 ? 306 LYS A HZ2  1 
ATOM   4895  H  HZ3  . LYS A  1 306 ? 100.962 139.265 173.887 1.00 130.58 ? 306 LYS A HZ3  1 
ATOM   4896  N  N    . TRP A  1 307 ? 105.224 137.350 170.110 1.00 133.77 ? 307 TRP A N    1 
ATOM   4897  C  CA   . TRP A  1 307 ? 104.569 136.417 169.196 1.00 133.77 ? 307 TRP A CA   1 
ATOM   4898  C  C    . TRP A  1 307 ? 105.594 135.605 168.414 1.00 133.77 ? 307 TRP A C    1 
ATOM   4899  O  O    . TRP A  1 307 ? 105.521 134.367 168.354 1.00 133.77 ? 307 TRP A O    1 
ATOM   4900  C  CB   . TRP A  1 307 ? 103.662 137.189 168.235 1.00 133.77 ? 307 TRP A CB   1 
ATOM   4901  C  CG   . TRP A  1 307 ? 102.358 137.630 168.830 1.00 133.77 ? 307 TRP A CG   1 
ATOM   4902  C  CD1  . TRP A  1 307 ? 102.148 138.703 169.649 1.00 133.77 ? 307 TRP A CD1  1 
ATOM   4903  C  CD2  . TRP A  1 307 ? 101.078 137.015 168.638 1.00 133.77 ? 307 TRP A CD2  1 
ATOM   4904  N  NE1  . TRP A  1 307 ? 100.817 138.790 169.983 1.00 133.77 ? 307 TRP A NE1  1 
ATOM   4905  C  CE2  . TRP A  1 307 ? 100.140 137.766 169.376 1.00 133.77 ? 307 TRP A CE2  1 
ATOM   4906  C  CE3  . TRP A  1 307 ? 100.635 135.902 167.918 1.00 133.77 ? 307 TRP A CE3  1 
ATOM   4907  C  CZ2  . TRP A  1 307 ? 98.785  137.437 169.414 1.00 133.77 ? 307 TRP A CZ2  1 
ATOM   4908  C  CZ3  . TRP A  1 307 ? 99.289  135.578 167.958 1.00 133.77 ? 307 TRP A CZ3  1 
ATOM   4909  C  CH2  . TRP A  1 307 ? 98.381  136.344 168.700 1.00 133.77 ? 307 TRP A CH2  1 
ATOM   4910  H  H    . TRP A  1 307 ? 105.009 138.174 169.991 1.00 133.77 ? 307 TRP A H    1 
ATOM   4911  H  HA   . TRP A  1 307 ? 104.020 135.803 169.706 1.00 133.77 ? 307 TRP A HA   1 
ATOM   4912  H  HB2  . TRP A  1 307 ? 104.132 137.983 167.935 1.00 133.77 ? 307 TRP A HB2  1 
ATOM   4913  H  HB3  . TRP A  1 307 ? 103.461 136.623 167.475 1.00 133.77 ? 307 TRP A HB3  1 
ATOM   4914  H  HD1  . TRP A  1 307 ? 102.809 139.291 169.940 1.00 133.77 ? 307 TRP A HD1  1 
ATOM   4915  H  HE1  . TRP A  1 307 ? 100.466 139.390 170.491 1.00 133.77 ? 307 TRP A HE1  1 
ATOM   4916  H  HE3  . TRP A  1 307 ? 101.235 135.390 167.424 1.00 133.77 ? 307 TRP A HE3  1 
ATOM   4917  H  HZ2  . TRP A  1 307 ? 98.179  137.942 169.905 1.00 133.77 ? 307 TRP A HZ2  1 
ATOM   4918  H  HZ3  . TRP A  1 307 ? 98.982  134.839 167.483 1.00 133.77 ? 307 TRP A HZ3  1 
ATOM   4919  H  HH2  . TRP A  1 307 ? 97.483  136.103 168.709 1.00 133.77 ? 307 TRP A HH2  1 
ATOM   4920  N  N    . THR A  1 308 ? 106.547 136.298 167.787 1.00 131.65 ? 308 THR A N    1 
ATOM   4921  C  CA   . THR A  1 308 ? 107.610 135.620 167.058 1.00 131.65 ? 308 THR A CA   1 
ATOM   4922  C  C    . THR A  1 308 ? 108.321 134.623 167.958 1.00 131.65 ? 308 THR A C    1 
ATOM   4923  O  O    . THR A  1 308 ? 108.577 133.480 167.563 1.00 131.65 ? 308 THR A O    1 
ATOM   4924  C  CB   . THR A  1 308 ? 108.604 136.650 166.513 1.00 131.65 ? 308 THR A CB   1 
ATOM   4925  O  OG1  . THR A  1 308 ? 107.899 137.661 165.782 1.00 131.65 ? 308 THR A OG1  1 
ATOM   4926  C  CG2  . THR A  1 308 ? 109.633 135.986 165.604 1.00 131.65 ? 308 THR A CG2  1 
ATOM   4927  H  H    . THR A  1 308 ? 106.596 137.157 167.768 1.00 131.65 ? 308 THR A H    1 
ATOM   4928  H  HA   . THR A  1 308 ? 107.227 135.141 166.307 1.00 131.65 ? 308 THR A HA   1 
ATOM   4929  H  HB   . THR A  1 308 ? 109.075 137.061 167.254 1.00 131.65 ? 308 THR A HB   1 
ATOM   4930  H  HG1  . THR A  1 308 ? 108.430 138.267 165.543 1.00 131.65 ? 308 THR A HG1  1 
ATOM   4931  H  HG21 . THR A  1 308 ? 110.262 136.649 165.279 1.00 131.65 ? 308 THR A HG21 1 
ATOM   4932  H  HG22 . THR A  1 308 ? 110.123 135.306 166.093 1.00 131.65 ? 308 THR A HG22 1 
ATOM   4933  H  HG23 . THR A  1 308 ? 109.191 135.572 164.845 1.00 131.65 ? 308 THR A HG23 1 
ATOM   4934  N  N    . ARG A  1 309 ? 108.636 135.040 169.185 1.00 130.56 ? 309 ARG A N    1 
ATOM   4935  C  CA   . ARG A  1 309 ? 109.367 134.171 170.098 1.00 130.56 ? 309 ARG A CA   1 
ATOM   4936  C  C    . ARG A  1 309 ? 108.613 132.878 170.344 1.00 130.56 ? 309 ARG A C    1 
ATOM   4937  O  O    . ARG A  1 309 ? 109.181 131.788 170.239 1.00 130.56 ? 309 ARG A O    1 
ATOM   4938  C  CB   . ARG A  1 309 ? 109.615 134.883 171.426 1.00 130.56 ? 309 ARG A CB   1 
ATOM   4939  C  CG   . ARG A  1 309 ? 110.080 133.949 172.561 1.00 130.56 ? 309 ARG A CG   1 
ATOM   4940  C  CD   . ARG A  1 309 ? 109.965 134.614 173.919 1.00 130.56 ? 309 ARG A CD   1 
ATOM   4941  N  NE   . ARG A  1 309 ? 110.364 133.722 175.002 1.00 130.56 ? 309 ARG A NE   1 
ATOM   4942  C  CZ   . ARG A  1 309 ? 110.539 134.118 176.258 1.00 130.56 ? 309 ARG A CZ   1 
ATOM   4943  N  NH1  . ARG A  1 309 ? 110.901 133.243 177.186 1.00 130.56 ? 309 ARG A NH1  1 
ATOM   4944  N  NH2  . ARG A  1 309 ? 110.377 135.395 176.584 1.00 130.56 ? 309 ARG A NH2  1 
ATOM   4945  H  H    . ARG A  1 309 ? 108.442 135.813 169.507 1.00 130.56 ? 309 ARG A H    1 
ATOM   4946  H  HA   . ARG A  1 309 ? 110.225 133.950 169.705 1.00 130.56 ? 309 ARG A HA   1 
ATOM   4947  H  HB2  . ARG A  1 309 ? 110.297 135.557 171.289 1.00 130.56 ? 309 ARG A HB2  1 
ATOM   4948  H  HB3  . ARG A  1 309 ? 108.788 135.302 171.710 1.00 130.56 ? 309 ARG A HB3  1 
ATOM   4949  H  HG2  . ARG A  1 309 ? 109.535 133.150 172.597 1.00 130.56 ? 309 ARG A HG2  1 
ATOM   4950  H  HG3  . ARG A  1 309 ? 111.002 133.699 172.415 1.00 130.56 ? 309 ARG A HG3  1 
ATOM   4951  H  HD2  . ARG A  1 309 ? 110.508 135.410 173.967 1.00 130.56 ? 309 ARG A HD2  1 
ATOM   4952  H  HD3  . ARG A  1 309 ? 109.034 134.842 174.061 1.00 130.56 ? 309 ARG A HD3  1 
ATOM   4953  H  HE   . ARG A  1 309 ? 110.779 133.004 174.770 1.00 130.56 ? 309 ARG A HE   1 
ATOM   4954  H  HH11 . ARG A  1 309 ? 111.012 132.416 176.978 1.00 130.56 ? 309 ARG A HH11 1 
ATOM   4955  H  HH12 . ARG A  1 309 ? 111.021 133.504 177.997 1.00 130.56 ? 309 ARG A HH12 1 
ATOM   4956  H  HH21 . ARG A  1 309 ? 110.147 135.969 175.987 1.00 130.56 ? 309 ARG A HH21 1 
ATOM   4957  H  HH22 . ARG A  1 309 ? 110.498 135.650 177.396 1.00 130.56 ? 309 ARG A HH22 1 
ATOM   4958  N  N    . VAL A  1 310 ? 107.341 132.981 170.718 1.00 131.80 ? 310 VAL A N    1 
ATOM   4959  C  CA   . VAL A  1 310 ? 106.620 131.785 171.132 1.00 131.80 ? 310 VAL A CA   1 
ATOM   4960  C  C    . VAL A  1 310 ? 106.387 130.869 169.939 1.00 131.80 ? 310 VAL A C    1 
ATOM   4961  O  O    . VAL A  1 310 ? 106.537 129.643 170.041 1.00 131.80 ? 310 VAL A O    1 
ATOM   4962  C  CB   . VAL A  1 310 ? 105.306 132.167 171.839 1.00 131.80 ? 310 VAL A CB   1 
ATOM   4963  C  CG1  . VAL A  1 310 ? 104.367 132.901 170.893 1.00 131.80 ? 310 VAL A CG1  1 
ATOM   4964  C  CG2  . VAL A  1 310 ? 104.651 130.932 172.431 1.00 131.80 ? 310 VAL A CG2  1 
ATOM   4965  H  H    . VAL A  1 310 ? 106.886 133.710 170.738 1.00 131.80 ? 310 VAL A H    1 
ATOM   4966  H  HA   . VAL A  1 310 ? 107.166 131.301 171.770 1.00 131.80 ? 310 VAL A HA   1 
ATOM   4967  H  HB   . VAL A  1 310 ? 105.514 132.767 172.571 1.00 131.80 ? 310 VAL A HB   1 
ATOM   4968  H  HG11 . VAL A  1 310 ? 103.584 133.186 171.390 1.00 131.80 ? 310 VAL A HG11 1 
ATOM   4969  H  HG12 . VAL A  1 310 ? 104.827 133.675 170.532 1.00 131.80 ? 310 VAL A HG12 1 
ATOM   4970  H  HG13 . VAL A  1 310 ? 104.104 132.305 170.177 1.00 131.80 ? 310 VAL A HG13 1 
ATOM   4971  H  HG21 . VAL A  1 310 ? 103.852 131.200 172.909 1.00 131.80 ? 310 VAL A HG21 1 
ATOM   4972  H  HG22 . VAL A  1 310 ? 104.427 130.319 171.715 1.00 131.80 ? 310 VAL A HG22 1 
ATOM   4973  H  HG23 . VAL A  1 310 ? 105.278 130.512 173.041 1.00 131.80 ? 310 VAL A HG23 1 
ATOM   4974  N  N    . ILE A  1 311 ? 106.043 131.442 168.782 1.00 133.85 ? 311 ILE A N    1 
ATOM   4975  C  CA   . ILE A  1 311 ? 105.849 130.617 167.593 1.00 133.85 ? 311 ILE A CA   1 
ATOM   4976  C  C    . ILE A  1 311 ? 107.141 129.887 167.249 1.00 133.85 ? 311 ILE A C    1 
ATOM   4977  O  O    . ILE A  1 311 ? 107.148 128.675 166.989 1.00 133.85 ? 311 ILE A O    1 
ATOM   4978  C  CB   . ILE A  1 311 ? 105.355 131.479 166.417 1.00 133.85 ? 311 ILE A CB   1 
ATOM   4979  C  CG1  . ILE A  1 311 ? 103.966 132.044 166.732 1.00 133.85 ? 311 ILE A CG1  1 
ATOM   4980  C  CG2  . ILE A  1 311 ? 105.333 130.656 165.126 1.00 133.85 ? 311 ILE A CG2  1 
ATOM   4981  C  CD1  . ILE A  1 311 ? 103.409 132.965 165.670 1.00 133.85 ? 311 ILE A CD1  1 
ATOM   4982  H  H    . ILE A  1 311 ? 105.920 132.285 168.664 1.00 133.85 ? 311 ILE A H    1 
ATOM   4983  H  HA   . ILE A  1 311 ? 105.170 129.949 167.780 1.00 133.85 ? 311 ILE A HA   1 
ATOM   4984  H  HB   . ILE A  1 311 ? 105.969 132.221 166.299 1.00 133.85 ? 311 ILE A HB   1 
ATOM   4985  H  HG12 . ILE A  1 311 ? 103.345 131.307 166.840 1.00 133.85 ? 311 ILE A HG12 1 
ATOM   4986  H  HG13 . ILE A  1 311 ? 104.017 132.550 167.556 1.00 133.85 ? 311 ILE A HG13 1 
ATOM   4987  H  HG21 . ILE A  1 311 ? 104.981 131.197 164.405 1.00 133.85 ? 311 ILE A HG21 1 
ATOM   4988  H  HG22 . ILE A  1 311 ? 106.235 130.379 164.903 1.00 133.85 ? 311 ILE A HG22 1 
ATOM   4989  H  HG23 . ILE A  1 311 ? 104.772 129.876 165.260 1.00 133.85 ? 311 ILE A HG23 1 
ATOM   4990  H  HD11 . ILE A  1 311 ? 102.557 133.314 165.976 1.00 133.85 ? 311 ILE A HD11 1 
ATOM   4991  H  HD12 . ILE A  1 311 ? 104.034 133.693 165.527 1.00 133.85 ? 311 ILE A HD12 1 
ATOM   4992  H  HD13 . ILE A  1 311 ? 103.282 132.468 164.848 1.00 133.85 ? 311 ILE A HD13 1 
ATOM   4993  N  N    . LEU A  1 312 ? 108.259 130.618 167.254 1.00 124.69 ? 312 LEU A N    1 
ATOM   4994  C  CA   . LEU A  1 312 ? 109.544 130.024 166.910 1.00 124.69 ? 312 LEU A CA   1 
ATOM   4995  C  C    . LEU A  1 312 ? 109.939 128.946 167.907 1.00 124.69 ? 312 LEU A C    1 
ATOM   4996  O  O    . LEU A  1 312 ? 110.451 127.891 167.521 1.00 124.69 ? 312 LEU A O    1 
ATOM   4997  C  CB   . LEU A  1 312 ? 110.608 131.118 166.857 1.00 124.69 ? 312 LEU A CB   1 
ATOM   4998  C  CG   . LEU A  1 312 ? 112.004 130.705 166.400 1.00 124.69 ? 312 LEU A CG   1 
ATOM   4999  C  CD1  . LEU A  1 312 ? 111.993 130.230 164.957 1.00 124.69 ? 312 LEU A CD1  1 
ATOM   5000  C  CD2  . LEU A  1 312 ? 112.935 131.875 166.569 1.00 124.69 ? 312 LEU A CD2  1 
ATOM   5001  H  H    . LEU A  1 312 ? 108.296 131.453 167.455 1.00 124.69 ? 312 LEU A H    1 
ATOM   5002  H  HA   . LEU A  1 312 ? 109.478 129.619 166.031 1.00 124.69 ? 312 LEU A HA   1 
ATOM   5003  H  HB2  . LEU A  1 312 ? 110.301 131.816 166.258 1.00 124.69 ? 312 LEU A HB2  1 
ATOM   5004  H  HB3  . LEU A  1 312 ? 110.702 131.483 167.751 1.00 124.69 ? 312 LEU A HB3  1 
ATOM   5005  H  HG   . LEU A  1 312 ? 112.324 129.982 166.960 1.00 124.69 ? 312 LEU A HG   1 
ATOM   5006  H  HD11 . LEU A  1 312 ? 112.895 129.984 164.700 1.00 124.69 ? 312 LEU A HD11 1 
ATOM   5007  H  HD12 . LEU A  1 312 ? 111.404 129.463 164.878 1.00 124.69 ? 312 LEU A HD12 1 
ATOM   5008  H  HD13 . LEU A  1 312 ? 111.675 130.951 164.393 1.00 124.69 ? 312 LEU A HD13 1 
ATOM   5009  H  HD21 . LEU A  1 312 ? 113.816 131.619 166.263 1.00 124.69 ? 312 LEU A HD21 1 
ATOM   5010  H  HD22 . LEU A  1 312 ? 112.598 132.617 166.042 1.00 124.69 ? 312 LEU A HD22 1 
ATOM   5011  H  HD23 . LEU A  1 312 ? 112.962 132.119 167.507 1.00 124.69 ? 312 LEU A HD23 1 
ATOM   5012  N  N    . LEU A  1 313 ? 109.719 129.200 169.198 1.00 134.26 ? 313 LEU A N    1 
ATOM   5013  C  CA   . LEU A  1 313 ? 110.074 128.225 170.222 1.00 134.26 ? 313 LEU A CA   1 
ATOM   5014  C  C    . LEU A  1 313 ? 109.271 126.943 170.061 1.00 134.26 ? 313 LEU A C    1 
ATOM   5015  O  O    . LEU A  1 313 ? 109.821 125.841 170.167 1.00 134.26 ? 313 LEU A O    1 
ATOM   5016  C  CB   . LEU A  1 313 ? 109.851 128.830 171.607 1.00 134.26 ? 313 LEU A CB   1 
ATOM   5017  C  CG   . LEU A  1 313 ? 110.087 127.918 172.810 1.00 134.26 ? 313 LEU A CG   1 
ATOM   5018  C  CD1  . LEU A  1 313 ? 111.517 127.402 172.834 1.00 134.26 ? 313 LEU A CD1  1 
ATOM   5019  C  CD2  . LEU A  1 313 ? 109.756 128.661 174.097 1.00 134.26 ? 313 LEU A CD2  1 
ATOM   5020  H  H    . LEU A  1 313 ? 109.372 129.926 169.503 1.00 134.26 ? 313 LEU A H    1 
ATOM   5021  H  HA   . LEU A  1 313 ? 111.015 128.005 170.139 1.00 134.26 ? 313 LEU A HA   1 
ATOM   5022  H  HB2  . LEU A  1 313 ? 110.448 129.588 171.702 1.00 134.26 ? 313 LEU A HB2  1 
ATOM   5023  H  HB3  . LEU A  1 313 ? 108.933 129.137 171.657 1.00 134.26 ? 313 LEU A HB3  1 
ATOM   5024  H  HG   . LEU A  1 313 ? 109.495 127.153 172.744 1.00 134.26 ? 313 LEU A HG   1 
ATOM   5025  H  HD11 . LEU A  1 313 ? 111.645 126.851 173.622 1.00 134.26 ? 313 LEU A HD11 1 
ATOM   5026  H  HD12 . LEU A  1 313 ? 111.673 126.876 172.034 1.00 134.26 ? 313 LEU A HD12 1 
ATOM   5027  H  HD13 . LEU A  1 313 ? 112.123 128.159 172.857 1.00 134.26 ? 313 LEU A HD13 1 
ATOM   5028  H  HD21 . LEU A  1 313 ? 109.969 128.097 174.857 1.00 134.26 ? 313 LEU A HD21 1 
ATOM   5029  H  HD22 . LEU A  1 313 ? 110.282 129.475 174.133 1.00 134.26 ? 313 LEU A HD22 1 
ATOM   5030  H  HD23 . LEU A  1 313 ? 108.811 128.882 174.102 1.00 134.26 ? 313 LEU A HD23 1 
ATOM   5031  N  N    . ASN A  1 314 ? 107.966 127.062 169.804 1.00 136.50 ? 314 ASN A N    1 
ATOM   5032  C  CA   . ASN A  1 314 ? 107.150 125.867 169.616 1.00 136.50 ? 314 ASN A CA   1 
ATOM   5033  C  C    . ASN A  1 314 ? 107.591 125.096 168.377 1.00 136.50 ? 314 ASN A C    1 
ATOM   5034  O  O    . ASN A  1 314 ? 107.732 123.863 168.409 1.00 136.50 ? 314 ASN A O    1 
ATOM   5035  C  CB   . ASN A  1 314 ? 105.675 126.258 169.523 1.00 136.50 ? 314 ASN A CB   1 
ATOM   5036  C  CG   . ASN A  1 314 ? 105.163 126.892 170.799 1.00 136.50 ? 314 ASN A CG   1 
ATOM   5037  O  OD1  . ASN A  1 314 ? 105.925 127.125 171.737 1.00 136.50 ? 314 ASN A OD1  1 
ATOM   5038  N  ND2  . ASN A  1 314 ? 103.868 127.175 170.843 1.00 136.50 ? 314 ASN A ND2  1 
ATOM   5039  H  H    . ASN A  1 314 ? 107.540 127.806 169.732 1.00 136.50 ? 314 ASN A H    1 
ATOM   5040  H  HA   . ASN A  1 314 ? 107.260 125.289 170.387 1.00 136.50 ? 314 ASN A HA   1 
ATOM   5041  H  HB2  . ASN A  1 314 ? 105.562 126.899 168.804 1.00 136.50 ? 314 ASN A HB2  1 
ATOM   5042  H  HB3  . ASN A  1 314 ? 105.145 125.464 169.349 1.00 136.50 ? 314 ASN A HB3  1 
ATOM   5043  H  HD21 . ASN A  1 314 ? 103.530 127.535 171.547 1.00 136.50 ? 314 ASN A HD21 1 
ATOM   5044  H  HD22 . ASN A  1 314 ? 103.366 126.997 170.167 1.00 136.50 ? 314 ASN A HD22 1 
ATOM   5045  N  N    . TRP A  1 315 ? 107.829 125.810 167.272 1.00 134.91 ? 315 TRP A N    1 
ATOM   5046  C  CA   . TRP A  1 315 ? 108.252 125.141 166.047 1.00 134.91 ? 315 TRP A CA   1 
ATOM   5047  C  C    . TRP A  1 315 ? 109.590 124.441 166.244 1.00 134.91 ? 315 TRP A C    1 
ATOM   5048  O  O    . TRP A  1 315 ? 109.792 123.321 165.761 1.00 134.91 ? 315 TRP A O    1 
ATOM   5049  C  CB   . TRP A  1 315 ? 108.334 126.149 164.900 1.00 134.91 ? 315 TRP A CB   1 
ATOM   5050  C  CG   . TRP A  1 315 ? 107.037 126.312 164.166 1.00 134.91 ? 315 TRP A CG   1 
ATOM   5051  C  CD1  . TRP A  1 315 ? 106.047 127.210 164.441 1.00 134.91 ? 315 TRP A CD1  1 
ATOM   5052  C  CD2  . TRP A  1 315 ? 106.586 125.554 163.035 1.00 134.91 ? 315 TRP A CD2  1 
ATOM   5053  N  NE1  . TRP A  1 315 ? 105.009 127.058 163.555 1.00 134.91 ? 315 TRP A NE1  1 
ATOM   5054  C  CE2  . TRP A  1 315 ? 105.315 126.048 162.682 1.00 134.91 ? 315 TRP A CE2  1 
ATOM   5055  C  CE3  . TRP A  1 315 ? 107.133 124.505 162.290 1.00 134.91 ? 315 TRP A CE3  1 
ATOM   5056  C  CZ2  . TRP A  1 315 ? 104.583 125.531 161.615 1.00 134.91 ? 315 TRP A CZ2  1 
ATOM   5057  C  CZ3  . TRP A  1 315 ? 106.404 123.994 161.232 1.00 134.91 ? 315 TRP A CZ3  1 
ATOM   5058  C  CH2  . TRP A  1 315 ? 105.143 124.507 160.905 1.00 134.91 ? 315 TRP A CH2  1 
ATOM   5059  H  H    . TRP A  1 315 ? 107.756 126.665 167.211 1.00 134.91 ? 315 TRP A H    1 
ATOM   5060  H  HA   . TRP A  1 315 ? 107.593 124.470 165.811 1.00 134.91 ? 315 TRP A HA   1 
ATOM   5061  H  HB2  . TRP A  1 315 ? 108.584 127.014 165.260 1.00 134.91 ? 315 TRP A HB2  1 
ATOM   5062  H  HB3  . TRP A  1 315 ? 109.003 125.849 164.266 1.00 134.91 ? 315 TRP A HB3  1 
ATOM   5063  H  HD1  . TRP A  1 315 ? 106.072 127.834 165.130 1.00 134.91 ? 315 TRP A HD1  1 
ATOM   5064  H  HE1  . TRP A  1 315 ? 104.285 127.521 163.548 1.00 134.91 ? 315 TRP A HE1  1 
ATOM   5065  H  HE3  . TRP A  1 315 ? 107.969 124.157 162.500 1.00 134.91 ? 315 TRP A HE3  1 
ATOM   5066  H  HZ2  . TRP A  1 315 ? 103.745 125.869 161.395 1.00 134.91 ? 315 TRP A HZ2  1 
ATOM   5067  H  HZ3  . TRP A  1 315 ? 106.758 123.296 160.728 1.00 134.91 ? 315 TRP A HZ3  1 
ATOM   5068  H  HH2  . TRP A  1 315 ? 104.675 124.144 160.189 1.00 134.91 ? 315 TRP A HH2  1 
ATOM   5069  N  N    . CYS A  1 316 ? 110.515 125.087 166.955 1.00 130.66 ? 316 CYS A N    1 
ATOM   5070  C  CA   . CYS A  1 316 ? 111.803 124.469 167.242 1.00 130.66 ? 316 CYS A CA   1 
ATOM   5071  C  C    . CYS A  1 316 ? 111.638 123.221 168.094 1.00 130.66 ? 316 CYS A C    1 
ATOM   5072  O  O    . CYS A  1 316 ? 112.208 122.166 167.791 1.00 130.66 ? 316 CYS A O    1 
ATOM   5073  C  CB   . CYS A  1 316 ? 112.712 125.463 167.954 1.00 130.66 ? 316 CYS A CB   1 
ATOM   5074  S  SG   . CYS A  1 316 ? 114.278 124.728 168.426 1.00 130.66 ? 316 CYS A SG   1 
ATOM   5075  H  H    . CYS A  1 316 ? 110.418 125.878 167.280 1.00 130.66 ? 316 CYS A H    1 
ATOM   5076  H  HA   . CYS A  1 316 ? 112.229 124.214 166.410 1.00 130.66 ? 316 CYS A HA   1 
ATOM   5077  H  HB2  . CYS A  1 316 ? 112.890 126.214 167.367 1.00 130.66 ? 316 CYS A HB2  1 
ATOM   5078  H  HB3  . CYS A  1 316 ? 112.270 125.768 168.762 1.00 130.66 ? 316 CYS A HB3  1 
ATOM   5079  H  HG   . CYS A  1 316 ? 114.801 124.395 167.399 1.00 130.66 ? 316 CYS A HG   1 
ATOM   5080  N  N    . ALA A  1 317 ? 110.865 123.324 169.176 1.00 136.13 ? 317 ALA A N    1 
ATOM   5081  C  CA   . ALA A  1 317 ? 110.705 122.186 170.071 1.00 136.13 ? 317 ALA A CA   1 
ATOM   5082  C  C    . ALA A  1 317 ? 110.127 120.993 169.328 1.00 136.13 ? 317 ALA A C    1 
ATOM   5083  O  O    . ALA A  1 317 ? 110.558 119.853 169.535 1.00 136.13 ? 317 ALA A O    1 
ATOM   5084  C  CB   . ALA A  1 317 ? 109.816 122.565 171.254 1.00 136.13 ? 317 ALA A CB   1 
ATOM   5085  H  H    . ALA A  1 317 ? 110.430 124.029 169.406 1.00 136.13 ? 317 ALA A H    1 
ATOM   5086  H  HA   . ALA A  1 317 ? 111.576 121.931 170.415 1.00 136.13 ? 317 ALA A HA   1 
ATOM   5087  H  HB1  . ALA A  1 317 ? 109.739 121.801 171.846 1.00 136.13 ? 317 ALA A HB1  1 
ATOM   5088  H  HB2  . ALA A  1 317 ? 110.219 123.310 171.726 1.00 136.13 ? 317 ALA A HB2  1 
ATOM   5089  H  HB3  . ALA A  1 317 ? 108.941 122.816 170.923 1.00 136.13 ? 317 ALA A HB3  1 
ATOM   5090  N  N    . TRP A  1 318 ? 109.152 121.234 168.450 1.00 136.08 ? 318 TRP A N    1 
ATOM   5091  C  CA   . TRP A  1 318 ? 108.578 120.123 167.698 1.00 136.08 ? 318 TRP A CA   1 
ATOM   5092  C  C    . TRP A  1 318 ? 109.555 119.588 166.657 1.00 136.08 ? 318 TRP A C    1 
ATOM   5093  O  O    . TRP A  1 318 ? 109.646 118.371 166.455 1.00 136.08 ? 318 TRP A O    1 
ATOM   5094  C  CB   . TRP A  1 318 ? 107.270 120.554 167.040 1.00 136.08 ? 318 TRP A CB   1 
ATOM   5095  C  CG   . TRP A  1 318 ? 106.106 120.514 167.980 1.00 136.08 ? 318 TRP A CG   1 
ATOM   5096  C  CD1  . TRP A  1 318 ? 105.856 119.573 168.936 1.00 136.08 ? 318 TRP A CD1  1 
ATOM   5097  C  CD2  . TRP A  1 318 ? 105.036 121.460 168.060 1.00 136.08 ? 318 TRP A CD2  1 
ATOM   5098  N  NE1  . TRP A  1 318 ? 104.697 119.873 169.604 1.00 136.08 ? 318 TRP A NE1  1 
ATOM   5099  C  CE2  . TRP A  1 318 ? 104.173 121.028 169.086 1.00 136.08 ? 318 TRP A CE2  1 
ATOM   5100  C  CE3  . TRP A  1 318 ? 104.723 122.630 167.364 1.00 136.08 ? 318 TRP A CE3  1 
ATOM   5101  C  CZ2  . TRP A  1 318 ? 103.018 121.723 169.431 1.00 136.08 ? 318 TRP A CZ2  1 
ATOM   5102  C  CZ3  . TRP A  1 318 ? 103.576 123.319 167.708 1.00 136.08 ? 318 TRP A CZ3  1 
ATOM   5103  C  CH2  . TRP A  1 318 ? 102.738 122.864 168.732 1.00 136.08 ? 318 TRP A CH2  1 
ATOM   5104  H  H    . TRP A  1 318 ? 108.816 122.006 168.276 1.00 136.08 ? 318 TRP A H    1 
ATOM   5105  H  HA   . TRP A  1 318 ? 108.392 119.397 168.311 1.00 136.08 ? 318 TRP A HA   1 
ATOM   5106  H  HB2  . TRP A  1 318 ? 107.367 121.465 166.720 1.00 136.08 ? 318 TRP A HB2  1 
ATOM   5107  H  HB3  . TRP A  1 318 ? 107.080 119.958 166.299 1.00 136.08 ? 318 TRP A HB3  1 
ATOM   5108  H  HD1  . TRP A  1 318 ? 106.395 118.834 169.110 1.00 136.08 ? 318 TRP A HD1  1 
ATOM   5109  H  HE1  . TRP A  1 318 ? 104.358 119.410 170.244 1.00 136.08 ? 318 TRP A HE1  1 
ATOM   5110  H  HE3  . TRP A  1 318 ? 105.276 122.937 166.682 1.00 136.08 ? 318 TRP A HE3  1 
ATOM   5111  H  HZ2  . TRP A  1 318 ? 102.460 121.422 170.111 1.00 136.08 ? 318 TRP A HZ2  1 
ATOM   5112  H  HZ3  . TRP A  1 318 ? 103.358 124.099 167.251 1.00 136.08 ? 318 TRP A HZ3  1 
ATOM   5113  H  HH2  . TRP A  1 318 ? 101.974 123.349 168.941 1.00 136.08 ? 318 TRP A HH2  1 
ATOM   5114  N  N    . PHE A  1 319 ? 110.297 120.474 165.990 1.00 127.46 ? 319 PHE A N    1 
ATOM   5115  C  CA   . PHE A  1 319 ? 111.221 120.018 164.959 1.00 127.46 ? 319 PHE A CA   1 
ATOM   5116  C  C    . PHE A  1 319 ? 112.376 119.213 165.542 1.00 127.46 ? 319 PHE A C    1 
ATOM   5117  O  O    . PHE A  1 319 ? 112.814 118.231 164.932 1.00 127.46 ? 319 PHE A O    1 
ATOM   5118  C  CB   . PHE A  1 319 ? 111.752 121.213 164.169 1.00 127.46 ? 319 PHE A CB   1 
ATOM   5119  C  CG   . PHE A  1 319 ? 112.647 120.834 163.023 1.00 127.46 ? 319 PHE A CG   1 
ATOM   5120  C  CD1  . PHE A  1 319 ? 112.502 119.616 162.377 1.00 127.46 ? 319 PHE A CD1  1 
ATOM   5121  C  CD2  . PHE A  1 319 ? 113.645 121.695 162.599 1.00 127.46 ? 319 PHE A CD2  1 
ATOM   5122  C  CE1  . PHE A  1 319 ? 113.326 119.268 161.330 1.00 127.46 ? 319 PHE A CE1  1 
ATOM   5123  C  CE2  . PHE A  1 319 ? 114.481 121.345 161.562 1.00 127.46 ? 319 PHE A CE2  1 
ATOM   5124  C  CZ   . PHE A  1 319 ? 114.324 120.128 160.929 1.00 127.46 ? 319 PHE A CZ   1 
ATOM   5125  H  H    . PHE A  1 319 ? 110.289 121.324 166.116 1.00 127.46 ? 319 PHE A H    1 
ATOM   5126  H  HA   . PHE A  1 319 ? 110.733 119.444 164.350 1.00 127.46 ? 319 PHE A HA   1 
ATOM   5127  H  HB2  . PHE A  1 319 ? 110.997 121.704 163.807 1.00 127.46 ? 319 PHE A HB2  1 
ATOM   5128  H  HB3  . PHE A  1 319 ? 112.260 121.784 164.766 1.00 127.46 ? 319 PHE A HB3  1 
ATOM   5129  H  HD1  . PHE A  1 319 ? 111.838 119.027 162.649 1.00 127.46 ? 319 PHE A HD1  1 
ATOM   5130  H  HD2  . PHE A  1 319 ? 113.755 122.518 163.021 1.00 127.46 ? 319 PHE A HD2  1 
ATOM   5131  H  HE1  . PHE A  1 319 ? 113.216 118.449 160.901 1.00 127.46 ? 319 PHE A HE1  1 
ATOM   5132  H  HE2  . PHE A  1 319 ? 115.137 121.936 161.269 1.00 127.46 ? 319 PHE A HE2  1 
ATOM   5133  H  HZ   . PHE A  1 319 ? 114.872 119.906 160.208 1.00 127.46 ? 319 PHE A HZ   1 
ATOM   5134  N  N    . LEU A  1 320 ? 112.878 119.602 166.712 1.00 132.27 ? 320 LEU A N    1 
ATOM   5135  C  CA   . LEU A  1 320 ? 114.024 118.949 167.329 1.00 132.27 ? 320 LEU A CA   1 
ATOM   5136  C  C    . LEU A  1 320 ? 113.621 117.861 168.318 1.00 132.27 ? 320 LEU A C    1 
ATOM   5137  O  O    . LEU A  1 320 ? 114.498 117.246 168.933 1.00 132.27 ? 320 LEU A O    1 
ATOM   5138  C  CB   . LEU A  1 320 ? 114.904 119.995 168.020 1.00 132.27 ? 320 LEU A CB   1 
ATOM   5139  C  CG   . LEU A  1 320 ? 115.402 121.148 167.136 1.00 132.27 ? 320 LEU A CG   1 
ATOM   5140  C  CD1  . LEU A  1 320 ? 116.384 122.021 167.897 1.00 132.27 ? 320 LEU A CD1  1 
ATOM   5141  C  CD2  . LEU A  1 320 ? 116.048 120.658 165.842 1.00 132.27 ? 320 LEU A CD2  1 
ATOM   5142  H  H    . LEU A  1 320 ? 112.563 120.253 167.177 1.00 132.27 ? 320 LEU A H    1 
ATOM   5143  H  HA   . LEU A  1 320 ? 114.554 118.525 166.639 1.00 132.27 ? 320 LEU A HA   1 
ATOM   5144  H  HB2  . LEU A  1 320 ? 114.393 120.392 168.743 1.00 132.27 ? 320 LEU A HB2  1 
ATOM   5145  H  HB3  . LEU A  1 320 ? 115.683 119.547 168.385 1.00 132.27 ? 320 LEU A HB3  1 
ATOM   5146  H  HG   . LEU A  1 320 ? 114.643 121.700 166.894 1.00 132.27 ? 320 LEU A HG   1 
ATOM   5147  H  HD11 . LEU A  1 320 ? 116.650 122.759 167.327 1.00 132.27 ? 320 LEU A HD11 1 
ATOM   5148  H  HD12 . LEU A  1 320 ? 115.952 122.356 168.699 1.00 132.27 ? 320 LEU A HD12 1 
ATOM   5149  H  HD13 . LEU A  1 320 ? 117.161 121.491 168.134 1.00 132.27 ? 320 LEU A HD13 1 
ATOM   5150  H  HD21 . LEU A  1 320 ? 116.213 121.423 165.269 1.00 132.27 ? 320 LEU A HD21 1 
ATOM   5151  H  HD22 . LEU A  1 320 ? 116.888 120.221 166.055 1.00 132.27 ? 320 LEU A HD22 1 
ATOM   5152  H  HD23 . LEU A  1 320 ? 115.456 120.037 165.391 1.00 132.27 ? 320 LEU A HD23 1 
ATOM   5153  N  N    . ARG A  1 321 ? 112.324 117.600 168.471 1.00 139.85 ? 321 ARG A N    1 
ATOM   5154  C  CA   . ARG A  1 321 ? 111.831 116.566 169.381 1.00 139.85 ? 321 ARG A CA   1 
ATOM   5155  C  C    . ARG A  1 321 ? 112.522 116.636 170.740 1.00 139.85 ? 321 ARG A C    1 
ATOM   5156  O  O    . ARG A  1 321 ? 113.240 115.715 171.130 1.00 139.85 ? 321 ARG A O    1 
ATOM   5157  C  CB   . ARG A  1 321 ? 112.023 115.173 168.771 1.00 139.85 ? 321 ARG A CB   1 
ATOM   5158  C  CG   . ARG A  1 321 ? 111.401 115.006 167.392 1.00 139.85 ? 321 ARG A CG   1 
ATOM   5159  C  CD   . ARG A  1 321 ? 111.383 113.549 166.948 1.00 139.85 ? 321 ARG A CD   1 
ATOM   5160  N  NE   . ARG A  1 321 ? 110.396 113.314 165.896 1.00 139.85 ? 321 ARG A NE   1 
ATOM   5161  C  CZ   . ARG A  1 321 ? 110.021 112.111 165.471 1.00 139.85 ? 321 ARG A CZ   1 
ATOM   5162  N  NH1  . ARG A  1 321 ? 110.544 111.016 166.007 1.00 139.85 ? 321 ARG A NH1  1 
ATOM   5163  N  NH2  . ARG A  1 321 ? 109.115 112.004 164.509 1.00 139.85 ? 321 ARG A NH2  1 
ATOM   5164  H  H    . ARG A  1 321 ? 111.698 118.013 168.052 1.00 139.85 ? 321 ARG A H    1 
ATOM   5165  H  HA   . ARG A  1 321 ? 110.881 116.700 169.522 1.00 139.85 ? 321 ARG A HA   1 
ATOM   5166  H  HB2  . ARG A  1 321 ? 112.973 114.988 168.696 1.00 139.85 ? 321 ARG A HB2  1 
ATOM   5167  H  HB3  . ARG A  1 321 ? 111.609 114.520 169.358 1.00 139.85 ? 321 ARG A HB3  1 
ATOM   5168  H  HG2  . ARG A  1 321 ? 110.485 115.325 167.415 1.00 139.85 ? 321 ARG A HG2  1 
ATOM   5169  H  HG3  . ARG A  1 321 ? 111.917 115.514 166.745 1.00 139.85 ? 321 ARG A HG3  1 
ATOM   5170  H  HD2  . ARG A  1 321 ? 112.257 113.309 166.602 1.00 139.85 ? 321 ARG A HD2  1 
ATOM   5171  H  HD3  . ARG A  1 321 ? 111.158 112.985 167.704 1.00 139.85 ? 321 ARG A HD3  1 
ATOM   5172  H  HE   . ARG A  1 321 ? 109.973 113.995 165.585 1.00 139.85 ? 321 ARG A HE   1 
ATOM   5173  H  HH11 . ARG A  1 321 ? 111.131 111.076 166.632 1.00 139.85 ? 321 ARG A HH11 1 
ATOM   5174  H  HH12 . ARG A  1 321 ? 110.295 110.242 165.726 1.00 139.85 ? 321 ARG A HH12 1 
ATOM   5175  H  HH21 . ARG A  1 321 ? 108.774 112.712 164.160 1.00 139.85 ? 321 ARG A HH21 1 
ATOM   5176  H  HH22 . ARG A  1 321 ? 108.871 111.227 164.233 1.00 139.85 ? 321 ARG A HH22 1 
ATOM   5177  N  N    . PRO A  1 483 ? 132.076 146.048 212.973 1.00 110.71 ? 408 PRO A N    1 
ATOM   5178  C  CA   . PRO A  1 483 ? 133.392 146.635 212.698 1.00 110.71 ? 408 PRO A CA   1 
ATOM   5179  C  C    . PRO A  1 483 ? 133.740 146.620 211.207 1.00 110.71 ? 408 PRO A C    1 
ATOM   5180  O  O    . PRO A  1 483 ? 132.853 146.424 210.378 1.00 110.71 ? 408 PRO A O    1 
ATOM   5181  C  CB   . PRO A  1 483 ? 134.346 145.747 213.509 1.00 110.71 ? 408 PRO A CB   1 
ATOM   5182  C  CG   . PRO A  1 483 ? 133.638 144.453 213.650 1.00 110.71 ? 408 PRO A CG   1 
ATOM   5183  C  CD   . PRO A  1 483 ? 132.176 144.772 213.702 1.00 110.71 ? 408 PRO A CD   1 
ATOM   5184  H  HA   . PRO A  1 483 ? 133.432 147.544 213.032 1.00 110.71 ? 408 PRO A HA   1 
ATOM   5185  H  HB2  . PRO A  1 483 ? 135.184 145.628 213.038 1.00 110.71 ? 408 PRO A HB2  1 
ATOM   5186  H  HB3  . PRO A  1 483 ? 134.498 146.145 214.381 1.00 110.71 ? 408 PRO A HB3  1 
ATOM   5187  H  HG2  . PRO A  1 483 ? 133.834 143.891 212.885 1.00 110.71 ? 408 PRO A HG2  1 
ATOM   5188  H  HG3  . PRO A  1 483 ? 133.919 144.021 214.472 1.00 110.71 ? 408 PRO A HG3  1 
ATOM   5189  H  HD2  . PRO A  1 483 ? 131.666 144.083 213.249 1.00 110.71 ? 408 PRO A HD2  1 
ATOM   5190  H  HD3  . PRO A  1 483 ? 131.887 144.884 214.621 1.00 110.71 ? 408 PRO A HD3  1 
ATOM   5191  N  N    . ASP A  1 484 ? 135.018 146.825 210.878 1.00 111.77 ? 409 ASP A N    1 
ATOM   5192  C  CA   . ASP A  1 484 ? 135.431 146.901 209.480 1.00 111.77 ? 409 ASP A CA   1 
ATOM   5193  C  C    . ASP A  1 484 ? 135.130 145.617 208.715 1.00 111.77 ? 409 ASP A C    1 
ATOM   5194  O  O    . ASP A  1 484 ? 135.021 145.649 207.484 1.00 111.77 ? 409 ASP A O    1 
ATOM   5195  C  CB   . ASP A  1 484 ? 136.922 147.224 209.405 1.00 111.77 ? 409 ASP A CB   1 
ATOM   5196  C  CG   . ASP A  1 484 ? 137.234 148.642 209.839 1.00 111.77 ? 409 ASP A CG   1 
ATOM   5197  O  OD1  . ASP A  1 484 ? 136.312 149.484 209.834 1.00 111.77 ? 409 ASP A OD1  1 
ATOM   5198  O  OD2  . ASP A  1 484 ? 138.401 148.914 210.189 1.00 111.77 ? 409 ASP A OD2  1 
ATOM   5199  H  H    . ASP A  1 484 ? 135.658 146.924 211.443 1.00 111.77 ? 409 ASP A H    1 
ATOM   5200  H  HA   . ASP A  1 484 ? 134.947 147.624 209.053 1.00 111.77 ? 409 ASP A HA   1 
ATOM   5201  H  HB2  . ASP A  1 484 ? 137.405 146.620 209.990 1.00 111.77 ? 409 ASP A HB2  1 
ATOM   5202  H  HB3  . ASP A  1 484 ? 137.225 147.117 208.491 1.00 111.77 ? 409 ASP A HB3  1 
ATOM   5203  N  N    . LEU A  1 485 ? 135.004 144.490 209.416 1.00 112.17 ? 410 LEU A N    1 
ATOM   5204  C  CA   . LEU A  1 485 ? 134.563 143.253 208.779 1.00 112.17 ? 410 LEU A CA   1 
ATOM   5205  C  C    . LEU A  1 485 ? 133.210 143.444 208.099 1.00 112.17 ? 410 LEU A C    1 
ATOM   5206  O  O    . LEU A  1 485 ? 132.981 142.962 206.975 1.00 112.17 ? 410 LEU A O    1 
ATOM   5207  C  CB   . LEU A  1 485 ? 134.501 142.157 209.841 1.00 112.17 ? 410 LEU A CB   1 
ATOM   5208  C  CG   . LEU A  1 485 ? 134.044 140.747 209.489 1.00 112.17 ? 410 LEU A CG   1 
ATOM   5209  C  CD1  . LEU A  1 485 ? 134.832 139.732 210.305 1.00 112.17 ? 410 LEU A CD1  1 
ATOM   5210  C  CD2  . LEU A  1 485 ? 132.562 140.608 209.764 1.00 112.17 ? 410 LEU A CD2  1 
ATOM   5211  H  H    . LEU A  1 485 ? 135.172 144.416 210.256 1.00 112.17 ? 410 LEU A H    1 
ATOM   5212  H  HA   . LEU A  1 485 ? 135.213 142.990 208.110 1.00 112.17 ? 410 LEU A HA   1 
ATOM   5213  H  HB2  . LEU A  1 485 ? 135.391 142.072 210.215 1.00 112.17 ? 410 LEU A HB2  1 
ATOM   5214  H  HB3  . LEU A  1 485 ? 133.903 142.471 210.536 1.00 112.17 ? 410 LEU A HB3  1 
ATOM   5215  H  HG   . LEU A  1 485 ? 134.206 140.582 208.548 1.00 112.17 ? 410 LEU A HG   1 
ATOM   5216  H  HD11 . LEU A  1 485 ? 134.557 138.839 210.052 1.00 112.17 ? 410 LEU A HD11 1 
ATOM   5217  H  HD12 . LEU A  1 485 ? 135.779 139.849 210.132 1.00 112.17 ? 410 LEU A HD12 1 
ATOM   5218  H  HD13 . LEU A  1 485 ? 134.651 139.877 211.247 1.00 112.17 ? 410 LEU A HD13 1 
ATOM   5219  H  HD21 . LEU A  1 485 ? 132.263 139.736 209.465 1.00 112.17 ? 410 LEU A HD21 1 
ATOM   5220  H  HD22 . LEU A  1 485 ? 132.414 140.699 210.718 1.00 112.17 ? 410 LEU A HD22 1 
ATOM   5221  H  HD23 . LEU A  1 485 ? 132.085 141.306 209.289 1.00 112.17 ? 410 LEU A HD23 1 
ATOM   5222  N  N    . ALA A  1 486 ? 132.298 144.145 208.773 1.00 113.66 ? 411 ALA A N    1 
ATOM   5223  C  CA   . ALA A  1 486 ? 131.021 144.487 208.165 1.00 113.66 ? 411 ALA A CA   1 
ATOM   5224  C  C    . ALA A  1 486 ? 131.216 145.285 206.884 1.00 113.66 ? 411 ALA A C    1 
ATOM   5225  O  O    . ALA A  1 486 ? 130.427 145.151 205.942 1.00 113.66 ? 411 ALA A O    1 
ATOM   5226  C  CB   . ALA A  1 486 ? 130.172 145.273 209.165 1.00 113.66 ? 411 ALA A CB   1 
ATOM   5227  H  H    . ALA A  1 486 ? 132.401 144.435 209.576 1.00 113.66 ? 411 ALA A H    1 
ATOM   5228  H  HA   . ALA A  1 486 ? 130.549 143.670 207.945 1.00 113.66 ? 411 ALA A HA   1 
ATOM   5229  H  HB1  . ALA A  1 486 ? 129.312 145.475 208.767 1.00 113.66 ? 411 ALA A HB1  1 
ATOM   5230  H  HB2  . ALA A  1 486 ? 130.052 144.735 209.964 1.00 113.66 ? 411 ALA A HB2  1 
ATOM   5231  H  HB3  . ALA A  1 486 ? 130.636 146.094 209.393 1.00 113.66 ? 411 ALA A HB3  1 
ATOM   5232  N  N    . LYS A  1 487 ? 132.260 146.115 206.828 1.00 111.44 ? 412 LYS A N    1 
ATOM   5233  C  CA   . LYS A  1 487 ? 132.537 146.877 205.616 1.00 111.44 ? 412 LYS A CA   1 
ATOM   5234  C  C    . LYS A  1 487 ? 133.128 145.994 204.523 1.00 111.44 ? 412 LYS A C    1 
ATOM   5235  O  O    . LYS A  1 487 ? 132.924 146.260 203.333 1.00 111.44 ? 412 LYS A O    1 
ATOM   5236  C  CB   . LYS A  1 487 ? 133.474 148.038 205.944 1.00 111.44 ? 412 LYS A CB   1 
ATOM   5237  C  CG   . LYS A  1 487 ? 132.871 149.022 206.933 1.00 111.44 ? 412 LYS A CG   1 
ATOM   5238  C  CD   . LYS A  1 487 ? 133.830 150.138 207.303 1.00 111.44 ? 412 LYS A CD   1 
ATOM   5239  C  CE   . LYS A  1 487 ? 133.205 151.061 208.335 1.00 111.44 ? 412 LYS A CE   1 
ATOM   5240  N  NZ   . LYS A  1 487 ? 131.974 151.710 207.809 1.00 111.44 ? 412 LYS A NZ   1 
ATOM   5241  H  H    . LYS A  1 487 ? 132.812 146.254 207.473 1.00 111.44 ? 412 LYS A H    1 
ATOM   5242  H  HA   . LYS A  1 487 ? 131.706 147.251 205.285 1.00 111.44 ? 412 LYS A HA   1 
ATOM   5243  H  HB2  . LYS A  1 487 ? 134.288 147.686 206.335 1.00 111.44 ? 412 LYS A HB2  1 
ATOM   5244  H  HB3  . LYS A  1 487 ? 133.680 148.521 205.129 1.00 111.44 ? 412 LYS A HB3  1 
ATOM   5245  H  HG2  . LYS A  1 487 ? 132.083 149.422 206.535 1.00 111.44 ? 412 LYS A HG2  1 
ATOM   5246  H  HG3  . LYS A  1 487 ? 132.631 148.550 207.745 1.00 111.44 ? 412 LYS A HG3  1 
ATOM   5247  H  HD2  . LYS A  1 487 ? 134.639 149.761 207.682 1.00 111.44 ? 412 LYS A HD2  1 
ATOM   5248  H  HD3  . LYS A  1 487 ? 134.039 150.659 206.513 1.00 111.44 ? 412 LYS A HD3  1 
ATOM   5249  H  HE2  . LYS A  1 487 ? 132.962 150.547 209.120 1.00 111.44 ? 412 LYS A HE2  1 
ATOM   5250  H  HE3  . LYS A  1 487 ? 133.839 151.757 208.572 1.00 111.44 ? 412 LYS A HE3  1 
ATOM   5251  H  HZ1  . LYS A  1 487 ? 131.629 152.253 208.424 1.00 111.44 ? 412 LYS A HZ1  1 
ATOM   5252  H  HZ2  . LYS A  1 487 ? 132.167 152.180 207.079 1.00 111.44 ? 412 LYS A HZ2  1 
ATOM   5253  H  HZ3  . LYS A  1 487 ? 131.372 151.089 207.602 1.00 111.44 ? 412 LYS A HZ3  1 
ATOM   5254  N  N    . ILE A  1 488 ? 133.862 144.947 204.906 1.00 111.76 ? 413 ILE A N    1 
ATOM   5255  C  CA   . ILE A  1 488 ? 134.355 143.977 203.931 1.00 111.76 ? 413 ILE A CA   1 
ATOM   5256  C  C    . ILE A  1 488 ? 133.184 143.274 203.254 1.00 111.76 ? 413 ILE A C    1 
ATOM   5257  O  O    . ILE A  1 488 ? 133.181 143.050 202.028 1.00 111.76 ? 413 ILE A O    1 
ATOM   5258  C  CB   . ILE A  1 488 ? 135.291 142.967 204.623 1.00 111.76 ? 413 ILE A CB   1 
ATOM   5259  C  CG1  . ILE A  1 488 ? 136.526 143.677 205.184 1.00 111.76 ? 413 ILE A CG1  1 
ATOM   5260  C  CG2  . ILE A  1 488 ? 135.700 141.866 203.655 1.00 111.76 ? 413 ILE A CG2  1 
ATOM   5261  C  CD1  . ILE A  1 488 ? 137.469 142.777 205.960 1.00 111.76 ? 413 ILE A CD1  1 
ATOM   5262  H  H    . ILE A  1 488 ? 134.086 144.778 205.719 1.00 111.76 ? 413 ILE A H    1 
ATOM   5263  H  HA   . ILE A  1 488 ? 134.865 144.442 203.252 1.00 111.76 ? 413 ILE A HA   1 
ATOM   5264  H  HB   . ILE A  1 488 ? 134.809 142.562 205.360 1.00 111.76 ? 413 ILE A HB   1 
ATOM   5265  H  HG12 . ILE A  1 488 ? 137.029 144.045 204.444 1.00 111.76 ? 413 ILE A HG12 1 
ATOM   5266  H  HG13 . ILE A  1 488 ? 136.239 144.389 205.776 1.00 111.76 ? 413 ILE A HG13 1 
ATOM   5267  H  HG21 . ILE A  1 488 ? 136.374 141.306 204.069 1.00 111.76 ? 413 ILE A HG21 1 
ATOM   5268  H  HG22 . ILE A  1 488 ? 134.923 141.328 203.439 1.00 111.76 ? 413 ILE A HG22 1 
ATOM   5269  H  HG23 . ILE A  1 488 ? 136.058 142.274 202.853 1.00 111.76 ? 413 ILE A HG23 1 
ATOM   5270  H  HD11 . ILE A  1 488 ? 138.132 143.328 206.405 1.00 111.76 ? 413 ILE A HD11 1 
ATOM   5271  H  HD12 . ILE A  1 488 ? 136.960 142.276 206.616 1.00 111.76 ? 413 ILE A HD12 1 
ATOM   5272  H  HD13 . ILE A  1 488 ? 137.906 142.168 205.345 1.00 111.76 ? 413 ILE A HD13 1 
ATOM   5273  N  N    . LEU A  1 489 ? 132.181 142.898 204.049 1.00 112.28 ? 414 LEU A N    1 
ATOM   5274  C  CA   . LEU A  1 489 ? 131.065 142.139 203.494 1.00 112.28 ? 414 LEU A CA   1 
ATOM   5275  C  C    . LEU A  1 489 ? 130.333 142.922 202.411 1.00 112.28 ? 414 LEU A C    1 
ATOM   5276  O  O    . LEU A  1 489 ? 129.850 142.328 201.443 1.00 112.28 ? 414 LEU A O    1 
ATOM   5277  C  CB   . LEU A  1 489 ? 130.090 141.724 204.597 1.00 112.28 ? 414 LEU A CB   1 
ATOM   5278  C  CG   . LEU A  1 489 ? 128.859 140.934 204.131 1.00 112.28 ? 414 LEU A CG   1 
ATOM   5279  C  CD1  . LEU A  1 489 ? 129.237 139.611 203.479 1.00 112.28 ? 414 LEU A CD1  1 
ATOM   5280  C  CD2  . LEU A  1 489 ? 127.913 140.679 205.292 1.00 112.28 ? 414 LEU A CD2  1 
ATOM   5281  H  H    . LEU A  1 489 ? 132.124 143.067 204.890 1.00 112.28 ? 414 LEU A H    1 
ATOM   5282  H  HA   . LEU A  1 489 ? 131.420 141.336 203.087 1.00 112.28 ? 414 LEU A HA   1 
ATOM   5283  H  HB2  . LEU A  1 489 ? 130.567 141.168 205.232 1.00 112.28 ? 414 LEU A HB2  1 
ATOM   5284  H  HB3  . LEU A  1 489 ? 129.771 142.524 205.040 1.00 112.28 ? 414 LEU A HB3  1 
ATOM   5285  H  HG   . LEU A  1 489 ? 128.381 141.459 203.471 1.00 112.28 ? 414 LEU A HG   1 
ATOM   5286  H  HD11 . LEU A  1 489 ? 128.501 139.312 202.925 1.00 112.28 ? 414 LEU A HD11 1 
ATOM   5287  H  HD12 . LEU A  1 489 ? 130.028 139.729 202.934 1.00 112.28 ? 414 LEU A HD12 1 
ATOM   5288  H  HD13 . LEU A  1 489 ? 129.410 138.956 204.172 1.00 112.28 ? 414 LEU A HD13 1 
ATOM   5289  H  HD21 . LEU A  1 489 ? 127.181 140.124 204.980 1.00 112.28 ? 414 LEU A HD21 1 
ATOM   5290  H  HD22 . LEU A  1 489 ? 128.396 140.220 205.997 1.00 112.28 ? 414 LEU A HD22 1 
ATOM   5291  H  HD23 . LEU A  1 489 ? 127.574 141.526 205.619 1.00 112.28 ? 414 LEU A HD23 1 
ATOM   5292  N  N    . GLU A  1 490 ? 130.237 144.247 202.549 1.00 113.60 ? 415 GLU A N    1 
ATOM   5293  C  CA   . GLU A  1 490 ? 129.558 145.049 201.533 1.00 113.60 ? 415 GLU A CA   1 
ATOM   5294  C  C    . GLU A  1 490 ? 130.279 144.969 200.192 1.00 113.60 ? 415 GLU A C    1 
ATOM   5295  O  O    . GLU A  1 490 ? 129.648 144.826 199.136 1.00 113.60 ? 415 GLU A O    1 
ATOM   5296  C  CB   . GLU A  1 490 ? 129.467 146.501 201.999 1.00 113.60 ? 415 GLU A CB   1 
ATOM   5297  C  CG   . GLU A  1 490 ? 128.662 146.697 203.272 1.00 113.60 ? 415 GLU A CG   1 
ATOM   5298  C  CD   . GLU A  1 490 ? 127.237 146.197 203.148 1.00 113.60 ? 415 GLU A CD   1 
ATOM   5299  O  OE1  . GLU A  1 490 ? 126.356 146.997 202.768 1.00 113.60 ? 415 GLU A OE1  1 
ATOM   5300  O  OE2  . GLU A  1 490 ? 126.997 145.006 203.434 1.00 113.60 ? 415 GLU A OE2  1 
ATOM   5301  H  H    . GLU A  1 490 ? 130.554 144.696 203.210 1.00 113.60 ? 415 GLU A H    1 
ATOM   5302  H  HA   . GLU A  1 490 ? 128.657 144.711 201.410 1.00 113.60 ? 415 GLU A HA   1 
ATOM   5303  H  HB2  . GLU A  1 490 ? 130.365 146.826 202.167 1.00 113.60 ? 415 GLU A HB2  1 
ATOM   5304  H  HB3  . GLU A  1 490 ? 129.052 147.029 201.301 1.00 113.60 ? 415 GLU A HB3  1 
ATOM   5305  H  HG2  . GLU A  1 490 ? 129.091 146.212 203.993 1.00 113.60 ? 415 GLU A HG2  1 
ATOM   5306  H  HG3  . GLU A  1 490 ? 128.631 147.643 203.482 1.00 113.60 ? 415 GLU A HG3  1 
ATOM   5307  N  N    . GLU A  1 491 ? 131.606 145.074 200.219 1.00 112.62 ? 416 GLU A N    1 
ATOM   5308  C  CA   . GLU A  1 491 ? 132.408 144.946 199.008 1.00 112.62 ? 416 GLU A CA   1 
ATOM   5309  C  C    . GLU A  1 491 ? 132.178 143.602 198.340 1.00 112.62 ? 416 GLU A C    1 
ATOM   5310  O  O    . GLU A  1 491 ? 131.976 143.511 197.116 1.00 112.62 ? 416 GLU A O    1 
ATOM   5311  C  CB   . GLU A  1 491 ? 133.870 145.078 199.394 1.00 112.62 ? 416 GLU A CB   1 
ATOM   5312  C  CG   . GLU A  1 491 ? 134.289 146.454 199.781 1.00 112.62 ? 416 GLU A CG   1 
ATOM   5313  C  CD   . GLU A  1 491 ? 135.717 146.461 200.229 1.00 112.62 ? 416 GLU A CD   1 
ATOM   5314  O  OE1  . GLU A  1 491 ? 136.180 145.406 200.691 1.00 112.62 ? 416 GLU A OE1  1 
ATOM   5315  O  OE2  . GLU A  1 491 ? 136.383 147.494 200.120 1.00 112.62 ? 416 GLU A OE2  1 
ATOM   5316  H  H    . GLU A  1 491 ? 132.066 145.220 200.929 1.00 112.62 ? 416 GLU A H    1 
ATOM   5317  H  HA   . GLU A  1 491 ? 132.181 145.653 198.386 1.00 112.62 ? 416 GLU A HA   1 
ATOM   5318  H  HB2  . GLU A  1 491 ? 134.042 144.491 200.143 1.00 112.62 ? 416 GLU A HB2  1 
ATOM   5319  H  HB3  . GLU A  1 491 ? 134.413 144.807 198.637 1.00 112.62 ? 416 GLU A HB3  1 
ATOM   5320  H  HG2  . GLU A  1 491 ? 134.204 147.045 199.016 1.00 112.62 ? 416 GLU A HG2  1 
ATOM   5321  H  HG3  . GLU A  1 491 ? 133.731 146.761 200.509 1.00 112.62 ? 416 GLU A HG3  1 
ATOM   5322  N  N    . VAL A  1 492 ? 132.252 142.536 199.134 1.00 111.83 ? 417 VAL A N    1 
ATOM   5323  C  CA   . VAL A  1 492 ? 132.076 141.208 198.560 1.00 111.83 ? 417 VAL A CA   1 
ATOM   5324  C  C    . VAL A  1 492 ? 130.667 141.068 197.989 1.00 111.83 ? 417 VAL A C    1 
ATOM   5325  O  O    . VAL A  1 492 ? 130.466 140.452 196.932 1.00 111.83 ? 417 VAL A O    1 
ATOM   5326  C  CB   . VAL A  1 492 ? 132.404 140.124 199.601 1.00 111.83 ? 417 VAL A CB   1 
ATOM   5327  C  CG1  . VAL A  1 492 ? 132.408 138.758 198.951 1.00 111.83 ? 417 VAL A CG1  1 
ATOM   5328  C  CG2  . VAL A  1 492 ? 133.763 140.379 200.221 1.00 111.83 ? 417 VAL A CG2  1 
ATOM   5329  H  H    . VAL A  1 492 ? 132.392 142.556 199.980 1.00 111.83 ? 417 VAL A H    1 
ATOM   5330  H  HA   . VAL A  1 492 ? 132.708 141.102 197.836 1.00 111.83 ? 417 VAL A HA   1 
ATOM   5331  H  HB   . VAL A  1 492 ? 131.749 140.154 200.309 1.00 111.83 ? 417 VAL A HB   1 
ATOM   5332  H  HG11 . VAL A  1 492 ? 132.467 138.079 199.640 1.00 111.83 ? 417 VAL A HG11 1 
ATOM   5333  H  HG12 . VAL A  1 492 ? 131.593 138.642 198.441 1.00 111.83 ? 417 VAL A HG12 1 
ATOM   5334  H  HG13 . VAL A  1 492 ? 133.177 138.701 198.363 1.00 111.83 ? 417 VAL A HG13 1 
ATOM   5335  H  HG21 . VAL A  1 492 ? 133.942 139.685 200.873 1.00 111.83 ? 417 VAL A HG21 1 
ATOM   5336  H  HG22 . VAL A  1 492 ? 134.433 140.354 199.521 1.00 111.83 ? 417 VAL A HG22 1 
ATOM   5337  H  HG23 . VAL A  1 492 ? 133.769 141.244 200.652 1.00 111.83 ? 417 VAL A HG23 1 
ATOM   5338  N  N    . ARG A  1 493 ? 129.674 141.665 198.659 1.00 113.59 ? 418 ARG A N    1 
ATOM   5339  C  CA   . ARG A  1 493 ? 128.327 141.719 198.100 1.00 113.59 ? 418 ARG A CA   1 
ATOM   5340  C  C    . ARG A  1 493 ? 128.343 142.365 196.727 1.00 113.59 ? 418 ARG A C    1 
ATOM   5341  O  O    . ARG A  1 493 ? 127.720 141.867 195.782 1.00 113.59 ? 418 ARG A O    1 
ATOM   5342  C  CB   . ARG A  1 493 ? 127.387 142.511 199.018 1.00 113.59 ? 418 ARG A CB   1 
ATOM   5343  C  CG   . ARG A  1 493 ? 126.620 141.738 200.090 1.00 113.59 ? 418 ARG A CG   1 
ATOM   5344  C  CD   . ARG A  1 493 ? 125.839 140.529 199.558 1.00 113.59 ? 418 ARG A CD   1 
ATOM   5345  N  NE   . ARG A  1 493 ? 124.576 140.866 198.908 1.00 113.59 ? 418 ARG A NE   1 
ATOM   5346  C  CZ   . ARG A  1 493 ? 123.380 140.743 199.477 1.00 113.59 ? 418 ARG A CZ   1 
ATOM   5347  N  NH1  . ARG A  1 493 ? 122.291 141.064 198.792 1.00 113.59 ? 418 ARG A NH1  1 
ATOM   5348  N  NH2  . ARG A  1 493 ? 123.262 140.311 200.727 1.00 113.59 ? 418 ARG A NH2  1 
ATOM   5349  H  H    . ARG A  1 493 ? 129.758 142.043 199.425 1.00 113.59 ? 418 ARG A H    1 
ATOM   5350  H  HA   . ARG A  1 493 ? 128.003 140.816 197.995 1.00 113.59 ? 418 ARG A HA   1 
ATOM   5351  H  HB2  . ARG A  1 493 ? 127.917 143.177 199.480 1.00 113.59 ? 418 ARG A HB2  1 
ATOM   5352  H  HB3  . ARG A  1 493 ? 126.730 142.959 198.462 1.00 113.59 ? 418 ARG A HB3  1 
ATOM   5353  H  HG2  . ARG A  1 493 ? 127.243 141.436 200.767 1.00 113.59 ? 418 ARG A HG2  1 
ATOM   5354  H  HG3  . ARG A  1 493 ? 125.979 142.342 200.495 1.00 113.59 ? 418 ARG A HG3  1 
ATOM   5355  H  HD2  . ARG A  1 493 ? 126.361 140.067 198.889 1.00 113.59 ? 418 ARG A HD2  1 
ATOM   5356  H  HD3  . ARG A  1 493 ? 125.667 139.924 200.293 1.00 113.59 ? 418 ARG A HD3  1 
ATOM   5357  H  HE   . ARG A  1 493 ? 124.594 140.972 198.054 1.00 113.59 ? 418 ARG A HE   1 
ATOM   5358  H  HH11 . ARG A  1 493 ? 122.361 141.344 197.982 1.00 113.59 ? 418 ARG A HH11 1 
ATOM   5359  H  HH12 . ARG A  1 493 ? 121.516 140.991 199.157 1.00 113.59 ? 418 ARG A HH12 1 
ATOM   5360  H  HH21 . ARG A  1 493 ? 123.958 140.099 201.184 1.00 113.59 ? 418 ARG A HH21 1 
ATOM   5361  H  HH22 . ARG A  1 493 ? 122.483 140.242 201.083 1.00 113.59 ? 418 ARG A HH22 1 
ATOM   5362  N  N    . TYR A  1 494 ? 129.028 143.502 196.607 1.00 112.86 ? 419 TYR A N    1 
ATOM   5363  C  CA   . TYR A  1 494 ? 129.030 144.215 195.337 1.00 112.86 ? 419 TYR A CA   1 
ATOM   5364  C  C    . TYR A  1 494 ? 129.566 143.328 194.224 1.00 112.86 ? 419 TYR A C    1 
ATOM   5365  O  O    . TYR A  1 494 ? 128.944 143.196 193.163 1.00 112.86 ? 419 TYR A O    1 
ATOM   5366  C  CB   . TYR A  1 494 ? 129.862 145.492 195.430 1.00 112.86 ? 419 TYR A CB   1 
ATOM   5367  C  CG   . TYR A  1 494 ? 130.129 146.089 194.069 1.00 112.86 ? 419 TYR A CG   1 
ATOM   5368  C  CD1  . TYR A  1 494 ? 129.196 146.915 193.457 1.00 112.86 ? 419 TYR A CD1  1 
ATOM   5369  C  CD2  . TYR A  1 494 ? 131.301 145.805 193.383 1.00 112.86 ? 419 TYR A CD2  1 
ATOM   5370  C  CE1  . TYR A  1 494 ? 129.429 147.450 192.208 1.00 112.86 ? 419 TYR A CE1  1 
ATOM   5371  C  CE2  . TYR A  1 494 ? 131.541 146.335 192.133 1.00 112.86 ? 419 TYR A CE2  1 
ATOM   5372  C  CZ   . TYR A  1 494 ? 130.603 147.156 191.551 1.00 112.86 ? 419 TYR A CZ   1 
ATOM   5373  O  OH   . TYR A  1 494 ? 130.845 147.686 190.305 1.00 112.86 ? 419 TYR A OH   1 
ATOM   5374  H  H    . TYR A  1 494 ? 129.493 143.869 197.231 1.00 112.86 ? 419 TYR A H    1 
ATOM   5375  H  HA   . TYR A  1 494 ? 128.121 144.467 195.115 1.00 112.86 ? 419 TYR A HA   1 
ATOM   5376  H  HB2  . TYR A  1 494 ? 129.386 146.147 195.964 1.00 112.86 ? 419 TYR A HB2  1 
ATOM   5377  H  HB3  . TYR A  1 494 ? 130.717 145.284 195.837 1.00 112.86 ? 419 TYR A HB3  1 
ATOM   5378  H  HD1  . TYR A  1 494 ? 128.403 147.115 193.900 1.00 112.86 ? 419 TYR A HD1  1 
ATOM   5379  H  HD2  . TYR A  1 494 ? 131.934 145.249 193.774 1.00 112.86 ? 419 TYR A HD2  1 
ATOM   5380  H  HE1  . TYR A  1 494 ? 128.799 148.006 191.811 1.00 112.86 ? 419 TYR A HE1  1 
ATOM   5381  H  HE2  . TYR A  1 494 ? 132.332 146.140 191.686 1.00 112.86 ? 419 TYR A HE2  1 
ATOM   5382  H  HH   . TYR A  1 494 ? 131.654 147.580 190.105 1.00 112.86 ? 419 TYR A HH   1 
ATOM   5383  N  N    . ILE A  1 495 ? 130.727 142.712 194.448 1.00 111.40 ? 420 ILE A N    1 
ATOM   5384  C  CA   . ILE A  1 495 ? 131.329 141.932 193.366 1.00 111.40 ? 420 ILE A CA   1 
ATOM   5385  C  C    . ILE A  1 495 ? 130.462 140.720 193.035 1.00 111.40 ? 420 ILE A C    1 
ATOM   5386  O  O    . ILE A  1 495 ? 130.271 140.374 191.858 1.00 111.40 ? 420 ILE A O    1 
ATOM   5387  C  CB   . ILE A  1 495 ? 132.776 141.525 193.706 1.00 111.40 ? 420 ILE A CB   1 
ATOM   5388  C  CG1  . ILE A  1 495 ? 132.829 140.626 194.935 1.00 111.40 ? 420 ILE A CG1  1 
ATOM   5389  C  CG2  . ILE A  1 495 ? 133.637 142.763 193.922 1.00 111.40 ? 420 ILE A CG2  1 
ATOM   5390  C  CD1  . ILE A  1 495 ? 134.190 140.022 195.167 1.00 111.40 ? 420 ILE A CD1  1 
ATOM   5391  H  H    . ILE A  1 495 ? 131.173 142.731 195.182 1.00 111.40 ? 420 ILE A H    1 
ATOM   5392  H  HA   . ILE A  1 495 ? 131.362 142.489 192.573 1.00 111.40 ? 420 ILE A HA   1 
ATOM   5393  H  HB   . ILE A  1 495 ? 133.137 141.029 192.956 1.00 111.40 ? 420 ILE A HB   1 
ATOM   5394  H  HG12 . ILE A  1 495 ? 132.588 141.151 195.710 1.00 111.40 ? 420 ILE A HG12 1 
ATOM   5395  H  HG13 . ILE A  1 495 ? 132.209 139.892 194.821 1.00 111.40 ? 420 ILE A HG13 1 
ATOM   5396  H  HG21 . ILE A  1 495 ? 134.565 142.492 194.005 1.00 111.40 ? 420 ILE A HG21 1 
ATOM   5397  H  HG22 . ILE A  1 495 ? 133.534 143.354 193.160 1.00 111.40 ? 420 ILE A HG22 1 
ATOM   5398  H  HG23 . ILE A  1 495 ? 133.349 143.214 194.730 1.00 111.40 ? 420 ILE A HG23 1 
ATOM   5399  H  HD11 . ILE A  1 495 ? 134.163 139.468 195.962 1.00 111.40 ? 420 ILE A HD11 1 
ATOM   5400  H  HD12 . ILE A  1 495 ? 134.423 139.484 194.395 1.00 111.40 ? 420 ILE A HD12 1 
ATOM   5401  H  HD13 . ILE A  1 495 ? 134.840 140.734 195.279 1.00 111.40 ? 420 ILE A HD13 1 
ATOM   5402  N  N    . ALA A  1 496 ? 129.916 140.056 194.058 1.00 112.37 ? 421 ALA A N    1 
ATOM   5403  C  CA   . ALA A  1 496 ? 129.085 138.885 193.803 1.00 112.37 ? 421 ALA A CA   1 
ATOM   5404  C  C    . ALA A  1 496 ? 127.845 139.254 192.999 1.00 112.37 ? 421 ALA A C    1 
ATOM   5405  O  O    . ALA A  1 496 ? 127.475 138.548 192.053 1.00 112.37 ? 421 ALA A O    1 
ATOM   5406  C  CB   . ALA A  1 496 ? 128.696 138.225 195.123 1.00 112.37 ? 421 ALA A CB   1 
ATOM   5407  H  H    . ALA A  1 496 ? 130.013 140.259 194.887 1.00 112.37 ? 421 ALA A H    1 
ATOM   5408  H  HA   . ALA A  1 496 ? 129.598 138.244 193.288 1.00 112.37 ? 421 ALA A HA   1 
ATOM   5409  H  HB1  . ALA A  1 496 ? 128.133 137.458 194.939 1.00 112.37 ? 421 ALA A HB1  1 
ATOM   5410  H  HB2  . ALA A  1 496 ? 129.504 137.945 195.580 1.00 112.37 ? 421 ALA A HB2  1 
ATOM   5411  H  HB3  . ALA A  1 496 ? 128.214 138.868 195.665 1.00 112.37 ? 421 ALA A HB3  1 
ATOM   5412  N  N    . ASN A  1 497 ? 127.193 140.364 193.351 1.00 109.89 ? 422 ASN A N    1 
ATOM   5413  C  CA   . ASN A  1 497 ? 126.005 140.776 192.614 1.00 109.89 ? 422 ASN A CA   1 
ATOM   5414  C  C    . ASN A  1 497 ? 126.352 141.214 191.198 1.00 109.89 ? 422 ASN A C    1 
ATOM   5415  O  O    . ASN A  1 497 ? 125.557 141.010 190.274 1.00 109.89 ? 422 ASN A O    1 
ATOM   5416  C  CB   . ASN A  1 497 ? 125.287 141.895 193.365 1.00 109.89 ? 422 ASN A CB   1 
ATOM   5417  C  CG   . ASN A  1 497 ? 124.770 141.447 194.718 1.00 109.89 ? 422 ASN A CG   1 
ATOM   5418  O  OD1  . ASN A  1 497 ? 125.185 141.962 195.756 1.00 109.89 ? 422 ASN A OD1  1 
ATOM   5419  N  ND2  . ASN A  1 497 ? 123.871 140.471 194.713 1.00 109.89 ? 422 ASN A ND2  1 
ATOM   5420  H  H    . ASN A  1 497 ? 127.416 140.887 193.995 1.00 109.89 ? 422 ASN A H    1 
ATOM   5421  H  HA   . ASN A  1 497 ? 125.401 140.021 192.552 1.00 109.89 ? 422 ASN A HA   1 
ATOM   5422  H  HB2  . ASN A  1 497 ? 125.910 142.624 193.511 1.00 109.89 ? 422 ASN A HB2  1 
ATOM   5423  H  HB3  . ASN A  1 497 ? 124.533 142.203 192.838 1.00 109.89 ? 422 ASN A HB3  1 
ATOM   5424  H  HD21 . ASN A  1 497 ? 123.549 140.180 195.455 1.00 109.89 ? 422 ASN A HD21 1 
ATOM   5425  H  HD22 . ASN A  1 497 ? 123.608 140.133 193.968 1.00 109.89 ? 422 ASN A HD22 1 
ATOM   5426  N  N    . ARG A  1 498 ? 127.529 141.811 191.009 1.00 107.03 ? 423 ARG A N    1 
ATOM   5427  C  CA   . ARG A  1 498 ? 128.000 142.108 189.661 1.00 107.03 ? 423 ARG A CA   1 
ATOM   5428  C  C    . ARG A  1 498 ? 128.076 140.835 188.826 1.00 107.03 ? 423 ARG A C    1 
ATOM   5429  O  O    . ARG A  1 498 ? 127.582 140.782 187.687 1.00 107.03 ? 423 ARG A O    1 
ATOM   5430  C  CB   . ARG A  1 498 ? 129.365 142.789 189.746 1.00 107.03 ? 423 ARG A CB   1 
ATOM   5431  C  CG   . ARG A  1 498 ? 129.927 143.268 188.436 1.00 107.03 ? 423 ARG A CG   1 
ATOM   5432  C  CD   . ARG A  1 498 ? 131.350 143.755 188.607 1.00 107.03 ? 423 ARG A CD   1 
ATOM   5433  N  NE   . ARG A  1 498 ? 131.933 144.141 187.329 1.00 107.03 ? 423 ARG A NE   1 
ATOM   5434  C  CZ   . ARG A  1 498 ? 132.654 143.336 186.555 1.00 107.03 ? 423 ARG A CZ   1 
ATOM   5435  N  NH1  . ARG A  1 498 ? 133.124 143.788 185.406 1.00 107.03 ? 423 ARG A NH1  1 
ATOM   5436  N  NH2  . ARG A  1 498 ? 132.907 142.085 186.920 1.00 107.03 ? 423 ARG A NH2  1 
ATOM   5437  H  H    . ARG A  1 498 ? 128.066 142.049 191.636 1.00 107.03 ? 423 ARG A H    1 
ATOM   5438  H  HA   . ARG A  1 498 ? 127.381 142.719 189.233 1.00 107.03 ? 423 ARG A HA   1 
ATOM   5439  H  HB2  . ARG A  1 498 ? 129.291 143.560 190.330 1.00 107.03 ? 423 ARG A HB2  1 
ATOM   5440  H  HB3  . ARG A  1 498 ? 130.000 142.157 190.118 1.00 107.03 ? 423 ARG A HB3  1 
ATOM   5441  H  HG2  . ARG A  1 498 ? 129.930 142.539 187.799 1.00 107.03 ? 423 ARG A HG2  1 
ATOM   5442  H  HG3  . ARG A  1 498 ? 129.392 144.006 188.109 1.00 107.03 ? 423 ARG A HG3  1 
ATOM   5443  H  HD2  . ARG A  1 498 ? 131.349 144.534 189.183 1.00 107.03 ? 423 ARG A HD2  1 
ATOM   5444  H  HD3  . ARG A  1 498 ? 131.888 143.054 189.004 1.00 107.03 ? 423 ARG A HD3  1 
ATOM   5445  H  HE   . ARG A  1 498 ? 131.977 144.983 187.161 1.00 107.03 ? 423 ARG A HE   1 
ATOM   5446  H  HH11 . ARG A  1 498 ? 132.969 144.599 185.168 1.00 107.03 ? 423 ARG A HH11 1 
ATOM   5447  H  HH12 . ARG A  1 498 ? 133.600 143.278 184.904 1.00 107.03 ? 423 ARG A HH12 1 
ATOM   5448  H  HH21 . ARG A  1 498 ? 132.605 141.776 187.661 1.00 107.03 ? 423 ARG A HH21 1 
ATOM   5449  H  HH22 . ARG A  1 498 ? 133.378 141.581 186.408 1.00 107.03 ? 423 ARG A HH22 1 
ATOM   5450  N  N    . PHE A  1 499 ? 128.689 139.792 189.387 1.00 108.31 ? 424 PHE A N    1 
ATOM   5451  C  CA   . PHE A  1 499 ? 128.775 138.520 188.676 1.00 108.31 ? 424 PHE A CA   1 
ATOM   5452  C  C    . PHE A  1 499 ? 127.390 137.956 188.382 1.00 108.31 ? 424 PHE A C    1 
ATOM   5453  O  O    . PHE A  1 499 ? 127.144 137.426 187.291 1.00 108.31 ? 424 PHE A O    1 
ATOM   5454  C  CB   . PHE A  1 499 ? 129.598 137.516 189.484 1.00 108.31 ? 424 PHE A CB   1 
ATOM   5455  C  CG   . PHE A  1 499 ? 131.082 137.775 189.460 1.00 108.31 ? 424 PHE A CG   1 
ATOM   5456  C  CD1  . PHE A  1 499 ? 131.602 138.920 188.880 1.00 108.31 ? 424 PHE A CD1  1 
ATOM   5457  C  CD2  . PHE A  1 499 ? 131.959 136.862 190.017 1.00 108.31 ? 424 PHE A CD2  1 
ATOM   5458  C  CE1  . PHE A  1 499 ? 132.962 139.146 188.860 1.00 108.31 ? 424 PHE A CE1  1 
ATOM   5459  C  CE2  . PHE A  1 499 ? 133.318 137.084 189.999 1.00 108.31 ? 424 PHE A CE2  1 
ATOM   5460  C  CZ   . PHE A  1 499 ? 133.820 138.225 189.421 1.00 108.31 ? 424 PHE A CZ   1 
ATOM   5461  H  H    . PHE A  1 499 ? 129.063 139.798 190.161 1.00 108.31 ? 424 PHE A H    1 
ATOM   5462  H  HA   . PHE A  1 499 ? 129.216 138.664 187.826 1.00 108.31 ? 424 PHE A HA   1 
ATOM   5463  H  HB2  . PHE A  1 499 ? 129.306 137.547 190.407 1.00 108.31 ? 424 PHE A HB2  1 
ATOM   5464  H  HB3  . PHE A  1 499 ? 129.448 136.631 189.120 1.00 108.31 ? 424 PHE A HB3  1 
ATOM   5465  H  HD1  . PHE A  1 499 ? 131.029 139.545 188.499 1.00 108.31 ? 424 PHE A HD1  1 
ATOM   5466  H  HD2  . PHE A  1 499 ? 131.627 136.088 190.412 1.00 108.31 ? 424 PHE A HD2  1 
ATOM   5467  H  HE1  . PHE A  1 499 ? 133.300 139.918 188.468 1.00 108.31 ? 424 PHE A HE1  1 
ATOM   5468  H  HE2  . PHE A  1 499 ? 133.896 136.463 190.380 1.00 108.31 ? 424 PHE A HE2  1 
ATOM   5469  H  HZ   . PHE A  1 499 ? 134.737 138.375 189.409 1.00 108.31 ? 424 PHE A HZ   1 
ATOM   5470  N  N    . ARG A  1 500 ? 126.473 138.046 189.347 1.00 110.91 ? 425 ARG A N    1 
ATOM   5471  C  CA   . ARG A  1 500 ? 125.122 137.538 189.122 1.00 110.91 ? 425 ARG A CA   1 
ATOM   5472  C  C    . ARG A  1 500 ? 124.443 138.271 187.972 1.00 110.91 ? 425 ARG A C    1 
ATOM   5473  O  O    . ARG A  1 500 ? 123.797 137.647 187.119 1.00 110.91 ? 425 ARG A O    1 
ATOM   5474  C  CB   . ARG A  1 500 ? 124.285 137.672 190.394 1.00 110.91 ? 425 ARG A CB   1 
ATOM   5475  C  CG   . ARG A  1 500 ? 124.850 136.940 191.586 1.00 110.91 ? 425 ARG A CG   1 
ATOM   5476  C  CD   . ARG A  1 500 ? 123.770 136.507 192.551 1.00 110.91 ? 425 ARG A CD   1 
ATOM   5477  N  NE   . ARG A  1 500 ? 124.333 136.097 193.834 1.00 110.91 ? 425 ARG A NE   1 
ATOM   5478  C  CZ   . ARG A  1 500 ? 123.622 135.599 194.840 1.00 110.91 ? 425 ARG A CZ   1 
ATOM   5479  N  NH1  . ARG A  1 500 ? 124.224 135.259 195.971 1.00 110.91 ? 425 ARG A NH1  1 
ATOM   5480  N  NH2  . ARG A  1 500 ? 122.312 135.432 194.719 1.00 110.91 ? 425 ARG A NH2  1 
ATOM   5481  H  H    . ARG A  1 500 ? 126.605 138.389 190.124 1.00 110.91 ? 425 ARG A H    1 
ATOM   5482  H  HA   . ARG A  1 500 ? 125.173 136.598 188.895 1.00 110.91 ? 425 ARG A HA   1 
ATOM   5483  H  HB2  . ARG A  1 500 ? 124.219 138.611 190.626 1.00 110.91 ? 425 ARG A HB2  1 
ATOM   5484  H  HB3  . ARG A  1 500 ? 123.401 137.315 190.222 1.00 110.91 ? 425 ARG A HB3  1 
ATOM   5485  H  HG2  . ARG A  1 500 ? 125.323 136.154 191.281 1.00 110.91 ? 425 ARG A HG2  1 
ATOM   5486  H  HG3  . ARG A  1 500 ? 125.448 137.530 192.065 1.00 110.91 ? 425 ARG A HG3  1 
ATOM   5487  H  HD2  . ARG A  1 500 ? 123.168 137.250 192.706 1.00 110.91 ? 425 ARG A HD2  1 
ATOM   5488  H  HD3  . ARG A  1 500 ? 123.290 135.753 192.175 1.00 110.91 ? 425 ARG A HD3  1 
ATOM   5489  H  HE   . ARG A  1 500 ? 125.189 136.043 193.890 1.00 110.91 ? 425 ARG A HE   1 
ATOM   5490  H  HH11 . ARG A  1 500 ? 125.074 135.365 196.054 1.00 110.91 ? 425 ARG A HH11 1 
ATOM   5491  H  HH12 . ARG A  1 500 ? 123.765 134.934 196.622 1.00 110.91 ? 425 ARG A HH12 1 
ATOM   5492  H  HH21 . ARG A  1 500 ? 121.915 135.649 193.989 1.00 110.91 ? 425 ARG A HH21 1 
ATOM   5493  H  HH22 . ARG A  1 500 ? 121.859 135.107 195.374 1.00 110.91 ? 425 ARG A HH22 1 
ATOM   5494  N  N    . CYS A  1 501 ? 124.573 139.599 187.937 1.00 106.08 ? 426 CYS A N    1 
ATOM   5495  C  CA   . CYS A  1 501 ? 123.929 140.375 186.883 1.00 106.08 ? 426 CYS A CA   1 
ATOM   5496  C  C    . CYS A  1 501 ? 124.493 140.015 185.515 1.00 106.08 ? 426 CYS A C    1 
ATOM   5497  O  O    . CYS A  1 501 ? 123.738 139.860 184.543 1.00 106.08 ? 426 CYS A O    1 
ATOM   5498  C  CB   . CYS A  1 501 ? 124.102 141.868 187.157 1.00 106.08 ? 426 CYS A CB   1 
ATOM   5499  S  SG   . CYS A  1 501 ? 122.994 142.522 188.427 1.00 106.08 ? 426 CYS A SG   1 
ATOM   5500  H  H    . CYS A  1 501 ? 125.031 140.062 188.496 1.00 106.08 ? 426 CYS A H    1 
ATOM   5501  H  HA   . CYS A  1 501 ? 122.982 140.181 186.879 1.00 106.08 ? 426 CYS A HA   1 
ATOM   5502  H  HB2  . CYS A  1 501 ? 125.016 142.016 187.457 1.00 106.08 ? 426 CYS A HB2  1 
ATOM   5503  H  HB3  . CYS A  1 501 ? 123.950 142.356 186.335 1.00 106.08 ? 426 CYS A HB3  1 
ATOM   5504  H  HG   . CYS A  1 501 ? 123.180 143.702 188.534 1.00 106.08 ? 426 CYS A HG   1 
ATOM   5505  N  N    . GLN A  1 502 ? 125.816 139.873 185.415 1.00 104.36 ? 427 GLN A N    1 
ATOM   5506  C  CA   . GLN A  1 502 ? 126.403 139.544 184.123 1.00 104.36 ? 427 GLN A CA   1 
ATOM   5507  C  C    . GLN A  1 502 ? 126.047 138.120 183.698 1.00 104.36 ? 427 GLN A C    1 
ATOM   5508  O  O    . GLN A  1 502 ? 125.828 137.862 182.509 1.00 104.36 ? 427 GLN A O    1 
ATOM   5509  C  CB   . GLN A  1 502 ? 127.910 139.788 184.180 1.00 104.36 ? 427 GLN A CB   1 
ATOM   5510  C  CG   . GLN A  1 502 ? 128.749 138.745 184.863 1.00 104.36 ? 427 GLN A CG   1 
ATOM   5511  C  CD   . GLN A  1 502 ? 130.212 139.144 184.915 1.00 104.36 ? 427 GLN A CD   1 
ATOM   5512  O  OE1  . GLN A  1 502 ? 131.107 138.295 184.809 1.00 104.36 ? 427 GLN A OE1  1 
ATOM   5513  N  NE2  . GLN A  1 502 ? 130.482 140.426 185.088 1.00 104.36 ? 427 GLN A NE2  1 
ATOM   5514  H  H    . GLN A  1 502 ? 126.375 139.969 186.060 1.00 104.36 ? 427 GLN A H    1 
ATOM   5515  H  HA   . GLN A  1 502 ? 126.035 140.142 183.458 1.00 104.36 ? 427 GLN A HA   1 
ATOM   5516  H  HB2  . GLN A  1 502 ? 128.238 139.852 183.267 1.00 104.36 ? 427 GLN A HB2  1 
ATOM   5517  H  HB3  . GLN A  1 502 ? 128.066 140.632 184.631 1.00 104.36 ? 427 GLN A HB3  1 
ATOM   5518  H  HG2  . GLN A  1 502 ? 128.422 138.645 185.775 1.00 104.36 ? 427 GLN A HG2  1 
ATOM   5519  H  HG3  . GLN A  1 502 ? 128.675 137.904 184.387 1.00 104.36 ? 427 GLN A HG3  1 
ATOM   5520  H  HE21 . GLN A  1 502 ? 129.828 140.988 185.154 1.00 104.36 ? 427 GLN A HE21 1 
ATOM   5521  H  HE22 . GLN A  1 502 ? 131.299 140.690 185.128 1.00 104.36 ? 427 GLN A HE22 1 
ATOM   5522  N  N    . ASP A  1 503 ? 125.930 137.189 184.651 1.00 107.10 ? 428 ASP A N    1 
ATOM   5523  C  CA   . ASP A  1 503 ? 125.445 135.849 184.307 1.00 107.10 ? 428 ASP A CA   1 
ATOM   5524  C  C    . ASP A  1 503 ? 124.011 135.895 183.787 1.00 107.10 ? 428 ASP A C    1 
ATOM   5525  O  O    . ASP A  1 503 ? 123.660 135.188 182.832 1.00 107.10 ? 428 ASP A O    1 
ATOM   5526  C  CB   . ASP A  1 503 ? 125.540 134.926 185.521 1.00 107.10 ? 428 ASP A CB   1 
ATOM   5527  C  CG   . ASP A  1 503 ? 126.893 134.258 185.645 1.00 107.10 ? 428 ASP A CG   1 
ATOM   5528  O  OD1  . ASP A  1 503 ? 127.308 133.579 184.688 1.00 107.10 ? 428 ASP A OD1  1 
ATOM   5529  O  OD2  . ASP A  1 503 ? 127.531 134.402 186.705 1.00 107.10 ? 428 ASP A OD2  1 
ATOM   5530  H  H    . ASP A  1 503 ? 126.120 137.303 185.480 1.00 107.10 ? 428 ASP A H    1 
ATOM   5531  H  HA   . ASP A  1 503 ? 126.006 135.480 183.611 1.00 107.10 ? 428 ASP A HA   1 
ATOM   5532  H  HB2  . ASP A  1 503 ? 125.381 135.444 186.327 1.00 107.10 ? 428 ASP A HB2  1 
ATOM   5533  H  HB3  . ASP A  1 503 ? 124.866 134.231 185.438 1.00 107.10 ? 428 ASP A HB3  1 
ATOM   5534  N  N    . GLU A  1 504 ? 123.159 136.708 184.415 1.00 105.57 ? 429 GLU A N    1 
ATOM   5535  C  CA   . GLU A  1 504 ? 121.784 136.848 183.938 1.00 105.57 ? 429 GLU A CA   1 
ATOM   5536  C  C    . GLU A  1 504 ? 121.746 137.397 182.515 1.00 105.57 ? 429 GLU A C    1 
ATOM   5537  O  O    . GLU A  1 504 ? 120.983 136.911 181.663 1.00 105.57 ? 429 GLU A O    1 
ATOM   5538  C  CB   . GLU A  1 504 ? 121.005 137.762 184.882 1.00 105.57 ? 429 GLU A CB   1 
ATOM   5539  C  CG   . GLU A  1 504 ? 119.537 137.925 184.529 1.00 105.57 ? 429 GLU A CG   1 
ATOM   5540  C  CD   . GLU A  1 504 ? 118.858 138.992 185.362 1.00 105.57 ? 429 GLU A CD   1 
ATOM   5541  O  OE1  . GLU A  1 504 ? 119.526 139.586 186.233 1.00 105.57 ? 429 GLU A OE1  1 
ATOM   5542  O  OE2  . GLU A  1 504 ? 117.656 139.241 185.141 1.00 105.57 ? 429 GLU A OE2  1 
ATOM   5543  H  H    . GLU A  1 504 ? 123.347 137.180 185.108 1.00 105.57 ? 429 GLU A H    1 
ATOM   5544  H  HA   . GLU A  1 504 ? 121.358 135.978 183.943 1.00 105.57 ? 429 GLU A HA   1 
ATOM   5545  H  HB2  . GLU A  1 504 ? 121.059 137.393 185.777 1.00 105.57 ? 429 GLU A HB2  1 
ATOM   5546  H  HB3  . GLU A  1 504 ? 121.414 138.641 184.862 1.00 105.57 ? 429 GLU A HB3  1 
ATOM   5547  H  HG2  . GLU A  1 504 ? 119.460 138.179 183.598 1.00 105.57 ? 429 GLU A HG2  1 
ATOM   5548  H  HG3  . GLU A  1 504 ? 119.081 137.083 184.684 1.00 105.57 ? 429 GLU A HG3  1 
ATOM   5549  N  N    . SER A  1 505 ? 122.556 138.421 182.241 1.00 106.23 ? 430 SER A N    1 
ATOM   5550  C  CA   . SER A  1 505 ? 122.622 138.953 180.885 1.00 106.23 ? 430 SER A CA   1 
ATOM   5551  C  C    . SER A  1 505 ? 123.073 137.878 179.905 1.00 106.23 ? 430 SER A C    1 
ATOM   5552  O  O    . SER A  1 505 ? 122.555 137.788 178.784 1.00 106.23 ? 430 SER A O    1 
ATOM   5553  C  CB   . SER A  1 505 ? 123.567 140.152 180.833 1.00 106.23 ? 430 SER A CB   1 
ATOM   5554  O  OG   . SER A  1 505 ? 124.916 139.742 180.958 1.00 106.23 ? 430 SER A OG   1 
ATOM   5555  H  H    . SER A  1 505 ? 123.064 138.816 182.810 1.00 106.23 ? 430 SER A H    1 
ATOM   5556  H  HA   . SER A  1 505 ? 121.740 139.254 180.619 1.00 106.23 ? 430 SER A HA   1 
ATOM   5557  H  HB2  . SER A  1 505 ? 123.453 140.603 179.982 1.00 106.23 ? 430 SER A HB2  1 
ATOM   5558  H  HB3  . SER A  1 505 ? 123.351 140.757 181.559 1.00 106.23 ? 430 SER A HB3  1 
ATOM   5559  H  HG   . SER A  1 505 ? 124.975 139.143 181.543 1.00 106.23 ? 430 SER A HG   1 
ATOM   5560  N  N    . GLU A  1 506 ? 124.034 137.047 180.315 1.00 107.00 ? 431 GLU A N    1 
ATOM   5561  C  CA   . GLU A  1 506 ? 124.483 135.960 179.452 1.00 107.00 ? 431 GLU A CA   1 
ATOM   5562  C  C    . GLU A  1 506 ? 123.356 134.976 179.170 1.00 107.00 ? 431 GLU A C    1 
ATOM   5563  O  O    . GLU A  1 506 ? 123.237 134.462 178.054 1.00 107.00 ? 431 GLU A O    1 
ATOM   5564  C  CB   . GLU A  1 506 ? 125.668 135.242 180.091 1.00 107.00 ? 431 GLU A CB   1 
ATOM   5565  C  CG   . GLU A  1 506 ? 126.949 136.051 180.078 1.00 107.00 ? 431 GLU A CG   1 
ATOM   5566  C  CD   . GLU A  1 506 ? 128.059 135.399 180.875 1.00 107.00 ? 431 GLU A CD   1 
ATOM   5567  O  OE1  . GLU A  1 506 ? 127.922 134.207 181.223 1.00 107.00 ? 431 GLU A OE1  1 
ATOM   5568  O  OE2  . GLU A  1 506 ? 129.068 136.079 181.154 1.00 107.00 ? 431 GLU A OE2  1 
ATOM   5569  H  H    . GLU A  1 506 ? 124.431 137.091 181.075 1.00 107.00 ? 431 GLU A H    1 
ATOM   5570  H  HA   . GLU A  1 506 ? 124.776 136.330 178.607 1.00 107.00 ? 431 GLU A HA   1 
ATOM   5571  H  HB2  . GLU A  1 506 ? 125.448 135.042 181.013 1.00 107.00 ? 431 GLU A HB2  1 
ATOM   5572  H  HB3  . GLU A  1 506 ? 125.830 134.419 179.605 1.00 107.00 ? 431 GLU A HB3  1 
ATOM   5573  H  HG2  . GLU A  1 506 ? 127.249 136.148 179.162 1.00 107.00 ? 431 GLU A HG2  1 
ATOM   5574  H  HG3  . GLU A  1 506 ? 126.773 136.923 180.462 1.00 107.00 ? 431 GLU A HG3  1 
ATOM   5575  N  N    . ALA A  1 507 ? 122.530 134.684 180.175 1.00 107.08 ? 432 ALA A N    1 
ATOM   5576  C  CA   . ALA A  1 507 ? 121.399 133.782 179.962 1.00 107.08 ? 432 ALA A CA   1 
