CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 22012515524046256

Job options:

ID        	=	 22012515524046256
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


REMARK    File generated by Swiss-PdbViewer  4.00b0
REMARK    http://www.expasy.org/spdbv/
TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 hBACE
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   21-JAN-22 1MOD    1       11:16
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.82
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.85
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    B7E
REMARK   3  BIND    A.72
REMARK   3  BIND 2  A.73
REMARK   3  BIND 3  A.74
REMARK   3  BIND 4  A.91
REMARK   3  BIND 5  A.93
REMARK   3  BIND 6  A.95
REMARK   3  BIND 7  A.96
REMARK   3  BIND 8  A.98
REMARK   3  BIND 9  A.130
REMARK   3  BIND 10  A.132
REMARK   3  BIND 11  A.137
REMARK   3  BIND 12  A.171
REMARK   3  BIND 13  A.179
REMARK   3  BIND 14  A.189
REMARK   3  BIND 15  A.289
REMARK   3  BIND 16  A.291
REMARK   3  BIND 17  _.1
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   6ej2
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2022-01-14
REMARK   3  SMTLE   6ej2.1.A
REMARK   3  SMTLV   2022-01-19
REMARK   3  MTHD    X-RAY DIFFRACTION 1.46 A
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.80
REMARK   3  SIM     0.62
REMARK   3  SID     99.60
REMARK   3  OSTAT   monomer
REMARK   3  LIGND   B7E
REMARK   3  ALN A TRG MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRG
REMARK   3  ALN A TRG SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQ
REMARK   3  ALN A TRG LSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGS
REMARK   3  ALN A TRG NWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVG
REMARK   3  ALN A TRG GSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDS
REMARK   3  ALN A TRG GTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYL
REMARK   3  ALN A TRG MGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVF
REMARK   3  ALN A TRG DRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAA
REMARK   3  ALN A TRG ICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK
REMARK   3  ALN A TPL MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRG
REMARK   3  ALN A TPL SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQ
REMARK   3  ALN A TPL LSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGS
REMARK   3  ALN A TPL NWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVG
REMARK   3  ALN A TPL GSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDS
REMARK   3  ALN A TPL GTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYL
REMARK   3  ALN A TPL MGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVF
REMARK   3  ALN A TPL DRARKRIGFAVSACHVHDEFRTAAVEGPFVTDLMEDCGYNIPQTDESTLMTIAYVMAA
REMARK   3  ALN A TPL ICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK
REMARK   3  ALN A OFF 0
ATOM      1  N   ALA A  37       5.637 -46.770  -9.882  1.00  0.76
ATOM      2  CA  ALA A  37       5.671 -45.610 -10.802  1.00  0.76
ATOM      3  C   ALA A  37       5.844 -46.073 -12.270  1.00  0.76
ATOM      4  O   ALA A  37       4.840 -46.114 -12.982  1.00  0.76
ATOM      5  CB  ALA A  37       6.626 -44.532 -10.262  1.00  0.76
ATOM      6 1H   ALA A  37       5.831 -47.621 -10.370  1.00 99.99
ATOM      7 2H   ALA A  37       6.282 -46.659  -9.136  1.00 99.99
ATOM      8 3H   ALA A  37       4.746 -46.831  -9.411  1.00 99.99
ATOM      9  N   PRO A  38       7.056 -46.295 -12.795  1.00  0.59
ATOM     10  CA  PRO A  38       7.241 -47.502 -13.635  1.00  0.59
ATOM     11  C   PRO A  38       7.575 -48.802 -12.857  1.00  0.59
ATOM     12  O   PRO A  38       7.263 -48.980 -11.688  1.00  0.59
ATOM     13  CB  PRO A  38       8.376 -47.138 -14.602  1.00  0.59
ATOM     14  CG  PRO A  38       8.276 -45.633 -14.758  1.00  0.59
ATOM     15  CD  PRO A  38       7.852 -45.183 -13.361  1.00  0.59
ATOM     16  N   LEU A  39       8.275 -49.669 -13.610  1.00  0.50
ATOM     17  CA  LEU A  39       8.968 -50.934 -13.293  1.00  0.50
ATOM     18  C   LEU A  39       9.965 -50.832 -12.115  1.00  0.50
ATOM     19  O   LEU A  39      11.188 -50.918 -12.292  1.00  0.50
ATOM     20  CB  LEU A  39       9.818 -51.298 -14.528  1.00  0.50
ATOM     21  CG  LEU A  39       9.239 -51.339 -15.940  1.00  0.50
ATOM     22  CD1 LEU A  39      10.390 -51.672 -16.894  1.00  0.50
ATOM     23  CD2 LEU A  39       8.142 -52.397 -16.060  1.00  0.50
ATOM     24  H   LEU A  39       8.346 -49.448 -14.576  1.00 99.99
ATOM     25  N   GLY A  40       9.462 -50.615 -10.899  1.00  0.62
ATOM     26  CA  GLY A  40      10.344 -50.540  -9.716  1.00  0.62
ATOM     27  C   GLY A  40      11.027 -49.176  -9.545  1.00  0.62
ATOM     28  O   GLY A  40      11.838 -49.018  -8.631  1.00  0.62
ATOM     29  H   GLY A  40       8.512 -50.325 -10.710  1.00 99.99
ATOM     30  N   LEU A  41      10.618 -48.177 -10.325  1.00  0.55
ATOM     31  CA  LEU A  41      11.075 -46.801 -10.072  1.00  0.55
ATOM     32  C   LEU A  41      10.252 -46.201  -8.925  1.00  0.55
ATOM     33  O   LEU A  41       9.085 -46.539  -8.731  1.00  0.55
ATOM     34  CB  LEU A  41      11.047 -45.896 -11.312  1.00  0.55
ATOM     35  CG  LEU A  41      11.829 -46.378 -12.547  1.00  0.55
ATOM     36  CD1 LEU A  41      12.035 -45.177 -13.470  1.00  0.55
ATOM     37  CD2 LEU A  41      13.173 -47.059 -12.252  1.00  0.55
ATOM     38  H   LEU A  41       9.876 -48.272 -10.986  1.00 99.99
ATOM     39  N   ARG A  42      10.898 -45.271  -8.234  1.00  0.54
ATOM     40  CA  ARG A  42      10.446 -44.680  -6.960  1.00  0.54
ATOM     41  C   ARG A  42      10.260 -43.159  -7.116  1.00  0.54
ATOM     42  O   ARG A  42      10.782 -42.571  -8.065  1.00  0.54
ATOM     43  CB  ARG A  42      11.499 -45.008  -5.883  1.00  0.54
ATOM     44  CG  ARG A  42      12.886 -44.428  -6.201  1.00  0.54
ATOM     45  CD  ARG A  42      13.953 -44.800  -5.173  1.00  0.54
ATOM     46  NE  ARG A  42      15.211 -44.131  -5.554  1.00  0.54
ATOM     47  CZ  ARG A  42      16.390 -44.224  -4.927  1.00  0.54
ATOM     48  NH1 ARG A  42      17.442 -43.549  -5.367  1.00  0.54
ATOM     49  NH2 ARG A  42      16.553 -44.997  -3.862  1.00  0.54
ATOM     50  H   ARG A  42      11.690 -44.810  -8.628  1.00 99.99
ATOM     51  HE  ARG A  42      15.154 -43.559  -6.369  1.00 99.99
ATOM     52 1HH1 ARG A  42      18.315 -43.632  -4.888  1.00 99.99
ATOM     53 2HH1 ARG A  42      17.373 -42.954  -6.166  1.00 99.99
ATOM     54 1HH2 ARG A  42      17.440 -45.057  -3.410  1.00 99.99
ATOM     55 2HH2 ARG A  42      15.773 -45.520  -3.526  1.00 99.99
ATOM     56  N   LEU A  43       9.542 -42.539  -6.183  1.00  0.61
ATOM     57  CA  LEU A  43       9.316 -41.079  -6.181  1.00  0.61
ATOM     58  C   LEU A  43       9.554 -40.516  -4.766  1.00  0.61
ATOM     59  O   LEU A  43       8.856 -40.949  -3.846  1.00  0.61
ATOM     60  CB  LEU A  43       7.880 -40.812  -6.660  1.00  0.61
ATOM     61  CG  LEU A  43       7.478 -39.332  -6.732  1.00  0.61
ATOM     62  CD1 LEU A  43       8.253 -38.575  -7.816  1.00  0.61
ATOM     63  CD2 LEU A  43       5.973 -39.228  -6.981  1.00  0.61
ATOM     64  H   LEU A  43       9.142 -43.022  -5.402  1.00 99.99
ATOM     65  N   PRO A  44      10.578 -39.676  -4.553  1.00  0.64
ATOM     66  CA  PRO A  44      10.888 -39.150  -3.210  1.00  0.64
ATOM     67  C   PRO A  44       9.942 -37.994  -2.847  1.00  0.64
ATOM     68  O   PRO A  44       9.333 -37.382  -3.724  1.00  0.64
ATOM     69  CB  PRO A  44      12.344 -38.701  -3.323  1.00  0.64
ATOM     70  CG  PRO A  44      12.438 -38.186  -4.761  1.00  0.64
ATOM     71  CD  PRO A  44      11.518 -39.124  -5.554  1.00  0.64
ATOM     72  N   ARG A  45       9.843 -37.707  -1.553  1.00  0.63
ATOM     73  CA  ARG A  45       9.017 -36.593  -1.046  1.00  0.63
ATOM     74  C   ARG A  45       9.591 -36.046   0.268  1.00  0.63
ATOM     75  O   ARG A  45       9.783 -36.778   1.238  1.00  0.63
ATOM     76  CB  ARG A  45       7.540 -37.016  -0.904  1.00  0.63
ATOM     77  CG  ARG A  45       7.363 -38.173   0.082  1.00  0.63
ATOM     78  CD  ARG A  45       5.980 -38.824   0.119  1.00  0.63
ATOM     79  NE  ARG A  45       6.063 -39.855   1.169  1.00  0.63
ATOM     80  CZ  ARG A  45       6.733 -41.010   1.094  1.00  0.63
ATOM     81  NH1 ARG A  45       6.894 -41.767   2.168  1.00  0.63
ATOM     82  NH2 ARG A  45       7.201 -41.461  -0.059  1.00  0.63
ATOM     83  H   ARG A  45      10.279 -38.258  -0.841  1.00 99.99
ATOM     84  HE  ARG A  45       5.633 -39.614   2.034  1.00 99.99
ATOM     85 1HH1 ARG A  45       7.411 -42.620   2.078  1.00 99.99
ATOM     86 2HH1 ARG A  45       6.553 -41.479   3.061  1.00 99.99
ATOM     87 1HH2 ARG A  45       7.699 -42.326  -0.086  1.00 99.99
ATOM     88 2HH2 ARG A  45       7.070 -40.932  -0.895  1.00 99.99
ATOM     89  N   GLU A  46      10.114 -34.831   0.178  1.00  0.60
ATOM     90  CA  GLU A  46      10.628 -34.105   1.357  1.00  0.60
ATOM     91  C   GLU A  46       9.960 -32.721   1.450  1.00  0.60
ATOM     92  O   GLU A  46      10.475 -31.785   2.062  1.00  0.60
ATOM     93  CB  GLU A  46      12.159 -33.998   1.281  1.00  0.60
ATOM     94  CG  GLU A  46      12.868 -35.362   1.305  1.00  0.60
ATOM     95  CD  GLU A  46      14.394 -35.300   1.140  1.00  0.60
ATOM     96  OE1 GLU A  46      14.983 -36.399   1.053  1.00  0.60
ATOM     97  OE2 GLU A  46      14.954 -34.181   1.092  1.00  0.60
ATOM     98  H   GLU A  46      10.064 -34.285  -0.657  1.00 99.99