ATOM   5577  C  C    . ALA A  1 507 ? 120.424 134.361 178.943 1.00 107.08 ? 432 ALA A C    1 
ATOM   5578  O  O    . ALA A  1 507 ? 119.942 133.656 178.042 1.00 107.08 ? 432 ALA A O    1 
ATOM   5579  C  CB   . ALA A  1 507 ? 120.689 133.515 181.287 1.00 107.08 ? 432 ALA A CB   1 
ATOM   5580  H  H    . ALA A  1 507 ? 122.597 134.992 180.974 1.00 107.08 ? 432 ALA A H    1 
ATOM   5581  H  HA   . ALA A  1 507 ? 121.728 132.938 179.618 1.00 107.08 ? 432 ALA A HA   1 
ATOM   5582  H  HB1  . ALA A  1 507 ? 119.943 132.915 181.129 1.00 107.08 ? 432 ALA A HB1  1 
ATOM   5583  H  HB2  . ALA A  1 507 ? 121.316 133.113 181.908 1.00 107.08 ? 432 ALA A HB2  1 
ATOM   5584  H  HB3  . ALA A  1 507 ? 120.365 134.358 181.641 1.00 107.08 ? 432 ALA A HB3  1 
ATOM   5585  N  N    . VAL A  1 508 ? 120.119 135.652 179.074 1.00 109.33 ? 433 VAL A N    1 
ATOM   5586  C  CA   . VAL A  1 508 ? 119.231 136.302 178.110 1.00 109.33 ? 433 VAL A CA   1 
ATOM   5587  C  C    . VAL A  1 508 ? 119.822 136.201 176.705 1.00 109.33 ? 433 VAL A C    1 
ATOM   5588  O  O    . VAL A  1 508 ? 119.131 135.857 175.732 1.00 109.33 ? 433 VAL A O    1 
ATOM   5589  C  CB   . VAL A  1 508 ? 118.985 137.764 178.523 1.00 109.33 ? 433 VAL A CB   1 
ATOM   5590  C  CG1  . VAL A  1 508 ? 118.188 138.508 177.468 1.00 109.33 ? 433 VAL A CG1  1 
ATOM   5591  C  CG2  . VAL A  1 508 ? 118.265 137.816 179.861 1.00 109.33 ? 433 VAL A CG2  1 
ATOM   5592  H  H    . VAL A  1 508 ? 120.405 136.164 179.702 1.00 109.33 ? 433 VAL A H    1 
ATOM   5593  H  HA   . VAL A  1 508 ? 118.377 135.844 178.111 1.00 109.33 ? 433 VAL A HA   1 
ATOM   5594  H  HB   . VAL A  1 508 ? 119.839 138.211 178.624 1.00 109.33 ? 433 VAL A HB   1 
ATOM   5595  H  HG11 . VAL A  1 508 ? 118.016 139.407 177.791 1.00 109.33 ? 433 VAL A HG11 1 
ATOM   5596  H  HG12 . VAL A  1 508 ? 118.701 138.549 176.647 1.00 109.33 ? 433 VAL A HG12 1 
ATOM   5597  H  HG13 . VAL A  1 508 ? 117.351 138.044 177.321 1.00 109.33 ? 433 VAL A HG13 1 
ATOM   5598  H  HG21 . VAL A  1 508 ? 118.006 138.732 180.044 1.00 109.33 ? 433 VAL A HG21 1 
ATOM   5599  H  HG22 . VAL A  1 508 ? 117.479 137.251 179.818 1.00 109.33 ? 433 VAL A HG22 1 
ATOM   5600  H  HG23 . VAL A  1 508 ? 118.862 137.495 180.554 1.00 109.33 ? 433 VAL A HG23 1 
ATOM   5601  N  N    . CYS A  1 509 ? 121.121 136.481 176.587 1.00 111.04 ? 434 CYS A N    1 
ATOM   5602  C  CA   . CYS A  1 509 ? 121.786 136.392 175.292 1.00 111.04 ? 434 CYS A CA   1 
ATOM   5603  C  C    . CYS A  1 509 ? 121.712 134.979 174.730 1.00 111.04 ? 434 CYS A C    1 
ATOM   5604  O  O    . CYS A  1 509 ? 121.531 134.791 173.523 1.00 111.04 ? 434 CYS A O    1 
ATOM   5605  C  CB   . CYS A  1 509 ? 123.239 136.842 175.426 1.00 111.04 ? 434 CYS A CB   1 
ATOM   5606  S  SG   . CYS A  1 509 ? 123.414 138.563 175.924 1.00 111.04 ? 434 CYS A SG   1 
ATOM   5607  H  H    . CYS A  1 509 ? 121.630 136.725 177.234 1.00 111.04 ? 434 CYS A H    1 
ATOM   5608  H  HA   . CYS A  1 509 ? 121.351 136.990 174.669 1.00 111.04 ? 434 CYS A HA   1 
ATOM   5609  H  HB2  . CYS A  1 509 ? 123.678 136.291 176.092 1.00 111.04 ? 434 CYS A HB2  1 
ATOM   5610  H  HB3  . CYS A  1 509 ? 123.678 136.740 174.569 1.00 111.04 ? 434 CYS A HB3  1 
ATOM   5611  H  HG   . CYS A  1 509 ? 124.572 138.859 176.009 1.00 111.04 ? 434 CYS A HG   1 
ATOM   5612  N  N    . SER A  1 510 ? 121.870 133.970 175.587 1.00 108.91 ? 435 SER A N    1 
ATOM   5613  C  CA   . SER A  1 510 ? 121.792 132.589 175.123 1.00 108.91 ? 435 SER A CA   1 
ATOM   5614  C  C    . SER A  1 510 ? 120.403 132.270 174.591 1.00 108.91 ? 435 SER A C    1 
ATOM   5615  O  O    . SER A  1 510 ? 120.255 131.518 173.620 1.00 108.91 ? 435 SER A O    1 
ATOM   5616  C  CB   . SER A  1 510 ? 122.164 131.632 176.254 1.00 108.91 ? 435 SER A CB   1 
ATOM   5617  O  OG   . SER A  1 510 ? 121.955 130.287 175.866 1.00 108.91 ? 435 SER A OG   1 
ATOM   5618  H  H    . SER A  1 510 ? 122.015 134.059 176.428 1.00 108.91 ? 435 SER A H    1 
ATOM   5619  H  HA   . SER A  1 510 ? 122.425 132.464 174.401 1.00 108.91 ? 435 SER A HA   1 
ATOM   5620  H  HB2  . SER A  1 510 ? 123.101 131.757 176.472 1.00 108.91 ? 435 SER A HB2  1 
ATOM   5621  H  HB3  . SER A  1 510 ? 121.612 131.829 177.025 1.00 108.91 ? 435 SER A HB3  1 
ATOM   5622  H  HG   . SER A  1 510 ? 122.068 129.780 176.525 1.00 108.91 ? 435 SER A HG   1 
ATOM   5623  N  N    . GLU A  1 511 ? 119.370 132.819 175.228 1.00 112.18 ? 436 GLU A N    1 
ATOM   5624  C  CA   . GLU A  1 511 ? 118.025 132.679 174.675 1.00 112.18 ? 436 GLU A CA   1 
ATOM   5625  C  C    . GLU A  1 511 ? 117.959 133.274 173.271 1.00 112.18 ? 436 GLU A C    1 
ATOM   5626  O  O    . GLU A  1 511 ? 117.449 132.641 172.330 1.00 112.18 ? 436 GLU A O    1 
ATOM   5627  C  CB   . GLU A  1 511 ? 117.005 133.344 175.597 1.00 112.18 ? 436 GLU A CB   1 
ATOM   5628  H  H    . GLU A  1 511 ? 119.417 133.273 175.957 1.00 112.18 ? 436 GLU A H    1 
ATOM   5629  H  HA   . GLU A  1 511 ? 117.807 131.735 174.613 1.00 112.18 ? 436 GLU A HA   1 
ATOM   5630  N  N    . TRP A  1 512 ? 118.487 134.494 173.112 1.00 113.41 ? 437 TRP A N    1 
ATOM   5631  C  CA   . TRP A  1 512 ? 118.533 135.094 171.782 1.00 113.41 ? 437 TRP A CA   1 
ATOM   5632  C  C    . TRP A  1 512 ? 119.198 134.143 170.796 1.00 113.41 ? 437 TRP A C    1 
ATOM   5633  O  O    . TRP A  1 512 ? 118.718 133.956 169.672 1.00 113.41 ? 437 TRP A O    1 
ATOM   5634  C  CB   . TRP A  1 512 ? 119.331 136.395 171.757 1.00 113.41 ? 437 TRP A CB   1 
ATOM   5635  C  CG   . TRP A  1 512 ? 118.773 137.586 172.444 1.00 113.41 ? 437 TRP A CG   1 
ATOM   5636  C  CD1  . TRP A  1 512 ? 118.934 137.927 173.751 1.00 113.41 ? 437 TRP A CD1  1 
ATOM   5637  C  CD2  . TRP A  1 512 ? 117.941 138.595 171.868 1.00 113.41 ? 437 TRP A CD2  1 
ATOM   5638  N  NE1  . TRP A  1 512 ? 118.282 139.100 174.024 1.00 113.41 ? 437 TRP A NE1  1 
ATOM   5639  C  CE2  . TRP A  1 512 ? 117.655 139.527 172.884 1.00 113.41 ? 437 TRP A CE2  1 
ATOM   5640  C  CE3  . TRP A  1 512 ? 117.415 138.805 170.594 1.00 113.41 ? 437 TRP A CE3  1 
ATOM   5641  C  CZ2  . TRP A  1 512 ? 116.863 140.651 172.664 1.00 113.41 ? 437 TRP A CZ2  1 
ATOM   5642  C  CZ3  . TRP A  1 512 ? 116.631 139.920 170.376 1.00 113.41 ? 437 TRP A CZ3  1 
ATOM   5643  C  CH2  . TRP A  1 512 ? 116.362 140.826 171.403 1.00 113.41 ? 437 TRP A CH2  1 
ATOM   5644  H  H    . TRP A  1 512 ? 118.816 134.980 173.742 1.00 113.41 ? 437 TRP A H    1 
ATOM   5645  H  HA   . TRP A  1 512 ? 117.634 135.278 171.474 1.00 113.41 ? 437 TRP A HA   1 
ATOM   5646  H  HB2  . TRP A  1 512 ? 120.200 136.220 172.146 1.00 113.41 ? 437 TRP A HB2  1 
ATOM   5647  H  HB3  . TRP A  1 512 ? 119.452 136.641 170.824 1.00 113.41 ? 437 TRP A HB3  1 
ATOM   5648  H  HD1  . TRP A  1 512 ? 119.447 137.449 174.361 1.00 113.41 ? 437 TRP A HD1  1 
ATOM   5649  H  HE1  . TRP A  1 512 ? 118.263 139.496 174.786 1.00 113.41 ? 437 TRP A HE1  1 
ATOM   5650  H  HE3  . TRP A  1 512 ? 117.590 138.204 169.905 1.00 113.41 ? 437 TRP A HE3  1 
ATOM   5651  H  HZ2  . TRP A  1 512 ? 116.688 141.254 173.345 1.00 113.41 ? 437 TRP A HZ2  1 
ATOM   5652  H  HZ3  . TRP A  1 512 ? 116.274 140.069 169.531 1.00 113.41 ? 437 TRP A HZ3  1 
ATOM   5653  H  HH2  . TRP A  1 512 ? 115.832 141.570 171.229 1.00 113.41 ? 437 TRP A HH2  1 
ATOM   5654  N  N    . LYS A  1 513 ? 120.330 133.568 171.205 1.00 109.42 ? 438 LYS A N    1 
ATOM   5655  C  CA   . LYS A  1 513 ? 121.144 132.780 170.302 1.00 109.42 ? 438 LYS A CA   1 
ATOM   5656  C  C    . LYS A  1 513 ? 120.436 131.502 169.882 1.00 109.42 ? 438 LYS A C    1 
ATOM   5657  O  O    . LYS A  1 513 ? 120.516 131.093 168.713 1.00 109.42 ? 438 LYS A O    1 
ATOM   5658  C  CB   . LYS A  1 513 ? 122.481 132.454 170.960 1.00 109.42 ? 438 LYS A CB   1 
ATOM   5659  C  CG   . LYS A  1 513 ? 123.376 133.661 171.150 1.00 109.42 ? 438 LYS A CG   1 
ATOM   5660  C  CD   . LYS A  1 513 ? 124.677 133.282 171.817 1.00 109.42 ? 438 LYS A CD   1 
ATOM   5661  C  CE   . LYS A  1 513 ? 125.641 134.459 171.790 1.00 109.42 ? 438 LYS A CE   1 
ATOM   5662  N  NZ   . LYS A  1 513 ? 126.268 135.013 173.028 1.00 109.42 ? 438 LYS A NZ   1 
ATOM   5663  H  H    . LYS A  1 513 ? 120.637 133.625 172.004 1.00 109.42 ? 438 LYS A H    1 
ATOM   5664  H  HA   . LYS A  1 513 ? 121.322 133.298 169.502 1.00 109.42 ? 438 LYS A HA   1 
ATOM   5665  H  HB2  . LYS A  1 513 ? 122.318 132.068 171.832 1.00 109.42 ? 438 LYS A HB2  1 
ATOM   5666  H  HB3  . LYS A  1 513 ? 122.962 131.822 170.404 1.00 109.42 ? 438 LYS A HB3  1 
ATOM   5667  H  HG2  . LYS A  1 513 ? 123.566 134.059 170.288 1.00 109.42 ? 438 LYS A HG2  1 
ATOM   5668  H  HG3  . LYS A  1 513 ? 122.922 134.303 171.717 1.00 109.42 ? 438 LYS A HG3  1 
ATOM   5669  H  HD2  . LYS A  1 513 ? 124.511 133.047 172.743 1.00 109.42 ? 438 LYS A HD2  1 
ATOM   5670  H  HD3  . LYS A  1 513 ? 125.074 132.536 171.344 1.00 109.42 ? 438 LYS A HD3  1 
ATOM   5671  H  HE2  . LYS A  1 513 ? 126.408 133.942 171.484 1.00 109.42 ? 438 LYS A HE2  1 
ATOM   5672  H  HE3  . LYS A  1 513 ? 125.455 135.111 171.092 1.00 109.42 ? 438 LYS A HE3  1 
ATOM   5673  H  HZ1  . LYS A  1 513 ? 127.082 135.364 172.792 1.00 109.42 ? 438 LYS A HZ1  1 
ATOM   5674  H  HZ2  . LYS A  1 513 ? 125.765 135.658 173.431 1.00 109.42 ? 438 LYS A HZ2  1 
ATOM   5675  H  HZ3  . LYS A  1 513 ? 126.462 134.337 173.606 1.00 109.42 ? 438 LYS A HZ3  1 
ATOM   5676  N  N    . PHE A  1 514 ? 119.753 130.842 170.813 1.00 112.89 ? 439 PHE A N    1 
ATOM   5677  C  CA   . PHE A  1 514 ? 119.010 129.641 170.437 1.00 112.89 ? 439 PHE A CA   1 
ATOM   5678  C  C    . PHE A  1 514 ? 117.902 129.985 169.452 1.00 112.89 ? 439 PHE A C    1 
ATOM   5679  O  O    . PHE A  1 514 ? 117.706 129.284 168.446 1.00 112.89 ? 439 PHE A O    1 
ATOM   5680  C  CB   . PHE A  1 514 ? 118.431 128.957 171.676 1.00 112.89 ? 439 PHE A CB   1 
ATOM   5681  C  CG   . PHE A  1 514 ? 117.751 127.655 171.382 1.00 112.89 ? 439 PHE A CG   1 
ATOM   5682  C  CD1  . PHE A  1 514 ? 118.491 126.517 171.118 1.00 112.89 ? 439 PHE A CD1  1 
ATOM   5683  C  CD2  . PHE A  1 514 ? 116.374 127.567 171.370 1.00 112.89 ? 439 PHE A CD2  1 
ATOM   5684  C  CE1  . PHE A  1 514 ? 117.869 125.314 170.846 1.00 112.89 ? 439 PHE A CE1  1 
ATOM   5685  C  CE2  . PHE A  1 514 ? 115.744 126.369 171.101 1.00 112.89 ? 439 PHE A CE2  1 
ATOM   5686  C  CZ   . PHE A  1 514 ? 116.492 125.242 170.839 1.00 112.89 ? 439 PHE A CZ   1 
ATOM   5687  H  H    . PHE A  1 514 ? 119.698 131.063 171.640 1.00 112.89 ? 439 PHE A H    1 
ATOM   5688  H  HA   . PHE A  1 514 ? 119.614 129.021 170.003 1.00 112.89 ? 439 PHE A HA   1 
ATOM   5689  H  HB2  . PHE A  1 514 ? 119.150 128.786 172.305 1.00 112.89 ? 439 PHE A HB2  1 
ATOM   5690  H  HB3  . PHE A  1 514 ? 117.775 129.548 172.076 1.00 112.89 ? 439 PHE A HB3  1 
ATOM   5691  H  HD1  . PHE A  1 514 ? 119.420 126.561 171.121 1.00 112.89 ? 439 PHE A HD1  1 
ATOM   5692  H  HD2  . PHE A  1 514 ? 115.865 128.325 171.546 1.00 112.89 ? 439 PHE A HD2  1 
ATOM   5693  H  HE1  . PHE A  1 514 ? 118.373 124.557 170.669 1.00 112.89 ? 439 PHE A HE1  1 
ATOM   5694  H  HE2  . PHE A  1 514 ? 114.815 126.322 171.095 1.00 112.89 ? 439 PHE A HE2  1 
ATOM   5695  H  HZ   . PHE A  1 514 ? 116.073 124.433 170.655 1.00 112.89 ? 439 PHE A HZ   1 
ATOM   5696  N  N    . ALA A  1 515 ? 117.180 131.081 169.711 1.00 113.43 ? 440 ALA A N    1 
ATOM   5697  C  CA   . ALA A  1 515 ? 116.146 131.490 168.770 1.00 113.43 ? 440 ALA A CA   1 
ATOM   5698  C  C    . ALA A  1 515 ? 116.739 131.759 167.391 1.00 113.43 ? 440 ALA A C    1 
ATOM   5699  O  O    . ALA A  1 515 ? 116.190 131.323 166.369 1.00 113.43 ? 440 ALA A O    1 
ATOM   5700  C  CB   . ALA A  1 515 ? 115.418 132.731 169.288 1.00 113.43 ? 440 ALA A CB   1 
ATOM   5701  H  H    . ALA A  1 515 ? 117.269 131.583 170.402 1.00 113.43 ? 440 ALA A H    1 
ATOM   5702  H  HA   . ALA A  1 515 ? 115.496 130.776 168.685 1.00 113.43 ? 440 ALA A HA   1 
ATOM   5703  H  HB1  . ALA A  1 515 ? 114.740 132.988 168.647 1.00 113.43 ? 440 ALA A HB1  1 
ATOM   5704  H  HB2  . ALA A  1 515 ? 115.010 132.523 170.143 1.00 113.43 ? 440 ALA A HB2  1 
ATOM   5705  H  HB3  . ALA A  1 515 ? 116.060 133.449 169.393 1.00 113.43 ? 440 ALA A HB3  1 
ATOM   5706  N  N    . ALA A  1 516 ? 117.867 132.469 167.344 1.00 107.36 ? 441 ALA A N    1 
ATOM   5707  C  CA   . ALA A  1 516 ? 118.474 132.808 166.062 1.00 107.36 ? 441 ALA A CA   1 
ATOM   5708  C  C    . ALA A  1 516 ? 118.947 131.562 165.328 1.00 107.36 ? 441 ALA A C    1 
ATOM   5709  O  O    . ALA A  1 516 ? 118.760 131.441 164.115 1.00 107.36 ? 441 ALA A O    1 
ATOM   5710  C  CB   . ALA A  1 516 ? 119.634 133.779 166.270 1.00 107.36 ? 441 ALA A CB   1 
ATOM   5711  H  H    . ALA A  1 516 ? 118.295 132.758 168.030 1.00 107.36 ? 441 ALA A H    1 
ATOM   5712  H  HA   . ALA A  1 516 ? 117.817 133.257 165.514 1.00 107.36 ? 441 ALA A HA   1 
ATOM   5713  H  HB1  . ALA A  1 516 ? 120.024 133.980 165.407 1.00 107.36 ? 441 ALA A HB1  1 
ATOM   5714  H  HB2  . ALA A  1 516 ? 119.292 134.589 166.677 1.00 107.36 ? 441 ALA A HB2  1 
ATOM   5715  H  HB3  . ALA A  1 516 ? 120.292 133.364 166.846 1.00 107.36 ? 441 ALA A HB3  1 
ATOM   5716  N  N    . CYS A  1 517 ? 119.554 130.617 166.048 1.00 106.98 ? 442 CYS A N    1 
ATOM   5717  C  CA   . CYS A  1 517 ? 120.017 129.389 165.414 1.00 106.98 ? 442 CYS A CA   1 
ATOM   5718  C  C    . CYS A  1 517 ? 118.859 128.613 164.803 1.00 106.98 ? 442 CYS A C    1 
ATOM   5719  O  O    . CYS A  1 517 ? 118.955 128.119 163.670 1.00 106.98 ? 442 CYS A O    1 
ATOM   5720  C  CB   . CYS A  1 517 ? 120.752 128.521 166.435 1.00 106.98 ? 442 CYS A CB   1 
ATOM   5721  S  SG   . CYS A  1 517 ? 121.357 126.957 165.779 1.00 106.98 ? 442 CYS A SG   1 
ATOM   5722  H  H    . CYS A  1 517 ? 119.712 130.666 166.890 1.00 106.98 ? 442 CYS A H    1 
ATOM   5723  H  HA   . CYS A  1 517 ? 120.641 129.615 164.709 1.00 106.98 ? 442 CYS A HA   1 
ATOM   5724  H  HB2  . CYS A  1 517 ? 121.513 129.013 166.777 1.00 106.98 ? 442 CYS A HB2  1 
ATOM   5725  H  HB3  . CYS A  1 517 ? 120.142 128.311 167.157 1.00 106.98 ? 442 CYS A HB3  1 
ATOM   5726  H  HG   . CYS A  1 517 ? 120.395 126.325 165.441 1.00 106.98 ? 442 CYS A HG   1 
ATOM   5727  N  N    . VAL A  1 518 ? 117.750 128.495 165.531 1.00 112.83 ? 443 VAL A N    1 
ATOM   5728  C  CA   . VAL A  1 518 ? 116.665 127.659 165.027 1.00 112.83 ? 443 VAL A CA   1 
ATOM   5729  C  C    . VAL A  1 518 ? 115.948 128.347 163.871 1.00 112.83 ? 443 VAL A C    1 
ATOM   5730  O  O    . VAL A  1 518 ? 115.545 127.695 162.900 1.00 112.83 ? 443 VAL A O    1 
ATOM   5731  C  CB   . VAL A  1 518 ? 115.703 127.277 166.165 1.00 112.83 ? 443 VAL A CB   1 
ATOM   5732  C  CG1  . VAL A  1 518 ? 116.485 126.680 167.325 1.00 112.83 ? 443 VAL A CG1  1 
ATOM   5733  C  CG2  . VAL A  1 518 ? 114.887 128.470 166.605 1.00 112.83 ? 443 VAL A CG2  1 
ATOM   5734  H  H    . VAL A  1 518 ? 117.604 128.877 166.286 1.00 112.83 ? 443 VAL A H    1 
ATOM   5735  H  HA   . VAL A  1 518 ? 117.048 126.838 164.682 1.00 112.83 ? 443 VAL A HA   1 
ATOM   5736  H  HB   . VAL A  1 518 ? 115.091 126.597 165.843 1.00 112.83 ? 443 VAL A HB   1 
ATOM   5737  H  HG11 . VAL A  1 518 ? 115.998 126.837 168.146 1.00 112.83 ? 443 VAL A HG11 1 
ATOM   5738  H  HG12 . VAL A  1 518 ? 116.583 125.728 167.168 1.00 112.83 ? 443 VAL A HG12 1 
ATOM   5739  H  HG13 . VAL A  1 518 ? 117.360 127.088 167.385 1.00 112.83 ? 443 VAL A HG13 1 
ATOM   5740  H  HG21 . VAL A  1 518 ? 114.451 128.264 167.446 1.00 112.83 ? 443 VAL A HG21 1 
ATOM   5741  H  HG22 . VAL A  1 518 ? 115.483 129.222 166.716 1.00 112.83 ? 443 VAL A HG22 1 
ATOM   5742  H  HG23 . VAL A  1 518 ? 114.225 128.668 165.926 1.00 112.83 ? 443 VAL A HG23 1 
ATOM   5743  N  N    . VAL A  1 519 ? 115.785 129.672 163.938 1.00 109.16 ? 444 VAL A N    1 
ATOM   5744  C  CA   . VAL A  1 519 ? 115.215 130.368 162.787 1.00 109.16 ? 444 VAL A CA   1 
ATOM   5745  C  C    . VAL A  1 519 ? 116.156 130.270 161.593 1.00 109.16 ? 444 VAL A C    1 
ATOM   5746  O  O    . VAL A  1 519 ? 115.707 130.200 160.443 1.00 109.16 ? 444 VAL A O    1 
ATOM   5747  C  CB   . VAL A  1 519 ? 114.882 131.830 163.134 1.00 109.16 ? 444 VAL A CB   1 
ATOM   5748  C  CG1  . VAL A  1 519 ? 116.124 132.586 163.528 1.00 109.16 ? 444 VAL A CG1  1 
ATOM   5749  C  CG2  . VAL A  1 519 ? 114.211 132.514 161.963 1.00 109.16 ? 444 VAL A CG2  1 
ATOM   5750  H  H    . VAL A  1 519 ? 115.986 130.166 164.612 1.00 109.16 ? 444 VAL A H    1 
ATOM   5751  H  HA   . VAL A  1 519 ? 114.384 129.932 162.544 1.00 109.16 ? 444 VAL A HA   1 
ATOM   5752  H  HB   . VAL A  1 519 ? 114.269 131.847 163.883 1.00 109.16 ? 444 VAL A HB   1 
ATOM   5753  H  HG11 . VAL A  1 519 ? 115.869 133.469 163.834 1.00 109.16 ? 444 VAL A HG11 1 
ATOM   5754  H  HG12 . VAL A  1 519 ? 116.555 132.100 164.241 1.00 109.16 ? 444 VAL A HG12 1 
ATOM   5755  H  HG13 . VAL A  1 519 ? 116.717 132.652 162.762 1.00 109.16 ? 444 VAL A HG13 1 
ATOM   5756  H  HG21 . VAL A  1 519 ? 113.959 133.411 162.228 1.00 109.16 ? 444 VAL A HG21 1 
ATOM   5757  H  HG22 . VAL A  1 519 ? 114.833 132.550 161.223 1.00 109.16 ? 444 VAL A HG22 1 
ATOM   5758  H  HG23 . VAL A  1 519 ? 113.422 132.006 161.712 1.00 109.16 ? 444 VAL A HG23 1 
ATOM   5759  N  N    . ASP A  1 520 ? 117.467 130.263 161.838 1.00 106.44 ? 445 ASP A N    1 
ATOM   5760  C  CA   . ASP A  1 520 ? 118.426 130.054 160.758 1.00 106.44 ? 445 ASP A CA   1 
ATOM   5761  C  C    . ASP A  1 520 ? 118.215 128.702 160.096 1.00 106.44 ? 445 ASP A C    1 
ATOM   5762  O  O    . ASP A  1 520 ? 118.236 128.592 158.867 1.00 106.44 ? 445 ASP A O    1 
ATOM   5763  C  CB   . ASP A  1 520 ? 119.850 130.159 161.308 1.00 106.44 ? 445 ASP A CB   1 
ATOM   5764  C  CG   . ASP A  1 520 ? 120.869 130.461 160.235 1.00 106.44 ? 445 ASP A CG   1 
ATOM   5765  O  OD1  . ASP A  1 520 ? 120.484 130.500 159.053 1.00 106.44 ? 445 ASP A OD1  1 
ATOM   5766  O  OD2  . ASP A  1 520 ? 122.054 130.661 160.576 1.00 106.44 ? 445 ASP A OD2  1 
ATOM   5767  H  H    . ASP A  1 520 ? 117.820 130.374 162.612 1.00 106.44 ? 445 ASP A H    1 
ATOM   5768  H  HA   . ASP A  1 520 ? 118.302 130.741 160.087 1.00 106.44 ? 445 ASP A HA   1 
ATOM   5769  H  HB2  . ASP A  1 520 ? 119.891 130.868 161.966 1.00 106.44 ? 445 ASP A HB2  1 
ATOM   5770  H  HB3  . ASP A  1 520 ? 120.095 129.312 161.712 1.00 106.44 ? 445 ASP A HB3  1 
ATOM   5771  N  N    . ARG A  1 521 ? 118.019 127.658 160.900 1.00 109.30 ? 446 ARG A N    1 
ATOM   5772  C  CA   . ARG A  1 521 ? 117.774 126.331 160.341 1.00 109.30 ? 446 ARG A CA   1 
ATOM   5773  C  C    . ARG A  1 521 ? 116.466 126.300 159.550 1.00 109.30 ? 446 ARG A C    1 
ATOM   5774  O  O    . ARG A  1 521 ? 116.389 125.693 158.472 1.00 109.30 ? 446 ARG A O    1 
ATOM   5775  C  CB   . ARG A  1 521 ? 117.771 125.299 161.470 1.00 109.30 ? 446 ARG A CB   1 
ATOM   5776  C  CG   . ARG A  1 521 ? 117.549 123.869 161.036 1.00 109.30 ? 446 ARG A CG   1 
ATOM   5777  C  CD   . ARG A  1 521 ? 117.523 122.940 162.237 1.00 109.30 ? 446 ARG A CD   1 
ATOM   5778  N  NE   . ARG A  1 521 ? 118.777 122.976 162.988 1.00 109.30 ? 446 ARG A NE   1 
ATOM   5779  C  CZ   . ARG A  1 521 ? 119.852 122.249 162.695 1.00 109.30 ? 446 ARG A CZ   1 
ATOM   5780  N  NH1  . ARG A  1 521 ? 120.944 122.349 163.440 1.00 109.30 ? 446 ARG A NH1  1 
ATOM   5781  N  NH2  . ARG A  1 521 ? 119.843 121.425 161.656 1.00 109.30 ? 446 ARG A NH2  1 
ATOM   5782  H  H    . ARG A  1 521 ? 118.019 127.691 161.758 1.00 109.30 ? 446 ARG A H    1 
ATOM   5783  H  HA   . ARG A  1 521 ? 118.495 126.108 159.734 1.00 109.30 ? 446 ARG A HA   1 
ATOM   5784  H  HB2  . ARG A  1 521 ? 118.630 125.333 161.919 1.00 109.30 ? 446 ARG A HB2  1 
ATOM   5785  H  HB3  . ARG A  1 521 ? 117.068 125.527 162.097 1.00 109.30 ? 446 ARG A HB3  1 
ATOM   5786  H  HG2  . ARG A  1 521 ? 116.698 123.801 160.578 1.00 109.30 ? 446 ARG A HG2  1 
ATOM   5787  H  HG3  . ARG A  1 521 ? 118.273 123.593 160.456 1.00 109.30 ? 446 ARG A HG3  1 
ATOM   5788  H  HD2  . ARG A  1 521 ? 116.813 123.220 162.837 1.00 109.30 ? 446 ARG A HD2  1 
ATOM   5789  H  HD3  . ARG A  1 521 ? 117.369 122.031 161.938 1.00 109.30 ? 446 ARG A HD3  1 
ATOM   5790  H  HE   . ARG A  1 521 ? 118.814 123.484 163.681 1.00 109.30 ? 446 ARG A HE   1 
ATOM   5791  H  HH11 . ARG A  1 521 ? 120.958 122.880 164.116 1.00 109.30 ? 446 ARG A HH11 1 
ATOM   5792  H  HH12 . ARG A  1 521 ? 121.638 121.880 163.248 1.00 109.30 ? 446 ARG A HH12 1 
ATOM   5793  H  HH21 . ARG A  1 521 ? 119.141 121.352 161.166 1.00 109.30 ? 446 ARG A HH21 1 
ATOM   5794  H  HH22 . ARG A  1 521 ? 120.544 120.962 161.474 1.00 109.30 ? 446 ARG A HH22 1 
ATOM   5795  N  N    . LEU A  1 522 ? 115.432 126.966 160.065 1.00 105.19 ? 447 LEU A N    1 
ATOM   5796  C  CA   . LEU A  1 522 ? 114.156 127.034 159.359 1.00 105.19 ? 447 LEU A CA   1 
ATOM   5797  C  C    . LEU A  1 522 ? 114.315 127.717 157.998 1.00 105.19 ? 447 LEU A C    1 
ATOM   5798  O  O    . LEU A  1 522 ? 113.771 127.253 156.982 1.00 105.19 ? 447 LEU A O    1 
ATOM   5799  C  CB   . LEU A  1 522 ? 113.150 127.782 160.232 1.00 105.19 ? 447 LEU A CB   1 
ATOM   5800  C  CG   . LEU A  1 522 ? 111.660 127.660 159.938 1.00 105.19 ? 447 LEU A CG   1 
ATOM   5801  C  CD1  . LEU A  1 522 ? 111.164 126.290 160.371 1.00 105.19 ? 447 LEU A CD1  1 
ATOM   5802  C  CD2  . LEU A  1 522 ? 110.897 128.756 160.654 1.00 105.19 ? 447 LEU A CD2  1 
ATOM   5803  H  H    . LEU A  1 522 ? 115.443 127.373 160.821 1.00 105.19 ? 447 LEU A H    1 
ATOM   5804  H  HA   . LEU A  1 522 ? 113.823 126.136 159.211 1.00 105.19 ? 447 LEU A HA   1 
ATOM   5805  H  HB2  . LEU A  1 522 ? 113.280 127.500 161.150 1.00 105.19 ? 447 LEU A HB2  1 
ATOM   5806  H  HB3  . LEU A  1 522 ? 113.359 128.726 160.162 1.00 105.19 ? 447 LEU A HB3  1 
ATOM   5807  H  HG   . LEU A  1 522 ? 111.517 127.774 158.990 1.00 105.19 ? 447 LEU A HG   1 
ATOM   5808  H  HD11 . LEU A  1 522 ? 110.216 126.267 160.187 1.00 105.19 ? 447 LEU A HD11 1 
ATOM   5809  H  HD12 . LEU A  1 522 ? 111.614 125.610 159.836 1.00 105.19 ? 447 LEU A HD12 1 
ATOM   5810  H  HD13 . LEU A  1 522 ? 111.323 126.116 161.324 1.00 105.19 ? 447 LEU A HD13 1 
ATOM   5811  H  HD21 . LEU A  1 522 ? 109.944 128.566 160.626 1.00 105.19 ? 447 LEU A HD21 1 
ATOM   5812  H  HD22 . LEU A  1 522 ? 111.200 128.789 161.576 1.00 105.19 ? 447 LEU A HD22 1 
ATOM   5813  H  HD23 . LEU A  1 522 ? 111.088 129.592 160.214 1.00 105.19 ? 447 LEU A HD23 1 
ATOM   5814  N  N    . CYS A  1 523 ? 115.056 128.828 157.964 1.00 98.57  ? 448 CYS A N    1 
ATOM   5815  C  CA   . CYS A  1 523 ? 115.329 129.522 156.708 1.00 98.57  ? 448 CYS A CA   1 
ATOM   5816  C  C    . CYS A  1 523 ? 116.132 128.643 155.759 1.00 98.57  ? 448 CYS A C    1 
ATOM   5817  O  O    . CYS A  1 523 ? 115.872 128.605 154.546 1.00 98.57  ? 448 CYS A O    1 
ATOM   5818  C  CB   . CYS A  1 523 ? 116.086 130.815 156.986 1.00 98.57  ? 448 CYS A CB   1 
ATOM   5819  S  SG   . CYS A  1 523 ? 115.133 132.078 157.838 1.00 98.57  ? 448 CYS A SG   1 
ATOM   5820  H  H    . CYS A  1 523 ? 115.407 129.197 158.654 1.00 98.57  ? 448 CYS A H    1 
ATOM   5821  H  HA   . CYS A  1 523 ? 114.487 129.741 156.282 1.00 98.57  ? 448 CYS A HA   1 
ATOM   5822  H  HB2  . CYS A  1 523 ? 116.856 130.605 157.533 1.00 98.57  ? 448 CYS A HB2  1 
ATOM   5823  H  HB3  . CYS A  1 523 ? 116.375 131.186 156.141 1.00 98.57  ? 448 CYS A HB3  1 
ATOM   5824  H  HG   . CYS A  1 523 ? 115.884 132.974 158.100 1.00 98.57  ? 448 CYS A HG   1 
ATOM   5825  N  N    . LEU A  1 524 ? 117.131 127.939 156.299 1.00 99.40  ? 449 LEU A N    1 
ATOM   5826  C  CA   . LEU A  1 524 ? 117.866 126.959 155.509 1.00 99.40  ? 449 LEU A CA   1 
ATOM   5827  C  C    . LEU A  1 524 ? 116.917 126.021 154.801 1.00 99.40  ? 449 LEU A C    1 
ATOM   5828  O  O    . LEU A  1 524 ? 117.061 125.769 153.597 1.00 99.40  ? 449 LEU A O    1 
ATOM   5829  C  CB   . LEU A  1 524 ? 118.809 126.153 156.406 1.00 99.40  ? 449 LEU A CB   1 
ATOM   5830  C  CG   . LEU A  1 524 ? 119.785 125.174 155.759 1.00 99.40  ? 449 LEU A CG   1 
ATOM   5831  C  CD1  . LEU A  1 524 ? 120.919 124.840 156.696 1.00 99.40  ? 449 LEU A CD1  1 
ATOM   5832  C  CD2  . LEU A  1 524 ? 119.121 123.875 155.349 1.00 99.40  ? 449 LEU A CD2  1 
ATOM   5833  H  H    . LEU A  1 524 ? 117.386 127.997 157.111 1.00 99.40  ? 449 LEU A H    1 
ATOM   5834  H  HA   . LEU A  1 524 ? 118.402 127.422 154.847 1.00 99.40  ? 449 LEU A HA   1 
ATOM   5835  H  HB2  . LEU A  1 524 ? 119.330 126.778 156.926 1.00 99.40  ? 449 LEU A HB2  1 
ATOM   5836  H  HB3  . LEU A  1 524 ? 118.252 125.626 157.002 1.00 99.40  ? 449 LEU A HB3  1 
ATOM   5837  H  HG   . LEU A  1 524 ? 120.165 125.586 154.960 1.00 99.40  ? 449 LEU A HG   1 
ATOM   5838  H  HD11 . LEU A  1 524 ? 121.529 124.260 156.223 1.00 99.40  ? 449 LEU A HD11 1 
ATOM   5839  H  HD12 . LEU A  1 524 ? 121.369 125.639 156.990 1.00 99.40  ? 449 LEU A HD12 1 
ATOM   5840  H  HD13 . LEU A  1 524 ? 120.549 124.371 157.464 1.00 99.40  ? 449 LEU A HD13 1 
ATOM   5841  H  HD21 . LEU A  1 524 ? 119.793 123.291 154.969 1.00 99.40  ? 449 LEU A HD21 1 
ATOM   5842  H  HD22 . LEU A  1 524 ? 118.742 123.467 156.143 1.00 99.40  ? 449 LEU A HD22 1 
ATOM   5843  H  HD23 . LEU A  1 524 ? 118.427 124.042 154.697 1.00 99.40  ? 449 LEU A HD23 1 
ATOM   5844  N  N    . MET A  1 525 ? 115.933 125.506 155.536 1.00 104.84 ? 450 MET A N    1 
ATOM   5845  C  CA   . MET A  1 525 ? 114.944 124.613 154.938 1.00 104.84 ? 450 MET A CA   1 
ATOM   5846  C  C    . MET A  1 525 ? 114.192 125.269 153.803 1.00 104.84 ? 450 MET A C    1 
ATOM   5847  O  O    . MET A  1 525 ? 114.005 124.679 152.726 1.00 104.84 ? 450 MET A O    1 
ATOM   5848  C  CB   . MET A  1 525 ? 113.900 124.234 155.957 1.00 104.84 ? 450 MET A CB   1 
ATOM   5849  C  CG   . MET A  1 525 ? 114.326 123.420 157.057 1.00 104.84 ? 450 MET A CG   1 
ATOM   5850  S  SD   . MET A  1 525 ? 112.807 123.288 157.978 1.00 104.84 ? 450 MET A SD   1 
ATOM   5851  C  CE   . MET A  1 525 ? 113.236 121.822 158.800 1.00 104.84 ? 450 MET A CE   1 
ATOM   5852  H  H    . MET A  1 525 ? 115.801 125.693 156.367 1.00 104.84 ? 450 MET A H    1 
ATOM   5853  H  HA   . MET A  1 525 ? 115.411 123.816 154.633 1.00 104.84 ? 450 MET A HA   1 
ATOM   5854  H  HB2  . MET A  1 525 ? 113.439 125.010 156.238 1.00 104.84 ? 450 MET A HB2  1 
ATOM   5855  H  HB3  . MET A  1 525 ? 113.266 123.670 155.445 1.00 104.84 ? 450 MET A HB3  1 
ATOM   5856  H  HG2  . MET A  1 525 ? 114.620 122.540 156.753 1.00 104.84 ? 450 MET A HG2  1 
ATOM   5857  H  HG3  . MET A  1 525 ? 114.987 123.932 157.586 1.00 104.84 ? 450 MET A HG3  1 
ATOM   5858  H  HE1  . MET A  1 525 ? 114.217 121.716 158.605 1.00 104.84 ? 450 MET A HE1  1 
ATOM   5859  H  HE2  . MET A  1 525 ? 112.650 120.977 158.617 1.00 104.84 ? 450 MET A HE2  1 
ATOM   5860  H  HE3  . MET A  1 525 ? 113.180 122.139 159.694 1.00 104.84 ? 450 MET A HE3  1 
ATOM   5861  N  N    . ALA A  1 526 ? 113.599 126.412 154.104 1.00 99.07  ? 451 ALA A N    1 
ATOM   5862  C  CA   . ALA A  1 526 ? 112.748 127.037 153.119 1.00 99.07  ? 451 ALA A CA   1 
ATOM   5863  C  C    . ALA A  1 526 ? 113.520 127.242 151.832 1.00 99.07  ? 451 ALA A C    1 
ATOM   5864  O  O    . ALA A  1 526 ? 113.008 126.970 150.735 1.00 99.07  ? 451 ALA A O    1 
ATOM   5865  C  CB   . ALA A  1 526 ? 112.197 128.353 153.671 1.00 99.07  ? 451 ALA A CB   1 
ATOM   5866  H  H    . ALA A  1 526 ? 113.657 126.812 154.860 1.00 99.07  ? 451 ALA A H    1 
ATOM   5867  H  HA   . ALA A  1 526 ? 111.999 126.450 152.933 1.00 99.07  ? 451 ALA A HA   1 
ATOM   5868  H  HB1  . ALA A  1 526 ? 111.625 128.763 153.005 1.00 99.07  ? 451 ALA A HB1  1 
ATOM   5869  H  HB2  . ALA A  1 526 ? 111.681 128.152 154.470 1.00 99.07  ? 451 ALA A HB2  1 
ATOM   5870  H  HB3  . ALA A  1 526 ? 112.936 128.936 153.893 1.00 99.07  ? 451 ALA A HB3  1 
ATOM   5871  N  N    . PHE A  1 527 ? 114.779 127.667 151.940 1.00 93.05  ? 452 PHE A N    1 
ATOM   5872  C  CA   . PHE A  1 527 ? 115.555 127.830 150.718 1.00 93.05  ? 452 PHE A CA   1 
ATOM   5873  C  C    . PHE A  1 527 ? 115.877 126.488 150.083 1.00 93.05  ? 452 PHE A C    1 
ATOM   5874  O  O    . PHE A  1 527 ? 115.928 126.381 148.858 1.00 93.05  ? 452 PHE A O    1 
ATOM   5875  C  CB   . PHE A  1 527 ? 116.850 128.604 150.940 1.00 93.05  ? 452 PHE A CB   1 
ATOM   5876  C  CG   . PHE A  1 527 ? 116.656 130.073 151.071 1.00 93.05  ? 452 PHE A CG   1 
ATOM   5877  C  CD1  . PHE A  1 527 ? 115.394 130.611 151.241 1.00 93.05  ? 452 PHE A CD1  1 
ATOM   5878  C  CD2  . PHE A  1 527 ? 117.688 130.928 150.766 1.00 93.05  ? 452 PHE A CD2  1 
ATOM   5879  C  CE1  . PHE A  1 527 ? 115.214 131.968 151.317 1.00 93.05  ? 452 PHE A CE1  1 
ATOM   5880  C  CE2  . PHE A  1 527 ? 117.508 132.291 150.795 1.00 93.05  ? 452 PHE A CE2  1 
ATOM   5881  C  CZ   . PHE A  1 527 ? 116.265 132.813 151.068 1.00 93.05  ? 452 PHE A CZ   1 
ATOM   5882  H  H    . PHE A  1 527 ? 115.182 127.859 152.672 1.00 93.05  ? 452 PHE A H    1 
ATOM   5883  H  HA   . PHE A  1 527 ? 115.022 128.321 150.076 1.00 93.05  ? 452 PHE A HA   1 
ATOM   5884  H  HB2  . PHE A  1 527 ? 117.258 128.279 151.758 1.00 93.05  ? 452 PHE A HB2  1 
ATOM   5885  H  HB3  . PHE A  1 527 ? 117.446 128.437 150.195 1.00 93.05  ? 452 PHE A HB3  1 
ATOM   5886  H  HD1  . PHE A  1 527 ? 114.685 130.040 151.427 1.00 93.05  ? 452 PHE A HD1  1 
ATOM   5887  H  HD2  . PHE A  1 527 ? 118.528 130.570 150.602 1.00 93.05  ? 452 PHE A HD2  1 
ATOM   5888  H  HE1  . PHE A  1 527 ? 114.365 132.303 151.469 1.00 93.05  ? 452 PHE A HE1  1 
ATOM   5889  H  HE2  . PHE A  1 527 ? 118.227 132.850 150.639 1.00 93.05  ? 452 PHE A HE2  1 
ATOM   5890  H  HZ   . PHE A  1 527 ? 116.136 133.729 151.085 1.00 93.05  ? 452 PHE A HZ   1 
ATOM   5891  N  N    . SER A  1 528 ? 116.118 125.452 150.885 1.00 95.31  ? 453 SER A N    1 
ATOM   5892  C  CA   . SER A  1 528 ? 116.430 124.152 150.299 1.00 95.31  ? 453 SER A CA   1 
ATOM   5893  C  C    . SER A  1 528 ? 115.282 123.674 149.420 1.00 95.31  ? 453 SER A C    1 
ATOM   5894  O  O    . SER A  1 528 ? 115.484 123.290 148.258 1.00 95.31  ? 453 SER A O    1 
ATOM   5895  C  CB   . SER A  1 528 ? 116.731 123.136 151.400 1.00 95.31  ? 453 SER A CB   1 
ATOM   5896  O  OG   . SER A  1 528 ? 117.128 121.894 150.849 1.00 95.31  ? 453 SER A OG   1 
ATOM   5897  H  H    . SER A  1 528 ? 116.096 125.470 151.742 1.00 95.31  ? 453 SER A H    1 
ATOM   5898  H  HA   . SER A  1 528 ? 117.217 124.235 149.742 1.00 95.31  ? 453 SER A HA   1 
ATOM   5899  H  HB2  . SER A  1 528 ? 117.446 123.478 151.956 1.00 95.31  ? 453 SER A HB2  1 
ATOM   5900  H  HB3  . SER A  1 528 ? 115.931 123.002 151.932 1.00 95.31  ? 453 SER A HB3  1 
ATOM   5901  H  HG   . SER A  1 528 ? 117.201 121.318 151.455 1.00 95.31  ? 453 SER A HG   1 
ATOM   5902  N  N    . VAL A  1 529 ? 114.060 123.717 149.956 1.00 96.25  ? 454 VAL A N    1 
ATOM   5903  C  CA   . VAL A  1 529 ? 112.904 123.243 149.197 1.00 96.25  ? 454 VAL A CA   1 
ATOM   5904  C  C    . VAL A  1 529 ? 112.683 124.127 147.977 1.00 96.25  ? 454 VAL A C    1 
ATOM   5905  O  O    . VAL A  1 529 ? 112.481 123.630 146.860 1.00 96.25  ? 454 VAL A O    1 
ATOM   5906  C  CB   . VAL A  1 529 ? 111.644 123.170 150.084 1.00 96.25  ? 454 VAL A CB   1 
ATOM   5907  C  CG1  . VAL A  1 529 ? 111.896 122.305 151.312 1.00 96.25  ? 454 VAL A CG1  1 
ATOM   5908  C  CG2  . VAL A  1 529 ? 111.146 124.551 150.488 1.00 96.25  ? 454 VAL A CG2  1 
ATOM   5909  H  H    . VAL A  1 529 ? 113.878 124.009 150.744 1.00 96.25  ? 454 VAL A H    1 
ATOM   5910  H  HA   . VAL A  1 529 ? 113.085 122.344 148.883 1.00 96.25  ? 454 VAL A HA   1 
ATOM   5911  H  HB   . VAL A  1 529 ? 110.937 122.748 149.573 1.00 96.25  ? 454 VAL A HB   1 
ATOM   5912  H  HG11 . VAL A  1 529 ? 111.070 122.235 151.816 1.00 96.25  ? 454 VAL A HG11 1 
ATOM   5913  H  HG12 . VAL A  1 529 ? 112.184 121.425 151.023 1.00 96.25  ? 454 VAL A HG12 1 
ATOM   5914  H  HG13 . VAL A  1 529 ? 112.582 122.719 151.859 1.00 96.25  ? 454 VAL A HG13 1 
ATOM   5915  H  HG21 . VAL A  1 529 ? 110.381 124.444 151.076 1.00 96.25  ? 454 VAL A HG21 1 
ATOM   5916  H  HG22 . VAL A  1 529 ? 111.852 125.018 150.955 1.00 96.25  ? 454 VAL A HG22 1 
ATOM   5917  H  HG23 . VAL A  1 529 ? 110.877 125.044 149.699 1.00 96.25  ? 454 VAL A HG23 1 
ATOM   5918  N  N    . PHE A  1 530 ? 112.731 125.451 148.167 1.00 96.24  ? 455 PHE A N    1 
ATOM   5919  C  CA   . PHE A  1 530 ? 112.546 126.363 147.044 1.00 96.24  ? 455 PHE A CA   1 
ATOM   5920  C  C    . PHE A  1 530 ? 113.556 126.081 145.942 1.00 96.24  ? 455 PHE A C    1 
ATOM   5921  O  O    . PHE A  1 530 ? 113.207 126.041 144.756 1.00 96.24  ? 455 PHE A O    1 
ATOM   5922  C  CB   . PHE A  1 530 ? 112.669 127.806 147.531 1.00 96.24  ? 455 PHE A CB   1 
ATOM   5923  C  CG   . PHE A  1 530 ? 112.281 128.834 146.510 1.00 96.24  ? 455 PHE A CG   1 
ATOM   5924  C  CD1  . PHE A  1 530 ? 110.968 128.957 146.089 1.00 96.24  ? 455 PHE A CD1  1 
ATOM   5925  C  CD2  . PHE A  1 530 ? 113.231 129.688 145.982 1.00 96.24  ? 455 PHE A CD2  1 
ATOM   5926  C  CE1  . PHE A  1 530 ? 110.614 129.910 145.153 1.00 96.24  ? 455 PHE A CE1  1 
ATOM   5927  C  CE2  . PHE A  1 530 ? 112.884 130.643 145.047 1.00 96.24  ? 455 PHE A CE2  1 
ATOM   5928  C  CZ   . PHE A  1 530 ? 111.573 130.753 144.632 1.00 96.24  ? 455 PHE A CZ   1 
ATOM   5929  H  H    . PHE A  1 530 ? 112.861 125.833 148.926 1.00 96.24  ? 455 PHE A H    1 
ATOM   5930  H  HA   . PHE A  1 530 ? 111.655 126.244 146.682 1.00 96.24  ? 455 PHE A HA   1 
ATOM   5931  H  HB2  . PHE A  1 530 ? 112.096 127.928 148.306 1.00 96.24  ? 455 PHE A HB2  1 
ATOM   5932  H  HB3  . PHE A  1 530 ? 113.593 127.969 147.776 1.00 96.24  ? 455 PHE A HB3  1 
ATOM   5933  H  HD1  . PHE A  1 530 ? 110.317 128.392 146.437 1.00 96.24  ? 455 PHE A HD1  1 
ATOM   5934  H  HD2  . PHE A  1 530 ? 114.116 129.617 146.259 1.00 96.24  ? 455 PHE A HD2  1 
ATOM   5935  H  HE1  . PHE A  1 530 ? 109.731 129.985 144.874 1.00 96.24  ? 455 PHE A HE1  1 
ATOM   5936  H  HE2  . PHE A  1 530 ? 113.532 131.210 144.698 1.00 96.24  ? 455 PHE A HE2  1 
ATOM   5937  H  HZ   . PHE A  1 530 ? 111.338 131.395 144.003 1.00 96.24  ? 455 PHE A HZ   1 
ATOM   5938  N  N    . THR A  1 531 ? 114.811 125.852 146.319 1.00 92.87  ? 456 THR A N    1 
ATOM   5939  C  CA   . THR A  1 531 ? 115.872 125.658 145.343 1.00 92.87  ? 456 THR A CA   1 
ATOM   5940  C  C    . THR A  1 531 ? 115.676 124.364 144.565 1.00 92.87  ? 456 THR A C    1 
ATOM   5941  O  O    . THR A  1 531 ? 115.770 124.351 143.330 1.00 92.87  ? 456 THR A O    1 
ATOM   5942  C  CB   . THR A  1 531 ? 117.223 125.667 146.059 1.00 92.87  ? 456 THR A CB   1 
ATOM   5943  O  OG1  . THR A  1 531 ? 117.450 126.960 146.633 1.00 92.87  ? 456 THR A OG1  1 
ATOM   5944  C  CG2  . THR A  1 531 ? 118.342 125.350 145.107 1.00 92.87  ? 456 THR A CG2  1 
ATOM   5945  H  H    . THR A  1 531 ? 115.070 125.808 147.138 1.00 92.87  ? 456 THR A H    1 
ATOM   5946  H  HA   . THR A  1 531 ? 115.863 126.397 144.716 1.00 92.87  ? 456 THR A HA   1 
ATOM   5947  H  HB   . THR A  1 531 ? 117.221 125.004 146.761 1.00 92.87  ? 456 THR A HB   1 
ATOM   5948  H  HG1  . THR A  1 531 ? 116.744 127.244 146.991 1.00 92.87  ? 456 THR A HG1  1 
ATOM   5949  H  HG21 . THR A  1 531 ? 119.192 125.511 145.545 1.00 92.87  ? 456 THR A HG21 1 
ATOM   5950  H  HG22 . THR A  1 531 ? 118.300 124.421 144.833 1.00 92.87  ? 456 THR A HG22 1 
ATOM   5951  H  HG23 . THR A  1 531 ? 118.274 125.920 144.329 1.00 92.87  ? 456 THR A HG23 1 
ATOM   5952  N  N    . ILE A  1 532 ? 115.415 123.256 145.266 1.00 92.62  ? 457 ILE A N    1 
ATOM   5953  C  CA   . ILE A  1 532 ? 115.260 121.991 144.550 1.00 92.62  ? 457 ILE A CA   1 
ATOM   5954  C  C    . ILE A  1 532 ? 114.060 122.068 143.616 1.00 92.62  ? 457 ILE A C    1 
ATOM   5955  O  O    . ILE A  1 532 ? 114.141 121.686 142.441 1.00 92.62  ? 457 ILE A O    1 
ATOM   5956  C  CB   . ILE A  1 532 ? 115.149 120.797 145.519 1.00 92.62  ? 457 ILE A CB   1 
ATOM   5957  C  CG1  . ILE A  1 532 ? 114.120 121.038 146.627 1.00 92.62  ? 457 ILE A CG1  1 
ATOM   5958  C  CG2  . ILE A  1 532 ? 116.512 120.481 146.112 1.00 92.62  ? 457 ILE A CG2  1 
ATOM   5959  C  CD1  . ILE A  1 532 ? 113.808 119.794 147.450 1.00 92.62  ? 457 ILE A CD1  1 
ATOM   5960  H  H    . ILE A  1 532 ? 115.328 123.214 146.120 1.00 92.62  ? 457 ILE A H    1 
ATOM   5961  H  HA   . ILE A  1 532 ? 116.049 121.853 144.005 1.00 92.62  ? 457 ILE A HA   1 
ATOM   5962  H  HB   . ILE A  1 532 ? 114.861 120.025 145.008 1.00 92.62  ? 457 ILE A HB   1 
ATOM   5963  H  HG12 . ILE A  1 532 ? 114.462 121.702 147.234 1.00 92.62  ? 457 ILE A HG12 1 
ATOM   5964  H  HG13 . ILE A  1 532 ? 113.290 121.342 146.232 1.00 92.62  ? 457 ILE A HG13 1 
ATOM   5965  H  HG21 . ILE A  1 532 ? 116.450 119.670 146.641 1.00 92.62  ? 457 ILE A HG21 1 
ATOM   5966  H  HG22 . ILE A  1 532 ? 117.140 120.350 145.386 1.00 92.62  ? 457 ILE A HG22 1 
ATOM   5967  H  HG23 . ILE A  1 532 ? 116.798 121.222 146.666 1.00 92.62  ? 457 ILE A HG23 1 
ATOM   5968  H  HD11 . ILE A  1 532 ? 113.136 120.013 148.115 1.00 92.62  ? 457 ILE A HD11 1 
ATOM   5969  H  HD12 . ILE A  1 532 ? 113.476 119.099 146.860 1.00 92.62  ? 457 ILE A HD12 1 
ATOM   5970  H  HD13 . ILE A  1 532 ? 114.618 119.493 147.891 1.00 92.62  ? 457 ILE A HD13 1 
ATOM   5971  N  N    . ILE A  1 533 ? 112.935 122.590 144.112 1.00 93.50  ? 458 ILE A N    1 
ATOM   5972  C  CA   . ILE A  1 533 ? 111.736 122.640 143.281 1.00 93.50  ? 458 ILE A CA   1 
ATOM   5973  C  C    . ILE A  1 533 ? 111.979 123.529 142.066 1.00 93.50  ? 458 ILE A C    1 
ATOM   5974  O  O    . ILE A  1 533 ? 111.586 123.188 140.943 1.00 93.50  ? 458 ILE A O    1 
ATOM   5975  C  CB   . ILE A  1 533 ? 110.523 123.100 144.119 1.00 93.50  ? 458 ILE A CB   1 
ATOM   5976  C  CG1  . ILE A  1 533 ? 109.222 123.048 143.317 1.00 93.50  ? 458 ILE A CG1  1 
ATOM   5977  C  CG2  . ILE A  1 533 ? 110.703 124.507 144.618 1.00 93.50  ? 458 ILE A CG2  1 
ATOM   5978  C  CD1  . ILE A  1 533 ? 108.703 121.647 143.055 1.00 93.50  ? 458 ILE A CD1  1 
ATOM   5979  H  H    . ILE A  1 533 ? 112.843 122.912 144.902 1.00 93.50  ? 458 ILE A H    1 
ATOM   5980  H  HA   . ILE A  1 533 ? 111.549 121.745 142.960 1.00 93.50  ? 458 ILE A HA   1 
ATOM   5981  H  HB   . ILE A  1 533 ? 110.438 122.509 144.883 1.00 93.50  ? 458 ILE A HB   1 
ATOM   5982  H  HG12 . ILE A  1 533 ? 108.542 123.513 143.830 1.00 93.50  ? 458 ILE A HG12 1 
ATOM   5983  H  HG13 . ILE A  1 533 ? 109.347 123.495 142.466 1.00 93.50  ? 458 ILE A HG13 1 
ATOM   5984  H  HG21 . ILE A  1 533 ? 109.956 124.729 145.195 1.00 93.50  ? 458 ILE A HG21 1 
ATOM   5985  H  HG22 . ILE A  1 533 ? 111.525 124.555 145.115 1.00 93.50  ? 458 ILE A HG22 1 
ATOM   5986  H  HG23 . ILE A  1 533 ? 110.732 125.112 143.863 1.00 93.50  ? 458 ILE A HG23 1 
ATOM   5987  H  HD11 . ILE A  1 533 ? 107.816 121.713 142.668 1.00 93.50  ? 458 ILE A HD11 1 
ATOM   5988  H  HD12 . ILE A  1 533 ? 109.298 121.192 142.442 1.00 93.50  ? 458 ILE A HD12 1 
ATOM   5989  H  HD13 . ILE A  1 533 ? 108.656 121.165 143.896 1.00 93.50  ? 458 ILE A HD13 1 
ATOM   5990  N  N    . CYS A  1 534 ? 112.672 124.656 142.257 1.00 90.59  ? 459 CYS A N    1 
ATOM   5991  C  CA   . CYS A  1 534 ? 112.926 125.569 141.146 1.00 90.59  ? 459 CYS A CA   1 
ATOM   5992  C  C    . CYS A  1 534 ? 113.796 124.920 140.078 1.00 90.59  ? 459 CYS A C    1 
ATOM   5993  O  O    . CYS A  1 534 ? 113.447 124.924 138.889 1.00 90.59  ? 459 CYS A O    1 
ATOM   5994  C  CB   . CYS A  1 534 ? 113.598 126.841 141.663 1.00 90.59  ? 459 CYS A CB   1 
ATOM   5995  S  SG   . CYS A  1 534 ? 112.502 127.986 142.521 1.00 90.59  ? 459 CYS A SG   1 
ATOM   5996  H  H    . CYS A  1 534 ? 113.005 124.904 143.008 1.00 90.59  ? 459 CYS A H    1 
ATOM   5997  H  HA   . CYS A  1 534 ? 112.081 125.816 140.743 1.00 90.59  ? 459 CYS A HA   1 
ATOM   5998  H  HB2  . CYS A  1 534 ? 114.299 126.586 142.282 1.00 90.59  ? 459 CYS A HB2  1 
ATOM   5999  H  HB3  . CYS A  1 534 ? 113.987 127.312 140.910 1.00 90.59  ? 459 CYS A HB3  1 
ATOM   6000  H  HG   . CYS A  1 534 ? 113.184 128.905 142.880 1.00 90.59  ? 459 CYS A HG   1 
ATOM   6001  N  N    . THR A  1 535 ? 114.948 124.374 140.478 1.00 87.76  ? 460 THR A N    1 
ATOM   6002  C  CA   . THR A  1 535 ? 115.842 123.770 139.493 1.00 87.76  ? 460 THR A CA   1 
ATOM   6003  C  C    . THR A  1 535 ? 115.138 122.642 138.749 1.00 87.76  ? 460 THR A C    1 
ATOM   6004  O  O    . THR A  1 535 ? 115.184 122.570 137.511 1.00 87.76  ? 460 THR A O    1 
ATOM   6005  C  CB   . THR A  1 535 ? 117.114 123.249 140.167 1.00 87.76  ? 460 THR A CB   1 
ATOM   6006  O  OG1  . THR A  1 535 ? 116.775 122.236 141.122 1.00 87.76  ? 460 THR A OG1  1 
ATOM   6007  C  CG2  . THR A  1 535 ? 117.875 124.374 140.860 1.00 87.76  ? 460 THR A CG2  1 
ATOM   6008  H  H    . THR A  1 535 ? 115.229 124.347 141.288 1.00 87.76  ? 460 THR A H    1 
ATOM   6009  H  HA   . THR A  1 535 ? 116.102 124.445 138.849 1.00 87.76  ? 460 THR A HA   1 
ATOM   6010  H  HB   . THR A  1 535 ? 117.694 122.866 139.493 1.00 87.76  ? 460 THR A HB   1 
ATOM   6011  H  HG1  . THR A  1 535 ? 116.213 122.534 141.668 1.00 87.76  ? 460 THR A HG1  1 
ATOM   6012  H  HG21 . THR A  1 535 ? 118.829 124.206 140.809 1.00 87.76  ? 460 THR A HG21 1 
ATOM   6013  H  HG22 . THR A  1 535 ? 117.682 125.222 140.433 1.00 87.76  ? 460 THR A HG22 1 
ATOM   6014  H  HG23 . THR A  1 535 ? 117.619 124.428 141.793 1.00 87.76  ? 460 THR A HG23 1 
ATOM   6015  N  N    . ILE A  1 536 ? 114.466 121.759 139.491 1.00 85.61  ? 461 ILE A N    1 
ATOM   6016  C  CA   . ILE A  1 536 ? 113.803 120.621 138.865 1.00 85.61  ? 461 ILE A CA   1 
ATOM   6017  C  C    . ILE A  1 536 ? 112.767 121.106 137.861 1.00 85.61  ? 461 ILE A C    1 
ATOM   6018  O  O    . ILE A  1 536 ? 112.737 120.660 136.711 1.00 85.61  ? 461 ILE A O    1 
ATOM   6019  C  CB   . ILE A  1 536 ? 113.161 119.713 139.928 1.00 85.61  ? 461 ILE A CB   1 
ATOM   6020  C  CG1  . ILE A  1 536 ? 114.209 119.212 140.932 1.00 85.61  ? 461 ILE A CG1  1 
ATOM   6021  C  CG2  . ILE A  1 536 ? 112.445 118.554 139.252 1.00 85.61  ? 461 ILE A CG2  1 
ATOM   6022  C  CD1  . ILE A  1 536 ? 115.018 118.036 140.464 1.00 85.61  ? 461 ILE A CD1  1 
ATOM   6023  H  H    . ILE A  1 536 ? 114.379 121.801 140.343 1.00 85.61  ? 461 ILE A H    1 
ATOM   6024  H  HA   . ILE A  1 536 ? 114.461 120.100 138.382 1.00 85.61  ? 461 ILE A HA   1 
ATOM   6025  H  HB   . ILE A  1 536 ? 112.503 120.237 140.409 1.00 85.61  ? 461 ILE A HB   1 
ATOM   6026  H  HG12 . ILE A  1 536 ? 114.836 119.922 141.122 1.00 85.61  ? 461 ILE A HG12 1 
ATOM   6027  H  HG13 . ILE A  1 536 ? 113.756 118.949 141.747 1.00 85.61  ? 461 ILE A HG13 1 
ATOM   6028  H  HG21 . ILE A  1 536 ? 112.182 117.904 139.920 1.00 85.61  ? 461 ILE A HG21 1 
ATOM   6029  H  HG22 . ILE A  1 536 ? 111.661 118.892 138.793 1.00 85.61  ? 461 ILE A HG22 1 
ATOM   6030  H  HG23 . ILE A  1 536 ? 113.050 118.146 138.613 1.00 85.61  ? 461 ILE A HG23 1 
ATOM   6031  H  HD11 . ILE A  1 536 ? 115.700 117.847 141.128 1.00 85.61  ? 461 ILE A HD11 1 
ATOM   6032  H  HD12 . ILE A  1 536 ? 114.438 117.267 140.361 1.00 85.61  ? 461 ILE A HD12 1 
ATOM   6033  H  HD13 . ILE A  1 536 ? 115.434 118.261 139.618 1.00 85.61  ? 461 ILE A HD13 1 
ATOM   6034  N  N    . GLY A  1 537 ? 111.898 122.029 138.281 1.00 81.99  ? 462 GLY A N    1 
ATOM   6035  C  CA   . GLY A  1 537 ? 110.844 122.485 137.393 1.00 81.99  ? 462 GLY A CA   1 
ATOM   6036  C  C    . GLY A  1 537 ? 111.369 123.155 136.142 1.00 81.99  ? 462 GLY A C    1 
ATOM   6037  O  O    . GLY A  1 537 ? 110.858 122.923 135.040 1.00 81.99  ? 462 GLY A O    1 
ATOM   6038  H  H    . GLY A  1 537 ? 111.901 122.391 139.059 1.00 81.99  ? 462 GLY A H    1 
ATOM   6039  H  HA2  . GLY A  1 537 ? 110.299 121.726 137.133 1.00 81.99  ? 462 GLY A HA2  1 
ATOM   6040  H  HA3  . GLY A  1 537 ? 110.281 123.119 137.864 1.00 81.99  ? 462 GLY A HA3  1 
ATOM   6041  N  N    . ILE A  1 538 ? 112.392 123.997 136.285 1.00 79.67  ? 463 ILE A N    1 
ATOM   6042  C  CA   . ILE A  1 538 ? 112.883 124.718 135.114 1.00 79.67  ? 463 ILE A CA   1 
ATOM   6043  C  C    . ILE A  1 538 ? 113.541 123.761 134.129 1.00 79.67  ? 463 ILE A C    1 
ATOM   6044  O  O    . ILE A  1 538 ? 113.335 123.878 132.918 1.00 79.67  ? 463 ILE A O    1 
ATOM   6045  C  CB   . ILE A  1 538 ? 113.827 125.861 135.536 1.00 79.67  ? 463 ILE A CB   1 
ATOM   6046  C  CG1  . ILE A  1 538 ? 113.029 126.890 136.331 1.00 79.67  ? 463 ILE A CG1  1 
ATOM   6047  C  CG2  . ILE A  1 538 ? 114.455 126.499 134.307 1.00 79.67  ? 463 ILE A CG2  1 
ATOM   6048  C  CD1  . ILE A  1 538 ? 113.794 128.113 136.729 1.00 79.67  ? 463 ILE A CD1  1 
ATOM   6049  H  H    . ILE A  1 538 ? 112.808 124.155 137.014 1.00 79.67  ? 463 ILE A H    1 
ATOM   6050  H  HA   . ILE A  1 538 ? 112.125 125.122 134.665 1.00 79.67  ? 463 ILE A HA   1 
ATOM   6051  H  HB   . ILE A  1 538 ? 114.525 125.494 136.099 1.00 79.67  ? 463 ILE A HB   1 
ATOM   6052  H  HG12 . ILE A  1 538 ? 112.281 127.177 135.783 1.00 79.67  ? 463 ILE A HG12 1 
ATOM   6053  H  HG13 . ILE A  1 538 ? 112.702 126.468 137.136 1.00 79.67  ? 463 ILE A HG13 1 
ATOM   6054  H  HG21 . ILE A  1 538 ? 115.032 127.227 134.583 1.00 79.67  ? 463 ILE A HG21 1 
ATOM   6055  H  HG22 . ILE A  1 538 ? 114.977 125.842 133.825 1.00 79.67  ? 463 ILE A HG22 1 
ATOM   6056  H  HG23 . ILE A  1 538 ? 113.745 126.838 133.741 1.00 79.67  ? 463 ILE A HG23 1 
ATOM   6057  H  HD11 . ILE A  1 538 ? 113.217 128.668 137.277 1.00 79.67  ? 463 ILE A HD11 1 
ATOM   6058  H  HD12 . ILE A  1 538 ? 114.576 127.843 137.233 1.00 79.67  ? 463 ILE A HD12 1 
ATOM   6059  H  HD13 . ILE A  1 538 ? 114.055 128.597 135.933 1.00 79.67  ? 463 ILE A HD13 1 
ATOM   6060  N  N    . LEU A  1 539 ? 114.259 122.747 134.614 1.00 79.18  ? 464 LEU A N    1 
ATOM   6061  C  CA   . LEU A  1 539 ? 114.967 121.787 133.725 1.00 79.18  ? 464 LEU A CA   1 
ATOM   6062  C  C    . LEU A  1 539 ? 114.042 120.648 133.276 1.00 79.18  ? 464 LEU A C    1 
ATOM   6063  O  O    . LEU A  1 539 ? 114.493 119.848 132.454 1.00 79.18  ? 464 LEU A O    1 
ATOM   6064  C  CB   . LEU A  1 539 ? 116.227 121.270 134.421 1.00 79.18  ? 464 LEU A CB   1 
ATOM   6065  C  CG   . LEU A  1 539 ? 117.488 122.076 134.123 1.00 79.18  ? 464 LEU A CG   1 
ATOM   6066  C  CD1  . LEU A  1 539 ? 117.209 123.559 134.250 1.00 79.18  ? 464 LEU A CD1  1 
ATOM   6067  C  CD2  . LEU A  1 539 ? 118.633 121.676 135.035 1.00 79.18  ? 464 LEU A CD2  1 
ATOM   6068  H  H    . LEU A  1 539 ? 114.300 122.544 135.501 1.00 79.18  ? 464 LEU A H    1 
ATOM   6069  H  HA   . LEU A  1 539 ? 115.241 122.282 132.919 1.00 79.18  ? 464 LEU A HA   1 
ATOM   6070  H  HB2  . LEU A  1 539 ? 116.073 121.275 135.387 1.00 79.18  ? 464 LEU A HB2  1 
ATOM   6071  H  HB3  . LEU A  1 539 ? 116.375 120.343 134.147 1.00 79.18  ? 464 LEU A HB3  1 
ATOM   6072  H  HG   . LEU A  1 539 ? 117.758 121.892 133.189 1.00 79.18  ? 464 LEU A HG   1 
ATOM   6073  H  HD11 . LEU A  1 539 ? 118.048 124.051 134.227 1.00 79.18  ? 464 LEU A HD11 1 
ATOM   6074  H  HD12 . LEU A  1 539 ? 116.644 123.848 133.512 1.00 79.18  ? 464 LEU A HD12 1 
ATOM   6075  H  HD13 . LEU A  1 539 ? 116.755 123.733 135.093 1.00 79.18  ? 464 LEU A HD13 1 
ATOM   6076  H  HD21 . LEU A  1 539 ? 118.498 122.065 135.917 1.00 79.18  ? 464 LEU A HD21 1 
ATOM   6077  H  HD22 . LEU A  1 539 ? 118.664 120.706 135.111 1.00 79.18  ? 464 LEU A HD22 1 
ATOM   6078  H  HD23 . LEU A  1 539 ? 119.473 121.999 134.664 1.00 79.18  ? 464 LEU A HD23 1 
ATOM   6079  N  N    . MET A  1 540 ? 112.829 120.539 133.821 1.00 80.88  ? 465 MET A N    1 
ATOM   6080  C  CA   . MET A  1 540 ? 111.807 119.544 133.390 1.00 80.88  ? 465 MET A CA   1 
ATOM   6081  C  C    . MET A  1 540 ? 110.743 120.221 132.519 1.00 80.88  ? 465 MET A C    1 
ATOM   6082  O  O    . MET A  1 540 ? 109.822 119.507 132.120 1.00 80.88  ? 465 MET A O    1 
ATOM   6083  C  CB   . MET A  1 540 ? 111.079 118.927 134.587 1.00 80.88  ? 465 MET A CB   1 
ATOM   6084  C  CG   . MET A  1 540 ? 110.912 117.424 134.533 1.00 80.88  ? 465 MET A CG   1 
ATOM   6085  S  SD   . MET A  1 540 ? 112.434 116.486 134.802 1.00 80.88  ? 465 MET A SD   1 
ATOM   6086  C  CE   . MET A  1 540 ? 113.395 117.633 135.785 1.00 80.88  ? 465 MET A CE   1 
ATOM   6087  H  H    . MET A  1 540 ? 112.544 121.072 134.498 1.00 80.88  ? 465 MET A H    1 
ATOM   6088  H  HA   . MET A  1 540 ? 112.252 118.839 132.867 1.00 80.88  ? 465 MET A HA   1 
ATOM   6089  H  HB2  . MET A  1 540 ? 111.556 119.169 135.402 1.00 80.88  ? 465 MET A HB2  1 
ATOM   6090  H  HB3  . MET A  1 540 ? 110.191 119.332 134.643 1.00 80.88  ? 465 MET A HB3  1 
ATOM   6091  H  HG2  . MET A  1 540 ? 110.258 117.154 135.213 1.00 80.88  ? 465 MET A HG2  1 
ATOM   6092  H  HG3  . MET A  1 540 ? 110.547 117.177 133.657 1.00 80.88  ? 465 MET A HG3  1 
ATOM   6093  H  HE1  . MET A  1 540 ? 113.904 117.143 136.444 1.00 80.88  ? 465 MET A HE1  1 
ATOM   6094  H  HE2  . MET A  1 540 ? 113.997 118.122 135.211 1.00 80.88  ? 465 MET A HE2  1 
ATOM   6095  H  HE3  . MET A  1 540 ? 112.801 118.250 136.229 1.00 80.88  ? 465 MET A HE3  1 
ATOM   6096  N  N    . SER A  1 541 ? 110.838 121.531 132.248 1.00 74.49  ? 466 SER A N    1 
ATOM   6097  C  CA   . SER A  1 541 ? 109.840 122.300 131.454 1.00 74.49  ? 466 SER A CA   1 
ATOM   6098  C  C    . SER A  1 541 ? 110.115 122.152 129.955 1.00 74.49  ? 466 SER A C    1 
ATOM   6099  O  O    . SER A  1 541 ? 109.153 121.981 129.197 1.00 74.49  ? 466 SER A O    1 
ATOM   6100  C  CB   . SER A  1 541 ? 109.801 123.738 131.877 1.00 74.49  ? 466 SER A CB   1 
ATOM   6101  O  OG   . SER A  1 541 ? 111.090 124.314 131.825 1.00 74.49  ? 466 SER A OG   1 
ATOM   6102  H  H    . SER A  1 541 ? 111.536 122.052 132.506 1.00 74.49  ? 466 SER A H    1 
ATOM   6103  H  HA   . SER A  1 541 ? 108.946 121.904 131.636 1.00 74.49  ? 466 SER A HA   1 
ATOM   6104  H  HB2  . SER A  1 541 ? 109.193 124.236 131.285 1.00 74.49  ? 466 SER A HB2  1 
ATOM   6105  H  HB3  . SER A  1 541 ? 109.451 123.798 132.795 1.00 74.49  ? 466 SER A HB3  1 
ATOM   6106  H  HG   . SER A  1 541 ? 111.059 125.067 132.208 1.00 74.49  ? 466 SER A HG   1 
ATOM   6107  N  N    . ALA A  1 542 ? 111.396 122.217 129.568 1.00 69.56  ? 467 ALA A N    1 
ATOM   6108  C  CA   . ALA A  1 542 ? 111.847 122.092 128.164 1.00 69.56  ? 467 ALA A CA   1 
ATOM   6109  C  C    . ALA A  1 542 ? 111.103 120.923 127.516 1.00 69.56  ? 467 ALA A C    1 
ATOM   6110  O  O    . ALA A  1 542 ? 111.139 119.822 128.093 1.00 69.56  ? 467 ALA A O    1 
ATOM   6111  C  CB   . ALA A  1 542 ? 113.339 121.914 128.101 1.00 69.56  ? 467 ALA A CB   1 
ATOM   6112  H  H    . ALA A  1 542 ? 112.082 122.420 130.136 1.00 69.56  ? 467 ALA A H    1 
ATOM   6113  H  HA   . ALA A  1 542 ? 111.613 122.918 127.700 1.00 69.56  ? 467 ALA A HA   1 
ATOM   6114  H  HB1  . ALA A  1 542 ? 113.559 121.339 127.351 1.00 69.56  ? 467 ALA A HB1  1 
ATOM   6115  H  HB2  . ALA A  1 542 ? 113.765 122.780 127.982 1.00 69.56  ? 467 ALA A HB2  1 
ATOM   6116  H  HB3  . ALA A  1 542 ? 113.659 121.507 128.921 1.00 69.56  ? 467 ALA A HB3  1 
ATOM   6117  N  N    . PRO A  1 543 ? 110.448 121.084 126.346 1.00 68.54  ? 468 PRO A N    1 
ATOM   6118  C  CA   . PRO A  1 543 ? 109.640 120.005 125.776 1.00 68.54  ? 468 PRO A CA   1 
ATOM   6119  C  C    . PRO A  1 543 ? 110.465 118.767 125.396 1.00 68.54  ? 468 PRO A C    1 
ATOM   6120  O  O    . PRO A  1 543 ? 109.961 117.685 125.614 1.00 68.54  ? 468 PRO A O    1 
ATOM   6121  C  CB   . PRO A  1 543 ? 108.958 120.653 124.567 1.00 68.54  ? 468 PRO A CB   1 
ATOM   6122  C  CG   . PRO A  1 543 ? 109.864 121.799 124.185 1.00 68.54  ? 468 PRO A CG   1 
ATOM   6123  C  CD   . PRO A  1 543 ? 110.466 122.270 125.489 1.00 68.54  ? 468 PRO A CD   1 
ATOM   6124  H  HA   . PRO A  1 543 ? 108.946 119.747 126.433 1.00 68.54  ? 468 PRO A HA   1 
ATOM   6125  H  HB2  . PRO A  1 543 ? 108.874 120.014 123.828 1.00 68.54  ? 468 PRO A HB2  1 
ATOM   6126  H  HB3  . PRO A  1 543 ? 108.065 120.981 124.805 1.00 68.54  ? 468 PRO A HB3  1 
ATOM   6127  H  HG2  . PRO A  1 543 ? 110.563 121.499 123.569 1.00 68.54  ? 468 PRO A HG2  1 
ATOM   6128  H  HG3  . PRO A  1 543 ? 109.354 122.518 123.760 1.00 68.54  ? 468 PRO A HG3  1 
ATOM   6129  H  HD2  . PRO A  1 543 ? 111.378 122.589 125.353 1.00 68.54  ? 468 PRO A HD2  1 
ATOM   6130  H  HD3  . PRO A  1 543 ? 109.934 122.988 125.880 1.00 68.54  ? 468 PRO A HD3  1 
ATOM   6131  N  N    . ASN A  1 544 ? 111.679 118.938 124.866 1.00 66.51  ? 469 ASN A N    1 
ATOM   6132  C  CA   . ASN A  1 544 ? 112.546 117.816 124.409 1.00 66.51  ? 469 ASN A CA   1 
ATOM   6133  C  C    . ASN A  1 544 ? 113.649 117.539 125.438 1.00 66.51  ? 469 ASN A C    1 
ATOM   6134  O  O    . ASN A  1 544 ? 114.582 116.795 125.093 1.00 66.51  ? 469 ASN A O    1 
ATOM   6135  C  CB   . ASN A  1 544 ? 113.098 118.045 122.996 1.00 66.51  ? 469 ASN A CB   1 
ATOM   6136  C  CG   . ASN A  1 544 ? 113.927 119.301 122.842 1.00 66.51  ? 469 ASN A CG   1 
ATOM   6137  O  OD1  . ASN A  1 544 ? 115.120 119.298 123.132 1.00 66.51  ? 469 ASN A OD1  1 
ATOM   6138  N  ND2  . ASN A  1 544 ? 113.314 120.368 122.355 1.00 66.51  ? 469 ASN A ND2  1 
ATOM   6139  H  H    . ASN A  1 544 ? 112.065 119.759 124.790 1.00 66.51  ? 469 ASN A H    1 
ATOM   6140  H  HA   . ASN A  1 544 ? 111.986 117.009 124.357 1.00 66.51  ? 469 ASN A HA   1 
ATOM   6141  H  HB2  . ASN A  1 544 ? 113.646 117.275 122.743 1.00 66.51  ? 469 ASN A HB2  1 
ATOM   6142  H  HB3  . ASN A  1 544 ? 112.344 118.086 122.373 1.00 66.51  ? 469 ASN A HB3  1 
ATOM   6143  H  HD21 . ASN A  1 544 ? 113.787 121.066 122.091 1.00 66.51  ? 469 ASN A HD21 1 
ATOM   6144  H  HD22 . ASN A  1 544 ? 112.434 120.384 122.286 1.00 66.51  ? 469 ASN A HD22 1 
ATOM   6145  N  N    . PHE A  1 545 ? 113.561 118.092 126.652 1.00 72.18  ? 470 PHE A N    1 
ATOM   6146  C  CA   . PHE A  1 545 ? 114.583 117.885 127.711 1.00 72.18  ? 470 PHE A CA   1 
ATOM   6147  C  C    . PHE A  1 545 ? 114.686 116.406 128.066 1.00 72.18  ? 470 PHE A C    1 
ATOM   6148  O  O    . PHE A  1 545 ? 115.814 115.916 128.205 1.00 72.18  ? 470 PHE A O    1 
ATOM   6149  C  CB   . PHE A  1 545 ? 114.260 118.600 129.024 1.00 72.18  ? 470 PHE A CB   1 
ATOM   6150  C  CG   . PHE A  1 545 ? 114.834 117.907 130.235 1.00 72.18  ? 470 PHE A CG   1 
ATOM   6151  C  CD1  . PHE A  1 545 ? 116.162 118.087 130.585 1.00 72.18  ? 470 PHE A CD1  1 
ATOM   6152  C  CD2  . PHE A  1 545 ? 114.062 117.057 131.011 1.00 72.18  ? 470 PHE A CD2  1 
ATOM   6153  C  CE1  . PHE A  1 545 ? 116.702 117.444 131.686 1.00 72.18  ? 470 PHE A CE1  1 
ATOM   6154  C  CE2  . PHE A  1 545 ? 114.607 116.408 132.107 1.00 72.18  ? 470 PHE A CE2  1 
ATOM   6155  C  CZ   . PHE A  1 545 ? 115.923 116.605 132.445 1.00 72.18  ? 470 PHE A CZ   1 
ATOM   6156  H  H    . PHE A  1 545 ? 112.893 118.651 126.906 1.00 72.18  ? 470 PHE A H    1 
ATOM   6157  H  HA   . PHE A  1 545 ? 115.462 118.196 127.379 1.00 72.18  ? 470 PHE A HA   1 
ATOM   6158  H  HB2  . PHE A  1 545 ? 114.626 119.504 128.979 1.00 72.18  ? 470 PHE A HB2  1 
ATOM   6159  H  HB3  . PHE A  1 545 ? 113.290 118.668 129.125 1.00 72.18  ? 470 PHE A HB3  1 
ATOM   6160  H  HD1  . PHE A  1 545 ? 116.699 118.658 130.071 1.00 72.18  ? 470 PHE A HD1  1 
ATOM   6161  H  HD2  . PHE A  1 545 ? 113.159 116.911 130.784 1.00 72.18  ? 470 PHE A HD2  1 
ATOM   6162  H  HE1  . PHE A  1 545 ? 117.607 117.583 131.913 1.00 72.18  ? 470 PHE A HE1  1 
ATOM   6163  H  HE2  . PHE A  1 545 ? 114.071 115.832 132.623 1.00 72.18  ? 470 PHE A HE2  1 
ATOM   6164  H  HZ   . PHE A  1 545 ? 116.291 116.167 133.195 1.00 72.18  ? 470 PHE A HZ   1 
ATOM   6165  N  N    . VAL A  1 546 ? 113.556 115.718 128.212 1.00 76.83  ? 471 VAL A N    1 
ATOM   6166  C  CA   . VAL A  1 546 ? 113.563 114.294 128.646 1.00 76.83  ? 471 VAL A CA   1 
ATOM   6167  C  C    . VAL A  1 546 ? 114.278 113.489 127.565 1.00 76.83  ? 471 VAL A C    1 
ATOM   6168  O  O    . VAL A  1 546 ? 115.082 112.674 127.933 1.00 76.83  ? 471 VAL A O    1 
ATOM   6169  C  CB   . VAL A  1 546 ? 112.149 113.755 128.939 1.00 76.83  ? 471 VAL A CB   1 
ATOM   6170  C  CG1  . VAL A  1 546 ? 112.155 112.252 129.182 1.00 76.83  ? 471 VAL A CG1  1 
ATOM   6171  C  CG2  . VAL A  1 546 ? 111.499 114.485 130.108 1.00 76.83  ? 471 VAL A CG2  1 
ATOM   6172  H  H    . VAL A  1 546 ? 112.735 116.057 128.019 1.00 76.83  ? 471 VAL A H    1 
ATOM   6173  H  HA   . VAL A  1 546 ? 114.087 114.232 129.465 1.00 76.83  ? 471 VAL A HA   1 
ATOM   6174  H  HB   . VAL A  1 546 ? 111.598 113.925 128.135 1.00 76.83  ? 471 VAL A HB   1 
ATOM   6175  H  HG11 . VAL A  1 546 ? 111.314 111.984 129.590 1.00 76.83  ? 471 VAL A HG11 1 
ATOM   6176  H  HG12 . VAL A  1 546 ? 112.263 111.784 128.335 1.00 76.83  ? 471 VAL A HG12 1 
ATOM   6177  H  HG13 . VAL A  1 546 ? 112.889 112.020 129.777 1.00 76.83  ? 471 VAL A HG13 1 
ATOM   6178  H  HG21 . VAL A  1 546 ? 110.629 114.092 130.295 1.00 76.83  ? 471 VAL A HG21 1 
ATOM   6179  H  HG22 . VAL A  1 546 ? 112.065 114.407 130.895 1.00 76.83  ? 471 VAL A HG22 1 
ATOM   6180  H  HG23 . VAL A  1 546 ? 111.385 115.424 129.884 1.00 76.83  ? 471 VAL A HG23 1 
ATOM   6181  N  N    . GLU A  1 547 ? 114.012 113.744 126.286 1.00 74.70  ? 472 GLU A N    1 
ATOM   6182  C  CA   . GLU A  1 547 ? 114.653 113.030 125.148 1.00 74.70  ? 472 GLU A CA   1 
ATOM   6183  C  C    . GLU A  1 547 ? 116.144 113.368 125.079 1.00 74.70  ? 472 GLU A C    1 
ATOM   6184  O  O    . GLU A  1 547 ? 116.910 112.462 124.732 1.00 74.70  ? 472 GLU A O    1 
ATOM   6185  C  CB   . GLU A  1 547 ? 113.962 113.367 123.825 1.00 74.70  ? 472 GLU A CB   1 
ATOM   6186  C  CG   . GLU A  1 547 ? 112.594 112.724 123.665 1.00 74.70  ? 472 GLU A CG   1 
ATOM   6187  C  CD   . GLU A  1 547 ? 111.530 113.204 124.638 1.00 74.70  ? 472 GLU A CD   1 
ATOM   6188  O  OE1  . GLU A  1 547 ? 111.084 114.361 124.501 1.00 74.70  ? 472 GLU A OE1  1 
ATOM   6189  O  OE2  . GLU A  1 547 ? 111.167 112.428 125.545 1.00 74.70  ? 472 GLU A OE2  1 
ATOM   6190  H  H    . GLU A  1 547 ? 113.466 114.425 126.036 1.00 74.70  ? 472 GLU A H    1 
ATOM   6191  H  HA   . GLU A  1 547 ? 114.565 112.062 125.308 1.00 74.70  ? 472 GLU A HA   1 
ATOM   6192  H  HB2  . GLU A  1 547 ? 113.868 114.341 123.757 1.00 74.70  ? 472 GLU A HB2  1 
ATOM   6193  H  HB3  . GLU A  1 547 ? 114.538 113.071 123.090 1.00 74.70  ? 472 GLU A HB3  1 
ATOM   6194  H  HG2  . GLU A  1 547 ? 112.273 112.891 122.755 1.00 74.70  ? 472 GLU A HG2  1 
ATOM   6195  H  HG3  . GLU A  1 547 ? 112.688 111.753 123.768 1.00 74.70  ? 472 GLU A HG3  1 
ATOM   6196  N  N    . ALA A  1 548 ? 116.541 114.611 125.361 1.00 66.47  ? 473 ALA A N    1 
ATOM   6197  C  CA   . ALA A  1 548 ? 117.942 115.089 125.243 1.00 66.47  ? 473 ALA A CA   1 
ATOM   6198  C  C    . ALA A  1 548 ? 118.886 114.385 126.225 1.00 66.47  ? 473 ALA A C    1 
ATOM   6199  O  O    . ALA A  1 548 ? 120.059 114.295 125.881 1.00 66.47  ? 473 ALA A O    1 
ATOM   6200  C  CB   . ALA A  1 548 ? 117.978 116.585 125.444 1.00 66.47  ? 473 ALA A CB   1 
ATOM   6201  H  H    . ALA A  1 548 ? 115.976 115.257 125.664 1.00 66.47  ? 473 ALA A H    1 
ATOM   6202  H  HA   . ALA A  1 548 ? 118.255 114.892 124.329 1.00 66.47  ? 473 ALA A HA   1 
ATOM   6203  H  HB1  . ALA A  1 548 ? 118.882 116.911 125.296 1.00 66.47  ? 473 ALA A HB1  1 
ATOM   6204  H  HB2  . ALA A  1 548 ? 117.375 117.014 124.814 1.00 66.47  ? 473 ALA A HB2  1 
ATOM   6205  H  HB3  . ALA A  1 548 ? 117.704 116.799 126.351 1.00 66.47  ? 473 ALA A HB3  1 
ATOM   6206  N  N    . VAL A  1 549 ? 118.438 114.003 127.424 1.00 73.55  ? 474 VAL A N    1 
ATOM   6207  C  CA   . VAL A  1 549 ? 119.255 113.281 128.397 1.00 73.55  ? 474 VAL A CA   1 
ATOM   6208  C  C    . VAL A  1 549 ? 119.356 111.805 128.027 1.00 73.55  ? 474 VAL A C    1 
ATOM   6209  O  O    . VAL A  1 549 ? 120.418 111.190 128.172 1.00 73.55  ? 474 VAL A O    1 
ATOM   6210  C  CB   . VAL A  1 549 ? 118.714 113.474 129.825 1.00 73.55  ? 474 VAL A CB   1 
ATOM   6211  C  CG1  . VAL A  1 549 ? 118.898 114.914 130.262 1.00 73.55  ? 474 VAL A CG1  1 
ATOM   6212  C  CG2  . VAL A  1 549 ? 117.261 113.048 129.927 1.00 73.55  ? 474 VAL A CG2  1 
ATOM   6213  H  H    . VAL A  1 549 ? 117.674 114.269 127.707 1.00 73.55  ? 474 VAL A H    1 
ATOM   6214  H  HA   . VAL A  1 549 ? 120.153 113.646 128.374 1.00 73.55  ? 474 VAL A HA   1 
ATOM   6215  H  HB   . VAL A  1 549 ? 119.227 112.917 130.431 1.00 73.55  ? 474 VAL A HB   1 
ATOM   6216  H  HG11 . VAL A  1 549 ? 118.470 115.041 131.122 1.00 73.55  ? 474 VAL A HG11 1 
ATOM   6217  H  HG12 . VAL A  1 549 ? 119.847 115.099 130.335 1.00 73.55  ? 474 VAL A HG12 1 
ATOM   6218  H  HG13 . VAL A  1 549 ? 118.500 115.498 129.599 1.00 73.55  ? 474 VAL A HG13 1 
ATOM   6219  H  HG21 . VAL A  1 549 ? 116.974 113.153 130.846 1.00 73.55  ? 474 VAL A HG21 1 
ATOM   6220  H  HG22 . VAL A  1 549 ? 116.724 113.604 129.347 1.00 73.55  ? 474 VAL A HG22 1 
ATOM   6221  H  HG23 . VAL A  1 549 ? 117.184 112.119 129.663 1.00 73.55  ? 474 VAL A HG23 1 
ATOM   6222  N  N    . SER A  1 550 ? 118.261 111.211 127.547 1.00 75.13  ? 475 SER A N    1 
ATOM   6223  C  CA   . SER A  1 550 ? 118.299 109.805 127.164 1.00 75.13  ? 475 SER A CA   1 
ATOM   6224  C  C    . SER A  1 550 ? 119.276 109.561 126.023 1.00 75.13  ? 475 SER A C    1 
ATOM   6225  O  O    . SER A  1 550 ? 119.858 108.474 125.927 1.00 75.13  ? 475 SER A O    1 
ATOM   6226  C  CB   . SER A  1 550 ? 116.901 109.331 126.766 1.00 75.13  ? 475 SER A CB   1 
ATOM   6227  O  OG   . SER A  1 550 ? 115.926 109.759 127.701 1.00 75.13  ? 475 SER A OG   1 
ATOM   6228  H  H    . SER A  1 550 ? 117.499 111.591 127.439 1.00 75.13  ? 475 SER A H    1 
ATOM   6229  H  HA   . SER A  1 550 ? 118.589 109.281 127.925 1.00 75.13  ? 475 SER A HA   1 
ATOM   6230  H  HB2  . SER A  1 550 ? 116.683 109.696 125.896 1.00 75.13  ? 475 SER A HB2  1 
ATOM   6231  H  HB3  . SER A  1 550 ? 116.895 108.362 126.726 1.00 75.13  ? 475 SER A HB3  1 
ATOM   6232  H  HG   . SER A  1 550 ? 115.806 110.587 127.632 1.00 75.13  ? 475 SER A HG   1 
ATOM   6233  N  N    . LYS A  1 551 ? 119.463 110.547 125.148 1.00 64.70  ? 476 LYS A N    1 
ATOM   6234  C  CA   . LYS A  1 551 ? 120.369 110.391 124.018 1.00 64.70  ? 476 LYS A CA   1 
ATOM   6235  C  C    . LYS A  1 551 ? 121.809 110.757 124.373 1.00 64.70  ? 476 LYS A C    1 
ATOM   6236  O  O    . LYS A  1 551 ? 122.734 109.989 124.093 1.00 64.70  ? 476 LYS A O    1 
ATOM   6237  C  CB   . LYS A  1 551 ? 119.884 111.247 122.846 1.00 64.70  ? 476 LYS A CB   1 
ATOM   6238  C  CG   . LYS A  1 551 ? 118.596 110.757 122.211 1.00 64.70  ? 476 LYS A CG   1 
ATOM   6239  C  CD   . LYS A  1 551 ? 118.529 111.129 120.745 1.00 64.70  ? 476 LYS A CD   1 
ATOM   6240  C  CE   . LYS A  1 551 ? 117.195 110.741 120.130 1.00 64.70  ? 476 LYS A CE   1 
ATOM   6241  N  NZ   . LYS A  1 551 ? 116.100 111.690 120.479 1.00 64.70  ? 476 LYS A NZ   1 
ATOM   6242  H  H    . LYS A  1 551 ? 119.079 111.315 125.188 1.00 64.70  ? 476 LYS A H    1 
ATOM   6243  H  HA   . LYS A  1 551 ? 120.359 109.465 123.736 1.00 64.70  ? 476 LYS A HA   1 
ATOM   6244  H  HB2  . LYS A  1 551 ? 119.730 112.147 123.168 1.00 64.70  ? 476 LYS A HB2  1 
ATOM   6245  H  HB3  . LYS A  1 551 ? 120.568 111.251 122.161 1.00 64.70  ? 476 LYS A HB3  1 
ATOM   6246  H  HG2  . LYS A  1 551 ? 118.552 109.792 122.280 1.00 64.70  ? 476 LYS A HG2  1 
ATOM   6247  H  HG3  . LYS A  1 551 ? 117.843 111.165 122.662 1.00 64.70  ? 476 LYS A HG3  1 
ATOM   6248  H  HD2  . LYS A  1 551 ? 118.641 112.087 120.651 1.00 64.70  ? 476 LYS A HD2  1 
ATOM   6249  H  HD3  . LYS A  1 551 ? 119.232 110.662 120.266 1.00 64.70  ? 476 LYS A HD3  1 
ATOM   6250  H  HE2  . LYS A  1 551 ? 117.286 110.729 119.164 1.00 64.70  ? 476 LYS A HE2  1 
ATOM   6251  H  HE3  . LYS A  1 551 ? 116.946 109.862 120.451 1.00 64.70  ? 476 LYS A HE3  1 
ATOM   6252  H  HZ1  . LYS A  1 551 ? 115.357 111.471 120.041 1.00 64.70  ? 476 LYS A HZ1  1 
ATOM   6253  H  HZ2  . LYS A  1 551 ? 115.940 111.662 121.353 1.00 64.70  ? 476 LYS A HZ2  1 
ATOM   6254  H  HZ3  . LYS A  1 551 ? 116.333 112.518 120.254 1.00 64.70  ? 476 LYS A HZ3  1 
ATOM   6255  N  N    . ASP A  1 552 ? 122.015 111.924 124.984 1.00 63.96  ? 477 ASP A N    1 
ATOM   6256  C  CA   . ASP A  1 552 ? 123.366 112.411 125.234 1.00 63.96  ? 477 ASP A CA   1 
ATOM   6257  C  C    . ASP A  1 552 ? 124.028 111.666 126.387 1.00 63.96  ? 477 ASP A C    1 
ATOM   6258  O  O    . ASP A  1 552 ? 125.201 111.287 126.298 1.00 63.96  ? 477 ASP A O    1 