ATOM     99  N   THR A  47       8.789 -32.618   0.824  1.00  0.69
ATOM    100  CA  THR A  47       7.925 -31.428   0.880  1.00  0.69
ATOM    101  C   THR A  47       6.768 -31.784   1.818  1.00  0.69
ATOM    102  O   THR A  47       5.637 -32.051   1.426  1.00  0.69
ATOM    103  CB  THR A  47       7.429 -31.010  -0.519  1.00  0.69
ATOM    104  OG1 THR A  47       6.772 -32.087  -1.192  1.00  0.69
ATOM    105  CG2 THR A  47       8.580 -30.510  -1.396  1.00  0.69
ATOM    106  H   THR A  47       8.392 -33.362   0.284  1.00 99.99
ATOM    107  HG1 THR A  47       6.354 -31.729  -2.032  1.00 99.99
ATOM    108  N   ASP A  48       7.109 -31.787   3.098  1.00  0.69
ATOM    109  CA  ASP A  48       6.178 -32.134   4.191  1.00  0.69
ATOM    110  C   ASP A  48       5.376 -30.920   4.705  1.00  0.69
ATOM    111  O   ASP A  48       4.658 -31.035   5.696  1.00  0.69
ATOM    112  CB  ASP A  48       6.978 -32.830   5.310  1.00  0.69
ATOM    113  CG  ASP A  48       8.155 -32.038   5.911  1.00  0.69
ATOM    114  OD1 ASP A  48       8.674 -31.125   5.223  1.00  0.69
ATOM    115  OD2 ASP A  48       8.604 -32.436   7.005  1.00  0.69
ATOM    116  H   ASP A  48       8.013 -31.480   3.411  1.00 99.99
ATOM    117  N   GLU A  49       5.485 -29.811   3.967  1.00  0.63
ATOM    118  CA  GLU A  49       4.926 -28.468   4.245  1.00  0.63
ATOM    119  C   GLU A  49       5.399 -27.884   5.587  1.00  0.63
ATOM    120  O   GLU A  49       5.266 -28.493   6.648  1.00  0.63
ATOM    121  CB  GLU A  49       3.394 -28.373   4.103  1.00  0.63
ATOM    122  CG  GLU A  49       2.887 -28.506   2.656  1.00  0.63
ATOM    123  CD  GLU A  49       1.477 -27.941   2.394  1.00  0.63
ATOM    124  OE1 GLU A  49       0.739 -27.639   3.361  1.00  0.63
ATOM    125  OE2 GLU A  49       1.187 -27.706   1.198  1.00  0.63
ATOM    126  H   GLU A  49       6.044 -29.839   3.142  1.00 99.99
ATOM    127  N   GLU A  50       6.046 -26.724   5.508  1.00  0.59
ATOM    128  CA  GLU A  50       6.563 -26.037   6.714  1.00  0.59
ATOM    129  C   GLU A  50       5.393 -25.697   7.665  1.00  0.59
ATOM    130  O   GLU A  50       4.350 -25.254   7.176  1.00  0.59
ATOM    131  CB  GLU A  50       7.336 -24.766   6.340  1.00  0.59
ATOM    132  CG  GLU A  50       8.660 -25.043   5.611  1.00  0.59
ATOM    133  CD  GLU A  50       9.505 -23.786   5.341  1.00  0.59
ATOM    134  OE1 GLU A  50       9.092 -22.679   5.755  1.00  0.59
ATOM    135  OE2 GLU A  50      10.565 -23.959   4.702  1.00  0.59
ATOM    136  H   GLU A  50       6.071 -26.188   4.667  1.00 99.99
ATOM    137  N   PRO A  51       5.528 -25.939   8.979  1.00  0.62
ATOM    138  CA  PRO A  51       4.434 -25.763   9.960  1.00  0.62
ATOM    139  C   PRO A  51       3.759 -24.383   9.927  1.00  0.62
ATOM    140  O   PRO A  51       4.368 -23.367  10.261  1.00  0.62
ATOM    141  CB  PRO A  51       5.095 -26.004  11.318  1.00  0.62
ATOM    142  CG  PRO A  51       6.180 -27.028  10.997  1.00  0.62
ATOM    143  CD  PRO A  51       6.690 -26.591   9.622  1.00  0.62
ATOM    144  N   GLU A  52       2.473 -24.379   9.583  1.00  0.60
ATOM    145  CA  GLU A  52       1.669 -23.143   9.543  1.00  0.60
ATOM    146  C   GLU A  52       0.319 -23.372  10.229  1.00  0.60
ATOM    147  O   GLU A  52      -0.499 -24.173   9.778  1.00  0.60
ATOM    148  CB  GLU A  52       1.492 -22.675   8.092  1.00  0.60
ATOM    149  CG  GLU A  52       0.786 -21.314   7.992  1.00  0.60
ATOM    150  CD  GLU A  52       0.609 -20.791   6.559  1.00  0.60
ATOM    151  OE1 GLU A  52       0.185 -19.620   6.456  1.00  0.60
ATOM    152  OE2 GLU A  52       0.838 -21.563   5.600  1.00  0.60
ATOM    153  H   GLU A  52       1.968 -25.220   9.381  1.00 99.99
ATOM    154  N   GLU A  53       0.131 -22.667  11.338  1.00  0.67
ATOM    155  CA  GLU A  53      -1.100 -22.750  12.141  1.00  0.67
ATOM    156  C   GLU A  53      -1.175 -21.457  12.967  1.00  0.67
ATOM    157  O   GLU A  53      -0.440 -21.336  13.947  1.00  0.67
ATOM    158  CB  GLU A  53      -1.019 -23.998  13.035  1.00  0.67
ATOM    159  CG  GLU A  53      -2.338 -24.373  13.721  1.00  0.67
ATOM    160  CD  GLU A  53      -2.242 -25.708  14.476  1.00  0.67
ATOM    161  OE1 GLU A  53      -1.554 -26.626  13.973  1.00  0.67
ATOM    162  OE2 GLU A  53      -2.910 -25.803  15.527  1.00  0.67
ATOM    163  H   GLU A  53       0.831 -22.046  11.697  1.00 99.99
ATOM    164  N   PRO A  54      -1.903 -20.440  12.484  1.00  0.68
ATOM    165  CA  PRO A  54      -2.081 -19.181  13.233  1.00  0.68
ATOM    166  C   PRO A  54      -2.657 -19.364  14.647  1.00  0.68
ATOM    167  O   PRO A  54      -2.522 -18.457  15.466  1.00  0.68
ATOM    168  CB  PRO A  54      -3.003 -18.332  12.358  1.00  0.68
ATOM    169  CG  PRO A  54      -2.626 -18.776  10.947  1.00  0.68
ATOM    170  CD  PRO A  54      -2.394 -20.282  11.098  1.00  0.68
ATOM    171  N   GLY A  55      -3.364 -20.482  14.884  1.00  0.34
ATOM    172  CA  GLY A  55      -3.990 -20.781  16.189  1.00  0.34
ATOM    173  C   GLY A  55      -5.145 -19.826  16.536  1.00  0.34
ATOM    174  O   GLY A  55      -5.339 -19.489  17.703  1.00  0.34
ATOM    175  H   GLY A  55      -3.509 -21.216  14.213  1.00 99.99
ATOM    176  N   ARG A  56      -5.852 -19.378  15.498  1.00  0.34
ATOM    177  CA  ARG A  56      -7.055 -18.520  15.580  1.00  0.34
ATOM    178  C   ARG A  56      -8.216 -19.168  16.371  1.00  0.34
ATOM    179  O   ARG A  56      -8.023 -20.178  17.050  1.00  0.34
ATOM    180  CB  ARG A  56      -7.464 -18.152  14.138  1.00  0.34
ATOM    181  CG  ARG A  56      -7.870 -19.335  13.239  1.00  0.34
ATOM    182  CD  ARG A  56      -9.387 -19.513  13.101  1.00  0.34
ATOM    183  NE  ARG A  56      -9.708 -20.629  12.189  1.00  0.34
ATOM    184  CZ  ARG A  56     -10.721 -21.503  12.313  1.00  0.34
ATOM    185  NH1 ARG A  56     -10.934 -22.454  11.418  1.00  0.34
ATOM    186  NH2 ARG A  56     -11.562 -21.470  13.332  1.00  0.34
ATOM    187  H   ARG A  56      -5.555 -19.570  14.566  1.00 99.99
ATOM    188  HE  ARG A  56      -9.056 -20.753  11.443  1.00 99.99
ATOM    189 1HH1 ARG A  56     -11.689 -23.094  11.557  1.00 99.99
ATOM    190 2HH1 ARG A  56     -10.357 -22.537  10.610  1.00 99.99
ATOM    191 1HH2 ARG A  56     -12.287 -22.148  13.415  1.00 99.99
ATOM    192 2HH2 ARG A  56     -11.367 -20.841  14.084  1.00 99.99
ATOM    193  N   ARG A  57      -9.400 -18.559  16.296  1.00  0.41
ATOM    194  CA  ARG A  57     -10.693 -19.108  16.784  1.00  0.41
ATOM    195  C   ARG A  57     -10.775 -20.643  16.656  1.00  0.41
ATOM    196  O   ARG A  57     -10.219 -21.219  15.728  1.00  0.41
ATOM    197  CB  ARG A  57     -11.850 -18.532  15.951  1.00  0.41
ATOM    198  CG  ARG A  57     -11.992 -17.005  16.005  1.00  0.41
ATOM    199  CD  ARG A  57     -13.207 -16.502  15.215  1.00  0.41
ATOM    200  NE  ARG A  57     -13.027 -16.710  13.767  1.00  0.41
ATOM    201  CZ  ARG A  57     -13.968 -16.603  12.821  1.00  0.41
ATOM    202  NH1 ARG A  57     -13.673 -16.855  11.558  1.00  0.41
ATOM    203  NH2 ARG A  57     -15.217 -16.247  13.091  1.00  0.41
ATOM    204  H   ARG A  57      -9.465 -17.632  15.929  1.00 99.99
ATOM    205  HE  ARG A  57     -12.095 -16.906  13.476  1.00 99.99
ATOM    206 1HH1 ARG A  57     -14.402 -16.769  10.872  1.00 99.99
ATOM    207 2HH1 ARG A  57     -12.756 -17.131  11.279  1.00 99.99
ATOM    208 1HH2 ARG A  57     -15.877 -16.180  12.339  1.00 99.99
ATOM    209 2HH2 ARG A  57     -15.475 -16.027  14.027  1.00 99.99
ATOM    210  N   GLY A  58     -11.448 -21.299  17.609  1.00  0.51
ATOM    211  CA  GLY A  58     -11.715 -22.745  17.498  1.00  0.51
ATOM    212  C   GLY A  58     -13.204 -23.043  17.680  1.00  0.51
ATOM    213  O   GLY A  58     -13.735 -22.824  18.768  1.00  0.51
ATOM    214  H   GLY A  58     -11.708 -20.909  18.498  1.00 99.99
ATOM    215  N   SER A  59     -13.887 -23.375  16.591  1.00  0.58
ATOM    216  CA  SER A  59     -15.256 -23.923  16.676  1.00  0.58
ATOM    217  C   SER A  59     -15.212 -25.325  16.072  1.00  0.58
ATOM    218  O   SER A  59     -14.443 -25.590  15.150  1.00  0.58
ATOM    219  CB  SER A  59     -16.297 -23.090  15.916  1.00  0.58
ATOM    220  OG  SER A  59     -17.612 -23.628  16.132  1.00  0.58
ATOM    221  H   SER A  59     -13.464 -23.451  15.685  1.00 99.99
ATOM    222  HG  SER A  59     -18.280 -23.055  15.638  1.00 99.99
ATOM    223  N   PHE A  60     -15.930 -26.227  16.721  1.00  0.72
ATOM    224  CA  PHE A  60     -16.049 -27.632  16.283  1.00  0.72
ATOM    225  C   PHE A  60     -17.310 -28.314  16.822  1.00  0.72
ATOM    226  O   PHE A  60     -17.884 -29.157  16.134  1.00  0.72
ATOM    227  CB  PHE A  60     -14.785 -28.451  16.592  1.00  0.72
ATOM    228  CG  PHE A  60     -14.312 -28.307  18.040  1.00  0.72
ATOM    229  CD1 PHE A  60     -13.428 -27.294  18.378  1.00  0.72
ATOM    230  CD2 PHE A  60     -14.807 -29.166  19.006  1.00  0.72
ATOM    231  CE1 PHE A  60     -13.041 -27.132  19.708  1.00  0.72
ATOM    232  CE2 PHE A  60     -14.412 -29.014  20.331  1.00  0.72
ATOM    233  CZ  PHE A  60     -13.532 -27.993  20.678  1.00  0.72
ATOM    234  H   PHE A  60     -16.398 -25.982  17.564  1.00 99.99
ATOM    235  HD1 PHE A  60     -13.032 -26.637  17.604  1.00 99.99
ATOM    236  HD2 PHE A  60     -15.519 -29.941  18.726  1.00 99.99
ATOM    237  HE1 PHE A  60     -12.385 -26.306  19.986  1.00 99.99
ATOM    238  HE2 PHE A  60     -14.784 -29.706  21.085  1.00 99.99
ATOM    239  HZ  PHE A  60     -13.244 -27.852  21.723  1.00 99.99
ATOM    240  N   VAL A  61     -17.836 -27.807  17.936  1.00  0.82
ATOM    241  CA  VAL A  61     -19.116 -28.292  18.498  1.00  0.82
ATOM    242  C   VAL A  61     -20.320 -28.001  17.582  1.00  0.82
ATOM    243  O   VAL A  61     -21.225 -28.825  17.485  1.00  0.82
ATOM    244  CB  VAL A  61     -19.354 -27.807  19.941  1.00  0.82
ATOM    245  CG1 VAL A  61     -18.247 -28.318  20.870  1.00  0.82
ATOM    246  CG2 VAL A  61     -19.509 -26.286  20.068  1.00  0.82
ATOM    247  H   VAL A  61     -17.372 -27.136  18.513  1.00 99.99
ATOM    248  N   GLU A  62     -20.260 -26.886  16.855  1.00  0.77
ATOM    249  CA  GLU A  62     -21.267 -26.524  15.835  1.00  0.77
ATOM    250  C   GLU A  62     -21.092 -27.298  14.512  1.00  0.77
ATOM    251  O   GLU A  62     -21.950 -27.201  13.631  1.00  0.77
ATOM    252  CB  GLU A  62     -21.240 -25.013  15.580  1.00  0.77
ATOM    253  CG  GLU A  62     -21.635 -24.189  16.816  1.00  0.77
ATOM    254  CD  GLU A  62     -21.448 -22.676  16.633  1.00  0.77
ATOM    255  OE1 GLU A  62     -20.543 -22.288  15.856  1.00  0.77
ATOM    256  OE2 GLU A  62     -22.149 -21.934  17.354  1.00  0.77
ATOM    257  H   GLU A  62     -19.528 -26.213  16.959  1.00 99.99
ATOM    258  N   MET A  63     -19.974 -28.007  14.366  1.00  0.84
ATOM    259  CA  MET A  63     -19.673 -28.811  13.162  1.00  0.84
ATOM    260  C   MET A  63     -19.924 -30.317  13.363  1.00  0.84
ATOM    261  O   MET A  63     -19.883 -31.088  12.400  1.00  0.84
ATOM    262  CB  MET A  63     -18.232 -28.591  12.688  1.00  0.84
ATOM    263  CG  MET A  63     -17.899 -27.123  12.418  1.00  0.84
ATOM    264  SD  MET A  63     -16.322 -26.932  11.513  1.00  0.84
ATOM    265  CE  MET A  63     -15.773 -25.396  12.219  1.00  0.84
ATOM    266  H   MET A  63     -19.268 -28.069  15.074  1.00 99.99
ATOM    267  N   VAL A  64     -20.098 -30.764  14.606  1.00  0.88
ATOM    268  CA  VAL A  64     -20.504 -32.159  14.876  1.00  0.88
ATOM    269  C   VAL A  64     -21.940 -32.357  14.363  1.00  0.88
ATOM    270  O   VAL A  64     -22.827 -31.538  14.602  1.00  0.88
ATOM    271  CB  VAL A  64     -20.349 -32.517  16.367  1.00  0.88
ATOM    272  CG1 VAL A  64     -20.856 -33.928  16.697  1.00  0.88
ATOM    273  CG2 VAL A  64     -18.874 -32.451  16.773  1.00  0.88
ATOM    274  H   VAL A  64     -20.013 -30.187  15.420  1.00 99.99
ATOM    275  N   ASP A  65     -22.105 -33.461  13.644  1.00  0.89
ATOM    276  CA  ASP A  65     -23.368 -33.914  13.030  1.00  0.89
ATOM    277  C   ASP A  65     -23.875 -32.953  11.931  1.00  0.89
ATOM    278  O   ASP A  65     -25.083 -32.830  11.718  1.00  0.89
ATOM    279  CB  ASP A  65     -24.400 -34.148  14.149  1.00  0.89
ATOM    280  CG  ASP A  65     -25.552 -35.051  13.724  1.00  0.89
ATOM    281  OD1 ASP A  65     -25.252 -36.048  13.027  1.00  0.89
ATOM    282  OD2 ASP A  65     -26.679 -34.780  14.187  1.00  0.89
ATOM    283  H   ASP A  65     -21.315 -34.056  13.482  1.00 99.99
ATOM    284  N   ASN A  66     -22.944 -32.401  11.156  1.00  0.89
ATOM    285  CA  ASN A  66     -23.275 -31.489  10.038  1.00  0.89
ATOM    286  C   ASN A  66     -23.421 -32.190   8.672  1.00  0.89
ATOM    287  O   ASN A  66     -23.689 -31.524   7.668  1.00  0.89
ATOM    288  CB  ASN A  66     -22.277 -30.320   9.970  1.00  0.89
ATOM    289  CG  ASN A  66     -20.835 -30.683   9.593  1.00  0.89
ATOM    290  OD1 ASN A  66     -20.466 -31.841   9.430  1.00  0.89
ATOM    291  ND2 ASN A  66     -19.998 -29.682   9.431  1.00  0.89
ATOM    292  H   ASN A  66     -21.962 -32.553  11.283  1.00 99.99
ATOM    293 1HD2 ASN A  66     -19.041 -29.889   9.223  1.00 99.99
ATOM    294 2HD2 ASN A  66     -20.290 -28.733   9.599  1.00 99.99
ATOM    295  N   LEU A  67     -23.259 -33.512   8.639  1.00  0.90
ATOM    296  CA  LEU A  67     -23.451 -34.301   7.407  1.00  0.90
ATOM    297  C   LEU A  67     -24.707 -35.165   7.516  1.00  0.90
ATOM    298  O   LEU A  67     -24.985 -35.758   8.559  1.00  0.90
ATOM    299  CB  LEU A  67     -22.257 -35.223   7.112  1.00  0.90
ATOM    300  CG  LEU A  67     -20.891 -34.531   7.013  1.00  0.90
ATOM    301  CD1 LEU A  67     -19.819 -35.573   6.699  1.00  0.90
ATOM    302  CD2 LEU A  67     -20.867 -33.434   5.947  1.00  0.90
ATOM    303  H   LEU A  67     -23.030 -34.054   9.451  1.00 99.99
ATOM    304  N   ARG A  68     -25.414 -35.235   6.398  1.00  0.83
ATOM    305  CA  ARG A  68     -26.604 -36.084   6.218  1.00  0.83
ATOM    306  C   ARG A  68     -26.523 -36.762   4.849  1.00  0.83
ATOM    307  O   ARG A  68     -25.744 -36.345   3.989  1.00  0.83
ATOM    308  CB  ARG A  68     -27.888 -35.245   6.298  1.00  0.83
ATOM    309  CG  ARG A  68     -28.251 -34.781   7.713  1.00  0.83
ATOM    310  CD  ARG A  68     -28.728 -35.947   8.585  1.00  0.83
ATOM    311  NE  ARG A  68     -29.019 -35.481   9.953  1.00  0.83
ATOM    312  CZ  ARG A  68     -28.166 -35.477  10.977  1.00  0.83
ATOM    313  NH1 ARG A  68     -28.579 -35.099  12.175  1.00  0.83
ATOM    314  NH2 ARG A  68     -26.892 -35.803  10.815  1.00  0.83
ATOM    315  H   ARG A  68     -25.136 -34.733   5.573  1.00 99.99
ATOM    316  HE  ARG A  68     -29.944 -35.153  10.120  1.00 99.99
ATOM    317 1HH1 ARG A  68     -27.927 -35.092  12.938  1.00 99.99
ATOM    318 2HH1 ARG A  68     -29.523 -34.823  12.337  1.00 99.99
ATOM    319 1HH2 ARG A  68     -26.270 -35.805  11.598  1.00 99.99
ATOM    320 2HH2 ARG A  68     -26.549 -36.029   9.904  1.00 99.99
ATOM    321  N   GLY A  69     -27.274 -37.851   4.698  1.00  0.87
ATOM    322  CA  GLY A  69     -27.400 -38.530   3.397  1.00  0.87
ATOM    323  C   GLY A  69     -28.463 -39.622   3.463  1.00  0.87
ATOM    324  O   GLY A  69     -29.291 -39.648   4.373  1.00  0.87
ATOM    325  H   GLY A  69     -27.779 -38.291   5.459  1.00 99.99
ATOM    326  N   LYS A  70     -28.431 -40.478   2.456  1.00  0.63
ATOM    327  CA  LYS A  70     -29.234 -41.713   2.397  1.00  0.63
ATOM    328  C   LYS A  70     -28.297 -42.840   1.934  1.00  0.63
ATOM    329  O   LYS A  70     -27.298 -42.568   1.253  1.00  0.63
ATOM    330  CB  LYS A  70     -30.411 -41.559   1.422  1.00  0.63
ATOM    331  CG  LYS A  70     -31.510 -40.584   1.868  1.00  0.63
ATOM    332  CD  LYS A  70     -32.656 -40.591   0.849  1.00  0.63
ATOM    333  CE  LYS A  70     -33.845 -39.702   1.233  1.00  0.63
ATOM    334  NZ  LYS A  70     -33.535 -38.268   1.129  1.00  0.63
ATOM    335  H   LYS A  70     -27.779 -40.382   1.701  1.00 99.99
ATOM    336  HZ1 LYS A  70     -34.344 -37.732   1.372  1.00 99.99
ATOM    337  HZ2 LYS A  70     -32.785 -38.050   1.750  1.00 99.99
ATOM    338  HZ3 LYS A  70     -33.276 -38.062   0.183  1.00 99.99
ATOM    339  N   SER A  71     -28.602 -44.080   2.300  1.00  0.69
ATOM    340  CA  SER A  71     -27.761 -45.259   1.970  1.00  0.69
ATOM    341  C   SER A  71     -27.371 -45.358   0.491  1.00  0.69
ATOM    342  O   SER A  71     -28.224 -45.517  -0.384  1.00  0.69
ATOM    343  CB  SER A  71     -28.458 -46.572   2.320  1.00  0.69
ATOM    344  OG  SER A  71     -28.647 -46.698   3.727  1.00  0.69
ATOM    345  H   SER A  71     -29.388 -44.273   2.897  1.00 99.99
ATOM    346  HG  SER A  71     -29.147 -47.556   3.888  1.00 99.99
ATOM    347  N   GLY A  72     -26.062 -45.222   0.246  1.00  0.80
ATOM    348  CA  GLY A  72     -25.481 -45.326  -1.108  1.00  0.80
ATOM    349  C   GLY A  72     -25.647 -44.074  -1.985  1.00  0.80
ATOM    350  O   GLY A  72     -25.177 -44.078  -3.123  1.00  0.80
ATOM    351  H   GLY A  72     -25.381 -45.007   0.956  1.00 99.99
ATOM    352  N   GLN A  73     -26.137 -42.981  -1.404  1.00  0.83
ATOM    353  CA  GLN A  73     -26.282 -41.696  -2.120  1.00  0.83
ATOM    354  C   GLN A  73     -25.286 -40.629  -1.623  1.00  0.83
ATOM    355  O   GLN A  73     -25.365 -39.468  -2.031  1.00  0.83
ATOM    356  CB  GLN A  73     -27.721 -41.177  -1.982  1.00  0.83
ATOM    357  CG  GLN A  73     -28.780 -42.109  -2.589  1.00  0.83
ATOM    358  CD  GLN A  73     -30.193 -41.512  -2.549  1.00  0.83
ATOM    359  OE1 GLN A  73     -30.475 -40.496  -1.926  1.00  0.83
ATOM    360  NE2 GLN A  73     -31.105 -42.123  -3.273  1.00  0.83
ATOM    361  H   GLN A  73     -26.503 -42.974  -0.467  1.00 99.99
ATOM    362 1HE2 GLN A  73     -32.028 -41.741  -3.259  1.00 99.99
ATOM    363 2HE2 GLN A  73     -30.889 -42.945  -3.790  1.00 99.99
ATOM    364  N   GLY A  74     -24.294 -41.072  -0.835  1.00  0.94
ATOM    365  CA  GLY A  74     -23.227 -40.217  -0.276  1.00  0.94
ATOM    366  C   GLY A  74     -23.686 -39.310   0.875  1.00  0.94
ATOM    367  O   GLY A  74     -24.830 -39.365   1.331  1.00  0.94
ATOM    368  H   GLY A  74     -24.225 -42.028  -0.533  1.00 99.99
ATOM    369  N   TYR A  75     -22.736 -38.498   1.325  1.00  0.93
ATOM    370  CA  TYR A  75     -22.921 -37.558   2.445  1.00  0.93
ATOM    371  C   TYR A  75     -22.860 -36.130   1.914  1.00  0.93
ATOM    372  O   TYR A  75     -21.969 -35.793   1.130  1.00  0.93
ATOM    373  CB  TYR A  75     -21.789 -37.706   3.466  1.00  0.93
ATOM    374  CG  TYR A  75     -21.827 -39.065   4.154  1.00  0.93
ATOM    375  CD1 TYR A  75     -21.192 -40.150   3.567  1.00  0.93
ATOM    376  CD2 TYR A  75     -22.491 -39.199   5.365  1.00  0.93
ATOM    377  CE1 TYR A  75     -21.220 -41.390   4.193  1.00  0.93
ATOM    378  CE2 TYR A  75     -22.516 -40.434   5.992  1.00  0.93
ATOM    379  CZ  TYR A  75     -21.888 -41.522   5.404  1.00  0.93