ATOM   6259  C  CB   . ASP A  1 552 ? 123.332 113.912 125.520 1.00 63.96  ? 477 ASP A CB   1 
ATOM   6260  C  CG   . ASP A  1 552 ? 122.750 114.710 124.372 1.00 63.96  ? 477 ASP A CG   1 
ATOM   6261  O  OD1  . ASP A  1 552 ? 122.407 114.103 123.335 1.00 63.96  ? 477 ASP A OD1  1 
ATOM   6262  O  OD2  . ASP A  1 552 ? 122.632 115.946 124.506 1.00 63.96  ? 477 ASP A OD2  1 
ATOM   6263  H  H    . ASP A  1 552 ? 121.393 112.443 125.265 1.00 63.96  ? 477 ASP A H    1 
ATOM   6264  H  HA   . ASP A  1 552 ? 123.903 112.265 124.442 1.00 63.96  ? 477 ASP A HA   1 
ATOM   6265  H  HB2  . ASP A  1 552 ? 122.788 114.070 126.305 1.00 63.96  ? 477 ASP A HB2  1 
ATOM   6266  H  HB3  . ASP A  1 552 ? 124.237 114.222 125.673 1.00 63.96  ? 477 ASP A HB3  1 
ATOM   6267  N  N    . PHE A  1 553 ? 123.301 111.461 127.479 1.00 72.74  ? 478 PHE A N    1 
ATOM   6268  C  CA   . PHE A  1 553 ? 123.830 110.709 128.608 1.00 72.74  ? 478 PHE A CA   1 
ATOM   6269  C  C    . PHE A  1 553 ? 123.515 109.227 128.445 1.00 72.74  ? 478 PHE A C    1 
ATOM   6270  O  O    . PHE A  1 553 ? 124.253 108.491 127.789 1.00 72.74  ? 478 PHE A O    1 
ATOM   6271  C  CB   . PHE A  1 553 ? 123.253 111.220 129.931 1.00 72.74  ? 478 PHE A CB   1 
ATOM   6272  C  CG   . PHE A  1 553 ? 123.649 112.633 130.270 1.00 72.74  ? 478 PHE A CG   1 
ATOM   6273  C  CD1  . PHE A  1 553 ? 124.820 113.175 129.802 1.00 72.74  ? 478 PHE A CD1  1 
ATOM   6274  C  CD2  . PHE A  1 553 ? 122.857 113.409 131.084 1.00 72.74  ? 478 PHE A CD2  1 
ATOM   6275  C  CE1  . PHE A  1 553 ? 125.185 114.470 130.122 1.00 72.74  ? 478 PHE A CE1  1 
ATOM   6276  C  CE2  . PHE A  1 553 ? 123.218 114.705 131.406 1.00 72.74  ? 478 PHE A CE2  1 
ATOM   6277  C  CZ   . PHE A  1 553 ? 124.385 115.232 130.926 1.00 72.74  ? 478 PHE A CZ   1 
ATOM   6278  H  H    . PHE A  1 553 ? 122.503 111.757 127.598 1.00 72.74  ? 478 PHE A H    1 
ATOM   6279  H  HA   . PHE A  1 553 ? 124.796 110.794 128.631 1.00 72.74  ? 478 PHE A HA   1 
ATOM   6280  H  HB2  . PHE A  1 553 ? 122.287 111.186 129.880 1.00 72.74  ? 478 PHE A HB2  1 
ATOM   6281  H  HB3  . PHE A  1 553 ? 123.559 110.643 130.647 1.00 72.74  ? 478 PHE A HB3  1 
ATOM   6282  H  HD1  . PHE A  1 553 ? 125.354 112.678 129.246 1.00 72.74  ? 478 PHE A HD1  1 
ATOM   6283  H  HD2  . PHE A  1 553 ? 122.081 113.058 131.425 1.00 72.74  ? 478 PHE A HD2  1 
ATOM   6284  H  HE1  . PHE A  1 553 ? 125.963 114.826 129.777 1.00 72.74  ? 478 PHE A HE1  1 
ATOM   6285  H  HE2  . PHE A  1 553 ? 122.674 115.204 131.965 1.00 72.74  ? 478 PHE A HE2  1 
ATOM   6286  H  HZ   . PHE A  1 553 ? 124.631 116.102 131.135 1.00 72.74  ? 478 PHE A HZ   1 
ATOM   6287  N  N    . ILE B  2 1   ? 79.684  123.396 99.111  1.00 96.06  ? 1   ILE F N    1 
ATOM   6288  C  CA   . ILE B  2 1   ? 80.426  124.591 98.621  1.00 96.06  ? 1   ILE F CA   1 
ATOM   6289  C  C    . ILE B  2 1   ? 81.673  124.134 97.884  1.00 96.06  ? 1   ILE F C    1 
ATOM   6290  O  O    . ILE B  2 1   ? 82.417  123.282 98.366  1.00 96.06  ? 1   ILE F O    1 
ATOM   6291  C  CB   . ILE B  2 1   ? 80.780  125.547 99.778  1.00 96.06  ? 1   ILE F CB   1 
ATOM   6292  C  CG1  . ILE B  2 1   ? 81.284  126.888 99.240  1.00 96.06  ? 1   ILE F CG1  1 
ATOM   6293  C  CG2  . ILE B  2 1   ? 81.834  124.932 100.672 1.00 96.06  ? 1   ILE F CG2  1 
ATOM   6294  C  CD1  . ILE B  2 1   ? 80.213  127.762 98.652  1.00 96.06  ? 1   ILE F CD1  1 
ATOM   6295  H  H1   . ILE B  2 1   ? 78.935  123.652 99.517  1.00 96.06  ? 1   ILE F H1   1 
ATOM   6296  H  H2   . ILE B  2 1   ? 79.484  122.873 98.420  1.00 96.06  ? 1   ILE F H2   1 
ATOM   6297  H  H3   . ILE B  2 1   ? 80.195  122.943 99.683  1.00 96.06  ? 1   ILE F H3   1 
ATOM   6298  H  HA   . ILE B  2 1   ? 79.874  125.074 97.989  1.00 96.06  ? 1   ILE F HA   1 
ATOM   6299  H  HB   . ILE B  2 1   ? 79.981  125.707 100.304 1.00 96.06  ? 1   ILE F HB   1 
ATOM   6300  H  HG12 . ILE B  2 1   ? 81.691  127.380 99.971  1.00 96.06  ? 1   ILE F HG12 1 
ATOM   6301  H  HG13 . ILE B  2 1   ? 81.942  126.722 98.550  1.00 96.06  ? 1   ILE F HG13 1 
ATOM   6302  H  HG21 . ILE B  2 1   ? 81.926  125.469 101.472 1.00 96.06  ? 1   ILE F HG21 1 
ATOM   6303  H  HG22 . ILE B  2 1   ? 81.568  124.030 100.909 1.00 96.06  ? 1   ILE F HG22 1 
ATOM   6304  H  HG23 . ILE B  2 1   ? 82.674  124.920 100.193 1.00 96.06  ? 1   ILE F HG23 1 
ATOM   6305  H  HD11 . ILE B  2 1   ? 80.623  128.573 98.312  1.00 96.06  ? 1   ILE F HD11 1 
ATOM   6306  H  HD12 . ILE B  2 1   ? 79.778  127.284 97.931  1.00 96.06  ? 1   ILE F HD12 1 
ATOM   6307  H  HD13 . ILE B  2 1   ? 79.571  127.983 99.344  1.00 96.06  ? 1   ILE F HD13 1 
ATOM   6308  N  N    . VAL B  2 2   ? 81.892  124.708 96.706  1.00 89.33  ? 2   VAL F N    1 
ATOM   6309  C  CA   . VAL B  2 2   ? 83.041  124.395 95.868  1.00 89.33  ? 2   VAL F CA   1 
ATOM   6310  C  C    . VAL B  2 2   ? 83.895  125.647 95.773  1.00 89.33  ? 2   VAL F C    1 
ATOM   6311  O  O    . VAL B  2 2   ? 83.423  126.696 95.318  1.00 89.33  ? 2   VAL F O    1 
ATOM   6312  C  CB   . VAL B  2 2   ? 82.617  123.910 94.475  1.00 89.33  ? 2   VAL F CB   1 
ATOM   6313  C  CG1  . VAL B  2 2   ? 83.826  123.696 93.596  1.00 89.33  ? 2   VAL F CG1  1 
ATOM   6314  C  CG2  . VAL B  2 2   ? 81.835  122.624 94.590  1.00 89.33  ? 2   VAL F CG2  1 
ATOM   6315  H  H    . VAL B  2 2   ? 81.373  125.301 96.367  1.00 89.33  ? 2   VAL F H    1 
ATOM   6316  H  HA   . VAL B  2 2   ? 83.568  123.696 96.284  1.00 89.33  ? 2   VAL F HA   1 
ATOM   6317  H  HB   . VAL B  2 2   ? 82.051  124.577 94.060  1.00 89.33  ? 2   VAL F HB   1 
ATOM   6318  H  HG11 . VAL B  2 2   ? 83.526  123.367 92.735  1.00 89.33  ? 2   VAL F HG11 1 
ATOM   6319  H  HG12 . VAL B  2 2   ? 84.299  124.535 93.482  1.00 89.33  ? 2   VAL F HG12 1 
ATOM   6320  H  HG13 . VAL B  2 2   ? 84.398  123.039 94.020  1.00 89.33  ? 2   VAL F HG13 1 
ATOM   6321  H  HG21 . VAL B  2 2   ? 81.600  122.322 93.700  1.00 89.33  ? 2   VAL F HG21 1 
ATOM   6322  H  HG22 . VAL B  2 2   ? 82.395  121.964 95.028  1.00 89.33  ? 2   VAL F HG22 1 
ATOM   6323  H  HG23 . VAL B  2 2   ? 81.035  122.783 95.114  1.00 89.33  ? 2   VAL F HG23 1 
ATOM   6324  N  N    . CYS B  2 3   ? 85.150  125.534 96.194  1.00 81.95  ? 3   CYS F N    1 
ATOM   6325  C  CA   . CYS B  2 3   ? 86.072  126.655 96.238  1.00 81.95  ? 3   CYS F CA   1 
ATOM   6326  C  C    . CYS B  2 3   ? 87.303  126.316 95.412  1.00 81.95  ? 3   CYS F C    1 
ATOM   6327  O  O    . CYS B  2 3   ? 87.850  125.215 95.533  1.00 81.95  ? 3   CYS F O    1 
ATOM   6328  C  CB   . CYS B  2 3   ? 86.473  126.961 97.680  1.00 81.95  ? 3   CYS F CB   1 
ATOM   6329  S  SG   . CYS B  2 3   ? 85.123  127.514 98.761  1.00 81.95  ? 3   CYS F SG   1 
ATOM   6330  H  H    . CYS B  2 3   ? 85.497  124.797 96.468  1.00 81.95  ? 3   CYS F H    1 
ATOM   6331  H  HA   . CYS B  2 3   ? 85.653  127.442 95.860  1.00 81.95  ? 3   CYS F HA   1 
ATOM   6332  H  HB2  . CYS B  2 3   ? 86.836  126.149 98.063  1.00 81.95  ? 3   CYS F HB2  1 
ATOM   6333  H  HB3  . CYS B  2 3   ? 87.151  127.652 97.677  1.00 81.95  ? 3   CYS F HB3  1 
ATOM   6334  N  N    . HIS B  2 4   ? 87.734  127.256 94.576  1.00 61.73  ? 4   HIS F N    1 
ATOM   6335  C  CA   . HIS B  2 4   ? 89.002  127.104 93.880  1.00 61.73  ? 4   HIS F CA   1 
ATOM   6336  C  C    . HIS B  2 4   ? 90.144  127.060 94.888  1.00 61.73  ? 4   HIS F C    1 
ATOM   6337  O  O    . HIS B  2 4   ? 90.069  127.647 95.970  1.00 61.73  ? 4   HIS F O    1 
ATOM   6338  C  CB   . HIS B  2 4   ? 89.221  128.259 92.907  1.00 61.73  ? 4   HIS F CB   1 
ATOM   6339  C  CG   . HIS B  2 4   ? 88.513  128.104 91.599  1.00 61.73  ? 4   HIS F CG   1 
ATOM   6340  N  ND1  . HIS B  2 4   ? 88.829  127.119 90.690  1.00 61.73  ? 4   HIS F ND1  1 
ATOM   6341  C  CD2  . HIS B  2 4   ? 87.520  128.831 91.035  1.00 61.73  ? 4   HIS F CD2  1 
ATOM   6342  C  CE1  . HIS B  2 4   ? 88.051  127.237 89.629  1.00 61.73  ? 4   HIS F CE1  1 
ATOM   6343  N  NE2  . HIS B  2 4   ? 87.249  128.269 89.813  1.00 61.73  ? 4   HIS F NE2  1 
ATOM   6344  H  H    . HIS B  2 4   ? 87.312  127.982 94.392  1.00 61.73  ? 4   HIS F H    1 
ATOM   6345  H  HA   . HIS B  2 4   ? 89.003  126.277 93.378  1.00 61.73  ? 4   HIS F HA   1 
ATOM   6346  H  HB2  . HIS B  2 4   ? 88.901  129.075 93.318  1.00 61.73  ? 4   HIS F HB2  1 
ATOM   6347  H  HB3  . HIS B  2 4   ? 90.167  128.327 92.720  1.00 61.73  ? 4   HIS F HB3  1 
ATOM   6348  H  HD2  . HIS B  2 4   ? 87.099  129.569 91.408  1.00 61.73  ? 4   HIS F HD2  1 
ATOM   6349  H  HE1  . HIS B  2 4   ? 88.066  126.690 88.878  1.00 61.73  ? 4   HIS F HE1  1 
ATOM   6350  N  N    . THR B  2 5   ? 91.211  126.352 94.530  1.00 55.58  ? 5   THR F N    1 
ATOM   6351  C  CA   . THR B  2 5   ? 92.384  126.260 95.384  1.00 55.58  ? 5   THR F CA   1 
ATOM   6352  C  C    . THR B  2 5   ? 93.641  126.253 94.527  1.00 55.58  ? 5   THR F C    1 
ATOM   6353  O  O    . THR B  2 5   ? 93.603  125.965 93.329  1.00 55.58  ? 5   THR F O    1 
ATOM   6354  C  CB   . THR B  2 5   ? 92.345  125.010 96.272  1.00 55.58  ? 5   THR F CB   1 
ATOM   6355  O  OG1  . THR B  2 5   ? 93.449  125.029 97.183  1.00 55.58  ? 5   THR F OG1  1 
ATOM   6356  C  CG2  . THR B  2 5   ? 92.419  123.755 95.436  1.00 55.58  ? 5   THR F CG2  1 
ATOM   6357  H  H    . THR B  2 5   ? 91.276  125.913 93.795  1.00 55.58  ? 5   THR F H    1 
ATOM   6358  H  HA   . THR B  2 5   ? 92.413  127.038 95.960  1.00 55.58  ? 5   THR F HA   1 
ATOM   6359  H  HB   . THR B  2 5   ? 91.514  124.997 96.770  1.00 55.58  ? 5   THR F HB   1 
ATOM   6360  H  HG1  . THR B  2 5   ? 93.461  124.319 97.630  1.00 55.58  ? 5   THR F HG1  1 
ATOM   6361  H  HG21 . THR B  2 5   ? 92.320  122.978 96.006  1.00 55.58  ? 5   THR F HG21 1 
ATOM   6362  H  HG22 . THR B  2 5   ? 91.715  123.758 94.770  1.00 55.58  ? 5   THR F HG22 1 
ATOM   6363  H  HG23 . THR B  2 5   ? 93.276  123.706 94.991  1.00 55.58  ? 5   THR F HG23 1 
ATOM   6364  N  N    . THR B  2 6   ? 94.766  126.575 95.167  1.00 45.29  ? 6   THR F N    1 
ATOM   6365  C  CA   . THR B  2 6   ? 96.059  126.626 94.506  1.00 45.29  ? 6   THR F CA   1 
ATOM   6366  C  C    . THR B  2 6   ? 97.020  125.551 94.981  1.00 45.29  ? 6   THR F C    1 
ATOM   6367  O  O    . THR B  2 6   ? 98.062  125.355 94.347  1.00 45.29  ? 6   THR F O    1 
ATOM   6368  C  CB   . THR B  2 6   ? 96.718  127.993 94.719  1.00 45.29  ? 6   THR F CB   1 
ATOM   6369  O  OG1  . THR B  2 6   ? 96.911  128.221 96.120  1.00 45.29  ? 6   THR F OG1  1 
ATOM   6370  C  CG2  . THR B  2 6   ? 95.872  129.083 94.141  1.00 45.29  ? 6   THR F CG2  1 
ATOM   6371  H  H    . THR B  2 6   ? 94.803  126.761 96.004  1.00 45.29  ? 6   THR F H    1 
ATOM   6372  H  HA   . THR B  2 6   ? 95.925  126.514 93.555  1.00 45.29  ? 6   THR F HA   1 
ATOM   6373  H  HB   . THR B  2 6   ? 97.573  128.007 94.271  1.00 45.29  ? 6   THR F HB   1 
ATOM   6374  H  HG1  . THR B  2 6   ? 97.298  128.955 96.237  1.00 45.29  ? 6   THR F HG1  1 
ATOM   6375  H  HG21 . THR B  2 6   ? 96.302  129.939 94.279  1.00 45.29  ? 6   THR F HG21 1 
ATOM   6376  H  HG22 . THR B  2 6   ? 95.753  128.939 93.190  1.00 45.29  ? 6   THR F HG22 1 
ATOM   6377  H  HG23 . THR B  2 6   ? 95.008  129.086 94.576  1.00 45.29  ? 6   THR F HG23 1 
ATOM   6378  N  N    . ALA B  2 7   ? 96.708  124.853 96.073  1.00 51.28  ? 7   ALA F N    1 
ATOM   6379  C  CA   . ALA B  2 7   ? 97.564  123.762 96.514  1.00 51.28  ? 7   ALA F CA   1 
ATOM   6380  C  C    . ALA B  2 7   ? 97.607  122.637 95.493  1.00 51.28  ? 7   ALA F C    1 
ATOM   6381  O  O    . ALA B  2 7   ? 98.488  121.774 95.569  1.00 51.28  ? 7   ALA F O    1 
ATOM   6382  C  CB   . ALA B  2 7   ? 97.087  123.232 97.862  1.00 51.28  ? 7   ALA F CB   1 
ATOM   6383  H  H    . ALA B  2 7   ? 96.020  124.992 96.567  1.00 51.28  ? 7   ALA F H    1 
ATOM   6384  H  HA   . ALA B  2 7   ? 98.465  124.097 96.630  1.00 51.28  ? 7   ALA F HA   1 
ATOM   6385  H  HB1  . ALA B  2 7   ? 97.665  122.504 98.133  1.00 51.28  ? 7   ALA F HB1  1 
ATOM   6386  H  HB2  . ALA B  2 7   ? 97.130  123.952 98.511  1.00 51.28  ? 7   ALA F HB2  1 
ATOM   6387  H  HB3  . ALA B  2 7   ? 96.174  122.920 97.769  1.00 51.28  ? 7   ALA F HB3  1 
ATOM   6388  N  N    . THR B  2 8   ? 96.674  122.627 94.547  1.00 53.60  ? 8   THR F N    1 
ATOM   6389  C  CA   . THR B  2 8   ? 96.655  121.679 93.445  1.00 53.60  ? 8   THR F CA   1 
ATOM   6390  C  C    . THR B  2 8   ? 97.018  122.402 92.157  1.00 53.60  ? 8   THR F C    1 
ATOM   6391  O  O    . THR B  2 8   ? 96.408  123.422 91.821  1.00 53.60  ? 8   THR F O    1 
ATOM   6392  C  CB   . THR B  2 8   ? 95.277  121.030 93.306  1.00 53.60  ? 8   THR F CB   1 
ATOM   6393  O  OG1  . THR B  2 8   ? 94.880  120.465 94.561  1.00 53.60  ? 8   THR F OG1  1 
ATOM   6394  C  CG2  . THR B  2 8   ? 95.295  119.944 92.236  1.00 53.60  ? 8   THR F CG2  1 
ATOM   6395  H  H    . THR B  2 8   ? 96.020  123.180 94.523  1.00 53.60  ? 8   THR F H    1 
ATOM   6396  H  HA   . THR B  2 8   ? 97.312  120.986 93.604  1.00 53.60  ? 8   THR F HA   1 
ATOM   6397  H  HB   . THR B  2 8   ? 94.636  121.706 93.043  1.00 53.60  ? 8   THR F HB   1 
ATOM   6398  H  HG1  . THR B  2 8   ? 94.078  120.218 94.522  1.00 53.60  ? 8   THR F HG1  1 
ATOM   6399  H  HG21 . THR B  2 8   ? 94.441  119.487 92.211  1.00 53.60  ? 8   THR F HG21 1 
ATOM   6400  H  HG22 . THR B  2 8   ? 95.463  120.336 91.365  1.00 53.60  ? 8   THR F HG22 1 
ATOM   6401  H  HG23 . THR B  2 8   ? 95.992  119.300 92.430  1.00 53.60  ? 8   THR F HG23 1 
ATOM   6402  N  N    . SER B  2 9   ? 98.008  121.873 91.443  1.00 43.53  ? 9   SER F N    1 
ATOM   6403  C  CA   . SER B  2 9   ? 98.404  122.390 90.149  1.00 43.53  ? 9   SER F CA   1 
ATOM   6404  C  C    . SER B  2 9   ? 98.149  121.334 89.083  1.00 43.53  ? 9   SER F C    1 
ATOM   6405  O  O    . SER B  2 9   ? 98.615  120.195 89.229  1.00 43.53  ? 9   SER F O    1 
ATOM   6406  C  CB   . SER B  2 9   ? 99.882  122.785 90.145  1.00 43.53  ? 9   SER F CB   1 
ATOM   6407  O  OG   . SER B  2 9   ? 100.332 123.039 88.827  1.00 43.53  ? 9   SER F OG   1 
ATOM   6408  H  H    . SER B  2 9   ? 98.480  121.205 91.702  1.00 43.53  ? 9   SER F H    1 
ATOM   6409  H  HA   . SER B  2 9   ? 97.888  123.182 89.955  1.00 43.53  ? 9   SER F HA   1 
ATOM   6410  H  HB2  . SER B  2 9   ? 99.992  123.590 90.673  1.00 43.53  ? 9   SER F HB2  1 
ATOM   6411  H  HB3  . SER B  2 9   ? 100.402 122.063 90.526  1.00 43.53  ? 9   SER F HB3  1 
ATOM   6412  H  HG   . SER B  2 9   ? 101.139 123.262 88.842  1.00 43.53  ? 9   SER F HG   1 
ATOM   6413  N  N    . PRO B  2 10  ? 97.425  121.654 87.998  1.00 48.38  ? 10  PRO F N    1 
ATOM   6414  C  CA   . PRO B  2 10  ? 96.836  122.950 87.642  1.00 48.38  ? 10  PRO F CA   1 
ATOM   6415  C  C    . PRO B  2 10  ? 95.745  123.403 88.603  1.00 48.38  ? 10  PRO F C    1 
ATOM   6416  O  O    . PRO B  2 10  ? 95.225  122.588 89.363  1.00 48.38  ? 10  PRO F O    1 
ATOM   6417  C  CB   . PRO B  2 10  ? 96.249  122.698 86.250  1.00 48.38  ? 10  PRO F CB   1 
ATOM   6418  C  CG   . PRO B  2 10  ? 96.974  121.521 85.732  1.00 48.38  ? 10  PRO F CG   1 
ATOM   6419  C  CD   . PRO B  2 10  ? 97.242  120.670 86.920  1.00 48.38  ? 10  PRO F CD   1 
ATOM   6420  H  HA   . PRO B  2 10  ? 97.522  123.630 87.588  1.00 48.38  ? 10  PRO F HA   1 
ATOM   6421  H  HB2  . PRO B  2 10  ? 95.303  122.507 86.330  1.00 48.38  ? 10  PRO F HB2  1 
ATOM   6422  H  HB3  . PRO B  2 10  ? 96.396  123.472 85.686  1.00 48.38  ? 10  PRO F HB3  1 
ATOM   6423  H  HG2  . PRO B  2 10  ? 96.419  121.051 85.091  1.00 48.38  ? 10  PRO F HG2  1 
ATOM   6424  H  HG3  . PRO B  2 10  ? 97.804  121.804 85.322  1.00 48.38  ? 10  PRO F HG3  1 
ATOM   6425  H  HD2  . PRO B  2 10  ? 96.479  120.102 87.106  1.00 48.38  ? 10  PRO F HD2  1 
ATOM   6426  H  HD3  . PRO B  2 10  ? 98.052  120.156 86.794  1.00 48.38  ? 10  PRO F HD3  1 
ATOM   6427  N  N    . ILE B  2 11  ? 95.423  124.698 88.572  1.00 46.29  ? 11  ILE F N    1 
ATOM   6428  C  CA   . ILE B  2 11  ? 94.401  125.235 89.460  1.00 46.29  ? 11  ILE F CA   1 
ATOM   6429  C  C    . ILE B  2 11  ? 93.151  124.385 89.353  1.00 46.29  ? 11  ILE F C    1 
ATOM   6430  O  O    . ILE B  2 11  ? 92.637  124.136 88.257  1.00 46.29  ? 11  ILE F O    1 
ATOM   6431  C  CB   . ILE B  2 11  ? 94.120  126.709 89.122  1.00 46.29  ? 11  ILE F CB   1 
ATOM   6432  C  CG1  . ILE B  2 11  ? 95.336  127.560 89.482  1.00 46.29  ? 11  ILE F CG1  1 
ATOM   6433  C  CG2  . ILE B  2 11  ? 92.890  127.206 89.876  1.00 46.29  ? 11  ILE F CG2  1 
ATOM   6434  C  CD1  . ILE B  2 11  ? 95.167  129.024 89.211  1.00 46.29  ? 11  ILE F CD1  1 
ATOM   6435  H  H    . ILE B  2 11  ? 95.782  125.280 88.052  1.00 46.29  ? 11  ILE F H    1 
ATOM   6436  H  HA   . ILE B  2 11  ? 94.717  125.191 90.374  1.00 46.29  ? 11  ILE F HA   1 
ATOM   6437  H  HB   . ILE B  2 11  ? 93.957  126.782 88.170  1.00 46.29  ? 11  ILE F HB   1 
ATOM   6438  H  HG12 . ILE B  2 11  ? 95.511  127.458 90.428  1.00 46.29  ? 11  ILE F HG12 1 
ATOM   6439  H  HG13 . ILE B  2 11  ? 96.095  127.249 88.968  1.00 46.29  ? 11  ILE F HG13 1 
ATOM   6440  H  HG21 . ILE B  2 11  ? 92.729  128.136 89.657  1.00 46.29  ? 11  ILE F HG21 1 
ATOM   6441  H  HG22 . ILE B  2 11  ? 92.116  126.683 89.621  1.00 46.29  ? 11  ILE F HG22 1 
ATOM   6442  H  HG23 . ILE B  2 11  ? 93.054  127.116 90.826  1.00 46.29  ? 11  ILE F HG23 1 
ATOM   6443  H  HD11 . ILE B  2 11  ? 96.013  129.468 89.359  1.00 46.29  ? 11  ILE F HD11 1 
ATOM   6444  H  HD12 . ILE B  2 11  ? 94.883  129.145 88.292  1.00 46.29  ? 11  ILE F HD12 1 
ATOM   6445  H  HD13 . ILE B  2 11  ? 94.500  129.382 89.815  1.00 46.29  ? 11  ILE F HD13 1 
ATOM   6446  N  N    . SER B  2 12  ? 92.654  123.943 90.498  1.00 58.17  ? 12  SER F N    1 
ATOM   6447  C  CA   . SER B  2 12  ? 91.557  122.997 90.584  1.00 58.17  ? 12  SER F CA   1 
ATOM   6448  C  C    . SER B  2 12  ? 90.282  123.693 91.037  1.00 58.17  ? 12  SER F C    1 
ATOM   6449  O  O    . SER B  2 12  ? 90.271  124.875 91.390  1.00 58.17  ? 12  SER F O    1 
ATOM   6450  C  CB   . SER B  2 12  ? 91.907  121.868 91.554  1.00 58.17  ? 12  SER F CB   1 
ATOM   6451  O  OG   . SER B  2 12  ? 92.149  122.388 92.848  1.00 58.17  ? 12  SER F OG   1 
ATOM   6452  H  H    . SER B  2 12  ? 92.953  124.184 91.266  1.00 58.17  ? 12  SER F H    1 
ATOM   6453  H  HA   . SER B  2 12  ? 91.397  122.608 89.711  1.00 58.17  ? 12  SER F HA   1 
ATOM   6454  H  HB2  . SER B  2 12  ? 91.167  121.243 91.595  1.00 58.17  ? 12  SER F HB2  1 
ATOM   6455  H  HB3  . SER B  2 12  ? 92.706  121.421 91.241  1.00 58.17  ? 12  SER F HB3  1 
ATOM   6456  H  HG   . SER B  2 12  ? 92.575  121.832 93.307  1.00 58.17  ? 12  SER F HG   1 
ATOM   6457  N  N    . ALA B  2 13  ? 89.195  122.924 91.022  1.00 72.47  ? 13  ALA F N    1 
ATOM   6458  C  CA   . ALA B  2 13  ? 87.914  123.368 91.550  1.00 72.47  ? 13  ALA F CA   1 
ATOM   6459  C  C    . ALA B  2 13  ? 87.492  122.452 92.686  1.00 72.47  ? 13  ALA F C    1 
ATOM   6460  O  O    . ALA B  2 13  ? 86.349  121.989 92.726  1.00 72.47  ? 13  ALA F O    1 
ATOM   6461  C  CB   . ALA B  2 13  ? 86.852  123.383 90.455  1.00 72.47  ? 13  ALA F CB   1 
ATOM   6462  H  H    . ALA B  2 13  ? 89.175  122.130 90.697  1.00 72.47  ? 13  ALA F H    1 
ATOM   6463  H  HA   . ALA B  2 13  ? 87.998  124.265 91.902  1.00 72.47  ? 13  ALA F HA   1 
ATOM   6464  H  HB1  . ALA B  2 13  ? 86.013  123.683 90.837  1.00 72.47  ? 13  ALA F HB1  1 
ATOM   6465  H  HB2  . ALA B  2 13  ? 87.135  123.987 89.752  1.00 72.47  ? 13  ALA F HB2  1 
ATOM   6466  H  HB3  . ALA B  2 13  ? 86.757  122.484 90.107  1.00 72.47  ? 13  ALA F HB3  1 
ATOM   6467  N  N    . VAL B  2 14  ? 88.419  122.173 93.605  1.00 75.85  ? 14  VAL F N    1 
ATOM   6468  C  CA   . VAL B  2 14  ? 88.158  121.189 94.643  1.00 75.85  ? 14  VAL F CA   1 
ATOM   6469  C  C    . VAL B  2 14  ? 86.884  121.558 95.391  1.00 75.85  ? 14  VAL F C    1 
ATOM   6470  O  O    . VAL B  2 14  ? 86.504  122.732 95.485  1.00 75.85  ? 14  VAL F O    1 
ATOM   6471  C  CB   . VAL B  2 14  ? 89.348  121.074 95.611  1.00 75.85  ? 14  VAL F CB   1 
ATOM   6472  C  CG1  . VAL B  2 14  ? 89.456  122.305 96.491  1.00 75.85  ? 14  VAL F CG1  1 
ATOM   6473  C  CG2  . VAL B  2 14  ? 89.219  119.836 96.464  1.00 75.85  ? 14  VAL F CG2  1 
ATOM   6474  H  H    . VAL B  2 14  ? 89.194  122.541 93.648  1.00 75.85  ? 14  VAL F H    1 
ATOM   6475  H  HA   . VAL B  2 14  ? 88.027  120.324 94.228  1.00 75.85  ? 14  VAL F HA   1 
ATOM   6476  H  HB   . VAL B  2 14  ? 90.165  120.996 95.099  1.00 75.85  ? 14  VAL F HB   1 
ATOM   6477  H  HG11 . VAL B  2 14  ? 90.247  122.219 97.044  1.00 75.85  ? 14  VAL F HG11 1 
ATOM   6478  H  HG12 . VAL B  2 14  ? 89.526  123.089 95.927  1.00 75.85  ? 14  VAL F HG12 1 
ATOM   6479  H  HG13 . VAL B  2 14  ? 88.673  122.369 97.057  1.00 75.85  ? 14  VAL F HG13 1 
ATOM   6480  H  HG21 . VAL B  2 14  ? 90.040  119.720 96.966  1.00 75.85  ? 14  VAL F HG21 1 
ATOM   6481  H  HG22 . VAL B  2 14  ? 88.472  119.953 97.071  1.00 75.85  ? 14  VAL F HG22 1 
ATOM   6482  H  HG23 . VAL B  2 14  ? 89.068  119.070 95.889  1.00 75.85  ? 14  VAL F HG23 1 
ATOM   6483  N  N    . THR B  2 15  ? 86.218  120.542 95.925  1.00 88.79  ? 15  THR F N    1 
ATOM   6484  C  CA   . THR B  2 15  ? 84.985  120.717 96.678  1.00 88.79  ? 15  THR F CA   1 
ATOM   6485  C  C    . THR B  2 15  ? 85.322  120.711 98.166  1.00 88.79  ? 15  THR F C    1 
ATOM   6486  O  O    . THR B  2 15  ? 85.922  119.756 98.670  1.00 88.79  ? 15  THR F O    1 
ATOM   6487  C  CB   . THR B  2 15  ? 83.970  119.631 96.308  1.00 88.79  ? 15  THR F CB   1 
ATOM   6488  O  OG1  . THR B  2 15  ? 82.720  119.885 96.962  1.00 88.79  ? 15  THR F OG1  1 
ATOM   6489  C  CG2  . THR B  2 15  ? 84.474  118.238 96.656  1.00 88.79  ? 15  THR F CG2  1 
ATOM   6490  H  H    . THR B  2 15  ? 86.470  119.723 95.869  1.00 88.79  ? 15  THR F H    1 
ATOM   6491  H  HA   . THR B  2 15  ? 84.599  121.578 96.455  1.00 88.79  ? 15  THR F HA   1 
ATOM   6492  H  HB   . THR B  2 15  ? 83.836  119.656 95.348  1.00 88.79  ? 15  THR F HB   1 
ATOM   6493  H  HG1  . THR B  2 15  ? 82.201  119.236 96.836  1.00 88.79  ? 15  THR F HG1  1 
ATOM   6494  H  HG21 . THR B  2 15  ? 83.784  117.589 96.440  1.00 88.79  ? 15  THR F HG21 1 
ATOM   6495  H  HG22 . THR B  2 15  ? 85.279  118.018 96.154  1.00 88.79  ? 15  THR F HG22 1 
ATOM   6496  H  HG23 . THR B  2 15  ? 84.659  118.187 97.600  1.00 88.79  ? 15  THR F HG23 1 
ATOM   6497  N  N    . CYS B  2 16  ? 84.949  121.786 98.853  1.00 99.49  ? 16  CYS F N    1 
ATOM   6498  C  CA   . CYS B  2 16  ? 85.465  122.050 100.185 1.00 99.49  ? 16  CYS F CA   1 
ATOM   6499  C  C    . CYS B  2 16  ? 84.852  121.091 101.206 1.00 99.49  ? 16  CYS F C    1 
ATOM   6500  O  O    . CYS B  2 16  ? 83.715  120.640 101.044 1.00 99.49  ? 16  CYS F O    1 
ATOM   6501  C  CB   . CYS B  2 16  ? 85.165  123.492 100.584 1.00 99.49  ? 16  CYS F CB   1 
ATOM   6502  S  SG   . CYS B  2 16  ? 85.816  124.039 102.189 1.00 99.49  ? 16  CYS F SG   1 
ATOM   6503  H  H    . CYS B  2 16  ? 84.393  122.377 98.568  1.00 99.49  ? 16  CYS F H    1 
ATOM   6504  H  HA   . CYS B  2 16  ? 86.425  121.928 100.172 1.00 99.49  ? 16  CYS F HA   1 
ATOM   6505  H  HB2  . CYS B  2 16  ? 85.521  124.082 99.903  1.00 99.49  ? 16  CYS F HB2  1 
ATOM   6506  H  HB3  . CYS B  2 16  ? 84.204  123.583 100.625 1.00 99.49  ? 16  CYS F HB3  1 
ATOM   6507  N  N    . PRO B  2 17  ? 85.587  120.760 102.265 1.00 106.84 ? 17  PRO F N    1 
ATOM   6508  C  CA   . PRO B  2 17  ? 85.013  119.948 103.341 1.00 106.84 ? 17  PRO F CA   1 
ATOM   6509  C  C    . PRO B  2 17  ? 83.996  120.736 104.144 1.00 106.84 ? 17  PRO F C    1 
ATOM   6510  O  O    . PRO B  2 17  ? 83.849  121.952 103.954 1.00 106.84 ? 17  PRO F O    1 
ATOM   6511  C  CB   . PRO B  2 17  ? 86.235  119.581 104.198 1.00 106.84 ? 17  PRO F CB   1 
ATOM   6512  C  CG   . PRO B  2 17  ? 87.224  120.651 103.903 1.00 106.84 ? 17  PRO F CG   1 
ATOM   6513  C  CD   . PRO B  2 17  ? 87.033  120.954 102.456 1.00 106.84 ? 17  PRO F CD   1 
ATOM   6514  H  HA   . PRO B  2 17  ? 84.606  119.144 102.980 1.00 106.84 ? 17  PRO F HA   1 
ATOM   6515  H  HB2  . PRO B  2 17  ? 85.991  119.584 105.135 1.00 106.84 ? 17  PRO F HB2  1 
ATOM   6516  H  HB3  . PRO B  2 17  ? 86.576  118.714 103.928 1.00 106.84 ? 17  PRO F HB3  1 
ATOM   6517  H  HG2  . PRO B  2 17  ? 87.022  121.430 104.443 1.00 106.84 ? 17  PRO F HG2  1 
ATOM   6518  H  HG3  . PRO B  2 17  ? 88.121  120.331 104.079 1.00 106.84 ? 17  PRO F HG3  1 
ATOM   6519  H  HD2  . PRO B  2 17  ? 87.297  121.865 102.263 1.00 106.84 ? 17  PRO F HD2  1 
ATOM   6520  H  HD3  . PRO B  2 17  ? 87.530  120.324 101.912 1.00 106.84 ? 17  PRO F HD3  1 
ATOM   6521  N  N    . PRO B  2 18  ? 83.272  120.081 105.048 1.00 109.43 ? 18  PRO F N    1 
ATOM   6522  C  CA   . PRO B  2 18  ? 82.289  120.797 105.869 1.00 109.43 ? 18  PRO F CA   1 
ATOM   6523  C  C    . PRO B  2 18  ? 82.957  121.689 106.903 1.00 109.43 ? 18  PRO F C    1 
ATOM   6524  O  O    . PRO B  2 18  ? 84.136  121.537 107.233 1.00 109.43 ? 18  PRO F O    1 
ATOM   6525  C  CB   . PRO B  2 18  ? 81.494  119.674 106.548 1.00 109.43 ? 18  PRO F CB   1 
ATOM   6526  C  CG   . PRO B  2 18  ? 81.932  118.399 105.884 1.00 109.43 ? 18  PRO F CG   1 
ATOM   6527  C  CD   . PRO B  2 18  ? 83.299  118.645 105.360 1.00 109.43 ? 18  PRO F CD   1 
ATOM   6528  H  HA   . PRO B  2 18  ? 81.700  121.327 105.314 1.00 109.43 ? 18  PRO F HA   1 
ATOM   6529  H  HB2  . PRO B  2 18  ? 81.710  119.657 107.494 1.00 109.43 ? 18  PRO F HB2  1 
ATOM   6530  H  HB3  . PRO B  2 18  ? 80.548  119.825 106.415 1.00 109.43 ? 18  PRO F HB3  1 
ATOM   6531  H  HG2  . PRO B  2 18  ? 81.941  117.682 106.537 1.00 109.43 ? 18  PRO F HG2  1 
ATOM   6532  H  HG3  . PRO B  2 18  ? 81.321  118.193 105.160 1.00 109.43 ? 18  PRO F HG3  1 
ATOM   6533  H  HD2  . PRO B  2 18  ? 83.965  118.455 106.040 1.00 109.43 ? 18  PRO F HD2  1 
ATOM   6534  H  HD3  . PRO B  2 18  ? 83.448  118.123 104.558 1.00 109.43 ? 18  PRO F HD3  1 
ATOM   6535  N  N    . GLY B  2 19  ? 82.170  122.628 107.416 1.00 107.57 ? 19  GLY F N    1 
ATOM   6536  C  CA   . GLY B  2 19  ? 82.656  123.581 108.391 1.00 107.57 ? 19  GLY F CA   1 
ATOM   6537  C  C    . GLY B  2 19  ? 83.341  124.786 107.806 1.00 107.57 ? 19  GLY F C    1 
ATOM   6538  O  O    . GLY B  2 19  ? 83.745  125.682 108.568 1.00 107.57 ? 19  GLY F O    1 
ATOM   6539  H  H    . GLY B  2 19  ? 81.346  122.740 107.206 1.00 107.57 ? 19  GLY F H    1 
ATOM   6540  H  HA2  . GLY B  2 19  ? 81.917  123.891 108.935 1.00 107.57 ? 19  GLY F HA2  1 
ATOM   6541  H  HA3  . GLY B  2 19  ? 83.306  123.131 108.961 1.00 107.57 ? 19  GLY F HA3  1 
ATOM   6542  N  N    . GLU B  2 20  ? 83.494  124.842 106.486 1.00 98.55  ? 20  GLU F N    1 
ATOM   6543  C  CA   . GLU B  2 20  ? 84.263  125.879 105.807 1.00 98.55  ? 20  GLU F CA   1 
ATOM   6544  C  C    . GLU B  2 20  ? 83.486  126.246 104.547 1.00 98.55  ? 20  GLU F C    1 
ATOM   6545  O  O    . GLU B  2 20  ? 83.618  125.598 103.510 1.00 98.55  ? 20  GLU F O    1 
ATOM   6546  C  CB   . GLU B  2 20  ? 85.667  125.393 105.483 1.00 98.55  ? 20  GLU F CB   1 
ATOM   6547  C  CG   . GLU B  2 20  ? 86.533  125.233 106.718 1.00 98.55  ? 20  GLU F CG   1 
ATOM   6548  C  CD   . GLU B  2 20  ? 87.741  124.331 106.493 1.00 98.55  ? 20  GLU F CD   1 
ATOM   6549  O  OE1  . GLU B  2 20  ? 87.678  123.371 105.690 1.00 98.55  ? 20  GLU F OE1  1 
ATOM   6550  O  OE2  . GLU B  2 20  ? 88.768  124.595 107.140 1.00 98.55  ? 20  GLU F OE2  1 
ATOM   6551  H  H    . GLU B  2 20  ? 83.147  124.301 105.939 1.00 98.55  ? 20  GLU F H    1 
ATOM   6552  H  HA   . GLU B  2 20  ? 84.312  126.654 106.368 1.00 98.55  ? 20  GLU F HA   1 
ATOM   6553  H  HB2  . GLU B  2 20  ? 85.610  124.525 105.038 1.00 98.55  ? 20  GLU F HB2  1 
ATOM   6554  H  HB3  . GLU B  2 20  ? 86.090  126.026 104.900 1.00 98.55  ? 20  GLU F HB3  1 
ATOM   6555  H  HG2  . GLU B  2 20  ? 86.866  126.099 107.011 1.00 98.55  ? 20  GLU F HG2  1 
ATOM   6556  H  HG3  . GLU B  2 20  ? 85.993  124.858 107.449 1.00 98.55  ? 20  GLU F HG3  1 
ATOM   6557  N  N    . ASN B  2 21  ? 82.670  127.299 104.641 1.00 100.02 ? 21  ASN F N    1 
ATOM   6558  C  CA   . ASN B  2 21  ? 81.766  127.688 103.571 1.00 100.02 ? 21  ASN F CA   1 
ATOM   6559  C  C    . ASN B  2 21  ? 82.095  129.073 103.038 1.00 100.02 ? 21  ASN F C    1 
ATOM   6560  O  O    . ASN B  2 21  ? 81.217  129.765 102.518 1.00 100.02 ? 21  ASN F O    1 
ATOM   6561  C  CB   . ASN B  2 21  ? 80.320  127.625 104.046 1.00 100.02 ? 21  ASN F CB   1 
ATOM   6562  C  CG   . ASN B  2 21  ? 79.837  126.205 104.252 1.00 100.02 ? 21  ASN F CG   1 
ATOM   6563  O  OD1  . ASN B  2 21  ? 80.448  125.252 103.774 1.00 100.02 ? 21  ASN F OD1  1 
ATOM   6564  N  ND2  . ASN B  2 21  ? 78.736  126.055 104.974 1.00 100.02 ? 21  ASN F ND2  1 
ATOM   6565  H  H    . ASN B  2 21  ? 82.629  127.819 105.322 1.00 100.02 ? 21  ASN F H    1 
ATOM   6566  H  HA   . ASN B  2 21  ? 81.865  127.069 102.834 1.00 100.02 ? 21  ASN F HA   1 
ATOM   6567  H  HB2  . ASN B  2 21  ? 80.245  128.092 104.894 1.00 100.02 ? 21  ASN F HB2  1 
ATOM   6568  H  HB3  . ASN B  2 21  ? 79.745  128.046 103.382 1.00 100.02 ? 21  ASN F HB3  1 
ATOM   6569  H  HD21 . ASN B  2 21  ? 78.426  125.266 105.122 1.00 100.02 ? 21  ASN F HD21 1 
ATOM   6570  H  HD22 . ASN B  2 21  ? 78.339  126.744 105.293 1.00 100.02 ? 21  ASN F HD22 1 
ATOM   6571  N  N    . LEU B  2 22  ? 83.355  129.481 103.154 1.00 96.11  ? 22  LEU F N    1 
ATOM   6572  C  CA   . LEU B  2 22  ? 83.826  130.750 102.616 1.00 96.11  ? 22  LEU F CA   1 
ATOM   6573  C  C    . LEU B  2 22  ? 85.037  130.478 101.737 1.00 96.11  ? 22  LEU F C    1 
ATOM   6574  O  O    . LEU B  2 22  ? 86.116  130.140 102.241 1.00 96.11  ? 22  LEU F O    1 
ATOM   6575  C  CB   . LEU B  2 22  ? 84.171  131.731 103.731 1.00 96.11  ? 22  LEU F CB   1 
ATOM   6576  C  CG   . LEU B  2 22  ? 82.981  132.225 104.552 1.00 96.11  ? 22  LEU F CG   1 
ATOM   6577  C  CD1  . LEU B  2 22  ? 83.472  133.093 105.673 1.00 96.11  ? 22  LEU F CD1  1 
ATOM   6578  C  CD2  . LEU B  2 22  ? 81.998  132.989 103.694 1.00 96.11  ? 22  LEU F CD2  1 
ATOM   6579  H  H    . LEU B  2 22  ? 83.969  129.028 103.552 1.00 96.11  ? 22  LEU F H    1 
ATOM   6580  H  HA   . LEU B  2 22  ? 83.142  131.144 102.057 1.00 96.11  ? 22  LEU F HA   1 
ATOM   6581  H  HB2  . LEU B  2 22  ? 84.781  131.293 104.344 1.00 96.11  ? 22  LEU F HB2  1 
ATOM   6582  H  HB3  . LEU B  2 22  ? 84.601  132.507 103.342 1.00 96.11  ? 22  LEU F HB3  1 
ATOM   6583  H  HG   . LEU B  2 22  ? 82.522  131.464 104.936 1.00 96.11  ? 22  LEU F HG   1 
ATOM   6584  H  HD11 . LEU B  2 22  ? 82.804  133.120 106.376 1.00 96.11  ? 22  LEU F HD11 1 
ATOM   6585  H  HD12 . LEU B  2 22  ? 84.294  132.709 106.005 1.00 96.11  ? 22  LEU F HD12 1 
ATOM   6586  H  HD13 . LEU B  2 22  ? 83.642  133.983 105.333 1.00 96.11  ? 22  LEU F HD13 1 
ATOM   6587  H  HD21 . LEU B  2 22  ? 81.280  133.323 104.256 1.00 96.11  ? 22  LEU F HD21 1 
ATOM   6588  H  HD22 . LEU B  2 22  ? 82.456  133.734 103.275 1.00 96.11  ? 22  LEU F HD22 1 
ATOM   6589  H  HD23 . LEU B  2 22  ? 81.637  132.398 103.018 1.00 96.11  ? 22  LEU F HD23 1 
ATOM   6590  N  N    . CYS B  2 23  ? 84.847  130.616 100.428 1.00 83.47  ? 23  CYS F N    1 
ATOM   6591  C  CA   . CYS B  2 23  ? 85.956  130.667 99.499  1.00 83.47  ? 23  CYS F CA   1 
ATOM   6592  C  C    . CYS B  2 23  ? 86.644  132.020 99.612  1.00 83.47  ? 23  CYS F C    1 
ATOM   6593  O  O    . CYS B  2 23  ? 85.992  133.068 99.638  1.00 83.47  ? 23  CYS F O    1 
ATOM   6594  C  CB   . CYS B  2 23  ? 85.484  130.448 98.064  1.00 83.47  ? 23  CYS F CB   1 
ATOM   6595  S  SG   . CYS B  2 23  ? 84.294  129.115 97.828  1.00 83.47  ? 23  CYS F SG   1 
ATOM   6596  H  H    . CYS B  2 23  ? 84.079  130.684 100.055 1.00 83.47  ? 23  CYS F H    1 
ATOM   6597  H  HA   . CYS B  2 23  ? 86.602  129.980 99.723  1.00 83.47  ? 23  CYS F HA   1 
ATOM   6598  H  HB2  . CYS B  2 23  ? 85.068  131.263 97.752  1.00 83.47  ? 23  CYS F HB2  1 
ATOM   6599  H  HB3  . CYS B  2 23  ? 86.260  130.248 97.514  1.00 83.47  ? 23  CYS F HB3  1 
ATOM   6600  N  N    . TYR B  2 24  ? 87.971  131.997 99.677  1.00 64.19  ? 24  TYR F N    1 
ATOM   6601  C  CA   . TYR B  2 24  ? 88.753  133.205 99.836  1.00 64.19  ? 24  TYR F CA   1 
ATOM   6602  C  C    . TYR B  2 24  ? 89.940  133.170 98.898  1.00 64.19  ? 24  TYR F C    1 
ATOM   6603  O  O    . TYR B  2 24  ? 90.345  132.126 98.385  1.00 64.19  ? 24  TYR F O    1 
ATOM   6604  C  CB   . TYR B  2 24  ? 89.289  133.384 101.254 1.00 64.19  ? 24  TYR F CB   1 
ATOM   6605  C  CG   . TYR B  2 24  ? 90.558  132.603 101.490 1.00 64.19  ? 24  TYR F CG   1 
ATOM   6606  C  CD1  . TYR B  2 24  ? 90.513  131.273 101.859 1.00 64.19  ? 24  TYR F CD1  1 
ATOM   6607  C  CD2  . TYR B  2 24  ? 91.801  133.193 101.317 1.00 64.19  ? 24  TYR F CD2  1 
ATOM   6608  C  CE1  . TYR B  2 24  ? 91.668  130.554 102.064 1.00 64.19  ? 24  TYR F CE1  1 
ATOM   6609  C  CE2  . TYR B  2 24  ? 92.959  132.480 101.515 1.00 64.19  ? 24  TYR F CE2  1 
ATOM   6610  C  CZ   . TYR B  2 24  ? 92.888  131.163 101.889 1.00 64.19  ? 24  TYR F CZ   1 
ATOM   6611  O  OH   . TYR B  2 24  ? 94.043  130.448 102.090 1.00 64.19  ? 24  TYR F OH   1 
ATOM   6612  H  H    . TYR B  2 24  ? 88.444  131.281 99.629  1.00 64.19  ? 24  TYR F H    1 
ATOM   6613  H  HA   . TYR B  2 24  ? 88.213  133.976 99.609  1.00 64.19  ? 24  TYR F HA   1 
ATOM   6614  H  HB2  . TYR B  2 24  ? 89.493  134.322 101.383 1.00 64.19  ? 24  TYR F HB2  1 
ATOM   6615  H  HB3  . TYR B  2 24  ? 88.622  133.090 101.889 1.00 64.19  ? 24  TYR F HB3  1 
ATOM   6616  H  HD1  . TYR B  2 24  ? 89.688  130.864 101.976 1.00 64.19  ? 24  TYR F HD1  1 
ATOM   6617  H  HD2  . TYR B  2 24  ? 91.848  134.084 101.060 1.00 64.19  ? 24  TYR F HD2  1 
ATOM   6618  H  HE1  . TYR B  2 24  ? 91.624  129.662 102.315 1.00 64.19  ? 24  TYR F HE1  1 
ATOM   6619  H  HE2  . TYR B  2 24  ? 93.785  132.888 101.398 1.00 64.19  ? 24  TYR F HE2  1 
ATOM   6620  H  HH   . TYR B  2 24  ? 94.706  130.932 101.913 1.00 64.19  ? 24  TYR F HH   1 
ATOM   6621  N  N    . ARG B  2 25  ? 90.516  134.353 98.727  1.00 52.11  ? 25  ARG F N    1 
ATOM   6622  C  CA   . ARG B  2 25  ? 91.732  134.556 97.964  1.00 52.11  ? 25  ARG F CA   1 
ATOM   6623  C  C    . ARG B  2 25  ? 92.534  135.699 98.574  1.00 52.11  ? 25  ARG F C    1 
ATOM   6624  O  O    . ARG B  2 25  ? 91.961  136.681 99.034  1.00 52.11  ? 25  ARG F O    1 
ATOM   6625  C  CB   . ARG B  2 25  ? 91.382  134.849 96.530  1.00 52.11  ? 25  ARG F CB   1 
ATOM   6626  C  CG   . ARG B  2 25  ? 90.752  136.181 96.402  1.00 52.11  ? 25  ARG F CG   1 
ATOM   6627  C  CD   . ARG B  2 25  ? 90.366  136.422 94.999  1.00 52.11  ? 25  ARG F CD   1 
ATOM   6628  N  NE   . ARG B  2 25  ? 91.498  136.646 94.131  1.00 52.11  ? 25  ARG F NE   1 
ATOM   6629  C  CZ   . ARG B  2 25  ? 91.391  137.151 92.909  1.00 52.11  ? 25  ARG F CZ   1 
ATOM   6630  N  NH1  . ARG B  2 25  ? 90.188  137.389 92.402  1.00 52.11  ? 25  ARG F NH1  1 
ATOM   6631  N  NH2  . ARG B  2 25  ? 92.483  137.324 92.181  1.00 52.11  ? 25  ARG F NH2  1 
ATOM   6632  H  H    . ARG B  2 25  ? 90.193  135.084 99.042  1.00 52.11  ? 25  ARG F H    1 
ATOM   6633  H  HA   . ARG B  2 25  ? 92.254  133.746 97.998  1.00 52.11  ? 25  ARG F HA   1 
ATOM   6634  H  HB2  . ARG B  2 25  ? 92.199  134.858 96.002  1.00 52.11  ? 25  ARG F HB2  1 
ATOM   6635  H  HB3  . ARG B  2 25  ? 90.770  134.185 96.208  1.00 52.11  ? 25  ARG F HB3  1 
ATOM   6636  H  HG2  . ARG B  2 25  ? 89.952  136.188 96.949  1.00 52.11  ? 25  ARG F HG2  1 
ATOM   6637  H  HG3  . ARG B  2 25  ? 91.379  136.877 96.674  1.00 52.11  ? 25  ARG F HG3  1 
ATOM   6638  H  HD2  . ARG B  2 25  ? 89.902  135.622 94.681  1.00 52.11  ? 25  ARG F HD2  1 
ATOM   6639  H  HD3  . ARG B  2 25  ? 89.791  137.182 94.946  1.00 52.11  ? 25  ARG F HD3  1 
ATOM   6640  H  HE   . ARG B  2 25  ? 92.244  136.824 94.542  1.00 52.11  ? 25  ARG F HE   1 
ATOM   6641  H  HH11 . ARG B  2 25  ? 89.472  137.228 92.889  1.00 52.11  ? 25  ARG F HH11 1 
ATOM   6642  H  HH12 . ARG B  2 25  ? 90.132  137.672 91.584  1.00 52.11  ? 25  ARG F HH12 1 
ATOM   6643  H  HH21 . ARG B  2 25  ? 93.275  137.154 92.524  1.00 52.11  ? 25  ARG F HH21 1 
ATOM   6644  H  HH22 . ARG B  2 25  ? 92.429  137.631 91.382  1.00 52.11  ? 25  ARG F HH22 1 
ATOM   6645  N  N    . LYS B  2 26  ? 93.843  135.547 98.549  1.00 47.57  ? 26  LYS F N    1 
ATOM   6646  C  CA   . LYS B  2 26  ? 94.758  136.465 99.170  1.00 47.57  ? 26  LYS F CA   1 
ATOM   6647  C  C    . LYS B  2 26  ? 95.844  136.827 98.179  1.00 47.57  ? 26  LYS F C    1 
ATOM   6648  O  O    . LYS B  2 26  ? 96.398  135.947 97.515  1.00 47.57  ? 26  LYS F O    1 
ATOM   6649  C  CB   . LYS B  2 26  ? 95.363  135.845 100.423 1.00 47.57  ? 26  LYS F CB   1 
ATOM   6650  C  CG   . LYS B  2 26  ? 96.005  136.821 101.345 1.00 47.57  ? 26  LYS F CG   1 
ATOM   6651  C  CD   . LYS B  2 26  ? 96.128  136.211 102.710 1.00 47.57  ? 26  LYS F CD   1 
ATOM   6652  C  CE   . LYS B  2 26  ? 97.097  135.048 102.683 1.00 47.57  ? 26  LYS F CE   1 
ATOM   6653  N  NZ   . LYS B  2 26  ? 97.450  134.564 104.038 1.00 47.57  ? 26  LYS F NZ   1 
ATOM   6654  H  H    . LYS B  2 26  ? 94.237  134.887 98.161  1.00 47.57  ? 26  LYS F H    1 
ATOM   6655  H  HA   . LYS B  2 26  ? 94.293  137.274 99.426  1.00 47.57  ? 26  LYS F HA   1 
ATOM   6656  H  HB2  . LYS B  2 26  ? 94.661  135.386 100.908 1.00 47.57  ? 26  LYS F HB2  1 
ATOM   6657  H  HB3  . LYS B  2 26  ? 96.040  135.212 100.150 1.00 47.57  ? 26  LYS F HB3  1 
ATOM   6658  H  HG2  . LYS B  2 26  ? 96.888  137.029 101.016 1.00 47.57  ? 26  LYS F HG2  1 
ATOM   6659  H  HG3  . LYS B  2 26  ? 95.460  137.621 101.403 1.00 47.57  ? 26  LYS F HG3  1 
ATOM   6660  H  HD2  . LYS B  2 26  ? 96.438  136.879 103.335 1.00 47.57  ? 26  LYS F HD2  1 
ATOM   6661  H  HD3  . LYS B  2 26  ? 95.268  135.876 102.981 1.00 47.57  ? 26  LYS F HD3  1 
ATOM   6662  H  HE2  . LYS B  2 26  ? 96.684  134.314 102.201 1.00 47.57  ? 26  LYS F HE2  1 
ATOM   6663  H  HE3  . LYS B  2 26  ? 97.911  135.322 102.234 1.00 47.57  ? 26  LYS F HE3  1 
ATOM   6664  H  HZ1  . LYS B  2 26  ? 97.960  133.836 103.978 1.00 47.57  ? 26  LYS F HZ1  1 
ATOM   6665  H  HZ2  . LYS B  2 26  ? 97.897  135.195 104.477 1.00 47.57  ? 26  LYS F HZ2  1 
ATOM   6666  H  HZ3  . LYS B  2 26  ? 96.712  134.364 104.490 1.00 47.57  ? 26  LYS F HZ3  1 
ATOM   6667  N  N    . MET B  2 27  ? 96.133  138.123 98.063  1.00 40.96  ? 27  MET F N    1 
ATOM   6668  C  CA   . MET B  2 27  ? 96.990  138.631 97.002  1.00 40.96  ? 27  MET F CA   1 
ATOM   6669  C  C    . MET B  2 27  ? 97.890  139.724 97.541  1.00 40.96  ? 27  MET F C    1 
ATOM   6670  O  O    . MET B  2 27  ? 97.421  140.624 98.243  1.00 40.96  ? 27  MET F O    1 
ATOM   6671  C  CB   . MET B  2 27  ? 96.114  139.144 95.858  1.00 40.96  ? 27  MET F CB   1 
ATOM   6672  C  CG   . MET B  2 27  ? 95.340  138.023 95.206  1.00 40.96  ? 27  MET F CG   1 
ATOM   6673  S  SD   . MET B  2 27  ? 94.302  138.460 93.800  1.00 40.96  ? 27  MET F SD   1 
ATOM   6674  C  CE   . MET B  2 27  ? 95.434  139.422 92.828  1.00 40.96  ? 27  MET F CE   1 
ATOM   6675  H  H    . MET B  2 27  ? 95.836  138.730 98.587  1.00 40.96  ? 27  MET F H    1 
ATOM   6676  H  HA   . MET B  2 27  ? 97.525  137.907 96.662  1.00 40.96  ? 27  MET F HA   1 
ATOM   6677  H  HB2  . MET B  2 27  ? 95.494  139.801 96.201  1.00 40.96  ? 27  MET F HB2  1 
ATOM   6678  H  HB3  . MET B  2 27  ? 96.689  139.543 95.194  1.00 40.96  ? 27  MET F HB3  1 
ATOM   6679  H  HG2  . MET B  2 27  ? 95.984  137.382 94.879  1.00 40.96  ? 27  MET F HG2  1 
ATOM   6680  H  HG3  . MET B  2 27  ? 94.775  137.612 95.876  1.00 40.96  ? 27  MET F HG3  1 
ATOM   6681  H  HE1  . MET B  2 27  ? 94.924  139.823 92.089  1.00 40.96  ? 27  MET F HE1  1 
ATOM   6682  H  HE2  . MET B  2 27  ? 95.819  140.095 93.408  1.00 40.96  ? 27  MET F HE2  1 
ATOM   6683  H  HE3  . MET B  2 27  ? 96.133  138.842 92.476  1.00 40.96  ? 27  MET F HE3  1 
ATOM   6684  N  N    . TRP B  2 28  ? 99.174  139.643 97.215  1.00 31.34  ? 28  TRP F N    1 
ATOM   6685  C  CA   . TRP B  2 28  ? 100.141 140.658 97.619  1.00 31.34  ? 28  TRP F CA   1 
ATOM   6686  C  C    . TRP B  2 28  ? 101.306 140.664 96.641  1.00 31.34  ? 28  TRP F C    1 
ATOM   6687  O  O    . TRP B  2 28  ? 101.491 139.728 95.862  1.00 31.34  ? 28  TRP F O    1 
ATOM   6688  C  CB   . TRP B  2 28  ? 100.640 140.422 99.045  1.00 31.34  ? 28  TRP F CB   1 
ATOM   6689  C  CG   . TRP B  2 28  ? 101.606 139.302 99.192  1.00 31.34  ? 28  TRP F CG   1 
ATOM   6690  C  CD1  . TRP B  2 28  ? 102.964 139.396 99.255  1.00 31.34  ? 28  TRP F CD1  1 
ATOM   6691  C  CD2  . TRP B  2 28  ? 101.293 137.917 99.324  1.00 31.34  ? 28  TRP F CD2  1 
ATOM   6692  N  NE1  . TRP B  2 28  ? 103.515 138.146 99.410  1.00 31.34  ? 28  TRP F NE1  1 
ATOM   6693  C  CE2  . TRP B  2 28  ? 102.508 137.223 99.454  1.00 31.34  ? 28  TRP F CE2  1 
ATOM   6694  C  CE3  . TRP B  2 28  ? 100.101 137.193 99.340  1.00 31.34  ? 28  TRP F CE3  1 
ATOM   6695  C  CZ2  . TRP B  2 28  ? 102.566 135.846 99.595  1.00 31.34  ? 28  TRP F CZ2  1 
ATOM   6696  C  CZ3  . TRP B  2 28  ? 100.160 135.829 99.480  1.00 31.34  ? 28  TRP F CZ3  1 
ATOM   6697  C  CH2  . TRP B  2 28  ? 101.385 135.169 99.606  1.00 31.34  ? 28  TRP F CH2  1 
ATOM   6698  H  H    . TRP B  2 28  ? 99.516  139.003 96.763  1.00 31.34  ? 28  TRP F H    1 
ATOM   6699  H  HA   . TRP B  2 28  ? 99.716  141.525 97.584  1.00 31.34  ? 28  TRP F HA   1 
ATOM   6700  H  HB2  . TRP B  2 28  ? 101.076 141.227 99.354  1.00 31.34  ? 28  TRP F HB2  1 
ATOM   6701  H  HB3  . TRP B  2 28  ? 99.876  140.214 99.600  1.00 31.34  ? 28  TRP F HB3  1 
ATOM   6702  H  HD1  . TRP B  2 28  ? 103.446 140.186 99.200  1.00 31.34  ? 28  TRP F HD1  1 
ATOM   6703  H  HE1  . TRP B  2 28  ? 104.355 137.970 99.469  1.00 31.34  ? 28  TRP F HE1  1 
ATOM   6704  H  HE3  . TRP B  2 28  ? 99.286  137.628 99.256  1.00 31.34  ? 28  TRP F HE3  1 
ATOM   6705  H  HZ2  . TRP B  2 28  ? 103.378 135.404 99.680  1.00 31.34  ? 28  TRP F HZ2  1 
ATOM   6706  H  HZ3  . TRP B  2 28  ? 99.374  135.339 99.493  1.00 31.34  ? 28  TRP F HZ3  1 
ATOM   6707  H  HH2  . TRP B  2 28  ? 101.395 134.246 99.701  1.00 31.34  ? 28  TRP F HH2  1 
ATOM   6708  N  N    . CYS B  2 29  ? 102.087 141.739 96.688  1.00 28.82  ? 29  CYS F N    1 
ATOM   6709  C  CA   . CYS B  2 29  ? 103.269 141.876 95.856  1.00 28.82  ? 29  CYS F CA   1 
ATOM   6710  C  C    . CYS B  2 29  ? 104.455 141.220 96.546  1.00 28.82  ? 29  CYS F C    1 
ATOM   6711  O  O    . CYS B  2 29  ? 104.746 141.518 97.709  1.00 28.82  ? 29  CYS F O    1 
ATOM   6712  C  CB   . CYS B  2 29  ? 103.597 143.350 95.589  1.00 28.82  ? 29  CYS F CB   1 
ATOM   6713  S  SG   . CYS B  2 29  ? 102.753 144.164 94.204  1.00 28.82  ? 29  CYS F SG   1 
ATOM   6714  H  H    . CYS B  2 29  ? 101.952 142.404 97.211  1.00 28.82  ? 29  CYS F H    1 
ATOM   6715  H  HA   . CYS B  2 29  ? 103.127 141.439 95.006  1.00 28.82  ? 29  CYS F HA   1 
ATOM   6716  H  HB2  . CYS B  2 29  ? 103.378 143.852 96.386  1.00 28.82  ? 29  CYS F HB2  1 
ATOM   6717  H  HB3  . CYS B  2 29  ? 104.547 143.415 95.423  1.00 28.82  ? 29  CYS F HB3  1 
ATOM   6718  N  N    . ASP B  2 30  ? 105.129 140.333 95.833  1.00 27.02  ? 30  ASP F N    1 
ATOM   6719  C  CA   . ASP B  2 30  ? 106.446 139.868 96.215  1.00 27.02  ? 30  ASP F CA   1 
ATOM   6720  C  C    . ASP B  2 30  ? 107.472 140.680 95.438  1.00 27.02  ? 30  ASP F C    1 
ATOM   6721  O  O    . ASP B  2 30  ? 107.150 141.705 94.831  1.00 27.02  ? 30  ASP F O    1 
ATOM   6722  C  CB   . ASP B  2 30  ? 106.611 138.367 95.991  1.00 27.02  ? 30  ASP F CB   1 
ATOM   6723  C  CG   . ASP B  2 30  ? 106.250 137.934 94.599  1.00 27.02  ? 30  ASP F CG   1 
ATOM   6724  O  OD1  . ASP B  2 30  ? 106.395 138.739 93.658  1.00 27.02  ? 30  ASP F OD1  1 
ATOM   6725  O  OD2  . ASP B  2 30  ? 105.788 136.785 94.461  1.00 27.02  ? 30  ASP F OD2  1 
ATOM   6726  H  H    . ASP B  2 30  ? 104.852 139.996 95.094  1.00 27.02  ? 30  ASP F H    1 
ATOM   6727  H  HA   . ASP B  2 30  ? 106.579 140.047 97.152  1.00 27.02  ? 30  ASP F HA   1 
ATOM   6728  H  HB2  . ASP B  2 30  ? 107.529 138.115 96.154  1.00 27.02  ? 30  ASP F HB2  1 
ATOM   6729  H  HB3  . ASP B  2 30  ? 106.032 137.898 96.599  1.00 27.02  ? 30  ASP F HB3  1 
ATOM   6730  N  N    . VAL B  2 31  ? 108.726 140.236 95.467  1.00 21.75  ? 31  VAL F N    1 
ATOM   6731  C  CA   . VAL B  2 31  ? 109.769 140.936 94.730  1.00 21.75  ? 31  VAL F CA   1 
ATOM   6732  C  C    . VAL B  2 31  ? 109.388 141.048 93.263  1.00 21.75  ? 31  VAL F C    1 
ATOM   6733  O  O    . VAL B  2 31  ? 109.534 142.105 92.642  1.00 21.75  ? 31  VAL F O    1 
ATOM   6734  C  CB   . VAL B  2 31  ? 111.111 140.209 94.887  1.00 21.75  ? 31  VAL F CB   1 
ATOM   6735  C  CG1  . VAL B  2 31  ? 112.141 140.885 94.063  1.00 21.75  ? 31  VAL F CG1  1 
ATOM   6736  C  CG2  . VAL B  2 31  ? 111.544 140.206 96.287  1.00 21.75  ? 31  VAL F CG2  1 
ATOM   6737  H  H    . VAL B  2 31  ? 109.000 139.557 95.911  1.00 21.75  ? 31  VAL F H    1 
ATOM   6738  H  HA   . VAL B  2 31  ? 109.871 141.828 95.085  1.00 21.75  ? 31  VAL F HA   1 
ATOM   6739  H  HB   . VAL B  2 31  ? 111.015 139.294 94.590  1.00 21.75  ? 31  VAL F HB   1 
ATOM   6740  H  HG11 . VAL B  2 31  ? 112.965 140.381 94.134  1.00 21.75  ? 31  VAL F HG11 1 
ATOM   6741  H  HG12 . VAL B  2 31  ? 111.856 140.918 93.138  1.00 21.75  ? 31  VAL F HG12 1 
ATOM   6742  H  HG13 . VAL B  2 31  ? 112.269 141.783 94.402  1.00 21.75  ? 31  VAL F HG13 1 
ATOM   6743  H  HG21 . VAL B  2 31  ? 112.366 139.699 96.369  1.00 21.75  ? 31  VAL F HG21 1 
ATOM   6744  H  HG22 . VAL B  2 31  ? 111.709 141.137 96.485  1.00 21.75  ? 31  VAL F HG22 1 
ATOM   6745  H  HG23 . VAL B  2 31  ? 110.846 139.829 96.842  1.00 21.75  ? 31  VAL F HG23 1 
ATOM   6746  N  N    . PHE B  2 32  ? 108.912 139.954 92.685  1.00 17.62  ? 32  PHE F N    1 
ATOM   6747  C  CA   . PHE B  2 32  ? 108.614 139.905 91.259  1.00 17.62  ? 32  PHE F CA   1 
ATOM   6748  C  C    . PHE B  2 32  ? 107.208 140.412 90.972  1.00 17.62  ? 32  PHE F C    1 
ATOM   6749  O  O    . PHE B  2 32  ? 106.444 139.782 90.247  1.00 17.62  ? 32  PHE F O    1 
ATOM   6750  C  CB   . PHE B  2 32  ? 108.778 138.481 90.753  1.00 17.62  ? 32  PHE F CB   1 
ATOM   6751  C  CG   . PHE B  2 32  ? 110.027 137.798 91.221  1.00 17.62  ? 32  PHE F CG   1 
ATOM   6752  C  CD1  . PHE B  2 32  ? 110.034 137.089 92.404  1.00 17.62  ? 32  PHE F CD1  1 
ATOM   6753  C  CD2  . PHE B  2 32  ? 111.183 137.832 90.468  1.00 17.62  ? 32  PHE F CD2  1 
ATOM   6754  C  CE1  . PHE B  2 32  ? 111.169 136.451 92.836  1.00 17.62  ? 32  PHE F CE1  1 
ATOM   6755  C  CE2  . PHE B  2 32  ? 112.321 137.190 90.901  1.00 17.62  ? 32  PHE F CE2  1 
ATOM   6756  C  CZ   . PHE B  2 32  ? 112.310 136.499 92.085  1.00 17.62  ? 32  PHE F CZ   1 
ATOM   6757  H  H    . PHE B  2 32  ? 108.753 139.221 93.095  1.00 17.62  ? 32  PHE F H    1 
ATOM   6758  H  HA   . PHE B  2 32  ? 109.239 140.469 90.784  1.00 17.62  ? 32  PHE F HA   1 
ATOM   6759  H  HB2  . PHE B  2 32  ? 108.030 137.965 91.075  1.00 17.62  ? 32  PHE F HB2  1 
ATOM   6760  H  HB3  . PHE B  2 32  ? 108.784 138.494 89.787  1.00 17.62  ? 32  PHE F HB3  1 
ATOM   6761  H  HD1  . PHE B  2 32  ? 109.264 137.058 92.917  1.00 17.62  ? 32  PHE F HD1  1 
ATOM   6762  H  HD2  . PHE B  2 32  ? 111.197 138.300 89.665  1.00 17.62  ? 32  PHE F HD2  1 
ATOM   6763  H  HE1  . PHE B  2 32  ? 111.163 135.984 93.637  1.00 17.62  ? 32  PHE F HE1  1 
ATOM   6764  H  HE2  . PHE B  2 32  ? 113.095 137.223 90.391  1.00 17.62  ? 32  PHE F HE2  1 
ATOM   6765  H  HZ   . PHE B  2 32  ? 113.078 136.068 92.373  1.00 17.62  ? 32  PHE F HZ   1 
ATOM   6766  N  N    . CYS B  2 33  ? 106.860 141.571 91.517  1.00 25.42  ? 33  CYS F N    1 
ATOM   6767  C  CA   . CYS B  2 33  ? 105.554 142.160 91.279  1.00 25.42  ? 33  CYS F CA   1 
ATOM   6768  C  C    . CYS B  2 33  ? 105.577 143.143 90.119  1.00 25.42  ? 33  CYS F C    1 
ATOM   6769  O  O    . CYS B  2 33  ? 104.568 143.805 89.860  1.00 25.42  ? 33  CYS F O    1 
ATOM   6770  C  CB   . CYS B  2 33  ? 105.038 142.847 92.546  1.00 25.42  ? 33  CYS F CB   1 
ATOM   6771  S  SG   . CYS B  2 33  ? 103.250 143.171 92.496  1.00 25.42  ? 33  CYS F SG   1 
ATOM   6772  H  H    . CYS B  2 33  ? 107.362 142.036 92.030  1.00 25.42  ? 33  CYS F H    1 
ATOM   6773  H  HA   . CYS B  2 33  ? 104.934 141.454 91.057  1.00 25.42  ? 33  CYS F HA   1 
ATOM   6774  H  HB2  . CYS B  2 33  ? 105.219 142.268 93.300  1.00 25.42  ? 33  CYS F HB2  1 
ATOM   6775  H  HB3  . CYS B  2 33  ? 105.498 143.693 92.653  1.00 25.42  ? 33  CYS F HB3  1 
ATOM   6776  N  N    . SER B  2 34  ? 106.705 143.248 89.420  1.00 19.69  ? 34  SER F N    1 
ATOM   6777  C  CA   . SER B  2 34  ? 106.841 144.104 88.250  1.00 19.69  ? 34  SER F CA   1 
ATOM   6778  C  C    . SER B  2 34  ? 106.498 143.351 86.973  1.00 19.69  ? 34  SER F C    1 
ATOM   6779  O  O    . SER B  2 34  ? 105.781 143.870 86.113  1.00 19.69  ? 34  SER F O    1 
ATOM   6780  C  CB   . SER B  2 34  ? 108.267 144.648 88.166  1.00 19.69  ? 34  SER F CB   1 
ATOM   6781  O  OG   . SER B  2 34  ? 108.484 145.320 86.940  1.00 19.69  ? 34  SER F OG   1 
ATOM   6782  H  H    . SER B  2 34  ? 107.420 142.815 89.603  1.00 19.69  ? 34  SER F H    1 
ATOM   6783  H  HA   . SER B  2 34  ? 106.239 144.858 88.331  1.00 19.69  ? 34  SER F HA   1 
ATOM   6784  H  HB2  . SER B  2 34  ? 108.416 145.262 88.898  1.00 19.69  ? 34  SER F HB2  1 
ATOM   6785  H  HB3  . SER B  2 34  ? 108.882 143.903 88.225  1.00 19.69  ? 34  SER F HB3  1 
ATOM   6786  H  HG   . SER B  2 34  ? 109.308 145.419 86.815  1.00 19.69  ? 34  SER F HG   1 
ATOM   6787  N  N    . SER B  2 35  ? 107.006 142.130 86.840  1.00 16.25  ? 35  SER F N    1 
ATOM   6788  C  CA   . SER B  2 35  ? 106.749 141.275 85.690  1.00 16.25  ? 35  SER F CA   1 
ATOM   6789  C  C    . SER B  2 35  ? 105.668 140.240 85.965  1.00 16.25  ? 35  SER F C    1 
ATOM   6790  O  O    . SER B  2 35  ? 104.702 140.132 85.206  1.00 16.25  ? 35  SER F O    1 
ATOM   6791  C  CB   . SER B  2 35  ? 108.042 140.570 85.275  1.00 16.25  ? 35  SER F CB   1 
ATOM   6792  O  OG   . SER B  2 35  ? 108.690 140.004 86.398  1.00 16.25  ? 35  SER F OG   1 
ATOM   6793  H  H    . SER B  2 35  ? 107.519 141.771 87.419  1.00 16.25  ? 35  SER F H    1 
ATOM   6794  H  HA   . SER B  2 35  ? 106.457 141.825 84.946  1.00 16.25  ? 35  SER F HA   1 
ATOM   6795  H  HB2  . SER B  2 35  ? 107.826 139.863 84.650  1.00 16.25  ? 35  SER F HB2  1 
ATOM   6796  H  HB3  . SER B  2 35  ? 108.633 141.214 84.863  1.00 16.25  ? 35  SER F HB3  1 
ATOM   6797  H  HG   . SER B  2 35  ? 109.378 139.591 86.153  1.00 16.25  ? 35  SER F HG   1 
ATOM   6798  N  N    . ARG B  2 36  ? 105.815 139.474 87.043  1.00 15.46  ? 36  ARG F N    1 
ATOM   6799  C  CA   . ARG B  2 36  ? 104.875 138.405 87.340  1.00 15.46  ? 36  ARG F CA   1 
ATOM   6800  C  C    . ARG B  2 36  ? 103.565 138.929 87.913  1.00 15.46  ? 36  ARG F C    1 
ATOM   6801  O  O    . ARG B  2 36  ? 102.514 138.318 87.702  1.00 15.46  ? 36  ARG F O    1 
ATOM   6802  C  CB   . ARG B  2 36  ? 105.518 137.418 88.310  1.00 15.46  ? 36  ARG F CB   1 
ATOM   6803  C  CG   . ARG B  2 36  ? 106.890 136.962 87.903  1.00 15.46  ? 36  ARG F CG   1 
ATOM   6804  C  CD   . ARG B  2 36  ? 107.439 135.949 88.867  1.00 15.46  ? 36  ARG F CD   1 
ATOM   6805  N  NE   . ARG B  2 36  ? 108.752 135.460 88.476  1.00 15.46  ? 36  ARG F NE   1 
ATOM   6806  C  CZ   . ARG B  2 36  ? 109.476 134.614 89.197  1.00 15.46  ? 36  ARG F CZ   1 
ATOM   6807  N  NH1  . ARG B  2 36  ? 109.023 134.160 90.352  1.00 15.46  ? 36  ARG F NH1  1 
ATOM   6808  N  NH2  . ARG B  2 36  ? 110.661 134.225 88.763  1.00 15.46  ? 36  ARG F NH2  1 
ATOM   6809  H  H    . ARG B  2 36  ? 106.445 139.553 87.614  1.00 15.46  ? 36  ARG F H    1 
ATOM   6810  H  HA   . ARG B  2 36  ? 104.677 137.931 86.520  1.00 15.46  ? 36  ARG F HA   1 
ATOM   6811  H  HB2  . ARG B  2 36  ? 105.599 137.837 89.173  1.00 15.46  ? 36  ARG F HB2  1 
ATOM   6812  H  HB3  . ARG B  2 36  ? 104.967 136.629 88.362  1.00 15.46  ? 36  ARG F HB3  1 
ATOM   6813  H  HG2  . ARG B  2 36  ? 106.845 136.553 87.030  1.00 15.46  ? 36  ARG F HG2  1 
ATOM   6814  H  HG3  . ARG B  2 36  ? 107.487 137.721 87.892  1.00 15.46  ? 36  ARG F HG3  1 
ATOM   6815  H  HD2  . ARG B  2 36  ? 107.518 136.347 89.740  1.00 15.46  ? 36  ARG F HD2  1 
ATOM   6816  H  HD3  . ARG B  2 36  ? 106.840 135.196 88.899  1.00 15.46  ? 36  ARG F HD3  1 
ATOM   6817  H  HE   . ARG B  2 36  ? 109.003 135.602 87.669  1.00 15.46  ? 36  ARG F HE   1 
ATOM   6818  H  HH11 . ARG B  2 36  ? 108.256 134.409 90.641  1.00 15.46  ? 36  ARG F HH11 1 
ATOM   6819  H  HH12 . ARG B  2 36  ? 109.497 133.612 90.813  1.00 15.46  ? 36  ARG F HH12 1 
ATOM   6820  H  HH21 . ARG B  2 36  ? 110.958 134.518 88.012  1.00 15.46  ? 36  ARG F HH21 1 
ATOM   6821  H  HH22 . ARG B  2 36  ? 111.127 133.675 89.230  1.00 15.46  ? 36  ARG F HH22 1 
ATOM   6822  N  N    . GLY B  2 37  ? 103.598 140.051 88.615  1.00 20.29  ? 37  GLY F N    1 
ATOM   6823  C  CA   . GLY B  2 37  ? 102.420 140.559 89.282  1.00 20.29  ? 37  GLY F CA   1 
ATOM   6824  C  C    . GLY B  2 37  ? 102.319 140.076 90.713  1.00 20.29  ? 37  GLY F C    1 
ATOM   6825  O  O    . GLY B  2 37  ? 103.242 139.485 91.279  1.00 20.29  ? 37  GLY F O    1 
ATOM   6826  H  H    . GLY B  2 37  ? 104.293 140.537 88.714  1.00 20.29  ? 37  GLY F H    1 
ATOM   6827  H  HA2  . GLY B  2 37  ? 102.442 141.525 89.288  1.00 20.29  ? 37  GLY F HA2  1 
ATOM   6828  H  HA3  . GLY B  2 37  ? 101.629 140.276 88.805  1.00 20.29  ? 37  GLY F HA3  1 
ATOM   6829  N  N    . LYS B  2 38  ? 101.161 140.343 91.309  1.00 28.30  ? 38  LYS F N    1 
ATOM   6830  C  CA   . LYS B  2 38  ? 100.946 139.959 92.694  1.00 28.30  ? 38  LYS F CA   1 
ATOM   6831  C  C    . LYS B  2 38  ? 100.726 138.459 92.820  1.00 28.30  ? 38  LYS F C    1 
ATOM   6832  O  O    . LYS B  2 38  ? 100.298 137.778 91.887  1.00 28.30  ? 38  LYS F O    1 
ATOM   6833  C  CB   . LYS B  2 38  ? 99.746  140.687 93.294  1.00 28.30  ? 38  LYS F CB   1 
ATOM   6834  C  CG   . LYS B  2 38  ? 99.721  142.179 93.079  1.00 28.30  ? 38  LYS F CG   1 
ATOM   6835  C  CD   . LYS B  2 38  ? 98.673  142.819 93.959  1.00 28.30  ? 38  LYS F CD   1 
ATOM   6836  C  CE   . LYS B  2 38  ? 99.060  144.217 94.361  1.00 28.30  ? 38  LYS F CE   1 
ATOM   6837  N  NZ   . LYS B  2 38  ? 98.320  144.656 95.563  1.00 28.30  ? 38  LYS F NZ   1 
ATOM   6838  H  H    . LYS B  2 38  ? 100.494 140.734 90.939  1.00 28.30  ? 38  LYS F H    1 
ATOM   6839  H  HA   . LYS B  2 38  ? 101.729 140.189 93.209  1.00 28.30  ? 38  LYS F HA   1 
ATOM   6840  H  HB2  . LYS B  2 38  ? 98.939  140.318 92.908  1.00 28.30  ? 38  LYS F HB2  1 
ATOM   6841  H  HB3  . LYS B  2 38  ? 99.749  140.533 94.248  1.00 28.30  ? 38  LYS F HB3  1 
ATOM   6842  H  HG2  . LYS B  2 38  ? 100.580 142.537 93.339  1.00 28.30  ? 38  LYS F HG2  1 
ATOM   6843  H  HG3  . LYS B  2 38  ? 99.540  142.406 92.160  1.00 28.30  ? 38  LYS F HG3  1 
ATOM   6844  H  HD2  . LYS B  2 38  ? 97.837  142.866 93.472  1.00 28.30  ? 38  LYS F HD2  1 
ATOM   6845  H  HD3  . LYS B  2 38  ? 98.563  142.294 94.765  1.00 28.30  ? 38  LYS F HD3  1 
ATOM   6846  H  HE2  . LYS B  2 38  ? 100.005 144.242 94.563  1.00 28.30  ? 38  LYS F HE2  1 
ATOM   6847  H  HE3  . LYS B  2 38  ? 98.852  144.825 93.636  1.00 28.30  ? 38  LYS F HE3  1 
ATOM   6848  H  HZ1  . LYS B  2 38  ? 98.533  145.496 95.760  1.00 28.30  ? 38  LYS F HZ1  1 
ATOM   6849  H  HZ2  . LYS B  2 38  ? 97.445  144.601 95.414  1.00 28.30  ? 38  LYS F HZ2  1 
ATOM   6850  H  HZ3  . LYS B  2 38  ? 98.530  144.134 96.252  1.00 28.30  ? 38  LYS F HZ3  1 
ATOM   6851  N  N    . VAL B  2 39  ? 101.025 137.951 94.014  1.00 25.17  ? 39  VAL F N    1 
ATOM   6852  C  CA   . VAL B  2 39  ? 100.818 136.546 94.304  1.00 25.17  ? 39  VAL F CA   1 
ATOM   6853  C  C    . VAL B  2 39  ? 99.329  136.255 94.441  1.00 25.17  ? 39  VAL F C    1 
ATOM   6854  O  O    . VAL B  2 39  ? 98.497  137.151 94.619  1.00 25.17  ? 39  VAL F O    1 
ATOM   6855  C  CB   . VAL B  2 39  ? 101.579 136.141 95.573  1.00 25.17  ? 39  VAL F CB   1 
ATOM   6856  C  CG1  . VAL B  2 39  ? 101.552 134.654 95.749  1.00 25.17  ? 39  VAL F CG1  1 
ATOM   6857  C  CG2  . VAL B  2 39  ? 102.995 136.621 95.498  1.00 25.17  ? 39  VAL F CG2  1 
ATOM   6858  H  H    . VAL B  2 39  ? 101.348 138.403 94.664  1.00 25.17  ? 39  VAL F H    1 
ATOM   6859  H  HA   . VAL B  2 39  ? 101.162 136.022 93.570  1.00 25.17  ? 39  VAL F HA   1 
ATOM   6860  H  HB   . VAL B  2 39  ? 101.156 136.548 96.338  1.00 25.17  ? 39  VAL F HB   1 
ATOM   6861  H  HG11 . VAL B  2 39  ? 102.251 134.403 96.366  1.00 25.17  ? 39  VAL F HG11 1 
ATOM   6862  H  HG12 . VAL B  2 39  ? 100.688 134.398 96.102  1.00 25.17  ? 39  VAL F HG12 1 
ATOM   6863  H  HG13 . VAL B  2 39  ? 101.701 134.237 94.888  1.00 25.17  ? 39  VAL F HG13 1 
ATOM   6864  H  HG21 . VAL B  2 39  ? 103.468 136.326 96.287  1.00 25.17  ? 39  VAL F HG21 1 
ATOM   6865  H  HG22 . VAL B  2 39  ? 103.396 136.241 94.706  1.00 25.17  ? 39  VAL F HG22 1 
ATOM   6866  H  HG23 . VAL B  2 39  ? 103.007 137.585 95.444  1.00 25.17  ? 39  VAL F HG23 1 
ATOM   6867  N  N    . VAL B  2 40  ? 98.990  134.974 94.342  1.00 34.59  ? 40  VAL F N    1 
ATOM   6868  C  CA   . VAL B  2 40  ? 97.612  134.512 94.439  1.00 34.59  ? 40  VAL F CA   1 
ATOM   6869  C  C    . VAL B  2 40  ? 97.576  133.262 95.304  1.00 34.59  ? 40  VAL F C    1 
ATOM   6870  O  O    . VAL B  2 40  ? 98.281  132.287 95.024  1.00 34.59  ? 40  VAL F O    1 
ATOM   6871  C  CB   . VAL B  2 40  ? 97.018  134.226 93.049  1.00 34.59  ? 40  VAL F CB   1 
ATOM   6872  C  CG1  . VAL B  2 40  ? 95.603  133.750 93.170  1.00 34.59  ? 40  VAL F CG1  1 
ATOM   6873  C  CG2  . VAL B  2 40  ? 97.067  135.466 92.202  1.00 34.59  ? 40  VAL F CG2  1 
ATOM   6874  H  H    . VAL B  2 40  ? 99.550  134.341 94.219  1.00 34.59  ? 40  VAL F H    1 
ATOM   6875  H  HA   . VAL B  2 40  ? 97.073  135.189 94.861  1.00 34.59  ? 40  VAL F HA   1 
ATOM   6876  H  HB   . VAL B  2 40  ? 97.541  133.538 92.621  1.00 34.59  ? 40  VAL F HB   1 
ATOM   6877  H  HG11 . VAL B  2 40  ? 95.236  133.644 92.278  1.00 34.59  ? 40  VAL F HG11 1 
ATOM   6878  H  HG12 . VAL B  2 40  ? 95.598  132.903 93.636  1.00 34.59  ? 40  VAL F HG12 1 
ATOM   6879  H  HG13 . VAL B  2 40  ? 95.096  134.410 93.662  1.00 34.59  ? 40  VAL F HG13 1 
ATOM   6880  H  HG21 . VAL B  2 40  ? 96.568  135.310 91.387  1.00 34.59  ? 40  VAL F HG21 1 
ATOM   6881  H  HG22 . VAL B  2 40  ? 96.667  136.193 92.697  1.00 34.59  ? 40  VAL F HG22 1 
ATOM   6882  H  HG23 . VAL B  2 40  ? 97.989  135.670 91.999  1.00 34.59  ? 40  VAL F HG23 1 
ATOM   6883  N  N    . GLU B  2 41  ? 96.751  133.285 96.345  1.00 40.80  ? 41  GLU F N    1 
ATOM   6884  C  CA   . GLU B  2 41  ? 96.470  132.108 97.159  1.00 40.80  ? 41  GLU F CA   1 
ATOM   6885  C  C    . GLU B  2 41  ? 94.963  131.953 97.255  1.00 40.80  ? 41  GLU F C    1 
ATOM   6886  O  O    . GLU B  2 41  ? 94.278  132.867 97.717  1.00 40.80  ? 41  GLU F O    1 
ATOM   6887  C  CB   . GLU B  2 41  ? 97.072  132.228 98.558  1.00 40.80  ? 41  GLU F CB   1 
ATOM   6888  C  CG   . GLU B  2 41  ? 98.551  131.927 98.639  1.00 40.80  ? 41  GLU F CG   1 
ATOM   6889  C  CD   . GLU B  2 41  ? 99.069  131.982 100.058 1.00 40.80  ? 41  GLU F CD   1 
ATOM   6890  O  OE1  . GLU B  2 41  ? 99.853  132.898 100.379 1.00 40.80  ? 41  GLU F OE1  1 
ATOM   6891  O  OE2  . GLU B  2 41  ? 98.676  131.105 100.852 1.00 40.80  ? 41  GLU F OE2  1 
ATOM   6892  H  H    . GLU B  2 41  ? 96.329  133.984 96.600  1.00 40.80  ? 41  GLU F H    1 
ATOM   6893  H  HA   . GLU B  2 41  ? 96.834  131.325 96.728  1.00 40.80  ? 41  GLU F HA   1 
ATOM   6894  H  HB2  . GLU B  2 41  ? 96.929  133.129 98.875  1.00 40.80  ? 41  GLU F HB2  1 
ATOM   6895  H  HB3  . GLU B  2 41  ? 96.617  131.599 99.136  1.00 40.80  ? 41  GLU F HB3  1 
ATOM   6896  H  HG2  . GLU B  2 41  ? 98.739  131.062 98.252  1.00 40.80  ? 41  GLU F HG2  1 
ATOM   6897  H  HG3  . GLU B  2 41  ? 99.021  132.622 98.147  1.00 40.80  ? 41  GLU F HG3  1 
ATOM   6898  N  N    . LEU B  2 42  ? 94.447  130.805 96.839  1.00 47.65  ? 42  LEU F N    1 
ATOM   6899  C  CA   . LEU B  2 42  ? 93.019  130.533 96.867  1.00 47.65  ? 42  LEU F CA   1 
ATOM   6900  C  C    . LEU B  2 42  ? 92.726  129.375 97.808  1.00 47.65  ? 42  LEU F C    1 
ATOM   6901  O  O    . LEU B  2 42  ? 93.555  128.481 97.995  1.00 47.65  ? 42  LEU F O    1 
ATOM   6902  C  CB   . LEU B  2 42  ? 92.496  130.203 95.477  1.00 47.65  ? 42  LEU F CB   1 
ATOM   6903  C  CG   . LEU B  2 42  ? 93.011  131.073 94.340  1.00 47.65  ? 42  LEU F CG   1 
ATOM   6904  C  CD1  . LEU B  2 42  ? 92.369  130.657 93.053  1.00 47.65  ? 42  LEU F CD1  1 
ATOM   6905  C  CD2  . LEU B  2 42  ? 92.722  132.523 94.599  1.00 47.65  ? 42  LEU F CD2  1 
ATOM   6906  H  H    . LEU B  2 42  ? 94.910  130.152 96.532  1.00 47.65  ? 42  LEU F H    1 
ATOM   6907  H  HA   . LEU B  2 42  ? 92.553  131.316 97.185  1.00 47.65  ? 42  LEU F HA   1 
ATOM   6908  H  HB2  . LEU B  2 42  ? 92.739  129.289 95.278  1.00 47.65  ? 42  LEU F HB2  1 
ATOM   6909  H  HB3  . LEU B  2 42  ? 91.533  130.290 95.488  1.00 47.65  ? 42  LEU F HB3  1 
ATOM   6910  H  HG   . LEU B  2 42  ? 93.966  130.968 94.262  1.00 47.65  ? 42  LEU F HG   1 
ATOM   6911  H  HD11 . LEU B  2 42  ? 92.687  131.234 92.345  1.00 47.65  ? 42  LEU F HD11 1 
ATOM   6912  H  HD12 . LEU B  2 42  ? 92.610  129.738 92.869  1.00 47.65  ? 42  LEU F HD12 1 
ATOM   6913  H  HD13 . LEU B  2 42  ? 91.411  130.740 93.145  1.00 47.65  ? 42  LEU F HD13 1 
ATOM   6914  H  HD21 . LEU B  2 42  ? 93.083  133.046 93.870  1.00 47.65  ? 42  LEU F HD21 1 
ATOM   6915  H  HD22 . LEU B  2 42  ? 91.764  132.642 94.643  1.00 47.65  ? 42  LEU F HD22 1 
ATOM   6916  H  HD23 . LEU B  2 42  ? 93.136  132.782 95.435  1.00 47.65  ? 42  LEU F HD23 1 
ATOM   6917  N  N    . GLY B  2 43  ? 91.540  129.394 98.402  1.00 66.26  ? 43  GLY F N    1 
ATOM   6918  C  CA   . GLY B  2 43  ? 91.170  128.298 99.277  1.00 66.26  ? 43  GLY F CA   1 
ATOM   6919  C  C    . GLY B  2 43  ? 89.779  128.468 99.837  1.00 66.26  ? 43  GLY F C    1 
ATOM   6920  O  O    . GLY B  2 43  ? 89.025  129.349 99.427  1.00 66.26  ? 43  GLY F O    1 
ATOM   6921  H  H    . GLY B  2 43  ? 90.943  130.008 98.316  1.00 66.26  ? 43  GLY F H    1 
ATOM   6922  H  HA2  . GLY B  2 43  ? 91.202  127.465 98.785  1.00 66.26  ? 43  GLY F HA2  1 
ATOM   6923  H  HA3  . GLY B  2 43  ? 91.791  128.249 100.018 1.00 66.26  ? 43  GLY F HA3  1 
ATOM   6924  N  N    . CYS B  2 44  ? 89.448  127.584 100.777 1.00 85.51  ? 44  CYS F N    1 
ATOM   6925  C  CA   . CYS B  2 44  ? 88.203  127.642 101.531 1.00 85.51  ? 44  CYS F CA   1 
ATOM   6926  C  C    . CYS B  2 44  ? 88.535  127.553 103.011 1.00 85.51  ? 44  CYS F C    1 
ATOM   6927  O  O    . CYS B  2 44  ? 89.262  126.647 103.431 1.00 85.51  ? 44  CYS F O    1 
ATOM   6928  C  CB   . CYS B  2 44  ? 87.248  126.515 101.118 1.00 85.51  ? 44  CYS F CB   1 
ATOM   6929  S  SG   . CYS B  2 44  ? 87.629  124.872 101.783 1.00 85.51  ? 44  CYS F SG   1 
ATOM   6930  H  H    . CYS B  2 44  ? 89.946  126.920 100.999 1.00 85.51  ? 44  CYS F H    1 
ATOM   6931  H  HA   . CYS B  2 44  ? 87.762  128.490 101.369 1.00 85.51  ? 44  CYS F HA   1 
ATOM   6932  H  HB2  . CYS B  2 44  ? 86.351  126.751 101.402 1.00 85.51  ? 44  CYS F HB2  1 
ATOM   6933  H  HB3  . CYS B  2 44  ? 87.276  126.442 100.155 1.00 85.51  ? 44  CYS F HB3  1 
ATOM   6934  N  N    . ALA B  2 45  ? 88.015  128.492 103.797 1.00 93.14  ? 45  ALA F N    1 
ATOM   6935  C  CA   . ALA B  2 45  ? 88.342  128.566 105.214 1.00 93.14  ? 45  ALA F CA   1 
ATOM   6936  C  C    . ALA B  2 45  ? 87.079  128.716 106.049 1.00 93.14  ? 45  ALA F C    1 
ATOM   6937  O  O    . ALA B  2 45  ? 86.021  129.117 105.556 1.00 93.14  ? 45  ALA F O    1 
ATOM   6938  C  CB   . ALA B  2 45  ? 89.297  129.725 105.513 1.00 93.14  ? 45  ALA F CB   1 
ATOM   6939  H  H    . ALA B  2 45  ? 87.477  129.103 103.529 1.00 93.14  ? 45  ALA F H    1 
ATOM   6940  H  HA   . ALA B  2 45  ? 88.784  127.743 105.478 1.00 93.14  ? 45  ALA F HA   1 