ATOM    380  OH  TYR A  75     -21.880 -42.710   6.059  1.00  0.93
ATOM    381  H   TYR A  75     -21.847 -38.428   0.874  1.00 99.99
ATOM    382  HD1 TYR A  75     -20.664 -40.017   2.623  1.00 99.99
ATOM    383  HD2 TYR A  75     -22.980 -38.338   5.821  1.00 99.99
ATOM    384  HE1 TYR A  75     -20.622 -42.205   3.786  1.00 99.99
ATOM    385  HE2 TYR A  75     -22.979 -40.525   6.973  1.00 99.99
ATOM    386  HH  TYR A  75     -21.455 -43.407   5.473  1.00 99.99
ATOM    387  N   TYR A  76     -23.790 -35.318   2.382  1.00  0.94
ATOM    388  CA  TYR A  76     -23.847 -33.896   2.022  1.00  0.94
ATOM    389  C   TYR A  76     -23.814 -32.992   3.258  1.00  0.94
ATOM    390  O   TYR A  76     -24.228 -33.387   4.350  1.00  0.94
ATOM    391  CB  TYR A  76     -25.062 -33.597   1.127  1.00  0.94
ATOM    392  CG  TYR A  76     -26.421 -33.955   1.734  1.00  0.94
ATOM    393  CD1 TYR A  76     -27.035 -33.087   2.624  1.00  0.94
ATOM    394  CD2 TYR A  76     -27.064 -35.122   1.348  1.00  0.94
ATOM    395  CE1 TYR A  76     -28.288 -33.394   3.143  1.00  0.94
ATOM    396  CE2 TYR A  76     -28.320 -35.430   1.861  1.00  0.94
ATOM    397  CZ  TYR A  76     -28.929 -34.567   2.765  1.00  0.94
ATOM    398  OH  TYR A  76     -30.153 -34.872   3.283  1.00  0.94
ATOM    399  H   TYR A  76     -24.503 -35.626   3.028  1.00 99.99
ATOM    400  HD1 TYR A  76     -26.535 -32.161   2.905  1.00 99.99
ATOM    401  HD2 TYR A  76     -26.573 -35.792   0.644  1.00 99.99
ATOM    402  HE1 TYR A  76     -28.740 -32.720   3.872  1.00 99.99
ATOM    403  HE2 TYR A  76     -28.807 -36.355   1.555  1.00 99.99
ATOM    404  HH  TYR A  76     -30.412 -35.799   3.004  1.00 99.99
ATOM    405  N   VAL A  77     -23.262 -31.809   3.032  1.00  0.95
ATOM    406  CA  VAL A  77     -23.223 -30.703   4.005  1.00  0.95
ATOM    407  C   VAL A  77     -24.082 -29.554   3.450  1.00  0.95
ATOM    408  O   VAL A  77     -24.155 -29.366   2.231  1.00  0.95
ATOM    409  CB  VAL A  77     -21.756 -30.275   4.238  1.00  0.95
ATOM    410  CG1 VAL A  77     -21.079 -29.633   3.016  1.00  0.95
ATOM    411  CG2 VAL A  77     -21.626 -29.389   5.480  1.00  0.95
ATOM    412  H   VAL A  77     -22.892 -31.579   2.126  1.00 99.99
ATOM    413  N   GLU A  78     -24.751 -28.834   4.341  1.00  0.90
ATOM    414  CA  GLU A  78     -25.444 -27.588   3.963  1.00  0.90
ATOM    415  C   GLU A  78     -24.408 -26.490   3.654  1.00  0.90
ATOM    416  O   GLU A  78     -23.443 -26.304   4.398  1.00  0.90
ATOM    417  CB  GLU A  78     -26.355 -27.163   5.117  1.00  0.90
ATOM    418  CG  GLU A  78     -27.345 -26.077   4.689  1.00  0.90
ATOM    419  CD  GLU A  78     -28.258 -25.638   5.836  1.00  0.90
ATOM    420  OE1 GLU A  78     -29.040 -26.491   6.309  1.00  0.90
ATOM    421  OE2 GLU A  78     -28.185 -24.437   6.177  1.00  0.90
ATOM    422  H   GLU A  78     -24.841 -29.111   5.299  1.00 99.99
ATOM    423  N   MET A  79     -24.604 -25.812   2.530  1.00  0.92
ATOM    424  CA  MET A  79     -23.777 -24.661   2.114  1.00  0.92
ATOM    425  C   MET A  79     -24.696 -23.543   1.607  1.00  0.92
ATOM    426  O   MET A  79     -25.835 -23.798   1.211  1.00  0.92
ATOM    427  CB  MET A  79     -22.797 -25.045   0.994  1.00  0.92
ATOM    428  CG  MET A  79     -21.769 -26.099   1.422  1.00  0.92
ATOM    429  SD  MET A  79     -20.546 -26.521   0.127  1.00  0.92
ATOM    430  CE  MET A  79     -19.425 -25.148   0.279  1.00  0.92
ATOM    431  H   MET A  79     -25.365 -26.022   1.903  1.00 99.99
ATOM    432  N   THR A  80     -24.212 -22.311   1.691  1.00  0.93
ATOM    433  CA  THR A  80     -24.914 -21.163   1.080  1.00  0.93
ATOM    434  C   THR A  80     -24.013 -20.501   0.039  1.00  0.93
ATOM    435  O   THR A  80     -22.803 -20.380   0.261  1.00  0.93
ATOM    436  CB  THR A  80     -25.389 -20.110   2.095  1.00  0.93
ATOM    437  OG1 THR A  80     -24.293 -19.538   2.817  1.00  0.93
ATOM    438  CG2 THR A  80     -26.441 -20.682   3.048  1.00  0.93
ATOM    439  H   THR A  80     -23.316 -22.121   2.106  1.00 99.99
ATOM    440  HG1 THR A  80     -23.440 -19.976   2.542  1.00 99.99
ATOM    441  N   VAL A  81     -24.614 -20.165  -1.094  1.00  0.94
ATOM    442  CA  VAL A  81     -23.919 -19.459  -2.191  1.00  0.94
ATOM    443  C   VAL A  81     -24.648 -18.146  -2.519  1.00  0.94
ATOM    444  O   VAL A  81     -25.876 -18.080  -2.434  1.00  0.94
ATOM    445  CB  VAL A  81     -23.759 -20.347  -3.447  1.00  0.94
ATOM    446  CG1 VAL A  81     -22.936 -21.607  -3.154  1.00  0.94
ATOM    447  CG2 VAL A  81     -25.095 -20.729  -4.094  1.00  0.94
ATOM    448  H   VAL A  81     -25.583 -20.372  -1.267  1.00 99.99
ATOM    449  N   GLY A  82     -23.865 -17.138  -2.917  1.00  0.95
ATOM    450  CA  GLY A  82     -24.391 -15.827  -3.353  1.00  0.95
ATOM    451  C   GLY A  82     -24.928 -14.899  -2.249  1.00  0.95
ATOM    452  O   GLY A  82     -24.981 -15.254  -1.072  1.00  0.95
ATOM    453  H   GLY A  82     -22.856 -17.180  -2.840  1.00 99.99
ATOM    454  N   SER A  83     -25.274 -13.689  -2.683  1.00  0.92
ATOM    455  CA  SER A  83     -25.876 -12.629  -1.842  1.00  0.92
ATOM    456  C   SER A  83     -27.184 -12.151  -2.486  1.00  0.92
ATOM    457  O   SER A  83     -27.114 -11.673  -3.625  1.00  0.92
ATOM    458  CB  SER A  83     -24.985 -11.385  -1.729  1.00  0.92
ATOM    459  OG  SER A  83     -23.832 -11.609  -0.922  1.00  0.92
ATOM    460  H   SER A  83     -25.207 -13.455  -3.654  1.00 99.99
ATOM    461  HG  SER A  83     -23.288 -10.768  -0.901  1.00 99.99
ATOM    462  N   PRO A  84     -28.339 -12.308  -1.819  1.00  0.94
ATOM    463  CA  PRO A  84     -28.549 -12.968  -0.508  1.00  0.94
ATOM    464  C   PRO A  84     -28.297 -14.492  -0.575  1.00  0.94
ATOM    465  O   PRO A  84     -28.449 -15.068  -1.654  1.00  0.94
ATOM    466  CB  PRO A  84     -30.002 -12.629  -0.149  1.00  0.94
ATOM    467  CG  PRO A  84     -30.690 -12.489  -1.505  1.00  0.94
ATOM    468  CD  PRO A  84     -29.619 -11.814  -2.360  1.00  0.94
ATOM    469  N   PRO A  85     -27.886 -15.129   0.535  1.00  0.94
ATOM    470  CA  PRO A  85     -27.492 -16.555   0.553  1.00  0.94
ATOM    471  C   PRO A  85     -28.573 -17.545   0.091  1.00  0.94
ATOM    472  O   PRO A  85     -29.682 -17.577   0.624  1.00  0.94
ATOM    473  CB  PRO A  85     -27.045 -16.819   1.995  1.00  0.94
ATOM    474  CG  PRO A  85     -27.768 -15.754   2.817  1.00  0.94
ATOM    475  CD  PRO A  85     -27.768 -14.543   1.886  1.00  0.94
ATOM    476  N   GLN A  86     -28.192 -18.389  -0.864  1.00  0.89
ATOM    477  CA  GLN A  86     -29.049 -19.466  -1.406  1.00  0.89
ATOM    478  C   GLN A  86     -28.587 -20.816  -0.835  1.00  0.89
ATOM    479  O   GLN A  86     -27.446 -21.231  -1.069  1.00  0.89
ATOM    480  CB  GLN A  86     -28.953 -19.504  -2.939  1.00  0.89
ATOM    481  CG  GLN A  86     -29.397 -18.199  -3.614  1.00  0.89
ATOM    482  CD  GLN A  86     -29.213 -18.231  -5.135  1.00  0.89
ATOM    483  OE1 GLN A  86     -29.468 -19.209  -5.827  1.00  0.89
ATOM    484  NE2 GLN A  86     -28.795 -17.115  -5.690  1.00  0.89
ATOM    485  H   GLN A  86     -27.319 -18.273  -1.352  1.00 99.99
ATOM    486 1HE2 GLN A  86     -28.705 -17.094  -6.689  1.00 99.99
ATOM    487 2HE2 GLN A  86     -28.635 -16.306  -5.130  1.00 99.99
ATOM    488  N   THR A  87     -29.424 -21.400   0.020  1.00  0.91
ATOM    489  CA  THR A  87     -29.131 -22.677   0.714  1.00  0.91
ATOM    490  C   THR A  87     -29.199 -23.866  -0.256  1.00  0.91
ATOM    491  O   THR A  87     -30.214 -24.099  -0.912  1.00  0.91
ATOM    492  CB  THR A  87     -30.101 -22.900   1.889  1.00  0.91
ATOM    493  OG1 THR A  87     -30.100 -21.746   2.734  1.00  0.91
ATOM    494  CG2 THR A  87     -29.730 -24.122   2.737  1.00  0.91
ATOM    495  H   THR A  87     -30.309 -20.998   0.259  1.00 99.99
ATOM    496  HG1 THR A  87     -30.682 -21.920   3.531  1.00 99.99
ATOM    497  N   LEU A  88     -28.118 -24.636  -0.262  1.00  0.94
ATOM    498  CA  LEU A  88     -27.969 -25.850  -1.087  1.00  0.94
ATOM    499  C   LEU A  88     -27.343 -26.968  -0.244  1.00  0.94
ATOM    500  O   LEU A  88     -26.469 -26.707   0.588  1.00  0.94
ATOM    501  CB  LEU A  88     -27.034 -25.554  -2.269  1.00  0.94
ATOM    502  CG  LEU A  88     -27.526 -24.487  -3.256  1.00  0.94
ATOM    503  CD1 LEU A  88     -26.365 -24.077  -4.158  1.00  0.94
ATOM    504  CD2 LEU A  88     -28.662 -25.018  -4.134  1.00  0.94
ATOM    505  H   LEU A  88     -27.329 -24.436   0.330  1.00 99.99
ATOM    506  N   ASN A  89     -27.751 -28.201  -0.512  1.00  0.93
ATOM    507  CA  ASN A  89     -27.113 -29.396   0.072  1.00  0.93
ATOM    508  C   ASN A  89     -26.087 -29.954  -0.911  1.00  0.93
ATOM    509  O   ASN A  89     -26.397 -30.217  -2.078  1.00  0.93
ATOM    510  CB  ASN A  89     -28.146 -30.472   0.396  1.00  0.93
ATOM    511  CG  ASN A  89     -28.960 -30.141   1.645  1.00  0.93
ATOM    512  OD1 ASN A  89     -28.514 -29.474   2.570  1.00  0.93
ATOM    513  ND2 ASN A  89     -30.161 -30.665   1.706  1.00  0.93
ATOM    514  H   ASN A  89     -28.526 -28.385  -1.124  1.00 99.99
ATOM    515 1HD2 ASN A  89     -30.711 -30.454   2.505  1.00 99.99
ATOM    516 2HD2 ASN A  89     -30.489 -31.275   0.982  1.00 99.99
ATOM    517  N   ILE A  90     -24.854 -30.057  -0.439  1.00  0.95
ATOM    518  CA  ILE A  90     -23.710 -30.342  -1.322  1.00  0.95
ATOM    519  C   ILE A  90     -22.979 -31.608  -0.851  1.00  0.95