ATOM   6941  H  HB1  . ALA B  2 45  ? 89.499  129.727 106.462 1.00 93.14  ? 45  ALA F HB1  1 
ATOM   6942  H  HB2  . ALA B  2 45  ? 90.111  129.599 105.002 1.00 93.14  ? 45  ALA F HB2  1 
ATOM   6943  H  HB3  . ALA B  2 45  ? 88.869  130.556 105.264 1.00 93.14  ? 45  ALA F HB3  1 
ATOM   6944  N  N    . ALA B  2 46  ? 87.211  128.377 107.335 1.00 98.88  ? 46  ALA F N    1 
ATOM   6945  C  CA   . ALA B  2 46  ? 86.088  128.464 108.262 1.00 98.88  ? 46  ALA F CA   1 
ATOM   6946  C  C    . ALA B  2 46  ? 85.472  129.854 108.229 1.00 98.88  ? 46  ALA F C    1 
ATOM   6947  O  O    . ALA B  2 46  ? 84.310  130.033 107.849 1.00 98.88  ? 46  ALA F O    1 
ATOM   6948  C  CB   . ALA B  2 46  ? 86.559  128.117 109.674 1.00 98.88  ? 46  ALA F CB   1 
ATOM   6949  H  H    . ALA B  2 46  ? 87.940  128.087 107.692 1.00 98.88  ? 46  ALA F H    1 
ATOM   6950  H  HA   . ALA B  2 46  ? 85.412  127.821 108.002 1.00 98.88  ? 46  ALA F HA   1 
ATOM   6951  H  HB1  . ALA B  2 46  ? 85.800  128.135 110.275 1.00 98.88  ? 46  ALA F HB1  1 
ATOM   6952  H  HB2  . ALA B  2 46  ? 86.961  127.234 109.671 1.00 98.88  ? 46  ALA F HB2  1 
ATOM   6953  H  HB3  . ALA B  2 46  ? 87.217  128.774 109.952 1.00 98.88  ? 46  ALA F HB3  1 
ATOM   6954  N  N    . THR B  2 47  ? 86.250  130.854 108.625 1.00 98.03  ? 47  THR F N    1 
ATOM   6955  C  CA   . THR B  2 47  ? 85.937  132.247 108.362 1.00 98.03  ? 47  THR F CA   1 
ATOM   6956  C  C    . THR B  2 47  ? 87.175  132.911 107.783 1.00 98.03  ? 47  THR F C    1 
ATOM   6957  O  O    . THR B  2 47  ? 88.305  132.581 108.153 1.00 98.03  ? 47  THR F O    1 
ATOM   6958  C  CB   . THR B  2 47  ? 85.475  132.992 109.615 1.00 98.03  ? 47  THR F CB   1 
ATOM   6959  O  OG1  . THR B  2 47  ? 85.208  134.360 109.281 1.00 98.03  ? 47  THR F OG1  1 
ATOM   6960  C  CG2  . THR B  2 47  ? 86.535  132.933 110.695 1.00 98.03  ? 47  THR F CG2  1 
ATOM   6961  H  H    . THR B  2 47  ? 86.982  130.743 109.063 1.00 98.03  ? 47  THR F H    1 
ATOM   6962  H  HA   . THR B  2 47  ? 85.231  132.286 107.709 1.00 98.03  ? 47  THR F HA   1 
ATOM   6963  H  HB   . THR B  2 47  ? 84.665  132.578 109.950 1.00 98.03  ? 47  THR F HB   1 
ATOM   6964  H  HG1  . THR B  2 47  ? 84.837  134.748 109.925 1.00 98.03  ? 47  THR F HG1  1 
ATOM   6965  H  HG21 . THR B  2 47  ? 86.191  133.327 111.511 1.00 98.03  ? 47  THR F HG21 1 
ATOM   6966  H  HG22 . THR B  2 47  ? 86.785  132.012 110.868 1.00 98.03  ? 47  THR F HG22 1 
ATOM   6967  H  HG23 . THR B  2 47  ? 87.322  133.426 110.416 1.00 98.03  ? 47  THR F HG23 1 
ATOM   6968  N  N    . CYS B  2 48  ? 86.953  133.851 106.875 1.00 93.49  ? 48  CYS F N    1 
ATOM   6969  C  CA   . CYS B  2 48  ? 88.054  134.364 106.079 1.00 93.49  ? 48  CYS F CA   1 
ATOM   6970  C  C    . CYS B  2 48  ? 89.105  134.996 106.990 1.00 93.49  ? 48  CYS F C    1 
ATOM   6971  O  O    . CYS B  2 48  ? 88.758  135.684 107.957 1.00 93.49  ? 48  CYS F O    1 
ATOM   6972  C  CB   . CYS B  2 48  ? 87.538  135.365 105.046 1.00 93.49  ? 48  CYS F CB   1 
ATOM   6973  S  SG   . CYS B  2 48  ? 86.867  134.524 103.587 1.00 93.49  ? 48  CYS F SG   1 
ATOM   6974  H  H    . CYS B  2 48  ? 86.189  134.204 106.708 1.00 93.49  ? 48  CYS F H    1 
ATOM   6975  H  HA   . CYS B  2 48  ? 88.460  133.624 105.603 1.00 93.49  ? 48  CYS F HA   1 
ATOM   6976  H  HB2  . CYS B  2 48  ? 86.834  135.899 105.442 1.00 93.49  ? 48  CYS F HB2  1 
ATOM   6977  H  HB3  . CYS B  2 48  ? 88.268  135.934 104.760 1.00 93.49  ? 48  CYS F HB3  1 
ATOM   6978  N  N    . PRO B  2 49  ? 90.395  134.781 106.715 1.00 83.59  ? 49  PRO F N    1 
ATOM   6979  C  CA   . PRO B  2 49  ? 91.422  135.035 107.733 1.00 83.59  ? 49  PRO F CA   1 
ATOM   6980  C  C    . PRO B  2 49  ? 91.863  136.486 107.831 1.00 83.59  ? 49  PRO F C    1 
ATOM   6981  O  O    . PRO B  2 49  ? 91.315  137.371 107.166 1.00 83.59  ? 49  PRO F O    1 
ATOM   6982  C  CB   . PRO B  2 49  ? 92.574  134.133 107.279 1.00 83.59  ? 49  PRO F CB   1 
ATOM   6983  C  CG   . PRO B  2 49  ? 92.440  134.087 105.791 1.00 83.59  ? 49  PRO F CG   1 
ATOM   6984  C  CD   . PRO B  2 49  ? 90.989  134.338 105.443 1.00 83.59  ? 49  PRO F CD   1 
ATOM   6985  H  HA   . PRO B  2 49  ? 91.108  134.740 108.602 1.00 83.59  ? 49  PRO F HA   1 
ATOM   6986  H  HB2  . PRO B  2 49  ? 93.424  134.522 107.538 1.00 83.59  ? 49  PRO F HB2  1 
ATOM   6987  H  HB3  . PRO B  2 49  ? 92.471  133.250 107.664 1.00 83.59  ? 49  PRO F HB3  1 
ATOM   6988  H  HG2  . PRO B  2 49  ? 93.000  134.773 105.398 1.00 83.59  ? 49  PRO F HG2  1 
ATOM   6989  H  HG3  . PRO B  2 49  ? 92.711  133.211 105.476 1.00 83.59  ? 49  PRO F HG3  1 
ATOM   6990  H  HD2  . PRO B  2 49  ? 90.917  135.042 104.782 1.00 83.59  ? 49  PRO F HD2  1 
ATOM   6991  H  HD3  . PRO B  2 49  ? 90.573  133.519 105.140 1.00 83.59  ? 49  PRO F HD3  1 
ATOM   6992  N  N    . SER B  2 50  ? 92.868  136.727 108.669 1.00 75.72  ? 50  SER F N    1 
ATOM   6993  C  CA   . SER B  2 50  ? 93.317  138.082 108.943 1.00 75.72  ? 50  SER F CA   1 
ATOM   6994  C  C    . SER B  2 50  ? 94.081  138.646 107.754 1.00 75.72  ? 50  SER F C    1 
ATOM   6995  O  O    . SER B  2 50  ? 94.831  137.935 107.080 1.00 75.72  ? 50  SER F O    1 
ATOM   6996  C  CB   . SER B  2 50  ? 94.200  138.102 110.188 1.00 75.72  ? 50  SER F CB   1 
ATOM   6997  O  OG   . SER B  2 50  ? 94.601  139.421 110.508 1.00 75.72  ? 50  SER F OG   1 
ATOM   6998  H  H    . SER B  2 50  ? 93.314  136.119 109.086 1.00 75.72  ? 50  SER F H    1 
ATOM   6999  H  HA   . SER B  2 50  ? 92.547  138.649 109.103 1.00 75.72  ? 50  SER F HA   1 
ATOM   7000  H  HB2  . SER B  2 50  ? 93.707  137.730 110.934 1.00 75.72  ? 50  SER F HB2  1 
ATOM   7001  H  HB3  . SER B  2 50  ? 94.990  137.566 110.016 1.00 75.72  ? 50  SER F HB3  1 
ATOM   7002  H  HG   . SER B  2 50  ? 95.138  139.407 111.155 1.00 75.72  ? 50  SER F HG   1 
ATOM   7003  N  N    . LYS B  2 51  ? 93.886  139.936 107.503 1.00 57.30  ? 51  LYS F N    1 
ATOM   7004  C  CA   . LYS B  2 51  ? 94.567  140.645 106.428 1.00 57.30  ? 51  LYS F CA   1 
ATOM   7005  C  C    . LYS B  2 51  ? 95.742  141.408 107.025 1.00 57.30  ? 51  LYS F C    1 
ATOM   7006  O  O    . LYS B  2 51  ? 95.553  142.378 107.765 1.00 57.30  ? 51  LYS F O    1 
ATOM   7007  C  CB   . LYS B  2 51  ? 93.602  141.584 105.709 1.00 57.30  ? 51  LYS F CB   1 
ATOM   7008  C  CG   . LYS B  2 51  ? 94.213  142.890 105.242 1.00 57.30  ? 51  LYS F CG   1 
ATOM   7009  C  CD   . LYS B  2 51  ? 93.313  143.574 104.235 1.00 57.30  ? 51  LYS F CD   1 
ATOM   7010  C  CE   . LYS B  2 51  ? 93.927  144.864 103.719 1.00 57.30  ? 51  LYS F CE   1 
ATOM   7011  N  NZ   . LYS B  2 51  ? 93.225  145.360 102.509 1.00 57.30  ? 51  LYS F NZ   1 
ATOM   7012  H  H    . LYS B  2 51  ? 93.345  140.431 107.948 1.00 57.30  ? 51  LYS F H    1 
ATOM   7013  H  HA   . LYS B  2 51  ? 94.912  140.009 105.786 1.00 57.30  ? 51  LYS F HA   1 
ATOM   7014  H  HB2  . LYS B  2 51  ? 93.257  141.131 104.925 1.00 57.30  ? 51  LYS F HB2  1 
ATOM   7015  H  HB3  . LYS B  2 51  ? 92.873  141.801 106.309 1.00 57.30  ? 51  LYS F HB3  1 
ATOM   7016  H  HG2  . LYS B  2 51  ? 94.331  143.485 105.997 1.00 57.30  ? 51  LYS F HG2  1 
ATOM   7017  H  HG3  . LYS B  2 51  ? 95.065  142.715 104.816 1.00 57.30  ? 51  LYS F HG3  1 
ATOM   7018  H  HD2  . LYS B  2 51  ? 93.173  142.982 103.482 1.00 57.30  ? 51  LYS F HD2  1 
ATOM   7019  H  HD3  . LYS B  2 51  ? 92.466  143.785 104.656 1.00 57.30  ? 51  LYS F HD3  1 
ATOM   7020  H  HE2  . LYS B  2 51  ? 93.863  145.545 104.405 1.00 57.30  ? 51  LYS F HE2  1 
ATOM   7021  H  HE3  . LYS B  2 51  ? 94.857  144.712 103.491 1.00 57.30  ? 51  LYS F HE3  1 
ATOM   7022  H  HZ1  . LYS B  2 51  ? 93.670  146.046 102.159 1.00 57.30  ? 51  LYS F HZ1  1 
ATOM   7023  H  HZ2  . LYS B  2 51  ? 93.170  144.710 101.904 1.00 57.30  ? 51  LYS F HZ2  1 
ATOM   7024  H  HZ3  . LYS B  2 51  ? 92.404  145.621 102.724 1.00 57.30  ? 51  LYS F HZ3  1 
ATOM   7025  N  N    . LYS B  2 52  ? 96.954  140.962 106.709 1.00 51.31  ? 52  LYS F N    1 
ATOM   7026  C  CA   . LYS B  2 52  ? 98.148  141.681 107.094 1.00 51.31  ? 52  LYS F CA   1 
ATOM   7027  C  C    . LYS B  2 52  ? 98.180  143.029 106.380 1.00 51.31  ? 52  LYS F C    1 
ATOM   7028  O  O    . LYS B  2 52  ? 97.396  143.279 105.464 1.00 51.31  ? 52  LYS F O    1 
ATOM   7029  C  CB   . LYS B  2 52  ? 99.389  140.859 106.761 1.00 51.31  ? 52  LYS F CB   1 
ATOM   7030  C  CG   . LYS B  2 52  ? 99.579  139.647 107.637 1.00 51.31  ? 52  LYS F CG   1 
ATOM   7031  C  CD   . LYS B  2 52  ? 100.980 139.097 107.494 1.00 51.31  ? 52  LYS F CD   1 
ATOM   7032  C  CE   . LYS B  2 52  ? 101.216 137.908 108.398 1.00 51.31  ? 52  LYS F CE   1 
ATOM   7033  N  NZ   . LYS B  2 52  ? 101.072 136.635 107.644 1.00 51.31  ? 52  LYS F NZ   1 
ATOM   7034  H  H    . LYS B  2 52  ? 97.106  140.234 106.278 1.00 51.31  ? 52  LYS F H    1 
ATOM   7035  H  HA   . LYS B  2 52  ? 98.134  141.836 108.050 1.00 51.31  ? 52  LYS F HA   1 
ATOM   7036  H  HB2  . LYS B  2 52  ? 99.318  140.550 105.845 1.00 51.31  ? 52  LYS F HB2  1 
ATOM   7037  H  HB3  . LYS B  2 52  ? 100.176 141.411 106.857 1.00 51.31  ? 52  LYS F HB3  1 
ATOM   7038  H  HG2  . LYS B  2 52  ? 99.441  139.900 108.561 1.00 51.31  ? 52  LYS F HG2  1 
ATOM   7039  H  HG3  . LYS B  2 52  ? 98.951  138.959 107.370 1.00 51.31  ? 52  LYS F HG3  1 
ATOM   7040  H  HD2  . LYS B  2 52  ? 101.122 138.813 106.582 1.00 51.31  ? 52  LYS F HD2  1 
ATOM   7041  H  HD3  . LYS B  2 52  ? 101.615 139.791 107.730 1.00 51.31  ? 52  LYS F HD3  1 
ATOM   7042  H  HE2  . LYS B  2 52  ? 102.120 137.951 108.747 1.00 51.31  ? 52  LYS F HE2  1 
ATOM   7043  H  HE3  . LYS B  2 52  ? 100.574 137.916 109.121 1.00 51.31  ? 52  LYS F HE3  1 
ATOM   7044  H  HZ1  . LYS B  2 52  ? 100.640 136.036 108.137 1.00 51.31  ? 52  LYS F HZ1  1 
ATOM   7045  H  HZ2  . LYS B  2 52  ? 100.613 136.778 106.895 1.00 51.31  ? 52  LYS F HZ2  1 
ATOM   7046  H  HZ3  . LYS B  2 52  ? 101.874 136.314 107.430 1.00 51.31  ? 52  LYS F HZ3  1 
ATOM   7047  N  N    . PRO B  2 53  ? 99.079  143.928 106.788 1.00 46.89  ? 53  PRO F N    1 
ATOM   7048  C  CA   . PRO B  2 53  ? 99.120  145.247 106.138 1.00 46.89  ? 53  PRO F CA   1 
ATOM   7049  C  C    . PRO B  2 53  ? 99.348  145.171 104.642 1.00 46.89  ? 53  PRO F C    1 
ATOM   7050  O  O    . PRO B  2 53  ? 98.765  145.958 103.887 1.00 46.89  ? 53  PRO F O    1 
ATOM   7051  C  CB   . PRO B  2 53  ? 100.284 145.949 106.850 1.00 46.89  ? 53  PRO F CB   1 
ATOM   7052  C  CG   . PRO B  2 53  ? 100.457 145.217 108.132 1.00 46.89  ? 53  PRO F CG   1 
ATOM   7053  C  CD   . PRO B  2 53  ? 100.090 143.804 107.849 1.00 46.89  ? 53  PRO F CD   1 
ATOM   7054  H  HA   . PRO B  2 53  ? 98.299  145.731 106.309 1.00 46.89  ? 53  PRO F HA   1 
ATOM   7055  H  HB2  . PRO B  2 53  ? 101.082 145.873 106.305 1.00 46.89  ? 53  PRO F HB2  1 
ATOM   7056  H  HB3  . PRO B  2 53  ? 100.062 146.879 107.005 1.00 46.89  ? 53  PRO F HB3  1 
ATOM   7057  H  HG2  . PRO B  2 53  ? 101.386 145.274 108.409 1.00 46.89  ? 53  PRO F HG2  1 
ATOM   7058  H  HG3  . PRO B  2 53  ? 99.874  145.594 108.807 1.00 46.89  ? 53  PRO F HG3  1 
ATOM   7059  H  HD2  . PRO B  2 53  ? 100.863 143.321 107.520 1.00 46.89  ? 53  PRO F HD2  1 
ATOM   7060  H  HD3  . PRO B  2 53  ? 99.716  143.380 108.634 1.00 46.89  ? 53  PRO F HD3  1 
ATOM   7061  N  N    . TYR B  2 54  ? 100.182 144.237 104.193 1.00 40.77  ? 54  TYR F N    1 
ATOM   7062  C  CA   . TYR B  2 54  ? 100.565 144.137 102.793 1.00 40.77  ? 54  TYR F CA   1 
ATOM   7063  C  C    . TYR B  2 54  ? 99.721  143.143 102.007 1.00 40.77  ? 54  TYR F C    1 
ATOM   7064  O  O    . TYR B  2 54  ? 99.977  142.946 100.816 1.00 40.77  ? 54  TYR F O    1 
ATOM   7065  C  CB   . TYR B  2 54  ? 102.048 143.760 102.684 1.00 40.77  ? 54  TYR F CB   1 
ATOM   7066  C  CG   . TYR B  2 54  ? 102.461 142.517 103.440 1.00 40.77  ? 54  TYR F CG   1 
ATOM   7067  C  CD1  . TYR B  2 54  ? 102.240 141.255 102.916 1.00 40.77  ? 54  TYR F CD1  1 
ATOM   7068  C  CD2  . TYR B  2 54  ? 103.100 142.610 104.666 1.00 40.77  ? 54  TYR F CD2  1 
ATOM   7069  C  CE1  . TYR B  2 54  ? 102.624 140.119 103.599 1.00 40.77  ? 54  TYR F CE1  1 
ATOM   7070  C  CE2  . TYR B  2 54  ? 103.489 141.480 105.356 1.00 40.77  ? 54  TYR F CE2  1 
ATOM   7071  C  CZ   . TYR B  2 54  ? 103.249 140.237 104.816 1.00 40.77  ? 54  TYR F CZ   1 
ATOM   7072  O  OH   . TYR B  2 54  ? 103.635 139.107 105.497 1.00 40.77  ? 54  TYR F OH   1 
ATOM   7073  H  H    . TYR B  2 54  ? 100.541 143.638 104.693 1.00 40.77  ? 54  TYR F H    1 
ATOM   7074  H  HA   . TYR B  2 54  ? 100.453 145.006 102.381 1.00 40.77  ? 54  TYR F HA   1 
ATOM   7075  H  HB2  . TYR B  2 54  ? 102.264 143.617 101.752 1.00 40.77  ? 54  TYR F HB2  1 
ATOM   7076  H  HB3  . TYR B  2 54  ? 102.573 144.492 103.037 1.00 40.77  ? 54  TYR F HB3  1 
ATOM   7077  H  HD1  . TYR B  2 54  ? 101.814 141.171 102.095 1.00 40.77  ? 54  TYR F HD1  1 
ATOM   7078  H  HD2  . TYR B  2 54  ? 103.263 143.446 105.032 1.00 40.77  ? 54  TYR F HD2  1 
ATOM   7079  H  HE1  . TYR B  2 54  ? 102.466 139.278 103.238 1.00 40.77  ? 54  TYR F HE1  1 
ATOM   7080  H  HE2  . TYR B  2 54  ? 103.914 141.555 106.178 1.00 40.77  ? 54  TYR F HE2  1 
ATOM   7081  H  HH   . TYR B  2 54  ? 104.264 139.293 106.024 1.00 40.77  ? 54  TYR F HH   1 
ATOM   7082  N  N    . GLU B  2 55  ? 98.723  142.524 102.631 1.00 47.39  ? 55  GLU F N    1 
ATOM   7083  C  CA   . GLU B  2 55  ? 97.898  141.512 101.990 1.00 47.39  ? 55  GLU F CA   1 
ATOM   7084  C  C    . GLU B  2 55  ? 96.492  142.043 101.753 1.00 47.39  ? 55  GLU F C    1 
ATOM   7085  O  O    . GLU B  2 55  ? 95.962  142.814 102.557 1.00 47.39  ? 55  GLU F O    1 
ATOM   7086  C  CB   . GLU B  2 55  ? 97.844  140.248 102.844 1.00 47.39  ? 55  GLU F CB   1 
ATOM   7087  C  CG   . GLU B  2 55  ? 99.066  139.375 102.668 1.00 47.39  ? 55  GLU F CG   1 
ATOM   7088  C  CD   . GLU B  2 55  ? 99.261  138.382 103.788 1.00 47.39  ? 55  GLU F CD   1 
ATOM   7089  O  OE1  . GLU B  2 55  ? 98.451  137.450 103.920 1.00 47.39  ? 55  GLU F OE1  1 
ATOM   7090  O  OE2  . GLU B  2 55  ? 100.245 138.526 104.533 1.00 47.39  ? 55  GLU F OE2  1 
ATOM   7091  H  H    . GLU B  2 55  ? 98.507  142.671 103.448 1.00 47.39  ? 55  GLU F H    1 
ATOM   7092  H  HA   . GLU B  2 55  ? 98.279  141.277 101.133 1.00 47.39  ? 55  GLU F HA   1 
ATOM   7093  H  HB2  . GLU B  2 55  ? 97.773  140.493 103.776 1.00 47.39  ? 55  GLU F HB2  1 
ATOM   7094  H  HB3  . GLU B  2 55  ? 97.068  139.730 102.578 1.00 47.39  ? 55  GLU F HB3  1 
ATOM   7095  H  HG2  . GLU B  2 55  ? 98.976  138.880 101.843 1.00 47.39  ? 55  GLU F HG2  1 
ATOM   7096  H  HG3  . GLU B  2 55  ? 99.849  139.945 102.630 1.00 47.39  ? 55  GLU F HG3  1 
ATOM   7097  N  N    . GLU B  2 56  ? 95.900  141.629 100.638 1.00 50.53  ? 56  GLU F N    1 
ATOM   7098  C  CA   . GLU B  2 56  ? 94.531  141.968 100.281 1.00 50.53  ? 56  GLU F CA   1 
ATOM   7099  C  C    . GLU B  2 56  ? 93.710  140.693 100.189 1.00 50.53  ? 56  GLU F C    1 
ATOM   7100  O  O    . GLU B  2 56  ? 94.197  139.665 99.714  1.00 50.53  ? 56  GLU F O    1 
ATOM   7101  C  CB   . GLU B  2 56  ? 94.472  142.712 98.953  1.00 50.53  ? 56  GLU F CB   1 
ATOM   7102  C  CG   . GLU B  2 56  ? 95.217  144.026 98.962  1.00 50.53  ? 56  GLU F CG   1 
ATOM   7103  C  CD   . GLU B  2 56  ? 95.078  144.786 97.658  1.00 50.53  ? 56  GLU F CD   1 
ATOM   7104  O  OE1  . GLU B  2 56  ? 94.644  144.178 96.657  1.00 50.53  ? 56  GLU F OE1  1 
ATOM   7105  O  OE2  . GLU B  2 56  ? 95.399  145.993 97.635  1.00 50.53  ? 56  GLU F OE2  1 
ATOM   7106  H  H    . GLU B  2 56  ? 96.287  141.135 100.054 1.00 50.53  ? 56  GLU F H    1 
ATOM   7107  H  HA   . GLU B  2 56  ? 94.149  142.533 100.965 1.00 50.53  ? 56  GLU F HA   1 
ATOM   7108  H  HB2  . GLU B  2 56  ? 94.864  142.153 98.269  1.00 50.53  ? 56  GLU F HB2  1 
ATOM   7109  H  HB3  . GLU B  2 56  ? 93.545  142.891 98.736  1.00 50.53  ? 56  GLU F HB3  1 
ATOM   7110  H  HG2  . GLU B  2 56  ? 94.865  144.581 99.673  1.00 50.53  ? 56  GLU F HG2  1 
ATOM   7111  H  HG3  . GLU B  2 56  ? 96.159  143.848 99.113  1.00 50.53  ? 56  GLU F HG3  1 
ATOM   7112  N  N    . VAL B  2 57  ? 92.465  140.765 100.643 1.00 56.00  ? 57  VAL F N    1 
ATOM   7113  C  CA   . VAL B  2 57  ? 91.574  139.614 100.665 1.00 56.00  ? 57  VAL F CA   1 
ATOM   7114  C  C    . VAL B  2 57  ? 90.236  140.009 100.064 1.00 56.00  ? 57  VAL F C    1 
ATOM   7115  O  O    . VAL B  2 57  ? 89.745  141.122 100.284 1.00 56.00  ? 57  VAL F O    1 
ATOM   7116  C  CB   . VAL B  2 57  ? 91.386  139.063 102.091 1.00 56.00  ? 57  VAL F CB   1 
ATOM   7117  C  CG1  . VAL B  2 57  ? 90.491  137.843 102.065 1.00 56.00  ? 57  VAL F CG1  1 
ATOM   7118  C  CG2  . VAL B  2 57  ? 92.725  138.714 102.690 1.00 56.00  ? 57  VAL F CG2  1 
ATOM   7119  H  H    . VAL B  2 57  ? 92.104  141.483 100.939 1.00 56.00  ? 57  VAL F H    1 
ATOM   7120  H  HA   . VAL B  2 57  ? 91.950  138.909 100.121 1.00 56.00  ? 57  VAL F HA   1 
ATOM   7121  H  HB   . VAL B  2 57  ? 90.969  139.740 102.641 1.00 56.00  ? 57  VAL F HB   1 
ATOM   7122  H  HG11 . VAL B  2 57  ? 90.434  137.473 102.958 1.00 56.00  ? 57  VAL F HG11 1 
ATOM   7123  H  HG12 . VAL B  2 57  ? 89.611  138.100 101.753 1.00 56.00  ? 57  VAL F HG12 1 
ATOM   7124  H  HG13 . VAL B  2 57  ? 90.878  137.191 101.464 1.00 56.00  ? 57  VAL F HG13 1 
ATOM   7125  H  HG21 . VAL B  2 57  ? 92.597  138.415 103.601 1.00 56.00  ? 57  VAL F HG21 1 
ATOM   7126  H  HG22 . VAL B  2 57  ? 93.121  138.006 102.163 1.00 56.00  ? 57  VAL F HG22 1 
ATOM   7127  H  HG23 . VAL B  2 57  ? 93.294  139.497 102.673 1.00 56.00  ? 57  VAL F HG23 1 
ATOM   7128  N  N    . THR B  2 58  ? 89.651  139.089 99.302  1.00 62.93  ? 58  THR F N    1 
ATOM   7129  C  CA   . THR B  2 58  ? 88.336  139.259 98.692  1.00 62.93  ? 58  THR F CA   1 
ATOM   7130  C  C    . THR B  2 58  ? 87.554  137.990 99.011  1.00 62.93  ? 58  THR F C    1 
ATOM   7131  O  O    . THR B  2 58  ? 87.731  136.962 98.352  1.00 62.93  ? 58  THR F O    1 
ATOM   7132  C  CB   . THR B  2 58  ? 88.447  139.494 97.192  1.00 62.93  ? 58  THR F CB   1 
ATOM   7133  O  OG1  . THR B  2 58  ? 89.276  140.637 96.949  1.00 62.93  ? 58  THR F OG1  1 
ATOM   7134  C  CG2  . THR B  2 58  ? 87.085  139.740 96.590  1.00 62.93  ? 58  THR F CG2  1 
ATOM   7135  H  H    . THR B  2 58  ? 90.009  138.329 99.125  1.00 62.93  ? 58  THR F H    1 
ATOM   7136  H  HA   . THR B  2 58  ? 87.885  140.016 99.092  1.00 62.93  ? 58  THR F HA   1 
ATOM   7137  H  HB   . THR B  2 58  ? 88.834  138.711 96.771  1.00 62.93  ? 58  THR F HB   1 
ATOM   7138  H  HG1  . THR B  2 58  ? 89.282  140.812 96.130  1.00 62.93  ? 58  THR F HG1  1 
ATOM   7139  H  HG21 . THR B  2 58  ? 87.175  139.893 95.637  1.00 62.93  ? 58  THR F HG21 1 
ATOM   7140  H  HG22 . THR B  2 58  ? 86.502  138.979 96.741  1.00 62.93  ? 58  THR F HG22 1 
ATOM   7141  H  HG23 . THR B  2 58  ? 86.693  140.526 97.000  1.00 62.93  ? 58  THR F HG23 1 
ATOM   7142  N  N    . CYS B  2 59  ? 86.696  138.067 100.021 1.00 81.52  ? 59  CYS F N    1 
ATOM   7143  C  CA   . CYS B  2 59  ? 86.060  136.898 100.607 1.00 81.52  ? 59  CYS F CA   1 
ATOM   7144  C  C    . CYS B  2 59  ? 84.631  136.775 100.098 1.00 81.52  ? 59  CYS F C    1 
ATOM   7145  O  O    . CYS B  2 59  ? 83.875  137.751 100.113 1.00 81.52  ? 59  CYS F O    1 
ATOM   7146  C  CB   . CYS B  2 59  ? 86.079  136.999 102.132 1.00 81.52  ? 59  CYS F CB   1 
ATOM   7147  S  SG   . CYS B  2 59  ? 85.287  135.650 102.995 1.00 81.52  ? 59  CYS F SG   1 
ATOM   7148  H  H    . CYS B  2 59  ? 86.463  138.807 100.393 1.00 81.52  ? 59  CYS F H    1 
ATOM   7149  H  HA   . CYS B  2 59  ? 86.547  136.102 100.346 1.00 81.52  ? 59  CYS F HA   1 
ATOM   7150  H  HB2  . CYS B  2 59  ? 87.004  137.020 102.420 1.00 81.52  ? 59  CYS F HB2  1 
ATOM   7151  H  HB3  . CYS B  2 59  ? 85.638  137.821 102.392 1.00 81.52  ? 59  CYS F HB3  1 
ATOM   7152  N  N    . CYS B  2 60  ? 84.273  135.576 99.654  1.00 97.21  ? 60  CYS F N    1 
ATOM   7153  C  CA   . CYS B  2 60  ? 82.957  135.263 99.117  1.00 97.21  ? 60  CYS F CA   1 
ATOM   7154  C  C    . CYS B  2 60  ? 82.319  134.160 99.947  1.00 97.21  ? 60  CYS F C    1 
ATOM   7155  O  O    . CYS B  2 60  ? 82.891  133.661 100.915 1.00 97.21  ? 60  CYS F O    1 
ATOM   7156  C  CB   . CYS B  2 60  ? 83.044  134.816 97.659  1.00 97.21  ? 60  CYS F CB   1 
ATOM   7157  S  SG   . CYS B  2 60  ? 83.370  136.111 96.460  1.00 97.21  ? 60  CYS F SG   1 
ATOM   7158  H  H    . CYS B  2 60  ? 84.801  134.896 99.653  1.00 97.21  ? 60  CYS F H    1 
ATOM   7159  H  HA   . CYS B  2 60  ? 82.394  136.051 99.157  1.00 97.21  ? 60  CYS F HA   1 
ATOM   7160  H  HB2  . CYS B  2 60  ? 83.749  134.154 97.581  1.00 97.21  ? 60  CYS F HB2  1 
ATOM   7161  H  HB3  . CYS B  2 60  ? 82.198  134.414 97.410  1.00 97.21  ? 60  CYS F HB3  1 
ATOM   7162  N  N    . SER B  2 61  ? 81.063  133.807 99.633  1.00 104.08 ? 61  SER F N    1 
ATOM   7163  C  CA   . SER B  2 61  ? 80.329  132.697 100.304 1.00 104.08 ? 61  SER F CA   1 
ATOM   7164  C  C    . SER B  2 61  ? 79.571  131.885 99.251  1.00 104.08 ? 61  SER F C    1 
ATOM   7165  O  O    . SER B  2 61  ? 78.680  131.114 99.652  1.00 104.08 ? 61  SER F O    1 
ATOM   7166  C  CB   . SER B  2 61  ? 79.386  133.236 101.345 1.00 104.08 ? 61  SER F CB   1 
ATOM   7167  O  OG   . SER B  2 61  ? 79.891  134.430 101.922 1.00 104.08 ? 61  SER F OG   1 
ATOM   7168  H  H    . SER B  2 61  ? 80.520  134.297 99.085  1.00 104.08 ? 61  SER F H    1 
ATOM   7169  H  HA   . SER B  2 61  ? 80.986  132.096 100.744 1.00 104.08 ? 61  SER F HA   1 
ATOM   7170  H  HB2  . SER B  2 61  ? 78.513  133.420 100.931 1.00 104.08 ? 61  SER F HB2  1 
ATOM   7171  H  HB3  . SER B  2 61  ? 79.257  132.561 102.049 1.00 104.08 ? 61  SER F HB3  1 
ATOM   7172  H  HG   . SER B  2 61  ? 79.397  134.642 102.574 1.00 104.08 ? 61  SER F HG   1 
ATOM   7173  N  N    . THR B  2 62  ? 79.921  132.017 97.968  1.00 102.40 ? 62  THR F N    1 
ATOM   7174  C  CA   . THR B  2 62  ? 79.222  131.352 96.841  1.00 102.40 ? 62  THR F CA   1 
ATOM   7175  C  C    . THR B  2 62  ? 80.197  130.431 96.106  1.00 102.40 ? 62  THR F C    1 
ATOM   7176  O  O    . THR B  2 62  ? 81.413  130.583 96.327  1.00 102.40 ? 62  THR F O    1 
ATOM   7177  C  CB   . THR B  2 62  ? 78.662  132.413 95.888  1.00 102.40 ? 62  THR F CB   1 
ATOM   7178  O  OG1  . THR B  2 62  ? 78.619  133.643 96.613  1.00 102.40 ? 62  THR F OG1  1 
ATOM   7179  C  CG2  . THR B  2 62  ? 77.290  132.073 95.348  1.00 102.40 ? 62  THR F CG2  1 
ATOM   7180  H  H    . THR B  2 62  ? 80.639  132.500 97.691  1.00 102.40 ? 62  THR F H    1 
ATOM   7181  H  HA   . THR B  2 62  ? 78.480  130.814 97.196  1.00 102.40 ? 62  THR F HA   1 
ATOM   7182  H  HB   . THR B  2 62  ? 79.288  132.510 95.131  1.00 102.40 ? 62  THR F HB   1 
ATOM   7183  H  HG1  . THR B  2 62  ? 78.355  134.267 96.104  1.00 102.40 ? 62  THR F HG1  1 
ATOM   7184  H  HG21 . THR B  2 62  ? 77.013  132.754 94.710  1.00 102.40 ? 62  THR F HG21 1 
ATOM   7185  H  HG22 . THR B  2 62  ? 77.319  131.208 94.903  1.00 102.40 ? 62  THR F HG22 1 
ATOM   7186  H  HG23 . THR B  2 62  ? 76.651  132.037 96.082  1.00 102.40 ? 62  THR F HG23 1 
ATOM   7187  N  N    . ASP B  2 63  ? 79.698  129.517 95.272  1.00 95.37  ? 63  ASP F N    1 
ATOM   7188  C  CA   . ASP B  2 63  ? 80.522  128.590 94.509  1.00 95.37  ? 63  ASP F CA   1 
ATOM   7189  C  C    . ASP B  2 63  ? 81.338  129.338 93.467  1.00 95.37  ? 63  ASP F C    1 
ATOM   7190  O  O    . ASP B  2 63  ? 80.811  130.173 92.729  1.00 95.37  ? 63  ASP F O    1 
ATOM   7191  C  CB   . ASP B  2 63  ? 79.646  127.543 93.818  1.00 95.37  ? 63  ASP F CB   1 
ATOM   7192  C  CG   . ASP B  2 63  ? 79.209  126.432 94.754  1.00 95.37  ? 63  ASP F CG   1 
ATOM   7193  O  OD1  . ASP B  2 63  ? 80.021  126.004 95.599  1.00 95.37  ? 63  ASP F OD1  1 
ATOM   7194  O  OD2  . ASP B  2 63  ? 78.046  125.985 94.644  1.00 95.37  ? 63  ASP F OD2  1 
ATOM   7195  H  H    . ASP B  2 63  ? 78.845  129.392 95.186  1.00 95.37  ? 63  ASP F H    1 
ATOM   7196  H  HA   . ASP B  2 63  ? 81.136  128.129 95.105  1.00 95.37  ? 63  ASP F HA   1 
ATOM   7197  H  HB2  . ASP B  2 63  ? 78.856  127.976 93.453  1.00 95.37  ? 63  ASP F HB2  1 
ATOM   7198  H  HB3  . ASP B  2 63  ? 80.169  127.132 93.108  1.00 95.37  ? 63  ASP F HB3  1 
ATOM   7199  N  N    . LYS B  2 64  ? 82.633  129.018 93.400  1.00 83.90  ? 64  LYS F N    1 
ATOM   7200  C  CA   . LYS B  2 64  ? 83.510  129.530 92.352  1.00 83.90  ? 64  LYS F CA   1 
ATOM   7201  C  C    . LYS B  2 64  ? 83.467  131.053 92.288  1.00 83.90  ? 64  LYS F C    1 
ATOM   7202  O  O    . LYS B  2 64  ? 83.424  131.649 91.209  1.00 83.90  ? 64  LYS F O    1 
ATOM   7203  C  CB   . LYS B  2 64  ? 83.144  128.931 90.996  1.00 83.90  ? 64  LYS F CB   1 
ATOM   7204  C  CG   . LYS B  2 64  ? 83.357  127.434 90.889  1.00 83.90  ? 64  LYS F CG   1 
ATOM   7205  C  CD   . LYS B  2 64  ? 83.023  126.949 89.488  1.00 83.90  ? 64  LYS F CD   1 
ATOM   7206  C  CE   . LYS B  2 64  ? 83.019  125.432 89.364  1.00 83.90  ? 64  LYS F CE   1 
ATOM   7207  N  NZ   . LYS B  2 64  ? 83.623  124.709 90.516  1.00 83.90  ? 64  LYS F NZ   1 
ATOM   7208  H  H    . LYS B  2 64  ? 83.031  128.495 93.955  1.00 83.90  ? 64  LYS F H    1 
ATOM   7209  H  HA   . LYS B  2 64  ? 84.420  129.270 92.549  1.00 83.90  ? 64  LYS F HA   1 
ATOM   7210  H  HB2  . LYS B  2 64  ? 82.207  129.105 90.824  1.00 83.90  ? 64  LYS F HB2  1 
ATOM   7211  H  HB3  . LYS B  2 64  ? 83.686  129.354 90.314  1.00 83.90  ? 64  LYS F HB3  1 
ATOM   7212  H  HG2  . LYS B  2 64  ? 84.284  127.228 91.072  1.00 83.90  ? 64  LYS F HG2  1 
ATOM   7213  H  HG3  . LYS B  2 64  ? 82.778  126.979 91.519  1.00 83.90  ? 64  LYS F HG3  1 
ATOM   7214  H  HD2  . LYS B  2 64  ? 82.140  127.267 89.247  1.00 83.90  ? 64  LYS F HD2  1 
ATOM   7215  H  HD3  . LYS B  2 64  ? 83.681  127.297 88.868  1.00 83.90  ? 64  LYS F HD3  1 
ATOM   7216  H  HE2  . LYS B  2 64  ? 82.100  125.134 89.280  1.00 83.90  ? 64  LYS F HE2  1 
ATOM   7217  H  HE3  . LYS B  2 64  ? 83.516  125.185 88.569  1.00 83.90  ? 64  LYS F HE3  1 
ATOM   7218  H  HZ1  . LYS B  2 64  ? 83.949  123.929 90.239  1.00 83.90  ? 64  LYS F HZ1  1 
ATOM   7219  H  HZ2  . LYS B  2 64  ? 84.284  125.184 90.871  1.00 83.90  ? 64  LYS F HZ2  1 
ATOM   7220  H  HZ3  . LYS B  2 64  ? 83.004  124.559 91.137  1.00 83.90  ? 64  LYS F HZ3  1 
ATOM   7221  N  N    . CYS B  2 65  ? 83.475  131.691 93.453  1.00 88.64  ? 65  CYS F N    1 
ATOM   7222  C  CA   . CYS B  2 65  ? 83.533  133.143 93.533  1.00 88.64  ? 65  CYS F CA   1 
ATOM   7223  C  C    . CYS B  2 65  ? 84.960  133.664 93.611  1.00 88.64  ? 65  CYS F C    1 
ATOM   7224  O  O    . CYS B  2 65  ? 85.159  134.883 93.637  1.00 88.64  ? 65  CYS F O    1 
ATOM   7225  C  CB   . CYS B  2 65  ? 82.748  133.642 94.746  1.00 88.64  ? 65  CYS F CB   1 
ATOM   7226  S  SG   . CYS B  2 65  ? 82.468  135.439 94.764  1.00 88.64  ? 65  CYS F SG   1 
ATOM   7227  H  H    . CYS B  2 65  ? 83.456  131.300 94.219  1.00 88.64  ? 65  CYS F H    1 
ATOM   7228  H  HA   . CYS B  2 65  ? 83.122  133.514 92.738  1.00 88.64  ? 65  CYS F HA   1 
ATOM   7229  H  HB2  . CYS B  2 65  ? 81.883  133.207 94.761  1.00 88.64  ? 65  CYS F HB2  1 
ATOM   7230  H  HB3  . CYS B  2 65  ? 83.249  133.403 95.538  1.00 88.64  ? 65  CYS F HB3  1 
ATOM   7231  N  N    . ASN B  2 66  ? 85.951  132.776 93.641  1.00 62.35  ? 66  ASN F N    1 
ATOM   7232  C  CA   . ASN B  2 66  ? 87.355  133.148 93.800  1.00 62.35  ? 66  ASN F CA   1 
ATOM   7233  C  C    . ASN B  2 66  ? 88.177  132.491 92.700  1.00 62.35  ? 66  ASN F C    1 
ATOM   7234  O  O    . ASN B  2 66  ? 88.972  131.579 92.954  1.00 62.35  ? 66  ASN F O    1 
ATOM   7235  C  CB   . ASN B  2 66  ? 87.861  132.752 95.188  1.00 62.35  ? 66  ASN F CB   1 
ATOM   7236  C  CG   . ASN B  2 66  ? 87.886  131.256 95.396  1.00 62.35  ? 66  ASN F CG   1 
ATOM   7237  O  OD1  . ASN B  2 66  ? 87.247  130.505 94.663  1.00 62.35  ? 66  ASN F OD1  1 
ATOM   7238  N  ND2  . ASN B  2 66  ? 88.631  130.813 96.396  1.00 62.35  ? 66  ASN F ND2  1 
ATOM   7239  H  H    . ASN B  2 66  ? 85.834  131.928 93.569  1.00 62.35  ? 66  ASN F H    1 
ATOM   7240  H  HA   . ASN B  2 66  ? 87.444  134.107 93.705  1.00 62.35  ? 66  ASN F HA   1 
ATOM   7241  H  HB2  . ASN B  2 66  ? 88.764  133.080 95.302  1.00 62.35  ? 66  ASN F HB2  1 
ATOM   7242  H  HB3  . ASN B  2 66  ? 87.278  133.137 95.859  1.00 62.35  ? 66  ASN F HB3  1 
ATOM   7243  H  HD21 . ASN B  2 66  ? 88.680  129.971 96.555  1.00 62.35  ? 66  ASN F HD21 1 
ATOM   7244  H  HD22 . ASN B  2 66  ? 89.065  131.371 96.885  1.00 62.35  ? 66  ASN F HD22 1 
ATOM   7245  N  N    . PRO B  2 67  ? 88.013  132.938 91.461  1.00 54.99  ? 67  PRO F N    1 
ATOM   7246  C  CA   . PRO B  2 67  ? 88.819  132.386 90.371  1.00 54.99  ? 67  PRO F CA   1 
ATOM   7247  C  C    . PRO B  2 67  ? 90.104  133.160 90.150  1.00 54.99  ? 67  PRO F C    1 
ATOM   7248  O  O    . PRO B  2 67  ? 90.336  134.197 90.778  1.00 54.99  ? 67  PRO F O    1 
ATOM   7249  C  CB   . PRO B  2 67  ? 87.885  132.510 89.166  1.00 54.99  ? 67  PRO F CB   1 
ATOM   7250  C  CG   . PRO B  2 67  ? 87.133  133.762 89.444  1.00 54.99  ? 67  PRO F CG   1 
ATOM   7251  C  CD   . PRO B  2 67  ? 86.993  133.868 90.952  1.00 54.99  ? 67  PRO F CD   1 
ATOM   7252  H  HA   . PRO B  2 67  ? 89.021  131.454 90.531  1.00 54.99  ? 67  PRO F HA   1 
ATOM   7253  H  HB2  . PRO B  2 67  ? 88.408  132.591 88.355  1.00 54.99  ? 67  PRO F HB2  1 
ATOM   7254  H  HB3  . PRO B  2 67  ? 87.292  131.745 89.128  1.00 54.99  ? 67  PRO F HB3  1 
ATOM   7255  H  HG2  . PRO B  2 67  ? 87.635  134.516 89.101  1.00 54.99  ? 67  PRO F HG2  1 
ATOM   7256  H  HG3  . PRO B  2 67  ? 86.262  133.713 89.020  1.00 54.99  ? 67  PRO F HG3  1 
ATOM   7257  H  HD2  . PRO B  2 67  ? 87.186  134.771 91.246  1.00 54.99  ? 67  PRO F HD2  1 
ATOM   7258  H  HD3  . PRO B  2 67  ? 86.110  133.583 91.228  1.00 54.99  ? 67  PRO F HD3  1 
ATOM   7259  N  N    . HIS B  2 68  ? 90.998  132.643 89.313  1.00 43.54  ? 68  HIS F N    1 
ATOM   7260  C  CA   . HIS B  2 68  ? 92.256  133.351 88.976  1.00 43.54  ? 68  HIS F CA   1 
ATOM   7261  C  C    . HIS B  2 68  ? 91.847  134.605 88.185  1.00 43.54  ? 68  HIS F C    1 
ATOM   7262  O  O    . HIS B  2 68  ? 90.942  134.474 87.347  1.00 43.54  ? 68  HIS F O    1 
ATOM   7263  C  CB   . HIS B  2 68  ? 93.219  132.411 88.240  1.00 43.54  ? 68  HIS F CB   1 
ATOM   7264  C  CG   . HIS B  2 68  ? 94.591  132.967 88.068  1.00 43.54  ? 68  HIS F CG   1 
ATOM   7265  N  ND1  . HIS B  2 68  ? 95.564  132.863 89.035  1.00 43.54  ? 68  HIS F ND1  1 
ATOM   7266  C  CD2  . HIS B  2 68  ? 95.150  133.643 87.049  1.00 43.54  ? 68  HIS F CD2  1 
ATOM   7267  C  CE1  . HIS B  2 68  ? 96.655  133.455 88.618  1.00 43.54  ? 68  HIS F CE1  1 
ATOM   7268  N  NE2  . HIS B  2 68  ? 96.426  133.932 87.404  1.00 43.54  ? 68  HIS F NE2  1 
ATOM   7269  H  H    . HIS B  2 68  ? 90.911  131.838 88.896  1.00 43.54  ? 68  HIS F H    1 
ATOM   7270  H  HA   . HIS B  2 68  ? 92.676  133.625 89.816  1.00 43.54  ? 68  HIS F HA   1 
ATOM   7271  H  HB2  . HIS B  2 68  ? 93.281  131.566 88.740  1.00 43.54  ? 68  HIS F HB2  1 
ATOM   7272  H  HB3  . HIS B  2 68  ? 92.847  132.205 87.354  1.00 43.54  ? 68  HIS F HB3  1 
ATOM   7273  H  HD2  . HIS B  2 68  ? 94.747  133.851 86.231  1.00 43.54  ? 68  HIS F HD2  1 
ATOM   7274  H  HE1  . HIS B  2 68  ? 97.463  133.522 89.096  1.00 43.54  ? 68  HIS F HE1  1 
ATOM   7275  N  N    . PRO B  2 69  ? 92.497  135.784 88.311  1.00 45.50  ? 69  PRO F N    1 
ATOM   7276  C  CA   . PRO B  2 69  ? 92.054  136.978 87.577  1.00 45.50  ? 69  PRO F CA   1 
ATOM   7277  C  C    . PRO B  2 69  ? 91.824  136.840 86.060  1.00 45.50  ? 69  PRO F C    1 
ATOM   7278  O  O    . PRO B  2 69  ? 90.992  137.550 85.567  1.00 45.50  ? 69  PRO F O    1 
ATOM   7279  C  CB   . PRO B  2 69  ? 93.230  137.932 87.795  1.00 45.50  ? 69  PRO F CB   1 
ATOM   7280  C  CG   . PRO B  2 69  ? 93.716  137.605 89.179  1.00 45.50  ? 69  PRO F CG   1 
ATOM   7281  C  CD   . PRO B  2 69  ? 93.499  136.119 89.330  1.00 45.50  ? 69  PRO F CD   1 
ATOM   7282  H  HA   . PRO B  2 69  ? 91.245  137.348 88.011  1.00 45.50  ? 69  PRO F HA   1 
ATOM   7283  H  HB2  . PRO B  2 69  ? 93.935  137.778 87.131  1.00 45.50  ? 69  PRO F HB2  1 
ATOM   7284  H  HB3  . PRO B  2 69  ? 92.939  138.867 87.739  1.00 45.50  ? 69  PRO F HB3  1 
ATOM   7285  H  HG2  . PRO B  2 69  ? 94.664  137.828 89.276  1.00 45.50  ? 69  PRO F HG2  1 
ATOM   7286  H  HG3  . PRO B  2 69  ? 93.205  138.099 89.853  1.00 45.50  ? 69  PRO F HG3  1 
ATOM   7287  H  HD2  . PRO B  2 69  ? 94.328  135.628 89.181  1.00 45.50  ? 69  PRO F HD2  1 
ATOM   7288  H  HD3  . PRO B  2 69  ? 93.170  135.922 90.226  1.00 45.50  ? 69  PRO F HD3  1 
ATOM   7289  N  N    . LYS B  2 70  ? 92.612  136.033 85.348  1.00 47.04  ? 70  LYS F N    1 
ATOM   7290  C  CA   . LYS B  2 70  ? 92.463  135.734 83.890  1.00 47.04  ? 70  LYS F CA   1 
ATOM   7291  C  C    . LYS B  2 70  ? 91.023  135.299 83.546  1.00 47.04  ? 70  LYS F C    1 
ATOM   7292  O  O    . LYS B  2 70  ? 90.464  135.812 82.549  1.00 47.04  ? 70  LYS F O    1 
ATOM   7293  C  CB   . LYS B  2 70  ? 93.435  134.615 83.511  1.00 47.04  ? 70  LYS F CB   1 
ATOM   7294  C  CG   . LYS B  2 70  ? 94.891  135.047 83.433  1.00 47.04  ? 70  LYS F CG   1 
ATOM   7295  C  CD   . LYS B  2 70  ? 95.115  136.187 82.468  1.00 47.04  ? 70  LYS F CD   1 
ATOM   7296  C  CE   . LYS B  2 70  ? 96.069  137.235 82.997  1.00 47.04  ? 70  LYS F CE   1 
ATOM   7297  N  NZ   . LYS B  2 70  ? 95.498  137.957 84.158  1.00 47.04  ? 70  LYS F NZ   1 
ATOM   7298  H  H    . LYS B  2 70  ? 93.390  135.735 85.683  1.00 47.04  ? 70  LYS F H    1 
ATOM   7299  H  HA   . LYS B  2 70  ? 92.686  136.545 83.377  1.00 47.04  ? 70  LYS F HA   1 
ATOM   7300  H  HB2  . LYS B  2 70  ? 93.356  133.896 84.172  1.00 47.04  ? 70  LYS F HB2  1 
ATOM   7301  H  HB3  . LYS B  2 70  ? 93.169  134.253 82.640  1.00 47.04  ? 70  LYS F HB3  1 
ATOM   7302  H  HG2  . LYS B  2 70  ? 95.190  135.319 84.327  1.00 47.04  ? 70  LYS F HG2  1 
ATOM   7303  H  HG3  . LYS B  2 70  ? 95.435  134.279 83.155  1.00 47.04  ? 70  LYS F HG3  1 
ATOM   7304  H  HD2  . LYS B  2 70  ? 95.472  135.829 81.628  1.00 47.04  ? 70  LYS F HD2  1 
ATOM   7305  H  HD3  . LYS B  2 70  ? 94.253  136.613 82.273  1.00 47.04  ? 70  LYS F HD3  1 
ATOM   7306  H  HE2  . LYS B  2 70  ? 96.905  136.810 83.267  1.00 47.04  ? 70  LYS F HE2  1 
ATOM   7307  H  HE3  . LYS B  2 70  ? 96.271  137.878 82.292  1.00 47.04  ? 70  LYS F HE3  1 
ATOM   7308  H  HZ1  . LYS B  2 70  ? 96.063  138.617 84.417  1.00 47.04  ? 70  LYS F HZ1  1 
ATOM   7309  H  HZ2  . LYS B  2 70  ? 94.699  138.322 83.931  1.00 47.04  ? 70  LYS F HZ2  1 
ATOM   7310  H  HZ3  . LYS B  2 70  ? 95.376  137.381 84.848  1.00 47.04  ? 70  LYS F HZ3  1 
ATOM   7311  N  N    . GLN B  2 71  ? 90.454  134.426 84.389  1.00 49.29  ? 71  GLN F N    1 
ATOM   7312  C  CA   . GLN B  2 71  ? 89.097  133.817 84.355  1.00 49.29  ? 71  GLN F CA   1 
ATOM   7313  C  C    . GLN B  2 71  ? 88.060  134.822 84.870  1.00 49.29  ? 71  GLN F C    1 
ATOM   7314  O  O    . GLN B  2 71  ? 88.478  135.858 85.421  1.00 49.29  ? 71  GLN F O    1 
ATOM   7315  C  CB   . GLN B  2 71  ? 89.053  132.544 85.199  1.00 49.29  ? 71  GLN F CB   1 
ATOM   7316  C  CG   . GLN B  2 71  ? 89.980  131.445 84.712  1.00 49.29  ? 71  GLN F CG   1 
ATOM   7317  C  CD   . GLN B  2 71  ? 89.871  130.214 85.575  1.00 49.29  ? 71  GLN F CD   1 
ATOM   7318  O  OE1  . GLN B  2 71  ? 90.164  130.238 86.766  1.00 49.29  ? 71  GLN F OE1  1 
ATOM   7319  N  NE2  . GLN B  2 71  ? 89.450  129.117 84.974  1.00 49.29  ? 71  GLN F NE2  1 
ATOM   7320  H  H    . GLN B  2 71  ? 90.905  134.254 85.161  1.00 49.29  ? 71  GLN F H    1 
ATOM   7321  H  HA   . GLN B  2 71  ? 88.881  133.589 83.421  1.00 49.29  ? 71  GLN F HA   1 
ATOM   7322  H  HB2  . GLN B  2 71  ? 89.289  132.775 86.121  1.00 49.29  ? 71  GLN F HB2  1 
ATOM   7323  H  HB3  . GLN B  2 71  ? 88.133  132.206 85.202  1.00 49.29  ? 71  GLN F HB3  1 
ATOM   7324  H  HG2  . GLN B  2 71  ? 89.754  131.213 83.786  1.00 49.29  ? 71  GLN F HG2  1 
ATOM   7325  H  HG3  . GLN B  2 71  ? 90.906  131.770 84.726  1.00 49.29  ? 71  GLN F HG3  1 
ATOM   7326  H  HE21 . GLN B  2 71  ? 89.235  129.137 84.117  1.00 49.29  ? 71  GLN F HE21 1 
ATOM   7327  H  HE22 . GLN B  2 71  ? 89.382  128.362 85.429  1.00 49.29  ? 71  GLN F HE22 1 
ATOM   7328  N  N    . ILE C  2 1   ? 134.201 78.068  99.491  1.00 91.67  ? 1   ILE J N    1 
ATOM   7329  C  CA   . ILE C  2 1   ? 133.281 79.126  98.988  1.00 91.67  ? 1   ILE J CA   1 
ATOM   7330  C  C    . ILE C  2 1   ? 134.084 80.154  98.210  1.00 91.67  ? 1   ILE J C    1 
ATOM   7331  O  O    . ILE C  2 1   ? 135.130 80.615  98.662  1.00 91.67  ? 1   ILE J O    1 
ATOM   7332  C  CB   . ILE C  2 1   ? 132.499 79.786  100.142 1.00 91.67  ? 1   ILE J CB   1 
ATOM   7333  C  CG1  . ILE C  2 1   ? 131.366 80.661  99.600  1.00 91.67  ? 1   ILE J CG1  1 
ATOM   7334  C  CG2  . ILE C  2 1   ? 133.421 80.625  100.998 1.00 91.67  ? 1   ILE J CG2  1 
ATOM   7335  C  CD1  . ILE C  2 1   ? 130.197 79.892  99.052  1.00 91.67  ? 1   ILE J CD1  1 
ATOM   7336  H  H1   . ILE C  2 1   ? 133.736 77.444  99.921  1.00 91.67  ? 1   ILE J H1   1 
ATOM   7337  H  H2   . ILE C  2 1   ? 134.627 77.700  98.802  1.00 91.67  ? 1   ILE J H2   1 
ATOM   7338  H  H3   . ILE C  2 1   ? 134.798 78.431  100.043 1.00 91.67  ? 1   ILE J H3   1 
ATOM   7339  H  HA   . ILE C  2 1   ? 132.642 78.732  98.377  1.00 91.67  ? 1   ILE J HA   1 
ATOM   7340  H  HB   . ILE C  2 1   ? 132.112 79.088  100.693 1.00 91.67  ? 1   ILE J HB   1 
ATOM   7341  H  HG12 . ILE C  2 1   ? 131.034 81.218  100.322 1.00 91.67  ? 1   ILE J HG12 1 
ATOM   7342  H  HG13 . ILE C  2 1   ? 131.713 81.218  98.889  1.00 91.67  ? 1   ILE J HG13 1 
ATOM   7343  H  HG21 . ILE C  2 1   ? 132.951 80.897  101.800 1.00 91.67  ? 1   ILE J HG21 1 
ATOM   7344  H  HG22 . ILE C  2 1   ? 134.203 80.103  101.236 1.00 91.67  ? 1   ILE J HG22 1 
ATOM   7345  H  HG23 . ILE C  2 1   ? 133.680 81.408  100.494 1.00 91.67  ? 1   ILE J HG23 1 
ATOM   7346  H  HD11 . ILE C  2 1   ? 129.544 80.521  98.706  1.00 91.67  ? 1   ILE J HD11 1 
ATOM   7347  H  HD12 . ILE C  2 1   ? 130.508 79.313  98.341  1.00 91.67  ? 1   ILE J HD12 1 
ATOM   7348  H  HD13 . ILE C  2 1   ? 129.803 79.367  99.765  1.00 91.67  ? 1   ILE J HD13 1 
ATOM   7349  N  N    . VAL C  2 2   ? 133.584 80.507  97.031  1.00 84.68  ? 2   VAL J N    1 
ATOM   7350  C  CA   . VAL C  2 2   ? 134.218 81.483  96.156  1.00 84.68  ? 2   VAL J CA   1 
ATOM   7351  C  C    . VAL C  2 2   ? 133.285 82.676  96.045  1.00 84.68  ? 2   VAL J C    1 
ATOM   7352  O  O    . VAL C  2 2   ? 132.134 82.535  95.613  1.00 84.68  ? 2   VAL J O    1 
ATOM   7353  C  CB   . VAL C  2 2   ? 134.527 80.895  94.772  1.00 84.68  ? 2   VAL J CB   1 
ATOM   7354  C  CG1  . VAL C  2 2   ? 135.084 81.957  93.855  1.00 84.68  ? 2   VAL J CG1  1 
ATOM   7355  C  CG2  . VAL C  2 2   ? 135.515 79.761  94.900  1.00 84.68  ? 2   VAL J CG2  1 
ATOM   7356  H  H    . VAL C  2 2   ? 132.855 80.185  96.713  1.00 84.68  ? 2   VAL J H    1 
ATOM   7357  H  HA   . VAL C  2 2   ? 135.052 81.782  96.550  1.00 84.68  ? 2   VAL J HA   1 
ATOM   7358  H  HB   . VAL C  2 2   ? 133.712 80.549  94.380  1.00 84.68  ? 2   VAL J HB   1 
ATOM   7359  H  HG11 . VAL C  2 2   ? 135.291 81.548  93.001  1.00 84.68  ? 2   VAL J HG11 1 
ATOM   7360  H  HG12 . VAL C  2 2   ? 134.428 82.660  93.734  1.00 84.68  ? 2   VAL J HG12 1 
ATOM   7361  H  HG13 . VAL C  2 2   ? 135.891 82.312  94.256  1.00 84.68  ? 2   VAL J HG13 1 
ATOM   7362  H  HG21 . VAL C  2 2   ? 135.716 79.421  94.015  1.00 84.68  ? 2   VAL J HG21 1 
ATOM   7363  H  HG22 . VAL C  2 2   ? 136.322 80.104  95.316  1.00 84.68  ? 2   VAL J HG22 1 
ATOM   7364  H  HG23 . VAL C  2 2   ? 135.129 79.062  95.450  1.00 84.68  ? 2   VAL J HG23 1 
ATOM   7365  N  N    . CYS C  2 3   ? 133.782 83.847  96.427  1.00 78.65  ? 3   CYS J N    1 
ATOM   7366  C  CA   . CYS C  2 3   ? 132.997 85.068  96.452  1.00 78.65  ? 3   CYS J CA   1 
ATOM   7367  C  C    . CYS C  2 3   ? 133.681 86.115  95.586  1.00 78.65  ? 3   CYS J C    1 
ATOM   7368  O  O    . CYS C  2 3   ? 134.898 86.302  95.682  1.00 78.65  ? 3   CYS J O    1 
ATOM   7369  C  CB   . CYS C  2 3   ? 132.852 85.581  97.884  1.00 78.65  ? 3   CYS J CB   1 
ATOM   7370  S  SG   . CYS C  2 3   ? 131.932 84.493  99.010  1.00 78.65  ? 3   CYS J SG   1 
ATOM   7371  H  H    . CYS C  2 3   ? 134.594 83.960  96.684  1.00 78.65  ? 3   CYS J H    1 
ATOM   7372  H  HA   . CYS C  2 3   ? 132.113 84.899  96.094  1.00 78.65  ? 3   CYS J HA   1 
ATOM   7373  H  HB2  . CYS C  2 3   ? 133.743 85.689  98.249  1.00 78.65  ? 3   CYS J HB2  1 
ATOM   7374  H  HB3  . CYS C  2 3   ? 132.401 86.437  97.866  1.00 78.65  ? 3   CYS J HB3  1 
ATOM   7375  N  N    . HIS C  2 4   ? 132.903 86.790  94.746  1.00 60.60  ? 4   HIS J N    1 
ATOM   7376  C  CA   . HIS C  2 4   ? 133.422 87.932  94.010  1.00 60.60  ? 4   HIS J CA   1 
ATOM   7377  C  C    . HIS C  2 4   ? 133.829 89.032  94.983  1.00 60.60  ? 4   HIS J C    1 
ATOM   7378  O  O    . HIS C  2 4   ? 133.266 89.169  96.071  1.00 60.60  ? 4   HIS J O    1 
ATOM   7379  C  CB   . HIS C  2 4   ? 132.372 88.467  93.040  1.00 60.60  ? 4   HIS J CB   1 
ATOM   7380  C  CG   . HIS C  2 4   ? 132.282 87.712  91.753  1.00 60.60  ? 4   HIS J CG   1 
ATOM   7381  N  ND1  . HIS C  2 4   ? 133.300 87.688  90.827  1.00 60.60  ? 4   HIS J ND1  1 
ATOM   7382  C  CD2  . HIS C  2 4   ? 131.277 86.973  91.226  1.00 60.60  ? 4   HIS J CD2  1 
ATOM   7383  C  CE1  . HIS C  2 4   ? 132.933 86.955  89.791  1.00 60.60  ? 4   HIS J CE1  1 
ATOM   7384  N  NE2  . HIS C  2 4   ? 131.709 86.512  90.008  1.00 60.60  ? 4   HIS J NE2  1 
ATOM   7385  H  H    . HIS C  2 4   ? 132.079 86.605  94.580  1.00 60.60  ? 4   HIS J H    1 
ATOM   7386  H  HA   . HIS C  2 4   ? 134.201 87.667  93.502  1.00 60.60  ? 4   HIS J HA   1 
ATOM   7387  H  HB2  . HIS C  2 4   ? 131.505 88.423  93.468  1.00 60.60  ? 4   HIS J HB2  1 
ATOM   7388  H  HB3  . HIS C  2 4   ? 132.593 89.384  92.825  1.00 60.60  ? 4   HIS J HB3  1 
ATOM   7389  H  HD2  . HIS C  2 4   ? 130.452 86.808  91.617  1.00 60.60  ? 4   HIS J HD2  1 
ATOM   7390  H  HE1  . HIS C  2 4   ? 133.445 86.783  89.036  1.00 60.60  ? 4   HIS J HE1  1 
ATOM   7391  N  N    . THR C  2 5   ? 134.823 89.822  94.587  1.00 53.99  ? 5   THR J N    1 
ATOM   7392  C  CA   . THR C  2 5   ? 135.283 90.933  95.404  1.00 53.99  ? 5   THR J CA   1 
ATOM   7393  C  C    . THR C  2 5   ? 135.658 92.105  94.509  1.00 53.99  ? 5   THR J C    1 
ATOM   7394  O  O    . THR C  2 5   ? 135.900 91.949  93.310  1.00 53.99  ? 5   THR J O    1 
ATOM   7395  C  CB   . THR C  2 5   ? 136.476 90.538  96.282  1.00 53.99  ? 5   THR J CB   1 
ATOM   7396  O  OG1  . THR C  2 5   ? 136.810 91.619  97.159  1.00 53.99  ? 5   THR J OG1  1 
ATOM   7397  C  CG2  . THR C  2 5   ? 137.680 90.203  95.434  1.00 53.99  ? 5   THR J CG2  1 
ATOM   7398  H  H    . THR C  2 5   ? 135.248 89.731  93.846  1.00 53.99  ? 5   THR J H    1 
ATOM   7399  H  HA   . THR C  2 5   ? 134.560 91.214  95.985  1.00 53.99  ? 5   THR J HA   1 
ATOM   7400  H  HB   . THR C  2 5   ? 136.244 89.756  96.805  1.00 53.99  ? 5   THR J HB   1 
ATOM   7401  H  HG1  . THR C  2 5   ? 137.498 91.425  97.600  1.00 53.99  ? 5   THR J HG1  1 
ATOM   7402  H  HG21 . THR C  2 5   ? 138.399 89.887  96.000  1.00 53.99  ? 5   THR J HG21 1 
ATOM   7403  H  HG22 . THR C  2 5   ? 137.451 89.516  94.790  1.00 53.99  ? 5   THR J HG22 1 
ATOM   7404  H  HG23 . THR C  2 5   ? 137.980 90.992  94.963  1.00 53.99  ? 5   THR J HG23 1 
ATOM   7405  N  N    . THR C  2 6   ? 135.705 93.291  95.117  1.00 42.63  ? 6   THR J N    1 
ATOM   7406  C  CA   . THR C  2 6   ? 136.040 94.520  94.418  1.00 42.63  ? 6   THR J CA   1 
ATOM   7407  C  C    . THR C  2 6   ? 137.364 95.119  94.854  1.00 42.63  ? 6   THR J C    1 
ATOM   7408  O  O    . THR C  2 6   ? 137.858 96.035  94.187  1.00 42.63  ? 6   THR J O    1 
ATOM   7409  C  CB   . THR C  2 6   ? 134.942 95.570  94.622  1.00 42.63  ? 6   THR J CB   1 
ATOM   7410  O  OG1  . THR C  2 6   ? 134.808 95.861  96.018  1.00 42.63  ? 6   THR J OG1  1 
ATOM   7411  C  CG2  . THR C  2 6   ? 133.637 95.082  94.079  1.00 42.63  ? 6   THR J CG2  1 
ATOM   7412  H  H    . THR C  2 6   ? 135.554 93.405  95.954  1.00 42.63  ? 6   THR J H    1 
ATOM   7413  H  HA   . THR C  2 6   ? 136.089 94.333  93.470  1.00 42.63  ? 6   THR J HA   1 
ATOM   7414  H  HB   . THR C  2 6   ? 135.182 96.377  94.148  1.00 42.63  ? 6   THR J HB   1 
ATOM   7415  H  HG1  . THR C  2 6   ? 134.229 96.456  96.129  1.00 42.63  ? 6   THR J HG1  1 
ATOM   7416  H  HG21 . THR C  2 6   ? 132.955 95.757  94.211  1.00 42.63  ? 6   THR J HG21 1 
ATOM   7417  H  HG22 . THR C  2 6   ? 133.721 94.900  93.131  1.00 42.63  ? 6   THR J HG22 1 
ATOM   7418  H  HG23 . THR C  2 6   ? 133.378 94.272  94.540  1.00 42.63  ? 6   THR J HG23 1 
ATOM   7419  N  N    . ALA C  2 7   ? 137.953 94.638  95.950  1.00 49.46  ? 7   ALA J N    1 
ATOM   7420  C  CA   . ALA C  2 7   ? 139.260 95.131  96.355  1.00 49.46  ? 7   ALA J CA   1 
ATOM   7421  C  C    . ALA C  2 7   ? 140.327 94.802  95.324  1.00 49.46  ? 7   ALA J C    1 
ATOM   7422  O  O    . ALA C  2 7   ? 141.419 95.379  95.366  1.00 49.46  ? 7   ALA J O    1 
ATOM   7423  C  CB   . ALA C  2 7   ? 139.642 94.551  97.713  1.00 49.46  ? 7   ALA J CB   1 
ATOM   7424  H  H    . ALA C  2 7   ? 137.619 94.039  96.465  1.00 49.46  ? 7   ALA J H    1 
ATOM   7425  H  HA   . ALA C  2 7   ? 139.218 96.094  96.447  1.00 49.46  ? 7   ALA J HA   1 
ATOM   7426  H  HB1  . ALA C  2 7   ? 140.516 94.886  97.960  1.00 49.46  ? 7   ALA J HB1  1 
ATOM   7427  H  HB2  . ALA C  2 7   ? 138.981 94.829  98.366  1.00 49.46  ? 7   ALA J HB2  1 
ATOM   7428  H  HB3  . ALA C  2 7   ? 139.659 93.584  97.645  1.00 49.46  ? 7   ALA J HB3  1 
ATOM   7429  N  N    . THR C  2 8   ? 140.036 93.886  94.407  1.00 50.37  ? 8   THR J N    1 
ATOM   7430  C  CA   . THR C  2 8   ? 140.914 93.549  93.298  1.00 50.37  ? 8   THR J CA   1 
ATOM   7431  C  C    . THR C  2 8   ? 140.314 94.082  92.006  1.00 50.37  ? 8   THR J C    1 
ATOM   7432  O  O    . THR C  2 8   ? 139.151 93.803  91.697  1.00 50.37  ? 8   THR J O    1 
ATOM   7433  C  CB   . THR C  2 8   ? 141.109 92.036  93.196  1.00 50.37  ? 8   THR J CB   1 
ATOM   7434  O  OG1  . THR C  2 8   ? 141.548 91.518  94.458  1.00 50.37  ? 8   THR J OG1  1 
ATOM   7435  C  CG2  . THR C  2 8   ? 142.131 91.693  92.117  1.00 50.37  ? 8   THR J CG2  1 
ATOM   7436  H  H    . THR C  2 8   ? 139.309 93.431  94.407  1.00 50.37  ? 8   THR J H    1 
ATOM   7437  H  HA   . THR C  2 8   ? 141.777 93.967  93.432  1.00 50.37  ? 8   THR J HA   1 
ATOM   7438  H  HB   . THR C  2 8   ? 140.266 91.625  92.958  1.00 50.37  ? 8   THR J HB   1 
ATOM   7439  H  HG1  . THR C  2 8   ? 141.538 90.679  94.441  1.00 50.37  ? 8   THR J HG1  1 
ATOM   7440  H  HG21 . THR C  2 8   ? 142.305 90.740  92.114  1.00 50.37  ? 8   THR J HG21 1 
ATOM   7441  H  HG22 . THR C  2 8   ? 141.794 91.950  91.244  1.00 50.37  ? 8   THR J HG22 1 
ATOM   7442  H  HG23 . THR C  2 8   ? 142.960 92.165  92.284  1.00 50.37  ? 8   THR J HG23 1 
ATOM   7443  N  N    . SER C  2 9   ? 141.107 94.844  91.258  1.00 40.70  ? 9   SER J N    1 
ATOM   7444  C  CA   . SER C  2 9   ? 140.714 95.344  89.957  1.00 40.70  ? 9   SER J CA   1 
ATOM   7445  C  C    . SER C  2 9   ? 141.623 94.751  88.890  1.00 40.70  ? 9   SER J C    1 
ATOM   7446  O  O    . SER C  2 9   ? 142.852 94.851  89.013  1.00 40.70  ? 9   SER J O    1 
ATOM   7447  C  CB   . SER C  2 9   ? 140.788 96.872  89.911  1.00 40.70  ? 9   SER J CB   1 
ATOM   7448  O  OG   . SER C  2 9   ? 140.661 97.343  88.582  1.00 40.70  ? 9   SER J OG   1 
ATOM   7449  H  H    . SER C  2 9   ? 141.892 95.096  91.497  1.00 40.70  ? 9   SER J H    1 
ATOM   7450  H  HA   . SER C  2 9   ? 139.799 95.090  89.785  1.00 40.70  ? 9   SER J HA   1 
ATOM   7451  H  HB2  . SER C  2 9   ? 140.064 97.236  90.442  1.00 40.70  ? 9   SER J HB2  1 
ATOM   7452  H  HB3  . SER C  2 9   ? 141.641 97.156  90.270  1.00 40.70  ? 9   SER J HB3  1 
ATOM   7453  H  HG   . SER C  2 9   ? 140.695 98.179  88.575  1.00 40.70  ? 9   SER J HG   1 
ATOM   7454  N  N    . PRO C  2 10  ? 141.079 94.131  87.830  1.00 47.49  ? 10  PRO J N    1 
ATOM   7455  C  CA   . PRO C  2 10  ? 139.659 93.956  87.503  1.00 47.49  ? 10  PRO J CA   1 
ATOM   7456  C  C    . PRO C  2 10  ? 138.912 93.082  88.501  1.00 47.49  ? 10  PRO J C    1 
ATOM   7457  O  O    . PRO C  2 10  ? 139.542 92.358  89.269  1.00 47.49  ? 10  PRO J O    1 
ATOM   7458  C  CB   . PRO C  2 10  ? 139.696 93.284  86.128  1.00 47.49  ? 10  PRO J CB   1 
ATOM   7459  C  CG   . PRO C  2 10  ? 141.029 93.601  85.578  1.00 47.49  ? 10  PRO J CG   1 
ATOM   7460  C  CD   . PRO C  2 10  ? 141.942 93.628  86.750  1.00 47.49  ? 10  PRO J CD   1 
ATOM   7461  H  HA   . PRO C  2 10  ? 139.220 94.816  87.434  1.00 47.49  ? 10  PRO J HA   1 
ATOM   7462  H  HB2  . PRO C  2 10  ? 139.591 92.327  86.235  1.00 47.49  ? 10  PRO J HB2  1 
ATOM   7463  H  HB3  . PRO C  2 10  ? 138.995 93.645  85.566  1.00 47.49  ? 10  PRO J HB3  1 
ATOM   7464  H  HG2  . PRO C  2 10  ? 141.297 92.912  84.950  1.00 47.49  ? 10  PRO J HG2  1 
ATOM   7465  H  HG3  . PRO C  2 10  ? 141.006 94.467  85.145  1.00 47.49  ? 10  PRO J HG3  1 
ATOM   7466  H  HD2  . PRO C  2 10  ? 142.253 92.733  86.955  1.00 47.49  ? 10  PRO J HD2  1 
ATOM   7467  H  HD3  . PRO C  2 10  ? 142.676 94.239  86.596  1.00 47.49  ? 10  PRO J HD3  1 
ATOM   7468  N  N    . ILE C  2 11  ? 137.580 93.170  88.490  1.00 47.05  ? 11  ILE J N    1 
ATOM   7469  C  CA   . ILE C  2 11  ? 136.772 92.384  89.413  1.00 47.05  ? 11  ILE J CA   1 
ATOM   7470  C  C    . ILE C  2 11  ? 137.199 90.932  89.337  1.00 47.05  ? 11  ILE J C    1 
ATOM   7471  O  O    . ILE C  2 11  ? 137.260 90.338  88.255  1.00 47.05  ? 11  ILE J O    1 
ATOM   7472  C  CB   . ILE C  2 11  ? 135.277 92.558  89.096  1.00 47.05  ? 11  ILE J CB   1 
ATOM   7473  C  CG1  . ILE C  2 11  ? 134.844 93.984  89.426  1.00 47.05  ? 11  ILE J CG1  1 
ATOM   7474  C  CG2  . ILE C  2 11  ? 134.442 91.558  89.891  1.00 47.05  ? 11  ILE J CG2  1 
ATOM   7475  C  CD1  . ILE C  2 11  ? 133.393 94.263  89.172  1.00 47.05  ? 11  ILE J CD1  1 
ATOM   7476  H  H    . ILE C  2 11  ? 137.126 93.675  87.964  1.00 47.05  ? 11  ILE J H    1 
ATOM   7477  H  HA   . ILE C  2 11  ? 136.926 92.696  90.317  1.00 47.05  ? 11  ILE J HA   1 
ATOM   7478  H  HB   . ILE C  2 11  ? 135.142 92.400  88.150  1.00 47.05  ? 11  ILE J HB   1 
ATOM   7479  H  HG12 . ILE C  2 11  ? 135.010 94.145  90.365  1.00 47.05  ? 11  ILE J HG12 1 
ATOM   7480  H  HG13 . ILE C  2 11  ? 135.362 94.598  88.886  1.00 47.05  ? 11  ILE J HG13 1 
ATOM   7481  H  HG21 . ILE C  2 11  ? 133.503 91.683  89.685  1.00 47.05  ? 11  ILE J HG21 1 
ATOM   7482  H  HG22 . ILE C  2 11  ? 134.699 90.655  89.655  1.00 47.05  ? 11  ILE J HG22 1 
ATOM   7483  H  HG23 . ILE C  2 11  ? 134.594 91.712  90.835  1.00 47.05  ? 11  ILE J HG23 1 
ATOM   7484  H  HD11 . ILE C  2 11  ? 133.231 95.208  89.298  1.00 47.05  ? 11  ILE J HD11 1 
ATOM   7485  H  HD12 . ILE C  2 11  ? 133.176 94.006  88.263  1.00 47.05  ? 11  ILE J HD12 1 
ATOM   7486  H  HD13 . ILE C  2 11  ? 132.860 93.754  89.799  1.00 47.05  ? 11  ILE J HD13 1 
ATOM   7487  N  N    . SER C  2 12  ? 137.488 90.354  90.493  1.00 55.79  ? 12  SER J N    1 
ATOM   7488  C  CA   . SER C  2 12  ? 138.055 89.023  90.604  1.00 55.79  ? 12  SER J CA   1 
ATOM   7489  C  C    . SER C  2 12  ? 137.012 88.034  91.102  1.00 55.79  ? 12  SER J C    1 
ATOM   7490  O  O    . SER C  2 12  ? 135.889 88.394  91.464  1.00 55.79  ? 12  SER J O    1 
ATOM   7491  C  CB   . SER C  2 12  ? 139.254 89.037  91.554  1.00 55.79  ? 12  SER J CB   1 
ATOM   7492  O  OG   . SER C  2 12  ? 138.855 89.461  92.844  1.00 55.79  ? 12  SER J OG   1 
ATOM   7493  H  H    . SER C  2 12  ? 137.362 90.733  91.253  1.00 55.79  ? 12  SER J H    1 
ATOM   7494  H  HA   . SER C  2 12  ? 138.362 88.729  89.733  1.00 55.79  ? 12  SER J HA   1 
ATOM   7495  H  HB2  . SER C  2 12  ? 139.624 88.143  91.612  1.00 55.79  ? 12  SER J HB2  1 
ATOM   7496  H  HB3  . SER C  2 12  ? 139.918 89.653  91.213  1.00 55.79  ? 12  SER J HB3  1 
ATOM   7497  H  HG   . SER C  2 12  ? 139.522 89.709  93.285  1.00 55.79  ? 12  SER J HG   1 
ATOM   7498  N  N    . ALA C  2 13  ? 137.412 86.764  91.113  1.00 68.91  ? 13  ALA J N    1 
ATOM   7499  C  CA   . ALA C  2 13  ? 136.608 85.694  91.683  1.00 68.91  ? 13  ALA J CA   1 
ATOM   7500  C  C    . ALA C  2 13  ? 137.371 85.043  92.824  1.00 68.91  ? 13  ALA J C    1 
ATOM   7501  O  O    . ALA C  2 13  ? 137.464 83.815  92.895  1.00 68.91  ? 13  ALA J O    1 
ATOM   7502  C  CB   . ALA C  2 13  ? 136.251 84.659  90.621  1.00 68.91  ? 13  ALA J CB   1 
ATOM   7503  H  H    . ALA C  2 13  ? 138.157 86.494  90.782  1.00 68.91  ? 13  ALA J H    1 
ATOM   7504  H  HA   . ALA C  2 13  ? 135.785 86.057  92.040  1.00 68.91  ? 13  ALA J HA   1 
ATOM   7505  H  HB1  . ALA C  2 13  ? 135.716 83.962  91.031  1.00 68.91  ? 13  ALA J HB1  1 
ATOM   7506  H  HB2  . ALA C  2 13  ? 135.750 85.094  89.915  1.00 68.91  ? 13  ALA J HB2  1 
ATOM   7507  H  HB3  . ALA C  2 13  ? 137.072 84.285  90.269  1.00 68.91  ? 13  ALA J HB3  1 
ATOM   7508  N  N    . VAL C  2 14  ? 137.935 85.864  93.712  1.00 72.36  ? 14  VAL J N    1 
ATOM   7509  C  CA   . VAL C  2 14  ? 138.810 85.343  94.750  1.00 72.36  ? 14  VAL J CA   1 
ATOM   7510  C  C    . VAL C  2 14  ? 138.083 84.263  95.539  1.00 72.36  ? 14  VAL J C    1 
ATOM   7511  O  O    . VAL C  2 14  ? 136.851 84.262  95.654  1.00 72.36  ? 14  VAL J O    1 
ATOM   7512  C  CB   . VAL C  2 14  ? 139.299 86.466  95.680  1.00 72.36  ? 14  VAL J CB   1 
ATOM   7513  C  CG1  . VAL C  2 14  ? 138.175 86.968  96.566  1.00 72.36  ? 14  VAL J CG1  1 
ATOM   7514  C  CG2  . VAL C  2 14  ? 140.453 85.988  96.526  1.00 72.36  ? 14  VAL J CG2  1 
ATOM   7515  H  H    . VAL C  2 14  ? 137.822 86.716  93.735  1.00 72.36  ? 14  VAL J H    1 
ATOM   7516  H  HA   . VAL C  2 14  ? 139.587 84.943  94.332  1.00 72.36  ? 14  VAL J HA   1 
ATOM   7517  H  HB   . VAL C  2 14  ? 139.614 87.207  95.143  1.00 72.36  ? 14  VAL J HB   1 
ATOM   7518  H  HG11 . VAL C  2 14  ? 138.507 87.709  97.094  1.00 72.36  ? 14  VAL J HG11 1 
ATOM   7519  H  HG12 . VAL C  2 14  ? 137.440 87.259  96.007  1.00 72.36  ? 14  VAL J HG12 1 
ATOM   7520  H  HG13 . VAL C  2 14  ? 137.885 86.257  97.156  1.00 72.36  ? 14  VAL J HG13 1 
ATOM   7521  H  HG21 . VAL C  2 14  ? 140.823 86.747  97.002  1.00 72.36  ? 14  VAL J HG21 1 
ATOM   7522  H  HG22 . VAL C  2 14  ? 140.124 85.329  97.157  1.00 72.36  ? 14  VAL J HG22 1 
ATOM   7523  H  HG23 . VAL C  2 14  ? 141.127 85.595  95.950  1.00 72.36  ? 14  VAL J HG23 1 
ATOM   7524  N  N    . THR C  2 15  ? 138.857 83.333  96.084  1.00 85.01  ? 15  THR J N    1 
ATOM   7525  C  CA   . THR C  2 15  ? 138.327 82.232  96.876  1.00 85.01  ? 15  THR J CA   1 
ATOM   7526  C  C    . THR C  2 15  ? 138.461 82.590  98.353  1.00 85.01  ? 15  THR J C    1 
ATOM   7527  O  O    . THR C  2 15  ? 139.562 82.883  98.831  1.00 85.01  ? 15  THR J O    1 
ATOM   7528  C  CB   . THR C  2 15  ? 139.045 80.925  96.528  1.00 85.01  ? 15  THR J CB   1 
ATOM   7529  O  OG1  . THR C  2 15  ? 138.434 79.830  97.222  1.00 85.01  ? 15  THR J OG1  1 
ATOM   7530  C  CG2  . THR C  2 15  ? 140.531 80.988  96.849  1.00 85.01  ? 15  THR J CG2  1 
ATOM   7531  H  H    . THR C  2 15  ? 139.712 83.321  96.014  1.00 85.01  ? 15  THR J H    1 
ATOM   7532  H  HA   . THR C  2 15  ? 137.386 82.122  96.672  1.00 85.01  ? 15  THR J HA   1 
ATOM   7533  H  HB   . THR C  2 15  ? 138.964 80.779  95.573  1.00 85.01  ? 15  THR J HB   1 
ATOM   7534  H  HG1  . THR C  2 15  ? 138.891 79.134  97.106  1.00 85.01  ? 15  THR J HG1  1 
ATOM   7535  H  HG21 . THR C  2 15  ? 140.935 80.128  96.649  1.00 85.01  ? 15  THR J HG21 1 
ATOM   7536  H  HG22 . THR C  2 15  ? 140.978 81.674  96.321  1.00 85.01  ? 15  THR J HG22 1 
ATOM   7537  H  HG23 . THR C  2 15  ? 140.653 81.174  97.786  1.00 85.01  ? 15  THR J HG23 1 
ATOM   7538  N  N    . CYS C  2 16  ? 137.335 82.582  99.060  1.00 97.15  ? 16  CYS J N    1 
ATOM   7539  C  CA   . CYS C  2 16  ? 137.264 83.189  100.378 1.00 97.15  ? 16  CYS J CA   1 
ATOM   7540  C  C    . CYS C  2 16  ? 138.008 82.339  101.409 1.00 97.15  ? 16  CYS J C    1 
ATOM   7541  O  O    . CYS C  2 16  ? 138.088 81.115  101.278 1.00 97.15  ? 16  CYS J O    1 
ATOM   7542  C  CB   . CYS C  2 16  ? 135.806 83.354  100.797 1.00 97.15  ? 16  CYS J CB   1 
ATOM   7543  S  SG   . CYS C  2 16  ? 135.511 84.183  102.386 1.00 97.15  ? 16  CYS J SG   1 
ATOM   7544  H  H    . CYS C  2 16  ? 136.598 82.225  98.797  1.00 97.15  ? 16  CYS J H    1 
ATOM   7545  H  HA   . CYS C  2 16  ? 137.673 84.065  100.334 1.00 97.15  ? 16  CYS J HA   1 
ATOM   7546  H  HB2  . CYS C  2 16  ? 135.341 83.855  100.111 1.00 97.15  ? 16  CYS J HB2  1 
ATOM   7547  H  HB3  . CYS C  2 16  ? 135.427 82.468  100.868 1.00 97.15  ? 16  CYS J HB3  1 
ATOM   7548  N  N    . PRO C  2 17  ? 138.565 82.966  102.442 1.00 105.60 ? 17  PRO J N    1 
ATOM   7549  C  CA   . PRO C  2 17  ? 139.182 82.200  103.528 1.00 105.60 ? 17  PRO J CA   1 
ATOM   7550  C  C    . PRO C  2 17  ? 138.135 81.494  104.368 1.00 105.60 ? 17  PRO J C    1 
ATOM   7551  O  O    . PRO C  2 17  ? 136.929 81.720  104.193 1.00 105.60 ? 17  PRO J O    1 
ATOM   7552  C  CB   . PRO C  2 17  ? 139.919 83.274  104.345 1.00 105.60 ? 17  PRO J CB   1 
ATOM   7553  C  CG   . PRO C  2 17  ? 139.196 84.534  104.029 1.00 105.60 ? 17  PRO J CG   1 
ATOM   7554  C  CD   . PRO C  2 17  ? 138.825 84.407  102.591 1.00 105.60 ? 17  PRO J CD   1 
ATOM   7555  H  HA   . PRO C  2 17  ? 139.817 81.558  103.173 1.00 105.60 ? 17  PRO J HA   1 
ATOM   7556  H  HB2  . PRO C  2 17  ? 139.857 83.067  105.289 1.00 105.60 ? 17  PRO J HB2  1 
ATOM   7557  H  HB3  . PRO C  2 17  ? 140.844 83.327  104.058 1.00 105.60 ? 17  PRO J HB3  1 
ATOM   7558  H  HG2  . PRO C  2 17  ? 138.402 84.594  104.581 1.00 105.60 ? 17  PRO J HG2  1 
ATOM   7559  H  HG3  . PRO C  2 17  ? 139.777 85.295  104.175 1.00 105.60 ? 17  PRO J HG3  1 
ATOM   7560  H  HD2  . PRO C  2 17  ? 138.034 84.931  102.397 1.00 105.60 ? 17  PRO J HD2  1 
ATOM   7561  H  HD3  . PRO C  2 17  ? 139.567 84.673  102.027 1.00 105.60 ? 17  PRO J HD3  1 
ATOM   7562  N  N    . PRO C  2 18  ? 138.554 80.628  105.289 1.00 109.09 ? 18  PRO J N    1 
ATOM   7563  C  CA   . PRO C  2 18  ? 137.586 79.933  106.145 1.00 109.09 ? 18  PRO J CA   1 
ATOM   7564  C  C    . PRO C  2 18  ? 136.958 80.868  107.165 1.00 109.09 ? 18  PRO J C    1 
ATOM   7565  O  O    . PRO C  2 18  ? 137.468 81.953  107.458 1.00 109.09 ? 18  PRO J O    1 
ATOM   7566  C  CB   . PRO C  2 18  ? 138.425 78.851  106.838 1.00 109.09 ? 18  PRO J CB   1 
ATOM   7567  C  CG   . PRO C  2 18  ? 139.761 78.861  106.151 1.00 109.09 ? 18  PRO J CG   1 
ATOM   7568  C  CD   . PRO C  2 18  ? 139.935 80.224  105.588 1.00 109.09 ? 18  PRO J CD   1 
ATOM   7569  H  HA   . PRO C  2 18  ? 136.892 79.519  105.612 1.00 109.09 ? 18  PRO J HA   1 
ATOM   7570  H  HB2  . PRO C  2 18  ? 138.523 79.077  107.777 1.00 109.09 ? 18  PRO J HB2  1 
ATOM   7571  H  HB3  . PRO C  2 18  ? 137.990 77.993  106.735 1.00 109.09 ? 18  PRO J HB3  1 
ATOM   7572  H  HG2  . PRO C  2 18  ? 140.458 78.668  106.797 1.00 109.09 ? 18  PRO J HG2  1 
ATOM   7573  H  HG3  . PRO C  2 18  ? 139.759 78.198  105.444 1.00 109.09 ? 18  PRO J HG3  1 
ATOM   7574  H  HD2  . PRO C  2 18  ? 140.330 80.818  106.246 1.00 109.09 ? 18  PRO J HD2  1 
ATOM   7575  H  HD3  . PRO C  2 18  ? 140.463 80.185  104.777 1.00 109.09 ? 18  PRO J HD3  1 
ATOM   7576  N  N    . GLY C  2 19  ? 135.833 80.419  107.710 1.00 109.42 ? 19  GLY J N    1 
ATOM   7577  C  CA   . GLY C  2 19  ? 135.090 81.199  108.677 1.00 109.42 ? 19  GLY J CA   1 
ATOM   7578  C  C    . GLY C  2 19  ? 134.142 82.203  108.082 1.00 109.42 ? 19  GLY J C    1 
ATOM   7579  O  O    . GLY C  2 19  ? 133.425 82.881  108.839 1.00 109.42 ? 19  GLY J O    1 
ATOM   7580  H  H    . GLY C  2 19  ? 135.471 79.664  107.526 1.00 109.42 ? 19  GLY J H    1 
ATOM   7581  H  HA2  . GLY C  2 19  ? 134.579 80.604  109.246 1.00 109.42 ? 19  GLY J HA2  1 
ATOM   7582  H  HA3  . GLY C  2 19  ? 135.727 81.695  109.224 1.00 109.42 ? 19  GLY J HA3  1 
ATOM   7583  N  N    . GLU C  2 20  ? 134.112 82.331  106.758 1.00 100.32 ? 20  GLU J N    1 
ATOM   7584  C  CA   . GLU C  2 20  ? 133.348 83.362  106.065 1.00 100.32 ? 20  GLU J CA   1 
ATOM   7585  C  C    . GLU C  2 20  ? 132.740 82.701  104.832 1.00 100.32 ? 20  GLU J C    1 
ATOM   7586  O  O    . GLU C  2 20  ? 133.379 82.601  103.786 1.00 100.32 ? 20  GLU J O    1 
ATOM   7587  C  CB   . GLU C  2 20  ? 134.233 84.541  105.694 1.00 100.32 ? 20  GLU J CB   1 
ATOM   7588  C  CG   . GLU C  2 20  ? 134.671 85.349  106.901 1.00 100.32 ? 20  GLU J CG   1 
ATOM   7589  C  CD   . GLU C  2 20  ? 135.894 86.218  106.632 1.00 100.32 ? 20  GLU J CD   1 
ATOM   7590  O  OE1  . GLU C  2 20  ? 136.775 85.844  105.824 1.00 100.32 ? 20  GLU J OE1  1 
ATOM   7591  O  OE2  . GLU C  2 20  ? 135.967 87.293  107.250 1.00 100.32 ? 20  GLU J OE2  1 
ATOM   7592  H  H    . GLU C  2 20  ? 134.512 81.821  106.218 1.00 100.32 ? 20  GLU J H    1 
ATOM   7593  H  HA   . GLU C  2 20  ? 132.634 83.660  106.631 1.00 100.32 ? 20  GLU J HA   1 
ATOM   7594  H  HB2  . GLU C  2 20  ? 135.035 84.210  105.244 1.00 100.32 ? 20  GLU J HB2  1 
ATOM   7595  H  HB3  . GLU C  2 20  ? 133.749 85.122  105.104 1.00 100.32 ? 20  GLU J HB3  1 
ATOM   7596  H  HG2  . GLU C  2 20  ? 133.953 85.938  107.191 1.00 100.32 ? 20  GLU J HG2  1 
ATOM   7597  H  HG3  . GLU C  2 20  ? 134.876 84.740  107.645 1.00 100.32 ? 20  GLU J HG3  1 
ATOM   7598  N  N    . ASN C  2 21  ? 131.490 82.248  104.960 1.00 98.84  ? 21  ASN J N    1 
ATOM   7599  C  CA   . ASN C  2 21  ? 130.826 81.478  103.921 1.00 98.84  ? 21  ASN J CA   1 
ATOM   7600  C  C    . ASN C  2 21  ? 129.598 82.200  103.389 1.00 98.84  ? 21  ASN J C    1 
ATOM   7601  O  O    . ASN C  2 21  ? 128.662 81.562  102.902 1.00 98.84  ? 21  ASN J O    1 
ATOM   7602  C  CB   . ASN C  2 21  ? 130.453 80.095  104.439 1.00 98.84  ? 21  ASN J CB   1 
ATOM   7603  C  CG   . ASN C  2 21  ? 131.661 79.207  104.648 1.00 98.84  ? 21  ASN J CG   1 
ATOM   7604  O  OD1  . ASN C  2 21  ? 132.747 79.485  104.144 1.00 98.84  ? 21  ASN J OD1  1 
ATOM   7605  N  ND2  . ASN C  2 21  ? 131.481 78.132  105.402 1.00 98.84  ? 21  ASN J ND2  1 
ATOM   7606  H  H    . ASN C  2 21  ? 130.994 82.386  105.646 1.00 98.84  ? 21  ASN J H    1 
ATOM   7607  H  HA   . ASN C  2 21  ? 131.433 81.364  103.176 1.00 98.84  ? 21  ASN J HA   1 
ATOM   7608  H  HB2  . ASN C  2 21  ? 130.000 80.188  105.293 1.00 98.84  ? 21  ASN J HB2  1 
ATOM   7609  H  HB3  . ASN C  2 21  ? 129.865 79.658  103.796 1.00 98.84  ? 21  ASN J HB3  1 
ATOM   7610  H  HD21 . ASN C  2 21  ? 132.140 77.600  105.552 1.00 98.84  ? 21  ASN J HD21 1 
ATOM   7611  H  HD22 . ASN C  2 21  ? 130.709 77.973  105.738 1.00 98.84  ? 21  ASN J HD22 1 
ATOM   7612  N  N    . LEU C  2 22  ? 129.596 83.527  103.471 1.00 94.82  ? 22  LEU J N    1 
ATOM   7613  C  CA   . LEU C  2 22  ? 128.522 84.348  102.929 1.00 94.82  ? 22  LEU J CA   1 
ATOM   7614  C  C    . LEU C  2 22  ? 129.135 85.395  102.011 1.00 94.82  ? 22  LEU J C    1 
ATOM   7615  O  O    . LEU C  2 22  ? 129.794 86.332  102.480 1.00 94.82  ? 22  LEU J O    1 
ATOM   7616  C  CB   . LEU C  2 22  ? 127.712 85.006  104.041 1.00 94.82  ? 22  LEU J CB   1 
ATOM   7617  C  CG   . LEU C  2 22  ? 126.893 84.045  104.902 1.00 94.82  ? 22  LEU J CG   1 
ATOM   7618  C  CD1  . LEU C  2 22  ? 126.235 84.807  106.015 1.00 94.82  ? 22  LEU J CD1  1 
ATOM   7619  C  CD2  . LEU C  2 22  ? 125.851 83.320  104.080 1.00 94.82  ? 22  LEU J CD2  1 
ATOM   7620  H  H    . LEU C  2 22  ? 130.221 83.984  103.846 1.00 94.82  ? 22  LEU J H    1 
ATOM   7621  H  HA   . LEU C  2 22  ? 127.928 83.803  102.394 1.00 94.82  ? 22  LEU J HA   1 
ATOM   7622  H  HB2  . LEU C  2 22  ? 128.325 85.469  104.632 1.00 94.82  ? 22  LEU J HB2  1 