ATOM    520  O   ILE A  90     -22.517 -31.668   0.291  1.00  0.95
ATOM    521  CB  ILE A  90     -22.785 -29.104  -1.340  1.00  0.95
ATOM    522  CG1 ILE A  90     -23.496 -27.794  -1.736  1.00  0.95
ATOM    523  CG2 ILE A  90     -21.555 -29.331  -2.220  1.00  0.95
ATOM    524  CD  ILE A  90     -24.159 -27.774  -3.120  1.00  0.95
ATOM    525  H   ILE A  90     -24.630 -29.928   0.537  1.00 99.99
ATOM    526  N   LEU A  91     -22.821 -32.555  -1.771  1.00  0.95
ATOM    527  CA  LEU A  91     -22.073 -33.811  -1.556  1.00  0.95
ATOM    528  C   LEU A  91     -20.609 -33.507  -1.186  1.00  0.95
ATOM    529  O   LEU A  91     -19.932 -32.729  -1.861  1.00  0.95
ATOM    530  CB  LEU A  91     -22.121 -34.624  -2.858  1.00  0.95
ATOM    531  CG  LEU A  91     -21.522 -36.032  -2.749  1.00  0.95
ATOM    532  CD1 LEU A  91     -22.548 -37.027  -2.203  1.00  0.95
ATOM    533  CD2 LEU A  91     -20.979 -36.495  -4.100  1.00  0.95
ATOM    534  H   LEU A  91     -23.201 -32.454  -2.698  1.00 99.99
ATOM    535  N   VAL A  92     -20.125 -34.181  -0.151  1.00  0.96
ATOM    536  CA  VAL A  92     -18.732 -34.061   0.324  1.00  0.96
ATOM    537  C   VAL A  92     -17.898 -35.121  -0.402  1.00  0.96
ATOM    538  O   VAL A  92     -18.015 -36.315  -0.129  1.00  0.96
ATOM    539  CB  VAL A  92     -18.687 -34.198   1.857  1.00  0.96
ATOM    540  CG1 VAL A  92     -17.269 -34.362   2.417  1.00  0.96
ATOM    541  CG2 VAL A  92     -19.297 -32.946   2.489  1.00  0.96
ATOM    542  H   VAL A  92     -20.699 -34.827   0.369  1.00 99.99
ATOM    543  N   ASP A  93     -17.063 -34.641  -1.312  1.00  0.95
ATOM    544  CA  ASP A  93     -16.287 -35.513  -2.199  1.00  0.95
ATOM    545  C   ASP A  93     -14.785 -35.245  -2.034  1.00  0.95
ATOM    546  O   ASP A  93     -14.300 -34.168  -2.376  1.00  0.95
ATOM    547  CB  ASP A  93     -16.778 -35.217  -3.622  1.00  0.95
ATOM    548  CG  ASP A  93     -16.176 -36.088  -4.727  1.00  0.95
ATOM    549  OD1 ASP A  93     -15.316 -36.934  -4.391  1.00  0.95
ATOM    550  OD2 ASP A  93     -16.570 -35.882  -5.893  1.00  0.95
ATOM    551  H   ASP A  93     -16.912 -33.655  -1.448  1.00 99.99
ATOM    552  N   THR A  94     -14.058 -36.263  -1.587  1.00  0.97
ATOM    553  CA  THR A  94     -12.580 -36.183  -1.515  1.00  0.97
ATOM    554  C   THR A  94     -11.876 -36.839  -2.717  1.00  0.97
ATOM    555  O   THR A  94     -10.651 -36.801  -2.816  1.00  0.97
ATOM    556  CB  THR A  94     -12.012 -36.747  -0.202  1.00  0.97
ATOM    557  OG1 THR A  94     -12.370 -38.119  -0.030  1.00  0.97
ATOM    558  CG2 THR A  94     -12.479 -35.937   1.009  1.00  0.97
ATOM    559  H   THR A  94     -14.466 -37.079  -1.173  1.00 99.99
ATOM    560  HG1 THR A  94     -11.855 -38.451   0.769  1.00 99.99
ATOM    561  N   GLY A  95     -12.673 -37.302  -3.689  1.00  0.95
ATOM    562  CA  GLY A  95     -12.175 -37.885  -4.948  1.00  0.95
ATOM    563  C   GLY A  95     -12.079 -36.875  -6.106  1.00  0.95
ATOM    564  O   GLY A  95     -11.495 -37.208  -7.134  1.00  0.95
ATOM    565  H   GLY A  95     -13.684 -37.290  -3.652  1.00 99.99
ATOM    566  N   SER A  96     -12.716 -35.708  -5.972  1.00  0.90
ATOM    567  CA  SER A  96     -12.714 -34.660  -7.019  1.00  0.90
ATOM    568  C   SER A  96     -12.326 -33.280  -6.455  1.00  0.90
ATOM    569  O   SER A  96     -12.180 -33.135  -5.237  1.00  0.90
ATOM    570  CB  SER A  96     -14.055 -34.624  -7.773  1.00  0.90
ATOM    571  OG  SER A  96     -15.062 -33.851  -7.112  1.00  0.90
ATOM    572  H   SER A  96     -13.091 -35.410  -5.096  1.00 99.99
ATOM    573  HG  SER A  96     -15.927 -33.970  -7.612  1.00 99.99
ATOM    574  N   SER A  97     -12.251 -32.275  -7.328  1.00  0.93
ATOM    575  CA  SER A  97     -11.712 -30.940  -6.966  1.00  0.93
ATOM    576  C   SER A  97     -12.499 -29.731  -7.493  1.00  0.93
ATOM    577  O   SER A  97     -12.032 -28.591  -7.411  1.00  0.93
ATOM    578  CB  SER A  97     -10.271 -30.794  -7.458  1.00  0.93
ATOM    579  OG  SER A  97      -9.460 -31.852  -6.956  1.00  0.93
ATOM    580  H   SER A  97     -12.601 -32.363  -8.259  1.00 99.99
ATOM    581  HG  SER A  97      -8.506 -31.673  -7.242  1.00 99.99
ATOM    582  N   ASN A  98     -13.710 -29.961  -7.985  1.00  0.89
ATOM    583  CA  ASN A  98     -14.573 -28.866  -8.457  1.00  0.89
ATOM    584  C   ASN A  98     -15.723 -28.650  -7.478  1.00  0.89
ATOM    585  O   ASN A  98     -16.284 -29.607  -6.937  1.00  0.89
ATOM    586  CB  ASN A  98     -15.169 -29.189  -9.830  1.00  0.89
ATOM    587  CG  ASN A  98     -14.159 -29.011 -10.961  1.00  0.89
ATOM    588  OD1 ASN A  98     -13.353 -29.877 -11.265  1.00  0.89
ATOM    589  ND2 ASN A  98     -14.205 -27.859 -11.592  1.00  0.89
ATOM    590  H   ASN A  98     -14.132 -30.867  -8.009  1.00 99.99
ATOM    591 1HD2 ASN A  98     -13.566 -27.697 -12.355  1.00 99.99
ATOM    592 2HD2 ASN A  98     -14.863 -27.159 -11.339  1.00 99.99
ATOM    593  N   PHE A  99     -16.013 -27.385  -7.229  1.00  0.94
ATOM    594  CA  PHE A  99     -17.283 -27.011  -6.594  1.00  0.94
ATOM    595  C   PHE A  99     -18.314 -26.792  -7.711  1.00  0.94
ATOM    596  O   PHE A  99     -18.192 -25.860  -8.509  1.00  0.94
ATOM    597  CB  PHE A  99     -17.078 -25.767  -5.727  1.00  0.94
ATOM    598  CG  PHE A  99     -18.317 -25.381  -4.912  1.00  0.94
ATOM    599  CD1 PHE A  99     -19.199 -26.334  -4.413  1.00  0.94
ATOM    600  CD2 PHE A  99     -18.537 -24.037  -4.662  1.00  0.94
ATOM    601  CE1 PHE A  99     -20.302 -25.937  -3.665  1.00  0.94
ATOM    602  CE2 PHE A  99     -19.640 -23.641  -3.913  1.00  0.94
ATOM    603  CZ  PHE A  99     -20.520 -24.591  -3.410  1.00  0.94
ATOM    604  H   PHE A  99     -15.386 -26.626  -7.414  1.00 99.99
ATOM    605  HD1 PHE A  99     -19.020 -27.394  -4.583  1.00 99.99
ATOM    606  HD2 PHE A  99     -17.831 -23.297  -5.039  1.00 99.99
ATOM    607  HE1 PHE A  99     -20.995 -26.689  -3.293  1.00 99.99
ATOM    608  HE2 PHE A  99     -19.812 -22.581  -3.737  1.00 99.99
ATOM    609  HZ  PHE A  99     -21.349 -24.284  -2.767  1.00 99.99
ATOM    610  N   ALA A 100     -19.143 -27.811  -7.907  1.00  0.95
ATOM    611  CA  ALA A 100     -20.088 -27.860  -9.039  1.00  0.95
ATOM    612  C   ALA A 100     -21.518 -28.049  -8.529  1.00  0.95
ATOM    613  O   ALA A 100     -21.793 -29.013  -7.812  1.00  0.95
ATOM    614  CB  ALA A 100     -19.686 -29.010  -9.968  1.00  0.95
ATOM    615  H   ALA A 100     -19.247 -28.550  -7.231  1.00 99.99
ATOM    616  N   VAL A 101     -22.383 -27.090  -8.837  1.00  0.94
ATOM    617  CA  VAL A 101     -23.768 -27.080  -8.316  1.00  0.94
ATOM    618  C   VAL A 101     -24.787 -26.991  -9.461  1.00  0.94
ATOM    619  O   VAL A 101     -24.523 -26.322 -10.465  1.00  0.94
ATOM    620  CB  VAL A 101     -23.979 -25.944  -7.289  1.00  0.94
ATOM    621  CG1 VAL A 101     -23.011 -26.051  -6.107  1.00  0.94
ATOM    622  CG2 VAL A 101     -23.857 -24.546  -7.898  1.00  0.94
ATOM    623  H   VAL A 101     -22.166 -26.353  -9.487  1.00 99.99
ATOM    624  N   GLY A 102     -25.924 -27.675  -9.305  1.00  0.95
ATOM    625  CA  GLY A 102     -27.058 -27.554 -10.246  1.00  0.95
ATOM    626  C   GLY A 102     -27.537 -26.098 -10.310  1.00  0.95
ATOM    627  O   GLY A 102     -27.704 -25.443  -9.281  1.00  0.95
ATOM    628  H   GLY A 102     -26.099 -28.320  -8.538  1.00 99.99
ATOM    629  N   ALA A 103     -27.728 -25.612 -11.532  1.00  0.93
ATOM    630  CA  ALA A 103     -28.095 -24.200 -11.772  1.00  0.93
ATOM    631  C   ALA A 103     -29.273 -24.036 -12.747  1.00  0.93
ATOM    632  O   ALA A 103     -29.524 -22.960 -13.293  1.00  0.93
ATOM    633  CB  ALA A 103     -26.856 -23.460 -12.283  1.00  0.93
ATOM    634  H   ALA A 103     -27.689 -26.186 -12.353  1.00 99.99
ATOM    635  N   ALA A 104     -30.011 -25.124 -12.926  1.00  0.91
ATOM    636  CA  ALA A 104     -31.174 -25.204 -13.822  1.00  0.91
ATOM    637  C   ALA A 104     -32.199 -26.152 -13.176  1.00  0.91
ATOM    638  O   ALA A 104     -31.787 -27.026 -12.404  1.00  0.91
ATOM    639  CB  ALA A 104     -30.707 -25.741 -15.181  1.00  0.91
ATOM    640  H   ALA A 104     -29.862 -25.963 -12.401  1.00 99.99
ATOM    641  N   PRO A 105     -33.500 -25.978 -13.449  1.00  0.88
ATOM    642  CA  PRO A 105     -34.553 -26.824 -12.858  1.00  0.88
ATOM    643  C   PRO A 105     -34.621 -28.253 -13.433  1.00  0.88
ATOM    644  O   PRO A 105     -35.559 -28.615 -14.146  1.00  0.88
ATOM    645  CB  PRO A 105     -35.833 -26.011 -13.079  1.00  0.88
ATOM    646  CG  PRO A 105     -35.566 -25.285 -14.397  1.00  0.88
ATOM    647  CD  PRO A 105     -34.088 -24.912 -14.288  1.00  0.88
ATOM    648  N   HIS A 106     -33.611 -29.067 -13.136  1.00  0.85
ATOM    649  CA  HIS A 106     -33.657 -30.521 -13.397  1.00  0.85
ATOM    650  C   HIS A 106     -34.746 -31.121 -12.477  1.00  0.85
ATOM    651  O   HIS A 106     -34.755 -30.799 -11.286  1.00  0.85
ATOM    652  CB  HIS A 106     -32.269 -31.113 -13.107  1.00  0.85
ATOM    653  CG  HIS A 106     -32.150 -32.593 -13.482  1.00  0.85
ATOM    654  ND1 HIS A 106     -32.815 -33.588 -12.902  1.00  0.85
ATOM    655  CD2 HIS A 106     -31.353 -33.113 -14.416  1.00  0.85
ATOM    656  CE1 HIS A 106     -32.434 -34.720 -13.491  1.00  0.85
ATOM    657  NE2 HIS A 106     -31.525 -34.432 -14.413  1.00  0.85
ATOM    658  H   HIS A 106     -32.761 -28.735 -12.719  1.00 99.99
ATOM    659  HD1 HIS A 106     -30.999 -35.101 -14.945  1.00 99.99
ATOM    660  N   PRO A 107     -35.655 -31.961 -12.999  1.00  0.83