ATOM   7623  H  HB3  . LEU C  2 22  ? 127.097 85.642  103.646 1.00 94.82  ? 22  LEU J HB3  1 
ATOM   7624  H  HG   . LEU C  2 22  ? 127.484 83.386  105.293 1.00 94.82  ? 22  LEU J HG   1 
ATOM   7625  H  HD11 . LEU C  2 22  ? 126.018 84.198  106.738 1.00 94.82  ? 22  LEU J HD11 1 
ATOM   7626  H  HD12 . LEU C  2 22  ? 126.857 85.481  106.318 1.00 94.82  ? 22  LEU J HD12 1 
ATOM   7627  H  HD13 . LEU C  2 22  ? 125.433 85.232  105.677 1.00 94.82  ? 22  LEU J HD13 1 
ATOM   7628  H  HD21 . LEU C  2 22  ? 125.323 82.754  104.667 1.00 94.82  ? 22  LEU J HD21 1 
ATOM   7629  H  HD22 . LEU C  2 22  ? 125.274 83.973  103.654 1.00 94.82  ? 22  LEU J HD22 1 
ATOM   7630  H  HD23 . LEU C  2 22  ? 126.292 82.778  103.411 1.00 94.82  ? 22  LEU J HD23 1 
ATOM   7631  N  N    . CYS C  2 23  ? 128.923 85.222  100.710 1.00 82.24  ? 23  CYS J N    1 
ATOM   7632  C  CA   . CYS C  2 23  ? 129.197 86.268  99.748  1.00 82.24  ? 23  CYS J CA   1 
ATOM   7633  C  C    . CYS C  2 23  ? 128.120 87.339  99.851  1.00 82.24  ? 23  CYS J C    1 
ATOM   7634  O  O    . CYS C  2 23  ? 126.924 87.039  99.906  1.00 82.24  ? 23  CYS J O    1 
ATOM   7635  C  CB   . CYS C  2 23  ? 129.237 85.714  98.326  1.00 82.24  ? 23  CYS J CB   1 
ATOM   7636  S  SG   . CYS C  2 23  ? 130.139 84.168  98.116  1.00 82.24  ? 23  CYS J SG   1 
ATOM   7637  H  H    . CYS C  2 23  ? 128.618 84.502  100.361 1.00 82.24  ? 23  CYS J H    1 
ATOM   7638  H  HA   . CYS C  2 23  ? 130.052 86.679  99.947  1.00 82.24  ? 23  CYS J HA   1 
ATOM   7639  H  HB2  . CYS C  2 23  ? 128.328 85.559  98.034  1.00 82.24  ? 23  CYS J HB2  1 
ATOM   7640  H  HB3  . CYS C  2 23  ? 129.654 86.377  97.751  1.00 82.24  ? 23  CYS J HB3  1 
ATOM   7641  N  N    . TYR C  2 24  ? 128.548 88.597  99.876  1.00 63.49  ? 24  TYR J N    1 
ATOM   7642  C  CA   . TYR C  2 24  ? 127.639 89.714  100.021 1.00 63.49  ? 24  TYR J CA   1 
ATOM   7643  C  C    . TYR C  2 24  ? 128.018 90.809  99.047  1.00 63.49  ? 24  TYR J C    1 
ATOM   7644  O  O    . TYR C  2 24  ? 129.127 90.862  98.514  1.00 63.49  ? 24  TYR J O    1 
ATOM   7645  C  CB   . TYR C  2 24  ? 127.656 90.317  101.424 1.00 63.49  ? 24  TYR J CB   1 
ATOM   7646  C  CG   . TYR C  2 24  ? 128.790 91.293  101.615 1.00 63.49  ? 24  TYR J CG   1 
ATOM   7647  C  CD1  . TYR C  2 24  ? 130.049 90.853  101.974 1.00 63.49  ? 24  TYR J CD1  1 
ATOM   7648  C  CD2  . TYR C  2 24  ? 128.605 92.651  101.409 1.00 63.49  ? 24  TYR J CD2  1 
ATOM   7649  C  CE1  . TYR C  2 24  ? 131.090 91.739  102.138 1.00 63.49  ? 24  TYR J CE1  1 
ATOM   7650  C  CE2  . TYR C  2 24  ? 129.640 93.541  101.566 1.00 63.49  ? 24  TYR J CE2  1 
ATOM   7651  C  CZ   . TYR C  2 24  ? 130.879 93.081  101.931 1.00 63.49  ? 24  TYR J CZ   1 
ATOM   7652  O  OH   . TYR C  2 24  ? 131.915 93.968  102.091 1.00 63.49  ? 24  TYR J OH   1 
ATOM   7653  H  H    . TYR C  2 24  ? 129.373 88.828  99.808  1.00 63.49  ? 24  TYR J H    1 
ATOM   7654  H  HA   . TYR C  2 24  ? 126.736 89.430  99.817  1.00 63.49  ? 24  TYR J HA   1 
ATOM   7655  H  HB2  . TYR C  2 24  ? 126.827 90.801  101.554 1.00 63.49  ? 24  TYR J HB2  1 
ATOM   7656  H  HB3  . TYR C  2 24  ? 127.743 89.609  102.076 1.00 63.49  ? 24  TYR J HB3  1 
ATOM   7657  H  HD1  . TYR C  2 24  ? 130.189 89.946  102.112 1.00 63.49  ? 24  TYR J HD1  1 
ATOM   7658  H  HD2  . TYR C  2 24  ? 127.766 92.961  101.158 1.00 63.49  ? 24  TYR J HD2  1 
ATOM   7659  H  HE1  . TYR C  2 24  ? 131.930 91.431  102.382 1.00 63.49  ? 24  TYR J HE1  1 
ATOM   7660  H  HE2  . TYR C  2 24  ? 129.501 94.449  101.427 1.00 63.49  ? 24  TYR J HE2  1 
ATOM   7661  H  HH   . TYR C  2 24  ? 131.654 94.742  101.898 1.00 63.49  ? 24  TYR J HH   1 
ATOM   7662  N  N    . ARG C  2 25  ? 127.064 91.714  98.869  1.00 50.99  ? 25  ARG J N    1 
ATOM   7663  C  CA   . ARG C  2 25  ? 127.228 92.913  98.071  1.00 50.99  ? 25  ARG J CA   1 
ATOM   7664  C  C    . ARG C  2 25  ? 126.395 94.042  98.666  1.00 50.99  ? 25  ARG J C    1 
ATOM   7665  O  O    . ARG C  2 25  ? 125.293 93.808  99.151  1.00 50.99  ? 25  ARG J O    1 
ATOM   7666  C  CB   . ARG C  2 25  ? 126.818 92.632  96.650  1.00 50.99  ? 25  ARG J CB   1 
ATOM   7667  C  CG   . ARG C  2 25  ? 125.355 92.435  96.553  1.00 50.99  ? 25  ARG J CG   1 
ATOM   7668  C  CD   . ARG C  2 25  ? 124.984 92.104  95.164  1.00 50.99  ? 25  ARG J CD   1 
ATOM   7669  N  NE   . ARG C  2 25  ? 125.101 93.227  94.264  1.00 50.99  ? 25  ARG J NE   1 
ATOM   7670  C  CZ   . ARG C  2 25  ? 124.567 93.247  93.050  1.00 50.99  ? 25  ARG J CZ   1 
ATOM   7671  N  NH1  . ARG C  2 25  ? 123.965 92.162  92.582  1.00 50.99  ? 25  ARG J NH1  1 
ATOM   7672  N  NH2  . ARG C  2 25  ? 124.722 94.321  92.291  1.00 50.99  ? 25  ARG J NH2  1 
ATOM   7673  H  H    . ARG C  2 25  ? 126.275 91.638  99.199  1.00 50.99  ? 25  ARG J H    1 
ATOM   7674  H  HA   . ARG C  2 25  ? 128.159 93.164  98.082  1.00 50.99  ? 25  ARG J HA   1 
ATOM   7675  H  HB2  . ARG C  2 25  ? 127.050 93.398  96.098  1.00 50.99  ? 25  ARG J HB2  1 
ATOM   7676  H  HB3  . ARG C  2 25  ? 127.258 91.838  96.342  1.00 50.99  ? 25  ARG J HB3  1 
ATOM   7677  H  HG2  . ARG C  2 25  ? 125.114 91.690  97.124  1.00 50.99  ? 25  ARG J HG2  1 
ATOM   7678  H  HG3  . ARG C  2 25  ? 124.888 93.252  96.811  1.00 50.99  ? 25  ARG J HG3  1 
ATOM   7679  H  HD2  . ARG C  2 25  ? 125.599 91.410  94.854  1.00 50.99  ? 25  ARG J HD2  1 
ATOM   7680  H  HD3  . ARG C  2 25  ? 124.084 91.788  95.135  1.00 50.99  ? 25  ARG J HD3  1 
ATOM   7681  H  HE   . ARG C  2 25  ? 125.166 94.003  94.654  1.00 50.99  ? 25  ARG J HE   1 
ATOM   7682  H  HH11 . ARG C  2 25  ? 123.908 91.444  93.089  1.00 50.99  ? 25  ARG J HH11 1 
ATOM   7683  H  HH12 . ARG C  2 25  ? 123.664 92.173  91.768  1.00 50.99  ? 25  ARG J HH12 1 
ATOM   7684  H  HH21 . ARG C  2 25  ? 125.132 95.032  92.608  1.00 50.99  ? 25  ARG J HH21 1 
ATOM   7685  H  HH22 . ARG C  2 25  ? 124.400 94.342  91.496  1.00 50.99  ? 25  ARG J HH22 1 
ATOM   7686  N  N    . LYS C  2 26  ? 126.938 95.241  98.600  1.00 46.67  ? 26  LYS J N    1 
ATOM   7687  C  CA   . LYS C  2 26  ? 126.354 96.408  99.200  1.00 46.67  ? 26  LYS J CA   1 
ATOM   7688  C  C    . LYS C  2 26  ? 126.323 97.526  98.180  1.00 46.67  ? 26  LYS J C    1 
ATOM   7689  O  O    . LYS C  2 26  ? 127.319 97.768  97.492  1.00 46.67  ? 26  LYS J O    1 
ATOM   7690  C  CB   . LYS C  2 26  ? 127.150 96.828  100.429 1.00 46.67  ? 26  LYS J CB   1 
ATOM   7691  C  CG   . LYS C  2 26  ? 126.432 97.761  101.339 1.00 46.67  ? 26  LYS J CG   1 
ATOM   7692  C  CD   . LYS C  2 26  ? 127.074 97.728  102.695 1.00 46.67  ? 26  LYS J CD   1 
ATOM   7693  C  CE   . LYS C  2 26  ? 128.476 98.295  102.629 1.00 46.67  ? 26  LYS J CE   1 
ATOM   7694  N  NZ   . LYS C  2 26  ? 129.068 98.519  103.968 1.00 46.67  ? 26  LYS J NZ   1 
ATOM   7695  H  H    . LYS C  2 26  ? 127.680 95.404  98.194  1.00 46.67  ? 26  LYS J H    1 
ATOM   7696  H  HA   . LYS C  2 26  ? 125.446 96.219  99.477  1.00 46.67  ? 26  LYS J HA   1 
ATOM   7697  H  HB2  . LYS C  2 26  ? 127.381 96.032  100.931 1.00 46.67  ? 26  LYS J HB2  1 
ATOM   7698  H  HB3  . LYS C  2 26  ? 127.955 97.272  100.130 1.00 46.67  ? 26  LYS J HB3  1 
ATOM   7699  H  HG2  . LYS C  2 26  ? 126.498 98.657  100.985 1.00 46.67  ? 26  LYS J HG2  1 
ATOM   7700  H  HG3  . LYS C  2 26  ? 125.505 97.488  101.420 1.00 46.67  ? 26  LYS J HG3  1 
ATOM   7701  H  HD2  . LYS C  2 26  ? 126.543 98.244  103.315 1.00 46.67  ? 26  LYS J HD2  1 
ATOM   7702  H  HD3  . LYS C  2 26  ? 127.135 96.814  102.989 1.00 46.67  ? 26  LYS J HD3  1 
ATOM   7703  H  HE2  . LYS C  2 26  ? 129.041 97.665  102.153 1.00 46.67  ? 26  LYS J HE2  1 
ATOM   7704  H  HE3  . LYS C  2 26  ? 128.456 99.142  102.157 1.00 46.67  ? 26  LYS J HE3  1 
ATOM   7705  H  HZ1  . LYS C  2 26  ? 129.916 98.781  103.887 1.00 46.67  ? 26  LYS J HZ1  1 
ATOM   7706  H  HZ2  . LYS C  2 26  ? 128.611 99.149  104.399 1.00 46.67  ? 26  LYS J HZ2  1 
ATOM   7707  H  HZ3  . LYS C  2 26  ? 129.041 97.767  104.441 1.00 46.67  ? 26  LYS J HZ3  1 
ATOM   7708  N  N    . MET C  2 27  ? 125.175 98.194  98.066  1.00 41.16  ? 27  MET J N    1 
ATOM   7709  C  CA   . MET C  2 27  ? 124.935 99.137  96.983  1.00 41.16  ? 27  MET J CA   1 
ATOM   7710  C  C    . MET C  2 27  ? 124.177 100.341 97.504  1.00 41.16  ? 27  MET J C    1 
ATOM   7711  O  O    . MET C  2 27  ? 123.189 100.188 98.227  1.00 41.16  ? 27  MET J O    1 
ATOM   7712  C  CB   . MET C  2 27  ? 124.159 98.429  95.871  1.00 41.16  ? 27  MET J CB   1 
ATOM   7713  C  CG   . MET C  2 27  ? 124.980 97.333  95.233  1.00 41.16  ? 27  MET J CG   1 
ATOM   7714  S  SD   . MET C  2 27  ? 124.223 96.442  93.863  1.00 41.16  ? 27  MET J SD   1 
ATOM   7715  C  CE   . MET C  2 27  ? 123.636 97.787  92.865  1.00 41.16  ? 27  MET J CE   1 
ATOM   7716  H  H    . MET C  2 27  ? 124.516 98.110  98.603  1.00 41.16  ? 27  MET J H    1 
ATOM   7717  H  HA   . MET C  2 27  ? 125.781 99.416  96.621  1.00 41.16  ? 27  MET J HA   1 
ATOM   7718  H  HB2  . MET C  2 27  ? 123.351 98.049  96.238  1.00 41.16  ? 27  MET J HB2  1 
ATOM   7719  H  HB3  . MET C  2 27  ? 123.943 99.081  95.193  1.00 41.16  ? 27  MET J HB3  1 
ATOM   7720  H  HG2  . MET C  2 27  ? 125.781 97.742  94.882  1.00 41.16  ? 27  MET J HG2  1 
ATOM   7721  H  HG3  . MET C  2 27  ? 125.210 96.688  95.917  1.00 41.16  ? 27  MET J HG3  1 
ATOM   7722  H  HE1  . MET C  2 27  ? 123.086 97.405  92.145  1.00 41.16  ? 27  MET J HE1  1 
ATOM   7723  H  HE2  . MET C  2 27  ? 123.122 98.374  93.439  1.00 41.16  ? 27  MET J HE2  1 
ATOM   7724  H  HE3  . MET C  2 27  ? 124.395 98.266  92.487  1.00 41.16  ? 27  MET J HE3  1 
ATOM   7725  N  N    . TRP C  2 28  ? 124.641 101.530 97.138  1.00 31.98  ? 28  TRP J N    1 
ATOM   7726  C  CA   . TRP C  2 28  ? 123.976 102.771 97.521  1.00 31.98  ? 28  TRP J CA   1 
ATOM   7727  C  C    . TRP C  2 28  ? 124.309 103.856 96.508  1.00 31.98  ? 28  TRP J C    1 
ATOM   7728  O  O    . TRP C  2 28  ? 125.243 103.726 95.716  1.00 31.98  ? 28  TRP J O    1 
ATOM   7729  C  CB   . TRP C  2 28  ? 124.377 103.212 98.929  1.00 31.98  ? 28  TRP J CB   1 
ATOM   7730  C  CG   . TRP C  2 28  ? 125.741 103.793 99.038  1.00 31.98  ? 28  TRP J CG   1 
ATOM   7731  C  CD1  . TRP C  2 28  ? 126.066 105.117 99.060  1.00 31.98  ? 28  TRP J CD1  1 
ATOM   7732  C  CD2  . TRP C  2 28  ? 126.966 103.076 99.168  1.00 31.98  ? 28  TRP J CD2  1 
ATOM   7733  N  NE1  . TRP C  2 28  ? 127.427 105.264 99.188  1.00 31.98  ? 28  TRP J NE1  1 
ATOM   7734  C  CE2  . TRP C  2 28  ? 128.000 104.024 99.255  1.00 31.98  ? 28  TRP J CE2  1 
ATOM   7735  C  CE3  . TRP C  2 28  ? 127.293 101.721 99.214  1.00 31.98  ? 28  TRP J CE3  1 
ATOM   7736  C  CZ2  . TRP C  2 28  ? 129.331 103.663 99.383  1.00 31.98  ? 28  TRP J CZ2  1 
ATOM   7737  C  CZ3  . TRP C  2 28  ? 128.612 101.364 99.341  1.00 31.98  ? 28  TRP J CZ3  1 
ATOM   7738  C  CH2  . TRP C  2 28  ? 129.616 102.332 99.424  1.00 31.98  ? 28  TRP J CH2  1 
ATOM   7739  H  H    . TRP C  2 28  ? 125.346 101.649 96.671  1.00 31.98  ? 28  TRP J H    1 
ATOM   7740  H  HA   . TRP C  2 28  ? 123.020 102.631 97.506  1.00 31.98  ? 28  TRP J HA   1 
ATOM   7741  H  HB2  . TRP C  2 28  ? 123.749 103.881 99.232  1.00 31.98  ? 28  TRP J HB2  1 
ATOM   7742  H  HB3  . TRP C  2 28  ? 124.352 102.436 99.505  1.00 31.98  ? 28  TRP J HB3  1 
ATOM   7743  H  HD1  . TRP C  2 28  ? 125.460 105.815 98.997  1.00 31.98  ? 28  TRP J HD1  1 
ATOM   7744  H  HE1  . TRP C  2 28  ? 127.852 106.011 99.220  1.00 31.98  ? 28  TRP J HE1  1 
ATOM   7745  H  HE3  . TRP C  2 28  ? 126.628 101.076 99.158  1.00 31.98  ? 28  TRP J HE3  1 
ATOM   7746  H  HZ2  . TRP C  2 28  ? 130.001 104.303 99.439  1.00 31.98  ? 28  TRP J HZ2  1 
ATOM   7747  H  HZ3  . TRP C  2 28  ? 128.839 100.467 99.374  1.00 31.98  ? 28  TRP J HZ3  1 
ATOM   7748  H  HH2  . TRP C  2 28  ? 130.499 102.063 99.511  1.00 31.98  ? 28  TRP J HH2  1 
ATOM   7749  N  N    . CYS C  2 29  ? 123.524 104.929 96.540  1.00 28.78  ? 29  CYS J N    1 
ATOM   7750  C  CA   . CYS C  2 29  ? 123.739 106.074 95.674  1.00 28.78  ? 29  CYS J CA   1 
ATOM   7751  C  C    . CYS C  2 29  ? 124.738 107.021 96.322  1.00 28.78  ? 29  CYS J C    1 
ATOM   7752  O  O    . CYS C  2 29  ? 124.562 107.420 97.478  1.00 28.78  ? 29  CYS J O    1 
ATOM   7753  C  CB   . CYS C  2 29  ? 122.431 106.829 95.409  1.00 28.78  ? 29  CYS J CB   1 
ATOM   7754  S  SG   . CYS C  2 29  ? 121.375 106.238 94.057  1.00 28.78  ? 29  CYS J SG   1 
ATOM   7755  H  H    . CYS C  2 29  ? 122.858 105.018 97.073  1.00 28.78  ? 29  CYS J H    1 
ATOM   7756  H  HA   . CYS C  2 29  ? 124.098 105.783 94.825  1.00 28.78  ? 29  CYS J HA   1 
ATOM   7757  H  HB2  . CYS C  2 29  ? 121.900 106.795 96.217  1.00 28.78  ? 29  CYS J HB2  1 
ATOM   7758  H  HB3  . CYS C  2 29  ? 122.656 107.749 95.215  1.00 28.78  ? 29  CYS J HB3  1 
ATOM   7759  N  N    . ASP C  2 30  ? 125.775 107.373 95.582  1.00 27.74  ? 30  ASP J N    1 
ATOM   7760  C  CA   . ASP C  2 30  ? 126.626 108.495 95.920  1.00 27.74  ? 30  ASP J CA   1 
ATOM   7761  C  C    . ASP C  2 30  ? 126.153 109.699 95.119  1.00 27.74  ? 30  ASP J C    1 
ATOM   7762  O  O    . ASP C  2 30  ? 125.068 109.689 94.530  1.00 27.74  ? 30  ASP J O    1 
ATOM   7763  C  CB   . ASP C  2 30  ? 128.102 108.188 95.679  1.00 27.74  ? 30  ASP J CB   1 
ATOM   7764  C  CG   . ASP C  2 30  ? 128.381 107.675 94.295  1.00 27.74  ? 30  ASP J CG   1 
ATOM   7765  O  OD1  . ASP C  2 30  ? 127.642 108.034 93.356  1.00 27.74  ? 30  ASP J OD1  1 
ATOM   7766  O  OD2  . ASP C  2 30  ? 129.331 106.881 94.161  1.00 27.74  ? 30  ASP J OD2  1 
ATOM   7767  H  H    . ASP C  2 30  ? 125.999 106.987 94.849  1.00 27.74  ? 30  ASP J H    1 
ATOM   7768  H  HA   . ASP C  2 30  ? 126.513 108.701 96.854  1.00 27.74  ? 30  ASP J HA   1 
ATOM   7769  H  HB2  . ASP C  2 30  ? 128.625 108.989 95.812  1.00 27.74  ? 30  ASP J HB2  1 
ATOM   7770  H  HB3  . ASP C  2 30  ? 128.383 107.510 96.300  1.00 27.74  ? 30  ASP J HB3  1 
ATOM   7771  N  N    . VAL C  2 31  ? 126.958 110.758 95.106  1.00 15.42  ? 31  VAL J N    1 
ATOM   7772  C  CA   . VAL C  2 31  ? 126.597 111.945 94.344  1.00 15.42  ? 31  VAL J CA   1 
ATOM   7773  C  C    . VAL C  2 31  ? 126.349 111.578 92.890  1.00 15.42  ? 31  VAL J C    1 
ATOM   7774  O  O    . VAL C  2 31  ? 125.377 112.023 92.273  1.00 15.42  ? 31  VAL J O    1 
ATOM   7775  C  CB   . VAL C  2 31  ? 127.701 113.005 94.454  1.00 15.42  ? 31  VAL J CB   1 
ATOM   7776  C  CG1  . VAL C  2 31  ? 127.358 114.170 93.604  1.00 15.42  ? 31  VAL J CG1  1 
ATOM   7777  C  CG2  . VAL C  2 31  ? 127.860 113.453 95.840  1.00 15.42  ? 31  VAL J CG2  1 
ATOM   7778  H  H    . VAL C  2 31  ? 127.696 110.823 95.536  1.00 15.42  ? 31  VAL J H    1 
ATOM   7779  H  HA   . VAL C  2 31  ? 125.785 112.324 94.703  1.00 15.42  ? 31  VAL J HA   1 
ATOM   7780  H  HB   . VAL C  2 31  ? 128.538 112.626 94.152  1.00 15.42  ? 31  VAL J HB   1 
ATOM   7781  H  HG11 . VAL C  2 31  ? 128.090 114.802 93.646  1.00 15.42  ? 31  VAL J HG11 1 
ATOM   7782  H  HG12 . VAL C  2 31  ? 127.223 113.884 92.689  1.00 15.42  ? 31  VAL J HG12 1 
ATOM   7783  H  HG13 . VAL C  2 31  ? 126.547 114.575 93.947  1.00 15.42  ? 31  VAL J HG13 1 
ATOM   7784  H  HG21 . VAL C  2 31  ? 128.595 114.083 95.893  1.00 15.42  ? 31  VAL J HG21 1 
ATOM   7785  H  HG22 . VAL C  2 31  ? 127.027 113.899 96.040  1.00 15.42  ? 31  VAL J HG22 1 
ATOM   7786  H  HG23 . VAL C  2 31  ? 128.016 112.688 96.413  1.00 15.42  ? 31  VAL J HG23 1 
ATOM   7787  N  N    . PHE C  2 32  ? 127.236 110.775 92.317  1.00 16.30  ? 32  PHE J N    1 
ATOM   7788  C  CA   . PHE C  2 32  ? 127.167 110.439 90.901  1.00 16.30  ? 32  PHE J CA   1 
ATOM   7789  C  C    . PHE C  2 32  ? 126.251 109.248 90.661  1.00 16.30  ? 32  PHE J C    1 
ATOM   7790  O  O    . PHE C  2 32  ? 126.605 108.309 89.954  1.00 16.30  ? 32  PHE J O    1 
ATOM   7791  C  CB   . PHE C  2 32  ? 128.565 110.147 90.378  1.00 16.30  ? 32  PHE J CB   1 
ATOM   7792  C  CG   . PHE C  2 32  ? 129.604 111.140 90.803  1.00 16.30  ? 32  PHE J CG   1 
ATOM   7793  C  CD1  . PHE C  2 32  ? 130.301 110.961 91.979  1.00 16.30  ? 32  PHE J CD1  1 
ATOM   7794  C  CD2  . PHE C  2 32  ? 129.911 112.231 90.015  1.00 16.30  ? 32  PHE J CD2  1 
ATOM   7795  C  CE1  . PHE C  2 32  ? 131.262 111.859 92.371  1.00 16.30  ? 32  PHE J CE1  1 
ATOM   7796  C  CE2  . PHE C  2 32  ? 130.877 113.130 90.408  1.00 16.30  ? 32  PHE J CE2  1 
ATOM   7797  C  CZ   . PHE C  2 32  ? 131.552 112.939 91.586  1.00 16.30  ? 32  PHE J CZ   1 
ATOM   7798  H  H    . PHE C  2 32  ? 127.892 110.411 92.726  1.00 16.30  ? 32  PHE J H    1 
ATOM   7799  H  HA   . PHE C  2 32  ? 126.813 111.194 90.412  1.00 16.30  ? 32  PHE J HA   1 
ATOM   7800  H  HB2  . PHE C  2 32  ? 128.833 109.286 90.719  1.00 16.30  ? 32  PHE J HB2  1 
ATOM   7801  H  HB3  . PHE C  2 32  ? 128.538 110.131 89.413  1.00 16.30  ? 32  PHE J HB3  1 
ATOM   7802  H  HD1  . PHE C  2 32  ? 130.105 110.233 92.515  1.00 16.30  ? 32  PHE J HD1  1 
ATOM   7803  H  HD2  . PHE C  2 32  ? 129.456 112.366 89.216  1.00 16.30  ? 32  PHE J HD2  1 
ATOM   7804  H  HE1  . PHE C  2 32  ? 131.719 111.731 93.168  1.00 16.30  ? 32  PHE J HE1  1 
ATOM   7805  H  HE2  . PHE C  2 32  ? 131.073 113.863 89.875  1.00 16.30  ? 32  PHE J HE2  1 
ATOM   7806  H  HZ   . PHE C  2 32  ? 132.201 113.547 91.847  1.00 16.30  ? 32  PHE J HZ   1 
ATOM   7807  N  N    . CYS C  2 33  ? 125.051 109.285 91.226  1.00 28.10  ? 33  CYS J N    1 
ATOM   7808  C  CA   . CYS C  2 33  ? 124.087 108.215 91.032  1.00 28.10  ? 33  CYS J CA   1 
ATOM   7809  C  C    . CYS C  2 33  ? 123.138 108.507 89.880  1.00 28.10  ? 33  CYS J C    1 
ATOM   7810  O  O    . CYS C  2 33  ? 122.196 107.741 89.658  1.00 28.10  ? 33  CYS J O    1 
ATOM   7811  C  CB   . CYS C  2 33  ? 123.298 107.967 92.320  1.00 28.10  ? 33  CYS J CB   1 
ATOM   7812  S  SG   . CYS C  2 33  ? 122.443 106.363 92.327  1.00 28.10  ? 33  CYS J SG   1 
ATOM   7813  H  H    . CYS C  2 33  ? 124.770 109.918 91.727  1.00 28.10  ? 33  CYS J H    1 
ATOM   7814  H  HA   . CYS C  2 33  ? 124.567 107.404 90.823  1.00 28.10  ? 33  CYS J HA   1 
ATOM   7815  H  HB2  . CYS C  2 33  ? 123.917 107.983 93.063  1.00 28.10  ? 33  CYS J HB2  1 
ATOM   7816  H  HB3  . CYS C  2 33  ? 122.634 108.666 92.420  1.00 28.10  ? 33  CYS J HB3  1 
ATOM   7817  N  N    . SER C  2 34  ? 123.370 109.594 89.148  1.00 22.81  ? 34  SER J N    1 
ATOM   7818  C  CA   . SER C  2 34  ? 122.577 109.954 87.982  1.00 22.81  ? 34  SER J CA   1 
ATOM   7819  C  C    . SER C  2 34  ? 123.167 109.364 86.710  1.00 22.81  ? 34  SER J C    1 
ATOM   7820  O  O    . SER C  2 34  ? 122.440 108.817 85.876  1.00 22.81  ? 34  SER J O    1 
ATOM   7821  C  CB   . SER C  2 34  ? 122.492 111.475 87.859  1.00 22.81  ? 34  SER J CB   1 
ATOM   7822  O  OG   . SER C  2 34  ? 121.897 111.855 86.633  1.00 22.81  ? 34  SER J OG   1 
ATOM   7823  H  H    . SER C  2 34  ? 124.004 110.147 89.306  1.00 22.81  ? 34  SER J H    1 
ATOM   7824  H  HA   . SER C  2 34  ? 121.677 109.613 88.087  1.00 22.81  ? 34  SER J HA   1 
ATOM   7825  H  HB2  . SER C  2 34  ? 121.965 111.824 88.591  1.00 22.81  ? 34  SER J HB2  1 
ATOM   7826  H  HB3  . SER C  2 34  ? 123.390 111.835 87.893  1.00 22.81  ? 34  SER J HB3  1 
ATOM   7827  H  HG   . SER C  2 34  ? 122.052 112.666 86.483  1.00 22.81  ? 34  SER J HG   1 
ATOM   7828  N  N    . SER C  2 35  ? 124.483 109.471 86.551  1.00 19.72  ? 35  SER J N    1 
ATOM   7829  C  CA   . SER C  2 35  ? 125.199 108.935 85.402  1.00 19.72  ? 35  SER J CA   1 
ATOM   7830  C  C    . SER C  2 35  ? 125.859 107.597 85.702  1.00 19.72  ? 35  SER J C    1 
ATOM   7831  O  O    . SER C  2 35  ? 125.655 106.625 84.971  1.00 19.72  ? 35  SER J O    1 
ATOM   7832  C  CB   . SER C  2 35  ? 126.257 109.940 84.943  1.00 19.72  ? 35  SER J CB   1 
ATOM   7833  O  OG   . SER C  2 35  ? 127.013 110.413 86.041  1.00 19.72  ? 35  SER J OG   1 
ATOM   7834  H  H    . SER C  2 35  ? 124.991 109.865 87.111  1.00 19.72  ? 35  SER J H    1 
ATOM   7835  H  HA   . SER C  2 35  ? 124.573 108.805 84.672  1.00 19.72  ? 35  SER J HA   1 
ATOM   7836  H  HB2  . SER C  2 35  ? 126.854 109.502 84.319  1.00 19.72  ? 35  SER J HB2  1 
ATOM   7837  H  HB3  . SER C  2 35  ? 125.817 110.688 84.518  1.00 19.72  ? 35  SER J HB3  1 
ATOM   7838  H  HG   . SER C  2 35  ? 127.612 110.936 85.772  1.00 19.72  ? 35  SER J HG   1 
ATOM   7839  N  N    . ARG C  2 36  ? 126.652 107.532 86.768  1.00 16.79  ? 36  ARG J N    1 
ATOM   7840  C  CA   . ARG C  2 36  ? 127.389 106.319 87.085  1.00 16.79  ? 36  ARG J CA   1 
ATOM   7841  C  C    . ARG C  2 36  ? 126.500 105.247 87.702  1.00 16.79  ? 36  ARG J C    1 
ATOM   7842  O  O    . ARG C  2 36  ? 126.758 104.054 87.518  1.00 16.79  ? 36  ARG J O    1 
ATOM   7843  C  CB   . ARG C  2 36  ? 128.541 106.655 88.027  1.00 16.79  ? 36  ARG J CB   1 
ATOM   7844  C  CG   . ARG C  2 36  ? 129.387 107.811 87.575  1.00 16.79  ? 36  ARG J CG   1 
ATOM   7845  C  CD   . ARG C  2 36  ? 130.535 108.050 88.513  1.00 16.79  ? 36  ARG J CD   1 
ATOM   7846  N  NE   . ARG C  2 36  ? 131.394 109.140 88.078  1.00 16.79  ? 36  ARG J NE   1 
ATOM   7847  C  CZ   . ARG C  2 36  ? 132.433 109.590 88.770  1.00 16.79  ? 36  ARG J CZ   1 
ATOM   7848  N  NH1  . ARG C  2 36  ? 132.747 109.051 89.934  1.00 16.79  ? 36  ARG J NH1  1 
ATOM   7849  N  NH2  . ARG C  2 36  ? 133.157 110.588 88.297  1.00 16.79  ? 36  ARG J NH2  1 
ATOM   7850  H  H    . ARG C  2 36  ? 126.779 108.171 87.321  1.00 16.79  ? 36  ARG J H    1 
ATOM   7851  H  HA   . ARG C  2 36  ? 127.765 105.964 86.267  1.00 16.79  ? 36  ARG J HA   1 
ATOM   7852  H  HB2  . ARG C  2 36  ? 128.182 106.883 88.890  1.00 16.79  ? 36  ARG J HB2  1 
ATOM   7853  H  HB3  . ARG C  2 36  ? 129.125 105.891 88.089  1.00 16.79  ? 36  ARG J HB3  1 
ATOM   7854  H  HG2  . ARG C  2 36  ? 129.747 107.620 86.700  1.00 16.79  ? 36  ARG J HG2  1 
ATOM   7855  H  HG3  . ARG C  2 36  ? 128.846 108.611 87.552  1.00 16.79  ? 36  ARG J HG3  1 
ATOM   7856  H  HD2  . ARG C  2 36  ? 130.195 108.270 89.386  1.00 16.79  ? 36  ARG J HD2  1 
ATOM   7857  H  HD3  . ARG C  2 36  ? 131.070 107.251 88.557  1.00 16.79  ? 36  ARG J HD3  1 
ATOM   7858  H  HE   . ARG C  2 36  ? 131.322 109.401 87.265  1.00 16.79  ? 36  ARG J HE   1 
ATOM   7859  H  HH11 . ARG C  2 36  ? 132.281 108.404 90.249  1.00 16.79  ? 36  ARG J HH11 1 
ATOM   7860  H  HH12 . ARG C  2 36  ? 133.421 109.347 90.376  1.00 16.79  ? 36  ARG J HH12 1 
ATOM   7861  H  HH21 . ARG C  2 36  ? 132.956 110.940 87.540  1.00 16.79  ? 36  ARG J HH21 1 
ATOM   7862  H  HH22 . ARG C  2 36  ? 133.831 110.876 88.745  1.00 16.79  ? 36  ARG J HH22 1 
ATOM   7863  N  N    . GLY C  2 37  ? 125.454 105.639 88.412  1.00 24.04  ? 37  GLY J N    1 
ATOM   7864  C  CA   . GLY C  2 37  ? 124.622 104.691 89.118  1.00 24.04  ? 37  GLY J CA   1 
ATOM   7865  C  C    . GLY C  2 37  ? 125.076 104.485 90.548  1.00 24.04  ? 37  GLY J C    1 
ATOM   7866  O  O    . GLY C  2 37  ? 125.930 105.198 91.080  1.00 24.04  ? 37  GLY J O    1 
ATOM   7867  H  H    . GLY C  2 37  ? 125.204 106.452 88.493  1.00 24.04  ? 37  GLY J H    1 
ATOM   7868  H  HA2  . GLY C  2 37  ? 123.709 105.007 89.131  1.00 24.04  ? 37  GLY J HA2  1 
ATOM   7869  H  HA3  . GLY C  2 37  ? 124.642 103.839 88.663  1.00 24.04  ? 37  GLY J HA3  1 
ATOM   7870  N  N    . LYS C  2 38  ? 124.479 103.480 91.181  1.00 31.65  ? 38  LYS J N    1 
ATOM   7871  C  CA   . LYS C  2 38  ? 124.802 103.194 92.568  1.00 31.65  ? 38  LYS J CA   1 
ATOM   7872  C  C    . LYS C  2 38  ? 126.166 102.530 92.689  1.00 31.65  ? 38  LYS J C    1 
ATOM   7873  O  O    . LYS C  2 38  ? 126.668 101.890 91.763  1.00 31.65  ? 38  LYS J O    1 
ATOM   7874  C  CB   . LYS C  2 38  ? 123.754 102.290 93.210  1.00 31.65  ? 38  LYS J CB   1 
ATOM   7875  C  CG   . LYS C  2 38  ? 122.322 102.716 93.009  1.00 31.65  ? 38  LYS J CG   1 
ATOM   7876  C  CD   . LYS C  2 38  ? 121.408 101.937 93.925  1.00 31.65  ? 38  LYS J CD   1 
ATOM   7877  C  CE   . LYS C  2 38  ? 120.201 102.743 94.327  1.00 31.65  ? 38  LYS J CE   1 
ATOM   7878  N  NZ   . LYS C  2 38  ? 119.578 102.204 95.554  1.00 31.65  ? 38  LYS J NZ   1 
ATOM   7879  H  H    . LYS C  2 38  ? 123.897 102.954 90.834  1.00 31.65  ? 38  LYS J H    1 
ATOM   7880  H  HA   . LYS C  2 38  ? 124.831 104.023 93.061  1.00 31.65  ? 38  LYS J HA   1 
ATOM   7881  H  HB2  . LYS C  2 38  ? 123.852 101.399 92.846  1.00 31.65  ? 38  LYS J HB2  1 
ATOM   7882  H  HB3  . LYS C  2 38  ? 123.918 102.271 94.163  1.00 31.65  ? 38  LYS J HB3  1 
ATOM   7883  H  HG2  . LYS C  2 38  ? 122.247 103.650 93.245  1.00 31.65  ? 38  LYS J HG2  1 
ATOM   7884  H  HG3  . LYS C  2 38  ? 122.035 102.589 92.097  1.00 31.65  ? 38  LYS J HG3  1 
ATOM   7885  H  HD2  . LYS C  2 38  ? 121.100 101.143 93.464  1.00 31.65  ? 38  LYS J HD2  1 
ATOM   7886  H  HD3  . LYS C  2 38  ? 121.888 101.693 94.730  1.00 31.65  ? 38  LYS J HD3  1 
ATOM   7887  H  HE2  . LYS C  2 38  ? 120.469 103.655 94.500  1.00 31.65  ? 38  LYS J HE2  1 
ATOM   7888  H  HE3  . LYS C  2 38  ? 119.547 102.711 93.614  1.00 31.65  ? 38  LYS J HE3  1 
ATOM   7889  H  HZ1  . LYS C  2 38  ? 118.847 102.669 95.752  1.00 31.65  ? 38  LYS J HZ1  1 
ATOM   7890  H  HZ2  . LYS C  2 38  ? 119.361 101.351 95.432  1.00 31.65  ? 38  LYS J HZ2  1 
ATOM   7891  H  HZ3  . LYS C  2 38  ? 120.151 102.263 96.232  1.00 31.65  ? 38  LYS J HZ3  1 
ATOM   7892  N  N    . VAL C  2 39  ? 126.761 102.691 93.869  1.00 26.96  ? 39  VAL J N    1 
ATOM   7893  C  CA   . VAL C  2 39  ? 128.041 102.073 94.153  1.00 26.96  ? 39  VAL J CA   1 
ATOM   7894  C  C    . VAL C  2 39  ? 127.866 100.571 94.333  1.00 26.96  ? 39  VAL J C    1 
ATOM   7895  O  O    . VAL C  2 39  ? 126.763 100.057 94.543  1.00 26.96  ? 39  VAL J O    1 
ATOM   7896  C  CB   . VAL C  2 39  ? 128.680 102.707 95.395  1.00 26.96  ? 39  VAL J CB   1 
ATOM   7897  C  CG1  . VAL C  2 39  ? 130.091 102.232 95.560  1.00 26.96  ? 39  VAL J CG1  1 
ATOM   7898  C  CG2  . VAL C  2 39  ? 128.654 104.200 95.281  1.00 26.96  ? 39  VAL J CG2  1 
ATOM   7899  H  H    . VAL C  2 39  ? 126.440 103.154 94.512  1.00 26.96  ? 39  VAL J H    1 
ATOM   7900  H  HA   . VAL C  2 39  ? 128.632 102.221 93.405  1.00 26.96  ? 39  VAL J HA   1 
ATOM   7901  H  HB   . VAL C  2 39  ? 128.177 102.449 96.176  1.00 26.96  ? 39  VAL J HB   1 
ATOM   7902  H  HG11 . VAL C  2 39  ? 130.554 102.837 96.153  1.00 26.96  ? 39  VAL J HG11 1 
ATOM   7903  H  HG12 . VAL C  2 39  ? 130.078 101.341 95.937  1.00 26.96  ? 39  VAL J HG12 1 
ATOM   7904  H  HG13 . VAL C  2 39  ? 130.519 102.224 94.691  1.00 26.96  ? 39  VAL J HG13 1 
ATOM   7905  H  HG21 . VAL C  2 39  ? 129.092 104.581 96.053  1.00 26.96  ? 39  VAL J HG21 1 
ATOM   7906  H  HG22 . VAL C  2 39  ? 129.124 104.445 94.474  1.00 26.96  ? 39  VAL J HG22 1 
ATOM   7907  H  HG23 . VAL C  2 39  ? 127.739 104.504 95.235  1.00 26.96  ? 39  VAL J HG23 1 
ATOM   7908  N  N    . VAL C  2 40  ? 128.981 99.854  94.234  1.00 35.34  ? 40  VAL J N    1 
ATOM   7909  C  CA   . VAL C  2 40  ? 129.003 98.404  94.369  1.00 35.34  ? 40  VAL J CA   1 
ATOM   7910  C  C    . VAL C  2 40  ? 130.197 98.011  95.224  1.00 35.34  ? 40  VAL J C    1 
ATOM   7911  O  O    . VAL C  2 40  ? 131.335 98.377  94.915  1.00 35.34  ? 40  VAL J O    1 
ATOM   7912  C  CB   . VAL C  2 40  ? 129.070 97.715  92.995  1.00 35.34  ? 40  VAL J CB   1 
ATOM   7913  C  CG1  . VAL C  2 40  ? 129.094 96.225  93.155  1.00 35.34  ? 40  VAL J CG1  1 
ATOM   7914  C  CG2  . VAL C  2 40  ? 127.890 98.117  92.157  1.00 35.34  ? 40  VAL J CG2  1 
ATOM   7915  H  H    . VAL C  2 40  ? 129.753 100.191 94.089  1.00 35.34  ? 40  VAL J H    1 
ATOM   7916  H  HA   . VAL C  2 40  ? 128.201 98.109  94.812  1.00 35.34  ? 40  VAL J HA   1 
ATOM   7917  H  HB   . VAL C  2 40  ? 129.877 97.991  92.546  1.00 35.34  ? 40  VAL J HB   1 
ATOM   7918  H  HG11 . VAL C  2 40  ? 129.068 95.820  92.274  1.00 35.34  ? 40  VAL J HG11 1 
ATOM   7919  H  HG12 . VAL C  2 40  ? 129.907 95.974  93.614  1.00 35.34  ? 40  VAL J HG12 1 
ATOM   7920  H  HG13 . VAL C  2 40  ? 128.319 95.957  93.668  1.00 35.34  ? 40  VAL J HG13 1 
ATOM   7921  H  HG21 . VAL C  2 40  ? 127.872 97.573  91.356  1.00 35.34  ? 40  VAL J HG21 1 
ATOM   7922  H  HG22 . VAL C  2 40  ? 127.084 97.972  92.670  1.00 35.34  ? 40  VAL J HG22 1 
ATOM   7923  H  HG23 . VAL C  2 40  ? 127.973 99.052  91.928  1.00 35.34  ? 40  VAL J HG23 1 
ATOM   7924  N  N    . GLU C  2 41  ? 129.941 97.260  96.290  1.00 39.82  ? 41  GLU J N    1 
ATOM   7925  C  CA   . GLU C  2 41  ? 130.990 96.655  97.102  1.00 39.82  ? 41  GLU J CA   1 
ATOM   7926  C  C    . GLU C  2 41  ? 130.680 95.175  97.243  1.00 39.82  ? 41  GLU J C    1 
ATOM   7927  O  O    . GLU C  2 41  ? 129.609 94.815  97.733  1.00 39.82  ? 41  GLU J O    1 
ATOM   7928  C  CB   . GLU C  2 41  ? 131.083 97.301  98.483  1.00 39.82  ? 41  GLU J CB   1 
ATOM   7929  C  CG   . GLU C  2 41  ? 131.822 98.619  98.517  1.00 39.82  ? 41  GLU J CG   1 
ATOM   7930  C  CD   . GLU C  2 41  ? 131.952 99.167  99.920  1.00 39.82  ? 41  GLU J CD   1 
ATOM   7931  O  OE1  . GLU C  2 41  ? 131.325 100.201 100.224 1.00 39.82  ? 41  GLU J OE1  1 
ATOM   7932  O  OE2  . GLU C  2 41  ? 132.681 98.546  100.718 1.00 39.82  ? 41  GLU J OE2  1 
ATOM   7933  H  H    . GLU C  2 41  ? 129.151 97.079  96.563  1.00 39.82  ? 41  GLU J H    1 
ATOM   7934  H  HA   . GLU C  2 41  ? 131.839 96.751  96.654  1.00 39.82  ? 41  GLU J HA   1 
ATOM   7935  H  HB2  . GLU C  2 41  ? 130.187 97.449  98.812  1.00 39.82  ? 41  GLU J HB2  1 
ATOM   7936  H  HB3  . GLU C  2 41  ? 131.554 96.692  99.069  1.00 39.82  ? 41  GLU J HB3  1 
ATOM   7937  H  HG2  . GLU C  2 41  ? 132.697 98.524  98.117  1.00 39.82  ? 41  GLU J HG2  1 
ATOM   7938  H  HG3  . GLU C  2 41  ? 131.295 99.266  98.016  1.00 39.82  ? 41  GLU J HG3  1 
ATOM   7939  N  N    . LEU C  2 42  ? 131.609 94.323  96.833  1.00 47.09  ? 42  LEU J N    1 
ATOM   7940  C  CA   . LEU C  2 42  ? 131.433 92.881  96.902  1.00 47.09  ? 42  LEU J CA   1 
ATOM   7941  C  C    . LEU C  2 42  ? 132.462 92.274  97.842  1.00 47.09  ? 42  LEU J C    1 
ATOM   7942  O  O    . LEU C  2 42  ? 133.569 92.795  97.996  1.00 47.09  ? 42  LEU J O    1 
ATOM   7943  C  CB   . LEU C  2 42  ? 131.564 92.246  95.526  1.00 47.09  ? 42  LEU J CB   1 
ATOM   7944  C  CG   . LEU C  2 42  ? 130.873 92.972  94.381  1.00 47.09  ? 42  LEU J CG   1 
ATOM   7945  C  CD1  . LEU C  2 42  ? 131.051 92.200  93.111  1.00 47.09  ? 42  LEU J CD1  1 
ATOM   7946  C  CD2  . LEU C  2 42  ? 129.408 93.146  94.661  1.00 47.09  ? 42  LEU J CD2  1 
ATOM   7947  H  H    . LEU C  2 42  ? 132.366 94.556  96.507  1.00 47.09  ? 42  LEU J H    1 
ATOM   7948  H  HA   . LEU C  2 42  ? 130.550 92.685  97.240  1.00 47.09  ? 42  LEU J HA   1 
ATOM   7949  H  HB2  . LEU C  2 42  ? 132.505 92.193  95.312  1.00 47.09  ? 42  LEU J HB2  1 
ATOM   7950  H  HB3  . LEU C  2 42  ? 131.187 91.356  95.567  1.00 47.09  ? 42  LEU J HB3  1 
ATOM   7951  H  HG   . LEU C  2 42  ? 131.263 93.847  94.273  1.00 47.09  ? 42  LEU J HG   1 
ATOM   7952  H  HD11 . LEU C  2 42  ? 130.587 92.660  92.398  1.00 47.09  ? 42  LEU J HD11 1 
ATOM   7953  H  HD12 . LEU C  2 42  ? 131.997 92.144  92.912  1.00 47.09  ? 42  LEU J HD12 1 
ATOM   7954  H  HD13 . LEU C  2 42  ? 130.682 91.316  93.232  1.00 47.09  ? 42  LEU J HD13 1 
ATOM   7955  H  HD21 . LEU C  2 42  ? 129.008 93.630  93.925  1.00 47.09  ? 42  LEU J HD21 1 
ATOM   7956  H  HD22 . LEU C  2 42  ? 129.004 92.272  94.735  1.00 47.09  ? 42  LEU J HD22 1 
ATOM   7957  H  HD23 . LEU C  2 42  ? 129.302 93.641  95.486  1.00 47.09  ? 42  LEU J HD23 1 
ATOM   7958  N  N    . GLY C  2 43  ? 132.093 91.166  98.472  1.00 64.15  ? 43  GLY J N    1 
ATOM   7959  C  CA   . GLY C  2 43  ? 133.038 90.503  99.348  1.00 64.15  ? 43  GLY J CA   1 
ATOM   7960  C  C    . GLY C  2 43  ? 132.462 89.245  99.952  1.00 64.15  ? 43  GLY J C    1 
ATOM   7961  O  O    . GLY C  2 43  ? 131.386 88.785  99.572  1.00 64.15  ? 43  GLY J O    1 
ATOM   7962  H  H    . GLY C  2 43  ? 131.324 90.783  98.409  1.00 64.15  ? 43  GLY J H    1 
ATOM   7963  H  HA2  . GLY C  2 43  ? 133.833 90.266  98.849  1.00 64.15  ? 43  GLY J HA2  1 
ATOM   7964  H  HA3  . GLY C  2 43  ? 133.287 91.098  100.070 1.00 64.15  ? 43  GLY J HA3  1 
ATOM   7965  N  N    . CYS C  2 44  ? 133.219 88.685  100.894 1.00 84.78  ? 44  CYS J N    1 
ATOM   7966  C  CA   . CYS C  2 44  ? 132.797 87.537  101.686 1.00 84.78  ? 44  CYS J CA   1 
ATOM   7967  C  C    . CYS C  2 44  ? 133.008 87.865  103.154 1.00 84.78  ? 44  CYS J C    1 
ATOM   7968  O  O    . CYS C  2 44  ? 134.100 88.292  103.545 1.00 84.78  ? 44  CYS J O    1 
ATOM   7969  C  CB   . CYS C  2 44  ? 133.572 86.273  101.293 1.00 84.78  ? 44  CYS J CB   1 
ATOM   7970  S  SG   . CYS C  2 44  ? 135.264 86.152  101.932 1.00 84.78  ? 44  CYS J SG   1 
ATOM   7971  H  H    . CYS C  2 44  ? 134.007 88.962  101.095 1.00 84.78  ? 44  CYS J H    1 
ATOM   7972  H  HA   . CYS C  2 44  ? 131.852 87.372  101.544 1.00 84.78  ? 44  CYS J HA   1 
ATOM   7973  H  HB2  . CYS C  2 44  ? 133.079 85.499  101.606 1.00 84.78  ? 44  CYS J HB2  1 
ATOM   7974  H  HB3  . CYS C  2 44  ? 133.634 86.252  100.329 1.00 84.78  ? 44  CYS J HB3  1 
ATOM   7975  N  N    . ALA C  2 45  ? 131.969 87.678  103.964 1.00 92.53  ? 45  ALA J N    1 
ATOM   7976  C  CA   . ALA C  2 45  ? 132.023 88.049  105.371 1.00 92.53  ? 45  ALA J CA   1 
ATOM   7977  C  C    . ALA C  2 45  ? 131.509 86.915  106.245 1.00 92.53  ? 45  ALA J C    1 
ATOM   7978  O  O    . ALA C  2 45  ? 130.796 86.017  105.787 1.00 92.53  ? 45  ALA J O    1 
ATOM   7979  C  CB   . ALA C  2 45  ? 131.215 89.320  105.650 1.00 92.53  ? 45  ALA J CB   1 
ATOM   7980  H  H    . ALA C  2 45  ? 131.219 87.345  103.717 1.00 92.53  ? 45  ALA J H    1 
ATOM   7981  H  HA   . ALA C  2 45  ? 132.946 88.225  105.614 1.00 92.53  ? 45  ALA J HA   1 
ATOM   7982  H  HB1  . ALA C  2 45  ? 131.291 89.538  106.592 1.00 92.53  ? 45  ALA J HB1  1 
ATOM   7983  H  HB2  . ALA C  2 45  ? 131.575 90.043  105.114 1.00 92.53  ? 45  ALA J HB2  1 
ATOM   7984  H  HB3  . ALA C  2 45  ? 130.289 89.159  105.421 1.00 92.53  ? 45  ALA J HB3  1 
ATOM   7985  N  N    . ALA C  2 46  ? 131.894 86.971  107.523 1.00 100.06 ? 46  ALA J N    1 
ATOM   7986  C  CA   . ALA C  2 46  ? 131.485 85.953  108.485 1.00 100.06 ? 46  ALA J CA   1 
ATOM   7987  C  C    . ALA C  2 46  ? 129.973 85.790  108.482 1.00 100.06 ? 46  ALA J C    1 
ATOM   7988  O  O    . ALA C  2 46  ? 129.442 84.728  108.139 1.00 100.06 ? 46  ALA J O    1 
ATOM   7989  C  CB   . ALA C  2 46  ? 131.983 86.332  109.879 1.00 100.06 ? 46  ALA J CB   1 
ATOM   7990  H  H    . ALA C  2 46  ? 132.399 87.586  107.856 1.00 100.06 ? 46  ALA J H    1 
ATOM   7991  H  HA   . ALA C  2 46  ? 131.886 85.106  108.240 1.00 100.06 ? 46  ALA J HA   1 
ATOM   7992  H  HB1  . ALA C  2 46  ? 131.745 85.631  110.503 1.00 100.06 ? 46  ALA J HB1  1 
ATOM   7993  H  HB2  . ALA C  2 46  ? 132.946 86.445  109.856 1.00 100.06 ? 46  ALA J HB2  1 
ATOM   7994  H  HB3  . ALA C  2 46  ? 131.563 87.167  110.142 1.00 100.06 ? 46  ALA J HB3  1 
ATOM   7995  N  N    . THR C  2 47  ? 129.265 86.846  108.862 1.00 98.92  ? 47  THR J N    1 
ATOM   7996  C  CA   . THR C  2 47  ? 127.838 86.966  108.620 1.00 98.92  ? 47  THR J CA   1 
ATOM   7997  C  C    . THR C  2 47  ? 127.573 88.332  108.010 1.00 98.92  ? 47  THR J C    1 
ATOM   7998  O  O    . THR C  2 47  ? 128.239 89.317  108.342 1.00 98.92  ? 47  THR J O    1 
ATOM   7999  C  CB   . THR C  2 47  ? 127.009 86.787  109.893 1.00 98.92  ? 47  THR J CB   1 
ATOM   8000  O  OG1  . THR C  2 47  ? 125.620 86.942  109.579 1.00 98.92  ? 47  THR J OG1  1 
ATOM   8001  C  CG2  . THR C  2 47  ? 127.407 87.807  110.940 1.00 98.92  ? 47  THR J CG2  1 
ATOM   8002  H  H    . THR C  2 47  ? 129.601 87.521  109.277 1.00 98.92  ? 47  THR J H    1 
ATOM   8003  H  HA   . THR C  2 47  ? 127.575 86.289  107.990 1.00 98.92  ? 47  THR J HA   1 
ATOM   8004  H  HB   . THR C  2 47  ? 127.162 85.899  110.249 1.00 98.92  ? 47  THR J HB   1 
ATOM   8005  H  HG1  . THR C  2 47  ? 125.148 86.724  110.237 1.00 98.92  ? 47  THR J HG1  1 
ATOM   8006  H  HG21 . THR C  2 47  ? 126.941 87.621  111.769 1.00 98.92  ? 47  THR J HG21 1 
ATOM   8007  H  HG22 . THR C  2 47  ? 128.363 87.768  111.098 1.00 98.92  ? 47  THR J HG22 1 
ATOM   8008  H  HG23 . THR C  2 47  ? 127.173 88.699  110.641 1.00 98.92  ? 47  THR J HG23 1 
ATOM   8009  N  N    . CYS C  2 48  ? 126.595 88.384  107.117 1.00 93.14  ? 48  CYS J N    1 
ATOM   8010  C  CA   . CYS C  2 48  ? 126.429 89.568  106.292 1.00 93.14  ? 48  CYS J CA   1 
ATOM   8011  C  C    . CYS C  2 48  ? 126.163 90.785  107.176 1.00 93.14  ? 48  CYS J C    1 
ATOM   8012  O  O    . CYS C  2 48  ? 125.419 90.690  108.158 1.00 93.14  ? 48  CYS J O    1 
ATOM   8013  C  CB   . CYS C  2 48  ? 125.300 89.355  105.283 1.00 93.14  ? 48  CYS J CB   1 
ATOM   8014  S  SG   . CYS C  2 48  ? 125.872 88.421  103.838 1.00 93.14  ? 48  CYS J SG   1 
ATOM   8015  H  H    . CYS C  2 48  ? 126.023 87.760  106.976 1.00 93.14  ? 48  CYS J H    1 
ATOM   8016  H  HA   . CYS C  2 48  ? 127.249 89.716  105.798 1.00 93.14  ? 48  CYS J HA   1 
ATOM   8017  H  HB2  . CYS C  2 48  ? 124.584 88.858  105.705 1.00 93.14  ? 48  CYS J HB2  1 
ATOM   8018  H  HB3  . CYS C  2 48  ? 124.976 90.216  104.980 1.00 93.14  ? 48  CYS J HB3  1 
ATOM   8019  N  N    . PRO C  2 49  ? 126.756 91.940  106.860 1.00 82.05  ? 49  PRO J N    1 
ATOM   8020  C  CA   . PRO C  2 49  ? 126.845 93.022  107.848 1.00 82.05  ? 49  PRO J CA   1 
ATOM   8021  C  C    . PRO C  2 49  ? 125.599 93.887  107.945 1.00 82.05  ? 49  PRO J C    1 
ATOM   8022  O  O    . PRO C  2 49  ? 124.578 93.618  107.304 1.00 82.05  ? 49  PRO J O    1 
ATOM   8023  C  CB   . PRO C  2 49  ? 128.047 93.831  107.352 1.00 82.05  ? 49  PRO J CB   1 
ATOM   8024  C  CG   . PRO C  2 49  ? 128.025 93.651  105.869 1.00 82.05  ? 49  PRO J CG   1 
ATOM   8025  C  CD   . PRO C  2 49  ? 127.337 92.337  105.567 1.00 82.05  ? 49  PRO J CD   1 
ATOM   8026  H  HA   . PRO C  2 49  ? 127.045 92.656  108.724 1.00 82.05  ? 49  PRO J HA   1 
ATOM   8027  H  HB2  . PRO C  2 49  ? 127.940 94.766  107.588 1.00 82.05  ? 49  PRO J HB2  1 
ATOM   8028  H  HB3  . PRO C  2 49  ? 128.863 93.474  107.733 1.00 82.05  ? 49  PRO J HB3  1 
ATOM   8029  H  HG2  . PRO C  2 49  ? 127.536 94.383  105.464 1.00 82.05  ? 49  PRO J HG2  1 
ATOM   8030  H  HG3  . PRO C  2 49  ? 128.936 93.633  105.538 1.00 82.05  ? 49  PRO J HG3  1 
ATOM   8031  H  HD2  . PRO C  2 49  ? 126.634 92.466  104.914 1.00 82.05  ? 49  PRO J HD2  1 
ATOM   8032  H  HD3  . PRO C  2 49  ? 127.985 91.683  105.270 1.00 82.05  ? 49  PRO J HD3  1 
ATOM   8033  N  N    . SER C  2 50  ? 125.691 94.940  108.754 1.00 72.23  ? 50  SER J N    1 
ATOM   8034  C  CA   . SER C  2 50  ? 124.542 95.788  109.025 1.00 72.23  ? 50  SER J CA   1 
ATOM   8035  C  C    . SER C  2 50  ? 124.218 96.656  107.818 1.00 72.23  ? 50  SER J C    1 
ATOM   8036  O  O    . SER C  2 50  ? 125.112 97.135  107.116 1.00 72.23  ? 50  SER J O    1 
ATOM   8037  C  CB   . SER C  2 50  ? 124.813 96.668  110.243 1.00 72.23  ? 50  SER J CB   1 
ATOM   8038  O  OG   . SER C  2 50  ? 123.685 97.460  110.562 1.00 72.23  ? 50  SER J OG   1 
ATOM   8039  H  H    . SER C  2 50  ? 126.413 95.190  109.152 1.00 72.23  ? 50  SER J H    1 
ATOM   8040  H  HA   . SER C  2 50  ? 123.770 95.232  109.213 1.00 72.23  ? 50  SER J HA   1 
ATOM   8041  H  HB2  . SER C  2 50  ? 125.030 96.104  111.001 1.00 72.23  ? 50  SER J HB2  1 
ATOM   8042  H  HB3  . SER C  2 50  ? 125.562 97.251  110.043 1.00 72.23  ? 50  SER J HB3  1 
ATOM   8043  H  HG   . SER C  2 50  ? 123.873 97.984  111.192 1.00 72.23  ? 50  SER J HG   1 
ATOM   8044  N  N    . LYS C  2 51  ? 122.925 96.858  107.584 1.00 54.58  ? 51  LYS J N    1 
ATOM   8045  C  CA   . LYS C  2 51  ? 122.439 97.694  106.495 1.00 54.58  ? 51  LYS J CA   1 
ATOM   8046  C  C    . LYS C  2 51  ? 122.081 99.061  107.062 1.00 54.58  ? 51  LYS J C    1 
ATOM   8047  O  O    . LYS C  2 51  ? 121.113 99.197  107.815 1.00 54.58  ? 51  LYS J O    1 
ATOM   8048  C  CB   . LYS C  2 51  ? 121.239 97.043  105.813 1.00 54.58  ? 51  LYS J CB   1 
ATOM   8049  C  CG   . LYS C  2 51  ? 120.173 98.011  105.339 1.00 54.58  ? 51  LYS J CG   1 
ATOM   8050  C  CD   . LYS C  2 51  ? 119.230 97.337  104.365 1.00 54.58  ? 51  LYS J CD   1 
ATOM   8051  C  CE   . LYS C  2 51  ? 118.180 98.301  103.841 1.00 54.58  ? 51  LYS J CE   1 
ATOM   8052  N  NZ   . LYS C  2 51  ? 117.473 97.752  102.657 1.00 54.58  ? 51  LYS J NZ   1 
ATOM   8053  H  H    . LYS C  2 51  ? 122.297 96.506  108.049 1.00 54.58  ? 51  LYS J H    1 
ATOM   8054  H  HA   . LYS C  2 51  ? 123.139 97.811  105.837 1.00 54.58  ? 51  LYS J HA   1 
ATOM   8055  H  HB2  . LYS C  2 51  ? 121.552 96.556  105.036 1.00 54.58  ? 51  LYS J HB2  1 
ATOM   8056  H  HB3  . LYS C  2 51  ? 120.820 96.431  106.437 1.00 54.58  ? 51  LYS J HB3  1 
ATOM   8057  H  HG2  . LYS C  2 51  ? 119.656 98.325  106.095 1.00 54.58  ? 51  LYS J HG2  1 
ATOM   8058  H  HG3  . LYS C  2 51  ? 120.593 98.757  104.886 1.00 54.58  ? 51  LYS J HG3  1 
ATOM   8059  H  HD2  . LYS C  2 51  ? 119.739 97.003  103.612 1.00 54.58  ? 51  LYS J HD2  1 
ATOM   8060  H  HD3  . LYS C  2 51  ? 118.779 96.606  104.813 1.00 54.58  ? 51  LYS J HD3  1 
ATOM   8061  H  HE2  . LYS C  2 51  ? 117.524 98.466  104.535 1.00 54.58  ? 51  LYS J HE2  1 
ATOM   8062  H  HE3  . LYS C  2 51  ? 118.605 99.134  103.584 1.00 54.58  ? 51  LYS J HE3  1 
ATOM   8063  H  HZ1  . LYS C  2 51  ? 116.950 98.376  102.300 1.00 54.58  ? 51  LYS J HZ1  1 
ATOM   8064  H  HZ2  . LYS C  2 51  ? 118.065 97.486  102.049 1.00 54.58  ? 51  LYS J HZ2  1 
ATOM   8065  H  HZ3  . LYS C  2 51  ? 116.978 97.056  102.899 1.00 54.58  ? 51  LYS J HZ3  1 
ATOM   8066  N  N    . LYS C  2 52  ? 122.870 100.070 106.706 1.00 50.46  ? 52  LYS J N    1 
ATOM   8067  C  CA   . LYS C  2 52  ? 122.556 101.437 107.060 1.00 50.46  ? 52  LYS J CA   1 
ATOM   8068  C  C    . LYS C  2 52  ? 121.270 101.860 106.357 1.00 50.46  ? 52  LYS J C    1 
ATOM   8069  O  O    . LYS C  2 52  ? 120.777 101.166 105.467 1.00 50.46  ? 52  LYS J O    1 
ATOM   8070  C  CB   . LYS C  2 52  ? 123.712 102.358 106.683 1.00 50.46  ? 52  LYS J CB   1 
ATOM   8071  C  CG   . LYS C  2 52  ? 124.939 102.192 107.543 1.00 50.46  ? 52  LYS J CG   1 
ATOM   8072  C  CD   . LYS C  2 52  ? 125.887 103.354 107.353 1.00 50.46  ? 52  LYS J CD   1 
ATOM   8073  C  CE   . LYS C  2 52  ? 127.107 103.240 108.239 1.00 50.46  ? 52  LYS J CE   1 
ATOM   8074  N  NZ   . LYS C  2 52  ? 128.262 102.694 107.480 1.00 50.46  ? 52  LYS J NZ   1 
ATOM   8075  H  H    . LYS C  2 52  ? 123.602 99.981  106.264 1.00 50.46  ? 52  LYS J H    1 
ATOM   8076  H  HA   . LYS C  2 52  ? 122.421 101.496 108.018 1.00 50.46  ? 52  LYS J HA   1 
ATOM   8077  H  HB2  . LYS C  2 52  ? 123.969 102.172 105.767 1.00 50.46  ? 52  LYS J HB2  1 
ATOM   8078  H  HB3  . LYS C  2 52  ? 123.428 103.278 106.760 1.00 50.46  ? 52  LYS J HB3  1 
ATOM   8079  H  HG2  . LYS C  2 52  ? 124.671 102.162 108.473 1.00 50.46  ? 52  LYS J HG2  1 
ATOM   8080  H  HG3  . LYS C  2 52  ? 125.398 101.377 107.289 1.00 50.46  ? 52  LYS J HG3  1 
ATOM   8081  H  HD2  . LYS C  2 52  ? 126.185 103.378 106.435 1.00 50.46  ? 52  LYS J HD2  1 
ATOM   8082  H  HD3  . LYS C  2 52  ? 125.424 104.177 107.575 1.00 50.46  ? 52  LYS J HD3  1 
ATOM   8083  H  HE2  . LYS C  2 52  ? 127.347 104.122 108.561 1.00 50.46  ? 52  LYS J HE2  1 
ATOM   8084  H  HE3  . LYS C  2 52  ? 126.916 102.650 108.982 1.00 50.46  ? 52  LYS J HE3  1 
ATOM   8085  H  HZ1  . LYS C  2 52  ? 128.709 102.113 107.981 1.00 50.46  ? 52  LYS J HZ1  1 
ATOM   8086  H  HZ2  . LYS C  2 52  ? 127.973 102.281 106.746 1.00 50.46  ? 52  LYS J HZ2  1 
ATOM   8087  H  HZ3  . LYS C  2 52  ? 128.809 103.354 107.239 1.00 50.46  ? 52  LYS J HZ3  1 
ATOM   8088  N  N    . PRO C  2 53  ? 120.695 103.001 106.745 1.00 48.62  ? 53  PRO J N    1 
ATOM   8089  C  CA   . PRO C  2 53  ? 119.441 103.425 106.105 1.00 48.62  ? 53  PRO J CA   1 
ATOM   8090  C  C    . PRO C  2 53  ? 119.557 103.580 104.602 1.00 48.62  ? 53  PRO J C    1 
ATOM   8091  O  O    . PRO C  2 53  ? 118.617 103.245 103.871 1.00 48.62  ? 53  PRO J O    1 
ATOM   8092  C  CB   . PRO C  2 53  ? 119.139 104.766 106.787 1.00 48.62  ? 53  PRO J CB   1 
ATOM   8093  C  CG   . PRO C  2 53  ? 119.911 104.741 108.057 1.00 48.62  ? 53  PRO J CG   1 
ATOM   8094  C  CD   . PRO C  2 53  ? 121.140 103.953 107.774 1.00 48.62  ? 53  PRO J CD   1 
ATOM   8095  H  HA   . PRO C  2 53  ? 118.732 102.796 106.305 1.00 48.62  ? 53  PRO J HA   1 
ATOM   8096  H  HB2  . PRO C  2 53  ? 119.446 105.488 106.217 1.00 48.62  ? 53  PRO J HB2  1 
ATOM   8097  H  HB3  . PRO C  2 53  ? 118.189 104.843 106.956 1.00 48.62  ? 53  PRO J HB3  1 
ATOM   8098  H  HG2  . PRO C  2 53  ? 120.145 105.650 108.306 1.00 48.62  ? 53  PRO J HG2  1 
ATOM   8099  H  HG3  . PRO C  2 53  ? 119.386 104.319 108.752 1.00 48.62  ? 53  PRO J HG3  1 
ATOM   8100  H  HD2  . PRO C  2 53  ? 121.830 104.533 107.417 1.00 48.62  ? 53  PRO J HD2  1 
ATOM   8101  H  HD3  . PRO C  2 53  ? 121.443 103.488 108.566 1.00 48.62  ? 53  PRO J HD3  1 
ATOM   8102  N  N    . TYR C  2 54  ? 120.693 104.076 104.120 1.00 40.89  ? 54  TYR J N    1 
ATOM   8103  C  CA   . TYR C  2 54  ? 120.881 104.374 102.708 1.00 40.89  ? 54  TYR J CA   1 
ATOM   8104  C  C    . TYR C  2 54  ? 121.557 103.246 101.940 1.00 40.89  ? 54  TYR J C    1 
ATOM   8105  O  O    . TYR C  2 54  ? 121.802 103.398 100.740 1.00 40.89  ? 54  TYR J O    1 
ATOM   8106  C  CB   . TYR C  2 54  ? 121.690 105.667 102.551 1.00 40.89  ? 54  TYR J CB   1 
ATOM   8107  C  CG   . TYR C  2 54  ? 123.013 105.701 103.284 1.00 40.89  ? 54  TYR J CG   1 
ATOM   8108  C  CD1  . TYR C  2 54  ? 124.138 105.091 102.757 1.00 40.89  ? 54  TYR J CD1  1 
ATOM   8109  C  CD2  . TYR C  2 54  ? 123.140 106.370 104.491 1.00 40.89  ? 54  TYR J CD2  1 
ATOM   8110  C  CE1  . TYR C  2 54  ? 125.348 105.128 103.418 1.00 40.89  ? 54  TYR J CE1  1 
ATOM   8111  C  CE2  . TYR C  2 54  ? 124.346 106.413 105.159 1.00 40.89  ? 54  TYR J CE2  1 
ATOM   8112  C  CZ   . TYR C  2 54  ? 125.448 105.791 104.617 1.00 40.89  ? 54  TYR J CZ   1 
ATOM   8113  O  OH   . TYR C  2 54  ? 126.653 105.832 105.276 1.00 40.89  ? 54  TYR J OH   1 
ATOM   8114  H  H    . TYR C  2 54  ? 121.381 104.249 104.604 1.00 40.89  ? 54  TYR J H    1 
ATOM   8115  H  HA   . TYR C  2 54  ? 120.012 104.521 102.307 1.00 40.89  ? 54  TYR J HA   1 
ATOM   8116  H  HB2  . TYR C  2 54  ? 121.876 105.805 101.612 1.00 40.89  ? 54  TYR J HB2  1 
ATOM   8117  H  HB3  . TYR C  2 54  ? 121.159 106.400 102.894 1.00 40.89  ? 54  TYR J HB3  1 
ATOM   8118  H  HD1  . TYR C  2 54  ? 124.074 104.639 101.948 1.00 40.89  ? 54  TYR J HD1  1 
ATOM   8119  H  HD2  . TYR C  2 54  ? 122.400 106.790 104.859 1.00 40.89  ? 54  TYR J HD2  1 
ATOM   8120  H  HE1  . TYR C  2 54  ? 126.095 104.712 103.055 1.00 40.89  ? 54  TYR J HE1  1 
ATOM   8121  H  HE2  . TYR C  2 54  ? 124.419 106.863 105.969 1.00 40.89  ? 54  TYR J HE2  1 
ATOM   8122  H  HH   . TYR C  2 54  ? 126.677 106.501 105.785 1.00 40.89  ? 54  TYR J HH   1 
ATOM   8123  N  N    . GLU C  2 55  ? 121.852 102.123 102.589 1.00 46.97  ? 55  GLU J N    1 
ATOM   8124  C  CA   . GLU C  2 55  ? 122.554 101.012 101.965 1.00 46.97  ? 55  GLU J CA   1 
ATOM   8125  C  C    . GLU C  2 55  ? 121.615 99.830  101.775 1.00 46.97  ? 55  GLU J C    1 
ATOM   8126  O  O    . GLU C  2 55  ? 120.733 99.582  102.601 1.00 46.97  ? 55  GLU J O    1 
ATOM   8127  C  CB   . GLU C  2 55  ? 123.755 100.598 102.810 1.00 46.97  ? 55  GLU J CB   1 
ATOM   8128  C  CG   . GLU C  2 55  ? 124.956 101.490 102.590 1.00 46.97  ? 55  GLU J CG   1 
ATOM   8129  C  CD   . GLU C  2 55  ? 125.980 101.402 103.695 1.00 46.97  ? 55  GLU J CD   1 
ATOM   8130  O  OE1  . GLU C  2 55  ? 126.623 100.350 103.844 1.00 46.97  ? 55  GLU J OE1  1 
ATOM   8131  O  OE2  . GLU C  2 55  ? 126.156 102.402 104.411 1.00 46.97  ? 55  GLU J OE2  1 
ATOM   8132  H  H    . GLU C  2 55  ? 121.661 101.984 103.413 1.00 46.97  ? 55  GLU J H    1 
ATOM   8133  H  HA   . GLU C  2 55  ? 122.879 101.281 101.095 1.00 46.97  ? 55  GLU J HA   1 
ATOM   8134  H  HB2  . GLU C  2 55  ? 123.516 100.629 103.746 1.00 46.97  ? 55  GLU J HB2  1 
ATOM   8135  H  HB3  . GLU C  2 55  ? 124.007 99.694  102.563 1.00 46.97  ? 55  GLU J HB3  1 
ATOM   8136  H  HG2  . GLU C  2 55  ? 125.386 101.231 101.764 1.00 46.97  ? 55  GLU J HG2  1 
ATOM   8137  H  HG3  . GLU C  2 55  ? 124.651 102.408 102.533 1.00 46.97  ? 55  GLU J HG3  1 
ATOM   8138  N  N    . GLU C  2 56  ? 121.810 99.110  100.675 1.00 47.89  ? 56  GLU J N    1 
ATOM   8139  C  CA   . GLU C  2 56  ? 121.063 97.901  100.363 1.00 47.89  ? 56  GLU J CA   1 
ATOM   8140  C  C    . GLU C  2 56  ? 122.026 96.728  100.285 1.00 47.89  ? 56  GLU J C    1 
ATOM   8141  O  O    . GLU C  2 56  ? 123.145 96.865  99.787  1.00 47.89  ? 56  GLU J O    1 
ATOM   8142  C  CB   . GLU C  2 56  ? 120.314 98.037  99.043  1.00 47.89  ? 56  GLU J CB   1 
ATOM   8143  C  CG   . GLU C  2 56  ? 119.290 99.148  99.041  1.00 47.89  ? 56  GLU J CG   1 
ATOM   8144  C  CD   . GLU C  2 56  ? 118.502 99.213  97.748  1.00 47.89  ? 56  GLU J CD   1 
ATOM   8145  O  OE1  . GLU C  2 56  ? 118.931 98.588  96.755  1.00 47.89  ? 56  GLU J OE1  1 
ATOM   8146  O  OE2  . GLU C  2 56  ? 117.450 99.887  97.725  1.00 47.89  ? 56  GLU J OE2  1 
ATOM   8147  H  H    . GLU C  2 56  ? 122.388 99.313  100.076 1.00 47.89  ? 56  GLU J H    1 
ATOM   8148  H  HA   . GLU C  2 56  ? 120.421 97.728  101.063 1.00 47.89  ? 56  GLU J HA   1 
ATOM   8149  H  HB2  . GLU C  2 56  ? 120.954 98.222  98.343  1.00 47.89  ? 56  GLU J HB2  1 
ATOM   8150  H  HB3  . GLU C  2 56  ? 119.857 97.204  98.856  1.00 47.89  ? 56  GLU J HB3  1 
ATOM   8151  H  HG2  . GLU C  2 56  ? 118.667 99.001  99.767  1.00 47.89  ? 56  GLU J HG2  1 
ATOM   8152  H  HG3  . GLU C  2 56  ? 119.750 99.994  99.162  1.00 47.89  ? 56  GLU J HG3  1 
ATOM   8153  N  N    . VAL C  2 57  ? 121.585 95.577  100.777 1.00 54.84  ? 57  VAL J N    1 
ATOM   8154  C  CA   . VAL C  2 57  ? 122.410 94.378  100.817 1.00 54.84  ? 57  VAL J CA   1 
ATOM   8155  C  C    . VAL C  2 57  ? 121.616 93.209  100.260 1.00 54.84  ? 57  VAL J C    1 
ATOM   8156  O  O    . VAL C  2 57  ? 120.410 93.087  100.504 1.00 54.84  ? 57  VAL J O    1 
ATOM   8157  C  CB   . VAL C  2 57  ? 122.902 94.069  102.243 1.00 54.84  ? 57  VAL J CB   1 
ATOM   8158  C  CG1  . VAL C  2 57  ? 123.790 92.844  102.235 1.00 54.84  ? 57  VAL J CG1  1 
ATOM   8159  C  CG2  . VAL C  2 57  ? 123.653 95.252  102.799 1.00 54.84  ? 57  VAL J CG2  1 
ATOM   8160  H  H    . VAL C  2 57  ? 120.797 95.460  101.090 1.00 54.84  ? 57  VAL J H    1 
ATOM   8161  H  HA   . VAL C  2 57  ? 123.187 94.506  100.256 1.00 54.84  ? 57  VAL J HA   1 
ATOM   8162  H  HB   . VAL C  2 57  ? 122.139 93.893  102.811 1.00 54.84  ? 57  VAL J HB   1 
ATOM   8163  H  HG11 . VAL C  2 57  ? 124.140 92.700  103.126 1.00 54.84  ? 57  VAL J HG11 1 
ATOM   8164  H  HG12 . VAL C  2 57  ? 123.272 92.076  101.952 1.00 54.84  ? 57  VAL J HG12 1 
ATOM   8165  H  HG13 . VAL C  2 57  ? 124.519 92.997  101.617 1.00 54.84  ? 57  VAL J HG13 1 
ATOM   8166  H  HG21 . VAL C  2 57  ? 123.914 95.063  103.711 1.00 54.84  ? 57  VAL J HG21 1 
ATOM   8167  H  HG22 . VAL C  2 57  ? 124.438 95.399  102.254 1.00 54.84  ? 57  VAL J HG22 1 
ATOM   8168  H  HG23 . VAL C  2 57  ? 123.080 96.033  102.771 1.00 54.84  ? 57  VAL J HG23 1 
ATOM   8169  N  N    . THR C  2 58  ? 122.300 92.351  99.509  1.00 64.30  ? 58  THR J N    1 
ATOM   8170  C  CA   . THR C  2 58  ? 121.727 91.135  98.940  1.00 64.30  ? 58  THR J CA   1 
ATOM   8171  C  C    . THR C  2 58  ? 122.702 90.012  99.272  1.00 64.30  ? 58  THR J C    1 
ATOM   8172  O  O    . THR C  2 58  ? 123.724 89.849  98.600  1.00 64.30  ? 58  THR J O    1 
ATOM   8173  C  CB   . THR C  2 58  ? 121.511 91.273  97.440  1.00 64.30  ? 58  THR J CB   1 
ATOM   8174  O  OG1  . THR C  2 58  ? 120.672 92.405  97.181  1.00 64.30  ? 58  THR J OG1  1 
ATOM   8175  C  CG2  . THR C  2 58  ? 120.852 90.036  96.881  1.00 64.30  ? 58  THR J CG2  1 
ATOM   8176  H  H    . THR C  2 58  ? 123.130 92.456  99.315  1.00 64.30  ? 58  THR J H    1 
ATOM   8177  H  HA   . THR C  2 58  ? 120.875 90.948  99.360  1.00 64.30  ? 58  THR J HA   1 
ATOM   8178  H  HB   . THR C  2 58  ? 122.368 91.392  97.001  1.00 64.30  ? 58  THR J HB   1 
ATOM   8179  H  HG1  . THR C  2 58  ? 120.493 92.442  96.364  1.00 64.30  ? 58  THR J HG1  1 
ATOM   8180  H  HG21 . THR C  2 58  ? 120.717 90.143  95.927  1.00 64.30  ? 58  THR J HG21 1 
ATOM   8181  H  HG22 . THR C  2 58  ? 121.401 89.253  97.044  1.00 64.30  ? 58  THR J HG22 1 
ATOM   8182  H  HG23 . THR C  2 58  ? 119.991 89.914  97.309  1.00 64.30  ? 58  THR J HG23 1 
ATOM   8183  N  N    . CYS C  2 59  ? 122.385 89.246  100.309 1.00 83.56  ? 59  CYS J N    1 
ATOM   8184  C  CA   . CYS C  2 59  ? 123.314 88.299  100.904 1.00 83.56  ? 59  CYS J CA   1 
ATOM   8185  C  C    . CYS C  2 59  ? 122.987 86.887  100.438 1.00 83.56  ? 59  CYS J C    1 
ATOM   8186  O  O    . CYS C  2 59  ? 121.827 86.466  100.484 1.00 83.56  ? 59  CYS J O    1 
ATOM   8187  C  CB   . CYS C  2 59  ? 123.250 88.388  102.428 1.00 83.56  ? 59  CYS J CB   1 
ATOM   8188  S  SG   . CYS C  2 59  ? 124.308 87.245  103.304 1.00 83.56  ? 59  CYS J SG   1 
ATOM   8189  H  H    . CYS C  2 59  ? 121.615 89.259  100.694 1.00 83.56  ? 59  CYS J H    1 
ATOM   8190  H  HA   . CYS C  2 59  ? 124.216 88.512  100.622 1.00 83.56  ? 59  CYS J HA   1 
ATOM   8191  H  HB2  . CYS C  2 59  ? 123.517 89.282  102.688 1.00 83.56  ? 59  CYS J HB2  1 
ATOM   8192  H  HB3  . CYS C  2 59  ? 122.337 88.226  102.708 1.00 83.56  ? 59  CYS J HB3  1 
ATOM   8193  N  N    . CYS C  2 60  ? 124.012 86.169  99.995  1.00 95.50  ? 60  CYS J N    1 
ATOM   8194  C  CA   . CYS C  2 60  ? 123.899 84.807  99.495  1.00 95.50  ? 60  CYS J CA   1 
ATOM   8195  C  C    . CYS C  2 60  ? 124.769 83.884  100.335 1.00 95.50  ? 60  CYS J C    1 
ATOM   8196  O  O    . CYS C  2 60  ? 125.435 84.302  101.281 1.00 95.50  ? 60  CYS J O    1 
ATOM   8197  C  CB   . CYS C  2 60  ? 124.327 84.714  98.032  1.00 95.50  ? 60  CYS J CB   1 
ATOM   8198  S  SG   . CYS C  2 60  ? 123.172 85.388  96.834  1.00 95.50  ? 60  CYS J SG   1 
ATOM   8199  H  H    . CYS C  2 60  ? 124.820 86.464  99.972  1.00 95.50  ? 60  CYS J H    1 
ATOM   8200  H  HA   . CYS C  2 60  ? 122.978 84.512  99.559  1.00 95.50  ? 60  CYS J HA   1 
ATOM   8201  H  HB2  . CYS C  2 60  ? 125.171 85.181  97.927  1.00 95.50  ? 60  CYS J HB2  1 
ATOM   8202  H  HB3  . CYS C  2 60  ? 124.447 83.780  97.805  1.00 95.50  ? 60  CYS J HB3  1 
ATOM   8203  N  N    . SER C  2 61  ? 124.717 82.573  100.057 1.00 99.37  ? 61  SER J N    1 
ATOM   8204  C  CA   . SER C  2 61  ? 125.562 81.553  100.740 1.00 99.37  ? 61  SER J CA   1 
ATOM   8205  C  C    . SER C  2 61  ? 126.085 80.555  99.704  1.00 99.37  ? 61  SER J C    1 
ATOM   8206  O  O    . SER C  2 61  ? 126.555 79.482  100.126 1.00 99.37  ? 61  SER J O    1 
ATOM   8207  C  CB   . SER C  2 61  ? 124.779 80.847  101.814 1.00 99.37  ? 61  SER J CB   1 
ATOM   8208  O  OG   . SER C  2 61  ? 123.806 81.708  102.385 1.00 99.37  ? 61  SER J OG   1 
ATOM   8209  H  H    . SER C  2 61  ? 124.076 82.191  99.530  1.00 99.37  ? 61  SER J H    1 
ATOM   8210  H  HA   . SER C  2 61  ? 126.342 82.006  101.155 1.00 99.37  ? 61  SER J HA   1 
ATOM   8211  H  HB2  . SER C  2 61  ? 124.331 80.061  101.428 1.00 99.37  ? 61  SER J HB2  1 
ATOM   8212  H  HB3  . SER C  2 61  ? 125.394 80.537  102.516 1.00 99.37  ? 61  SER J HB3  1 
ATOM   8213  H  HG   . SER C  2 61  ? 123.464 81.320  103.054 1.00 99.37  ? 61  SER J HG   1 
ATOM   8214  N  N    . THR C  2 62  ? 126.044 80.895  98.412  1.00 98.87  ? 62  THR J N    1 
ATOM   8215  C  CA   . THR C  2 62  ? 126.446 79.997  97.301  1.00 98.87  ? 62  THR J CA   1 
ATOM   8216  C  C    . THR C  2 62  ? 127.607 80.625  96.530  1.00 98.87  ? 62  THR J C    1 
ATOM   8217  O  O    . THR C  2 62  ? 127.837 81.834  96.715  1.00 98.87  ? 62  THR J O    1 
ATOM   8218  C  CB   . THR C  2 62  ? 125.248 79.763  96.375  1.00 98.87  ? 62  THR J CB   1 
ATOM   8219  O  OG1  . THR C  2 62  ? 124.077 80.117  97.111  1.00 98.87  ? 62  THR J OG1  1 
ATOM   8220  C  CG2  . THR C  2 62  ? 125.145 78.339  95.874  1.00 98.87  ? 62  THR J CG2  1 
ATOM   8221  H  H    . THR C  2 62  ? 125.799 81.719  98.117  1.00 98.87  ? 62  THR J H    1 
ATOM   8222  H  HA   . THR C  2 62  ? 126.738 79.136  97.674  1.00 98.87  ? 62  THR J HA   1 
ATOM   8223  H  HB   . THR C  2 62  ? 125.334 80.369  95.600  1.00 98.87  ? 62  THR J HB   1 
ATOM   8224  H  HG1  . THR C  2 62  ? 123.393 80.042  96.616  1.00 98.87  ? 62  THR J HG1  1 
ATOM   8225  H  HG21 . THR C  2 62  ? 124.401 78.266  95.250  1.00 98.87  ? 62  THR J HG21 1 
ATOM   8226  H  HG22 . THR C  2 62  ? 125.970 78.091  95.421  1.00 98.87  ? 62  THR J HG22 1 
ATOM   8227  H  HG23 . THR C  2 62  ? 124.996 77.739  96.627  1.00 98.87  ? 62  THR J HG23 1 
ATOM   8228  N  N    . ASP C  2 63  ? 128.311 79.849  95.704  1.00 94.10  ? 63  ASP J N    1 
ATOM   8229  C  CA   . ASP C  2 63  ? 129.432 80.330  94.908  1.00 94.10  ? 63  ASP J CA   1 
ATOM   8230  C  C    . ASP C  2 63  ? 128.951 81.308  93.848  1.00 94.10  ? 63  ASP J C    1 
ATOM   8231  O  O    . ASP C  2 63  ? 127.982 81.041  93.134  1.00 94.10  ? 63  ASP J O    1 
ATOM   8232  C  CB   . ASP C  2 63  ? 130.150 79.158  94.236  1.00 94.10  ? 63  ASP J CB   1 
ATOM   8233  C  CG   . ASP C  2 63  ? 131.091 78.428  95.175  1.00 94.10  ? 63  ASP J CG   1 
ATOM   8234  O  OD1  . ASP C  2 63  ? 131.761 79.092  95.992  1.00 94.10  ? 63  ASP J OD1  1 
ATOM   8235  O  OD2  . ASP C  2 63  ? 131.160 77.181  95.097  1.00 94.10  ? 63  ASP J OD2  1 
ATOM   8236  H  H    . ASP C  2 63  ? 128.169 78.996  95.643  1.00 94.10  ? 63  ASP J H    1 
ATOM   8237  H  HA   . ASP C  2 63  ? 130.069 80.789  95.482  1.00 94.10  ? 63  ASP J HA   1 
ATOM   8238  H  HB2  . ASP C  2 63  ? 129.491 78.529  93.898  1.00 94.10  ? 63  ASP J HB2  1 
ATOM   8239  H  HB3  . ASP C  2 63  ? 130.689 79.512  93.507  1.00 94.10  ? 63  ASP J HB3  1 
ATOM   8240  N  N    . LYS C  2 64  ? 129.649 82.441  93.739  1.00 81.77  ? 64  LYS J N    1 
ATOM   8241  C  CA   . LYS C  2 64  ? 129.411 83.404  92.670  1.00 81.77  ? 64  LYS J CA   1 
ATOM   8242  C  C    . LYS C  2 64  ? 127.947 83.827  92.619  1.00 81.77  ? 64  LYS J C    1 
ATOM   8243  O  O    . LYS C  2 64  ? 127.348 83.939  91.547  1.00 81.77  ? 64  LYS J O    1 
ATOM   8244  C  CB   . LYS C  2 64  ? 129.847 82.837  91.320  1.00 81.77  ? 64  LYS J CB   1 
ATOM   8245  C  CG   . LYS C  2 64  ? 131.335 82.580  91.195  1.00 81.77  ? 64  LYS J CG   1 
ATOM   8246  C  CD   . LYS C  2 64  ? 131.671 82.077  89.800  1.00 81.77  ? 64  LYS J CD   1 
ATOM   8247  C  CE   . LYS C  2 64  ? 133.113 81.607  89.664  1.00 81.77  ? 64  LYS J CE   1 
ATOM   8248  N  NZ   . LYS C  2 64  ? 134.005 81.992  90.791  1.00 81.77  ? 64  LYS J NZ   1 
ATOM   8249  H  H    . LYS C  2 64  ? 130.278 82.675  94.278  1.00 81.77  ? 64  LYS J H    1 
ATOM   8250  H  HA   . LYS C  2 64  ? 129.940 84.196  92.837  1.00 81.77  ? 64  LYS J HA   1 
ATOM   8251  H  HB2  . LYS C  2 64  ? 129.392 81.994  91.178  1.00 81.77  ? 64  LYS J HB2  1 
ATOM   8252  H  HB3  . LYS C  2 64  ? 129.598 83.464  90.626  1.00 81.77  ? 64  LYS J HB3  1 
ATOM   8253  H  HG2  . LYS C  2 64  ? 131.817 83.405  91.348  1.00 81.77  ? 64  LYS J HG2  1 
ATOM   8254  H  HG3  . LYS C  2 64  ? 131.603 81.907  91.838  1.00 81.77  ? 64  LYS J HG3  1 
ATOM   8255  H  HD2  . LYS C  2 64  ? 131.095 81.327  89.589  1.00 81.77  ? 64  LYS J HD2  1 
ATOM   8256  H  HD3  . LYS C  2 64  ? 131.530 82.794  89.164  1.00 81.77  ? 64  LYS J HD3  1 
ATOM   8257  H  HE2  . LYS C  2 64  ? 133.115 80.639  89.606  1.00 81.77  ? 64  LYS J HE2  1 
ATOM   8258  H  HE3  . LYS C  2 64  ? 133.486 81.984  88.852  1.00 81.77  ? 64  LYS J HE3  1 
ATOM   8259  H  HZ1  . LYS C  2 64  ? 134.842 82.057  90.498  1.00 81.77  ? 64  LYS J HZ1  1 
ATOM   8260  H  HZ2  . LYS C  2 64  ? 133.760 82.775  91.130  1.00 81.77  ? 64  LYS J HZ2  1 
ATOM   8261  H  HZ3  . LYS C  2 64  ? 133.970 81.373  91.430  1.00 81.77  ? 64  LYS J HZ3  1 
ATOM   8262  N  N    . CYS C  2 65  ? 127.362 84.060  93.789  1.00 87.46  ? 65  CYS J N    1 
ATOM   8263  C  CA   . CYS C  2 65  ? 125.998 84.560  93.879  1.00 87.46  ? 65  CYS J CA   1 
ATOM   8264  C  C    . CYS C  2 65  ? 125.938 86.080  93.918  1.00 87.46  ? 65  CYS J C    1 
ATOM   8265  O  O    . CYS C  2 65  ? 124.839 86.642  93.948  1.00 87.46  ? 65  CYS J O    1 
ATOM   8266  C  CB   . CYS C  2 65  ? 125.304 83.997  95.119  1.00 87.46  ? 65  CYS J CB   1 
ATOM   8267  S  SG   . CYS C  2 65  ? 123.508 84.280  95.161  1.00 87.46  ? 65  CYS J SG   1 
ATOM   8268  H  H    . CYS C  2 65  ? 127.741 83.943  94.552  1.00 87.46  ? 65  CYS J H    1 
ATOM   8269  H  HA   . CYS C  2 65  ? 125.506 84.261  93.100  1.00 87.46  ? 65  CYS J HA   1 
ATOM   8270  H  HB2  . CYS C  2 65  ? 125.455 83.042  95.157  1.00 87.46  ? 65  CYS J HB2  1 
ATOM   8271  H  HB3  . CYS C  2 65  ? 125.698 84.422  95.894  1.00 87.46  ? 65  CYS J HB3  1 
ATOM   8272  N  N    . ASN C  2 66  ? 127.087 86.753  93.911  1.00 62.60  ? 66  ASN J N    1 
ATOM   8273  C  CA   . ASN C  2 66  ? 127.163 88.207  94.030  1.00 62.60  ? 66  ASN J CA   1 
ATOM   8274  C  C    . ASN C  2 66  ? 128.021 88.760  92.900  1.00 62.60  ? 66  ASN J C    1 
ATOM   8275  O  O    . ASN C  2 66  ? 129.136 89.245  93.122  1.00 62.60  ? 66  ASN J O    1 
ATOM   8276  C  CB   . ASN C  2 66  ? 127.718 88.604  95.399  1.00 62.60  ? 66  ASN J CB   1 
ATOM   8277  C  CG   . ASN C  2 66  ? 129.154 88.177  95.594  1.00 62.60  ? 66  ASN J CG   1 
ATOM   8278  O  OD1  . ASN C  2 66  ? 129.662 87.320  94.874  1.00 62.60  ? 66  ASN J OD1  1 
ATOM   8279  N  ND2  . ASN C  2 66  ? 129.820 88.777  96.567  1.00 62.60  ? 66  ASN J ND2  1 
ATOM   8280  H  H    . ASN C  2 66  ? 127.857 86.381  93.835  1.00 62.60  ? 66  ASN J H    1 
ATOM   8281  H  HA   . ASN C  2 66  ? 126.275 88.582  93.940  1.00 62.60  ? 66  ASN J HA   1 
ATOM   8282  H  HB2  . ASN C  2 66  ? 127.683 89.567  95.488  1.00 62.60  ? 66  ASN J HB2  1 
ATOM   8283  H  HB3  . ASN C  2 66  ? 127.185 88.185  96.090  1.00 62.60  ? 66  ASN J HB3  1 
ATOM   8284  H  HD21 . ASN C  2 66  ? 130.640 88.571  96.717  1.00 62.60  ? 66  ASN J HD21 1 
ATOM   8285  H  HD22 . ASN C  2 66  ? 129.429 89.374  97.047  1.00 62.60  ? 66  ASN J HD22 1 
ATOM   8286  N  N    . PRO C  2 67  ? 127.524 88.708  91.670  1.00 55.78  ? 67  PRO J N    1 
ATOM   8287  C  CA   . PRO C  2 67  ? 128.276 89.278  90.552  1.00 55.78  ? 67  PRO J CA   1 
ATOM   8288  C  C    . PRO C  2 67  ? 127.927 90.731  90.299  1.00 55.78  ? 67  PRO J C    1 
ATOM   8289  O  O    . PRO C  2 67  ? 127.021 91.285  90.928  1.00 55.78  ? 67  PRO J O    1 
ATOM   8290  C  CB   . PRO C  2 67  ? 127.853 88.395  89.377  1.00 55.78  ? 67  PRO J CB   1 
ATOM   8291  C  CG   . PRO C  2 67  ? 126.436 88.068  89.688  1.00 55.78  ? 67  PRO J CG   1 
ATOM   8292  C  CD   . PRO C  2 67  ? 126.318 88.007  91.200  1.00 55.78  ? 67  PRO J CD   1 
ATOM   8293  H  HA   . PRO C  2 67  ? 129.228 89.190  90.698  1.00 55.78  ? 67  PRO J HA   1 
ATOM   8294  H  HB2  . PRO C  2 67  ? 127.921 88.896  88.551  1.00 55.78  ? 67  PRO J HB2  1 
ATOM   8295  H  HB3  . PRO C  2 67  ? 128.400 87.596  89.351  1.00 55.78  ? 67  PRO J HB3  1 
ATOM   8296  H  HG2  . PRO C  2 67  ? 125.865 88.767  89.336  1.00 55.78  ? 67  PRO J HG2  1 
ATOM   8297  H  HG3  . PRO C  2 67  ? 126.210 87.213  89.290  1.00 55.78  ? 67  PRO J HG3  1 
ATOM   8298  H  HD2  . PRO C  2 67  ? 125.522 88.474  91.496  1.00 55.78  ? 67  PRO J HD2  1 
ATOM   8299  H  HD3  . PRO C  2 67  ? 126.325 87.087  91.501  1.00 55.78  ? 67  PRO J HD3  1 
ATOM   8300  N  N    . HIS C  2 68  ? 128.678 91.402  89.431  1.00 46.76  ? 68  HIS J N    1 
ATOM   8301  C  CA   . HIS C  2 68  ? 128.382 92.807  89.061  1.00 46.76  ? 68  HIS J CA   1 
ATOM   8302  C  C    . HIS C  2 68  ? 127.049 92.780  88.294  1.00 46.76  ? 68  HIS J C    1 
ATOM   8303  O  O    . HIS C  2 68  ? 126.884 91.856  87.482  1.00 46.76  ? 68  HIS J O    1 
ATOM   8304  C  CB   . HIS C  2 68  ? 129.558 93.417  88.289  1.00 46.76  ? 68  HIS J CB   1 