ATOM    661  CA  PRO A 107     -36.778 -32.515 -12.216  1.00  0.83
ATOM    662  C   PRO A 107     -36.420 -33.341 -10.968  1.00  0.83
ATOM    663  O   PRO A 107     -37.309 -33.616 -10.163  1.00  0.83
ATOM    664  CB  PRO A 107     -37.629 -33.299 -13.218  1.00  0.83
ATOM    665  CG  PRO A 107     -36.633 -33.674 -14.314  1.00  0.83
ATOM    666  CD  PRO A 107     -35.707 -32.458 -14.388  1.00  0.83
ATOM    667  N   PHE A 108     -35.167 -33.772 -10.834  1.00  0.87
ATOM    668  CA  PHE A 108     -34.698 -34.468  -9.614  1.00  0.87
ATOM    669  C   PHE A 108     -34.291 -33.523  -8.470  1.00  0.87
ATOM    670  O   PHE A 108     -34.094 -33.981  -7.341  1.00  0.87
ATOM    671  CB  PHE A 108     -33.514 -35.400  -9.901  1.00  0.87
ATOM    672  CG  PHE A 108     -33.740 -36.552 -10.892  1.00  0.87
ATOM    673  CD1 PHE A 108     -34.998 -36.923 -11.353  1.00  0.87
ATOM    674  CD2 PHE A 108     -32.618 -37.248 -11.315  1.00  0.87
ATOM    675  CE1 PHE A 108     -35.128 -37.979 -12.250  1.00  0.87
ATOM    676  CE2 PHE A 108     -32.746 -38.312 -12.208  1.00  0.87
ATOM    677  CZ  PHE A 108     -34.001 -38.672 -12.675  1.00  0.87
ATOM    678  H   PHE A 108     -34.456 -33.631 -11.531  1.00 99.99
ATOM    679  HD1 PHE A 108     -35.893 -36.414 -10.995  1.00 99.99
ATOM    680  HD2 PHE A 108     -31.639 -36.963 -10.934  1.00 99.99
ATOM    681  HE1 PHE A 108     -36.120 -38.257 -12.602  1.00 99.99
ATOM    682  HE2 PHE A 108     -31.865 -38.887 -12.492  1.00 99.99
ATOM    683  HZ  PHE A 108     -34.109 -39.525 -13.349  1.00 99.99
ATOM    684  N   LEU A 109     -34.070 -32.247  -8.776  1.00  0.89
ATOM    685  CA  LEU A 109     -33.506 -31.289  -7.805  1.00  0.89
ATOM    686  C   LEU A 109     -34.563 -30.588  -6.944  1.00  0.89
ATOM    687  O   LEU A 109     -35.484 -29.955  -7.462  1.00  0.89
ATOM    688  CB  LEU A 109     -32.655 -30.227  -8.515  1.00  0.89
ATOM    689  CG  LEU A 109     -31.419 -30.766  -9.249  1.00  0.89
ATOM    690  CD1 LEU A 109     -30.697 -29.603  -9.931  1.00  0.89
ATOM    691  CD2 LEU A 109     -30.455 -31.486  -8.302  1.00  0.89
ATOM    692  H   LEU A 109     -34.381 -31.833  -9.639  1.00 99.99
ATOM    693  N   HIS A 110     -34.304 -30.601  -5.642  1.00  0.80
ATOM    694  CA  HIS A 110     -35.094 -29.867  -4.629  1.00  0.80
ATOM    695  C   HIS A 110     -34.985 -28.339  -4.753  1.00  0.80
ATOM    696  O   HIS A 110     -35.933 -27.606  -4.474  1.00  0.80
ATOM    697  CB  HIS A 110     -34.610 -30.268  -3.235  1.00  0.80
ATOM    698  CG  HIS A 110     -34.969 -31.708  -2.879  1.00  0.80
ATOM    699  ND1 HIS A 110     -36.055 -32.079  -2.211  1.00  0.80
ATOM    700  CD2 HIS A 110     -34.286 -32.801  -3.212  1.00  0.80
ATOM    701  CE1 HIS A 110     -36.042 -33.406  -2.128  1.00  0.80
ATOM    702  NE2 HIS A 110     -34.953 -33.849  -2.743  1.00  0.80
ATOM    703  H   HIS A 110     -33.623 -31.222  -5.253  1.00 99.99
ATOM    704  HD1 HIS A 110     -34.633 -34.802  -2.768  1.00 99.99
ATOM    705  N   ARG A 111     -33.787 -27.883  -5.100  1.00  0.80
ATOM    706  CA  ARG A 111     -33.436 -26.462  -5.275  1.00  0.80
ATOM    707  C   ARG A 111     -32.195 -26.394  -6.179  1.00  0.80
ATOM    708  O   ARG A 111     -31.633 -27.432  -6.541  1.00  0.80
ATOM    709  CB  ARG A 111     -33.246 -25.772  -3.905  1.00  0.80
ATOM    710  CG  ARG A 111     -32.141 -26.381  -3.034  1.00  0.80
ATOM    711  CD  ARG A 111     -32.586 -26.629  -1.590  1.00  0.80
ATOM    712  NE  ARG A 111     -32.093 -27.966  -1.221  1.00  0.80
ATOM    713  CZ  ARG A 111     -32.789 -28.969  -0.677  1.00  0.80
ATOM    714  NH1 ARG A 111     -32.268 -30.182  -0.598  1.00  0.80
ATOM    715  NH2 ARG A 111     -33.970 -28.777  -0.112  1.00  0.80
ATOM    716  H   ARG A 111     -33.043 -28.505  -5.343  1.00 99.99
ATOM    717  HE  ARG A 111     -31.132 -28.128  -1.437  1.00 99.99
ATOM    718 1HH1 ARG A 111     -32.812 -30.933  -0.207  1.00 99.99
ATOM    719 2HH1 ARG A 111     -31.411 -30.406  -1.060  1.00 99.99
ATOM    720 1HH2 ARG A 111     -34.465 -29.549   0.286  1.00 99.99
ATOM    721 2HH2 ARG A 111     -34.376 -27.867  -0.133  1.00 99.99
ATOM    722  N   TYR A 112     -31.825 -25.194  -6.598  1.00  0.90
ATOM    723  CA  TYR A 112     -30.686 -24.985  -7.515  1.00  0.90
ATOM    724  C   TYR A 112     -30.184 -23.542  -7.435  1.00  0.90
ATOM    725  O   TYR A 112     -30.862 -22.663  -6.897  1.00  0.90
ATOM    726  CB  TYR A 112     -31.018 -25.397  -8.964  1.00  0.90
ATOM    727  CG  TYR A 112     -32.270 -24.735  -9.547  1.00  0.90
ATOM    728  CD1 TYR A 112     -33.510 -25.330  -9.364  1.00  0.90
ATOM    729  CD2 TYR A 112     -32.167 -23.533 -10.230  1.00  0.90
ATOM    730  CE1 TYR A 112     -34.657 -24.707  -9.844  1.00  0.90
ATOM    731  CE2 TYR A 112     -33.312 -22.911 -10.720  1.00  0.90
ATOM    732  CZ  TYR A 112     -34.556 -23.498 -10.520  1.00  0.90
ATOM    733  OH  TYR A 112     -35.685 -22.901 -10.990  1.00  0.90
ATOM    734  H   TYR A 112     -32.221 -24.350  -6.231  1.00 99.99
ATOM    735  HD1 TYR A 112     -33.576 -26.294  -8.860  1.00 99.99
ATOM    736  HD2 TYR A 112     -31.187 -23.078 -10.374  1.00 99.99
ATOM    737  HE1 TYR A 112     -35.633 -25.157  -9.657  1.00 99.99
ATOM    738  HE2 TYR A 112     -33.219 -21.959 -11.243  1.00 99.99
ATOM    739  HH  TYR A 112     -35.462 -22.020 -11.406  1.00 99.99
ATOM    740  N   TYR A 113     -28.937 -23.370  -7.845  1.00  0.91
ATOM    741  CA  TYR A 113     -28.240 -22.075  -7.828  1.00  0.91
ATOM    742  C   TYR A 113     -28.778 -21.130  -8.912  1.00  0.91
ATOM    743  O   TYR A 113     -28.585 -21.348 -10.110  1.00  0.91
ATOM    744  CB  TYR A 113     -26.748 -22.368  -8.004  1.00  0.91
ATOM    745  CG  TYR A 113     -25.822 -21.150  -8.072  1.00  0.91
ATOM    746  CD1 TYR A 113     -26.077 -19.983  -7.363  1.00  0.91
ATOM    747  CD2 TYR A 113     -24.676 -21.250  -8.847  1.00  0.91
ATOM    748  CE1 TYR A 113     -25.190 -18.914  -7.436  1.00  0.91
ATOM    749  CE2 TYR A 113     -23.776 -20.193  -8.906  1.00  0.91
ATOM    750  CZ  TYR A 113     -24.041 -19.021  -8.211  1.00  0.91
ATOM    751  OH  TYR A 113     -23.192 -17.964  -8.333  1.00  0.91
ATOM    752  H   TYR A 113     -28.424 -24.112  -8.294  1.00 99.99
ATOM    753  HD1 TYR A 113     -26.947 -19.925  -6.710  1.00 99.99
ATOM    754  HD2 TYR A 113     -24.502 -22.155  -9.427  1.00 99.99
ATOM    755  HE1 TYR A 113     -25.390 -18.021  -6.846  1.00 99.99
ATOM    756  HE2 TYR A 113     -22.828 -20.327  -9.427  1.00 99.99
ATOM    757  HH  TYR A 113     -23.564 -17.179  -7.839  1.00 99.99
ATOM    758  N   GLN A 114     -29.419 -20.061  -8.459  1.00  0.87
ATOM    759  CA  GLN A 114     -29.989 -19.039  -9.353  1.00  0.87
ATOM    760  C   GLN A 114     -29.086 -17.799  -9.377  1.00  0.87
ATOM    761  O   GLN A 114     -29.155 -16.912  -8.520  1.00  0.87
ATOM    762  CB  GLN A 114     -31.418 -18.688  -8.924  1.00  0.87
ATOM    763  CG  GLN A 114     -32.351 -19.900  -8.999  1.00  0.87
ATOM    764  CD  GLN A 114     -33.806 -19.507  -8.748  1.00  0.87
ATOM    765  OE1 GLN A 114     -34.577 -19.270  -9.669  1.00  0.87
ATOM    766  NE2 GLN A 114     -34.191 -19.442  -7.491  1.00  0.87
ATOM    767  H   GLN A 114     -29.570 -19.901  -7.474  1.00 99.99
ATOM    768 1HE2 GLN A 114     -35.138 -19.196  -7.306  1.00 99.99
ATOM    769 2HE2 GLN A 114     -33.546 -19.643  -6.758  1.00 99.99
ATOM    770  N   ARG A 115     -28.205 -17.778 -10.369  1.00  0.83
ATOM    771  CA  ARG A 115     -27.186 -16.719 -10.541  1.00  0.83
ATOM    772  C   ARG A 115     -27.753 -15.301 -10.711  1.00  0.83
ATOM    773  O   ARG A 115     -27.179 -14.354 -10.167  1.00  0.83
ATOM    774  CB  ARG A 115     -26.275 -17.059 -11.718  1.00  0.83
ATOM    775  CG  ARG A 115     -25.399 -18.265 -11.379  1.00  0.83
ATOM    776  CD  ARG A 115     -24.594 -18.723 -12.589  1.00  0.83
ATOM    777  NE  ARG A 115     -25.460 -19.415 -13.559  1.00  0.83
ATOM    778  CZ  ARG A 115     -25.113 -19.724 -14.806  1.00  0.83
ATOM    779  NH1 ARG A 115     -23.932 -19.374 -15.295  1.00  0.83
ATOM    780  NH2 ARG A 115     -25.917 -20.455 -15.561  1.00  0.83
ATOM    781  H   ARG A 115     -28.190 -18.491 -11.072  1.00 99.99
ATOM    782  HE  ARG A 115     -26.340 -19.739 -13.221  1.00 99.99
ATOM    783 1HH1 ARG A 115     -23.703 -19.634 -16.234  1.00 99.99
ATOM    784 2HH1 ARG A 115     -23.326 -18.793 -14.759  1.00 99.99
ATOM    785 1HH2 ARG A 115     -25.616 -20.678 -16.490  1.00 99.99
ATOM    786 2HH2 ARG A 115     -26.818 -20.747 -15.244  1.00 99.99
ATOM    787  N   GLN A 116     -28.943 -15.200 -11.297  1.00  0.85
ATOM    788  CA  GLN A 116     -29.655 -13.919 -11.495  1.00  0.85
ATOM    789  C   GLN A 116     -30.101 -13.240 -10.183  1.00  0.85
ATOM    790  O   GLN A 116     -30.435 -12.055 -10.186  1.00  0.85
ATOM    791  CB  GLN A 116     -30.832 -14.070 -12.476  1.00  0.85
ATOM    792  CG  GLN A 116     -32.090 -14.784 -11.950  1.00  0.85
ATOM    793  CD  GLN A 116     -32.032 -16.314 -11.862  1.00  0.85
ATOM    794  OE1 GLN A 116     -30.999 -16.969 -11.969  1.00  0.85
ATOM    795  NE2 GLN A 116     -33.184 -16.908 -11.643  1.00  0.85
ATOM    796  H   GLN A 116     -29.454 -16.001 -11.632  1.00 99.99
ATOM    797 1HE2 GLN A 116     -33.205 -17.903 -11.574  1.00 99.99
ATOM    798 2HE2 GLN A 116     -34.019 -16.376 -11.527  1.00 99.99
ATOM    799  N   LEU A 117     -30.164 -14.012  -9.100  1.00  0.89
ATOM    800  CA  LEU A 117     -30.543 -13.503  -7.767  1.00  0.89
ATOM    801  C   LEU A 117     -29.338 -13.076  -6.910  1.00  0.89
ATOM    802  O   LEU A 117     -29.524 -12.602  -5.786  1.00  0.89
ATOM    803  CB  LEU A 117     -31.342 -14.560  -6.994  1.00  0.89
ATOM    804  CG  LEU A 117     -32.648 -15.027  -7.648  1.00  0.89
ATOM    805  CD1 LEU A 117     -33.259 -16.121  -6.772  1.00  0.89
ATOM    806  CD2 LEU A 117     -33.659 -13.890  -7.827  1.00  0.89
ATOM    807  H   LEU A 117     -29.924 -14.985  -9.116  1.00 99.99
ATOM    808  N   SER A 118     -28.118 -13.323  -7.381  1.00  0.91
ATOM    809  CA  SER A 118     -26.917 -12.954  -6.606  1.00  0.91
ATOM    810  C   SER A 118     -26.296 -11.656  -7.122  1.00  0.91
ATOM    811  O   SER A 118     -25.864 -11.574  -8.273  1.00  0.91
ATOM    812  CB  SER A 118     -25.868 -14.065  -6.635  1.00  0.91
ATOM    813  OG  SER A 118     -24.774 -13.736  -5.764  1.00  0.91
ATOM    814  H   SER A 118     -27.948 -13.691  -8.302  1.00 99.99
ATOM    815  HG  SER A 118     -24.122 -14.510  -5.841  1.00 99.99
ATOM    816  N   SER A 119     -26.145 -10.710  -6.204  1.00  0.92
ATOM    817  CA  SER A 119     -25.457  -9.430  -6.482  1.00  0.92
ATOM    818  C   SER A 119     -23.928  -9.559  -6.487  1.00  0.92
ATOM    819  O   SER A 119     -23.221  -8.697  -7.008  1.00  0.92
ATOM    820  CB  SER A 119     -25.873  -8.344  -5.486  1.00  0.92
ATOM    821  OG  SER A 119     -25.559  -8.730  -4.144  1.00  0.92
ATOM    822  H   SER A 119     -26.476 -10.816  -5.258  1.00 99.99
ATOM    823  HG  SER A 119     -25.811  -7.973  -3.538  1.00 99.99
ATOM    824  N   THR A 120     -23.442 -10.660  -5.921  1.00  0.92
ATOM    825  CA  THR A 120     -21.997 -10.919  -5.785  1.00  0.92
ATOM    826  C   THR A 120     -21.439 -11.927  -6.799  1.00  0.92
ATOM    827  O   THR A 120     -20.247 -12.198  -6.809  1.00  0.92
ATOM    828  CB  THR A 120     -21.611 -11.274  -4.339  1.00  0.92
ATOM    829  OG1 THR A 120     -22.476 -12.268  -3.778  1.00  0.92
ATOM    830  CG2 THR A 120     -21.609 -10.017  -3.466  1.00  0.92
ATOM    831  H   THR A 120     -24.053 -11.376  -5.591  1.00 99.99
ATOM    832  HG1 THR A 120     -23.143 -12.572  -4.450  1.00 99.99
ATOM    833  N   TYR A 121     -22.289 -12.470  -7.667  1.00  0.88
ATOM    834  CA  TYR A 121     -21.854 -13.326  -8.788  1.00  0.88
ATOM    835  C   TYR A 121     -20.924 -12.581  -9.766  1.00  0.88
ATOM    836  O   TYR A 121     -21.111 -11.400 -10.056  1.00  0.88
ATOM    837  CB  TYR A 121     -23.115 -13.829  -9.505  1.00  0.88
ATOM    838  CG  TYR A 121     -22.831 -14.603 -10.794  1.00  0.88
ATOM    839  CD1 TYR A 121     -23.168 -14.050 -12.022  1.00  0.88
ATOM    840  CD2 TYR A 121     -22.194 -15.836 -10.750  1.00  0.88
ATOM    841  CE1 TYR A 121     -22.889 -14.730 -13.197  1.00  0.88
ATOM    842  CE2 TYR A 121     -21.908 -16.519 -11.921  1.00  0.88
ATOM    843  CZ  TYR A 121     -22.265 -15.977 -13.154  1.00  0.88
ATOM    844  OH  TYR A 121     -22.085 -16.690 -14.297  1.00  0.88
ATOM    845  H   TYR A 121     -23.269 -12.275  -7.649  1.00 99.99
ATOM    846  HD1 TYR A 121     -23.657 -13.074 -12.050  1.00 99.99
ATOM    847  HD2 TYR A 121     -21.908 -16.255  -9.786  1.00 99.99
ATOM    848  HE1 TYR A 121     -23.165 -14.276 -14.151  1.00 99.99
ATOM    849  HE2 TYR A 121     -21.408 -17.486 -11.852  1.00 99.99
ATOM    850  HH  TYR A 121     -21.663 -17.572 -14.080  1.00 99.99
ATOM    851  N   ARG A 122     -19.918 -13.305 -10.241  1.00  0.82
ATOM    852  CA  ARG A 122     -19.024 -12.854 -11.322  1.00  0.82
ATOM    853  C   ARG A 122     -18.873 -13.998 -12.324  1.00  0.82
ATOM    854  O   ARG A 122     -18.615 -15.139 -11.934  1.00  0.82
ATOM    855  CB  ARG A 122     -17.634 -12.490 -10.786  1.00  0.82
ATOM    856  CG  ARG A 122     -17.658 -11.284  -9.845  1.00  0.82
ATOM    857  CD  ARG A 122     -16.262 -11.004  -9.293  1.00  0.82
ATOM    858  NE  ARG A 122     -16.355  -9.959  -8.258  1.00  0.82
ATOM    859  CZ  ARG A 122     -15.390  -9.607  -7.405  1.00  0.82
ATOM    860  NH1 ARG A 122     -15.607  -8.654  -6.510  1.00  0.82
ATOM    861  NH2 ARG A 122     -14.205 -10.205  -7.411  1.00  0.82
ATOM    862  H   ARG A 122     -19.684 -14.204  -9.858  1.00 99.99
ATOM    863  HE  ARG A 122     -17.246  -9.518  -8.181  1.00 99.99
ATOM    864 1HH1 ARG A 122     -14.884  -8.408  -5.869  1.00 99.99
ATOM    865 2HH1 ARG A 122     -16.487  -8.184  -6.480  1.00 99.99
ATOM    866 1HH2 ARG A 122     -13.499  -9.944  -6.759  1.00 99.99
ATOM    867 2HH2 ARG A 122     -14.044 -10.923  -8.084  1.00 99.99
ATOM    868  N   ASP A 123     -19.136 -13.703 -13.589  1.00  0.86
ATOM    869  CA  ASP A 123     -18.933 -14.675 -14.675  1.00  0.86
ATOM    870  C   ASP A 123     -17.428 -14.778 -15.003  1.00  0.86
ATOM    871  O   ASP A 123     -16.722 -13.770 -14.997  1.00  0.86
ATOM    872  CB  ASP A 123     -19.751 -14.183 -15.878  1.00  0.86
ATOM    873  CG  ASP A 123     -19.998 -15.230 -16.971  1.00  0.86
ATOM    874  OD1 ASP A 123     -19.365 -16.311 -16.908  1.00  0.86
ATOM    875  OD2 ASP A 123     -20.720 -14.883 -17.927  1.00  0.86
ATOM    876  H   ASP A 123     -19.453 -12.797 -13.871  1.00 99.99
ATOM    877  N   LEU A 124     -16.967 -15.994 -15.282  1.00  0.85
ATOM    878  CA  LEU A 124     -15.595 -16.238 -15.776  1.00  0.85
ATOM    879  C   LEU A 124     -15.538 -16.400 -17.307  1.00  0.85
ATOM    880  O   LEU A 124     -14.452 -16.552 -17.868  1.00  0.85
ATOM    881  CB  LEU A 124     -14.969 -17.462 -15.088  1.00  0.85
ATOM    882  CG  LEU A 124     -14.482 -17.211 -13.653  1.00  0.85
ATOM    883  CD1 LEU A 124     -14.177 -18.547 -12.973  1.00  0.85
ATOM    884  CD2 LEU A 124     -13.212 -16.352 -13.641  1.00  0.85
ATOM    885  H   LEU A 124     -17.527 -16.822 -15.194  1.00 99.99
ATOM    886  N   ARG A 125     -16.704 -16.428 -17.960  1.00  0.78
ATOM    887  CA  ARG A 125     -16.854 -16.533 -19.431  1.00  0.78
ATOM    888  C   ARG A 125     -16.168 -17.777 -20.036  1.00  0.78
ATOM    889  O   ARG A 125     -15.623 -17.747 -21.140  1.00  0.78
ATOM    890  CB  ARG A 125     -16.367 -15.234 -20.092  1.00  0.78
ATOM    891  CG  ARG A 125     -17.376 -14.083 -19.993  1.00  0.78
ATOM    892  CD  ARG A 125     -16.790 -12.756 -20.500  1.00  0.78
ATOM    893  NE  ARG A 125     -16.177 -12.888 -21.837  1.00  0.78
ATOM    894  CZ  ARG A 125     -16.800 -12.951 -23.021  1.00  0.78
ATOM    895  NH1 ARG A 125     -18.119 -12.856 -23.120  1.00  0.78
ATOM    896  NH2 ARG A 125     -16.103 -13.155 -24.128  1.00  0.78
ATOM    897  H   ARG A 125     -17.578 -16.360 -17.474  1.00 99.99
ATOM    898  HE  ARG A 125     -15.185 -12.990 -21.823  1.00 99.99
ATOM    899 1HH1 ARG A 125     -18.567 -12.911 -24.010  1.00 99.99
ATOM    900 2HH1 ARG A 125     -18.653 -12.718 -22.289  1.00 99.99
ATOM    901 1HH2 ARG A 125     -16.578 -13.208 -25.006  1.00 99.99
ATOM    902 2HH2 ARG A 125     -15.111 -13.256 -24.093  1.00 99.99
ATOM    903  N   LYS A 126     -16.274 -18.900 -19.327  1.00  0.85
ATOM    904  CA  LYS A 126     -15.597 -20.158 -19.702  1.00  0.85
ATOM    905  C   LYS A 126     -16.490 -21.338 -19.292  1.00  0.85
ATOM    906  O   LYS A 126     -17.055 -21.349 -18.195  1.00  0.85
ATOM    907  CB  LYS A 126     -14.220 -20.174 -19.008  1.00  0.85
ATOM    908  CG  LYS A 126     -13.245 -21.279 -19.444  1.00  0.85
ATOM    909  CD  LYS A 126     -11.847 -21.049 -18.844  1.00  0.85
ATOM    910  CE  LYS A 126     -10.917 -22.259 -19.013  1.00  0.85
ATOM    911  NZ  LYS A 126      -9.628 -22.122 -18.304  1.00  0.85
ATOM    912  H   LYS A 126     -16.859 -18.967 -18.519  1.00 99.99
ATOM    913  HZ1 LYS A 126      -9.102 -22.972 -18.396  1.00 99.99
ATOM    914  HZ2 LYS A 126      -9.095 -21.373 -18.696  1.00 99.99
ATOM    915  HZ3 LYS A 126      -9.780 -21.950 -17.331  1.00 99.99
ATOM    916  N   GLY A 127     -16.743 -22.218 -20.266  1.00  0.93
ATOM    917  CA  GLY A 127     -17.539 -23.440 -20.041  1.00  0.93
ATOM    918  C   GLY A 127     -16.615 -24.642 -19.806  1.00  0.93
ATOM    919  O   GLY A 127     -15.408 -24.573 -20.034  1.00  0.93
ATOM    920  H   GLY A 127     -16.359 -22.154 -21.196  1.00 99.99
ATOM    921  N   VAL A 128     -17.199 -25.712 -19.284  1.00  0.84
ATOM    922  CA  VAL A 128     -16.491 -26.989 -19.090  1.00  0.84
ATOM    923  C   VAL A 128     -17.447 -28.162 -19.351  1.00  0.84
ATOM    924  O   VAL A 128     -18.602 -28.141 -18.913  1.00  0.84
ATOM    925  CB  VAL A 128     -15.821 -27.023 -17.697  1.00  0.84
ATOM    926  CG1 VAL A 128     -16.802 -27.077 -16.517  1.00  0.84
ATOM    927  CG2 VAL A 128     -14.779 -28.141 -17.618  1.00  0.84
ATOM    928  H   VAL A 128     -18.160 -25.703 -18.991  1.00 99.99
ATOM    929  N   TYR A 129     -16.951 -29.133 -20.103  1.00  0.76
ATOM    930  CA  TYR A 129     -17.673 -30.388 -20.374  1.00  0.76
ATOM    931  C   TYR A 129     -16.861 -31.505 -19.711  1.00  0.76
ATOM    932  O   TYR A 129     -15.678 -31.673 -20.009  1.00  0.76
ATOM    933  CB  TYR A 129     -17.740 -30.612 -21.888  1.00  0.76
ATOM    934  CG  TYR A 129     -18.751 -31.694 -22.270  1.00  0.76
ATOM    935  CD1 TYR A 129     -20.024 -31.318 -22.669  1.00  0.76
ATOM    936  CD2 TYR A 129     -18.410 -33.040 -22.243  1.00  0.76
ATOM    937  CE1 TYR A 129     -20.957 -32.275 -23.041  1.00  0.76
ATOM    938  CE2 TYR A 129     -19.336 -34.004 -22.619  1.00  0.76
ATOM    939  CZ  TYR A 129     -20.616 -33.621 -23.022  1.00  0.76
ATOM    940  OH  TYR A 129     -21.550 -34.542 -23.386  1.00  0.76
ATOM    941  H   TYR A 129     -16.027 -29.095 -20.492  1.00 99.99