ATOM   8305  C  CG   . HIS C  2 68  ? 129.444 94.889  88.080  1.00 46.76  ? 68  HIS J CG   1 
ATOM   8306  N  ND1  . HIS C  2 68  ? 129.856 95.808  89.016  1.00 46.76  ? 68  HIS J ND1  1 
ATOM   8307  C  CD2  . HIS C  2 68  ? 128.953 95.600  87.050  1.00 46.76  ? 68  HIS J CD2  1 
ATOM   8308  C  CE1  . HIS C  2 68  ? 129.618 97.017  88.571  1.00 46.76  ? 68  HIS J CE1  1 
ATOM   8309  N  NE2  . HIS C  2 68  ? 129.073 96.912  87.368  1.00 46.76  ? 68  HIS J NE2  1 
ATOM   8310  H  H    . HIS C  2 68  ? 129.411 91.063  89.010  1.00 46.76  ? 68  HIS J H    1 
ATOM   8311  H  HA   . HIS C  2 68  ? 128.263 93.313  89.890  1.00 46.76  ? 68  HIS J HA   1 
ATOM   8312  H  HB2  . HIS C  2 68  ? 130.390 93.232  88.780  1.00 46.76  ? 68  HIS J HB2  1 
ATOM   8313  H  HB3  . HIS C  2 68  ? 129.625 92.977  87.413  1.00 46.76  ? 68  HIS J HB3  1 
ATOM   8314  H  HD2  . HIS C  2 68  ? 128.618 95.258  86.246  1.00 46.76  ? 68  HIS J HD2  1 
ATOM   8315  H  HE1  . HIS C  2 68  ? 129.808 97.819  89.025  1.00 46.76  ? 68  HIS J HE1  1 
ATOM   8316  N  N    . PRO C  2 69  ? 126.127 93.762  88.409  1.00 45.91  ? 69  PRO J N    1 
ATOM   8317  C  CA   . PRO C  2 69  ? 124.842 93.685  87.699  1.00 45.91  ? 69  PRO J CA   1 
ATOM   8318  C  C    . PRO C  2 69  ? 124.878 93.384  86.189  1.00 45.91  ? 69  PRO J C    1 
ATOM   8319  O  O    . PRO C  2 69  ? 123.939 92.796  85.727  1.00 45.91  ? 69  PRO J O    1 
ATOM   8320  C  CB   . PRO C  2 69  ? 124.296 95.101  87.889  1.00 45.91  ? 69  PRO J CB   1 
ATOM   8321  C  CG   . PRO C  2 69  ? 124.779 95.501  89.255  1.00 45.91  ? 69  PRO J CG   1 
ATOM   8322  C  CD   . PRO C  2 69  ? 126.131 94.845  89.400  1.00 45.91  ? 69  PRO J CD   1 
ATOM   8323  H  HA   . PRO C  2 69  ? 124.251 93.039  88.161  1.00 45.91  ? 69  PRO J HA   1 
ATOM   8324  H  HB2  . PRO C  2 69  ? 124.646 95.708  87.203  1.00 45.91  ? 69  PRO J HB2  1 
ATOM   8325  H  HB3  . PRO C  2 69  ? 123.316 95.108  87.850  1.00 45.91  ? 69  PRO J HB3  1 
ATOM   8326  H  HG2  . PRO C  2 69  ? 124.858 96.474  89.325  1.00 45.91  ? 69  PRO J HG2  1 
ATOM   8327  H  HG3  . PRO C  2 69  ? 124.165 95.183  89.948  1.00 45.91  ? 69  PRO J HG3  1 
ATOM   8328  H  HD2  . PRO C  2 69  ? 126.849 95.480  89.222  1.00 45.91  ? 69  PRO J HD2  1 
ATOM   8329  H  HD3  . PRO C  2 69  ? 126.233 94.495  90.304  1.00 45.91  ? 69  PRO J HD3  1 
ATOM   8330  N  N    . LYS C  2 70  ? 125.874 93.869  85.446  1.00 49.52  ? 70  LYS J N    1 
ATOM   8331  C  CA   . LYS C  2 70  ? 126.088 93.597  83.991  1.00 49.52  ? 70  LYS J CA   1 
ATOM   8332  C  C    . LYS C  2 70  ? 126.058 92.085  83.688  1.00 49.52  ? 70  LYS J C    1 
ATOM   8333  O  O    . LYS C  2 70  ? 125.382 91.683  82.712  1.00 49.52  ? 70  LYS J O    1 
ATOM   8334  C  CB   . LYS C  2 70  ? 127.444 94.171  83.574  1.00 49.52  ? 70  LYS J CB   1 
ATOM   8335  C  CG   . LYS C  2 70  ? 127.475 95.687  83.455  1.00 49.52  ? 70  LYS J CG   1 
ATOM   8336  C  CD   . LYS C  2 70  ? 126.441 96.223  82.493  1.00 49.52  ? 70  LYS J CD   1 
ATOM   8337  C  CE   . LYS C  2 70  ? 125.743 97.465  83.002  1.00 49.52  ? 70  LYS J CE   1 
ATOM   8338  N  NZ   . LYS C  2 70  ? 124.902 97.172  84.185  1.00 49.52  ? 70  LYS J NZ   1 
ATOM   8339  H  H    . LYS C  2 70  ? 126.401 94.527  85.755  1.00 49.52  ? 70  LYS J H    1 
ATOM   8340  H  HA   . LYS C  2 70  ? 125.375 94.044  83.478  1.00 49.52  ? 70  LYS J HA   1 
ATOM   8341  H  HB2  . LYS C  2 70  ? 128.116 93.894  84.231  1.00 49.52  ? 70  LYS J HB2  1 
ATOM   8342  H  HB3  . LYS C  2 70  ? 127.693 93.784  82.708  1.00 49.52  ? 70  LYS J HB3  1 
ATOM   8343  H  HG2  . LYS C  2 70  ? 127.323 96.078  84.342  1.00 49.52  ? 70  LYS J HG2  1 
ATOM   8344  H  HG3  . LYS C  2 70  ? 128.368 95.963  83.154  1.00 49.52  ? 70  LYS J HG3  1 
ATOM   8345  H  HD2  . LYS C  2 70  ? 126.877 96.431  81.640  1.00 49.52  ? 70  LYS J HD2  1 
ATOM   8346  H  HD3  . LYS C  2 70  ? 125.770 95.527  82.328  1.00 49.52  ? 70  LYS J HD3  1 
ATOM   8347  H  HE2  . LYS C  2 70  ? 126.408 98.138  83.243  1.00 49.52  ? 70  LYS J HE2  1 
ATOM   8348  H  HE3  . LYS C  2 70  ? 125.181 97.834  82.296  1.00 49.52  ? 70  LYS J HE3  1 
ATOM   8349  H  HZ1  . LYS C  2 70  ? 124.450 97.918  84.433  1.00 49.52  ? 70  LYS J HZ1  1 
ATOM   8350  H  HZ2  . LYS C  2 70  ? 124.307 96.517  83.986  1.00 49.52  ? 70  LYS J HZ2  1 
ATOM   8351  H  HZ3  . LYS C  2 70  ? 125.425 96.898  84.874  1.00 49.52  ? 70  LYS J HZ3  1 
ATOM   8352  N  N    . GLN C  2 71  ? 126.730 91.299  84.540  1.00 53.35  ? 71  GLN J N    1 
ATOM   8353  C  CA   . GLN C  2 71  ? 126.896 89.820  84.542  1.00 53.35  ? 71  GLN J CA   1 
ATOM   8354  C  C    . GLN C  2 71  ? 125.631 89.154  85.097  1.00 53.35  ? 71  GLN J C    1 
ATOM   8355  O  O    . GLN C  2 71  ? 124.782 89.882  85.643  1.00 53.35  ? 71  GLN J O    1 
ATOM   8356  C  CB   . GLN C  2 71  ? 128.109 89.412  85.377  1.00 53.35  ? 71  GLN J CB   1 
ATOM   8357  C  CG   . GLN C  2 71  ? 129.430 89.946  84.853  1.00 53.35  ? 71  GLN J CG   1 
ATOM   8358  C  CD   . GLN C  2 71  ? 130.583 89.489  85.709  1.00 53.35  ? 71  GLN J CD   1 
ATOM   8359  O  OE1  . GLN C  2 71  ? 130.670 89.807  86.890  1.00 53.35  ? 71  GLN J OE1  1 
ATOM   8360  N  NE2  . GLN C  2 71  ? 131.489 88.738  85.112  1.00 53.35  ? 71  GLN J NE2  1 
ATOM   8361  H  H    . GLN C  2 71  ? 127.044 91.696  85.297  1.00 53.35  ? 71  GLN J H    1 
ATOM   8362  H  HA   . GLN C  2 71  ? 127.031 89.520  83.613  1.00 53.35  ? 71  GLN J HA   1 
ATOM   8363  H  HB2  . GLN C  2 71  ? 127.977 89.732  86.293  1.00 53.35  ? 71  GLN J HB2  1 
ATOM   8364  H  HB3  . GLN C  2 71  ? 128.150 88.433  85.405  1.00 53.35  ? 71  GLN J HB3  1 
ATOM   8365  H  HG2  . GLN C  2 71  ? 129.566 89.636  83.932  1.00 53.35  ? 71  GLN J HG2  1 
ATOM   8366  H  HG3  . GLN C  2 71  ? 129.403 90.927  84.841  1.00 53.35  ? 71  GLN J HG3  1 
ATOM   8367  H  HE21 . GLN C  2 71  ? 131.390 88.517  84.262  1.00 53.35  ? 71  GLN J HE21 1 
ATOM   8368  H  HE22 . GLN C  2 71  ? 132.195 88.455  85.562  1.00 53.35  ? 71  GLN J HE22 1 
ATOM   8369  N  N    . ILE D  2 1   ? 106.200 188.920 99.213  1.00 91.86  ? 1   ILE G N    1 
ATOM   8370  C  CA   . ILE D  2 1   ? 107.566 188.589 98.719  1.00 91.86  ? 1   ILE G CA   1 
ATOM   8371  C  C    . ILE D  2 1   ? 107.516 187.269 97.968  1.00 91.86  ? 1   ILE G C    1 
ATOM   8372  O  O    . ILE D  2 1   ? 106.935 186.294 98.440  1.00 91.86  ? 1   ILE G O    1 
ATOM   8373  C  CB   . ILE D  2 1   ? 108.585 188.535 99.875  1.00 91.86  ? 1   ILE G CB   1 
ATOM   8374  C  CG1  . ILE D  2 1   ? 110.016 188.475 99.335  1.00 91.86  ? 1   ILE G CG1  1 
ATOM   8375  C  CG2  . ILE D  2 1   ? 108.326 187.333 100.756 1.00 91.86  ? 1   ILE G CG2  1 
ATOM   8376  C  CD1  . ILE D  2 1   ? 110.516 189.770 98.760  1.00 91.86  ? 1   ILE G CD1  1 
ATOM   8377  H  H1   . ILE D  2 1   ? 106.213 189.708 99.628  1.00 91.86  ? 1   ILE G H1   1 
ATOM   8378  H  H2   . ILE D  2 1   ? 105.641 188.956 98.523  1.00 91.86  ? 1   ILE G H2   1 
ATOM   8379  H  H3   . ILE D  2 1   ? 105.928 188.289 99.779  1.00 91.86  ? 1   ILE G H3   1 
ATOM   8380  H  HA   . ILE D  2 1   ? 107.854 189.269 98.094  1.00 91.86  ? 1   ILE G HA   1 
ATOM   8381  H  HB   . ILE D  2 1   ? 108.491 189.339 100.409 1.00 91.86  ? 1   ILE G HB   1 
ATOM   8382  H  HG12 . ILE D  2 1   ? 110.610 188.232 100.063 1.00 91.86  ? 1   ILE G HG12 1 
ATOM   8383  H  HG13 . ILE D  2 1   ? 110.061 187.805 98.638  1.00 91.86  ? 1   ILE G HG13 1 
ATOM   8384  H  HG21 . ILE D  2 1   ? 108.866 187.403 101.557 1.00 91.86  ? 1   ILE G HG21 1 
ATOM   8385  H  HG22 . ILE D  2 1   ? 107.386 187.305 100.994 1.00 91.86  ? 1   ILE G HG22 1 
ATOM   8386  H  HG23 . ILE D  2 1   ? 108.574 186.536 100.269 1.00 91.86  ? 1   ILE G HG23 1 
ATOM   8387  H  HD11 . ILE D  2 1   ? 111.414 189.633 98.418  1.00 91.86  ? 1   ILE G HD11 1 
ATOM   8388  H  HD12 . ILE D  2 1   ? 109.927 190.043 98.042  1.00 91.86  ? 1   ILE G HD12 1 
ATOM   8389  H  HD13 . ILE D  2 1   ? 110.529 190.441 99.459  1.00 91.86  ? 1   ILE G HD13 1 
ATOM   8390  N  N    . VAL D  2 2   ? 108.128 187.250 96.790  1.00 85.36  ? 2   VAL G N    1 
ATOM   8391  C  CA   . VAL D  2 2   ? 108.185 186.070 95.939  1.00 85.36  ? 2   VAL G CA   1 
ATOM   8392  C  C    . VAL D  2 2   ? 109.639 185.645 95.839  1.00 85.36  ? 2   VAL G C    1 
ATOM   8393  O  O    . VAL D  2 2   ? 110.491 186.422 95.391  1.00 85.36  ? 2   VAL G O    1 
ATOM   8394  C  CB   . VAL D  2 2   ? 107.592 186.338 94.549  1.00 85.36  ? 2   VAL G CB   1 
ATOM   8395  C  CG1  . VAL D  2 2   ? 107.761 185.131 93.658  1.00 85.36  ? 2   VAL G CG1  1 
ATOM   8396  C  CG2  . VAL D  2 2   ? 106.127 186.683 94.669  1.00 85.36  ? 2   VAL G CG2  1 
ATOM   8397  H  H    . VAL D  2 2   ? 108.532 187.931 96.457  1.00 85.36  ? 2   VAL G H    1 
ATOM   8398  H  HA   . VAL D  2 2   ? 107.683 185.348 96.348  1.00 85.36  ? 2   VAL G HA   1 
ATOM   8399  H  HB   . VAL D  2 2   ? 108.051 187.086 94.142  1.00 85.36  ? 2   VAL G HB   1 
ATOM   8400  H  HG11 . VAL D  2 2   ? 107.354 185.324 92.799  1.00 85.36  ? 2   VAL G HG11 1 
ATOM   8401  H  HG12 . VAL D  2 2   ? 108.704 184.941 93.541  1.00 85.36  ? 2   VAL G HG12 1 
ATOM   8402  H  HG13 . VAL D  2 2   ? 107.312 184.380 94.074  1.00 85.36  ? 2   VAL G HG13 1 
ATOM   8403  H  HG21 . VAL D  2 2   ? 105.767 186.823 93.781  1.00 85.36  ? 2   VAL G HG21 1 
ATOM   8404  H  HG22 . VAL D  2 2   ? 105.672 185.942 95.099  1.00 85.36  ? 2   VAL G HG22 1 
ATOM   8405  H  HG23 . VAL D  2 2   ? 106.032 187.488 95.201  1.00 85.36  ? 2   VAL G HG23 1 
ATOM   8406  N  N    . CYS D  2 3   ? 109.919 184.412 96.247  1.00 77.81  ? 3   CYS G N    1 
ATOM   8407  C  CA   . CYS D  2 3   ? 111.270 183.880 96.284  1.00 77.81  ? 3   CYS G CA   1 
ATOM   8408  C  C    . CYS D  2 3   ? 111.327 182.614 95.445  1.00 77.81  ? 3   CYS G C    1 
ATOM   8409  O  O    . CYS D  2 3   ? 110.449 181.752 95.558  1.00 77.81  ? 3   CYS G O    1 
ATOM   8410  C  CB   . CYS D  2 3   ? 111.686 183.578 97.723  1.00 77.81  ? 3   CYS G CB   1 
ATOM   8411  S  SG   . CYS D  2 3   ? 111.796 185.022 98.819  1.00 77.81  ? 3   CYS G SG   1 
ATOM   8412  H  H    . CYS D  2 3   ? 109.325 183.851 96.515  1.00 77.81  ? 3   CYS G H    1 
ATOM   8413  H  HA   . CYS D  2 3   ? 111.889 184.526 95.913  1.00 77.81  ? 3   CYS G HA   1 
ATOM   8414  H  HB2  . CYS D  2 3   ? 111.026 182.979 98.100  1.00 77.81  ? 3   CYS G HB2  1 
ATOM   8415  H  HB3  . CYS D  2 3   ? 112.552 183.147 97.715  1.00 77.81  ? 3   CYS G HB3  1 
ATOM   8416  N  N    . HIS D  2 4   ? 112.354 182.502 94.607  1.00 59.80  ? 4   HIS G N    1 
ATOM   8417  C  CA   . HIS D  2 4   ? 112.600 181.257 93.898  1.00 59.80  ? 4   HIS G CA   1 
ATOM   8418  C  C    . HIS D  2 4   ? 112.911 180.147 94.894  1.00 59.80  ? 4   HIS G C    1 
ATOM   8419  O  O    . HIS D  2 4   ? 113.447 180.388 95.978  1.00 59.80  ? 4   HIS G O    1 
ATOM   8420  C  CB   . HIS D  2 4   ? 113.765 181.415 92.926  1.00 59.80  ? 4   HIS G CB   1 
ATOM   8421  C  CG   . HIS D  2 4   ? 113.399 182.054 91.625  1.00 59.80  ? 4   HIS G CG   1 
ATOM   8422  N  ND1  . HIS D  2 4   ? 112.559 181.459 90.710  1.00 59.80  ? 4   HIS G ND1  1 
ATOM   8423  C  CD2  . HIS D  2 4   ? 113.783 183.229 91.072  1.00 59.80  ? 4   HIS G CD2  1 
ATOM   8424  C  CE1  . HIS D  2 4   ? 112.430 182.247 89.657  1.00 59.80  ? 4   HIS G CE1  1 
ATOM   8425  N  NE2  . HIS D  2 4   ? 113.164 183.326 89.852  1.00 59.80  ? 4   HIS G NE2  1 
ATOM   8426  H  H    . HIS D  2 4   ? 112.914 183.130 94.429  1.00 59.80  ? 4   HIS G H    1 
ATOM   8427  H  HA   . HIS D  2 4   ? 111.813 181.006 93.394  1.00 59.80  ? 4   HIS G HA   1 
ATOM   8428  H  HB2  . HIS D  2 4   ? 114.443 181.967 93.342  1.00 59.80  ? 4   HIS G HB2  1 
ATOM   8429  H  HB3  . HIS D  2 4   ? 114.122 180.538 92.729  1.00 59.80  ? 4   HIS G HB3  1 
ATOM   8430  H  HD2  . HIS D  2 4   ? 114.355 183.853 91.452  1.00 59.80  ? 4   HIS G HD2  1 
ATOM   8431  H  HE1  . HIS D  2 4   ? 111.914 182.071 88.905  1.00 59.80  ? 4   HIS G HE1  1 
ATOM   8432  N  N    . THR D  2 5   ? 112.567 178.917 94.524  1.00 54.04  ? 5   THR G N    1 
ATOM   8433  C  CA   . THR D  2 5   ? 112.842 177.764 95.365  1.00 54.04  ? 5   THR G CA   1 
ATOM   8434  C  C    . THR D  2 5   ? 113.223 176.575 94.496  1.00 54.04  ? 5   THR G C    1 
ATOM   8435  O  O    . THR D  2 5   ? 112.936 176.535 93.297  1.00 54.04  ? 5   THR G O    1 
ATOM   8436  C  CB   . THR D  2 5   ? 111.642 177.406 96.251  1.00 54.04  ? 5   THR G CB   1 
ATOM   8437  O  OG1  . THR D  2 5   ? 112.001 176.352 97.150  1.00 54.04  ? 5   THR G OG1  1 
ATOM   8438  C  CG2  . THR D  2 5   ? 110.470 176.957 95.411  1.00 54.04  ? 5   THR G CG2  1 
ATOM   8439  H  H    . THR D  2 5   ? 112.169 178.727 93.787  1.00 54.04  ? 5   THR G H    1 
ATOM   8440  H  HA   . THR D  2 5   ? 113.591 177.970 95.943  1.00 54.04  ? 5   THR G HA   1 
ATOM   8441  H  HB   . THR D  2 5   ? 111.373 178.187 96.757  1.00 54.04  ? 5   THR G HB   1 
ATOM   8442  H  HG1  . THR D  2 5   ? 111.330 176.117 97.595  1.00 54.04  ? 5   THR G HG1  1 
ATOM   8443  H  HG21 . THR D  2 5   ? 109.701 176.805 95.980  1.00 54.04  ? 5   THR G HG21 1 
ATOM   8444  H  HG22 . THR D  2 5   ? 110.255 177.634 94.752  1.00 54.04  ? 5   THR G HG22 1 
ATOM   8445  H  HG23 . THR D  2 5   ? 110.688 176.131 94.957  1.00 54.04  ? 5   THR G HG23 1 
ATOM   8446  N  N    . THR D  2 6   ? 113.877 175.598 95.125  1.00 42.41  ? 6   THR G N    1 
ATOM   8447  C  CA   . THR D  2 6   ? 114.324 174.391 94.451  1.00 42.41  ? 6   THR G CA   1 
ATOM   8448  C  C    . THR D  2 6   ? 113.598 173.140 94.914  1.00 42.41  ? 6   THR G C    1 
ATOM   8449  O  O    . THR D  2 6   ? 113.733 172.095 94.269  1.00 42.41  ? 6   THR G O    1 
ATOM   8450  C  CB   . THR D  2 6   ? 115.828 174.184 94.661  1.00 42.41  ? 6   THR G CB   1 
ATOM   8451  O  OG1  . THR D  2 6   ? 116.105 174.056 96.061  1.00 42.41  ? 6   THR G OG1  1 
ATOM   8452  C  CG2  . THR D  2 6   ? 116.603 175.331 94.094  1.00 42.41  ? 6   THR G CG2  1 
ATOM   8453  H  H    . THR D  2 6   ? 114.066 175.611 95.962  1.00 42.41  ? 6   THR G H    1 
ATOM   8454  H  HA   . THR D  2 6   ? 114.175 174.493 93.501  1.00 42.41  ? 6   THR G HA   1 
ATOM   8455  H  HB   . THR D  2 6   ? 116.105 173.379 94.204  1.00 42.41  ? 6   THR G HB   1 
ATOM   8456  H  HG1  . THR D  2 6   ? 116.923 173.913 96.176  1.00 42.41  ? 6   THR G HG1  1 
ATOM   8457  H  HG21 . THR D  2 6   ? 117.550 175.184 94.230  1.00 42.41  ? 6   THR G HG21 1 
ATOM   8458  H  HG22 . THR D  2 6   ? 116.429 175.409 93.144  1.00 42.41  ? 6   THR G HG22 1 
ATOM   8459  H  HG23 . THR D  2 6   ? 116.339 176.149 94.538  1.00 42.41  ? 6   THR G HG23 1 
ATOM   8460  N  N    . ALA D  2 7   ? 112.839 173.210 96.007  1.00 50.73  ? 7   ALA G N    1 
ATOM   8461  C  CA   . ALA D  2 7   ? 112.066 172.054 96.436  1.00 50.73  ? 7   ALA G CA   1 
ATOM   8462  C  C    . ALA D  2 7   ? 111.008 171.677 95.412  1.00 50.73  ? 7   ALA G C    1 
ATOM   8463  O  O    . ALA D  2 7   ? 110.459 170.572 95.477  1.00 50.73  ? 7   ALA G O    1 
ATOM   8464  C  CB   . ALA D  2 7   ? 111.415 172.330 97.788  1.00 50.73  ? 7   ALA G CB   1 
ATOM   8465  H  H    . ALA D  2 7   ? 112.759 173.902 96.508  1.00 50.73  ? 7   ALA G H    1 
ATOM   8466  H  HA   . ALA D  2 7   ? 112.662 171.300 96.544  1.00 50.73  ? 7   ALA G HA   1 
ATOM   8467  H  HB1  . ALA D  2 7   ? 110.901 171.553 98.051  1.00 50.73  ? 7   ALA G HB1  1 
ATOM   8468  H  HB2  . ALA D  2 7   ? 112.114 172.505 98.438  1.00 50.73  ? 7   ALA G HB2  1 
ATOM   8469  H  HB3  . ALA D  2 7   ? 110.836 173.103 97.703  1.00 50.73  ? 7   ALA G HB3  1 
ATOM   8470  N  N    . THR D  2 8   ? 110.710 172.571 94.476  1.00 51.27  ? 8   THR G N    1 
ATOM   8471  C  CA   . THR D  2 8   ? 109.802 172.308 93.372  1.00 51.27  ? 8   THR G CA   1 
ATOM   8472  C  C    . THR D  2 8   ? 110.600 172.199 92.082  1.00 51.27  ? 8   THR G C    1 
ATOM   8473  O  O    . THR D  2 8   ? 111.382 173.098 91.755  1.00 51.27  ? 8   THR G O    1 
ATOM   8474  C  CB   . THR D  2 8   ? 108.759 173.420 93.245  1.00 51.27  ? 8   THR G CB   1 
ATOM   8475  O  OG1  . THR D  2 8   ? 108.100 173.610 94.502  1.00 51.27  ? 8   THR G OG1  1 
ATOM   8476  C  CG2  . THR D  2 8   ? 107.731 173.079 92.172  1.00 51.27  ? 8   THR G CG2  1 
ATOM   8477  H  H    . THR D  2 8   ? 111.034 173.364 94.460  1.00 51.27  ? 8   THR G H    1 
ATOM   8478  H  HA   . THR D  2 8   ? 109.345 171.468 93.522  1.00 51.27  ? 8   THR G HA   1 
ATOM   8479  H  HB   . THR D  2 8   ? 109.204 174.241 92.990  1.00 51.27  ? 8   THR G HB   1 
ATOM   8480  H  HG1  . THR D  2 8   ? 107.617 174.297 94.471  1.00 51.27  ? 8   THR G HG1  1 
ATOM   8481  H  HG21 . THR D  2 8   ? 107.032 173.750 92.154  1.00 51.27  ? 8   THR G HG21 1 
ATOM   8482  H  HG22 . THR D  2 8   ? 108.155 173.049 91.300  1.00 51.27  ? 8   THR G HG22 1 
ATOM   8483  H  HG23 . THR D  2 8   ? 107.333 172.215 92.357  1.00 51.27  ? 8   THR G HG23 1 
ATOM   8484  N  N    . SER D  2 9   ? 110.402 171.102 91.356  1.00 41.47  ? 9   SER G N    1 
ATOM   8485  C  CA   . SER D  2 9   ? 111.015 170.898 90.060  1.00 41.47  ? 9   SER G CA   1 
ATOM   8486  C  C    . SER D  2 9   ? 109.932 170.826 88.994  1.00 41.47  ? 9   SER G C    1 
ATOM   8487  O  O    . SER D  2 9   ? 108.992 170.030 89.132  1.00 41.47  ? 9   SER G O    1 
ATOM   8488  C  CB   . SER D  2 9   ? 111.847 169.614 90.042  1.00 41.47  ? 9   SER G CB   1 
ATOM   8489  O  OG   . SER D  2 9   ? 112.227 169.279 88.720  1.00 41.47  ? 9   SER G OG   1 
ATOM   8490  H  H    . SER D  2 9   ? 109.913 170.444 91.609  1.00 41.47  ? 9   SER G H    1 
ATOM   8491  H  HA   . SER D  2 9   ? 111.609 171.636 89.873  1.00 41.47  ? 9   SER G HA   1 
ATOM   8492  H  HB2  . SER D  2 9   ? 112.647 169.753 90.571  1.00 41.47  ? 9   SER G HB2  1 
ATOM   8493  H  HB3  . SER D  2 9   ? 111.321 168.893 90.416  1.00 41.47  ? 9   SER G HB3  1 
ATOM   8494  H  HG   . SER D  2 9   ? 112.688 168.580 88.727  1.00 41.47  ? 9   SER G HG   1 
ATOM   8495  N  N    . PRO D  2 10  ? 110.012 171.625 87.917  1.00 48.18  ? 10  PRO G N    1 
ATOM   8496  C  CA   . PRO D  2 10  ? 111.062 172.589 87.570  1.00 48.18  ? 10  PRO G CA   1 
ATOM   8497  C  C    . PRO D  2 10  ? 111.157 173.756 88.543  1.00 48.18  ? 10  PRO G C    1 
ATOM   8498  O  O    . PRO D  2 10  ? 110.222 173.991 89.307  1.00 48.18  ? 10  PRO G O    1 
ATOM   8499  C  CB   . PRO D  2 10  ? 110.641 173.084 86.184  1.00 48.18  ? 10  PRO G CB   1 
ATOM   8500  C  CG   . PRO D  2 10  ? 109.744 172.036 85.655  1.00 48.18  ? 10  PRO G CG   1 
ATOM   8501  C  CD   . PRO D  2 10  ? 109.019 171.506 86.838  1.00 48.18  ? 10  PRO G CD   1 
ATOM   8502  H  HA   . PRO D  2 10  ? 111.921 172.147 87.511  1.00 48.18  ? 10  PRO G HA   1 
ATOM   8503  H  HB2  . PRO D  2 10  ? 110.167 173.924 86.273  1.00 48.18  ? 10  PRO G HB2  1 
ATOM   8504  H  HB3  . PRO D  2 10  ? 111.422 173.189 85.620  1.00 48.18  ? 10  PRO G HB3  1 
ATOM   8505  H  HG2  . PRO D  2 10  ? 109.126 172.426 85.019  1.00 48.18  ? 10  PRO G HG2  1 
ATOM   8506  H  HG3  . PRO D  2 10  ? 110.270 171.338 85.238  1.00 48.18  ? 10  PRO G HG3  1 
ATOM   8507  H  HD2  . PRO D  2 10  ? 108.243 172.055 87.031  1.00 48.18  ? 10  PRO G HD2  1 
ATOM   8508  H  HD3  . PRO D  2 10  ? 108.780 170.579 86.703  1.00 48.18  ? 10  PRO G HD3  1 
ATOM   8509  N  N    . ILE D  2 11  ? 112.290 174.462 88.519  1.00 44.97  ? 11  ILE G N    1 
ATOM   8510  C  CA   . ILE D  2 11  ? 112.486 175.591 89.419  1.00 44.97  ? 11  ILE G CA   1 
ATOM   8511  C  C    . ILE D  2 11  ? 111.291 176.519 89.322  1.00 44.97  ? 11  ILE G C    1 
ATOM   8512  O  O    . ILE D  2 11  ? 110.895 176.942 88.231  1.00 44.97  ? 11  ILE G O    1 
ATOM   8513  C  CB   . ILE D  2 11  ? 113.801 176.317 89.087  1.00 44.97  ? 11  ILE G CB   1 
ATOM   8514  C  CG1  . ILE D  2 11  ? 114.986 175.419 89.437  1.00 44.97  ? 11  ILE G CG1  1 
ATOM   8515  C  CG2  . ILE D  2 11  ? 113.894 177.632 89.855  1.00 44.97  ? 11  ILE G CG2  1 
ATOM   8516  C  CD1  . ILE D  2 11  ? 116.326 176.034 89.172  1.00 44.97  ? 11  ILE G CD1  1 
ATOM   8517  H  H    . ILE D  2 11  ? 112.954 174.306 87.997  1.00 44.97  ? 11  ILE G H    1 
ATOM   8518  H  HA   . ILE D  2 11  ? 112.542 175.267 90.329  1.00 44.97  ? 11  ILE G HA   1 
ATOM   8519  H  HB   . ILE D  2 11  ? 113.819 176.504 88.137  1.00 44.97  ? 11  ILE G HB   1 
ATOM   8520  H  HG12 . ILE D  2 11  ? 114.943 175.211 90.381  1.00 44.97  ? 11  ILE G HG12 1 
ATOM   8521  H  HG13 . ILE D  2 11  ? 114.924 174.606 88.915  1.00 44.97  ? 11  ILE G HG13 1 
ATOM   8522  H  HG21 . ILE D  2 11  ? 114.729 178.074 89.640  1.00 44.97  ? 11  ILE G HG21 1 
ATOM   8523  H  HG22 . ILE D  2 11  ? 113.158 178.209 89.607  1.00 44.97  ? 11  ILE G HG22 1 
ATOM   8524  H  HG23 . ILE D  2 11  ? 113.860 177.438 90.803  1.00 44.97  ? 11  ILE G HG23 1 
ATOM   8525  H  HD11 . ILE D  2 11  ? 117.009 175.365 89.312  1.00 44.97  ? 11  ILE G HD11 1 
ATOM   8526  H  HD12 . ILE D  2 11  ? 116.353 176.351 88.256  1.00 44.97  ? 11  ILE G HD12 1 
ATOM   8527  H  HD13 . ILE D  2 11  ? 116.461 176.773 89.783  1.00 44.97  ? 11  ILE G HD13 1 
ATOM   8528  N  N    . SER D  2 12  ? 110.718 176.843 90.471  1.00 54.95  ? 12  SER G N    1 
ATOM   8529  C  CA   . SER D  2 12  ? 109.480 177.593 90.566  1.00 54.95  ? 12  SER G CA   1 
ATOM   8530  C  C    . SER D  2 12  ? 109.749 179.016 91.033  1.00 54.95  ? 12  SER G C    1 
ATOM   8531  O  O    . SER D  2 12  ? 110.870 179.388 91.389  1.00 54.95  ? 12  SER G O    1 
ATOM   8532  C  CB   . SER D  2 12  ? 108.515 176.902 91.529  1.00 54.95  ? 12  SER G CB   1 
ATOM   8533  O  OG   . SER D  2 12  ? 109.085 176.819 92.822  1.00 54.95  ? 12  SER G OG   1 
ATOM   8534  H  H    . SER D  2 12  ? 111.040 176.625 91.237  1.00 54.95  ? 12  SER G H    1 
ATOM   8535  H  HA   . SER D  2 12  ? 109.060 177.635 89.693  1.00 54.95  ? 12  SER G HA   1 
ATOM   8536  H  HB2  . SER D  2 12  ? 107.692 177.412 91.576  1.00 54.95  ? 12  SER G HB2  1 
ATOM   8537  H  HB3  . SER D  2 12  ? 108.336 176.007 91.207  1.00 54.95  ? 12  SER G HB3  1 
ATOM   8538  H  HG   . SER D  2 12  ? 108.688 176.237 93.275  1.00 54.95  ? 12  SER G HG   1 
ATOM   8539  N  N    . ALA D  2 13  ? 108.682 179.813 91.027  1.00 69.74  ? 13  ALA G N    1 
ATOM   8540  C  CA   . ALA D  2 13  ? 108.709 181.163 91.569  1.00 69.74  ? 13  ALA G CA   1 
ATOM   8541  C  C    . ALA D  2 13  ? 107.708 181.270 92.707  1.00 69.74  ? 13  ALA G C    1 
ATOM   8542  O  O    . ALA D  2 13  ? 106.915 182.213 92.758  1.00 69.74  ? 13  ALA G O    1 
ATOM   8543  C  CB   . ALA D  2 13  ? 108.395 182.189 90.485  1.00 69.74  ? 13  ALA G CB   1 
ATOM   8544  H  H    . ALA D  2 13  ? 107.920 179.590 90.701  1.00 69.74  ? 13  ALA G H    1 
ATOM   8545  H  HA   . ALA D  2 13  ? 109.588 181.356 91.923  1.00 69.74  ? 13  ALA G HA   1 
ATOM   8546  H  HB1  . ALA D  2 13  ? 108.421 183.076 90.877  1.00 69.74  ? 13  ALA G HB1  1 
ATOM   8547  H  HB2  . ALA D  2 13  ? 109.056 182.114 89.781  1.00 69.74  ? 13  ALA G HB2  1 
ATOM   8548  H  HB3  . ALA D  2 13  ? 107.510 182.005 90.136  1.00 69.74  ? 13  ALA G HB3  1 
ATOM   8549  N  N    . VAL D  2 14  ? 107.730 180.292 93.616  1.00 73.33  ? 14  VAL G N    1 
ATOM   8550  C  CA   . VAL D  2 14  ? 106.714 180.226 94.654  1.00 73.33  ? 14  VAL G CA   1 
ATOM   8551  C  C    . VAL D  2 14  ? 106.672 181.544 95.416  1.00 73.33  ? 14  VAL G C    1 
ATOM   8552  O  O    . VAL D  2 14  ? 107.671 182.267 95.517  1.00 73.33  ? 14  VAL G O    1 
ATOM   8553  C  CB   . VAL D  2 14  ? 106.972 179.049 95.610  1.00 73.33  ? 14  VAL G CB   1 
ATOM   8554  C  CG1  . VAL D  2 14  ? 108.177 179.317 96.492  1.00 73.33  ? 14  VAL G CG1  1 
ATOM   8555  C  CG2  . VAL D  2 14  ? 105.755 178.780 96.461  1.00 73.33  ? 14  VAL G CG2  1 
ATOM   8556  H  H    . VAL D  2 14  ? 108.319 179.668 93.652  1.00 73.33  ? 14  VAL G H    1 
ATOM   8557  H  HA   . VAL D  2 14  ? 105.850 180.088 94.238  1.00 73.33  ? 14  VAL G HA   1 
ATOM   8558  H  HB   . VAL D  2 14  ? 107.150 178.253 95.089  1.00 73.33  ? 14  VAL G HB   1 
ATOM   8559  H  HG11 . VAL D  2 14  ? 108.340 178.532 97.037  1.00 73.33  ? 14  VAL G HG11 1 
ATOM   8560  H  HG12 . VAL D  2 14  ? 108.944 179.498 95.929  1.00 73.33  ? 14  VAL G HG12 1 
ATOM   8561  H  HG13 . VAL D  2 14  ? 107.997 180.075 97.066  1.00 73.33  ? 14  VAL G HG13 1 
ATOM   8562  H  HG21 . VAL D  2 14  ? 105.899 177.958 96.954  1.00 73.33  ? 14  VAL G HG21 1 
ATOM   8563  H  HG22 . VAL D  2 14  ? 105.637 179.521 97.076  1.00 73.33  ? 14  VAL G HG22 1 
ATOM   8564  H  HG23 . VAL D  2 14  ? 104.980 178.693 95.885  1.00 73.33  ? 14  VAL G HG23 1 
ATOM   8565  N  N    . THR D  2 15  ? 105.500 181.858 95.954  1.00 86.96  ? 15  THR G N    1 
ATOM   8566  C  CA   . THR D  2 15  ? 105.287 183.077 96.720  1.00 86.96  ? 15  THR G CA   1 
ATOM   8567  C  C    . THR D  2 15  ? 105.386 182.739 98.204  1.00 86.96  ? 15  THR G C    1 
ATOM   8568  O  O    . THR D  2 15  ? 104.663 181.868 98.700  1.00 86.96  ? 15  THR G O    1 
ATOM   8569  C  CB   . THR D  2 15  ? 103.940 183.711 96.357  1.00 86.96  ? 15  THR G CB   1 
ATOM   8570  O  OG1  . THR D  2 15  ? 103.797 184.972 97.025  1.00 86.96  ? 15  THR G OG1  1 
ATOM   8571  C  CG2  . THR D  2 15  ? 102.771 182.798 96.697  1.00 86.96  ? 15  THR G CG2  1 
ATOM   8572  H  H    . THR D  2 15  ? 104.799 181.366 95.893  1.00 86.96  ? 15  THR G H    1 
ATOM   8573  H  HA   . THR D  2 15  ? 105.986 183.712 96.503  1.00 86.96  ? 15  THR G HA   1 
ATOM   8574  H  HB   . THR D  2 15  ? 103.922 183.856 95.399  1.00 86.96  ? 15  THR G HB   1 
ATOM   8575  H  HG1  . THR D  2 15  ? 103.019 185.266 96.902  1.00 86.96  ? 15  THR G HG1  1 
ATOM   8576  H  HG21 . THR D  2 15  ? 101.941 183.256 96.486  1.00 86.96  ? 15  THR G HG21 1 
ATOM   8577  H  HG22 . THR D  2 15  ? 102.810 181.970 96.186  1.00 86.96  ? 15  THR G HG22 1 
ATOM   8578  H  HG23 . THR D  2 15  ? 102.780 182.597 97.639  1.00 86.96  ? 15  THR G HG23 1 
ATOM   8579  N  N    . CYS D  2 16  ? 106.294 183.419 98.898  1.00 97.55  ? 16  CYS G N    1 
ATOM   8580  C  CA   . CYS D  2 16  ? 106.705 182.995 100.225 1.00 97.55  ? 16  CYS G CA   1 
ATOM   8581  C  C    . CYS D  2 16  ? 105.605 183.272 101.250 1.00 97.55  ? 16  CYS G C    1 
ATOM   8582  O  O    . CYS D  2 16  ? 104.825 184.216 101.098 1.00 97.55  ? 16  CYS G O    1 
ATOM   8583  C  CB   . CYS D  2 16  ? 107.985 183.722 100.631 1.00 97.55  ? 16  CYS G CB   1 
ATOM   8584  S  SG   . CYS D  2 16  ? 108.707 183.255 102.231 1.00 97.55  ? 16  CYS G SG   1 
ATOM   8585  H  H    . CYS D  2 16  ? 106.684 184.133 98.620  1.00 97.55  ? 16  CYS G H    1 
ATOM   8586  H  HA   . CYS D  2 16  ? 106.886 182.045 100.202 1.00 97.55  ? 16  CYS G HA   1 
ATOM   8587  H  HB2  . CYS D  2 16  ? 108.655 183.572 99.948  1.00 97.55  ? 16  CYS G HB2  1 
ATOM   8588  H  HB3  . CYS D  2 16  ? 107.774 184.663 100.682 1.00 97.55  ? 16  CYS G HB3  1 
ATOM   8589  N  N    . PRO D  2 17  ? 105.517 182.459 102.301 1.00 105.48 ? 17  PRO G N    1 
ATOM   8590  C  CA   . PRO D  2 17  ? 104.569 182.744 103.380 1.00 105.48 ? 17  PRO G CA   1 
ATOM   8591  C  C    . PRO D  2 17  ? 105.005 183.946 104.196 1.00 105.48 ? 17  PRO G C    1 
ATOM   8592  O  O    . PRO D  2 17  ? 106.116 184.463 104.010 1.00 105.48 ? 17  PRO G O    1 
ATOM   8593  C  CB   . PRO D  2 17  ? 104.597 181.459 104.224 1.00 105.48 ? 17  PRO G CB   1 
ATOM   8594  C  CG   . PRO D  2 17  ? 105.920 180.852 103.922 1.00 105.48 ? 17  PRO G CG   1 
ATOM   8595  C  CD   . PRO D  2 17  ? 106.148 181.142 102.478 1.00 105.48 ? 17  PRO G CD   1 
ATOM   8596  H  HA   . PRO D  2 17  ? 103.678 182.886 103.021 1.00 105.48 ? 17  PRO G HA   1 
ATOM   8597  H  HB2  . PRO D  2 17  ? 104.525 181.682 105.163 1.00 105.48 ? 17  PRO G HB2  1 
ATOM   8598  H  HB3  . PRO D  2 17  ? 103.878 180.870 103.948 1.00 105.48 ? 17  PRO G HB3  1 
ATOM   8599  H  HG2  . PRO D  2 17  ? 106.599 181.279 104.466 1.00 105.48 ? 17  PRO G HG2  1 
ATOM   8600  H  HG3  . PRO D  2 17  ? 105.893 179.898 104.088 1.00 105.48 ? 17  PRO G HG3  1 
ATOM   8601  H  HD2  . PRO D  2 17  ? 107.096 181.174 102.284 1.00 105.48 ? 17  PRO G HD2  1 
ATOM   8602  H  HD3  . PRO D  2 17  ? 105.702 180.481 101.927 1.00 105.48 ? 17  PRO G HD3  1 
ATOM   8603  N  N    . PRO D  2 18  ? 104.159 184.423 105.105 1.00 107.54 ? 18  PRO G N    1 
ATOM   8604  C  CA   . PRO D  2 18  ? 104.537 185.570 105.938 1.00 107.54 ? 18  PRO G CA   1 
ATOM   8605  C  C    . PRO D  2 18  ? 105.592 185.199 106.967 1.00 107.54 ? 18  PRO G C    1 
ATOM   8606  O  O    . PRO D  2 18  ? 105.812 184.028 107.285 1.00 107.54 ? 18  PRO G O    1 
ATOM   8607  C  CB   . PRO D  2 18  ? 103.224 185.973 106.622 1.00 107.54 ? 18  PRO G CB   1 
ATOM   8608  C  CG   . PRO D  2 18  ? 102.146 185.169 105.950 1.00 107.54 ? 18  PRO G CG   1 
ATOM   8609  C  CD   . PRO D  2 18  ? 102.801 183.951 105.413 1.00 107.54 ? 18  PRO G CD   1 
ATOM   8610  H  HA   . PRO D  2 18  ? 104.859 186.300 105.390 1.00 107.54 ? 18  PRO G HA   1 
ATOM   8611  H  HB2  . PRO D  2 18  ? 103.275 185.752 107.566 1.00 107.54 ? 18  PRO G HB2  1 
ATOM   8612  H  HB3  . PRO D  2 18  ? 103.076 186.920 106.499 1.00 107.54 ? 18  PRO G HB3  1 
ATOM   8613  H  HG2  . PRO D  2 18  ? 101.467 184.933 106.601 1.00 107.54 ? 18  PRO G HG2  1 
ATOM   8614  H  HG3  . PRO D  2 18  ? 101.761 185.695 105.232 1.00 107.54 ? 18  PRO G HG3  1 
ATOM   8615  H  HD2  . PRO D  2 18  ? 102.827 183.251 106.086 1.00 107.54 ? 18  PRO G HD2  1 
ATOM   8616  H  HD3  . PRO D  2 18  ? 102.350 183.656 104.608 1.00 107.54 ? 18  PRO G HD3  1 
ATOM   8617  N  N    . GLY D  2 19  ? 106.243 186.232 107.491 1.00 106.24 ? 19  GLY G N    1 
ATOM   8618  C  CA   . GLY D  2 19  ? 107.300 186.054 108.463 1.00 106.24 ? 19  GLY G CA   1 
ATOM   8619  C  C    . GLY D  2 19  ? 108.657 185.781 107.874 1.00 106.24 ? 19  GLY G C    1 
ATOM   8620  O  O    . GLY D  2 19  ? 109.635 185.665 108.635 1.00 106.24 ? 19  GLY G O    1 
ATOM   8621  H  H    . GLY D  2 19  ? 106.095 187.053 107.289 1.00 106.24 ? 19  GLY G H    1 
ATOM   8622  H  HA2  . GLY D  2 19  ? 107.367 186.847 109.016 1.00 106.24 ? 19  GLY G HA2  1 
ATOM   8623  H  HA3  . GLY D  2 19  ? 107.073 185.291 109.026 1.00 106.24 ? 19  GLY G HA3  1 
ATOM   8624  N  N    . GLU D  2 20  ? 108.757 185.666 106.553 1.00 97.51  ? 20  GLU G N    1 
ATOM   8625  C  CA   . GLU D  2 20  ? 109.980 185.262 105.869 1.00 97.51  ? 20  GLU G CA   1 
ATOM   8626  C  C    . GLU D  2 20  ? 110.089 186.127 104.618 1.00 97.51  ? 20  GLU G C    1 
ATOM   8627  O  O    . GLU D  2 20  ? 109.512 185.812 103.578 1.00 97.51  ? 20  GLU G O    1 
ATOM   8628  C  CB   . GLU D  2 20  ? 109.951 183.780 105.530 1.00 97.51  ? 20  GLU G CB   1 
ATOM   8629  C  CG   . GLU D  2 20  ? 110.067 182.894 106.755 1.00 97.51  ? 20  GLU G CG   1 
ATOM   8630  C  CD   . GLU D  2 20  ? 109.582 181.469 106.516 1.00 97.51  ? 20  GLU G CD   1 
ATOM   8631  O  OE1  . GLU D  2 20  ? 108.649 181.241 105.711 1.00 97.51  ? 20  GLU G OE1  1 
ATOM   8632  O  OE2  . GLU D  2 20  ? 110.150 180.567 107.153 1.00 97.51  ? 20  GLU G OE2  1 
ATOM   8633  H  H    . GLU D  2 20  ? 108.135 185.835 106.008 1.00 97.51  ? 20  GLU G H    1 
ATOM   8634  H  HA   . GLU D  2 20  ? 110.733 185.449 106.432 1.00 97.51  ? 20  GLU G HA   1 
ATOM   8635  H  HB2  . GLU D  2 20  ? 109.107 183.571 105.083 1.00 97.51  ? 20  GLU G HB2  1 
ATOM   8636  H  HB3  . GLU D  2 20  ? 110.683 183.579 104.944 1.00 97.51  ? 20  GLU G HB3  1 
ATOM   8637  H  HG2  . GLU D  2 20  ? 110.994 182.841 107.047 1.00 97.51  ? 20  GLU G HG2  1 
ATOM   8638  H  HG3  . GLU D  2 20  ? 109.544 183.284 107.491 1.00 97.51  ? 20  GLU G HG3  1 
ATOM   8639  N  N    . ASN D  2 21  ? 110.838 187.227 104.723 1.00 96.95  ? 21  ASN G N    1 
ATOM   8640  C  CA   . ASN D  2 21  ? 110.929 188.218 103.663 1.00 96.95  ? 21  ASN G CA   1 
ATOM   8641  C  C    . ASN D  2 21  ? 112.347 188.338 103.130 1.00 96.95  ? 21  ASN G C    1 
ATOM   8642  O  O    . ASN D  2 21  ? 112.734 189.393 102.621 1.00 96.95  ? 21  ASN G O    1 
ATOM   8643  C  CB   . ASN D  2 21  ? 110.423 189.569 104.153 1.00 96.95  ? 21  ASN G CB   1 
ATOM   8644  C  CG   . ASN D  2 21  ? 108.923 189.588 104.360 1.00 96.95  ? 21  ASN G CG   1 
ATOM   8645  O  OD1  . ASN D  2 21  ? 108.205 188.718 103.873 1.00 96.95  ? 21  ASN G OD1  1 
ATOM   8646  N  ND2  . ASN D  2 21  ? 108.441 190.582 105.092 1.00 96.95  ? 21  ASN G ND2  1 
ATOM   8647  H  H    . ASN D  2 21  ? 111.321 187.420 105.406 1.00 96.95  ? 21  ASN G H    1 
ATOM   8648  H  HA   . ASN D  2 21  ? 110.370 187.941 102.924 1.00 96.95  ? 21  ASN G HA   1 
ATOM   8649  H  HB2  . ASN D  2 21  ? 110.844 189.776 105.002 1.00 96.95  ? 21  ASN G HB2  1 
ATOM   8650  H  HB3  . ASN D  2 21  ? 110.645 190.253 103.495 1.00 96.95  ? 21  ASN G HB3  1 
ATOM   8651  H  HD21 . ASN D  2 21  ? 107.595 190.631 105.242 1.00 96.95  ? 21  ASN G HD21 1 
ATOM   8652  H  HD22 . ASN D  2 21  ? 108.974 191.169 105.417 1.00 96.95  ? 21  ASN G HD22 1 
ATOM   8653  N  N    . LEU D  2 22  ? 113.124 187.265 103.235 1.00 92.95  ? 22  LEU G N    1 
ATOM   8654  C  CA   . LEU D  2 22  ? 114.476 187.214 102.695 1.00 92.95  ? 22  LEU G CA   1 
ATOM   8655  C  C    . LEU D  2 22  ? 114.591 185.987 101.803 1.00 92.95  ? 22  LEU G C    1 
ATOM   8656  O  O    . LEU D  2 22  ? 114.603 184.852 102.295 1.00 92.95  ? 22  LEU G O    1 
ATOM   8657  C  CB   . LEU D  2 22  ? 115.517 187.177 103.809 1.00 92.95  ? 22  LEU G CB   1 
ATOM   8658  C  CG   . LEU D  2 22  ? 115.620 188.453 104.643 1.00 92.95  ? 22  LEU G CG   1 
ATOM   8659  C  CD1  . LEU D  2 22  ? 116.598 188.242 105.762 1.00 92.95  ? 22  LEU G CD1  1 
ATOM   8660  C  CD2  . LEU D  2 22  ? 116.042 189.633 103.797 1.00 92.95  ? 22  LEU G CD2  1 
ATOM   8661  H  H    . LEU D  2 22  ? 112.883 186.537 103.625 1.00 92.95  ? 22  LEU G H    1 
ATOM   8662  H  HA   . LEU D  2 22  ? 114.640 187.992 102.144 1.00 92.95  ? 22  LEU G HA   1 
ATOM   8663  H  HB2  . LEU D  2 22  ? 115.289 186.455 104.415 1.00 92.95  ? 22  LEU G HB2  1 
ATOM   8664  H  HB3  . LEU D  2 22  ? 116.387 187.012 103.418 1.00 92.95  ? 22  LEU G HB3  1 
ATOM   8665  H  HG   . LEU D  2 22  ? 114.755 188.651 105.030 1.00 92.95  ? 22  LEU G HG   1 
ATOM   8666  H  HD11 . LEU D  2 22  ? 116.418 188.878 106.471 1.00 92.95  ? 22  LEU G HD11 1 
ATOM   8667  H  HD12 . LEU D  2 22  ? 116.486 187.338 106.084 1.00 92.95  ? 22  LEU G HD12 1 
ATOM   8668  H  HD13 . LEU D  2 22  ? 117.496 188.359 105.422 1.00 92.95  ? 22  LEU G HD13 1 
ATOM   8669  H  HD21 . LEU D  2 22  ? 116.139 190.413 104.367 1.00 92.95  ? 22  LEU G HD21 1 
ATOM   8670  H  HD22 . LEU D  2 22  ? 116.892 189.431 103.376 1.00 92.95  ? 22  LEU G HD22 1 
ATOM   8671  H  HD23 . LEU D  2 22  ? 115.368 189.801 103.124 1.00 92.95  ? 22  LEU G HD23 1 
ATOM   8672  N  N    . CYS D  2 23  ? 114.662 186.224 100.497 1.00 81.78  ? 23  CYS G N    1 
ATOM   8673  C  CA   . CYS D  2 23  ? 115.053 185.195 99.557  1.00 81.78  ? 23  CYS G CA   1 
ATOM   8674  C  C    . CYS D  2 23  ? 116.552 184.957 99.666  1.00 81.78  ? 23  CYS G C    1 
ATOM   8675  O  O    . CYS D  2 23  ? 117.348 185.900 99.701  1.00 81.78  ? 23  CYS G O    1 
ATOM   8676  C  CB   . CYS D  2 23  ? 114.698 185.591 98.126  1.00 81.78  ? 23  CYS G CB   1 
ATOM   8677  S  SG   . CYS D  2 23  ? 113.062 186.314 97.898  1.00 81.78  ? 23  CYS G SG   1 
ATOM   8678  H  H    . CYS D  2 23  ? 114.490 186.980 100.132 1.00 81.78  ? 23  CYS G H    1 
ATOM   8679  H  HA   . CYS D  2 23  ? 114.599 184.366 99.772  1.00 81.78  ? 23  CYS G HA   1 
ATOM   8680  H  HB2  . CYS D  2 23  ? 115.344 186.242 97.820  1.00 81.78  ? 23  CYS G HB2  1 
ATOM   8681  H  HB3  . CYS D  2 23  ? 114.747 184.797 97.567  1.00 81.78  ? 23  CYS G HB3  1 
ATOM   8682  N  N    . TYR D  2 24  ? 116.940 183.687 99.718  1.00 62.64  ? 24  TYR G N    1 
ATOM   8683  C  CA   . TYR D  2 24  ? 118.330 183.315 99.872  1.00 62.64  ? 24  TYR G CA   1 
ATOM   8684  C  C    . TYR D  2 24  ? 118.663 182.185 98.922  1.00 62.64  ? 24  TYR G C    1 
ATOM   8685  O  O    . TYR D  2 24  ? 117.794 181.482 98.402  1.00 62.64  ? 24  TYR G O    1 
ATOM   8686  C  CB   . TYR D  2 24  ? 118.667 182.845 101.285 1.00 62.64  ? 24  TYR G CB   1 
ATOM   8687  C  CG   . TYR D  2 24  ? 118.316 181.395 101.506 1.00 62.64  ? 24  TYR G CG   1 
ATOM   8688  C  CD1  . TYR D  2 24  ? 117.037 181.023 101.872 1.00 62.64  ? 24  TYR G CD1  1 
ATOM   8689  C  CD2  . TYR D  2 24  ? 119.261 180.396 101.322 1.00 62.64  ? 24  TYR G CD2  1 
ATOM   8690  C  CE1  . TYR D  2 24  ? 116.710 179.701 102.063 1.00 62.64  ? 24  TYR G CE1  1 
ATOM   8691  C  CE2  . TYR D  2 24  ? 118.940 179.073 101.506 1.00 62.64  ? 24  TYR G CE2  1 
ATOM   8692  C  CZ   . TYR D  2 24  ? 117.666 178.730 101.878 1.00 62.64  ? 24  TYR G CZ   1 
ATOM   8693  O  OH   . TYR D  2 24  ? 117.342 177.409 102.065 1.00 62.64  ? 24  TYR G OH   1 
ATOM   8694  H  H    . TYR D  2 24  ? 116.405 183.017 99.663  1.00 62.64  ? 24  TYR G H    1 
ATOM   8695  H  HA   . TYR D  2 24  ? 118.897 184.069 99.652  1.00 62.64  ? 24  TYR G HA   1 
ATOM   8696  H  HB2  . TYR D  2 24  ? 119.622 182.939 101.414 1.00 62.64  ? 24  TYR G HB2  1 
ATOM   8697  H  HB3  . TYR D  2 24  ? 118.182 183.382 101.926 1.00 62.64  ? 24  TYR G HB3  1 
ATOM   8698  H  HD1  . TYR D  2 24  ? 116.394 181.680 101.996 1.00 62.64  ? 24  TYR G HD1  1 
ATOM   8699  H  HD2  . TYR D  2 24  ? 120.122 180.629 101.067 1.00 62.64  ? 24  TYR G HD2  1 
ATOM   8700  H  HE1  . TYR D  2 24  ? 115.848 179.465 102.312 1.00 62.64  ? 24  TYR G HE1  1 
ATOM   8701  H  HE2  . TYR D  2 24  ? 119.583 178.414 101.382 1.00 62.64  ? 24  TYR G HE2  1 
ATOM   8702  H  HH   . TYR D  2 24  ? 118.007 176.929 101.883 1.00 62.64  ? 24  TYR G HH   1 
ATOM   8703  N  N    . ARG D  2 25  ? 119.966 182.004 98.748  1.00 50.61  ? 25  ARG G N    1 
ATOM   8704  C  CA   . ARG D  2 25  ? 120.533 180.918 97.973  1.00 50.61  ? 25  ARG G CA   1 
ATOM   8705  C  C    . ARG D  2 25  ? 121.869 180.501 98.578  1.00 50.61  ? 25  ARG G C    1 
ATOM   8706  O  O    . ARG D  2 25  ? 122.626 181.345 99.046  1.00 50.61  ? 25  ARG G O    1 
ATOM   8707  C  CB   . ARG D  2 25  ? 120.703 181.356 96.544  1.00 50.61  ? 25  ARG G CB   1 
ATOM   8708  C  CG   . ARG D  2 25  ? 121.776 182.368 96.425  1.00 50.61  ? 25  ARG G CG   1 
ATOM   8709  C  CD   . ARG D  2 25  ? 121.885 182.824 95.027  1.00 50.61  ? 25  ARG G CD   1 
ATOM   8710  N  NE   . ARG D  2 25  ? 122.447 181.825 94.148  1.00 50.61  ? 25  ARG G NE   1 
ATOM   8711  C  CZ   . ARG D  2 25  ? 122.893 182.096 92.929  1.00 50.61  ? 25  ARG G CZ   1 
ATOM   8712  N  NH1  . ARG D  2 25  ? 122.748 183.319 92.434  1.00 50.61  ? 25  ARG G NH1  1 
ATOM   8713  N  NH2  . ARG D  2 25  ? 123.394 181.118 92.190  1.00 50.61  ? 25  ARG G NH2  1 
ATOM   8714  H  H    . ARG D  2 25  ? 120.561 182.533 99.068  1.00 50.61  ? 25  ARG G H    1 
ATOM   8715  H  HA   . ARG D  2 25  ? 119.924 180.171 98.000  1.00 50.61  ? 25  ARG G HA   1 
ATOM   8716  H  HB2  . ARG D  2 25  ? 120.964 180.587 96.007  1.00 50.61  ? 25  ARG G HB2  1 
ATOM   8717  H  HB3  . ARG D  2 25  ? 119.882 181.736 96.226  1.00 50.61  ? 25  ARG G HB3  1 
ATOM   8718  H  HG2  . ARG D  2 25  ? 121.536 183.125 96.980  1.00 50.61  ? 25  ARG G HG2  1 
ATOM   8719  H  HG3  . ARG D  2 25  ? 122.631 181.983 96.693  1.00 50.61  ? 25  ARG G HG3  1 
ATOM   8720  H  HD2  . ARG D  2 25  ? 120.980 183.021 94.712  1.00 50.61  ? 25  ARG G HD2  1 
ATOM   8721  H  HD3  . ARG D  2 25  ? 122.430 183.606 94.982  1.00 50.61  ? 25  ARG G HD3  1 
ATOM   8722  H  HE   . ARG D  2 25  ? 122.846 181.166 94.552  1.00 50.61  ? 25  ARG G HE   1 
ATOM   8723  H  HH11 . ARG D  2 25  ? 122.374 183.945 92.928  1.00 50.61  ? 25  ARG G HH11 1 
ATOM   8724  H  HH12 . ARG D  2 25  ? 122.999 183.468 91.618  1.00 50.61  ? 25  ARG G HH12 1 
ATOM   8725  H  HH21 . ARG D  2 25  ? 123.477 180.309 92.524  1.00 50.61  ? 25  ARG G HH21 1 
ATOM   8726  H  HH22 . ARG D  2 25  ? 123.669 181.272 91.392  1.00 50.61  ? 25  ARG G HH22 1 
ATOM   8727  N  N    . LYS D  2 26  ? 122.128 179.210 98.539  1.00 46.90  ? 26  LYS G N    1 
ATOM   8728  C  CA   . LYS D  2 26  ? 123.284 178.616 99.153  1.00 46.90  ? 26  LYS G CA   1 
ATOM   8729  C  C    . LYS D  2 26  ? 123.963 177.705 98.152  1.00 46.90  ? 26  LYS G C    1 
ATOM   8730  O  O    . LYS D  2 26  ? 123.296 176.914 97.481  1.00 46.90  ? 26  LYS G O    1 
ATOM   8731  C  CB   . LYS D  2 26  ? 122.882 177.836 100.399 1.00 46.90  ? 26  LYS G CB   1 
ATOM   8732  C  CG   . LYS D  2 26  ? 124.009 177.517 101.317 1.00 46.90  ? 26  LYS G CG   1 
ATOM   8733  C  CD   . LYS D  2 26  ? 123.468 177.198 102.679 1.00 46.90  ? 26  LYS G CD   1 
ATOM   8734  C  CE   . LYS D  2 26  ? 122.661 175.918 102.639 1.00 46.90  ? 26  LYS G CE   1 
ATOM   8735  N  NZ   . LYS D  2 26  ? 122.310 175.418 103.989 1.00 46.90  ? 26  LYS G NZ   1 
ATOM   8736  H  H    . LYS D  2 26  ? 121.622 178.635 98.146  1.00 46.90  ? 26  LYS G H    1 
ATOM   8737  H  HA   . LYS D  2 26  ? 123.910 179.306 99.416  1.00 46.90  ? 26  LYS G HA   1 
ATOM   8738  H  HB2  . LYS D  2 26  ? 122.229 178.357 100.889 1.00 46.90  ? 26  LYS G HB2  1 
ATOM   8739  H  HB3  . LYS D  2 26  ? 122.489 177.000 100.117 1.00 46.90  ? 26  LYS G HB3  1 
ATOM   8740  H  HG2  . LYS D  2 26  ? 124.479 176.745 100.979 1.00 46.90  ? 26  LYS G HG2  1 
ATOM   8741  H  HG3  . LYS D  2 26  ? 124.602 178.282 101.382 1.00 46.90  ? 26  LYS G HG3  1 
ATOM   8742  H  HD2  . LYS D  2 26  ? 124.199 177.103 103.302 1.00 46.90  ? 26  LYS G HD2  1 
ATOM   8743  H  HD3  . LYS D  2 26  ? 122.884 177.910 102.957 1.00 46.90  ? 26  LYS G HD3  1 
ATOM   8744  H  HE2  . LYS D  2 26  ? 121.835 176.089 102.159 1.00 46.90  ? 26  LYS G HE2  1 
ATOM   8745  H  HE3  . LYS D  2 26  ? 123.172 175.233 102.182 1.00 46.90  ? 26  LYS G HE3  1 
ATOM   8746  H  HZ1  . LYS D  2 26  ? 121.775 174.709 103.922 1.00 46.90  ? 26  LYS G HZ1  1 
ATOM   8747  H  HZ2  . LYS D  2 26  ? 123.049 175.183 104.425 1.00 46.90  ? 26  LYS G HZ2  1 
ATOM   8748  H  HZ3  . LYS D  2 26  ? 121.892 176.054 104.448 1.00 46.90  ? 26  LYS G HZ3  1 
ATOM   8749  N  N    . MET D  2 27  ? 125.285 177.832 98.037  1.00 40.58  ? 27  MET G N    1 
ATOM   8750  C  CA   . MET D  2 27  ? 126.032 177.184 96.968  1.00 40.58  ? 27  MET G CA   1 
ATOM   8751  C  C    . MET D  2 27  ? 127.350 176.660 97.501  1.00 40.58  ? 27  MET G C    1 
ATOM   8752  O  O    . MET D  2 27  ? 128.061 177.377 98.210  1.00 40.58  ? 27  MET G O    1 
ATOM   8753  C  CB   . MET D  2 27  ? 126.249 178.188 95.835  1.00 40.58  ? 27  MET G CB   1 
ATOM   8754  C  CG   . MET D  2 27  ? 124.943 178.585 95.188  1.00 40.58  ? 27  MET G CG   1 
ATOM   8755  S  SD   . MET D  2 27  ? 125.037 179.722 93.793  1.00 40.58  ? 27  MET G SD   1 
ATOM   8756  C  CE   . MET D  2 27  ? 126.301 178.952 92.812  1.00 40.58  ? 27  MET G CE   1 
ATOM   8757  H  H    . MET D  2 27  ? 125.771 178.296 98.565  1.00 40.58  ? 27  MET G H    1 
ATOM   8758  H  HA   . MET D  2 27  ? 125.508 176.456 96.621  1.00 40.58  ? 27  MET G HA   1 
ATOM   8759  H  HB2  . MET D  2 27  ? 126.682 178.977 96.186  1.00 40.58  ? 27  MET G HB2  1 
ATOM   8760  H  HB3  . MET D  2 27  ? 126.805 177.771 95.166  1.00 40.58  ? 27  MET G HB3  1 
ATOM   8761  H  HG2  . MET D  2 27  ? 124.532 177.778 94.853  1.00 40.58  ? 27  MET G HG2  1 
ATOM   8762  H  HG3  . MET D  2 27  ? 124.378 178.988 95.862  1.00 40.58  ? 27  MET G HG3  1 
ATOM   8763  H  HE1  . MET D  2 27  ? 126.524 179.569 92.080  1.00 40.58  ? 27  MET G HE1  1 
ATOM   8764  H  HE2  . MET D  2 27  ? 127.060 178.787 93.390  1.00 40.58  ? 27  MET G HE2  1 
ATOM   8765  H  HE3  . MET D  2 27  ? 125.965 178.112 92.452  1.00 40.58  ? 27  MET G HE3  1 
ATOM   8766  N  N    . TRP D  2 28  ? 127.669 175.417 97.162  1.00 32.18  ? 28  TRP G N    1 
ATOM   8767  C  CA   . TRP D  2 28  ? 128.933 174.807 97.559  1.00 32.18  ? 28  TRP G CA   1 
ATOM   8768  C  C    . TRP D  2 28  ? 129.297 173.711 96.569  1.00 32.18  ? 28  TRP G C    1 
ATOM   8769  O  O    . TRP D  2 28  ? 128.464 173.254 95.786  1.00 32.18  ? 28  TRP G O    1 
ATOM   8770  C  CB   . TRP D  2 28  ? 128.863 174.244 98.979  1.00 32.18  ? 28  TRP G CB   1 
ATOM   8771  C  CG   . TRP D  2 28  ? 128.096 172.978 99.113  1.00 32.18  ? 28  TRP G CG   1 
ATOM   8772  C  CD1  . TRP D  2 28  ? 128.605 171.715 99.163  1.00 32.18  ? 28  TRP G CD1  1 
ATOM   8773  C  CD2  . TRP D  2 28  ? 126.682 172.847 99.245  1.00 32.18  ? 28  TRP G CD2  1 
ATOM   8774  N  NE1  . TRP D  2 28  ? 127.586 170.804 99.309  1.00 32.18  ? 28  TRP G NE1  1 
ATOM   8775  C  CE2  . TRP D  2 28  ? 126.397 171.476 99.361  1.00 32.18  ? 28  TRP G CE2  1 
ATOM   8776  C  CE3  . TRP D  2 28  ? 125.626 173.757 99.271  1.00 32.18  ? 28  TRP G CE3  1 
ATOM   8777  C  CZ2  . TRP D  2 28  ? 125.106 170.994 99.498  1.00 32.18  ? 28  TRP G CZ2  1 
ATOM   8778  C  CZ3  . TRP D  2 28  ? 124.347 173.279 99.407  1.00 32.18  ? 28  TRP G CZ3  1 
ATOM   8779  C  CH2  . TRP D  2 28  ? 124.097 171.909 99.519  1.00 32.18  ? 28  TRP G CH2  1 
ATOM   8780  H  H    . TRP D  2 28  ? 127.165 174.899 96.705  1.00 32.18  ? 28  TRP G H    1 
ATOM   8781  H  HA   . TRP D  2 28  ? 129.626 175.479 97.530  1.00 32.18  ? 28  TRP G HA   1 
ATOM   8782  H  HB2  . TRP D  2 28  ? 129.764 174.075 99.286  1.00 32.18  ? 28  TRP G HB2  1 
ATOM   8783  H  HB3  . TRP D  2 28  ? 128.430 174.901 99.541  1.00 32.18  ? 28  TRP G HB3  1 
ATOM   8784  H  HD1  . TRP D  2 28  ? 129.505 171.501 99.105  1.00 32.18  ? 28  TRP G HD1  1 
ATOM   8785  H  HE1  . TRP D  2 28  ? 127.678 169.950 99.359  1.00 32.18  ? 28  TRP G HE1  1 
ATOM   8786  H  HE3  . TRP D  2 28  ? 125.788 174.668 99.197  1.00 32.18  ? 28  TRP G HE3  1 
ATOM   8787  H  HZ2  . TRP D  2 28  ? 124.936 170.085 99.573  1.00 32.18  ? 28  TRP G HZ2  1 
ATOM   8788  H  HZ3  . TRP D  2 28  ? 123.638 173.875 99.427  1.00 32.18  ? 28  TRP G HZ3  1 
ATOM   8789  H  HH2  . TRP D  2 28  ? 123.222 171.613 99.611  1.00 32.18  ? 28  TRP G HH2  1 
ATOM   8790  N  N    . CYS D  2 29  ? 130.561 173.299 96.611  1.00 28.10  ? 29  CYS G N    1 
ATOM   8791  C  CA   . CYS D  2 29  ? 131.056 172.226 95.767  1.00 28.10  ? 29  CYS G CA   1 
ATOM   8792  C  C    . CYS D  2 29  ? 130.798 170.888 96.444  1.00 28.10  ? 29  CYS G C    1 
ATOM   8793  O  O    . CYS D  2 29  ? 131.172 170.691 97.604  1.00 28.10  ? 29  CYS G O    1 
ATOM   8794  C  CB   . CYS D  2 29  ? 132.559 172.372 95.501  1.00 28.10  ? 29  CYS G CB   1 
ATOM   8795  S  SG   . CYS D  2 29  ? 133.071 173.440 94.126  1.00 28.10  ? 29  CYS G SG   1 
ATOM   8796  H  H    . CYS D  2 29  ? 131.152 173.627 97.137  1.00 28.10  ? 29  CYS G H    1 
ATOM   8797  H  HA   . CYS D  2 29  ? 130.595 172.235 94.918  1.00 28.10  ? 29  CYS G HA   1 
ATOM   8798  H  HB2  . CYS D  2 29  ? 132.969 172.726 96.301  1.00 28.10  ? 29  CYS G HB2  1 
ATOM   8799  H  HB3  . CYS D  2 29  ? 132.914 171.490 95.325  1.00 28.10  ? 29  CYS G HB3  1 
ATOM   8800  N  N    . ASP D  2 30  ? 130.162 169.981 95.722  1.00 24.26  ? 30  ASP G N    1 
ATOM   8801  C  CA   . ASP D  2 30  ? 130.126 168.581 96.089  1.00 24.26  ? 30  ASP G CA   1 
ATOM   8802  C  C    . ASP D  2 30  ? 131.215 167.863 95.304  1.00 24.26  ? 30  ASP G C    1 
ATOM   8803  O  O    . ASP D  2 30  ? 132.090 168.492 94.703  1.00 24.26  ? 30  ASP G O    1 
ATOM   8804  C  CB   . ASP D  2 30  ? 128.749 167.963 95.859  1.00 24.26  ? 30  ASP G CB   1 
ATOM   8805  C  CG   . ASP D  2 30  ? 128.225 168.187 94.470  1.00 24.26  ? 30  ASP G CG   1 
ATOM   8806  O  OD1  . ASP D  2 30  ? 129.035 168.307 93.530  1.00 24.26  ? 30  ASP G OD1  1 
ATOM   8807  O  OD2  . ASP D  2 30  ? 126.990 168.273 94.334  1.00 24.26  ? 30  ASP G OD2  1 
ATOM   8808  H  H    . ASP D  2 30  ? 129.755 170.148 94.984  1.00 24.26  ? 30  ASP G H    1 
ATOM   8809  H  HA   . ASP D  2 30  ? 130.338 168.500 97.025  1.00 24.26  ? 30  ASP G HA   1 
ATOM   8810  H  HB2  . ASP D  2 30  ? 128.793 167.010 96.013  1.00 24.26  ? 30  ASP G HB2  1 
ATOM   8811  H  HB3  . ASP D  2 30  ? 128.125 168.362 96.472  1.00 24.26  ? 30  ASP G HB3  1 
ATOM   8812  N  N    . VAL D  2 31  ? 131.180 166.533 95.319  1.00 12.50  ? 31  VAL G N    1 
ATOM   8813  C  CA   . VAL D  2 31  ? 132.167 165.765 94.573  1.00 12.50  ? 31  VAL G CA   1 
ATOM   8814  C  C    . VAL D  2 31  ? 132.155 166.177 93.110  1.00 12.50  ? 31  VAL G C    1 
ATOM   8815  O  O    . VAL D  2 31  ? 133.205 166.371 92.491  1.00 12.50  ? 31  VAL G O    1 
ATOM   8816  C  CB   . VAL D  2 31  ? 131.890 164.263 94.715  1.00 12.50  ? 31  VAL G CB   1 
ATOM   8817  C  CG1  . VAL D  2 31  ? 132.850 163.500 93.882  1.00 12.50  ? 31  VAL G CG1  1 
ATOM   8818  C  CG2  . VAL D  2 31  ? 132.021 163.835 96.110  1.00 12.50  ? 31  VAL G CG2  1 
ATOM   8819  H  H    . VAL D  2 31  ? 130.619 166.059 95.758  1.00 12.50  ? 31  VAL G H    1 
ATOM   8820  H  HA   . VAL D  2 31  ? 133.047 165.940 94.929  1.00 12.50  ? 31  VAL G HA   1 
ATOM   8821  H  HB   . VAL D  2 31  ? 130.990 164.075 94.416  1.00 12.50  ? 31  VAL G HB   1 
ATOM   8822  H  HG11 . VAL D  2 31  ? 132.625 162.560 93.943  1.00 12.50  ? 31  VAL G HG11 1 
ATOM   8823  H  HG12 . VAL D  2 31  ? 132.793 163.791 92.960  1.00 12.50  ? 31  VAL G HG12 1 
ATOM   8824  H  HG13 . VAL D  2 31  ? 133.744 163.652 94.222  1.00 12.50  ? 31  VAL G HG13 1 
ATOM   8825  H  HG21 . VAL D  2 31  ? 131.793 162.896 96.183  1.00 12.50  ? 31  VAL G HG21 1 
ATOM   8826  H  HG22 . VAL D  2 31  ? 132.958 163.964 96.309  1.00 12.50  ? 31  VAL G HG22 1 
ATOM   8827  H  HG23 . VAL D  2 31  ? 131.448 164.377 96.671  1.00 12.50  ? 31  VAL G HG23 1 
ATOM   8828  N  N    . PHE D  2 32  ? 130.967 166.298 92.534  1.00 12.34  ? 32  PHE G N    1 
ATOM   8829  C  CA   . PHE D  2 32  ? 130.827 166.582 91.111  1.00 12.34  ? 32  PHE G CA   1 
ATOM   8830  C  C    . PHE D  2 32  ? 130.875 168.078 90.840  1.00 12.34  ? 32  PHE G C    1 
ATOM   8831  O  O    . PHE D  2 32  ? 130.040 168.618 90.121  1.00 12.34  ? 32  PHE G O    1 
ATOM   8832  C  CB   . PHE D  2 32  ? 129.523 165.991 90.600  1.00 12.34  ? 32  PHE G CB   1 
ATOM   8833  C  CG   . PHE D  2 32  ? 129.259 164.588 91.054  1.00 12.34  ? 32  PHE G CG   1 
ATOM   8834  C  CD1  . PHE D  2 32  ? 128.588 164.350 92.235  1.00 12.34  ? 32  PHE G CD1  1 
ATOM   8835  C  CD2  . PHE D  2 32  ? 129.648 163.507 90.289  1.00 12.34  ? 32  PHE G CD2  1 
ATOM   8836  C  CE1  . PHE D  2 32  ? 128.332 163.069 92.654  1.00 12.34  ? 32  PHE G CE1  1 
ATOM   8837  C  CE2  . PHE D  2 32  ? 129.389 162.222 90.709  1.00 12.34  ? 32  PHE G CE2  1 
ATOM   8838  C  CZ   . PHE D  2 32  ? 128.729 162.006 91.891  1.00 12.34  ? 32  PHE G CZ   1 
ATOM   8839  H  H    . PHE D  2 32  ? 130.221 166.219 92.944  1.00 12.34  ? 32  PHE G H    1 
ATOM   8840  H  HA   . PHE D  2 32  ? 131.556 166.166 90.632  1.00 12.34  ? 32  PHE G HA   1 
ATOM   8841  H  HB2  . PHE D  2 32  ? 128.802 166.540 90.928  1.00 12.34  ? 32  PHE G HB2  1 
ATOM   8842  H  HB3  . PHE D  2 32  ? 129.537 166.000 89.634  1.00 12.34  ? 32  PHE G HB3  1 
ATOM   8843  H  HD1  . PHE D  2 32  ? 128.321 165.067 92.755  1.00 12.34  ? 32  PHE G HD1  1 
ATOM   8844  H  HD2  . PHE D  2 32  ? 130.097 163.646 89.487  1.00 12.34  ? 32  PHE G HD2  1 
ATOM   8845  H  HE1  . PHE D  2 32  ? 127.886 162.922 93.453  1.00 12.34  ? 32  PHE G HE1  1 
ATOM   8846  H  HE2  . PHE D  2 32  ? 129.659 161.501 90.191  1.00 12.34  ? 32  PHE G HE2  1 
ATOM   8847  H  HZ   . PHE D  2 32  ? 128.556 161.140 92.170  1.00 12.34  ? 32  PHE G HZ   1 
ATOM   8848  N  N    . CYS D  2 33  ? 131.871 168.761 91.391  1.00 21.97  ? 33  CYS G N    1 
ATOM   8849  C  CA   . CYS D  2 33  ? 132.028 170.188 91.168  1.00 21.97  ? 33  CYS G CA   1 
ATOM   8850  C  C    . CYS D  2 33  ? 132.969 170.481 90.010  1.00 21.97  ? 33  CYS G C    1 
ATOM   8851  O  O    . CYS D  2 33  ? 133.287 171.648 89.763  1.00 21.97  ? 33  CYS G O    1 
ATOM   8852  C  CB   . CYS D  2 33  ? 132.523 170.877 92.442  1.00 21.97  ? 33  CYS G CB   1 
ATOM   8853  S  SG   . CYS D  2 33  ? 132.279 172.679 92.411  1.00 21.97  ? 33  CYS G SG   1 
ATOM   8854  H  H    . CYS D  2 33  ? 132.468 168.422 91.900  1.00 21.97  ? 33  CYS G H    1 
ATOM   8855  H  HA   . CYS D  2 33  ? 131.165 170.562 90.951  1.00 21.97  ? 33  CYS G HA   1 
ATOM   8856  H  HB2  . CYS D  2 33  ? 132.029 170.519 93.193  1.00 21.97  ? 33  CYS G HB2  1 
ATOM   8857  H  HB3  . CYS D  2 33  ? 133.470 170.700 92.547  1.00 21.97  ? 33  CYS G HB3  1 
ATOM   8858  N  N    . SER D  2 34  ? 133.417 169.448 89.300  1.00 16.74  ? 34  SER G N    1 
ATOM   8859  C  CA   . SER D  2 34  ? 134.272 169.595 88.131  1.00 16.74  ? 34  SER G CA   1 
ATOM   8860  C  C    . SER D  2 34  ? 133.449 169.702 86.856  1.00 16.74  ? 34  SER G C    1 
ATOM   8861  O  O    . SER D  2 34  ? 133.721 170.554 86.005  1.00 16.74  ? 34  SER G O    1 
ATOM   8862  C  CB   . SER D  2 34  ? 135.230 168.408 88.034  1.00 16.74  ? 34  SER G CB   1 
ATOM   8863  O  OG   . SER D  2 34  ? 135.935 168.422 86.808  1.00 16.74  ? 34  SER G OG   1 
ATOM   8864  H  H    . SER D  2 34  ? 133.226 168.633 89.475  1.00 16.74  ? 34  SER G H    1 
ATOM   8865  H  HA   . SER D  2 34  ? 134.803 170.400 88.220  1.00 16.74  ? 34  SER G HA   1 
ATOM   8866  H  HB2  . SER D  2 34  ? 135.860 168.448 88.766  1.00 16.74  ? 34  SER G HB2  1 
ATOM   8867  H  HB3  . SER D  2 34  ? 134.711 167.592 88.085  1.00 16.74  ? 34  SER G HB3  1 
ATOM   8868  H  HG   . SER D  2 34  ? 136.283 167.670 86.675  1.00 16.74  ? 34  SER G HG   1 
ATOM   8869  N  N    . SER D  2 35  ? 132.444 168.844 86.715  1.00 13.26  ? 35  SER G N    1 
ATOM   8870  C  CA   . SER D  2 35  ? 131.551 168.836 85.565  1.00 13.26  ? 35  SER G CA   1 
ATOM   8871  C  C    . SER D  2 35  ? 130.233 169.542 85.848  1.00 13.26  ? 35  SER G C    1 
ATOM   8872  O  O    . SER D  2 35  ? 129.832 170.436 85.099  1.00 13.26  ? 35  SER G O    1 
ATOM   8873  C  CB   . SER D  2 35  ? 131.279 167.393 85.135  1.00 13.26  ? 35  SER G CB   1 
ATOM   8874  O  OG   . SER D  2 35  ? 130.942 166.591 86.250  1.00 13.26  ? 35  SER G OG   1 
ATOM   8875  H  H    . SER D  2 35  ? 132.262 168.239 87.287  1.00 13.26  ? 35  SER G H    1 
ATOM   8876  H  HA   . SER D  2 35  ? 131.984 169.292 84.825  1.00 13.26  ? 35  SER G HA   1 
ATOM   8877  H  HB2  . SER D  2 35  ? 130.540 167.387 84.511  1.00 13.26  ? 35  SER G HB2  1 
ATOM   8878  H  HB3  . SER D  2 35  ? 132.074 167.034 84.719  1.00 13.26  ? 35  SER G HB3  1 
ATOM   8879  H  HG   . SER D  2 35  ? 130.761 165.811 85.997  1.00 13.26  ? 35  SER G HG   1 
ATOM   8880  N  N    . ARG D  2 36  ? 129.551 169.155 86.923  1.00 13.65  ? 36  ARG G N    1 
ATOM   8881  C  CA   . ARG D  2 36  ? 128.244 169.716 87.227  1.00 13.65  ? 36  ARG G CA   1 
ATOM   8882  C  C    . ARG D  2 36  ? 128.338 171.117 87.814  1.00 13.65  ? 36  ARG G C    1 
ATOM   8883  O  O    . ARG D  2 36  ? 127.433 171.931 87.612  1.00 13.65  ? 36  ARG G O    1 
ATOM   8884  C  CB   . ARG D  2 36  ? 127.504 168.789 88.187  1.00 13.65  ? 36  ARG G CB   1 
ATOM   8885  C  CG   . ARG D  2 36  ? 127.494 167.348 87.765  1.00 13.65  ? 36  ARG G CG   1 
ATOM   8886  C  CD   . ARG D  2 36  ? 126.700 166.503 88.721  1.00 13.65  ? 36  ARG G CD   1 
ATOM   8887  N  NE   . ARG D  2 36  ? 126.640 165.107 88.316  1.00 13.65  ? 36  ARG G NE   1 
ATOM   8888  C  CZ   . ARG D  2 36  ? 126.059 164.150 89.027  1.00 13.65  ? 36  ARG G CZ   1 
ATOM   8889  N  NH1  . ARG D  2 36  ? 125.488 164.429 90.186  1.00 13.65  ? 36  ARG G NH1  1 
ATOM   8890  N  NH2  . ARG D  2 36  ? 126.055 162.908 88.580  1.00 13.65  ? 36  ARG G NH2  1 
ATOM   8891  H  H    . ARG D  2 36  ? 129.821 168.574 87.488  1.00 13.65  ? 36  ARG G H    1 
ATOM   8892  H  HA   . ARG D  2 36  ? 127.731 169.766 86.407  1.00 13.65  ? 36  ARG G HA   1 
ATOM   8893  H  HB2  . ARG D  2 36  ? 127.928 168.833 89.051  1.00 13.65  ? 36  ARG G HB2  1 
ATOM   8894  H  HB3  . ARG D  2 36  ? 126.584 169.069 88.243  1.00 13.65  ? 36  ARG G HB3  1 
ATOM   8895  H  HG2  . ARG D  2 36  ? 127.090 167.274 86.892  1.00 13.65  ? 36  ARG G HG2  1 
ATOM   8896  H  HG3  . ARG D  2 36  ? 128.400 167.015 87.750  1.00 13.65  ? 36  ARG G HG3  1 
ATOM   8897  H  HD2  . ARG D  2 36  ? 127.104 166.542 89.594  1.00 13.65  ? 36  ARG G HD2  1 
ATOM   8898  H  HD3  . ARG D  2 36  ? 125.799 166.840 88.757  1.00 13.65  ? 36  ARG G HD3  1 
ATOM   8899  H  HE   . ARG D  2 36  ? 126.852 164.921 87.507  1.00 13.65  ? 36  ARG G HE   1 
ATOM   8900  H  HH11 . ARG D  2 36  ? 125.489 165.232 90.483  1.00 13.65  ? 36  ARG G HH11 1 
ATOM   8901  H  HH12 . ARG D  2 36  ? 125.114 163.804 90.640  1.00 13.65  ? 36  ARG G HH12 1 
ATOM   8902  H  HH21 . ARG D  2 36  ? 126.425 162.723 87.827  1.00 13.65  ? 36  ARG G HH21 1 
ATOM   8903  H  HH22 . ARG D  2 36  ? 125.676 162.290 89.041  1.00 13.65  ? 36  ARG G HH22 1 
ATOM   8904  N  N    . GLY D  2 37  ? 129.416 171.425 88.519  1.00 21.09  ? 37  GLY G N    1 
ATOM   8905  C  CA   . GLY D  2 37  ? 129.536 172.695 89.199  1.00 21.09  ? 37  GLY G CA   1 
ATOM   8906  C  C    . GLY D  2 37  ? 129.047 172.627 90.630  1.00 21.09  ? 37  GLY G C    1 
ATOM   8907  O  O    . GLY D  2 37  ? 128.770 171.561 91.185  1.00 21.09  ? 37  GLY G O    1 
ATOM   8908  H  H    . GLY D  2 37  ? 130.093 170.913 88.612  1.00 21.09  ? 37  GLY G H    1 
ATOM   8909  H  HA2  . GLY D  2 37  ? 130.462 172.972 89.207  1.00 21.09  ? 37  GLY G HA2  1 
ATOM   8910  H  HA3  . GLY D  2 37  ? 129.023 173.365 88.729  1.00 21.09  ? 37  GLY G HA3  1 
ATOM   8911  N  N    . LYS D  2 38  ? 128.944 173.805 91.238  1.00 29.80  ? 38  LYS G N    1 
ATOM   8912  C  CA   . LYS D  2 38  ? 128.513 173.877 92.624  1.00 29.80  ? 38  LYS G CA   1 
ATOM   8913  C  C    . LYS D  2 38  ? 127.018 173.622 92.748  1.00 29.80  ? 38  LYS G C    1 
ATOM   8914  O  O    . LYS D  2 38  ? 126.238 173.828 91.818  1.00 29.80  ? 38  LYS G O    1 
ATOM   8915  C  CB   . LYS D  2 38  ? 128.835 175.236 93.238  1.00 29.80  ? 38  LYS G CB   1 
ATOM   8916  C  CG   . LYS D  2 38  ? 130.247 175.723 93.027  1.00 29.80  ? 38  LYS G CG   1 
ATOM   8917  C  CD   . LYS D  2 38  ? 130.533 176.908 93.919  1.00 29.80  ? 38  LYS G CD   1 
ATOM   8918  C  CE   . LYS D  2 38  ? 131.982 176.967 94.321  1.00 29.80  ? 38  LYS G CE   1 
ATOM   8919  N  NZ   . LYS D  2 38  ? 132.172 177.794 95.532  1.00 29.80  ? 38  LYS G NZ   1 
ATOM   8920  H  H    . LYS D  2 38  ? 129.109 174.564 90.876  1.00 29.80  ? 38  LYS G H    1 
ATOM   8921  H  HA   . LYS D  2 38  ? 128.974 173.197 93.132  1.00 29.80  ? 38  LYS G HA   1 
ATOM   8922  H  HB2  . LYS D  2 38  ? 128.235 175.894 92.859  1.00 29.80  ? 38  LYS G HB2  1 
ATOM   8923  H  HB3  . LYS D  2 38  ? 128.691 175.176 94.192  1.00 29.80  ? 38  LYS G HB3  1 
ATOM   8924  H  HG2  . LYS D  2 38  ? 130.853 175.014 93.279  1.00 29.80  ? 38  LYS G HG2  1 
ATOM   8925  H  HG3  . LYS D  2 38  ? 130.406 175.975 92.111  1.00 29.80  ? 38  LYS G HG3  1 
ATOM   8926  H  HD2  . LYS D  2 38  ? 130.319 177.723 93.441  1.00 29.80  ? 38  LYS G HD2  1 
ATOM   8927  H  HD3  . LYS D  2 38  ? 130.000 176.842 94.725  1.00 29.80  ? 38  LYS G HD3  1 
ATOM   8928  H  HE2  . LYS D  2 38  ? 132.298 176.074 94.513  1.00 29.80  ? 38  LYS G HE2  1 
ATOM   8929  H  HE3  . LYS D  2 38  ? 132.496 177.360 93.600  1.00 29.80  ? 38  LYS G HE3  1 
ATOM   8930  H  HZ1  . LYS D  2 38  ? 133.037 177.849 95.729  1.00 29.80  ? 38  LYS G HZ1  1 
ATOM   8931  H  HZ2  . LYS D  2 38  ? 131.850 178.611 95.391  1.00 29.80  ? 38  LYS G HZ2  1 
ATOM   8932  H  HZ3  . LYS D  2 38  ? 131.741 177.426 96.217  1.00 29.80  ? 38  LYS G HZ3  1 
ATOM   8933  N  N    . VAL D  2 39  ? 126.628 173.168 93.938  1.00 25.52  ? 39  VAL G N    1 
ATOM   8934  C  CA   . VAL D  2 39  ? 125.228 172.928 94.226  1.00 25.52  ? 39  VAL G CA   1 
ATOM   8935  C  C    . VAL D  2 39  ? 124.492 174.253 94.378  1.00 25.52  ? 39  VAL G C    1 
ATOM   8936  O  O    . VAL D  2 39  ? 125.087 175.319 94.567  1.00 25.52  ? 39  VAL G O    1 
ATOM   8937  C  CB   . VAL D  2 39  ? 125.079 172.066 95.487  1.00 25.52  ? 39  VAL G CB   1 
ATOM   8938  C  CG1  . VAL D  2 39  ? 123.656 171.631 95.659  1.00 25.52  ? 39  VAL G CG1  1 
ATOM   8939  C  CG2  . VAL D  2 39  ? 125.972 170.868 95.399  1.00 25.52  ? 39  VAL G CG2  1 
ATOM   8940  H  H    . VAL D  2 39  ? 127.158 172.993 94.586  1.00 25.52  ? 39  VAL G H    1 
ATOM   8941  H  HA   . VAL D  2 39  ? 124.835 172.447 93.488  1.00 25.52  ? 39  VAL G HA   1 
ATOM   8942  H  HB   . VAL D  2 39  ? 125.336 172.586 96.257  1.00 25.52  ? 39  VAL G HB   1 
ATOM   8943  H  HG11 . VAL D  2 39  ? 123.634 170.882 96.268  1.00 25.52  ? 39  VAL G HG11 1 
ATOM   8944  H  HG12 . VAL D  2 39  ? 123.146 172.370 96.020  1.00 25.52  ? 39  VAL G HG12 1 
ATOM   8945  H  HG13 . VAL D  2 39  ? 123.305 171.370 94.796  1.00 25.52  ? 39  VAL G HG13 1 
ATOM   8946  H  HG21 . VAL D  2 39  ? 125.838 170.319 96.182  1.00 25.52  ? 39  VAL G HG21 1 
ATOM   8947  H  HG22 . VAL D  2 39  ? 125.734 170.378 94.602  1.00 25.52  ? 39  VAL G HG22 1 
ATOM   8948  H  HG23 . VAL D  2 39  ? 126.893 171.155 95.347  1.00 25.52  ? 39  VAL G HG23 1 
ATOM   8949  N  N    . VAL D  2 40  ? 123.169 174.181 94.279  1.00 33.96  ? 40  VAL G N    1 
ATOM   8950  C  CA   . VAL D  2 40  ? 122.304 175.348 94.389  1.00 33.96  ? 40  VAL G CA   1 
ATOM   8951  C  C    . VAL D  2 40  ? 121.105 174.988 95.251  1.00 33.96  ? 40  VAL G C    1 
ATOM   8952  O  O    . VAL D  2 40  ? 120.395 174.019 94.961  1.00 33.96  ? 40  VAL G O    1 
ATOM   8953  C  CB   . VAL D  2 40  ? 121.848 175.839 93.004  1.00 33.96  ? 40  VAL G CB   1 
ATOM   8954  C  CG1  . VAL D  2 40  ? 120.958 177.037 93.138  1.00 33.96  ? 40  VAL G CG1  1 
ATOM   8955  C  CG2  . VAL D  2 40  ? 123.042 176.184 92.160  1.00 33.96  ? 40  VAL G CG2  1 
ATOM   8956  H  H    . VAL D  2 40  ? 122.739 173.454 94.149  1.00 33.96  ? 40  VAL G H    1 
ATOM   8957  H  HA   . VAL D  2 40  ? 122.782 176.065 94.818  1.00 33.96  ? 40  VAL G HA   1 
ATOM   8958  H  HB   . VAL D  2 40  ? 121.354 175.134 92.569  1.00 33.96  ? 40  VAL G HB   1 
ATOM   8959  H  HG11 . VAL D  2 40  ? 120.744 177.363 92.250  1.00 33.96  ? 40  VAL G HG11 1 
ATOM   8960  H  HG12 . VAL D  2 40  ? 120.151 176.776 93.602  1.00 33.96  ? 40  VAL G HG12 1 
ATOM   8961  H  HG13 . VAL D  2 40  ? 121.430 177.718 93.637  1.00 33.96  ? 40  VAL G HG13 1 
ATOM   8962  H  HG21 . VAL D  2 40  ? 122.739 176.619 91.349  1.00 33.96  ? 40  VAL G HG21 1 
ATOM   8963  H  HG22 . VAL D  2 40  ? 123.610 176.784 92.661  1.00 33.96  ? 40  VAL G HG22 1 
ATOM   8964  H  HG23 . VAL D  2 40  ? 123.520 175.372 91.948  1.00 33.96  ? 40  VAL G HG23 1 
ATOM   8965  N  N    . GLU D  2 41  ? 120.873 175.769 96.300  1.00 40.80  ? 41  GLU G N    1 
ATOM   8966  C  CA   . GLU D  2 41  ? 119.667 175.664 97.114  1.00 40.80  ? 41  GLU G CA   1 
ATOM   8967  C  C    . GLU D  2 41  ? 119.054 177.049 97.225  1.00 40.80  ? 41  GLU G C    1 
ATOM   8968  O  O    . GLU D  2 41  ? 119.713 177.977 97.696  1.00 40.80  ? 41  GLU G O    1 
ATOM   8969  C  CB   . GLU D  2 41  ? 119.968 175.114 98.507  1.00 40.80  ? 41  GLU G CB   1 
ATOM   8970  C  CG   . GLU D  2 41  ? 120.138 173.614 98.572  1.00 40.80  ? 41  GLU G CG   1 
ATOM   8971  C  CD   . GLU D  2 41  ? 120.351 173.123 99.986  1.00 40.80  ? 41  GLU G CD   1 
ATOM   8972  O  OE1  . GLU D  2 41  ? 121.465 172.657 100.302 1.00 40.80  ? 41  GLU G OE1  1 
ATOM   8973  O  OE2  . GLU D  2 41  ? 119.396 173.218 100.782 1.00 40.80  ? 41  GLU G OE2  1 
ATOM   8974  H  H    . GLU D  2 41  ? 121.407 176.383 96.561  1.00 40.80  ? 41  GLU G H    1 
ATOM   8975  H  HA   . GLU D  2 41  ? 119.034 175.081 96.677  1.00 40.80  ? 41  GLU G HA   1 
ATOM   8976  H  HB2  . GLU D  2 41  ? 120.781 175.525 98.828  1.00 40.80  ? 41  GLU G HB2  1 
ATOM   8977  H  HB3  . GLU D  2 41  ? 119.229 175.347 99.088  1.00 40.80  ? 41  GLU G HB3  1 
ATOM   8978  H  HG2  . GLU D  2 41  ? 119.373 173.172 98.181  1.00 40.80  ? 41  GLU G HG2  1 
ATOM   8979  H  HG3  . GLU D  2 41  ? 120.944 173.386 98.077  1.00 40.80  ? 41  GLU G HG3  1 
ATOM   8980  N  N    . LEU D  2 42  ? 117.803 177.189 96.811  1.00 46.55  ? 42  LEU G N    1 
ATOM   8981  C  CA   . LEU D  2 42  ? 117.103 178.463 96.853  1.00 46.55  ? 42  LEU G CA   1 
ATOM   8982  C  C    . LEU D  2 42  ? 115.912 178.375 97.794  1.00 46.55  ? 42  LEU G C    1 
ATOM   8983  O  O    . LEU D  2 42  ? 115.318 177.308 97.970  1.00 46.55  ? 42  LEU G O    1 
ATOM   8984  C  CB   . LEU D  2 42  ? 116.627 178.873 95.467  1.00 46.55  ? 42  LEU G CB   1 
ATOM   8985  C  CG   . LEU D  2 42  ? 117.613 178.664 94.327  1.00 46.55  ? 42  LEU G CG   1 
ATOM   8986  C  CD1  . LEU D  2 42  ? 117.018 179.160 93.046  1.00 46.55  ? 42  LEU G CD1  1 
ATOM   8987  C  CD2  . LEU D  2 42  ? 118.903 179.384 94.593  1.00 46.55  ? 42  LEU G CD2  1 
ATOM   8988  H  H    . LEU D  2 42  ? 117.324 176.551 96.498  1.00 46.55  ? 42  LEU G H    1 
ATOM   8989  H  HA   . LEU D  2 42  ? 117.705 179.145 97.178  1.00 46.55  ? 42  LEU G HA   1 
ATOM   8990  H  HB2  . LEU D  2 42  ? 115.833 178.362 95.264  1.00 46.55  ? 42  LEU G HB2  1 
ATOM   8991  H  HB3  . LEU D  2 42  ? 116.413 179.816 95.488  1.00 46.55  ? 42  LEU G HB3  1 
ATOM   8992  H  HG   . LEU D  2 42  ? 117.808 177.724 94.240  1.00 46.55  ? 42  LEU G HG   1 
ATOM   8993  H  HD11 . LEU D  2 42  ? 117.665 179.043 92.336  1.00 46.55  ? 42  LEU G HD11 1 
ATOM   8994  H  HD12 . LEU D  2 42  ? 116.218 178.649 92.857  1.00 46.55  ? 42  LEU G HD12 1 
ATOM   8995  H  HD13 . LEU D  2 42  ? 116.801 180.095 93.148  1.00 46.55  ? 42  LEU G HD13 1 
ATOM   8996  H  HD21 . LEU D  2 42  ? 119.511 179.209 93.862  1.00 46.55  ? 42  LEU G HD21 1 
ATOM   8997  H  HD22 . LEU D  2 42  ? 118.721 180.331 94.647  1.00 46.55  ? 42  LEU G HD22 1 
ATOM   8998  H  HD23 . LEU D  2 42  ? 119.278 179.061 95.426  1.00 46.55  ? 42  LEU G HD23 1 
ATOM   8999  N  N    . GLY D  2 43  ? 115.565 179.503 98.400  1.00 63.08  ? 43  GLY G N    1 
ATOM   9000  C  CA   . GLY D  2 43  ? 114.408 179.507 99.276  1.00 63.08  ? 43  GLY G CA   1 
ATOM   9001  C  C    . GLY D  2 43  ? 114.141 180.877 99.850  1.00 63.08  ? 43  GLY G C    1 
ATOM   9002  O  O    . GLY D  2 43  ? 114.746 181.870 99.450  1.00 63.08  ? 43  GLY G O    1 
ATOM   9003  H  H    . GLY D  2 43  ? 115.964 180.261 98.321  1.00 63.08  ? 43  GLY G H    1 
ATOM   9004  H  HA2  . GLY D  2 43  ? 113.626 179.225 98.781  1.00 63.08  ? 43  GLY G HA2  1 
ATOM   9005  H  HA3  . GLY D  2 43  ? 114.554 178.894 100.010 1.00 63.08  ? 43  GLY G HA3  1 
ATOM   9006  N  N    . CYS D  2 44  ? 113.199 180.909 100.791 1.00 80.91  ? 44  CYS G N    1 
ATOM   9007  C  CA   . CYS D  2 44  ? 112.870 182.103 101.558 1.00 80.91  ? 44  CYS G CA   1 
ATOM   9008  C  C    . CYS D  2 44  ? 112.889 181.744 103.034 1.00 80.91  ? 44  CYS G C    1 
ATOM   9009  O  O    . CYS D  2 44  ? 112.252 180.769 103.445 1.00 80.91  ? 44  CYS G O    1 
ATOM   9010  C  CB   . CYS D  2 44  ? 111.503 182.668 101.152 1.00 80.91  ? 44  CYS G CB   1 
ATOM   9011  S  SG   . CYS D  2 44  ? 110.058 181.791 101.809 1.00 80.91  ? 44  CYS G SG   1 
ATOM   9012  H  H    . CYS D  2 44  ? 112.721 180.228 101.006 1.00 80.91  ? 44  CYS G H    1 
ATOM   9013  H  HA   . CYS D  2 44  ? 113.541 182.786 101.403 1.00 80.91  ? 44  CYS G HA   1 
ATOM   9014  H  HB2  . CYS D  2 44  ? 111.451 183.591 101.445 1.00 80.91  ? 44  CYS G HB2  1 
ATOM   9015  H  HB3  . CYS D  2 44  ? 111.442 182.629 100.188 1.00 80.91  ? 44  CYS G HB3  1 
ATOM   9016  N  N    . ALA D  2 45  ? 113.622 182.521 103.828 1.00 89.72  ? 45  ALA G N    1 
ATOM   9017  C  CA   . ALA D  2 45  ? 113.795 182.218 105.242 1.00 89.72  ? 45  ALA G CA   1 
ATOM   9018  C  C    . ALA D  2 45  ? 113.548 183.457 106.090 1.00 89.72  ? 45  ALA G C    1 
ATOM   9019  O  O    . ALA D  2 45  ? 113.602 184.592 105.609 1.00 89.72  ? 45  ALA G O    1 
ATOM   9020  C  CB   . ALA D  2 45  ? 115.192 181.664 105.534 1.00 89.72  ? 45  ALA G CB   1 
ATOM   9021  H  H    . ALA D  2 45  ? 114.037 183.224 103.567 1.00 89.72  ? 45  ALA G H    1 
ATOM   9022  H  HA   . ALA D  2 45  ? 113.148 181.541 105.499 1.00 89.72  ? 45  ALA G HA   1 
ATOM   9023  H  HB1  . ALA D  2 45  ? 115.257 181.463 106.481 1.00 89.72  ? 45  ALA G HB1  1 
ATOM   9024  H  HB2  . ALA D  2 45  ? 115.323 180.856 105.014 1.00 89.72  ? 45  ALA G HB2  1 
ATOM   9025  H  HB3  . ALA D  2 45  ? 115.850 182.330 105.291 1.00 89.72  ? 45  ALA G HB3  1 
ATOM   9026  N  N    . ALA D  2 46  ? 113.267 183.213 107.374 1.00 96.36  ? 46  ALA G N    1 
ATOM   9027  C  CA   . ALA D  2 46  ? 113.004 184.298 108.312 1.00 96.36  ? 46  ALA G CA   1 
ATOM   9028  C  C    . ALA D  2 46  ? 114.136 185.314 108.289 1.00 96.36  ? 46  ALA G C    1 
ATOM   9029  O  O    . ALA D  2 46  ? 113.947 186.478 107.921 1.00 96.36  ? 46  ALA G O    1 
ATOM   9030  C  CB   . ALA D  2 46  ? 112.820 183.728 109.718 1.00 96.36  ? 46  ALA G CB   1 
ATOM   9031  H  H    . ALA D  2 46  ? 113.217 182.426 107.722 1.00 96.36  ? 46  ALA G H    1 
ATOM   9032  H  HA   . ALA D  2 46  ? 112.183 184.745 108.057 1.00 96.36  ? 46  ALA G HA   1 
ATOM   9033  H  HB1  . ALA D  2 46  ? 112.603 184.450 110.327 1.00 96.36  ? 46  ALA G HB1  1 
ATOM   9034  H  HB2  . ALA D  2 46  ? 112.104 183.074 109.709 1.00 96.36  ? 46  ALA G HB2  1 
ATOM   9035  H  HB3  . ALA D  2 46  ? 113.648 183.303 109.991 1.00 96.36  ? 46  ALA G HB3  1 
ATOM   9036  N  N    . THR D  2 47  ? 115.327 184.878 108.680 1.00 97.56  ? 47  THR G N    1 
ATOM   9037  C  CA   . THR D  2 47  ? 116.556 185.608 108.423 1.00 97.56  ? 47  THR G CA   1 
ATOM   9038  C  C    . THR D  2 47  ? 117.569 184.642 107.834 1.00 97.56  ? 47  THR G C    1 
ATOM   9039  O  O    . THR D  2 47  ? 117.604 183.461 108.191 1.00 97.56  ? 47  THR G O    1 
ATOM   9040  C  CB   . THR D  2 47  ? 117.123 186.265 109.683 1.00 97.56  ? 47  THR G CB   1 
ATOM   9041  O  OG1  . THR D  2 47  ? 118.341 186.944 109.355 1.00 97.56  ? 47  THR G OG1  1 
ATOM   9042  C  CG2  . THR D  2 47  ? 117.394 185.227 110.752 1.00 97.56  ? 47  THR G CG2  1 
ATOM   9043  H  H    . THR D  2 47  ? 115.448 184.143 109.110 1.00 97.56  ? 47  THR G H    1 
ATOM   9044  H  HA   . THR D  2 47  ? 116.374 186.299 107.778 1.00 97.56  ? 47  THR G HA   1 
ATOM   9045  H  HB   . THR D  2 47  ? 116.479 186.904 110.025 1.00 97.56  ? 47  THR G HB   1 
ATOM   9046  H  HG1  . THR D  2 47  ? 118.596 187.410 110.004 1.00 97.56  ? 47  THR G HG1  1 
ATOM   9047  H  HG21 . THR D  2 47  ? 117.663 185.667 111.572 1.00 97.56  ? 47  THR G HG21 1 
ATOM   9048  H  HG22 . THR D  2 47  ? 116.596 184.703 110.920 1.00 97.56  ? 47  THR G HG22 1 
ATOM   9049  H  HG23 . THR D  2 47  ? 118.106 184.634 110.466 1.00 97.56  ? 47  THR G HG23 1 
ATOM   9050  N  N    . CYS D  2 48  ? 118.394 185.153 106.930 1.00 91.70  ? 48  CYS G N    1 
ATOM   9051  C  CA   . CYS D  2 48  ? 119.221 184.272 106.124 1.00 91.70  ? 48  CYS G CA   1 
ATOM   9052  C  C    . CYS D  2 48  ? 120.147 183.458 107.026 1.00 91.70  ? 48  CYS G C    1 
ATOM   9053  O  O    . CYS D  2 48  ? 120.695 183.990 107.999 1.00 91.70  ? 48  CYS G O    1 
ATOM   9054  C  CB   . CYS D  2 48  ? 120.013 185.083 105.099 1.00 91.70  ? 48  CYS G CB   1 
ATOM   9055  S  SG   . CYS D  2 48  ? 119.005 185.476 103.645 1.00 91.70  ? 48  CYS G SG   1 
ATOM   9056  H  H    . CYS D  2 48  ? 118.494 185.990 106.772 1.00 91.70  ? 48  CYS G H    1 
ATOM   9057  H  HA   . CYS D  2 48  ? 118.642 183.662 105.642 1.00 91.70  ? 48  CYS G HA   1 
ATOM   9058  H  HB2  . CYS D  2 48  ? 120.304 185.913 105.504 1.00 91.70  ? 48  CYS G HB2  1 
ATOM   9059  H  HB3  . CYS D  2 48  ? 120.780 184.567 104.807 1.00 91.70  ? 48  CYS G HB3  1 
ATOM   9060  N  N    . PRO D  2 49  ? 120.341 182.168 106.738 1.00 81.60  ? 49  PRO G N    1 
ATOM   9061  C  CA   . PRO D  2 49  ? 120.900 181.259 107.746 1.00 81.60  ? 49  PRO G CA   1 
ATOM   9062  C  C    . PRO D  2 49  ? 122.416 181.286 107.843 1.00 81.60  ? 49  PRO G C    1 
ATOM   9063  O  O    . PRO D  2 49  ? 123.089 182.087 107.186 1.00 81.60  ? 49  PRO G O    1 
ATOM   9064  C  CB   . PRO D  2 49  ? 120.397 179.889 107.278 1.00 81.60  ? 49  PRO G CB   1 
ATOM   9065  C  CG   . PRO D  2 49  ? 120.311 180.018 105.791 1.00 81.60  ? 49  PRO G CG   1 
ATOM   9066  C  CD   . PRO D  2 49  ? 120.102 181.479 105.459 1.00 81.60  ? 49  PRO G CD   1 
ATOM   9067  H  HA   . PRO D  2 49  ? 120.523 181.457 108.617 1.00 81.60  ? 49  PRO G HA   1 
ATOM   9068  H  HB2  . PRO D  2 49  ? 121.030 179.198 107.529 1.00 81.60  ? 49  PRO G HB2  1 
ATOM   9069  H  HB3  . PRO D  2 49  ? 119.526 179.711 107.662 1.00 81.60  ? 49  PRO G HB3  1 
ATOM   9070  H  HG2  . PRO D  2 49  ? 121.136 179.701 105.394 1.00 81.60  ? 49  PRO G HG2  1 
ATOM   9071  H  HG3  . PRO D  2 49  ? 119.561 179.493 105.471 1.00 81.60  ? 49  PRO G HG3  1 
ATOM   9072  H  HD2  . PRO D  2 49  ? 120.749 181.772 104.800 1.00 81.60  ? 49  PRO G HD2  1 
ATOM   9073  H  HD3  . PRO D  2 49  ? 119.194 181.625 105.158 1.00 81.60  ? 49  PRO G HD3  1 
ATOM   9074  N  N    . SER D  2 50  ? 122.956 180.396 108.672 1.00 72.46  ? 50  SER G N    1 
ATOM   9075  C  CA   . SER D  2 50  ? 124.384 180.384 108.945 1.00 72.46  ? 50  SER G CA   1 
ATOM   9076  C  C    . SER D  2 50  ? 125.155 179.844 107.749 1.00 72.46  ? 50  SER G C    1 
ATOM   9077  O  O    . SER D  2 50  ? 124.710 178.918 107.066 1.00 72.46  ? 50  SER G O    1 
ATOM   9078  C  CB   . SER D  2 50  ? 124.676 179.537 110.181 1.00 72.46  ? 50  SER G CB   1 
ATOM   9079  O  OG   . SER D  2 50  ? 126.055 179.560 110.500 1.00 72.46  ? 50  SER G OG   1 
ATOM   9080  H  H    . SER D  2 50  ? 122.516 179.780 109.083 1.00 72.46  ? 50  SER G H    1 
ATOM   9081  H  HA   . SER D  2 50  ? 124.686 181.290 109.114 1.00 72.46  ? 50  SER G HA   1 
ATOM   9082  H  HB2  . SER D  2 50  ? 124.171 179.884 110.931 1.00 72.46  ? 50  SER G HB2  1 
ATOM   9083  H  HB3  . SER D  2 50  ? 124.410 178.622 109.999 1.00 72.46  ? 50  SER G HB3  1 
ATOM   9084  H  HG   . SER D  2 50  ? 126.208 179.038 111.141 1.00 72.46  ? 50  SER G HG   1 
ATOM   9085  N  N    . LYS D  2 51  ? 126.322 180.430 107.504 1.00 54.14  ? 51  LYS G N    1 
ATOM   9086  C  CA   . LYS D  2 51  ? 127.206 180.012 106.424 1.00 54.14  ? 51  LYS G CA   1 
ATOM   9087  C  C    . LYS D  2 51  ? 128.295 179.124 107.011 1.00 54.14  ? 51  LYS G C    1 
ATOM   9088  O  O    . LYS D  2 51  ? 129.160 179.596 107.755 1.00 54.14  ? 51  LYS G O    1 
ATOM   9089  C  CB   . LYS D  2 51  ? 127.801 181.228 105.717 1.00 54.14  ? 51  LYS G CB   1 
ATOM   9090  C  CG   . LYS D  2 51  ? 129.231 181.054 105.247 1.00 54.14  ? 51  LYS G CG   1 
ATOM   9091  C  CD   . LYS D  2 51  ? 129.603 182.132 104.251 1.00 54.14  ? 51  LYS G CD   1 
ATOM   9092  C  CE   . LYS D  2 51  ? 131.020 181.951 103.732 1.00 54.14  ? 51  LYS G CE   1 
ATOM   9093  N  NZ   . LYS D  2 51  ? 131.274 182.785 102.531 1.00 54.14  ? 51  LYS G NZ   1 
ATOM   9094  H  H    . LYS D  2 51  ? 126.626 181.093 107.955 1.00 54.14  ? 51  LYS G H    1 
ATOM   9095  H  HA   . LYS D  2 51  ? 126.707 179.495 105.777 1.00 54.14  ? 51  LYS G HA   1 
ATOM   9096  H  HB2  . LYS D  2 51  ? 127.263 181.424 104.935 1.00 54.14  ? 51  LYS G HB2  1 
ATOM   9097  H  HB3  . LYS D  2 51  ? 127.783 181.982 106.325 1.00 54.14  ? 51  LYS G HB3  1 
ATOM   9098  H  HG2  . LYS D  2 51  ? 129.834 181.118 106.002 1.00 54.14  ? 51  LYS G HG2  1 
ATOM   9099  H  HG3  . LYS D  2 51  ? 129.327 180.194 104.812 1.00 54.14  ? 51  LYS G HG3  1 
ATOM   9100  H  HD2  . LYS D  2 51  ? 128.997 182.090 103.498 1.00 54.14  ? 51  LYS G HD2  1 
ATOM   9101  H  HD3  . LYS D  2 51  ? 129.543 182.998 104.681 1.00 54.14  ? 51  LYS G HD3  1 
ATOM   9102  H  HE2  . LYS D  2 51  ? 131.648 182.215 104.420 1.00 54.14  ? 51  LYS G HE2  1 
ATOM   9103  H  HE3  . LYS D  2 51  ? 131.162 181.022 103.494 1.00 54.14  ? 51  LYS G HE3  1 
ATOM   9104  H  HZ1  . LYS D  2 51  ? 132.063 182.577 102.178 1.00 54.14  ? 51  LYS G HZ1  1 
ATOM   9105  H  HZ2  . LYS D  2 51  ? 130.638 182.643 101.924 1.00 54.14  ? 51  LYS G HZ2  1 
ATOM   9106  H  HZ3  . LYS D  2 51  ? 131.269 183.644 102.754 1.00 54.14  ? 51  LYS G HZ3  1 
ATOM   9107  N  N    . LYS D  2 52  ? 128.244 177.837 106.681 1.00 49.80  ? 52  LYS G N    1 
ATOM   9108  C  CA   . LYS D  2 52  ? 129.297 176.919 107.056 1.00 49.80  ? 52  LYS G CA   1 
ATOM   9109  C  C    . LYS D  2 52  ? 130.589 177.312 106.345 1.00 49.80  ? 52  LYS G C    1 
ATOM   9110  O  O    . LYS D  2 52  ? 130.584 178.145 105.438 1.00 49.80  ? 52  LYS G O    1 
ATOM   9111  C  CB   . LYS D  2 52  ? 128.898 175.489 106.708 1.00 49.80  ? 52  LYS G CB   1 
ATOM   9112  C  CG   . LYS D  2 52  ? 127.804 174.925 107.579 1.00 49.80  ? 52  LYS G CG   1 
ATOM   9113  C  CD   . LYS D  2 52  ? 127.714 173.424 107.421 1.00 49.80  ? 52  LYS G CD   1 
ATOM   9114  C  CE   . LYS D  2 52  ? 126.656 172.823 108.319 1.00 49.80  ? 52  LYS G CE   1 
ATOM   9115  N  NZ   . LYS D  2 52  ? 125.400 172.575 107.563 1.00 49.80  ? 52  LYS G NZ   1 
ATOM   9116  H  H    . LYS D  2 52  ? 127.599 177.472 106.247 1.00 49.80  ? 52  LYS G H    1 
ATOM   9117  H  HA   . LYS D  2 52  ? 129.441 176.970 108.012 1.00 49.80  ? 52  LYS G HA   1 
ATOM   9118  H  HB2  . LYS D  2 52  ? 128.582 175.470 105.792 1.00 49.80  ? 52  LYS G HB2  1 
ATOM   9119  H  HB3  . LYS D  2 52  ? 129.666 174.909 106.798 1.00 49.80  ? 52  LYS G HB3  1 
ATOM   9120  H  HG2  . LYS D  2 52  ? 128.003 175.124 108.505 1.00 49.80  ? 52  LYS G HG2  1 
ATOM   9121  H  HG3  . LYS D  2 52  ? 126.956 175.312 107.317 1.00 49.80  ? 52  LYS G HG3  1 
ATOM   9122  H  HD2  . LYS D  2 52  ? 127.487 173.211 106.507 1.00 49.80  ? 52  LYS G HD2  1 
ATOM   9123  H  HD3  . LYS D  2 52  ? 128.570 173.032 107.652 1.00 49.80  ? 52  LYS G HD3  1 
ATOM   9124  H  HE2  . LYS D  2 52  ? 126.976 171.973 108.659 1.00 49.80  ? 52  LYS G HE2  1 
ATOM   9125  H  HE3  . LYS D  2 52  ? 126.466 173.429 109.049 1.00 49.80  ? 52  LYS G HE3  1 
ATOM   9126  H  HZ1  . LYS D  2 52  ? 124.698 172.796 108.059 1.00 49.80  ? 52  LYS G HZ1  1 
ATOM   9127  H  HZ2  . LYS D  2 52  ? 125.394 173.064 106.819 1.00 49.80  ? 52  LYS G HZ2  1 
ATOM   9128  H  HZ3  . LYS D  2 52  ? 125.342 171.715 107.340 1.00 49.80  ? 52  LYS G HZ3  1 
ATOM   9129  N  N    . PRO D  2 53  ? 131.722 176.730 106.746 1.00 47.46  ? 53  PRO G N    1 
ATOM   9130  C  CA   . PRO D  2 53  ? 132.988 177.105 106.099 1.00 47.46  ? 53  PRO G CA   1 
ATOM   9131  C  C    . PRO D  2 53  ? 132.985 176.881 104.601 1.00 47.46  ? 53  PRO G C    1 
ATOM   9132  O  O    . PRO D  2 53  ? 133.554 177.686 103.854 1.00 47.46  ? 53  PRO G O    1 
ATOM   9133  C  CB   . PRO D  2 53  ? 134.016 176.207 106.801 1.00 47.46  ? 53  PRO G CB   1 
ATOM   9134  C  CG   . PRO D  2 53  ? 133.374 175.804 108.080 1.00 47.46  ? 53  PRO G CG   1 
ATOM   9135  C  CD   . PRO D  2 53  ? 131.916 175.720 107.797 1.00 47.46  ? 53  PRO G CD   1 
ATOM   9136  H  HA   . PRO D  2 53  ? 133.195 178.034 106.280 1.00 47.46  ? 53  PRO G HA   1 
ATOM   9137  H  HB2  . PRO D  2 53  ? 134.189 175.431 106.248 1.00 47.46  ? 53  PRO G HB2  1 
ATOM   9138  H  HB3  . PRO D  2 53  ? 134.832 176.704 106.961 1.00 47.46  ? 53  PRO G HB3  1 
ATOM   9139  H  HG2  . PRO D  2 53  ? 133.715 174.935 108.347 1.00 47.46  ? 53  PRO G HG2  1 
ATOM   9140  H  HG3  . PRO D  2 53  ? 133.553 176.467 108.761 1.00 47.46  ? 53  PRO G HG3  1 
ATOM   9141  H  HD2  . PRO D  2 53  ? 131.695 174.839 107.459 1.00 47.46  ? 53  PRO G HD2  1 
ATOM   9142  H  HD3  . PRO D  2 53  ? 131.398 175.936 108.584 1.00 47.46  ? 53  PRO G HD3  1 
ATOM   9143  N  N    . TYR D  2 54  ? 132.354 175.804 104.141 1.00 40.10  ? 54  TYR G N    1 
ATOM   9144  C  CA   . TYR D  2 54  ? 132.376 175.423 102.737 1.00 40.10  ? 54  TYR G CA   1 
ATOM   9145  C  C    . TYR D  2 54  ? 131.170 175.927 101.957 1.00 40.10  ? 54  TYR G C    1 
ATOM   9146  O  O    . TYR D  2 54  ? 131.061 175.635 100.763 1.00 40.10  ? 54  TYR G O    1 
ATOM   9147  C  CB   . TYR D  2 54  ? 132.475 173.897 102.612 1.00 40.10  ? 54  TYR G CB   1 
ATOM   9148  C  CG   . TYR D  2 54  ? 131.421 173.113 103.361 1.00 40.10  ? 54  TYR G CG   1 
ATOM   9149  C  CD1  . TYR D  2 54  ? 130.152 172.939 102.836 1.00 40.10  ? 54  TYR G CD1  1 
ATOM   9150  C  CD2  . TYR D  2 54  ? 131.708 172.521 104.580 1.00 40.10  ? 54  TYR G CD2  1 
ATOM   9151  C  CE1  . TYR D  2 54  ? 129.191 172.216 103.512 1.00 40.10  ? 54  TYR G CE1  1 
ATOM   9152  C  CE2  . TYR D  2 54  ? 130.753 171.795 105.264 1.00 40.10  ? 54  TYR G CE2  1 
ATOM   9153  C  CZ   . TYR D  2 54  ? 129.496 171.646 104.723 1.00 40.10  ? 54  TYR G CZ   1 
ATOM   9154  O  OH   . TYR D  2 54  ? 128.541 170.923 105.397 1.00 40.10  ? 54  TYR G OH   1 
ATOM   9155  H  H    . TYR D  2 54  ? 131.896 175.272 104.636 1.00 40.10  ? 54  TYR G H    1 
ATOM   9156  H  HA   . TYR D  2 54  ? 133.168 175.802 102.328 1.00 40.10  ? 54  TYR G HA   1 
ATOM   9157  H  HB2  . TYR D  2 54  ? 132.405 173.658 101.678 1.00 40.10  ? 54  TYR G HB2  1 
ATOM   9158  H  HB3  . TYR D  2 54  ? 133.334 173.620 102.962 1.00 40.10  ? 54  TYR G HB3  1 
ATOM   9159  H  HD1  . TYR D  2 54  ? 129.940 173.327 102.019 1.00 40.10  ? 54  TYR G HD1  1 
ATOM   9160  H  HD2  . TYR D  2 54  ? 132.553 172.620 104.947 1.00 40.10  ? 54  TYR G HD2  1 
ATOM   9161  H  HE1  . TYR D  2 54  ? 128.342 172.111 103.150 1.00 40.10  ? 54  TYR G HE1  1 
ATOM   9162  H  HE2  . TYR D  2 54  ? 130.956 171.406 106.081 1.00 40.10  ? 54  TYR G HE2  1 
ATOM   9163  H  HH   . TYR D  2 54  ? 128.913 170.376 105.918 1.00 40.10  ? 54  TYR G HH   1 
ATOM   9164  N  N    . GLU D  2 55  ? 130.273 176.679 102.590 1.00 47.57  ? 55  GLU G N    1 
ATOM   9165  C  CA   . GLU D  2 55  ? 129.056 177.158 101.954 1.00 47.57  ? 55  GLU G CA   1 
ATOM   9166  C  C    . GLU D  2 55  ? 129.127 178.662 101.733 1.00 47.57  ? 55  GLU G C    1 
ATOM   9167  O  O    . GLU D  2 55  ? 129.697 179.395 102.544 1.00 47.57  ? 55  GLU G O    1 
ATOM   9168  C  CB   . GLU D  2 55  ? 127.837 176.810 102.806 1.00 47.57  ? 55  GLU G CB   1 
ATOM   9169  C  CG   . GLU D  2 55  ? 127.384 175.380 102.615 1.00 47.57  ? 55  GLU G CG   1 
ATOM   9170  C  CD   . GLU D  2 55  ? 126.500 174.877 103.730 1.00 47.57  ? 55  GLU G CD   1 
ATOM   9171  O  OE1  . GLU D  2 55  ? 125.364 175.358 103.868 1.00 47.57  ? 55  GLU G OE1  1 
ATOM   9172  O  OE2  . GLU D  2 55  ? 126.942 173.978 104.466 1.00 47.57  ? 55  GLU G OE2  1 
ATOM   9173  H  H    . GLU D  2 55  ? 130.347 176.921 103.409 1.00 47.57  ? 55  GLU G H    1 
ATOM   9174  H  HA   . GLU D  2 55  ? 128.949 176.732 101.093 1.00 47.57  ? 55  GLU G HA   1 
ATOM   9175  H  HB2  . GLU D  2 55  ? 128.049 176.944 103.739 1.00 47.57  ? 55  GLU G HB2  1 
ATOM   9176  H  HB3  . GLU D  2 55  ? 127.105 177.391 102.546 1.00 47.57  ? 55  GLU G HB3  1 
ATOM   9177  H  HG2  . GLU D  2 55  ? 126.885 175.322 101.790 1.00 47.57  ? 55  GLU G HG2  1 
ATOM   9178  H  HG3  . GLU D  2 55  ? 128.168 174.812 102.571 1.00 47.57  ? 55  GLU G HG3  1 
ATOM   9179  N  N    . GLU D  2 56  ? 128.549 179.109 100.623 1.00 48.80  ? 56  GLU G N    1 
ATOM   9180  C  CA   . GLU D  2 56  ? 128.449 180.519 100.281 1.00 48.80  ? 56  GLU G CA   1 
ATOM   9181  C  C    . GLU D  2 56  ? 126.983 180.907 100.194 1.00 48.80  ? 56  GLU G C    1 
ATOM   9182  O  O    . GLU D  2 56  ? 126.155 180.132 99.711  1.00 48.80  ? 56  GLU G O    1 
ATOM   9183  C  CB   . GLU D  2 56  ? 129.138 180.819 98.955  1.00 48.80  ? 56  GLU G CB   1 
ATOM   9184  C  CG   . GLU D  2 56  ? 130.617 180.515 98.960  1.00 48.80  ? 56  GLU G CG   1 
ATOM   9185  C  CD   . GLU D  2 56  ? 131.297 180.896 97.660  1.00 48.80  ? 56  GLU G CD   1 
ATOM   9186  O  OE1  . GLU D  2 56  ? 130.584 181.131 96.661  1.00 48.80  ? 56  GLU G OE1  1 
ATOM   9187  O  OE2  . GLU D  2 56  ? 132.544 180.963 97.636  1.00 48.80  ? 56  GLU G OE2  1 
ATOM   9188  H  H    . GLU D  2 56  ? 128.199 178.594 100.034 1.00 48.80  ? 56  GLU G H    1 
ATOM   9189  H  HA   . GLU D  2 56  ? 128.869 181.050 100.970 1.00 48.80  ? 56  GLU G HA   1 
ATOM   9190  H  HB2  . GLU D  2 56  ? 128.726 180.280 98.266  1.00 48.80  ? 56  GLU G HB2  1 
ATOM   9191  H  HB3  . GLU D  2 56  ? 129.022 181.758 98.748  1.00 48.80  ? 56  GLU G HB3  1 
ATOM   9192  H  HG2  . GLU D  2 56  ? 131.037 181.014 99.676  1.00 48.80  ? 56  GLU G HG2  1 
ATOM   9193  H  HG3  . GLU D  2 56  ? 130.739 179.563 99.101  1.00 48.80  ? 56  GLU G HG3  1 
ATOM   9194  N  N    . VAL D  2 57  ? 126.667 182.109 100.661 1.00 53.59  ? 57  VAL G N    1 
ATOM   9195  C  CA   . VAL D  2 57  ? 125.298 182.601 100.689 1.00 53.59  ? 57  VAL G CA   1 
ATOM   9196  C  C    . VAL D  2 57  ? 125.260 184.002 100.102 1.00 53.59  ? 57  VAL G C    1 
ATOM   9197  O  O    . VAL D  2 57  ? 126.167 184.810 100.330 1.00 53.59  ? 57  VAL G O    1 
ATOM   9198  C  CB   . VAL D  2 57  ? 124.716 182.595 102.115 1.00 53.59  ? 57  VAL G CB   1 
ATOM   9199  C  CG1  . VAL D  2 57  ? 123.280 183.070 102.095 1.00 53.59  ? 57  VAL G CG1  1 
ATOM   9200  C  CG2  . VAL D  2 57  ? 124.798 181.207 102.700 1.00 53.59  ? 57  VAL G CG2  1 
ATOM   9201  H  H    . VAL D  2 57  ? 127.239 182.671 100.962 1.00 53.59  ? 57  VAL G H    1 
ATOM   9202  H  HA   . VAL D  2 57  ? 124.743 182.031 100.139 1.00 53.59  ? 57  VAL G HA   1 
ATOM   9203  H  HB   . VAL D  2 57  ? 125.232 183.195 102.671 1.00 53.59  ? 57  VAL G HB   1 
ATOM   9204  H  HG11 . VAL D  2 57  ? 122.911 183.001 102.988 1.00 53.59  ? 57  VAL G HG11 1 
ATOM   9205  H  HG12 . VAL D  2 57  ? 123.252 183.989 101.793 1.00 53.59  ? 57  VAL G HG12 1 
ATOM   9206  H  HG13 . VAL D  2 57  ? 122.779 182.507 101.488 1.00 53.59  ? 57  VAL G HG13 1 
ATOM   9207  H  HG21 . VAL D  2 57  ? 124.475 181.227 103.611 1.00 53.59  ? 57  VAL G HG21 1 
ATOM   9208  H  HG22 . VAL D  2 57  ? 124.247 180.618 102.167 1.00 53.59  ? 57  VAL G HG22 1 
ATOM   9209  H  HG23 . VAL D  2 57  ? 125.719 180.908 102.679 1.00 53.59  ? 57  VAL G HG23 1 
ATOM   9210  N  N    . THR D  2 58  ? 124.204 184.282 99.344  1.00 60.00  ? 58  THR G N    1 
ATOM   9211  C  CA   . THR D  2 58  ? 123.959 185.592 98.748  1.00 60.00  ? 58  THR G CA   1 
ATOM   9212  C  C    . THR D  2 58  ? 122.511 185.940 99.071  1.00 60.00  ? 58  THR G C    1 
ATOM   9213  O  O    . THR D  2 58  ? 121.587 185.462 98.408  1.00 60.00  ? 58  THR G O    1 
ATOM   9214  C  CB   . THR D  2 58  ? 124.216 185.574 97.247  1.00 60.00  ? 58  THR G CB   1 
ATOM   9215  O  OG1  . THR D  2 58  ? 125.559 185.141 96.999  1.00 60.00  ? 58  THR G OG1  1 
ATOM   9216  C  CG2  . THR D  2 58  ? 124.029 186.952 96.660  1.00 60.00  ? 58  THR G CG2  1 
ATOM   9217  H  H    . THR D  2 58  ? 123.591 183.709 99.161  1.00 60.00  ? 58  THR G H    1 
ATOM   9218  H  HA   . THR D  2 58  ? 124.540 186.250 99.154  1.00 60.00  ? 58  THR G HA   1 
ATOM   9219  H  HB   . THR D  2 58  ? 123.590 184.969 96.820  1.00 60.00  ? 58  THR G HB   1 
ATOM   9220  H  HG1  . THR D  2 58  ? 125.727 185.198 96.180  1.00 60.00  ? 58  THR G HG1  1 
ATOM   9221  H  HG21 . THR D  2 58  ? 124.202 186.923 95.706  1.00 60.00  ? 58  THR G HG21 1 
ATOM   9222  H  HG22 . THR D  2 58  ? 123.125 187.270 96.815  1.00 60.00  ? 58  THR G HG22 1 
ATOM   9223  H  HG23 . THR D  2 58  ? 124.656 187.563 97.076  1.00 60.00  ? 58  THR G HG23 1 
ATOM   9224  N  N    . CYS D  2 59  ? 122.320 186.770 100.090 1.00 78.74  ? 59  CYS G N    1 
ATOM   9225  C  CA   . CYS D  2 59  ? 121.012 187.008 100.679 1.00 78.74  ? 59  CYS G CA   1 
ATOM   9226  C  C    . CYS D  2 59  ? 120.454 188.334 100.185 1.00 78.74  ? 59  CYS G C    1 
ATOM   9227  O  O    . CYS D  2 59  ? 121.149 189.354 100.210 1.00 78.74  ? 59  CYS G O    1 
ATOM   9228  C  CB   . CYS D  2 59  ? 121.115 187.005 102.204 1.00 78.74  ? 59  CYS G CB   1 
ATOM   9229  S  SG   . CYS D  2 59  ? 119.588 187.333 103.072 1.00 78.74  ? 59  CYS G SG   1 
ATOM   9230  H  H    . CYS D  2 59  ? 122.952 187.216 100.466 1.00 78.74  ? 59  CYS G H    1 
ATOM   9231  H  HA   . CYS D  2 59  ? 120.405 186.302 100.411 1.00 78.74  ? 59  CYS G HA   1 
ATOM   9232  H  HB2  . CYS D  2 59  ? 121.421 186.129 102.483 1.00 78.74  ? 59  CYS G HB2  1 
ATOM   9233  H  HB3  . CYS D  2 59  ? 121.761 187.675 102.471 1.00 78.74  ? 59  CYS G HB3  1 
ATOM   9234  N  N    . CYS D  2 60  ? 119.203 188.309 99.741  1.00 93.42  ? 60  CYS G N    1 
ATOM   9235  C  CA   . CYS D  2 60  ? 118.498 189.470 99.217  1.00 93.42  ? 60  CYS G CA   1 
ATOM   9236  C  C    . CYS D  2 60  ? 117.253 189.728 100.050 1.00 93.42  ? 60  CYS G C    1 
ATOM   9237  O  O    . CYS D  2 60  ? 116.955 189.020 101.011 1.00 93.42  ? 60  CYS G O    1 
ATOM   9238  C  CB   . CYS D  2 60  ? 118.099 189.264 97.757  1.00 93.42  ? 60  CYS G CB   1 
ATOM   9239  S  SG   . CYS D  2 60  ? 119.431 189.367 96.558  1.00 93.42  ? 60  CYS G SG   1 
ATOM   9240  H  H    . CYS D  2 60  ? 118.719 187.597 99.733  1.00 93.42  ? 60  CYS G H    1 
ATOM   9241  H  HA   . CYS D  2 60  ? 119.074 190.248 99.264  1.00 93.42  ? 60  CYS G HA   1 
ATOM   9242  H  HB2  . CYS D  2 60  ? 117.687 188.390 97.670  1.00 93.42  ? 60  CYS G HB2  1 
ATOM   9243  H  HB3  . CYS D  2 60  ? 117.455 189.948 97.515  1.00 93.42  ? 60  CYS G HB3  1 
ATOM   9244  N  N    . SER D  2 61  ? 116.530 190.816 99.749  1.00 99.09  ? 61  SER G N    1 
ATOM   9245  C  CA   . SER D  2 61  ? 115.247 191.165 100.424 1.00 99.09  ? 61  SER G CA   1 
ATOM   9246  C  C    . SER D  2 61  ? 114.240 191.647 99.376  1.00 99.09  ? 61  SER G C    1 
ATOM   9247  O  O    . SER D  2 61  ? 113.232 192.252 99.784  1.00 99.09  ? 61  SER G O    1 
ATOM   9248  C  CB   . SER D  2 61  ? 115.470 192.218 101.475 1.00 99.09  ? 61  SER G CB   1 
ATOM   9249  O  OG   . SER D  2 61  ? 116.762 192.100 102.051 1.00 99.09  ? 61  SER G OG   1 
ATOM   9250  H  H    . SER D  2 61  ? 116.827 191.490 99.207  1.00 99.09  ? 61  SER G H    1 
ATOM   9251  H  HA   . SER D  2 61  ? 114.879 190.350 100.855 1.00 99.09  ? 61  SER G HA   1 
ATOM   9252  H  HB2  . SER D  2 61  ? 115.374 193.109 101.071 1.00 99.09  ? 61  SER G HB2  1 
ATOM   9253  H  HB3  . SER D  2 61  ? 114.788 192.125 102.179 1.00 99.09  ? 61  SER G HB3  1 
ATOM   9254  H  HG   . SER D  2 61  ? 116.811 192.628 102.708 1.00 99.09  ? 61  SER G HG   1 
ATOM   9255  N  N    . THR D  2 62  ? 114.473 191.368 98.090  1.00 97.37  ? 62  THR G N    1 
ATOM   9256  C  CA   . THR D  2 62  ? 113.624 191.839 96.968  1.00 97.37  ? 62  THR G CA   1 
ATOM   9257  C  C    . THR D  2 62  ? 113.048 190.635 96.222  1.00 97.37  ? 62  THR G C    1 
ATOM   9258  O  O    . THR D  2 62  ? 113.568 189.523 96.431  1.00 97.37  ? 62  THR G O    1 
ATOM   9259  C  CB   . THR D  2 62  ? 114.460 192.709 96.024  1.00 97.37  ? 62  THR G CB   1 
ATOM   9260  O  OG1  . THR D  2 62  ? 115.617 193.122 96.752  1.00 97.37  ? 62  THR G OG1  1 
ATOM   9261  C  CG2  . THR D  2 62  ? 113.712 193.914 95.497  1.00 97.37  ? 62  THR G CG2  1 
ATOM   9262  H  H    . THR D  2 62  ? 115.154 190.836 97.807  1.00 97.37  ? 62  THR G H    1 
ATOM   9263  H  HA   . THR D  2 62  ? 112.884 192.375 97.329  1.00 97.37  ? 62  THR G HA   1 
ATOM   9264  H  HB   . THR D  2 62  ? 114.744 192.151 95.261  1.00 97.37  ? 62  THR G HB   1 
ATOM   9265  H  HG1  . THR D  2 62  ? 116.128 193.571 96.248  1.00 97.37  ? 62  THR G HG1  1 
ATOM   9266  H  HG21 . THR D  2 62  ? 114.274 194.395 94.864  1.00 97.37  ? 62  THR G HG21 1 
ATOM   9267  H  HG22 . THR D  2 62  ? 112.898 193.624 95.050  1.00 97.37  ? 62  THR G HG22 1 
ATOM   9268  H  HG23 . THR D  2 62  ? 113.482 194.504 96.237  1.00 97.37  ? 62  THR G HG23 1 
ATOM   9269  N  N    . ASP D  2 63  ? 112.024 190.836 95.390  1.00 91.87  ? 63  ASP G N    1 
ATOM   9270  C  CA   . ASP D  2 63  ? 111.396 189.774 94.616  1.00 91.87  ? 63  ASP G CA   1 
ATOM   9271  C  C    . ASP D  2 63  ? 112.359 189.240 93.568  1.00 91.87  ? 63  ASP G C    1 
ATOM   9272  O  O    . ASP D  2 63  ? 112.990 190.007 92.838  1.00 91.87  ? 63  ASP G O    1 
ATOM   9273  C  CB   . ASP D  2 63  ? 110.130 190.292 93.932  1.00 91.87  ? 63  ASP G CB   1 
ATOM   9274  C  CG   . ASP D  2 63  ? 108.939 190.355 94.869  1.00 91.87  ? 63  ASP G CG   1 
ATOM   9275  O  OD1  . ASP D  2 63  ? 108.783 189.441 95.705  1.00 91.87  ? 63  ASP G OD1  1 
ATOM   9276  O  OD2  . ASP D  2 63  ? 108.154 191.324 94.770  1.00 91.87  ? 63  ASP G OD2  1 
ATOM   9277  H  H    . ASP D  2 63  ? 111.642 191.610 95.312  1.00 91.87  ? 63  ASP G H    1 
ATOM   9278  H  HA   . ASP D  2 63  ? 111.148 189.042 95.205  1.00 91.87  ? 63  ASP G HA   1 
ATOM   9279  H  HB2  . ASP D  2 63  ? 110.297 191.180 93.576  1.00 91.87  ? 63  ASP G HB2  1 
ATOM   9280  H  HB3  . ASP D  2 63  ? 109.900 189.675 93.215  1.00 91.87  ? 63  ASP G HB3  1 
ATOM   9281  N  N    . LYS D  2 64  ? 112.454 187.910 93.487  1.00 79.62  ? 64  LYS G N    1 
ATOM   9282  C  CA   . LYS D  2 64  ? 113.211 187.245 92.432  1.00 79.62  ? 64  LYS G CA   1 
ATOM   9283  C  C    . LYS D  2 64  ? 114.647 187.757 92.372  1.00 79.62  ? 64  LYS G C    1 
ATOM   9284  O  O    . LYS D  2 64  ? 115.200 187.993 91.295  1.00 79.62  ? 64  LYS G O    1 
ATOM   9285  C  CB   . LYS D  2 64  ? 112.528 187.422 91.078  1.00 79.62  ? 64  LYS G CB   1 
ATOM   9286  C  CG   . LYS D  2 64  ? 111.169 186.759 90.965  1.00 79.62  ? 64  LYS G CG   1 
ATOM   9287  C  CD   . LYS D  2 64  ? 110.604 186.941 89.566  1.00 79.62  ? 64  LYS G CD   1 
ATOM   9288  C  CE   . LYS D  2 64  ? 109.160 186.478 89.438  1.00 79.62  ? 64  LYS G CE   1 
ATOM   9289  N  NZ   . LYS D  2 64  ? 108.659 185.669 90.582  1.00 79.62  ? 64  LYS G NZ   1 
ATOM   9290  H  H    . LYS D  2 64  ? 112.080 187.364 94.037  1.00 79.62  ? 64  LYS G H    1 
ATOM   9291  H  HA   . LYS D  2 64  ? 113.245 186.297 92.619  1.00 79.62  ? 64  LYS G HA   1 
ATOM   9292  H  HB2  . LYS D  2 64  ? 112.404 188.369 90.916  1.00 79.62  ? 64  LYS G HB2  1 
ATOM   9293  H  HB3  . LYS D  2 64  ? 113.097 187.045 90.392  1.00 79.62  ? 64  LYS G HB3  1 
ATOM   9294  H  HG2  . LYS D  2 64  ? 111.260 185.812 91.138  1.00 79.62  ? 64  LYS G HG2  1 
ATOM   9295  H  HG3  . LYS D  2 64  ? 110.558 187.163 91.600  1.00 79.62  ? 64  LYS G HG3  1 
ATOM   9296  H  HD2  . LYS D  2 64  ? 110.634 187.882 89.335  1.00 79.62  ? 64  LYS G HD2  1 
ATOM   9297  H  HD3  . LYS D  2 64  ? 111.138 186.429 88.940  1.00 79.62  ? 64  LYS G HD3  1 
ATOM   9298  H  HE2  . LYS D  2 64  ? 108.593 187.261 89.363  1.00 79.62  ? 64  LYS G HE2  1 
ATOM   9299  H  HE3  . LYS D  2 64  ? 109.078 185.938 88.638  1.00 79.62  ? 64  LYS G HE3  1 
ATOM   9300  H  HZ1  . LYS D  2 64  ? 108.018 185.121 90.300  1.00 79.62  ? 64  LYS G HZ1  1 
ATOM   9301  H  HZ2  . LYS D  2 64  ? 109.315 185.183 90.932  1.00 79.62  ? 64  LYS G HZ2  1 
ATOM   9302  H  HZ3  . LYS D  2 64  ? 108.326 186.205 91.209  1.00 79.62  ? 64  LYS G HZ3  1 
ATOM   9303  N  N    . CYS D  2 65  ? 115.257 187.934 93.539  1.00 84.38  ? 65  CYS G N    1 
ATOM   9304  C  CA   . CYS D  2 65  ? 116.656 188.326 93.622  1.00 84.38  ? 65  CYS G CA   1 
ATOM   9305  C  C    . CYS D  2 65  ? 117.592 187.129 93.687  1.00 84.38  ? 65  CYS G C    1 
ATOM   9306  O  O    . CYS D  2 65  ? 118.813 187.315 93.714  1.00 84.38  ? 65  CYS G O    1 
ATOM   9307  C  CB   . CYS D  2 65  ? 116.889 189.214 94.844  1.00 84.38  ? 65  CYS G CB   1 
ATOM   9308  S  SG   . CYS D  2 65  ? 118.512 190.035 94.869  1.00 84.38  ? 65  CYS G SG   1 
ATOM   9309  H  H    . CYS D  2 65  ? 114.879 187.823 94.304  1.00 84.38  ? 65  CYS G H    1 
ATOM   9310  H  HA   . CYS D  2 65  ? 116.881 188.840 92.832  1.00 84.38  ? 65  CYS G HA   1 
ATOM   9311  H  HB2  . CYS D  2 65  ? 116.208 189.902 94.867  1.00 84.38  ? 65  CYS G HB2  1 
ATOM   9312  H  HB3  . CYS D  2 65  ? 116.817 188.655 95.630  1.00 84.38  ? 65  CYS G HB3  1 
ATOM   9313  N  N    . ASN D  2 66  ? 117.053 185.912 93.704  1.00 60.92  ? 66  ASN G N    1 
ATOM   9314  C  CA   . ASN D  2 66  ? 117.840 184.690 93.850  1.00 60.92  ? 66  ASN G CA   1 
ATOM   9315  C  C    . ASN D  2 66  ? 117.468 183.716 92.740  1.00 60.92  ? 66  ASN G C    1 
ATOM   9316  O  O    . ASN D  2 66  ? 116.847 182.676 92.984  1.00 60.92  ? 66  ASN G O    1 
ATOM   9317  C  CB   . ASN D  2 66  ? 117.621 184.072 95.232  1.00 60.92  ? 66  ASN G CB   1 
ATOM   9318  C  CG   . ASN D  2 66  ? 116.206 183.584 95.436  1.00 60.92  ? 66  ASN G CG   1 
ATOM   9319  O  OD1  . ASN D  2 66  ? 115.294 183.968 94.707  1.00 60.92  ? 66  ASN G OD1  1 
ATOM   9320  N  ND2  . ASN D  2 66  ? 116.015 182.728 96.427  1.00 60.92  ? 66  ASN G ND2  1 
ATOM   9321  H  H    . ASN D  2 66  ? 116.210 185.762 93.631  1.00 60.92  ? 66  ASN G H    1 
ATOM   9322  H  HA   . ASN D  2 66  ? 118.780 184.902 93.757  1.00 60.92  ? 66  ASN G HA   1 
ATOM   9323  H  HB2  . ASN D  2 66  ? 118.212 183.313 95.338  1.00 60.92  ? 66  ASN G HB2  1 
ATOM   9324  H  HB3  . ASN D  2 66  ? 117.808 184.738 95.910  1.00 60.92  ? 66  ASN G HB3  1 
ATOM   9325  H  HD21 . ASN D  2 66  ? 115.229 182.420 96.583  1.00 60.92  ? 66  ASN G HD21 1 
ATOM   9326  H  HD22 . ASN D  2 66  ? 116.680 182.483 96.913  1.00 60.92  ? 66  ASN G HD22 1 
ATOM   9327  N  N    . PRO D  2 67  ? 117.842 184.023 91.504  1.00 53.87  ? 67  PRO G N    1 
ATOM   9328  C  CA   . PRO D  2 67  ? 117.565 183.098 90.404  1.00 53.87  ? 67  PRO G CA   1 
ATOM   9329  C  C    . PRO D  2 67  ? 118.698 182.117 90.172  1.00 53.87  ? 67  PRO G C    1 
ATOM   9330  O  O    . PRO D  2 67  ? 119.756 182.210 90.801  1.00 53.87  ? 67  PRO G O    1 
ATOM   9331  C  CB   . PRO D  2 67  ? 117.394 184.037 89.209  1.00 53.87  ? 67  PRO G CB   1 
ATOM   9332  C  CG   . PRO D  2 67  ? 118.353 185.136 89.498  1.00 53.87  ? 67  PRO G CG   1 
ATOM   9333  C  CD   . PRO D  2 67  ? 118.412 185.286 91.008  1.00 53.87  ? 67  PRO G CD   1 
ATOM   9334  H  HA   . PRO D  2 67  ? 116.741 182.616 90.560  1.00 53.87  ? 67  PRO G HA   1 
ATOM   9335  H  HB2  . PRO D  2 67  ? 117.632 183.573 88.393  1.00 53.87  ? 67  PRO G HB2  1 
ATOM   9336  H  HB3  . PRO D  2 67  ? 116.483 184.365 89.175  1.00 53.87  ? 67  PRO G HB3  1 
ATOM   9337  H  HG2  . PRO D  2 67  ? 119.225 184.894 89.152  1.00 53.87  ? 67  PRO G HG2  1 
ATOM   9338  H  HG3  . PRO D  2 67  ? 118.037 185.953 89.083  1.00 53.87  ? 67  PRO G HG3  1 
ATOM   9339  H  HD2  . PRO D  2 67  ? 119.330 185.378 91.302  1.00 53.87  ? 67  PRO G HD2  1 
ATOM   9340  H  HD3  . PRO D  2 67  ? 117.868 186.035 91.292  1.00 53.87  ? 67  PRO G HD3  1 
ATOM   9341  N  N    . HIS D  2 68  ? 118.481 181.115 89.325  1.00 43.93  ? 68  HIS G N    1 
ATOM   9342  C  CA   . HIS D  2 68  ? 119.543 180.141 88.977  1.00 43.93  ? 68  HIS G CA   1 
ATOM   9343  C  C    . HIS D  2 68  ? 120.609 180.925 88.194  1.00 43.93  ? 68  HIS G C    1 
ATOM   9344  O  O    . HIS D  2 68  ? 120.204 181.754 87.365  1.00 43.93  ? 68  HIS G O    1 
ATOM   9345  C  CB   . HIS D  2 68  ? 118.946 178.943 88.229  1.00 43.93  ? 68  HIS G CB   1 
ATOM   9346  C  CG   . HIS D  2 68  ? 119.898 177.811 88.045  1.00 43.93  ? 68  HIS G CG   1 
ATOM   9347  N  ND1  . HIS D  2 68  ? 120.100 176.843 89.002  1.00 43.93  ? 68  HIS G ND1  1 
ATOM   9348  C  CD2  . HIS D  2 68  ? 120.713 177.499 87.022  1.00 43.93  ? 68  HIS G CD2  1 
ATOM   9349  C  CE1  . HIS D  2 68  ? 120.999 175.993 88.575  1.00 43.93  ? 68  HIS G CE1  1 
ATOM   9350  N  NE2  . HIS D  2 68  ? 121.382 176.371 87.365  1.00 43.93  ? 68  HIS G NE2  1 
ATOM   9351  H  H    . HIS D  2 68  ? 117.689 180.954 88.907  1.00 43.93  ? 68  HIS G H    1 
ATOM   9352  H  HA   . HIS D  2 68  ? 119.934 179.817 89.814  1.00 43.93  ? 68  HIS G HA   1 
ATOM   9353  H  HB2  . HIS D  2 68  ? 118.161 178.618 88.726  1.00 43.93  ? 68  HIS G HB2  1 
ATOM   9354  H  HB3  . HIS D  2 68  ? 118.634 179.242 87.346  1.00 43.93  ? 68  HIS G HB3  1 
ATOM   9355  H  HD2  . HIS D  2 68  ? 120.785 177.955 86.208  1.00 43.93  ? 68  HIS G HD2  1 
ATOM   9356  H  HE1  . HIS D  2 68  ? 121.313 175.240 89.045  1.00 43.93  ? 68  HIS G HE1  1 
ATOM   9357  N  N    . PRO D  2 69  ? 121.931 180.670 88.316  1.00 45.47  ? 69  PRO G N    1 
ATOM   9358  C  CA   . PRO D  2 69  ? 122.929 181.467 87.590  1.00 45.47  ? 69  PRO G CA   1 
ATOM   9359  C  C    . PRO D  2 69  ? 122.726 181.659 86.075  1.00 45.47  ? 69  PRO G C    1 
ATOM   9360  O  O    . PRO D  2 69  ? 123.144 182.675 85.592  1.00 45.47  ? 69  PRO G O    1 
ATOM   9361  C  CB   . PRO D  2 69  ? 124.200 180.641 87.798  1.00 45.47  ? 69  PRO G CB   1 
ATOM   9362  C  CG   . PRO D  2 69  ? 124.040 180.063 89.176  1.00 45.47  ? 69  PRO G CG   1 
ATOM   9363  C  CD   . PRO D  2 69  ? 122.560 179.809 89.326  1.00 45.47  ? 69  PRO G CD   1 
ATOM   9364  H  HA   . PRO D  2 69  ? 123.032 182.346 88.033  1.00 45.47  ? 69  PRO G HA   1 
ATOM   9365  H  HB2  . PRO D  2 69  ? 124.271 179.930 87.127  1.00 45.47  ? 69  PRO G HB2  1 
ATOM   9366  H  HB3  . PRO D  2 69  ? 125.000 181.207 87.748  1.00 45.47  ? 69  PRO G HB3  1 
ATOM   9367  H  HG2  . PRO D  2 69  ? 124.545 179.229 89.264  1.00 45.47  ? 69  PRO G HG2  1 
ATOM   9368  H  HG3  . PRO D  2 69  ? 124.353 180.695 89.857  1.00 45.47  ? 69  PRO G HG3  1 
ATOM   9369  H  HD2  . PRO D  2 69  ? 122.348 178.871 89.167  1.00 45.47  ? 69  PRO G HD2  1 
ATOM   9370  H  HD3  . PRO D  2 69  ? 122.271 180.052 90.225  1.00 45.47  ? 69  PRO G HD3  1 
ATOM   9371  N  N    . LYS D  2 70  ? 122.201 180.668 85.353  1.00 48.05  ? 70  LYS G N    1 
ATOM   9372  C  CA   . LYS D  2 70  ? 121.870 180.733 83.896  1.00 48.05  ? 70  LYS G CA   1 
ATOM   9373  C  C    . LYS D  2 70  ? 121.011 181.972 83.565  1.00 48.05  ? 70  LYS G C    1 
ATOM   9374  O  O    . LYS D  2 70  ? 121.326 182.672 82.575  1.00 48.05  ? 70  LYS G O    1 
ATOM   9375  C  CB   . LYS D  2 70  ? 121.105 179.467 83.504  1.00 48.05  ? 70  LYS G CB   1 
ATOM   9376  C  CG   . LYS D  2 70  ? 121.966 178.216 83.412  1.00 48.05  ? 70  LYS G CG   1 
ATOM   9377  C  CD   . LYS D  2 70  ? 123.118 178.365 82.448  1.00 48.05  ? 70  LYS G CD   1 
ATOM   9378  C  CE   . LYS D  2 70  ? 124.410 177.775 82.970  1.00 48.05  ? 70  LYS G CE   1 
ATOM   9379  N  NZ   . LYS D  2 70  ? 124.921 178.529 84.139  1.00 48.05  ? 70  LYS G NZ   1 
ATOM   9380  H  H    . LYS D  2 70  ? 122.158 179.833 85.679  1.00 48.05  ? 70  LYS G H    1 
ATOM   9381  H  HA   . LYS D  2 70  ? 122.710 180.776 83.382  1.00 48.05  ? 70  LYS G HA   1 
ATOM   9382  H  HB2  . LYS D  2 70  ? 120.398 179.313 84.164  1.00 48.05  ? 70  LYS G HB2  1 
ATOM   9383  H  HB3  . LYS D  2 70  ? 120.678 179.617 82.635  1.00 48.05  ? 70  LYS G HB3  1 
ATOM   9384  H  HG2  . LYS D  2 70  ? 122.317 178.006 84.304  1.00 48.05  ? 70  LYS G HG2  1 
ATOM   9385  H  HG3  . LYS D  2 70  ? 121.403 177.464 83.127  1.00 48.05  ? 70  LYS G HG3  1 
ATOM   9386  H  HD2  . LYS D  2 70  ? 122.888 177.924 81.603  1.00 48.05  ? 70  LYS G HD2  1 
ATOM   9387  H  HD3  . LYS D  2 70  ? 123.257 179.318 82.263  1.00 48.05  ? 70  LYS G HD3  1 
ATOM   9388  H  HE2  . LYS D  2 70  ? 124.264 176.846 83.230  1.00 48.05  ? 70  LYS G HE2  1 
ATOM   9389  H  HE3  . LYS D  2 70  ? 125.084 177.789 82.265  1.00 48.05  ? 70  LYS G HE3  1 
ATOM   9390  H  HZ1  . LYS D  2 70  ? 125.724 178.193 84.393  1.00 48.05  ? 70  LYS G HZ1  1 
ATOM   9391  H  HZ2  . LYS D  2 70  ? 125.022 179.404 83.921  1.00 48.05  ? 70  LYS G HZ2  1 
ATOM   9392  H  HZ3  . LYS D  2 70  ? 124.336 178.460 84.828  1.00 48.05  ? 70  LYS G HZ3  1 
ATOM   9393  N  N    . GLN D  2 71  ? 120.006 182.235 84.411  1.00 50.15  ? 71  GLN G N    1 
ATOM   9394  C  CA   . GLN D  2 71  ? 119.008 183.338 84.390  1.00 50.15  ? 71  GLN G CA   1 
ATOM   9395  C  C    . GLN D  2 71  ? 119.644 184.629 84.918  1.00 50.15  ? 71  GLN G C    1 
ATOM   9396  O  O    . GLN D  2 71  ? 120.759 184.545 85.467  1.00 50.15  ? 71  GLN G O    1 
ATOM   9397  C  CB   . GLN D  2 71  ? 117.784 182.978 85.231  1.00 50.15  ? 71  GLN G CB   1 
ATOM   9398  C  CG   . GLN D  2 71  ? 117.025 181.762 84.732  1.00 50.15  ? 71  GLN G CG   1 
ATOM   9399  C  CD   . GLN D  2 71  ? 115.821 181.477 85.593  1.00 50.15  ? 71  GLN G CD   1 
ATOM   9400  O  OE1  . GLN D  2 71  ? 115.935 181.193 86.781  1.00 50.15  ? 71  GLN G OE1  1 
ATOM   9401  N  NE2  . GLN D  2 71  ? 114.647 181.545 84.993  1.00 50.15  ? 71  GLN G NE2  1 
ATOM   9402  H  H    . GLN D  2 71  ? 119.982 181.744 85.178  1.00 50.15  ? 71  GLN G H    1 
ATOM   9403  H  HA   . GLN D  2 71  ? 118.724 183.482 83.457  1.00 50.15  ? 71  GLN G HA   1 
ATOM   9404  H  HB2  . GLN D  2 71  ? 118.077 182.815 86.151  1.00 50.15  ? 71  GLN G HB2  1 
ATOM   9405  H  HB3  . GLN D  2 71  ? 117.179 183.748 85.242  1.00 50.15  ? 71  GLN G HB3  1 
ATOM   9406  H  HG2  . GLN D  2 71  ? 116.733 181.915 83.807  1.00 50.15  ? 71  GLN G HG2  1 
ATOM   9407  H  HG3  . GLN D  2 71  ? 117.619 180.981 84.737  1.00 50.15  ? 71  GLN G HG3  1 
ATOM   9408  H  HE21 . GLN D  2 71  ? 114.599 181.764 84.138  1.00 50.15  ? 71  GLN G HE21 1 
ATOM   9409  H  HE22 . GLN D  2 71  ? 113.908 181.372 85.447  1.00 50.15  ? 71  GLN G HE22 1 
ATOM   9410  N  N    . ILE E  2 1   ? 193.838 115.736 99.415  1.00 94.59  ? 1   ILE I N    1 
ATOM   9411  C  CA   . ILE E  2 1   ? 192.541 115.199 98.918  1.00 94.59  ? 1   ILE I CA   1 
ATOM   9412  C  C    . ILE E  2 1   ? 191.809 116.292 98.159  1.00 94.59  ? 1   ILE I C    1 
ATOM   9413  O  O    . ILE E  2 1   ? 191.702 117.425 98.626  1.00 94.59  ? 1   ILE I O    1 
ATOM   9414  C  CB   . ILE E  2 1   ? 191.681 114.648 100.073 1.00 94.59  ? 1   ILE I CB   1 
ATOM   9415  C  CG1  . ILE E  2 1   ? 190.491 113.852 99.532  1.00 94.59  ? 1   ILE I CG1  1 
ATOM   9416  C  CG2  . ILE E  2 1   ? 191.179 115.776 100.947 1.00 94.59  ? 1   ILE I CG2  1 
ATOM   9417  C  CD1  . ILE E  2 1   ? 190.850 112.508 98.964  1.00 94.59  ? 1   ILE I CD1  1 
ATOM   9418  H  H1   . ILE E  2 1   ? 194.290 115.094 99.835  1.00 94.59  ? 1   ILE I H1   1 
ATOM   9419  H  H2   . ILE E  2 1   ? 194.315 116.033 98.726  1.00 94.59  ? 1   ILE I H2   1 
ATOM   9420  H  H3   . ILE E  2 1   ? 193.685 116.410 99.977  1.00 94.59  ? 1   ILE I H3   1 
ATOM   9421  H  HA   . ILE E  2 1   ? 192.711 114.476 98.297  1.00 94.59  ? 1   ILE I HA   1 
ATOM   9422  H  HB   . ILE E  2 1   ? 192.227 114.056 100.612 1.00 94.59  ? 1   ILE I HB   1 
ATOM   9423  H  HG12 . ILE E  2 1   ? 189.864 113.702 100.258 1.00 94.59  ? 1   ILE I HG12 1 
ATOM   9424  H  HG13 . ILE E  2 1   ? 190.063 114.364 98.830  1.00 94.59  ? 1   ILE I HG13 1 
ATOM   9425  H  HG21 . ILE E  2 1   ? 190.781 115.406 101.747 1.00 94.59  ? 1   ILE I HG21 1 
ATOM   9426  H  HG22 . ILE E  2 1   ? 191.922 116.353 101.185 1.00 94.59  ? 1   ILE I HG22 1 
ATOM   9427  H  HG23 . ILE E  2 1   ? 190.512 116.273 100.454 1.00 94.59  ? 1   ILE I HG23 1 
ATOM   9428  H  HD11 . ILE E  2 1   ? 190.046 112.089 98.621  1.00 94.59  ? 1   ILE I HD11 1 
ATOM   9429  H  HD12 . ILE E  2 1   ? 191.491 112.631 98.249  1.00 94.59  ? 1   ILE I HD12 1 
ATOM   9430  H  HD13 . ILE E  2 1   ? 191.232 111.961 99.668  1.00 94.59  ? 1   ILE I HD13 1 
ATOM   9431  N  N    . VAL E  2 2   ? 191.307 115.941 96.980  1.00 87.18  ? 2   VAL I N    1 
ATOM   9432  C  CA   . VAL E  2 2   ? 190.571 116.859 96.122  1.00 87.18  ? 2   VAL I CA   1 
ATOM   9433  C  C    . VAL E  2 2   ? 189.145 116.346 96.018  1.00 87.18  ? 2   VAL I C    1 
ATOM   9434  O  O    . VAL E  2 2   ? 188.916 115.215 95.575  1.00 87.18  ? 2   VAL I O    1 
ATOM   9435  C  CB   . VAL E  2 2   ? 191.214 116.985 94.734  1.00 87.18  ? 2   VAL I CB   1 
ATOM   9436  C  CG1  . VAL E  2 2   ? 190.371 117.857 93.835  1.00 87.18  ? 2   VAL I CG1  1 
ATOM   9437  C  CG2  . VAL E  2 2   ? 192.601 117.568 94.857  1.00 87.18  ? 2   VAL I CG2  1 
ATOM   9438  H  H    . VAL E  2 2   ? 191.383 115.152 96.652  1.00 87.18  ? 2   VAL I H    1 
ATOM   9439  H  HA   . VAL E  2 2   ? 190.551 117.740 96.527  1.00 87.18  ? 2   VAL I HA   1 
ATOM   9440  H  HB   . VAL E  2 2   ? 191.285 116.107 94.331  1.00 87.18  ? 2   VAL I HB   1 
ATOM   9441  H  HG11 . VAL E  2 2   ? 190.817 117.936 92.978  1.00 87.18  ? 2   VAL I HG11 1 
ATOM   9442  H  HG12 . VAL E  2 2   ? 189.497 117.455 93.716  1.00 87.18  ? 2   VAL I HG12 1 
ATOM   9443  H  HG13 . VAL E  2 2   ? 190.290 118.730 94.247  1.00 87.18  ? 2   VAL I HG13 1 
ATOM   9444  H  HG21 . VAL E  2 2   ? 192.979 117.663 93.970  1.00 87.18  ? 2   VAL I HG21 1 
ATOM   9445  H  HG22 . VAL E  2 2   ? 192.531 118.436 95.284  1.00 87.18  ? 2   VAL I HG22 1 
ATOM   9446  H  HG23 . VAL E  2 2   ? 193.149 116.976 95.395  1.00 87.18  ? 2   VAL I HG23 1 
ATOM   9447  N  N    . CYS E  2 3   ? 188.192 117.180 96.418  1.00 79.86  ? 3   CYS I N    1 
ATOM   9448  C  CA   . CYS E  2 3   ? 186.787 116.816 96.451  1.00 79.86  ? 3   CYS I CA   1 
ATOM   9449  C  C    . CYS E  2 3   ? 185.999 117.803 95.604  1.00 79.86  ? 3   CYS I C    1 
ATOM   9450  O  O    . CYS E  2 3   ? 186.202 119.016 95.712  1.00 79.86  ? 3   CYS I O    1 
ATOM   9451  C  CB   . CYS E  2 3   ? 186.266 116.822 97.888  1.00 79.86  ? 3   CYS I CB   1 
ATOM   9452  S  SG   . CYS E  2 3   ? 187.022 115.595 98.993  1.00 79.86  ? 3   CYS I SG   1 
ATOM   9453  H  H    . CYS E  2 3   ? 188.341 117.984 96.684  1.00 79.86  ? 3   CYS I H    1 
ATOM   9454  H  HA   . CYS E  2 3   ? 186.667 115.928 96.083  1.00 79.86  ? 3   CYS I HA   1 
ATOM   9455  H  HB2  . CYS E  2 3   ? 186.446 117.697 98.262  1.00 79.86  ? 3   CYS I HB2  1 
ATOM   9456  H  HB3  . CYS E  2 3   ? 185.312 116.661 97.876  1.00 79.86  ? 3   CYS I HB3  1 
ATOM   9457  N  N    . HIS E  2 4   ? 185.107 117.285 94.765  1.00 60.17  ? 4   HIS I N    1 
ATOM   9458  C  CA   . HIS E  2 4   ? 184.178 118.144 94.048  1.00 60.17  ? 4   HIS I CA   1 
ATOM   9459  C  C    . HIS E  2 4   ? 183.269 118.863 95.037  1.00 60.17  ? 4   HIS I C    1 
ATOM   9460  O  O    . HIS E  2 4   ? 182.973 118.358 96.122  1.00 60.17  ? 4   HIS I O    1 
ATOM   9461  C  CB   . HIS E  2 4   ? 183.333 117.326 93.075  1.00 60.17  ? 4   HIS I CB   1 
ATOM   9462  C  CG   . HIS E  2 4   ? 184.011 117.019 91.779  1.00 60.17  ? 4   HIS I CG   1 
ATOM   9463  N  ND1  . HIS E  2 4   ? 184.344 117.990 90.861  1.00 60.17  ? 4   HIS I ND1  1 
ATOM   9464  C  CD2  . HIS E  2 4   ? 184.393 115.840 91.234  1.00 60.17  ? 4   HIS I CD2  1 
ATOM   9465  C  CE1  . HIS E  2 4   ? 184.916 117.424 89.813  1.00 60.17  ? 4   HIS I CE1  1 
ATOM   9466  N  NE2  . HIS E  2 4   ? 184.956 116.120 90.014  1.00 60.17  ? 4   HIS I NE2  1 
ATOM   9467  H  H    . HIS E  2 4   ? 185.024 116.447 94.590  1.00 60.17  ? 4   HIS I H    1 
ATOM   9468  H  HA   . HIS E  2 4   ? 184.669 118.807 93.542  1.00 60.17  ? 4   HIS I HA   1 
ATOM   9469  H  HB2  . HIS E  2 4   ? 183.108 116.482 93.495  1.00 60.17  ? 4   HIS I HB2  1 
ATOM   9470  H  HB3  . HIS E  2 4   ? 182.529 117.824 92.873  1.00 60.17  ? 4   HIS I HB3  1 
ATOM   9471  H  HD2  . HIS E  2 4   ? 184.296 115.000 91.616  1.00 60.17  ? 4   HIS I HD2  1 
ATOM   9472  H  HE1  . HIS E  2 4   ? 185.233 117.866 89.060  1.00 60.17  ? 4   HIS I HE1  1 
ATOM   9473  N  N    . THR E  2 5   ? 182.825 120.058 94.659  1.00 54.94  ? 5   THR I N    1 
ATOM   9474  C  CA   . THR E  2 5   ? 181.921 120.832 95.493  1.00 54.94  ? 5   THR I CA   1 
ATOM   9475  C  C    . THR E  2 5   ? 180.917 121.566 94.616  1.00 54.94  ? 5   THR I C    1 
ATOM   9476  O  O    . THR E  2 5   ? 181.131 121.761 93.417  1.00 54.94  ? 5   THR I O    1 
ATOM   9477  C  CB   . THR E  2 5   ? 182.677 121.832 96.377  1.00 54.94  ? 5   THR I CB   1 
ATOM   9478  O  OG1  . THR E  2 5   ? 181.763 122.477 97.270  1.00 54.94  ? 5   THR I OG1  1 
ATOM   9479  C  CG2  . THR E  2 5   ? 183.364 122.881 95.535  1.00 54.94  ? 5   THR I CG2  1 
ATOM   9480  H  H    . THR E  2 5   ? 183.039 120.442 93.921  1.00 54.94  ? 5   THR I H    1 
ATOM   9481  H  HA   . THR E  2 5   ? 181.434 120.227 96.071  1.00 54.94  ? 5   THR I HA   1 
ATOM   9482  H  HB   . THR E  2 5   ? 183.352 121.361 96.888  1.00 54.94  ? 5   THR I HB   1 
ATOM   9483  H  HG1  . THR E  2 5   ? 182.165 123.064 97.714  1.00 54.94  ? 5   THR I HG1  1 
ATOM   9484  H  HG21 . THR E  2 5   ? 183.894 123.458 96.104  1.00 54.94  ? 5   THR I HG21 1 
ATOM   9485  H  HG22 . THR E  2 5   ? 183.939 122.456 94.881  1.00 54.94  ? 5   THR I HG22 1 
ATOM   9486  H  HG23 . THR E  2 5   ? 182.704 123.418 95.076  1.00 54.94  ? 5   THR I HG23 1 
ATOM   9487  N  N    . THR E  2 6   ? 179.811 121.974 95.239  1.00 43.85  ? 6   THR I N    1 
ATOM   9488  C  CA   . THR E  2 6   ? 178.742 122.684 94.557  1.00 43.85  ? 6   THR I CA   1 
ATOM   9489  C  C    . THR E  2 6   ? 178.591 124.124 95.012  1.00 43.85  ? 6   THR I C    1 
ATOM   9490  O  O    . THR E  2 6   ? 177.870 124.887 94.360  1.00 43.85  ? 6   THR I O    1 
ATOM   9491  C  CB   . THR E  2 6   ? 177.403 121.968 94.764  1.00 43.85  ? 6   THR I CB   1 
ATOM   9492  O  OG1  . THR E  2 6   ? 177.098 121.914 96.163  1.00 43.85  ? 6   THR I OG1  1 
ATOM   9493  C  CG2  . THR E  2 6   ? 177.454 120.581 94.204  1.00 43.85  ? 6   THR I CG2  1 
ATOM   9494  H  H    . THR E  2 6   ? 179.663 121.856 96.076  1.00 43.85  ? 6   THR I H    1 
ATOM   9495  H  HA   . THR E  2 6   ? 178.927 122.684 93.608  1.00 43.85  ? 6   THR I HA   1 
ATOM   9496  H  HB   . THR E  2 6   ? 176.708 122.453 94.302  1.00 43.85  ? 6   THR I HB   1 
ATOM   9497  H  HG1  . THR E  2 6   ? 176.352 121.549 96.276  1.00 43.85  ? 6   THR I HG1  1 
ATOM   9498  H  HG21 . THR E  2 6   ? 176.601 120.143 94.338  1.00 43.85  ? 6   THR I HG21 1 
ATOM   9499  H  HG22 . THR E  2 6   ? 177.645 120.616 93.255  1.00 43.85  ? 6   THR I HG22 1 
ATOM   9500  H  HG23 . THR E  2 6   ? 178.146 120.077 94.653  1.00 43.85  ? 6   THR I HG23 1 
ATOM   9501  N  N    . ALA E  2 7   ? 179.242 124.520 96.106  1.00 49.41  ? 7   ALA I N    1 
ATOM   9502  C  CA   . ALA E  2 7   ? 179.185 125.911 96.529  1.00 49.41  ? 7   ALA I CA   1 
ATOM   9503  C  C    . ALA E  2 7   ? 179.823 126.834 95.503  1.00 49.41  ? 7   ALA I C    1 
ATOM   9504  O  O    . ALA E  2 7   ? 179.616 128.050 95.562  1.00 49.41  ? 7   ALA I O    1 
ATOM   9505  C  CB   . ALA E  2 7   ? 179.868 126.077 97.883  1.00 49.41  ? 7   ALA I CB   1 
ATOM   9506  H  H    . ALA E  2 7   ? 179.711 124.009 96.612  1.00 49.41  ? 7   ALA I H    1 
ATOM   9507  H  HA   . ALA E  2 7   ? 178.258 126.171 96.632  1.00 49.41  ? 7   ALA I HA   1 
ATOM   9508  H  HB1  . ALA E  2 7   ? 179.825 127.009 98.142  1.00 49.41  ? 7   ALA I HB1  1 
ATOM   9509  H  HB2  . ALA E  2 7   ? 179.403 125.527 98.534  1.00 49.41  ? 7   ALA I HB2  1 
ATOM   9510  H  HB3  . ALA E  2 7   ? 180.791 125.792 97.804  1.00 49.41  ? 7   ALA I HB3  1 
ATOM   9511  N  N    . THR E  2 8   ? 180.594 126.282 94.573  1.00 50.68  ? 8   THR I N    1 
ATOM   9512  C  CA   . THR E  2 8   ? 181.178 127.024 93.468  1.00 50.68  ? 8   THR I CA   1 
ATOM   9513  C  C    . THR E  2 8   ? 180.474 126.636 92.177  1.00 50.68  ? 8   THR I C    1 
ATOM   9514  O  O    . THR E  2 8   ? 180.372 125.448 91.854  1.00 50.68  ? 8   THR I O    1 
ATOM   9515  C  CB   . THR E  2 8   ? 182.676 126.738 93.349  1.00 50.68  ? 8   THR I CB   1 
ATOM   9516  O  OG1  . THR E  2 8   ? 183.315 126.977 94.608  1.00 50.68  ? 8   THR I OG1  1 
ATOM   9517  C  CG2  . THR E  2 8   ? 183.311 127.613 92.274  1.00 50.68  ? 8   THR I CG2  1 
ATOM   9518  H  H    . THR E  2 8   ? 180.798 125.450 94.561  1.00 50.68  ? 8   THR I H    1 
ATOM   9519  H  HA   . THR E  2 8   ? 181.052 127.972 93.613  1.00 50.68  ? 8   THR I HA   1 
ATOM   9520  H  HB   . THR E  2 8   ? 182.800 125.811 93.099  1.00 50.68  ? 8   THR I HB   1 
ATOM   9521  H  HG1  . THR E  2 8   ? 184.110 126.706 94.581  1.00 50.68  ? 8   THR I HG1  1 
ATOM   9522  H  HG21 . THR E  2 8   ? 184.271 127.481 92.262  1.00 50.68  ? 8   THR I HG21 1 
ATOM   9523  H  HG22 . THR E  2 8   ? 182.955 127.384 91.402  1.00 50.68  ? 8   THR I HG22 1 
ATOM   9524  H  HG23 . THR E  2 8   ? 183.124 128.546 92.455  1.00 50.68  ? 8   THR I HG23 1 
ATOM   9525  N  N    . SER E  2 9   ? 179.991 127.636 91.445  1.00 37.85  ? 9   SER I N    1 
ATOM   9526  C  CA   . SER E  2 9   ? 179.381 127.434 90.146  1.00 37.85  ? 9   SER I CA   1 
ATOM   9527  C  C    . SER E  2 9   ? 180.220 128.126 89.081  1.00 37.85  ? 9   SER I C    1 
ATOM   9528  O  O    . SER E  2 9   ? 180.511 129.323 89.215  1.00 37.85  ? 9   SER I O    1 
ATOM   9529  C  CB   . SER E  2 9   ? 177.954 127.983 90.120  1.00 37.85  ? 9   SER I CB   1 
ATOM   9530  O  OG   . SER E  2 9   ? 177.455 128.025 88.796  1.00 37.85  ? 9   SER I OG   1 
ATOM   9531  H  H    . SER E  2 9   ? 179.999 128.457 91.693  1.00 37.85  ? 9   SER I H    1 
ATOM   9532  H  HA   . SER E  2 9   ? 179.336 126.488 89.964  1.00 37.85  ? 9   SER I HA   1 
ATOM   9533  H  HB2  . SER E  2 9   ? 177.386 127.403 90.649  1.00 37.85  ? 9   SER I HB2  1 
ATOM   9534  H  HB3  . SER E  2 9   ? 177.953 128.877 90.490  1.00 37.85  ? 9   SER I HB3  1 
ATOM   9535  H  HG   . SER E  2 9   ? 176.671 128.319 88.798  1.00 37.85  ? 9   SER I HG   1 
ATOM   9536  N  N    . PRO E  2 10  ? 180.630 127.428 88.009  1.00 45.98  ? 10  PRO I N    1 
ATOM   9537  C  CA   . PRO E  2 10  ? 180.349 126.028 87.667  1.00 45.98  ? 10  PRO I CA   1 
ATOM   9538  C  C    . PRO E  2 10  ? 180.955 125.033 88.648  1.00 45.98  ? 10  PRO I C    1 
ATOM   9539  O  O    . PRO E  2 10  ? 181.846 125.397 89.413  1.00 45.98  ? 10  PRO I O    1 
ATOM   9540  C  CB   . PRO E  2 10  ? 180.987 125.870 86.284  1.00 45.98  ? 10  PRO I CB   1 
ATOM   9541  C  CG   . PRO E  2 10  ? 181.097 127.242 85.750  1.00 45.98  ? 10  PRO I CG   1 
ATOM   9542  C  CD   . PRO E  2 10  ? 181.368 128.103 86.930  1.00 45.98  ? 10  PRO I CD   1 
ATOM   9543  H  HA   . PRO E  2 10  ? 179.395 125.881 87.605  1.00 45.98  ? 10  PRO I HA   1 
ATOM   9544  H  HB2  . PRO E  2 10  ? 181.864 125.470 86.379  1.00 45.98  ? 10  PRO I HB2  1 
ATOM   9545  H  HB3  . PRO E  2 10  ? 180.419 125.323 85.721  1.00 45.98  ? 10  PRO I HB3  1 
ATOM   9546  H  HG2  . PRO E  2 10  ? 181.830 127.288 85.116  1.00 45.98  ? 10  PRO I HG2  1 
ATOM   9547  H  HG3  . PRO E  2 10  ? 180.264 127.495 85.328  1.00 45.98  ? 10  PRO I HG3  1 
ATOM   9548  H  HD2  . PRO E  2 10  ? 182.317 128.116 87.126  1.00 45.98  ? 10  PRO I HD2  1 
ATOM   9549  H  HD3  . PRO E  2 10  ? 181.016 128.993 86.789  1.00 45.98  ? 10  PRO I HD3  1 
ATOM   9550  N  N    . ILE E  2 11  ? 180.455 123.796 88.627  1.00 46.28  ? 11  ILE I N    1 
ATOM   9551  C  CA   . ILE E  2 11  ? 180.956 122.772 89.533  1.00 46.28  ? 11  ILE I CA   1 
ATOM   9552  C  C    . ILE E  2 11  ? 182.468 122.724 89.443  1.00 46.28  ? 11  ILE I C    1 
ATOM   9553  O  O    . ILE E  2 11  ? 183.042 122.610 88.355  1.00 46.28  ? 11  ILE I O    1 
ATOM   9554  C  CB   . ILE E  2 11  ? 180.321 121.410 89.205  1.00 46.28  ? 11  ILE I CB   1 
ATOM   9555  C  CG1  . ILE E  2 11  ? 178.833 121.440 89.549  1.00 46.28  ? 11  ILE I CG1  1 
ATOM   9556  C  CG2  . ILE E  2 11  ? 181.016 120.295 89.981  1.00 46.28  ? 11  ILE I CG2  1 
ATOM   9557  C  CD1  . ILE E  2 11  ? 178.113 120.153 89.286  1.00 46.28  ? 11  ILE I CD1  1 
ATOM   9558  H  H    . ILE E  2 11  ? 179.828 123.529 88.103  1.00 46.28  ? 11  ILE I H    1 
ATOM   9559  H  HA   . ILE E  2 11  ? 180.716 123.005 90.442  1.00 46.28  ? 11  ILE I HA   1 
ATOM   9560  H  HB   . ILE E  2 11  ? 180.421 121.243 88.256  1.00 46.28  ? 11  ILE I HB   1 
ATOM   9561  H  HG12 . ILE E  2 11  ? 178.741 121.638 90.491  1.00 46.28  ? 11  ILE I HG12 1 
ATOM   9562  H  HG13 . ILE E  2 11  ? 178.408 122.131 89.021  1.00 46.28  ? 11  ILE I HG13 1 
ATOM   9563  H  HG21 . ILE E  2 11  ? 180.602 119.445 89.768  1.00 46.28  ? 11  ILE I HG21 1 
ATOM   9564  H  HG22 . ILE E  2 11  ? 181.952 120.260 89.737  1.00 46.28  ? 11  ILE I HG22 1 
ATOM   9565  H  HG23 . ILE E  2 11  ? 180.926 120.476 90.928  1.00 46.28  ? 11  ILE I HG23 1 
ATOM   9566  H  HD11 . ILE E  2 11  ? 177.166 120.293 89.422  1.00 46.28  ? 11  ILE I HD11 1 
ATOM   9567  H  HD12 . ILE E  2 11  ? 178.282 119.877 88.372  1.00 46.28  ? 11  ILE I HD12 1 
ATOM   9568  H  HD13 . ILE E  2 11  ? 178.436 119.479 89.902  1.00 46.28  ? 11  ILE I HD13 1 
ATOM   9569  N  N    . SER E  2 12  ? 183.117 122.804 90.595  1.00 57.27  ? 12  SER I N    1 
ATOM   9570  C  CA   . SER E  2 12  ? 184.560 122.926 90.695  1.00 57.27  ? 12  SER I CA   1 
ATOM   9571  C  C    . SER E  2 12  ? 185.178 121.620 91.171  1.00 57.27  ? 12  SER I C    1 
ATOM   9572  O  O    . SER E  2 12  ? 184.488 120.661 91.529  1.00 57.27  ? 12  SER I O    1 
ATOM   9573  C  CB   . SER E  2 12  ? 184.929 124.058 91.655  1.00 57.27  ? 12  SER I CB   1 
ATOM   9574  O  OG   . SER E  2 12  ? 184.414 123.795 92.947  1.00 57.27  ? 12  SER I OG   1 
ATOM   9575  H  H    . SER E  2 12  ? 182.726 122.795 91.359  1.00 57.27  ? 12  SER I H    1 
ATOM   9576  H  HA   . SER E  2 12  ? 184.928 123.136 89.823  1.00 57.27  ? 12  SER I HA   1 
ATOM   9577  H  HB2  . SER E  2 12  ? 185.895 124.129 91.706  1.00 57.27  ? 12  SER I HB2  1 
ATOM   9578  H  HB3  . SER E  2 12  ? 184.549 124.885 91.327  1.00 57.27  ? 12  SER I HB3  1 
ATOM   9579  H  HG   . SER E  2 12  ? 184.391 124.501 93.397  1.00 57.27  ? 12  SER I HG   1 
ATOM   9580  N  N    . ALA E  2 13  ? 186.509 121.603 91.171  1.00 73.18  ? 13  ALA I N    1 
ATOM   9581  C  CA   . ALA E  2 13  ? 187.279 120.498 91.722  1.00 73.18  ? 13  ALA I CA   1 
ATOM   9582  C  C    . ALA E  2 13  ? 188.146 121.006 92.861  1.00 73.18  ? 13  ALA I C    1 
ATOM   9583  O  O    . ALA E  2 13  ? 189.343 120.710 92.918  1.00 73.18  ? 13  ALA I O    1 
ATOM   9584  C  CB   . ALA E  2 13  ? 188.141 119.848 90.644  1.00 73.18  ? 13  ALA I CB   1 
ATOM   9585  H  H    . ALA E  2 13  ? 186.995 122.230 90.843  1.00 73.18  ? 13  ALA I H    1 
ATOM   9586  H  HA   . ALA E  2 13  ? 186.680 119.826 92.075  1.00 73.18  ? 13  ALA I HA   1 
ATOM   9587  H  HB1  . ALA E  2 13  ? 188.640 119.118 91.041  1.00 73.18  ? 13  ALA I HB1  1 
ATOM   9588  H  HB2  . ALA E  2 13  ? 187.565 119.517 89.939  1.00 73.18  ? 13  ALA I HB2  1 
ATOM   9589  H  HB3  . ALA E  2 13  ? 188.750 120.516 90.294  1.00 73.18  ? 13  ALA I HB3  1 
ATOM   9590  N  N    . VAL E  2 14  ? 187.550 121.788 93.764  1.00 77.49  ? 14  VAL I N    1 
ATOM   9591  C  CA   . VAL E  2 14  ? 188.328 122.444 94.802  1.00 77.49  ? 14  VAL I CA   1 
ATOM   9592  C  C    . VAL E  2 14  ? 189.134 121.406 95.572  1.00 77.49  ? 14  VAL I C    1 
ATOM   9593  O  O    . VAL E  2 14  ? 188.750 120.234 95.677  1.00 77.49  ? 14  VAL I O    1 
ATOM   9594  C  CB   . VAL E  2 14  ? 187.422 123.248 95.750  1.00 77.49  ? 14  VAL I CB   1 
ATOM   9595  C  CG1  . VAL E  2 14  ? 186.602 122.327 96.633  1.00 77.49  ? 14  VAL I CG1  1 
ATOM   9596  C  CG2  . VAL E  2 14  ? 188.244 124.185 96.600  1.00 77.49  ? 14  VAL I CG2  1 
ATOM   9597  H  H    . VAL E  2 14  ? 186.706 121.946 93.795  1.00 77.49  ? 14  VAL I H    1 
ATOM   9598  H  HA   . VAL E  2 14  ? 188.947 123.062 94.386  1.00 77.49  ? 14  VAL I HA   1 
ATOM   9599  H  HB   . VAL E  2 14  ? 186.812 123.785 95.224  1.00 77.49  ? 14  VAL I HB   1 
ATOM   9600  H  HG11 . VAL E  2 14  ? 186.006 122.868 97.172  1.00 77.49  ? 14  VAL I HG11 1 
ATOM   9601  H  HG12 . VAL E  2 14  ? 186.091 121.726 96.071  1.00 77.49  ? 14  VAL I HG12 1 
ATOM   9602  H  HG13 . VAL E  2 14  ? 187.191 121.822 97.212  1.00 77.49  ? 14  VAL I HG13 1 
ATOM   9603  H  HG21 . VAL E  2 14  ? 187.643 124.767 97.088  1.00 77.49  ? 14  VAL I HG21 1 
ATOM   9604  H  HG22 . VAL E  2 14  ? 188.773 123.659 97.220  1.00 77.49  ? 14  VAL I HG22 1 
ATOM   9605  H  HG23 . VAL E  2 14  ? 188.823 124.709 96.025  1.00 77.49  ? 14  VAL I HG23 1 
ATOM   9606  N  N    . THR E  2 15  ? 190.264 121.844 96.113  1.00 91.04  ? 15  THR I N    1 
ATOM   9607  C  CA   . THR E  2 15  ? 191.150 120.987 96.886  1.00 91.04  ? 15  THR I CA   1 
ATOM   9608  C  C    . THR E  2 15  ? 190.865 121.209 98.369  1.00 91.04  ? 15  THR I C    1 
ATOM   9609  O  O    . THR E  2 15  ? 190.935 122.341 98.859  1.00 91.04  ? 15  THR I O    1 
ATOM   9610  C  CB   . THR E  2 15  ? 192.614 121.265 96.529  1.00 91.04  ? 15  THR I CB   1 
ATOM   9611  O  OG1  . THR E  2 15  ? 193.469 120.334 97.204  1.00 91.04  ? 15  THR I OG1  1 
ATOM   9612  C  CG2  . THR E  2 15  ? 193.020 122.693 96.863  1.00 91.04  ? 15  THR I CG2  1 
ATOM   9613  H  H    . THR E  2 15  ? 190.542 122.654 96.050  1.00 91.04  ? 15  THR I H    1 
ATOM   9614  H  HA   . THR E  2 15  ? 190.959 120.061 96.673  1.00 91.04  ? 15  THR I HA   1 
ATOM   9615  H  HB   . THR E  2 15  ? 192.718 121.154 95.571  1.00 91.04  ? 15  THR I HB   1 
ATOM   9616  H  HG1  . THR E  2 15  ? 194.271 120.552 97.084  1.00 91.04  ? 15  THR I HG1  1 
ATOM   9617  H  HG21 . THR E  2 15  ? 193.962 122.810 96.656  1.00 91.04  ? 15  THR I HG21 1 
ATOM   9618  H  HG22 . THR E  2 15  ? 192.504 123.337 96.348  1.00 91.04  ? 15  THR I HG22 1 
ATOM   9619  H  HG23 . THR E  2 15  ? 192.890 122.855 97.804  1.00 91.04  ? 15  THR I HG23 1 
ATOM   9620  N  N    . CYS E  2 16  ? 190.527 120.129 99.066  1.00 101.23 ? 16  CYS I N    1 
ATOM   9621  C  CA   . CYS E  2 16  ? 189.940 120.235 100.390 1.00 101.23 ? 16  CYS I CA   1 
ATOM   9622  C  C    . CYS E  2 16  ? 190.988 120.664 101.417 1.00 101.23 ? 16  CYS I C    1 
ATOM   9623  O  O    . CYS E  2 16  ? 192.175 120.359 101.272 1.00 101.23 ? 16  CYS I O    1 
ATOM   9624  C  CB   . CYS E  2 16  ? 189.331 118.897 100.799 1.00 101.23 ? 16  CYS I CB   1 
ATOM   9625  S  SG   . CYS E  2 16  ? 188.466 118.857 102.396 1.00 101.23 ? 16  CYS I SG   1 
ATOM   9626  H  H    . CYS E  2 16  ? 190.633 119.320 98.792  1.00 101.23 ? 16  CYS I H    1 
ATOM   9627  H  HA   . CYS E  2 16  ? 189.235 120.897 100.361 1.00 101.23 ? 16  CYS I HA   1 
ATOM   9628  H  HB2  . CYS E  2 16  ? 188.704 118.620 100.115 1.00 101.23 ? 16  CYS I HB2  1 
ATOM   9629  H  HB3  . CYS E  2 16  ? 190.055 118.259 100.856 1.00 101.23 ? 16  CYS I HB3  1 
ATOM   9630  N  N    . PRO E  2 17  ? 190.577 121.377 102.463 1.00 108.77 ? 17  PRO I N    1 
ATOM   9631  C  CA   . PRO E  2 17  ? 191.506 121.710 103.545 1.00 108.77 ? 17  PRO I CA   1 
ATOM   9632  C  C    . PRO E  2 17  ? 191.857 120.485 104.368 1.00 108.77 ? 17  PRO I C    1 
ATOM   9633  O  O    . PRO E  2 17  ? 191.264 119.412 104.185 1.00 108.77 ? 17  PRO I O    1 
ATOM   9634  C  CB   . PRO E  2 17  ? 190.724 122.736 104.381 1.00 108.77 ? 17  PRO I CB   1 
ATOM   9635  C  CG   . PRO E  2 17  ? 189.298 122.447 104.074 1.00 108.77 ? 17  PRO I CG   1 
ATOM   9636  C  CD   . PRO E  2 17  ? 189.291 122.072 102.631 1.00 108.77 ? 17  PRO I CD   1 
ATOM   9637  H  HA   . PRO E  2 17  ? 192.312 122.117 103.188 1.00 108.77 ? 17  PRO I HA   1 
ATOM   9638  H  HB2  . PRO E  2 17  ? 190.909 122.602 105.322 1.00 108.77 ? 17  PRO I HB2  1 
ATOM   9639  H  HB3  . PRO E  2 17  ? 190.960 123.634 104.102 1.00 108.77 ? 17  PRO I HB3  1 
ATOM   9640  H  HG2  . PRO E  2 17  ? 188.998 121.705 104.620 1.00 108.77 ? 17  PRO I HG2  1 
ATOM   9641  H  HG3  . PRO E  2 17  ? 188.759 123.235 104.234 1.00 108.77 ? 17  PRO I HG3  1 
ATOM   9642  H  HD2  . PRO E  2 17  ? 188.544 121.487 102.437 1.00 108.77 ? 17  PRO I HD2  1 
ATOM   9643  H  HD3  . PRO E  2 17  ? 189.265 122.866 102.077 1.00 108.77 ? 17  PRO I HD3  1 
ATOM   9644  N  N    . PRO E  2 18  ? 192.818 120.601 105.281 1.00 111.62 ? 18  PRO I N    1 
ATOM   9645  C  CA   . PRO E  2 18  ? 193.184 119.455 106.120 1.00 111.62 ? 18  PRO I CA   1 
ATOM   9646  C  C    . PRO E  2 18  ? 192.108 119.138 107.147 1.00 111.62 ? 18  PRO I C    1 
ATOM   9647  O  O    . PRO E  2 18  ? 191.240 119.958 107.457 1.00 111.62 ? 18  PRO I O    1 
ATOM   9648  C  CB   . PRO E  2 18  ? 194.479 119.905 106.808 1.00 111.62 ? 18  PRO I CB   1 
ATOM   9649  C  CG   . PRO E  2 18  ? 194.882 121.186 106.132 1.00 111.62 ? 18  PRO I CG   1 
ATOM   9650  C  CD   . PRO E  2 18  ? 193.637 121.783 105.587 1.00 111.62 ? 18  PRO I CD   1 
ATOM   9651  H  HA   . PRO E  2 18  ? 193.355 118.673 105.577 1.00 111.62 ? 18  PRO I HA   1 
ATOM   9652  H  HB2  . PRO E  2 18  ? 194.304 120.058 107.750 1.00 111.62 ? 18  PRO I HB2  1 
ATOM   9653  H  HB3  . PRO E  2 18  ? 195.158 119.225 106.691 1.00 111.62 ? 18  PRO I HB3  1 
ATOM   9654  H  HG2  . PRO E  2 18  ? 195.288 121.779 106.782 1.00 111.62 ? 18  PRO I HG2  1 
ATOM   9655  H  HG3  . PRO E  2 18  ? 195.505 120.984 105.417 1.00 111.62 ? 18  PRO I HG3  1 
ATOM   9656  H  HD2  . PRO E  2 18  ? 193.202 122.337 106.255 1.00 111.62 ? 18  PRO I HD2  1 
ATOM   9657  H  HD3  . PRO E  2 18  ? 193.832 122.283 104.781 1.00 111.62 ? 18  PRO I HD3  1 
ATOM   9658  N  N    . GLY E  2 19  ? 192.187 117.923 107.676 1.00 109.09 ? 19  GLY I N    1 
ATOM   9659  C  CA   . GLY E  2 19  ? 191.223 117.449 108.647 1.00 109.09 ? 19  GLY I CA   1 
ATOM   9660  C  C    . GLY E  2 19  ? 189.968 116.869 108.055 1.00 109.09 ? 19  GLY I C    1 
ATOM   9661  O  O    . GLY E  2 19  ? 189.106 116.391 108.814 1.00 109.09 ? 19  GLY I O    1 
ATOM   9662  H  H    . GLY E  2 19  ? 192.791 117.345 107.480 1.00 109.09 ? 19  GLY I H    1 
ATOM   9663  H  HA2  . GLY E  2 19  ? 191.633 116.771 109.204 1.00 109.09 ? 19  GLY I HA2  1 
ATOM   9664  H  HA3  . GLY E  2 19  ? 190.956 118.203 109.204 1.00 109.09 ? 19  GLY I HA3  1 
ATOM   9665  N  N    . GLU E  2 20  ? 189.825 116.897 106.733 1.00 102.79 ? 20  GLU I N    1 
ATOM   9666  C  CA   . GLU E  2 20  ? 188.601 116.501 106.045 1.00 102.79 ? 20  GLU I CA   1 
ATOM   9667  C  C    . GLU E  2 20  ? 189.028 115.732 104.800 1.00 102.79 ? 20  GLU I C    1 
ATOM   9668  O  O    . GLU E  2 20  ? 189.313 116.321 103.758 1.00 102.79 ? 20  GLU I O    1 
ATOM   9669  C  CB   . GLU E  2 20  ? 187.754 117.715 105.697 1.00 102.79 ? 20  GLU I CB   1 
ATOM   9670  C  CG   . GLU E  2 20  ? 187.134 118.369 106.917 1.00 102.79 ? 20  GLU I CG   1 
ATOM   9671  C  CD   . GLU E  2 20  ? 186.689 119.806 106.669 1.00 102.79 ? 20  GLU I CD   1 
ATOM   9672  O  OE1  . GLU E  2 20  ? 187.313 120.535 105.863 1.00 102.79 ? 20  GLU I OE1  1 
ATOM   9673  O  OE2  . GLU E  2 20  ? 185.696 120.204 107.300 1.00 102.79 ? 20  GLU I OE2  1 
ATOM   9674  H  H    . GLU E  2 20  ? 190.430 117.124 106.190 1.00 102.79 ? 20  GLU I H    1 
ATOM   9675  H  HA   . GLU E  2 20  ? 188.100 115.910 106.608 1.00 102.79 ? 20  GLU I HA   1 
ATOM   9676  H  HB2  . GLU E  2 20  ? 188.315 118.379 105.249 1.00 102.79 ? 20  GLU I HB2  1 
ATOM   9677  H  HB3  . GLU E  2 20  ? 187.047 117.444 105.109 1.00 102.79 ? 20  GLU I HB3  1 
ATOM   9678  H  HG2  . GLU E  2 20  ? 186.353 117.868 107.208 1.00 102.79 ? 20  GLU I HG2  1 
ATOM   9679  H  HG3  . GLU E  2 20  ? 187.783 118.365 107.655 1.00 102.79 ? 20  GLU I HG3  1 
ATOM   9680  N  N    . ASN E  2 21  ? 189.069 114.402 104.911 1.00 99.59  ? 21  ASN I N    1 
ATOM   9681  C  CA   . ASN E  2 21  ? 189.583 113.543 103.857 1.00 99.59  ? 21  ASN I CA   1 
ATOM   9682  C  C    . ASN E  2 21  ? 188.509 112.608 103.324 1.00 99.59  ? 21  ASN I C    1 
ATOM   9683  O  O    . ASN E  2 21  ? 188.819 111.526 102.821 1.00 99.59  ? 21  ASN I O    1 
ATOM   9684  C  CB   . ASN E  2 21  ? 190.785 112.750 104.355 1.00 99.59  ? 21  ASN I CB   1 
ATOM   9685  C  CG   . ASN E  2 21  ? 192.008 113.618 104.564 1.00 99.59  ? 21  ASN I CG   1 
ATOM   9686  O  OD1  . ASN E  2 21  ? 192.079 114.742 104.072 1.00 99.59  ? 21  ASN I OD1  1 
ATOM   9687  N  ND2  . ASN E  2 21  ? 192.979 113.102 105.303 1.00 99.59  ? 21  ASN I ND2  1 
ATOM   9688  H  H    . ASN E  2 21  ? 188.789 113.966 105.594 1.00 99.59  ? 21  ASN I H    1 
ATOM   9689  H  HA   . ASN E  2 21  ? 189.875 114.092 103.116 1.00 99.59  ? 21  ASN I HA   1 
ATOM   9690  H  HB2  . ASN E  2 21  ? 190.562 112.339 105.206 1.00 99.59  ? 21  ASN I HB2  1 
ATOM   9691  H  HB3  . ASN E  2 21  ? 191.010 112.063 103.702 1.00 99.59  ? 21  ASN I HB3  1 
ATOM   9692  H  HD21 . ASN E  2 21  ? 193.692 113.560 105.453 1.00 99.59  ? 21  ASN I HD21 1 
ATOM   9693  H  HD22 . ASN E  2 21  ? 192.892 112.315 105.631 1.00 99.59  ? 21  ASN I HD22 1 
ATOM   9694  N  N    . LEU E  2 22  ? 187.249 113.020 103.421 1.00 94.53  ? 22  LEU I N    1 
ATOM   9695  C  CA   . LEU E  2 22  ? 186.128 112.263 102.880 1.00 94.53  ? 22  LEU I CA   1 
ATOM   9696  C  C    . LEU E  2 22  ? 185.317 113.183 101.981 1.00 94.53  ? 22  LEU I C    1 
ATOM   9697  O  O    . LEU E  2 22  ? 184.637 114.097 102.466 1.00 94.53  ? 22  LEU I O    1 
ATOM   9698  C  CB   . LEU E  2 22  ? 185.260 111.686 103.993 1.00 94.53  ? 22  LEU I CB   1 
ATOM   9699  C  CG   . LEU E  2 22  ? 185.924 110.598 104.835 1.00 94.53  ? 22  LEU I CG   1 
ATOM   9700  C  CD1  . LEU E  2 22  ? 185.004 110.198 105.951 1.00 94.53  ? 22  LEU I CD1  1 
ATOM   9701  C  CD2  . LEU E  2 22  ? 186.279 109.391 103.996 1.00 94.53  ? 22  LEU I CD2  1 
ATOM   9702  H  H    . LEU E  2 22  ? 187.014 113.752 103.807 1.00 94.53  ? 22  LEU I H    1 
ATOM   9703  H  HA   . LEU E  2 22  ? 186.456 111.535 102.334 1.00 94.53  ? 22  LEU I HA   1 
ATOM   9704  H  HB2  . LEU E  2 22  ? 185.017 112.406 104.595 1.00 94.53  ? 22  LEU I HB2  1 
ATOM   9705  H  HB3  . LEU E  2 22  ? 184.460 111.306 103.600 1.00 94.53  ? 22  LEU I HB3  1 
ATOM   9706  H  HG   . LEU E  2 22  ? 186.738 110.949 105.224 1.00 94.53  ? 22  LEU I HG   1 
ATOM   9707  H  HD11 . LEU E  2 22  ? 185.521 109.792 106.665 1.00 94.53  ? 22  LEU I HD11 1 
ATOM   9708  H  HD12 . LEU E  2 22  ? 184.561 110.996 106.269 1.00 94.53  ? 22  LEU I HD12 1 
ATOM   9709  H  HD13 . LEU E  2 22  ? 184.347 109.573 105.612 1.00 94.53  ? 22  LEU I HD13 1 
ATOM   9710  H  HD21 . LEU E  2 22  ? 186.658 108.706 104.571 1.00 94.53  ? 22  LEU I HD21 1 
ATOM   9711  H  HD22 . LEU E  2 22  ? 185.476 109.052 103.573 1.00 94.53  ? 22  LEU I HD22 1 
ATOM   9712  H  HD23 . LEU E  2 22  ? 186.926 109.649 103.324 1.00 94.53  ? 22  LEU I HD23 1 
ATOM   9713  N  N    . CYS E  2 23  ? 185.404 112.944 100.675 1.00 82.41  ? 23  CYS I N    1 
ATOM   9714  C  CA   . CYS E  2 23  ? 184.487 113.542 99.729  1.00 82.41  ? 23  CYS I CA   1 
ATOM   9715  C  C    . CYS E  2 23  ? 183.134 112.853 99.836  1.00 82.41  ? 23  CYS I C    1 
ATOM   9716  O  O    . CYS E  2 23  ? 183.046 111.622 99.876  1.00 82.41  ? 23  CYS I O    1 
ATOM   9717  C  CB   . CYS E  2 23  ? 185.014 113.424 98.301  1.00 82.41  ? 23  CYS I CB   1 
ATOM   9718  S  SG   . CYS E  2 23  ? 186.762 113.801 98.079  1.00 82.41  ? 23  CYS I SG   1 
ATOM   9719  H  H    . CYS E  2 23  ? 185.990 112.433 100.315 1.00 82.41  ? 23  CYS I H    1 
ATOM   9720  H  HA   . CYS E  2 23  ? 184.366 114.480 99.940  1.00 82.41  ? 23  CYS I HA   1 
ATOM   9721  H  HB2  . CYS E  2 23  ? 184.875 112.516 97.999  1.00 82.41  ? 23  CYS I HB2  1 
ATOM   9722  H  HB3  . CYS E  2 23  ? 184.509 114.035 97.737  1.00 82.41  ? 23  CYS I HB3  1 
ATOM   9723  N  N    . TYR E  2 24  ? 182.074 113.652 99.879  1.00 63.03  ? 24  TYR I N    1 
ATOM   9724  C  CA   . TYR E  2 24  ? 180.729 113.136 100.030 1.00 63.03  ? 24  TYR I CA   1 
ATOM   9725  C  C    . TYR E  2 24  ? 179.800 113.850 99.072  1.00 63.03  ? 24  TYR I C    1 
ATOM   9726  O  O    . TYR E  2 24  ? 180.091 114.926 98.549  1.00 63.03  ? 24  TYR I O    1 
ATOM   9727  C  CB   . TYR E  2 24  ? 180.175 113.324 101.439 1.00 63.03  ? 24  TYR I CB   1 
ATOM   9728  C  CG   . TYR E  2 24  ? 179.605 114.704 101.652 1.00 63.03  ? 24  TYR I CG   1 
ATOM   9729  C  CD1  . TYR E  2 24  ? 180.418 115.759 102.017 1.00 63.03  ? 24  TYR I CD1  1 
ATOM   9730  C  CD2  . TYR E  2 24  ? 178.254 114.955 101.461 1.00 63.03  ? 24  TYR I CD2  1 
ATOM   9731  C  CE1  . TYR E  2 24  ? 179.904 117.021 102.200 1.00 63.03  ? 24  TYR I CE1  1 
ATOM   9732  C  CE2  . TYR E  2 24  ? 177.734 116.214 101.637 1.00 63.03  ? 24  TYR I CE2  1 
ATOM   9733  C  CZ   . TYR E  2 24  ? 178.561 117.243 102.007 1.00 63.03  ? 24  TYR I CZ   1 
ATOM   9734  O  OH   . TYR E  2 24  ? 178.044 118.503 102.187 1.00 63.03  ? 24  TYR I OH   1 
ATOM   9735  H  H    . TYR E  2 24  ? 182.112 114.509 99.821  1.00 63.03  ? 24  TYR I H    1 
ATOM   9736  H  HA   . TYR E  2 24  ? 180.716 112.192 99.814  1.00 63.03  ? 24  TYR I HA   1 
ATOM   9737  H  HB2  . TYR E  2 24  ? 179.457 112.686 101.569 1.00 63.03  ? 24  TYR I HB2  1 
ATOM   9738  H  HB3  . TYR E  2 24  ? 180.880 113.178 102.084 1.00 63.03  ? 24  TYR I HB3  1 
ATOM   9739  H  HD1  . TYR E  2 24  ? 181.325 115.606 102.145 1.00 63.03  ? 24  TYR I HD1  1 
ATOM   9740  H  HD2  . TYR E  2 24  ? 177.695 114.258 101.206 1.00 63.03  ? 24  TYR I HD2  1 
ATOM   9741  H  HE1  . TYR E  2 24  ? 180.461 117.721 102.448 1.00 63.03  ? 24  TYR I HE1  1 
ATOM   9742  H  HE2  . TYR E  2 24  ? 176.827 116.368 101.508 1.00 63.03  ? 24  TYR I HE2  1 
ATOM   9743  H  HH   . TYR E  2 24  ? 177.226 118.498 102.001 1.00 63.03  ? 24  TYR I HH   1 
ATOM   9744  N  N    . ARG E  2 25  ? 178.641 113.229 98.897  1.00 51.08  ? 25  ARG I N    1 
ATOM   9745  C  CA   . ARG E  2 25  ? 177.546 113.769 98.115  1.00 51.08  ? 25  ARG I CA   1 
ATOM   9746  C  C    . ARG E  2 25  ? 176.219 113.323 98.716  1.00 51.08  ? 25  ARG I C    1 
ATOM   9747  O  O    . ARG E  2 25  ? 176.100 112.198 99.189  1.00 51.08  ? 25  ARG I O    1 
ATOM   9748  C  CB   . ARG E  2 25  ? 177.672 113.308 96.688  1.00 51.08  ? 25  ARG I CB   1 
ATOM   9749  C  CG   . ARG E  2 25  ? 177.401 111.859 96.575  1.00 51.08  ? 25  ARG I CG   1 
ATOM   9750  C  CD   . ARG E  2 25  ? 177.587 111.419 95.179  1.00 51.08  ? 25  ARG I CD   1 
ATOM   9751  N  NE   . ARG E  2 25  ? 176.549 111.892 94.294  1.00 51.08  ? 25  ARG I NE   1 
ATOM   9752  C  CZ   . ARG E  2 25  ? 176.352 111.405 93.076  1.00 51.08  ? 25  ARG I CZ   1 
ATOM   9753  N  NH1  . ARG E  2 25  ? 177.191 110.500 92.589  1.00 51.08  ? 25  ARG I NH1  1 
ATOM   9754  N  NH2  . ARG E  2 25  ? 175.375 111.898 92.331  1.00 51.08  ? 25  ARG I NH2  1 
ATOM   9755  H  H    . ARG E  2 25  ? 178.469 112.451 99.219  1.00 51.08  ? 25  ARG I H    1 
ATOM   9756  H  HA   . ARG E  2 25  ? 177.599 114.732 98.137  1.00 51.08  ? 25  ARG I HA   1 
ATOM   9757  H  HB2  . ARG E  2 25  ? 177.012 113.774 96.146  1.00 51.08  ? 25  ARG I HB2  1 
ATOM   9758  H  HB3  . ARG E  2 25  ? 178.561 113.482 96.373  1.00 51.08  ? 25  ARG I HB3  1 
ATOM   9759  H  HG2  . ARG E  2 25  ? 178.038 111.390 97.135  1.00 51.08  ? 25  ARG I HG2  1 
ATOM   9760  H  HG3  . ARG E  2 25  ? 176.482 111.667 96.839  1.00 51.08  ? 25  ARG I HG3  1 
ATOM   9761  H  HD2  . ARG E  2 25  ? 178.436 111.790 94.866  1.00 51.08  ? 25  ARG I HD2  1 
ATOM   9762  H  HD3  . ARG E  2 25  ? 177.606 110.466 95.138  1.00 51.08  ? 25  ARG I HD3  1 
ATOM   9763  H  HE   . ARG E  2 25  ? 175.836 112.192 94.693  1.00 51.08  ? 25  ARG I HE   1 
ATOM   9764  H  HH11 . ARG E  2 25  ? 177.860 110.215 93.087  1.00 51.08  ? 25  ARG I HH11 1 
ATOM   9765  H  HH12 . ARG E  2 25  ? 177.079 110.227 91.773  1.00 51.08  ? 25  ARG I HH12 1 
ATOM   9766  H  HH21 . ARG E  2 25  ? 174.830 112.505 92.660  1.00 51.08  ? 25  ARG I HH21 1 
ATOM   9767  H  HH22 . ARG E  2 25  ? 175.247 111.607 91.534  1.00 51.08  ? 25  ARG I HH22 1 
ATOM   9768  N  N    . LYS E  2 26  ? 175.249 114.215 98.669  1.00 46.83  ? 26  LYS I N    1 
ATOM   9769  C  CA   . LYS E  2 26  ? 173.963 114.017 99.278  1.00 46.83  ? 26  LYS I CA   1 
ATOM   9770  C  C    . LYS E  2 26  ? 172.882 114.350 98.271  1.00 46.83  ? 26  LYS I C    1 
ATOM   9771  O  O    . LYS E  2 26  ? 172.958 115.379 97.595  1.00 46.83  ? 26  LYS I O    1 
ATOM   9772  C  CB   . LYS E  2 26  ? 173.824 114.890 100.519 1.00 46.83  ? 26  LYS I CB   1 
ATOM   9773  C  CG   . LYS E  2 26  ? 172.721 114.489 101.434 1.00 46.83  ? 26  LYS I CG   1 
ATOM   9774  C  CD   . LYS E  2 26  ? 172.965 115.072 102.795 1.00 46.83  ? 26  LYS I CD   1 
ATOM   9775  C  CE   . LYS E  2 26  ? 172.864 116.582 102.747 1.00 46.83  ? 26  LYS I CE   1 
ATOM   9776  N  NZ   . LYS E  2 26  ? 172.848 117.198 104.095 1.00 46.83  ? 26  LYS I NZ   1 
ATOM   9777  H  H    . LYS E  2 26  ? 175.322 114.975 98.272  1.00 46.83  ? 26  LYS I H    1 
ATOM   9778  H  HA   . LYS E  2 26  ? 173.861 113.093 99.545  1.00 46.83  ? 26  LYS I HA   1 
ATOM   9779  H  HB2  . LYS E  2 26  ? 174.656 114.855 101.014 1.00 46.83  ? 26  LYS I HB2  1 
ATOM   9780  H  HB3  . LYS E  2 26  ? 173.651 115.797 100.233 1.00 46.83  ? 26  LYS I HB3  1 
ATOM   9781  H  HG2  . LYS E  2 26  ? 171.888 114.835 101.092 1.00 46.83  ? 26  LYS I HG2  1 
ATOM   9782  H  HG3  . LYS E  2 26  ? 172.691 113.522 101.504 1.00 46.83  ? 26  LYS I HG3  1 
ATOM   9783  H  HD2  . LYS E  2 26  ? 172.314 114.722 103.417 1.00 46.83  ? 26  LYS I HD2  1 
ATOM   9784  H  HD3  . LYS E  2 26  ? 173.854 114.841 103.078 1.00 46.83  ? 26  LYS I HD3  1 
ATOM   9785  H  HE2  . LYS E  2 26  ? 173.635 116.927 102.269 1.00 46.83  ? 26  LYS I HE2  1 
ATOM   9786  H  HE3  . LYS E  2 26  ? 172.049 116.833 102.286 1.00 46.83  ? 26  LYS I HE3  1 
ATOM   9787  H  HZ1  . LYS E  2 26  ? 172.864 118.086 104.024 1.00 46.83  ? 26  LYS I HZ1  1 
ATOM   9788  H  HZ2  . LYS E  2 26  ? 172.111 116.956 104.529 1.00 46.83  ? 26  LYS I HZ2  1 
ATOM   9789  H  HZ3  . LYS E  2 26  ? 173.558 116.932 104.558 1.00 46.83  ? 26  LYS I HZ3  1 
ATOM   9790  N  N    . MET E  2 27  ? 171.888 113.469 98.155  1.00 42.52  ? 27  MET I N    1 
ATOM   9791  C  CA   . MET E  2 27  ? 170.908 113.548 97.082  1.00 42.52  ? 27  MET I CA   1 
ATOM   9792  C  C    . MET E  2 27  ? 169.531 113.200 97.611  1.00 42.52  ? 27  MET I C    1 
ATOM   9793  O  O    . MET E  2 27  ? 169.374 112.205 98.324  1.00 42.52  ? 27  MET I O    1 
ATOM   9794  C  CB   . MET E  2 27  ? 171.328 112.604 95.955  1.00 42.52  ? 27  MET I CB   1 
ATOM   9795  C  CG   . MET E  2 27  ? 172.620 113.048 95.311  1.00 42.52  ? 27  MET I CG   1 
ATOM   9796  S  SD   . MET E  2 27  ? 173.218 112.067 93.924  1.00 42.52  ? 27  MET I SD   1 
ATOM   9797  C  CE   . MET E  2 27  ? 171.748 111.942 92.937  1.00 42.52  ? 27  MET I CE   1 
ATOM   9798  H  H    . MET E  2 27  ? 171.766 112.810 98.686  1.00 42.52  ? 27  MET I H    1 
ATOM   9799  H  HA   . MET E  2 27  ? 170.904 114.444 96.731  1.00 42.52  ? 27  MET I HA   1 
ATOM   9800  H  HB2  . MET E  2 27  ? 171.439 111.713 96.310  1.00 42.52  ? 27  MET I HB2  1 
ATOM   9801  H  HB3  . MET E  2 27  ? 170.635 112.611 95.283  1.00 42.52  ? 27  MET I HB3  1 
ATOM   9802  H  HG2  . MET E  2 27  ? 172.479 113.941 94.971  1.00 42.52  ? 27  MET I HG2  1 
ATOM   9803  H  HG3  . MET E  2 27  ? 173.311 113.058 95.989  1.00 42.52  ? 27  MET I HG3  1 
ATOM   9804  H  HE1  . MET E  2 27  ? 171.933 111.308 92.208  1.00 42.52  ? 27  MET I HE1  1 
ATOM   9805  H  HE2  . MET E  2 27  ? 171.034 111.631 93.514  1.00 42.52  ? 27  MET I HE2  1 
ATOM   9806  H  HE3  . MET E  2 27  ? 171.527 112.817 92.572  1.00 42.52  ? 27  MET I HE3  1 
ATOM   9807  N  N    . TRP E  2 28  ? 168.544 114.015 97.264  1.00 33.23  ? 28  TRP I N    1 
ATOM   9808  C  CA   . TRP E  2 28  ? 167.160 113.767 97.656  1.00 33.23  ? 28  TRP I CA   1 
ATOM   9809  C  C    . TRP E  2 28  ? 166.225 114.434 96.659  1.00 33.23  ? 28  TRP I C    1 
ATOM   9810  O  O    . TRP E  2 28  ? 166.634 115.291 95.874  1.00 33.23  ? 28  TRP I O    1 
ATOM   9811  C  CB   . TRP E  2 28  ? 166.880 114.269 99.073  1.00 33.23  ? 28  TRP I CB   1 
ATOM   9812  C  CG   . TRP E  2 28  ? 166.755 115.745 99.200  1.00 33.23  ? 28  TRP I CG   1 
ATOM   9813  C  CD1  . TRP E  2 28  ? 165.600 116.467 99.241  1.00 33.23  ? 28  TRP I CD1  1 
ATOM   9814  C  CD2  . TRP E  2 28  ? 167.820 116.683 99.331  1.00 33.23  ? 28  TRP I CD2  1 
ATOM   9815  N  NE1  . TRP E  2 28  ? 165.887 117.804 99.382  1.00 33.23  ? 28  TRP I NE1  1 
ATOM   9816  C  CE2  . TRP E  2 28  ? 167.244 117.960 99.439  1.00 33.23  ? 28  TRP I CE2  1 
ATOM   9817  C  CE3  . TRP E  2 28  ? 169.210 116.569 99.364  1.00 33.23  ? 28  TRP I CE3  1 
ATOM   9818  C  CZ2  . TRP E  2 28  ? 168.004 119.110 99.574  1.00 33.23  ? 28  TRP I CZ2  1 
ATOM   9819  C  CZ3  . TRP E  2 28  ? 169.962 117.709 99.498  1.00 33.23  ? 28  TRP I CZ3  1 
ATOM   9820  C  CH2  . TRP E  2 28  ? 169.357 118.964 99.602  1.00 33.23  ? 28  TRP I CH2  1 
ATOM   9821  H  H    . TRP E  2 28  ? 168.648 114.728 96.804  1.00 33.23  ? 28  TRP I H    1 
ATOM   9822  H  HA   . TRP E  2 28  ? 166.995 112.815 97.631  1.00 33.23  ? 28  TRP I HA   1 
ATOM   9823  H  HB2  . TRP E  2 28  ? 166.051 113.878 99.377  1.00 33.23  ? 28  TRP I HB2  1 
ATOM   9824  H  HB3  . TRP E  2 28  ? 167.614 113.996 99.639  1.00 33.23  ? 28  TRP I HB3  1 
ATOM   9825  H  HD1  . TRP E  2 28  ? 164.746 116.110 99.181  1.00 33.23  ? 28  TRP I HD1  1 
ATOM   9826  H  HE1  . TRP E  2 28  ? 165.310 118.441 99.427  1.00 33.23  ? 28  TRP I HE1  1 
ATOM   9827  H  HE3  . TRP E  2 28  ? 169.615 115.737 99.295  1.00 33.23  ? 28  TRP I HE3  1 
ATOM   9828  H  HZ2  . TRP E  2 28  ? 167.606 119.946 99.644  1.00 33.23  ? 28  TRP I HZ2  1 
ATOM   9829  H  HZ3  . TRP E  2 28  ? 170.886 117.644 99.522  1.00 33.23  ? 28  TRP I HZ3  1 
ATOM   9830  H  HH2  . TRP E  2 28  ? 169.891 119.718 99.693  1.00 33.23  ? 28  TRP I HH2  1 
ATOM   9831  N  N    . CYS E  2 29  ? 164.961 114.024 96.697  1.00 28.50  ? 29  CYS I N    1 
ATOM   9832  C  CA   . CYS E  2 29  ? 163.933 114.597 95.847  1.00 28.50  ? 29  CYS I CA   1 
ATOM   9833  C  C    . CYS E  2 29  ? 163.352 115.833 96.515  1.00 28.50  ? 29  CYS I C    1 
ATOM   9834  O  O    . CYS E  2 29  ? 162.928 115.778 97.674  1.00 28.50  ? 29  CYS I O    1 
ATOM   9835  C  CB   . CYS E  2 29  ? 162.805 113.593 95.580  1.00 28.50  ? 29  CYS I CB   1 
ATOM   9836  S  SG   . CYS E  2 29  ? 163.024 112.422 94.212  1.00 28.50  ? 29  CYS I SG   1 
ATOM   9837  H  H    . CYS E  2 29  ? 164.674 113.413 97.225  1.00 28.50  ? 29  CYS I H    1 
ATOM   9838  H  HA   . CYS E  2 29  ? 164.314 114.856 94.997  1.00 28.50  ? 29  CYS I HA   1 
ATOM   9839  H  HB2  . CYS E  2 29  ? 162.678 113.069 96.382  1.00 28.50  ? 29  CYS I HB2  1 
ATOM   9840  H  HB3  . CYS E  2 29  ? 162.000 114.097 95.399  1.00 28.50  ? 29  CYS I HB3  1 
ATOM   9841  N  N    . ASP E  2 30  ? 163.335 116.938 95.788  1.00 28.09  ? 30  ASP I N    1 
ATOM   9842  C  CA   . ASP E  2 30  ? 162.539 118.092 96.146  1.00 28.09  ? 30  ASP I CA   1 
ATOM   9843  C  C    . ASP E  2 30  ? 161.240 118.028 95.356  1.00 28.09  ? 30  ASP I C    1 
ATOM   9844  O  O    . ASP E  2 30  ? 160.905 117.002 94.758  1.00 28.09  ? 30  ASP I O    1 
ATOM   9845  C  CB   . ASP E  2 30  ? 163.290 119.401 95.914  1.00 28.09  ? 30  ASP I CB   1 
ATOM   9846  C  CG   . ASP E  2 30  ? 163.851 119.522 94.527  1.00 28.09  ? 30  ASP I CG   1 
ATOM   9847  O  OD1  . ASP E  2 30  ? 163.271 118.944 93.586  1.00 28.09  ? 30  ASP I OD1  1 
ATOM   9848  O  OD2  . ASP E  2 30  ? 164.902 120.178 94.392  1.00 28.09  ? 30  ASP I OD2  1 
ATOM   9849  H  H    . ASP E  2 30  ? 163.765 117.038 95.052  1.00 28.09  ? 30  ASP I H    1 
ATOM   9850  H  HA   . ASP E  2 30  ? 162.316 118.038 97.082  1.00 28.09  ? 30  ASP I HA   1 
ATOM   9851  H  HB2  . ASP E  2 30  ? 162.693 120.146 96.061  1.00 28.09  ? 30  ASP I HB2  1 
ATOM   9852  H  HB3  . ASP E  2 30  ? 164.027 119.448 96.530  1.00 28.09  ? 30  ASP I HB3  1 
ATOM   9853  N  N    . VAL E  2 31  ? 160.486 119.125 95.363  1.00 18.50  ? 31  VAL I N    1 
ATOM   9854  C  CA   . VAL E  2 31  ? 159.239 119.162 94.612  1.00 18.50  ? 31  VAL I CA   1 
ATOM   9855  C  C    . VAL E  2 31  ? 159.497 118.829 93.151  1.00 18.50  ? 31  VAL I C    1 
ATOM   9856  O  O    . VAL E  2 31  ? 158.765 118.051 92.532  1.00 18.50  ? 31  VAL I O    1 
ATOM   9857  C  CB   . VAL E  2 31  ? 158.578 120.540 94.744  1.00 18.50  ? 31  VAL I CB   1 
ATOM   9858  C  CG1  . VAL E  2 31  ? 157.357 120.588 93.906  1.00 18.50  ? 31  VAL I CG1  1 
ATOM   9859  C  CG2  . VAL E  2 31  ? 158.214 120.815 96.137  1.00 18.50  ? 31  VAL I CG2  1 
ATOM   9860  H  H    . VAL E  2 31  ? 160.658 119.841 95.800  1.00 18.50  ? 31  VAL I H    1 
ATOM   9861  H  HA   . VAL E  2 31  ? 158.628 118.504 94.968  1.00 18.50  ? 31  VAL I HA   1 
ATOM   9862  H  HB   . VAL E  2 31  ? 159.197 121.220 94.445  1.00 18.50  ? 31  VAL I HB   1 
ATOM   9863  H  HG11 . VAL E  2 31  ? 156.986 121.481 93.962  1.00 18.50  ? 31  VAL I HG11 1 
ATOM   9864  H  HG12 . VAL E  2 31  ? 157.578 120.382 92.986  1.00 18.50  ? 31  VAL I HG12 1 
ATOM   9865  H  HG13 . VAL E  2 31  ? 156.722 119.941 94.246  1.00 18.50  ? 31  VAL I HG13 1 
ATOM   9866  H  HG21 . VAL E  2 31  ? 157.846 121.709 96.203  1.00 18.50  ? 31  VAL I HG21 1 
ATOM   9867  H  HG22 . VAL E  2 31  ? 157.532 120.161 96.335  1.00 18.50  ? 31  VAL I HG22 1 
ATOM   9868  H  HG23 . VAL E  2 31  ? 158.995 120.717 96.702  1.00 18.50  ? 31  VAL I HG23 1 
ATOM   9869  N  N    . PHE E  2 32  ? 160.532 119.427 92.577  1.00 17.10  ? 32  PHE I N    1 
ATOM   9870  C  CA   . PHE E  2 32  ? 160.817 119.274 91.156  1.00 17.10  ? 32  PHE I CA   1 
ATOM   9871  C  C    . PHE E  2 32  ? 161.660 118.034 90.894  1.00 17.10  ? 32  PHE I C    1 
ATOM   9872  O  O    . PHE E  2 32  ? 162.656 118.086 90.179  1.00 17.10  ? 32  PHE I O    1 
ATOM   9873  C  CB   . PHE E  2 32  ? 161.527 120.516 90.642  1.00 17.10  ? 32  PHE I CB   1 
ATOM   9874  C  CG   . PHE E  2 32  ? 160.912 121.808 91.087  1.00 17.10  ? 32  PHE I CG   1 
ATOM   9875  C  CD1  . PHE E  2 32  ? 161.310 122.401 92.267  1.00 17.10  ? 32  PHE I CD1  1 
ATOM   9876  C  CD2  . PHE E  2 32  ? 159.965 122.450 90.315  1.00 17.10  ? 32  PHE I CD2  1 
ATOM   9877  C  CE1  . PHE E  2 32  ? 160.762 123.589 92.678  1.00 17.10  ? 32  PHE I CE1  1 
ATOM   9878  C  CE2  . PHE E  2 32  ? 159.417 123.644 90.727  1.00 17.10  ? 32  PHE I CE2  1 
ATOM   9879  C  CZ   . PHE E  2 32  ? 159.819 124.211 91.909  1.00 17.10  ? 32  PHE I CZ   1 
ATOM   9880  H  H    . PHE E  2 32  ? 161.086 119.932 92.987  1.00 17.10  ? 32  PHE I H    1 
ATOM   9881  H  HA   . PHE E  2 32  ? 159.985 119.178 90.673  1.00 17.10  ? 32  PHE I HA   1 
ATOM   9882  H  HB2  . PHE E  2 32  ? 162.432 120.498 90.974  1.00 17.10  ? 32  PHE I HB2  1 
ATOM   9883  H  HB3  . PHE E  2 32  ? 161.525 120.497 89.676  1.00 17.10  ? 32  PHE I HB3  1 
ATOM   9884  H  HD1  . PHE E  2 32  ? 161.946 121.980 92.792  1.00 17.10  ? 32  PHE I HD1  1 
ATOM   9885  H  HD2  . PHE E  2 32  ? 159.688 122.070 89.514  1.00 17.10  ? 32  PHE I HD2  1 
ATOM   9886  H  HE1  . PHE E  2 32  ? 161.033 123.974 93.477  1.00 17.10  ? 32  PHE I HE1  1 
ATOM   9887  H  HE2  . PHE E  2 32  ? 158.777 124.065 90.205  1.00 17.10  ? 32  PHE I HE2  1 
ATOM   9888  H  HZ   . PHE E  2 32  ? 159.448 125.015 92.183  1.00 17.10  ? 32  PHE I HZ   1 
ATOM   9889  N  N    . CYS E  2 33  ? 161.255 116.898 91.449  1.00 26.00  ? 33  CYS I N    1 
ATOM   9890  C  CA   . CYS E  2 33  ? 161.968 115.652 91.234  1.00 26.00  ? 33  CYS I CA   1 
ATOM   9891  C  C    . CYS E  2 33  ? 161.384 114.855 90.078  1.00 26.00  ? 33  CYS I C    1 
ATOM   9892  O  O    . CYS E  2 33  ? 161.815 113.723 89.838  1.00 26.00  ? 33  CYS I O    1 
ATOM   9893  C  CB   . CYS E  2 33  ? 161.968 114.809 92.512  1.00 26.00  ? 33  CYS I CB   1 
ATOM   9894  S  SG   . CYS E  2 33  ? 163.225 113.495 92.492  1.00 26.00  ? 33  CYS I SG   1 
ATOM   9895  H  H    . CYS E  2 33  ? 160.570 116.824 91.955  1.00 26.00  ? 33  CYS I H    1 
ATOM   9896  H  HA   . CYS E  2 33  ? 162.887 115.856 91.020  1.00 26.00  ? 33  CYS I HA   1 
ATOM   9897  H  HB2  . CYS E  2 33  ? 162.153 115.393 93.261  1.00 26.00  ? 33  CYS I HB2  1 
ATOM   9898  H  HB3  . CYS E  2 33  ? 161.097 114.396 92.615  1.00 26.00  ? 33  CYS I HB3  1 
ATOM   9899  N  N    . SER E  2 34  ? 160.418 115.424 89.361  1.00 19.57  ? 34  SER I N    1 
ATOM   9900  C  CA   . SER E  2 34  ? 159.817 114.796 88.192  1.00 19.57  ? 34  SER I CA   1 
ATOM   9901  C  C    . SER E  2 34  ? 160.551 115.188 86.918  1.00 19.57  ? 34  SER I C    1 
ATOM   9902  O  O    . SER E  2 34  ? 160.836 114.336 86.072  1.00 19.57  ? 34  SER I O    1 
ATOM   9903  C  CB   . SER E  2 34  ? 158.345 115.193 88.087  1.00 19.57  ? 34  SER I CB   1 
ATOM   9904  O  OG   . SER E  2 34  ? 157.788 114.761 86.860  1.00 19.57  ? 34  SER I OG   1 
ATOM   9905  H  H    . SER E  2 34  ? 160.091 116.197 89.531  1.00 19.57  ? 34  SER I H    1 
ATOM   9906  H  HA   . SER E  2 34  ? 159.861 113.834 88.286  1.00 19.57  ? 34  SER I HA   1 
ATOM   9907  H  HB2  . SER E  2 34  ? 157.856 114.793 88.819  1.00 19.57  ? 34  SER I HB2  1 
ATOM   9908  H  HB3  . SER E  2 34  ? 158.284 116.158 88.133  1.00 19.57  ? 34  SER I HB3  1 
ATOM   9909  H  HG   . SER E  2 34  ? 157.064 115.164 86.722  1.00 19.57  ? 34  SER I HG   1 
ATOM   9910  N  N    . SER E  2 35  ? 160.859 116.473 86.772  1.00 17.80  ? 35  SER I N    1 
ATOM   9911  C  CA   . SER E  2 35  ? 161.582 116.999 85.623  1.00 17.80  ? 35  SER I CA   1 
ATOM   9912  C  C    . SER E  2 35  ? 163.062 117.205 85.912  1.00 17.80  ? 35  SER I C    1 
ATOM   9913  O  O    . SER E  2 35  ? 163.915 116.716 85.168  1.00 17.80  ? 35  SER I O    1 
ATOM   9914  C  CB   . SER E  2 35  ? 160.955 118.324 85.185  1.00 17.80  ? 35  SER I CB   1 
ATOM   9915  O  OG   . SER E  2 35  ? 160.751 119.177 86.295  1.00 17.80  ? 35  SER I OG   1 
ATOM   9916  H  H    . SER E  2 35  ? 160.649 117.072 87.341  1.00 17.80  ? 35  SER I H    1 
ATOM   9917  H  HA   . SER E  2 35  ? 161.503 116.373 84.886  1.00 17.80  ? 35  SER I HA   1 
ATOM   9918  H  HB2  . SER E  2 35  ? 161.552 118.761 84.561  1.00 17.80  ? 35  SER I HB2  1 
ATOM   9919  H  HB3  . SER E  2 35  ? 160.103 118.145 84.765  1.00 17.80  ? 35  SER I HB3  1 
ATOM   9920  H  HG   . SER E  2 35  ? 160.439 119.912 86.037  1.00 17.80  ? 35  SER I HG   1 
ATOM   9921  N  N    . ARG E  2 36  ? 163.381 117.925 86.984  1.00 17.58  ? 36  ARG I N    1 
ATOM   9922  C  CA   . ARG E  2 36  ? 164.767 118.242 87.293  1.00 17.58  ? 36  ARG I CA   1 
ATOM   9923  C  C    . ARG E  2 36  ? 165.512 117.055 87.889  1.00 17.58  ? 36  ARG I C    1 
ATOM   9924  O  O    . ARG E  2 36  ? 166.724 116.930 87.693  1.00 17.58  ? 36  ARG I O    1 
ATOM   9925  C  CB   . ARG E  2 36  ? 164.816 119.430 88.248  1.00 17.58  ? 36  ARG I CB   1 
ATOM   9926  C  CG   . ARG E  2 36  ? 163.978 120.600 87.817  1.00 17.58  ? 36  ARG I CG   1 
ATOM   9927  C  CD   . ARG E  2 36  ? 164.118 121.754 88.768  1.00 17.58  ? 36  ARG I CD   1 
ATOM   9928  N  NE   . ARG E  2 36  ? 163.348 122.916 88.354  1.00 17.58  ? 36  ARG I NE   1 
ATOM   9929  C  CZ   . ARG E  2 36  ? 163.251 124.035 89.060  1.00 17.58  ? 36  ARG I CZ   1 
ATOM   9930  N  NH1  . ARG E  2 36  ? 163.872 124.151 90.221  1.00 17.58  ? 36  ARG I NH1  1 
ATOM   9931  N  NH2  . ARG E  2 36  ? 162.526 125.041 88.606  1.00 17.58  ? 36  ARG I NH2  1 
ATOM   9932  H  H    . ARG E  2 36  ? 162.819 118.238 87.545  1.00 17.58  ? 36  ARG I H    1 
ATOM   9933  H  HA   . ARG E  2 36  ? 165.214 118.498 86.474  1.00 17.58  ? 36  ARG I HA   1 
ATOM   9934  H  HB2  . ARG E  2 36  ? 164.494 119.150 89.111  1.00 17.58  ? 36  ARG I HB2  1 
ATOM   9935  H  HB3  . ARG E  2 36  ? 165.724 119.746 88.306  1.00 17.58  ? 36  ARG I HB3  1 
ATOM   9936  H  HG2  . ARG E  2 36  ? 164.264 120.893 86.944  1.00 17.58  ? 36  ARG I HG2  1 
ATOM   9937  H  HG3  . ARG E  2 36  ? 163.049 120.336 87.800  1.00 17.58  ? 36  ARG I HG3  1 
ATOM   9938  H  HD2  . ARG E  2 36  ? 163.811 121.490 89.642  1.00 17.58  ? 36  ARG I HD2  1 
ATOM   9939  H  HD3  . ARG E  2 36  ? 165.045 122.012 88.807  1.00 17.58  ? 36  ARG I HD3  1 
ATOM   9940  H  HE   . ARG E  2 36  ? 163.070 122.939 87.544  1.00 17.58  ? 36  ARG I HE   1 
ATOM   9941  H  HH11 . ARG E  2 36  ? 164.343 123.503 90.523  1.00 17.58  ? 36  ARG I HH11 1 
ATOM   9942  H  HH12 . ARG E  2 36  ? 163.805 124.879 90.672  1.00 17.58  ? 36  ARG I HH12 1 
ATOM   9943  H  HH21 . ARG E  2 36  ? 162.121 124.969 87.851  1.00 17.58  ? 36  ARG I HH21 1 
ATOM   9944  H  HH22 . ARG E  2 36  ? 162.467 125.765 89.063  1.00 17.58  ? 36  ARG I HH22 1 
ATOM   9945  N  N    . GLY E  2 37  ? 164.819 116.176 88.594  1.00 22.94  ? 37  GLY I N    1 
ATOM   9946  C  CA   . GLY E  2 37  ? 165.466 115.081 89.282  1.00 22.94  ? 37  GLY I CA   1 
ATOM   9947  C  C    . GLY E  2 37  ? 165.816 115.430 90.713  1.00 22.94  ? 37  GLY I C    1 
ATOM   9948  O  O    . GLY E  2 37  ? 165.410 116.458 91.262  1.00 22.94  ? 37  GLY I O    1 
ATOM   9949  H  H    . GLY E  2 37  ? 163.970 116.192 88.684  1.00 22.94  ? 37  GLY I H    1 
ATOM   9950  H  HA2  . GLY E  2 37  ? 164.881 114.312 89.292  1.00 22.94  ? 37  GLY I HA2  1 
ATOM   9951  H  HA3  . GLY E  2 37  ? 166.278 114.839 88.817  1.00 22.94  ? 37  GLY I HA3  1 
ATOM   9952  N  N    . LYS E  2 38  ? 166.589 114.542 91.329  1.00 32.94  ? 38  LYS I N    1 
ATOM   9953  C  CA   . LYS E  2 38  ? 166.974 114.743 92.716  1.00 32.94  ? 38  LYS I CA   1 
ATOM   9954  C  C    . LYS E  2 38  ? 168.032 115.830 92.840  1.00 32.94  ? 38  LYS I C    1 
ATOM   9955  O  O    . LYS E  2 38  ? 168.788 116.117 91.911  1.00 32.94  ? 38  LYS I O    1 
ATOM   9956  C  CB   . LYS E  2 38  ? 167.510 113.457 93.338  1.00 32.94  ? 38  LYS I CB   1 
ATOM   9957  C  CG   . LYS E  2 38  ? 166.656 112.232 93.129  1.00 32.94  ? 38  LYS I CG   1 
ATOM   9958  C  CD   . LYS E  2 38  ? 167.119 111.110 94.028  1.00 32.94  ? 38  LYS I CD   1 
ATOM   9959  C  CE   . LYS E  2 38  ? 165.980 110.211 94.429  1.00 32.94  ? 38  LYS I CE   1 
ATOM   9960  N  NZ   . LYS E  2 38  ? 166.307 109.436 95.645  1.00 32.94  ? 38  LYS I NZ   1 
ATOM   9961  H  H    . LYS E  2 38  ? 166.903 113.829 90.971  1.00 32.94  ? 38  LYS I H    1 
ATOM   9962  H  HA   . LYS E  2 38  ? 166.199 115.024 93.219  1.00 32.94  ? 38  LYS I HA   1 
ATOM   9963  H  HB2  . LYS E  2 38  ? 168.384 113.277 92.964  1.00 32.94  ? 38  LYS I HB2  1 
ATOM   9964  H  HB3  . LYS E  2 38  ? 167.588 113.595 94.291  1.00 32.94  ? 38  LYS I HB3  1 
ATOM   9965  H  HG2  . LYS E  2 38  ? 165.748 112.451 93.376  1.00 32.94  ? 38  LYS I HG2  1 
ATOM   9966  H  HG3  . LYS E  2 38  ? 166.679 111.931 92.214  1.00 32.94  ? 38  LYS I HG3  1 
ATOM   9967  H  HD2  . LYS E  2 38  ? 167.773 110.575 93.555  1.00 32.94  ? 38  LYS I HD2  1 
ATOM   9968  H  HD3  . LYS E  2 38  ? 167.507 111.480 94.834  1.00 32.94  ? 38  LYS I HD3  1 
ATOM   9969  H  HE2  . LYS E  2 38  ? 165.198 110.749 94.616  1.00 32.94  ? 38  LYS I HE2  1 
ATOM   9970  H  HE3  . LYS E  2 38  ? 165.799 109.588 93.710  1.00 32.94  ? 38  LYS I HE3  1 
ATOM   9971  H  HZ1  . LYS E  2 38  ? 165.639 108.884 95.841  1.00 32.94  ? 38  LYS I HZ1  1 
ATOM   9972  H  HZ2  . LYS E  2 38  ? 167.049 108.965 95.510  1.00 32.94  ? 38  LYS I HZ2  1 
ATOM   9973  H  HZ3  . LYS E  2 38  ? 166.436 109.991 96.328  1.00 32.94  ? 38  LYS I HZ3  1 
ATOM   9974  N  N    . VAL E  2 39  ? 168.075 116.431 94.027  1.00 28.67  ? 39  VAL I N    1 
ATOM   9975  C  CA   . VAL E  2 39  ? 169.065 117.450 94.315  1.00 28.67  ? 39  VAL I CA   1 
ATOM   9976  C  C    . VAL E  2 39  ? 170.439 116.813 94.475  1.00 28.67  ? 39  VAL I C    1 
ATOM   9977  O  O    . VAL E  2 39  ? 170.584 115.601 94.670  1.00 28.67  ? 39  VAL I O    1 
ATOM   9978  C  CB   . VAL E  2 39  ? 168.673 118.241 95.570  1.00 28.67  ? 39  VAL I CB   1 
ATOM   9979  C  CG1  . VAL E  2 39  ? 169.567 119.431 95.740  1.00 28.67  ? 39  VAL I CG1  1 
ATOM   9980  C  CG2  . VAL E  2 39  ? 167.247 118.684 95.473  1.00 28.67  ? 39  VAL I CG2  1 
ATOM   9981  H  H    . VAL E  2 39  ? 167.541 116.264 94.673  1.00 28.67  ? 39  VAL I H    1 
ATOM   9982  H  HA   . VAL E  2 39  ? 169.103 118.067 93.573  1.00 28.67  ? 39  VAL I HA   1 
ATOM   9983  H  HB   . VAL E  2 39  ? 168.768 117.673 96.343  1.00 28.67  ? 39  VAL I HB   1 
ATOM   9984  H  HG11 . VAL E  2 39  ? 169.142 120.052 96.345  1.00 28.67  ? 39  VAL I HG11 1 
ATOM   9985  H  HG12 . VAL E  2 39  ? 170.413 119.135 96.107  1.00 28.67  ? 39  VAL I HG12 1 
ATOM   9986  H  HG13 . VAL E  2 39  ? 169.701 119.845 94.876  1.00 28.67  ? 39  VAL I HG13 1 
ATOM   9987  H  HG21 . VAL E  2 39  ? 167.029 119.210 96.253  1.00 28.67  ? 39  VAL I HG21 1 
ATOM   9988  H  HG22 . VAL E  2 39  ? 167.154 119.217 94.674  1.00 28.67  ? 39  VAL I HG22 1 
ATOM   9989  H  HG23 . VAL E  2 39  ? 166.671 117.910 95.423  1.00 28.67  ? 39  VAL I HG23 1 
ATOM   9990  N  N    . VAL E  2 40  ? 171.467 117.649 94.377  1.00 36.78  ? 40  VAL I N    1 
ATOM   9991  C  CA   . VAL E  2 40  ? 172.853 117.214 94.494  1.00 36.78  ? 40  VAL I CA   1 
ATOM   9992  C  C    . VAL E  2 40  ? 173.607 118.216 95.355  1.00 36.78  ? 40  VAL I C    1 
ATOM   9993  O  O    . VAL E  2 40  ? 173.612 119.415 95.060  1.00 36.78  ? 40  VAL I O    1 
ATOM   9994  C  CB   . VAL E  2 40  ? 173.517 117.079 93.113  1.00 36.78  ? 40  VAL I CB   1 
ATOM   9995  C  CG1  . VAL E  2 40  ? 174.940 116.635 93.255  1.00 36.78  ? 40  VAL I CG1  1 
ATOM   9996  C  CG2  . VAL E  2 40  ? 172.758 116.094 92.270  1.00 36.78  ? 40  VAL I CG2  1 
ATOM   9997  H  H    . VAL E  2 40  ? 171.388 118.489 94.242  1.00 36.78  ? 40  VAL I H    1 
ATOM   9998  H  HA   . VAL E  2 40  ? 172.886 116.355 94.927  1.00 36.78  ? 40  VAL I HA   1 
ATOM   9999  H  HB   . VAL E  2 40  ? 173.502 117.938 92.674  1.00 36.78  ? 40  VAL I HB   1 
ATOM   10000 H  HG11 . VAL E  2 40  ? 175.309 116.494 92.369  1.00 36.78  ? 40  VAL I HG11 1 
ATOM   10001 H  HG12 . VAL E  2 40  ? 175.436 117.323 93.718  1.00 36.78  ? 40  VAL I HG12 1 
ATOM   10002 H  HG13 . VAL E  2 40  ? 174.957 115.809 93.758  1.00 36.78  ? 40  VAL I HG13 1 
ATOM   10003 H  HG21 . VAL E  2 40  ? 173.262 115.917 91.463  1.00 36.78  ? 40  VAL I HG21 1 
ATOM   10004 H  HG22 . VAL E  2 40  ? 172.649 115.277 92.774  1.00 36.78  ? 40  VAL I HG22 1 
ATOM   10005 H  HG23 . VAL E  2 40  ? 171.894 116.468 92.053  1.00 36.78  ? 40  VAL I HG23 1 
ATOM   10006 N  N    . GLU E  2 41  ? 174.249 117.726 96.409  1.00 39.96  ? 41  GLU I N    1 
ATOM   10007 C  CA   . GLU E  2 41  ? 175.159 118.523 97.223  1.00 39.96  ? 41  GLU I CA   1 
ATOM   10008 C  C    . GLU E  2 41  ? 176.469 117.764 97.343  1.00 39.96  ? 41  GLU I C    1 
ATOM   10009 O  O    . GLU E  2 41  ? 176.481 116.628 97.820  1.00 39.96  ? 41  GLU I O    1 
ATOM   10010 C  CB   . GLU E  2 41  ? 174.587 118.797 98.613  1.00 39.96  ? 41  GLU I CB   1 
ATOM   10011 C  CG   . GLU E  2 41  ? 173.566 119.911 98.669  1.00 39.96  ? 41  GLU I CG   1 
ATOM   10012 C  CD   . GLU E  2 41  ? 173.099 120.188 100.079 1.00 39.96  ? 41  GLU I CD   1 
ATOM   10013 O  OE1  . GLU E  2 41  ? 171.923 119.912 100.391 1.00 39.96  ? 41  GLU I OE1  1 
ATOM   10014 O  OE2  . GLU E  2 41  ? 173.923 120.677 100.876 1.00 39.96  ? 41  GLU I OE2  1 
ATOM   10015 H  H    . GLU E  2 41  ? 174.177 116.915 96.674  1.00 39.96  ? 41  GLU I H    1 
ATOM   10016 H  HA   . GLU E  2 41  ? 175.330 119.365 96.784  1.00 39.96  ? 41  GLU I HA   1 
ATOM   10017 H  HB2  . GLU E  2 41  ? 174.169 117.988 98.936  1.00 39.96  ? 41  GLU I HB2  1 
ATOM   10018 H  HB3  . GLU E  2 41  ? 175.318 119.046 99.196  1.00 39.96  ? 41  GLU I HB3  1 
ATOM   10019 H  HG2  . GLU E  2 41  ? 173.926 120.716 98.275  1.00 39.96  ? 41  GLU I HG2  1 
ATOM   10020 H  HG3  . GLU E  2 41  ? 172.783 119.618 98.172  1.00 39.96  ? 41  GLU I HG3  1 
ATOM   10021 N  N    . LEU E  2 42  ? 177.565 118.385 96.931  1.00 46.87  ? 42  LEU I N    1 
ATOM   10022 C  CA   . LEU E  2 42  ? 178.880 117.767 96.982  1.00 46.87  ? 42  LEU I CA   1 
ATOM   10023 C  C    . LEU E  2 42  ? 179.787 118.543 97.923  1.00 46.87  ? 42  LEU I C    1 
ATOM   10024 O  O    . LEU E  2 42  ? 179.640 119.756 98.093  1.00 46.87  ? 42  LEU I O    1 
ATOM   10025 C  CB   . LEU E  2 42  ? 179.513 117.709 95.599  1.00 46.87  ? 42  LEU I CB   1 
ATOM   10026 C  CG   . LEU E  2 42  ? 178.597 117.293 94.457  1.00 46.87  ? 42  LEU I CG   1 
ATOM   10027 C  CD1  . LEU E  2 42  ? 179.375 117.236 93.179  1.00 46.87  ? 42  LEU I CD1  1 
ATOM   10028 C  CD2  . LEU E  2 42  ? 177.976 115.953 94.726  1.00 46.87  ? 42  LEU I CD2  1 
ATOM   10029 H  H    . LEU E  2 42  ? 177.578 119.182 96.614  1.00 46.87  ? 42  LEU I H    1 
ATOM   10030 H  HA   . LEU E  2 42  ? 178.794 116.863 97.310  1.00 46.87  ? 42  LEU I HA   1 
ATOM   10031 H  HB2  . LEU E  2 42  ? 179.855 118.589 95.393  1.00 46.87  ? 42  LEU I HB2  1 
ATOM   10032 H  HB3  . LEU E  2 42  ? 180.240 117.073 95.626  1.00 46.87  ? 42  LEU I HB3  1 
ATOM   10033 H  HG   . LEU E  2 42  ? 177.887 117.938 94.363  1.00 46.87  ? 42  LEU I HG   1 
ATOM   10034 H  HD11 . LEU E  2 42  ? 178.787 116.947 92.468  1.00 46.87  ? 42  LEU I HD11 1 
ATOM   10035 H  HD12 . LEU E  2 42  ? 179.722 118.119 92.988  1.00 46.87  ? 42  LEU I HD12 1 
ATOM   10036 H  HD13 . LEU E  2 42  ? 180.100 116.608 93.287  1.00 46.87  ? 42  LEU I HD13 1 
ATOM   10037 H  HD21 . LEU E  2 42  ? 177.385 115.733 93.993  1.00 46.87  ? 42  LEU I HD21 1 
ATOM   10038 H  HD22 . LEU E  2 42  ? 178.681 115.295 94.786  1.00 46.87  ? 42  LEU I HD22 1 
ATOM   10039 H  HD23 . LEU E  2 42  ? 177.480 115.997 95.556  1.00 46.87  ? 42  LEU I HD23 1 
ATOM   10040 N  N    . GLY E  2 43  ? 180.729 117.839 98.536  1.00 64.44  ? 43  GLY I N    1 
ATOM   10041 C  CA   . GLY E  2 43  ? 181.663 118.519 99.413  1.00 64.44  ? 43  GLY I CA   1 
ATOM   10042 C  C    . GLY E  2 43  ? 182.683 117.572 99.996  1.00 64.44  ? 43  GLY I C    1 
ATOM   10043 O  O    . GLY E  2 43  ? 182.779 116.411 99.602  1.00 64.44  ? 43  GLY I O    1 
ATOM   10044 H  H    . GLY E  2 43  ? 180.853 116.990 98.462  1.00 64.44  ? 43  GLY I H    1 
ATOM   10045 H  HA2  . GLY E  2 43  ? 182.132 119.206 98.917  1.00 64.44  ? 43  GLY I HA2  1 
ATOM   10046 H  HA3  . GLY E  2 43  ? 181.181 118.933 100.144 1.00 64.44  ? 43  GLY I HA3  1 
ATOM   10047 N  N    . CYS E  2 44  ? 183.459 118.104 100.938 1.00 85.64  ? 44  CYS I N    1 
ATOM   10048 C  CA   . CYS E  2 44  ? 184.424 117.336 101.712 1.00 85.64  ? 44  CYS I CA   1 
ATOM   10049 C  C    . CYS E  2 44  ? 184.192 117.621 103.187 1.00 85.64  ? 44  CYS I C    1 
ATOM   10050 O  O    . CYS E  2 44  ? 184.131 118.787 103.591 1.00 85.64  ? 44  CYS I O    1 
ATOM   10051 C  CB   . CYS E  2 44  ? 185.864 117.681 101.311 1.00 85.64  ? 44  CYS I CB   1 
ATOM   10052 S  SG   . CYS E  2 44  ? 186.514 119.243 101.963 1.00 85.64  ? 44  CYS I SG   1 
ATOM   10053 H  H    . CYS E  2 44  ? 183.444 118.937 101.149 1.00 85.64  ? 44  CYS I H    1 
ATOM   10054 H  HA   . CYS E  2 44  ? 184.285 116.388 101.561 1.00 85.64  ? 44  CYS I HA   1 
ATOM   10055 H  HB2  . CYS E  2 44  ? 186.448 116.967 101.610 1.00 85.64  ? 44  CYS I HB2  1 
ATOM   10056 H  HB3  . CYS E  2 44  ? 185.895 117.745 100.347 1.00 85.64  ? 44  CYS I HB3  1 
ATOM   10057 N  N    . ALA E  2 45  ? 184.052 116.566 103.984 1.00 94.05  ? 45  ALA I N    1 
ATOM   10058 C  CA   . ALA E  2 45  ? 183.729 116.716 105.396 1.00 94.05  ? 45  ALA I CA   1 
ATOM   10059 C  C    . ALA E  2 45  ? 184.653 115.863 106.252 1.00 94.05  ? 45  ALA I C    1 
ATOM   10060 O  O    . ALA E  2 45  ? 185.279 114.911 105.778 1.00 94.05  ? 45  ALA I O    1 
ATOM   10061 C  CB   . ALA E  2 45  ? 182.272 116.343 105.684 1.00 94.05  ? 45  ALA I CB   1 
ATOM   10062 H  H    . ALA E  2 45  ? 184.131 115.752 103.728 1.00 94.05  ? 45  ALA I H    1 
ATOM   10063 H  HA   . ALA E  2 45  ? 183.852 117.645 105.650 1.00 94.05  ? 45  ALA I HA   1 
ATOM   10064 H  HB1  . ALA E  2 45  ? 182.097 116.472 106.630 1.00 94.05  ? 45  ALA I HB1  1 
ATOM   10065 H  HB2  . ALA E  2 45  ? 181.693 116.917 105.159 1.00 94.05  ? 45  ALA I HB2  1 
ATOM   10066 H  HB3  . ALA E  2 45  ? 182.132 115.416 105.445 1.00 94.05  ? 45  ALA I HB3  1 
ATOM   10067 N  N    . ALA E  2 46  ? 184.732 116.231 107.535 1.00 101.02 ? 46  ALA I N    1 
ATOM   10068 C  CA   . ALA E  2 46  ? 185.579 115.513 108.480 1.00 101.02 ? 46  ALA I CA   1 
ATOM   10069 C  C    . ALA E  2 46  ? 185.261 114.026 108.462 1.00 101.02 ? 46  ALA I C    1 
ATOM   10070 O  O    . ALA E  2 46  ? 186.100 113.194 108.102 1.00 101.02 ? 46  ALA I O    1 
ATOM   10071 C  CB   . ALA E  2 46  ? 185.386 116.088 109.883 1.00 101.02 ? 46  ALA I CB   1 
ATOM   10072 H  H    . ALA E  2 46  ? 184.308 116.899 107.879 1.00 101.02 ? 46  ALA I H    1 
ATOM   10073 H  HA   . ALA E  2 46  ? 186.507 115.633 108.229 1.00 101.02 ? 46  ALA I HA   1 
ATOM   10074 H  HB1  . ALA E  2 46  ? 185.983 115.635 110.496 1.00 101.02 ? 46  ALA I HB1  1 
ATOM   10075 H  HB2  . ALA E  2 46  ? 185.580 117.039 109.870 1.00 101.02 ? 46  ALA I HB2  1 
ATOM   10076 H  HB3  . ALA E  2 46  ? 184.465 115.947 110.153 1.00 101.02 ? 46  ALA I HB3  1 
ATOM   10077 N  N    . THR E  2 47  ? 184.040 113.679 108.849 1.00 97.19  ? 47  THR I N    1 
ATOM   10078 C  CA   . THR E  2 47  ? 183.477 112.364 108.597 1.00 97.19  ? 47  THR I CA   1 
ATOM   10079 C  C    . THR E  2 47  ? 182.092 112.547 108.000 1.00 97.19  ? 47  THR I C    1 
ATOM   10080 O  O    . THR E  2 47  ? 181.367 113.482 108.351 1.00 97.19  ? 47  THR I O    1 
ATOM   10081 C  CB   . THR E  2 47  ? 183.400 111.506 109.860 1.00 97.19  ? 47  THR I CB   1 
ATOM   10082 O  OG1  . THR E  2 47  ? 182.815 110.238 109.535 1.00 97.19  ? 47  THR I OG1  1 
ATOM   10083 C  CG2  . THR E  2 47  ? 182.565 112.190 110.922 1.00 97.19  ? 47  THR I CG2  1 
ATOM   10084 H  H    . THR E  2 47  ? 183.508 114.204 109.275 1.00 97.19  ? 47  THR I H    1 
ATOM   10085 H  HA   . THR E  2 47  ? 184.033 111.910 107.955 1.00 97.19  ? 47  THR I HA   1 
ATOM   10086 H  HB   . THR E  2 47  ? 184.295 111.369 110.206 1.00 97.19  ? 47  THR I HB   1 
ATOM   10087 H  HG1  . THR E  2 47  ? 182.881 109.714 110.187 1.00 97.19  ? 47  THR I HG1  1 
ATOM   10088 H  HG21 . THR E  2 47  ? 182.603 111.679 111.745 1.00 97.19  ? 47  THR I HG21 1 
ATOM   10089 H  HG22 . THR E  2 47  ? 182.902 113.084 111.088 1.00 97.19  ? 47  THR I HG22 1 
ATOM   10090 H  HG23 . THR E  2 47  ? 181.641 112.250 110.632 1.00 97.19  ? 47  THR I HG23 1 
ATOM   10091 N  N    . CYS E  2 48  ? 181.729 111.644 107.099 1.00 90.21  ? 48  CYS I N    1 
ATOM   10092 C  CA   . CYS E  2 48  ? 180.545 111.866 106.288 1.00 90.21  ? 48  CYS I CA   1 
ATOM   10093 C  C    . CYS E  2 48  ? 179.314 111.984 107.184 1.00 90.21  ? 48  CYS I C    1 
ATOM   10094 O  O    . CYS E  2 48  ? 179.180 111.235 108.159 1.00 90.21  ? 48  CYS I O    1 
ATOM   10095 C  CB   . CYS E  2 48  ? 180.386 110.740 105.267 1.00 90.21  ? 48  CYS I CB   1 
ATOM   10096 S  SG   . CYS E  2 48  ? 181.439 111.008 103.816 1.00 90.21  ? 48  CYS I SG   1 
ATOM   10097 H  H    . CYS E  2 48  ? 182.142 110.908 106.946 1.00 90.21  ? 48  CYS I H    1 
ATOM   10098 H  HA   . CYS E  2 48  ? 180.657 112.697 105.802 1.00 90.21  ? 48  CYS I HA   1 
ATOM   10099 H  HB2  . CYS E  2 48  ? 180.638 109.899 105.676 1.00 90.21  ? 48  CYS I HB2  1 
ATOM   10100 H  HB3  . CYS E  2 48  ? 179.464 110.705 104.971 1.00 90.21  ? 48  CYS I HB3  1 
ATOM   10101 N  N    . PRO E  2 49  ? 178.399 112.912 106.887 1.00 78.03  ? 49  PRO I N    1 
ATOM   10102 C  CA   . PRO E  2 49  ? 177.408 113.323 107.889 1.00 78.03  ? 49  PRO I CA   1 
ATOM   10103 C  C    . PRO E  2 49  ? 176.198 112.409 107.985 1.00 78.03  ? 49  PRO I C    1 
ATOM   10104 O  O    . PRO E  2 49  ? 176.128 111.362 107.333 1.00 78.03  ? 49  PRO I O    1 
ATOM   10105 C  CB   . PRO E  2 49  ? 177.011 114.723 107.413 1.00 78.03  ? 49  PRO I CB   1 
ATOM   10106 C  CG   . PRO E  2 49  ? 177.163 114.663 105.927 1.00 78.03  ? 49  PRO I CG   1 
ATOM   10107 C  CD   . PRO E  2 49  ? 178.193 113.603 105.604 1.00 78.03  ? 49  PRO I CD   1 
ATOM   10108 H  HA   . PRO E  2 49  ? 177.826 113.388 108.762 1.00 78.03  ? 49  PRO I HA   1 
ATOM   10109 H  HB2  . PRO E  2 49  ? 176.092 114.911 107.660 1.00 78.03  ? 49  PRO I HB2  1 
ATOM   10110 H  HB3  . PRO E  2 49  ? 177.609 115.382 107.796 1.00 78.03  ? 49  PRO I HB3  1 
ATOM   10111 H  HG2  . PRO E  2 49  ? 176.311 114.432 105.528 1.00 78.03  ? 49  PRO I HG2  1 
ATOM   10112 H  HG3  . PRO E  2 49  ? 177.462 115.527 105.605 1.00 78.03  ? 49  PRO I HG3  1 
ATOM   10113 H  HD2  . PRO E  2 49  ? 177.845 112.983 104.947 1.00 78.03  ? 49  PRO I HD2  1 
ATOM   10114 H  HD3  . PRO E  2 49  ? 179.014 114.018 105.305 1.00 78.03  ? 49  PRO I HD3  1 
ATOM   10115 N  N    . SER E  2 50  ? 175.234 112.815 108.808 1.00 69.52  ? 50  SER I N    1 
ATOM   10116 C  CA   . SER E  2 50  ? 174.071 111.986 109.080 1.00 69.52  ? 50  SER I CA   1 
ATOM   10117 C  C    . SER E  2 50  ? 173.135 111.963 107.880 1.00 69.52  ? 50  SER I C    1 
ATOM   10118 O  O    . SER E  2 50  ? 172.953 112.970 107.192 1.00 69.52  ? 50  SER I O    1 
ATOM   10119 C  CB   . SER E  2 50  ? 173.331 112.504 110.310 1.00 69.52  ? 50  SER I CB   1 
ATOM   10120 O  OG   . SER E  2 50  ? 172.228 111.676 110.628 1.00 69.52  ? 50  SER I OG   1 
ATOM   10121 H  H    . SER E  2 50  ? 175.226 113.574 109.215 1.00 69.52  ? 50  SER I H    1 
ATOM   10122 H  HA   . SER E  2 50  ? 174.359 111.076 109.254 1.00 69.52  ? 50  SER I HA   1 
ATOM   10123 H  HB2  . SER E  2 50  ? 173.941 112.525 111.063 1.00 69.52  ? 50  SER I HB2  1 
ATOM   10124 H  HB3  . SER E  2 50  ? 173.009 113.399 110.123 1.00 69.52  ? 50  SER I HB3  1 
ATOM   10125 H  HG   . SER E  2 50  ? 171.795 112.011 111.267 1.00 69.52  ? 50  SER I HG   1 
ATOM   10126 N  N    . LYS E  2 51  ? 172.537 110.801 107.637 1.00 55.34  ? 51  LYS I N    1 
ATOM   10127 C  CA   . LYS E  2 51  ? 171.581 110.614 106.554 1.00 55.34  ? 51  LYS I CA   1 
ATOM   10128 C  C    . LYS E  2 51  ? 170.176 110.695 107.135 1.00 55.34  ? 51  LYS I C    1 
ATOM   10129 O  O    . LYS E  2 51  ? 169.751 109.808 107.881 1.00 55.34  ? 51  LYS I O    1 
ATOM   10130 C  CB   . LYS E  2 51  ? 171.818 109.278 105.855 1.00 55.34  ? 51  LYS I CB   1 
ATOM   10131 C  CG   . LYS E  2 51  ? 170.562 108.575 105.383 1.00 55.34  ? 51  LYS I CG   1 
ATOM   10132 C  CD   . LYS E  2 51  ? 170.899 107.480 104.393 1.00 55.34  ? 51  LYS I CD   1 
ATOM   10133 C  CE   . LYS E  2 51  ? 169.650 106.790 103.872 1.00 55.34  ? 51  LYS I CE   1 
ATOM   10134 N  NZ   . LYS E  2 51  ? 169.940 105.961 102.675 1.00 55.34  ? 51  LYS I NZ   1 
ATOM   10135 H  H    . LYS E  2 51  ? 172.679 110.089 108.093 1.00 55.34  ? 51  LYS I H    1 
ATOM   10136 H  HA   . LYS E  2 51  ? 171.683 111.323 105.904 1.00 55.34  ? 51  LYS I HA   1 
ATOM   10137 H  HB2  . LYS E  2 51  ? 172.372 109.432 105.075 1.00 55.34  ? 51  LYS I HB2  1 
ATOM   10138 H  HB3  . LYS E  2 51  ? 172.274 108.682 106.467 1.00 55.34  ? 51  LYS I HB3  1 
ATOM   10139 H  HG2  . LYS E  2 51  ? 170.108 108.172 106.138 1.00 55.34  ? 51  LYS I HG2  1 
ATOM   10140 H  HG3  . LYS E  2 51  ? 169.980 109.211 104.942 1.00 55.34  ? 51  LYS I HG3  1 
ATOM   10141 H  HD2  . LYS E  2 51  ? 171.368 107.867 103.640 1.00 55.34  ? 51  LYS I HD2  1 
ATOM   10142 H  HD3  . LYS E  2 51  ? 171.456 106.817 104.828 1.00 55.34  ? 51  LYS I HD3  1 
ATOM   10143 H  HE2  . LYS E  2 51  ? 169.294 106.210 104.561 1.00 55.34  ? 51  LYS I HE2  1 
ATOM   10144 H  HE3  . LYS E  2 51  ? 168.989 107.457 103.628 1.00 55.34  ? 51  LYS I HE3  1 
ATOM   10145 H  HZ1  . LYS E  2 51  ? 169.181 105.663 102.321 1.00 55.34  ? 51  LYS I HZ1  1 
ATOM   10146 H  HZ2  . LYS E  2 51  ? 170.373 106.447 102.069 1.00 55.34  ? 51  LYS I HZ2  1 
ATOM   10147 H  HZ3  . LYS E  2 51  ? 170.448 105.270 102.905 1.00 55.34  ? 51  LYS I HZ3  1 
ATOM   10148 N  N    . LYS E  2 52  ? 169.461 111.764 106.797 1.00 51.82  ? 52  LYS I N    1 
ATOM   10149 C  CA   . LYS E  2 52  ? 168.068 111.888 107.166 1.00 51.82  ? 52  LYS I CA   1 
ATOM   10150 C  C    . LYS E  2 52  ? 167.258 110.807 106.456 1.00 51.82  ? 52  LYS I C    1 
ATOM   10151 O  O    . LYS E  2 52  ? 167.755 110.133 105.554 1.00 51.82  ? 52  LYS I O    1 
ATOM   10152 C  CB   . LYS E  2 52  ? 167.551 113.278 106.809 1.00 51.82  ? 52  LYS I CB   1 
ATOM   10153 C  CG   . LYS E  2 52  ? 168.099 114.381 107.678 1.00 51.82  ? 52  LYS I CG   1 
ATOM   10154 C  CD   . LYS E  2 52  ? 167.291 115.648 107.510 1.00 51.82  ? 52  LYS I CD   1 
ATOM   10155 C  CE   . LYS E  2 52  ? 167.788 116.760 108.405 1.00 51.82  ? 52  LYS I CE   1 
ATOM   10156 N  NZ   . LYS E  2 52  ? 168.661 117.696 107.649 1.00 51.82  ? 52  LYS I NZ   1 
ATOM   10157 H  H    . LYS E  2 52  ? 169.770 112.436 106.361 1.00 51.82  ? 52  LYS I H    1 
ATOM   10158 H  HA   . LYS E  2 52  ? 167.978 111.766 108.122 1.00 51.82  ? 52  LYS I HA   1 
ATOM   10159 H  HB2  . LYS E  2 52  ? 167.800 113.475 105.894 1.00 51.82  ? 52  LYS I HB2  1 
ATOM   10160 H  HB3  . LYS E  2 52  ? 166.588 113.295 106.895 1.00 51.82  ? 52  LYS I HB3  1 
ATOM   10161 H  HG2  . LYS E  2 52  ? 168.052 114.107 108.605 1.00 51.82  ? 52  LYS I HG2  1 
ATOM   10162 H  HG3  . LYS E  2 52  ? 169.015 114.566 107.418 1.00 51.82  ? 52  LYS I HG3  1 
ATOM   10163 H  HD2  . LYS E  2 52  ? 167.353 115.949 106.595 1.00 51.82  ? 52  LYS I HD2  1 
ATOM   10164 H  HD3  . LYS E  2 52  ? 166.366 115.462 107.738 1.00 51.82  ? 52  LYS I HD3  1 
ATOM   10165 H  HE2  . LYS E  2 52  ? 167.028 117.260 108.740 1.00 51.82  ? 52  LYS I HE2  1 
ATOM   10166 H  HE3  . LYS E  2 52  ? 168.295 116.385 109.139 1.00 51.82  ? 52  LYS I HE3  1 
ATOM   10167 H  HZ1  . LYS E  2 52  ? 169.357 117.933 108.147 1.00 51.82  ? 52  LYS I HZ1  1 
ATOM   10168 H  HZ2  . LYS E  2 52  ? 168.957 117.301 106.908 1.00 51.82  ? 52  LYS I HZ2  1 
ATOM   10169 H  HZ3  . LYS E  2 52  ? 168.203 118.424 107.421 1.00 51.82  ? 52  LYS I HZ3  1 
ATOM   10170 N  N    . PRO E  2 53  ? 165.998 110.613 106.853 1.00 48.90  ? 53  PRO I N    1 
ATOM   10171 C  CA   . PRO E  2 53  ? 165.197 109.561 106.207 1.00 48.90  ? 53  PRO I CA   1 
ATOM   10172 C  C    . PRO E  2 53  ? 165.073 109.738 104.708 1.00 48.90  ? 53  PRO I C    1 
ATOM   10173 O  O    . PRO E  2 53  ? 165.091 108.749 103.965 1.00 48.90  ? 53  PRO I O    1 
ATOM   10174 C  CB   . PRO E  2 53  ? 163.835 109.686 106.903 1.00 48.90  ? 53  PRO I CB   1 
ATOM   10175 C  CG   . PRO E  2 53  ? 164.111 110.396 108.179 1.00 48.90  ? 53  PRO I CG   1 
ATOM   10176 C  CD   . PRO E  2 53  ? 165.241 111.320 107.897 1.00 48.90  ? 53  PRO I CD   1 
ATOM   10177 H  HA   . PRO E  2 53  ? 165.575 108.690 106.394 1.00 48.90  ? 53  PRO I HA   1 
ATOM   10178 H  HB2  . PRO E  2 53  ? 163.240 110.210 106.345 1.00 48.90  ? 53  PRO I HB2  1 
ATOM   10179 H  HB3  . PRO E  2 53  ? 163.466 108.805 107.065 1.00 48.90  ? 53  PRO I HB3  1 
ATOM   10180 H  HG2  . PRO E  2 53  ? 163.323 110.899 108.441 1.00 48.90  ? 53  PRO I HG2  1 
ATOM   10181 H  HG3  . PRO E  2 53  ? 164.354 109.757 108.865 1.00 48.90  ? 53  PRO I HG3  1 
ATOM   10182 H  HD2  . PRO E  2 53  ? 164.903 112.161 107.554 1.00 48.90  ? 53  PRO I HD2  1 
ATOM   10183 H  HD3  . PRO E  2 53  ? 165.784 111.454 108.686 1.00 48.90  ? 53  PRO I HD3  1 
ATOM   10184 N  N    . TYR E  2 54  ? 164.952 110.978 104.242 1.00 42.74  ? 54  TYR I N    1 
ATOM   10185 C  CA   . TYR E  2 54  ? 164.717 111.266 102.835 1.00 42.74  ? 54  TYR I CA   1 
ATOM   10186 C  C    . TYR E  2 54  ? 165.992 111.565 102.059 1.00 42.74  ? 54  TYR I C    1 
ATOM   10187 O  O    . TYR E  2 54  ? 165.914 111.860 100.864 1.00 42.74  ? 54  TYR I O    1 
ATOM   10188 C  CB   . TYR E  2 54  ? 163.739 112.441 102.701 1.00 42.74  ? 54  TYR I CB   1 
ATOM   10189 C  CG   . TYR E  2 54  ? 164.127 113.699 103.445 1.00 42.74  ? 54  TYR I CG   1 
ATOM   10190 C  CD1  . TYR E  2 54  ? 165.053 114.584 102.920 1.00 42.74  ? 54  TYR I CD1  1 
ATOM   10191 C  CD2  . TYR E  2 54  ? 163.542 114.015 104.661 1.00 42.74  ? 54  TYR I CD2  1 
ATOM   10192 C  CE1  . TYR E  2 54  ? 165.403 115.737 103.592 1.00 42.74  ? 54  TYR I CE1  1 
ATOM   10193 C  CE2  . TYR E  2 54  ? 163.884 115.166 105.340 1.00 42.74  ? 54  TYR I CE2  1 
ATOM   10194 C  CZ   . TYR E  2 54  ? 164.814 116.024 104.800 1.00 42.74  ? 54  TYR I CZ   1 
ATOM   10195 O  OH   . TYR E  2 54  ? 165.158 117.174 105.470 1.00 42.74  ? 54  TYR I OH   1 
ATOM   10196 H  H    . TYR E  2 54  ? 165.008 111.680 104.733 1.00 42.74  ? 54  TYR I H    1 
ATOM   10197 H  HA   . TYR E  2 54  ? 164.301 110.492 102.428 1.00 42.74  ? 54  TYR I HA   1 
ATOM   10198 H  HB2  . TYR E  2 54  ? 163.659 112.672 101.765 1.00 42.74  ? 54  TYR I HB2  1 
ATOM   10199 H  HB3  . TYR E  2 54  ? 162.881 112.162 103.048 1.00 42.74  ? 54  TYR I HB3  1 
ATOM   10200 H  HD1  . TYR E  2 54  ? 165.456 114.391 102.106 1.00 42.74  ? 54  TYR I HD1  1 
ATOM   10201 H  HD2  . TYR E  2 54  ? 162.915 113.439 105.027 1.00 42.74  ? 54  TYR I HD2  1 
ATOM   10202 H  HE1  . TYR E  2 54  ? 166.029 116.320 103.231 1.00 42.74  ? 54  TYR I HE1  1 
ATOM   10203 H  HE2  . TYR E  2 54  ? 163.487 115.366 106.156 1.00 42.74  ? 54  TYR I HE2  1 
ATOM   10204 H  HH   . TYR E  2 54  ? 164.534 117.400 105.987 1.00 42.74  ? 54  TYR I HH   1 
ATOM   10205 N  N    . GLU E  2 55  ? 167.156 111.487 102.697 1.00 47.86  ? 55  GLU I N    1 
ATOM   10206 C  CA   . GLU E  2 55  ? 168.426 111.814 102.066 1.00 47.86  ? 55  GLU I CA   1 
ATOM   10207 C  C    . GLU E  2 55  ? 169.254 110.555 101.854 1.00 47.86  ? 55  GLU I C    1 
ATOM   10208 O  O    . GLU E  2 55  ? 169.221 109.630 102.669 1.00 47.86  ? 55  GLU I O    1 
ATOM   10209 C  CB   . GLU E  2 55  ? 169.203 112.815 102.916 1.00 47.86  ? 55  GLU I CB   1 
ATOM   10210 C  CG   . GLU E  2 55  ? 168.729 114.237 102.717 1.00 47.86  ? 55  GLU I CG   1 
ATOM   10211 C  CD   . GLU E  2 55  ? 169.142 115.170 103.830 1.00 47.86  ? 55  GLU I CD   1 
ATOM   10212 O  OE1  . GLU E  2 55  ? 170.344 115.450 103.971 1.00 47.86  ? 55  GLU I OE1  1 
ATOM   10213 O  OE2  . GLU E  2 55  ? 168.253 115.640 104.559 1.00 47.86  ? 55  GLU I OE2  1 
ATOM   10214 H  H    . GLU E  2 55  ? 167.236 111.252 103.518 1.00 47.86  ? 55  GLU I H    1 
ATOM   10215 H  HA   . GLU E  2 55  ? 168.265 112.217 101.202 1.00 47.86  ? 55  GLU I HA   1 
ATOM   10216 H  HB2  . GLU E  2 55  ? 169.106 112.587 103.850 1.00 47.86  ? 55  GLU I HB2  1 
ATOM   10217 H  HB3  . GLU E  2 55  ? 170.138 112.775 102.661 1.00 47.86  ? 55  GLU I HB3  1 
ATOM   10218 H  HG2  . GLU E  2 55  ? 169.101 114.575 101.891 1.00 47.86  ? 55  GLU I HG2  1 
ATOM   10219 H  HG3  . GLU E  2 55  ? 167.761 114.236 102.668 1.00 47.86  ? 55  GLU I HG3  1 
ATOM   10220 N  N    . GLU E  2 56  ? 169.988 110.528 100.747 1.00 50.05  ? 56  GLU I N    1 
ATOM   10221 C  CA   . GLU E  2 56  ? 170.901 109.445 100.414 1.00 50.05  ? 56  GLU I CA   1 
ATOM   10222 C  C    . GLU E  2 56  ? 172.315 109.993 100.330 1.00 50.05  ? 56  GLU I C    1 
ATOM   10223 O  O    . GLU E  2 56  ? 172.530 111.105 99.843  1.00 50.05  ? 56  GLU I O    1 
ATOM   10224 C  CB   . GLU E  2 56  ? 170.526 108.792 99.090  1.00 50.05  ? 56  GLU I CB   1 
ATOM   10225 C  CG   . GLU E  2 56  ? 169.151 108.166 99.091  1.00 50.05  ? 56  GLU I CG   1 
ATOM   10226 C  CD   . GLU E  2 56  ? 168.831 107.453 97.793  1.00 50.05  ? 56  GLU I CD   1 
ATOM   10227 O  OE1  . GLU E  2 56  ? 169.550 107.677 96.797  1.00 50.05  ? 56  GLU I OE1  1 
ATOM   10228 O  OE2  . GLU E  2 56  ? 167.862 106.665 97.769  1.00 50.05  ? 56  GLU I OE2  1 
ATOM   10229 H  H    . GLU E  2 56  ? 169.972 111.148 100.155 1.00 50.05  ? 56  GLU I H    1 
ATOM   10230 H  HA   . GLU E  2 56  ? 170.870 108.772 101.106 1.00 50.05  ? 56  GLU I HA   1 
ATOM   10231 H  HB2  . GLU E  2 56  ? 170.545 109.466 98.397  1.00 50.05  ? 56  GLU I HB2  1 
ATOM   10232 H  HB3  . GLU E  2 56  ? 171.173 108.099 98.888  1.00 50.05  ? 56  GLU I HB3  1 
ATOM   10233 H  HG2  . GLU E  2 56  ? 169.102 107.519 99.810  1.00 50.05  ? 56  GLU I HG2  1 
ATOM   10234 H  HG3  . GLU E  2 56  ? 168.492 108.865 99.226  1.00 50.05  ? 56  GLU I HG3  1 
ATOM   10235 N  N    . VAL E  2 57  ? 173.275 109.209 100.805 1.00 55.47  ? 57  VAL I N    1 
ATOM   10236 C  CA   . VAL E  2 57  ? 174.672 109.618 100.837 1.00 55.47  ? 57  VAL I CA   1 
ATOM   10237 C  C    . VAL E  2 57  ? 175.529 108.504 100.259 1.00 55.47  ? 57  VAL I C    1 
ATOM   10238 O  O    . VAL E  2 57  ? 175.270 107.318 100.491 1.00 55.47  ? 57  VAL I O    1 
ATOM   10239 C  CB   . VAL E  2 57  ? 175.132 109.971 102.264 1.00 55.47  ? 57  VAL I CB   1 
ATOM   10240 C  CG1  . VAL E  2 57  ? 176.574 110.432 102.248 1.00 55.47  ? 57  VAL I CG1  1 
ATOM   10241 C  CG2  . VAL E  2 57  ? 174.247 111.048 102.839 1.00 55.47  ? 57  VAL I CG2  1 
ATOM   10242 H  H    . VAL E  2 57  ? 173.142 108.420 101.109 1.00 55.47  ? 57  VAL I H    1 
ATOM   10243 H  HA   . VAL E  2 57  ? 174.788 110.402 100.284 1.00 55.47  ? 57  VAL I HA   1 
ATOM   10244 H  HB   . VAL E  2 57  ? 175.066 109.185 102.823 1.00 55.47  ? 57  VAL I HB   1 
ATOM   10245 H  HG11 . VAL E  2 57  ? 176.827 110.709 103.140 1.00 55.47  ? 57  VAL I HG11 1 
ATOM   10246 H  HG12 . VAL E  2 57  ? 177.138 109.703 101.951 1.00 55.47  ? 57  VAL I HG12 1 
ATOM   10247 H  HG13 . VAL E  2 57  ? 176.650 111.179 101.638 1.00 55.47  ? 57  VAL I HG13 1 
ATOM   10248 H  HG21 . VAL E  2 57  ? 174.517 111.226 103.751 1.00 55.47  ? 57  VAL I HG21 1 
ATOM   10249 H  HG22 . VAL E  2 57  ? 174.349 111.846 102.303 1.00 55.47  ? 57  VAL I HG22 1 
ATOM   10250 H  HG23 . VAL E  2 57  ? 173.327 110.748 102.816 1.00 55.47  ? 57  VAL I HG23 1 
ATOM   10251 N  N    . THR E  2 58  ? 176.551 108.896 99.503  1.00 63.87  ? 58  THR I N    1 
ATOM   10252 C  CA   . THR E  2 58  ? 177.522 107.978 98.915  1.00 63.87  ? 58  THR I CA   1 
ATOM   10253 C  C    . THR E  2 58  ? 178.897 108.549 99.242  1.00 63.87  ? 58  THR I C    1 
ATOM   10254 O  O    . THR E  2 58  ? 179.365 109.477 98.577  1.00 63.87  ? 58  THR I O    1 
ATOM   10255 C  CB   . THR E  2 58  ? 177.311 107.834 97.415  1.00 63.87  ? 58  THR I CB   1 
ATOM   10256 O  OG1  . THR E  2 58  ? 175.971 107.393 97.163  1.00 63.87  ? 58  THR I OG1  1 
ATOM   10257 C  CG2  . THR E  2 58  ? 178.275 106.827 96.836  1.00 63.87  ? 58  THR I CG2  1 
ATOM   10258 H  H    . THR E  2 58  ? 176.710 109.719 99.318  1.00 63.87  ? 58  THR I H    1 
ATOM   10259 H  HA   . THR E  2 58  ? 177.438 107.105 99.326  1.00 63.87  ? 58  THR I HA   1 
ATOM   10260 H  HB   . THR E  2 58  ? 177.462 108.690 96.985  1.00 63.87  ? 58  THR I HB   1 
ATOM   10261 H  HG1  . THR E  2 58  ? 175.872 107.245 96.344  1.00 63.87  ? 58  THR I HG1  1 
ATOM   10262 H  HG21 . THR E  2 58  ? 178.122 106.744 95.882  1.00 63.87  ? 58  THR I HG21 1 
ATOM   10263 H  HG22 . THR E  2 58  ? 179.192 107.102 96.994  1.00 63.87  ? 58  THR I HG22 1 
ATOM   10264 H  HG23 . THR E  2 58  ? 178.126 105.966 97.255  1.00 63.87  ? 58  THR I HG23 1 
ATOM   10265 N  N    . CYS E  2 59  ? 179.535 107.996 100.266 1.00 82.16  ? 59  CYS I N    1 
ATOM   10266 C  CA   . CYS E  2 59  ? 180.730 108.575 100.858 1.00 82.16  ? 59  CYS I CA   1 
ATOM   10267 C  C    . CYS E  2 59  ? 181.964 107.829 100.372 1.00 82.16  ? 59  CYS I C    1 
ATOM   10268 O  O    . CYS E  2 59  ? 182.002 106.595 100.403 1.00 82.16  ? 59  CYS I O    1 
ATOM   10269 C  CB   . CYS E  2 59  ? 180.638 108.524 102.383 1.00 82.16  ? 59  CYS I CB   1 
ATOM   10270 S  SG   . CYS E  2 59  ? 182.062 109.161 103.254 1.00 82.16  ? 59  CYS I SG   1 
ATOM   10271 H  H    . CYS E  2 59  ? 179.285 107.265 100.645 1.00 82.16  ? 59  CYS I H    1 
ATOM   10272 H  HA   . CYS E  2 59  ? 180.806 109.502 100.586 1.00 82.16  ? 59  CYS I HA   1 
ATOM   10273 H  HB2  . CYS E  2 59  ? 179.875 109.054 102.656 1.00 82.16  ? 59  CYS I HB2  1 
ATOM   10274 H  HB3  . CYS E  2 59  ? 180.509 107.603 102.653 1.00 82.16  ? 59  CYS I HB3  1 
ATOM   10275 N  N    . CYS E  2 60  ? 182.963 108.583 99.930  1.00 93.17  ? 60  CYS I N    1 
ATOM   10276 C  CA   . CYS E  2 60  ? 184.218 108.057 99.413  1.00 93.17  ? 60  CYS I CA   1 
ATOM   10277 C  C    . CYS E  2 60  ? 185.373 108.585 100.249 1.00 93.17  ? 60  CYS I C    1 
ATOM   10278 O  O    . CYS E  2 60  ? 185.193 109.337 101.206 1.00 93.17  ? 60  CYS I O    1 
ATOM   10279 C  CB   . CYS E  2 60  ? 184.426 108.451 97.952  1.00 93.17  ? 60  CYS I CB   1 
ATOM   10280 S  SG   . CYS E  2 60  ? 183.414 107.580 96.753  1.00 93.17  ? 60  CYS I SG   1 
ATOM   10281 H  H    . CYS E  2 60  ? 182.935 109.444 99.917  1.00 93.17  ? 60  CYS I H    1 
ATOM   10282 H  HA   . CYS E  2 60  ? 184.210 107.089 99.465  1.00 93.17  ? 60  CYS I HA   1 
ATOM   10283 H  HB2  . CYS E  2 60  ? 184.245 109.400 97.860  1.00 93.17  ? 60  CYS I HB2  1 
ATOM   10284 H  HB3  . CYS E  2 60  ? 185.349 108.276 97.715  1.00 93.17  ? 60  CYS I HB3  1 
ATOM   10285 N  N    . SER E  2 61  ? 186.599 108.129 99.955  1.00 97.31  ? 61  SER I N    1 
ATOM   10286 C  CA   . SER E  2 61  ? 187.838 108.604 100.633 1.00 97.31  ? 61  SER I CA   1 
ATOM   10287 C  C    . SER E  2 61  ? 188.941 108.802 99.589  1.00 97.31  ? 61  SER I C    1 
ATOM   10288 O  O    . SER E  2 61  ? 190.110 108.908 100.002 1.00 97.31  ? 61  SER I O    1 
ATOM   10289 C  CB   . SER E  2 61  ? 188.274 107.627 101.691 1.00 97.31  ? 61  SER I CB   1 
ATOM   10290 O  OG   . SER E  2 61  ? 187.157 106.965 102.264 1.00 97.31  ? 61  SER I OG   1 
ATOM   10291 H  H    . SER E  2 61  ? 186.758 107.407 99.417  1.00 97.31  ? 61  SER I H    1 
ATOM   10292 H  HA   . SER E  2 61  ? 187.655 109.482 101.060 1.00 97.31  ? 61  SER I HA   1 
ATOM   10293 H  HB2  . SER E  2 61  ? 188.877 106.960 101.292 1.00 97.31  ? 61  SER I HB2  1 
ATOM   10294 H  HB3  . SER E  2 61  ? 188.767 108.106 102.395 1.00 97.31  ? 61  SER I HB3  1 
ATOM   10295 H  HG   . SER E  2 61  ? 187.425 106.512 102.925 1.00 97.31  ? 61  SER I HG   1 
ATOM   10296 N  N    . THR E  2 62  ? 188.594 108.885 98.301  1.00 96.65  ? 62  THR I N    1 
ATOM   10297 C  CA   . THR E  2 62  ? 189.562 108.999 97.183  1.00 96.65  ? 62  THR I CA   1 
ATOM   10298 C  C    . THR E  2 62  ? 189.323 110.307 96.429  1.00 96.65  ? 62  THR I C    1 
ATOM   10299 O  O    . THR E  2 62  ? 188.247 110.902 96.631  1.00 96.65  ? 62  THR I O    1 
ATOM   10300 C  CB   . THR E  2 62  ? 189.403 107.799 96.244  1.00 96.65  ? 62  THR I CB   1 
ATOM   10301 O  OG1  . THR E  2 62  ? 188.707 106.788 96.973  1.00 96.65  ? 62  THR I OG1  1 
ATOM   10302 C  CG2  . THR E  2 62  ? 190.719 107.262 95.725  1.00 96.65  ? 62  THR I CG2  1 
ATOM   10303 H  H    . THR E  2 62  ? 187.732 108.913 98.014  1.00 96.65  ? 62  THR I H    1 
ATOM   10304 H  HA   . THR E  2 62  ? 190.475 109.002 97.548  1.00 96.65  ? 62  THR I HA   1 
ATOM   10305 H  HB   . THR E  2 62  ? 188.847 108.079 95.477  1.00 96.65  ? 62  THR I HB   1 
ATOM   10306 H  HG1  . THR E  2 62  ? 188.559 106.122 96.472  1.00 96.65  ? 62  THR I HG1  1 
ATOM   10307 H  HG21 . THR E  2 62  ? 190.550 106.539 95.094  1.00 96.65  ? 62  THR I HG21 1 
ATOM   10308 H  HG22 . THR E  2 62  ? 191.208 107.973 95.276  1.00 96.65  ? 62  THR I HG22 1 
ATOM   10309 H  HG23 . THR E  2 62  ? 191.249 106.924 96.469  1.00 96.65  ? 62  THR I HG23 1 
ATOM   10310 N  N    . ASP E  2 63  ? 190.273 110.743 95.600  1.00 92.75  ? 63  ASP I N    1 
ATOM   10311 C  CA   . ASP E  2 63  ? 190.159 111.968 94.820  1.00 92.75  ? 63  ASP I CA   1 
ATOM   10312 C  C    . ASP E  2 63  ? 189.071 111.829 93.768  1.00 92.75  ? 63  ASP I C    1 
ATOM   10313 O  O    . ASP E  2 63  ? 189.015 110.834 93.042  1.00 92.75  ? 63  ASP I O    1 
ATOM   10314 C  CB   . ASP E  2 63  ? 191.491 112.292 94.139  1.00 92.75  ? 63  ASP I CB   1 
ATOM   10315 C  CG   . ASP E  2 63  ? 192.487 112.946 95.078  1.00 92.75  ? 63  ASP I CG   1 
ATOM   10316 O  OD1  . ASP E  2 63  ? 192.072 113.780 95.908  1.00 92.75  ? 63  ASP I OD1  1 
ATOM   10317 O  OD2  . ASP E  2 63  ? 193.692 112.623 94.986  1.00 92.75  ? 63  ASP I OD2  1 
ATOM   10318 H  H    . ASP E  2 63  ? 191.037 110.342 95.527  1.00 92.75  ? 63  ASP I H    1 
ATOM   10319 H  HA   . ASP E  2 63  ? 189.927 112.709 95.404  1.00 92.75  ? 63  ASP I HA   1 
ATOM   10320 H  HB2  . ASP E  2 63  ? 191.879 111.473 93.789  1.00 92.75  ? 63  ASP I HB2  1 
ATOM   10321 H  HB3  . ASP E  2 63  ? 191.317 112.922 93.419  1.00 92.75  ? 63  ASP I HB3  1 
ATOM   10322 N  N    . LYS E  2 64  ? 188.212 112.848 93.678  1.00 80.67  ? 64  LYS I N    1 
ATOM   10323 C  CA   . LYS E  2 64  ? 187.213 112.935 92.618  1.00 80.67  ? 64  LYS I CA   1 
ATOM   10324 C  C    . LYS E  2 64  ? 186.353 111.677 92.561  1.00 80.67  ? 64  LYS I C    1 
ATOM   10325 O  O    . LYS E  2 64  ? 186.050 111.156 91.485  1.00 80.67  ? 64  LYS I O    1 
ATOM   10326 C  CB   . LYS E  2 64  ? 187.876 113.188 91.266  1.00 80.67  ? 64  LYS I CB   1 
ATOM   10327 C  CG   . LYS E  2 64  ? 188.584 114.523 91.150  1.00 80.67  ? 64  LYS I CG   1 
ATOM   10328 C  CD   . LYS E  2 64  ? 189.155 114.701 89.753  1.00 80.67  ? 64  LYS I CD   1 
ATOM   10329 C  CE   . LYS E  2 64  ? 190.051 115.925 89.623  1.00 80.67  ? 64  LYS I CE   1 
ATOM   10330 N  NZ   . LYS E  2 64  ? 189.974 116.879 90.763  1.00 80.67  ? 64  LYS I NZ   1 
ATOM   10331 H  H    . LYS E  2 64  ? 188.191 113.512 94.225  1.00 80.67  ? 64  LYS I H    1 
ATOM   10332 H  HA   . LYS E  2 64  ? 186.627 113.683 92.799  1.00 80.67  ? 64  LYS I HA   1 
ATOM   10333 H  HB2  . LYS E  2 64  ? 188.533 112.494 91.110  1.00 80.67  ? 64  LYS I HB2  1 
ATOM   10334 H  HB3  . LYS E  2 64  ? 187.196 113.155 90.577  1.00 80.67  ? 64  LYS I HB3  1 
ATOM   10335 H  HG2  . LYS E  2 64  ? 187.953 115.236 91.317  1.00 80.67  ? 64  LYS I HG2  1 
ATOM   10336 H  HG3  . LYS E  2 64  ? 189.313 114.559 91.788  1.00 80.67  ? 64  LYS I HG3  1 
ATOM   10337 H  HD2  . LYS E  2 64  ? 189.685 113.922 89.527  1.00 80.67  ? 64  LYS I HD2  1 
ATOM   10338 H  HD3  . LYS E  2 64  ? 188.425 114.799 89.124  1.00 80.67  ? 64  LYS I HD3  1 
ATOM   10339 H  HE2  . LYS E  2 64  ? 190.970 115.625 89.553  1.00 80.67  ? 64  LYS I HE2  1 
ATOM   10340 H  HE3  . LYS E  2 64  ? 189.802 116.407 88.819  1.00 80.67  ? 64  LYS I HE3  1 
ATOM   10341 H  HZ1  . LYS E  2 64  ? 190.172 117.699 90.477  1.00 80.67  ? 64  LYS I HZ1  1 
ATOM   10342 H  HZ2  . LYS E  2 64  ? 189.156 116.888 91.109  1.00 80.67  ? 64  LYS I HZ2  1 
ATOM   10343 H  HZ3  . LYS E  2 64  ? 190.556 116.645 91.393  1.00 80.67  ? 64  LYS I HZ3  1 
ATOM   10344 N  N    . CYS E  2 65  ? 185.959 111.180 93.728  1.00 85.56  ? 65  CYS I N    1 
ATOM   10345 C  CA   . CYS E  2 65  ? 185.058 110.040 93.812  1.00 85.56  ? 65  CYS I CA   1 
ATOM   10346 C  C    . CYS E  2 65  ? 183.597 110.458 93.869  1.00 85.56  ? 65  CYS I C    1 
ATOM   10347 O  O    . CYS E  2 65  ? 182.719 109.589 93.896  1.00 85.56  ? 65  CYS I O    1 
ATOM   10348 C  CB   . CYS E  2 65  ? 185.387 109.190 95.040  1.00 85.56  ? 65  CYS I CB   1 
ATOM   10349 S  SG   . CYS E  2 65  ? 184.557 107.572 95.069  1.00 85.56  ? 65  CYS I SG   1 
ATOM   10350 H  H    . CYS E  2 65  ? 186.