ATOM    942  HD1 TYR A 129     -20.263 -30.260 -22.725  1.00 99.99
ATOM    943  HD2 TYR A 129     -17.409 -33.329 -21.923  1.00 99.99
ATOM    944  HE1 TYR A 129     -21.964 -31.962 -23.325  1.00 99.99
ATOM    945  HE2 TYR A 129     -19.038 -35.053 -22.600  1.00 99.99
ATOM    946  HH  TYR A 129     -21.169 -35.465 -23.336  1.00 99.99
ATOM    947  N   VAL A 130     -17.479 -32.181 -18.751  1.00  0.78
ATOM    948  CA  VAL A 130     -16.781 -33.181 -17.919  1.00  0.78
ATOM    949  C   VAL A 130     -17.424 -34.564 -18.113  1.00  0.78
ATOM    950  O   VAL A 130     -18.505 -34.808 -17.569  1.00  0.78
ATOM    951  CB  VAL A 130     -16.782 -32.780 -16.429  1.00  0.78
ATOM    952  CG1 VAL A 130     -15.986 -33.775 -15.574  1.00  0.78
ATOM    953  CG2 VAL A 130     -16.213 -31.376 -16.214  1.00  0.78
ATOM    954  H   VAL A 130     -18.447 -32.037 -18.512  1.00 99.99
ATOM    955  N   PRO A 131     -16.799 -35.426 -18.923  1.00  0.78
ATOM    956  CA  PRO A 131     -17.188 -36.841 -19.006  1.00  0.78
ATOM    957  C   PRO A 131     -16.503 -37.600 -17.858  1.00  0.78
ATOM    958  O   PRO A 131     -15.445 -37.192 -17.378  1.00  0.78
ATOM    959  CB  PRO A 131     -16.664 -37.337 -20.356  1.00  0.78
ATOM    960  CG  PRO A 131     -15.808 -36.208 -20.943  1.00  0.78
ATOM    961  CD  PRO A 131     -15.705 -35.125 -19.867  1.00  0.78
ATOM    962  N   TYR A 132     -17.146 -38.661 -17.389  1.00  0.68
ATOM    963  CA  TYR A 132     -16.558 -39.579 -16.392  1.00  0.68
ATOM    964  C   TYR A 132     -17.198 -40.966 -16.520  1.00  0.68
ATOM    965  O   TYR A 132     -18.203 -41.139 -17.214  1.00  0.68
ATOM    966  CB  TYR A 132     -16.685 -39.037 -14.955  1.00  0.68
ATOM    967  CG  TYR A 132     -18.126 -38.799 -14.501  1.00  0.68
ATOM    968  CD1 TYR A 132     -18.720 -37.569 -14.744  1.00  0.68
ATOM    969  CD2 TYR A 132     -18.845 -39.810 -13.874  1.00  0.68
ATOM    970  CE1 TYR A 132     -20.040 -37.356 -14.379  1.00  0.68
ATOM    971  CE2 TYR A 132     -20.169 -39.598 -13.506  1.00  0.68
ATOM    972  CZ  TYR A 132     -20.770 -38.373 -13.771  1.00  0.68
ATOM    973  OH  TYR A 132     -22.086 -38.162 -13.506  1.00  0.68
ATOM    974  H   TYR A 132     -18.075 -38.913 -17.685  1.00 99.99
ATOM    975  HD1 TYR A 132     -18.140 -36.777 -15.218  1.00 99.99
ATOM    976  HD2 TYR A 132     -18.349 -40.751 -13.633  1.00 99.99
ATOM    977  HE1 TYR A 132     -20.492 -36.382 -14.564  1.00 99.99
ATOM    978  HE2 TYR A 132     -20.696 -40.372 -12.945  1.00 99.99
ATOM    979  HH  TYR A 132     -22.521 -38.980 -13.103  1.00 99.99
ATOM    980  N   THR A 133     -16.568 -41.961 -15.912  1.00  0.57
ATOM    981  CA  THR A 133     -17.104 -43.337 -15.900  1.00  0.57
ATOM    982  C   THR A 133     -18.338 -43.465 -14.998  1.00  0.57
ATOM    983  O   THR A 133     -18.199 -43.501 -13.777  1.00  0.57
ATOM    984  CB  THR A 133     -16.017 -44.351 -15.519  1.00  0.57
ATOM    985  OG1 THR A 133     -15.246 -43.879 -14.411  1.00  0.57
ATOM    986  CG2 THR A 133     -15.107 -44.632 -16.715  1.00  0.57
ATOM    987  H   THR A 133     -15.744 -41.840 -15.352  1.00 99.99
ATOM    988  HG1 THR A 133     -14.606 -44.597 -14.133  1.00 99.99
ATOM    989  N   GLN A 134     -19.498 -43.372 -15.653  1.00  0.62
ATOM    990  CA  GLN A 134     -20.895 -43.424 -15.140  1.00  0.62
ATOM    991  C   GLN A 134     -21.791 -42.287 -15.668  1.00  0.62
ATOM    992  O   GLN A 134     -23.008 -42.391 -15.521  1.00  0.62
ATOM    993  CB  GLN A 134     -21.095 -43.563 -13.614  1.00  0.62
ATOM    994  CG  GLN A 134     -20.878 -44.997 -13.103  1.00  0.62
ATOM    995  CD  GLN A 134     -20.813 -45.074 -11.572  1.00  0.62
ATOM    996  OE1 GLN A 134     -19.759 -45.042 -10.953  1.00  0.62
ATOM    997  NE2 GLN A 134     -21.947 -45.253 -10.927  1.00  0.62
ATOM    998  H   GLN A 134     -19.468 -43.201 -16.638  1.00 99.99
ATOM    999 1HE2 GLN A 134     -21.896 -45.298  -9.933  1.00 99.99
ATOM   1000 2HE2 GLN A 134     -22.807 -45.324 -11.420  1.00 99.99
ATOM   1001  N   GLY A 135     -21.221 -41.235 -16.281  1.00  0.74
ATOM   1002  CA  GLY A 135     -22.037 -40.156 -16.887  1.00  0.74
ATOM   1003  C   GLY A 135     -21.233 -38.920 -17.311  1.00  0.74
ATOM   1004  O   GLY A 135     -20.071 -39.028 -17.711  1.00  0.74
ATOM   1005  H   GLY A 135     -20.225 -41.082 -16.373  1.00 99.99
ATOM   1006  N   LYS A 136     -21.887 -37.762 -17.245  1.00  0.81
ATOM   1007  CA  LYS A 136     -21.270 -36.465 -17.597  1.00  0.81
ATOM   1008  C   LYS A 136     -21.982 -35.281 -16.925  1.00  0.81
ATOM   1009  O   LYS A 136     -23.167 -35.367 -16.593  1.00  0.81
ATOM   1010  CB  LYS A 136     -21.215 -36.277 -19.131  1.00  0.81
ATOM   1011  CG  LYS A 136     -22.533 -35.916 -19.837  1.00  0.81
ATOM   1012  CD  LYS A 136     -22.655 -34.398 -20.042  1.00  0.81
ATOM   1013  CE  LYS A 136     -24.016 -33.958 -20.592  1.00  0.81
ATOM   1014  NZ  LYS A 136     -24.286 -34.501 -21.933  1.00  0.81
ATOM   1015  H   LYS A 136     -22.825 -37.709 -16.881  1.00 99.99
ATOM   1016  HZ1 LYS A 136     -25.168 -34.173 -22.269  1.00 99.99
ATOM   1017  HZ2 LYS A 136     -23.560 -34.212 -22.566  1.00 99.99
ATOM   1018  HZ3 LYS A 136     -24.294 -35.499 -21.892  1.00 99.99
ATOM   1019  N   TRP A 137     -21.242 -34.190 -16.769  1.00  0.88
ATOM   1020  CA  TRP A 137     -21.829 -32.877 -16.442  1.00  0.88
ATOM   1021  C   TRP A 137     -21.178 -31.772 -17.284  1.00  0.88
ATOM   1022  O   TRP A 137     -20.032 -31.893 -17.720  1.00  0.88
ATOM   1023  CB  TRP A 137     -21.771 -32.575 -14.936  1.00  0.88
ATOM   1024  CG  TRP A 137     -20.367 -32.398 -14.338  1.00  0.88
ATOM   1025  CD1 TRP A 137     -19.637 -33.351 -13.761  1.00  0.88
ATOM   1026  CD2 TRP A 137     -19.717 -31.201 -14.137  1.00  0.88
ATOM   1027  NE1 TRP A 137     -18.556 -32.798 -13.200  1.00  0.88
ATOM   1028  CE2 TRP A 137     -18.569 -31.488 -13.408  1.00  0.88
ATOM   1029  CE3 TRP A 137     -20.006 -29.891 -14.510  1.00  0.88
ATOM   1030  CZ2 TRP A 137     -17.702 -30.453 -13.059  1.00  0.88
ATOM   1031  CZ3 TRP A 137     -19.125 -28.876 -14.200  1.00  0.88
ATOM   1032  CH2 TRP A 137     -17.962 -29.158 -13.472  1.00  0.88
ATOM   1033  H   TRP A 137     -20.252 -34.182 -16.947  1.00 99.99
ATOM   1034  HD1 TRP A 137     -19.894 -34.405 -13.730  1.00 99.99
ATOM   1035  HE1 TRP A 137     -17.849 -33.308 -12.704  1.00 99.99
ATOM   1036  HE3 TRP A 137     -21.002 -29.647 -14.882  1.00 99.99
ATOM   1037  HZ2 TRP A 137     -16.901 -30.632 -12.339  1.00 99.99
ATOM   1038  HZ3 TRP A 137     -19.344 -27.857 -14.516  1.00 99.99
ATOM   1039  HH2 TRP A 137     -17.253 -28.365 -13.243  1.00 99.99
ATOM   1040  N   GLU A 138     -21.986 -30.781 -17.630  1.00  0.87
ATOM   1041  CA  GLU A 138     -21.526 -29.580 -18.344  1.00  0.87
ATOM   1042  C   GLU A 138     -21.905 -28.367 -17.491  1.00  0.87
ATOM   1043  O   GLU A 138     -23.016 -28.299 -16.950  1.00  0.87
ATOM   1044  CB  GLU A 138     -22.186 -29.545 -19.726  1.00  0.87
ATOM   1045  CG  GLU A 138     -21.678 -28.411 -20.627  1.00  0.87
ATOM   1046  CD  GLU A 138     -22.078 -28.571 -22.102  1.00  0.87
ATOM   1047  OE1 GLU A 138     -21.442 -27.876 -22.922  1.00  0.87
ATOM   1048  OE2 GLU A 138     -22.962 -29.406 -22.400  1.00  0.87
ATOM   1049  H   GLU A 138     -22.961 -30.780 -17.380  1.00 99.99
ATOM   1050  N   GLY A 139     -20.944 -27.451 -17.365  1.00  0.91
ATOM   1051  CA  GLY A 139     -21.129 -26.259 -16.523  1.00  0.91
ATOM   1052  C   GLY A 139     -20.504 -24.981 -17.080  1.00  0.91
ATOM   1053  O   GLY A 139     -19.579 -25.019 -17.892  1.00  0.91
ATOM   1054  H   GLY A 139     -20.020 -27.542 -17.776  1.00 99.99
ATOM   1055  N   GLU A 140     -21.000 -23.876 -16.540  1.00  0.88
ATOM   1056  CA  GLU A 140     -20.502 -22.518 -16.820  1.00  0.88
ATOM   1057  C   GLU A 140     -19.756 -22.029 -15.569  1.00  0.88
ATOM   1058  O   GLU A 140     -20.280 -22.129 -14.457  1.00  0.88
ATOM   1059  CB  GLU A 140     -21.704 -21.612 -17.117  1.00  0.88
ATOM   1060  CG  GLU A 140     -22.443 -22.020 -18.403  1.00  0.88
ATOM   1061  CD  GLU A 140     -23.813 -21.356 -18.612  1.00  0.88
ATOM   1062  OE1 GLU A 140     -24.493 -21.736 -19.585  1.00  0.88
ATOM   1063  OE2 GLU A 140     -24.171 -20.467 -17.819  1.00  0.88
ATOM   1064  H   GLU A 140     -21.761 -23.919 -15.882  1.00 99.99
ATOM   1065  N   LEU A 141     -18.498 -21.641 -15.747  1.00  0.89
ATOM   1066  CA  LEU A 141     -17.634 -21.228 -14.622  1.00  0.89
ATOM   1067  C   LEU A 141     -17.896 -19.773 -14.205  1.00  0.89
ATOM   1068  O   LEU A 141     -18.023 -18.878 -15.047  1.00  0.89
ATOM   1069  CB  LEU A 141     -16.150 -21.391 -14.983  1.00  0.89
ATOM   1070  CG  LEU A 141     -15.720 -22.801 -15.419  1.00  0.89
ATOM   1071  CD1 LEU A 141     -14.250 -22.771 -15.837  1.00  0.89
ATOM   1072  CD2 LEU A 141     -15.912 -23.839 -14.310  1.00  0.89
ATOM   1073  H   LEU A 141     -18.073 -21.554 -16.656  1.00 99.99
ATOM   1074  N   GLY A 142     -17.979 -19.576 -12.887  1.00  0.92
ATOM   1075  CA  GLY A 142     -18.087 -18.235 -12.283  1.00  0.92
ATOM   1076  C   GLY A 142     -17.503 -18.251 -10.867  1.00  0.92
ATOM   1077  O   GLY A 142     -17.007 -19.284 -10.408  1.00  0.92
ATOM   1078  H   GLY A 142     -18.010 -20.323 -12.201  1.00 99.99
ATOM   1079  N   THR A 143     -17.531 -17.099 -10.211  1.00  0.91
ATOM   1080  CA  THR A 143     -17.153 -17.003  -8.784  1.00  0.91
ATOM   1081  C   THR A 143     -18.258 -16.281  -8.009  1.00  0.91
ATOM   1082  O   THR A 143     -18.984 -15.447  -8.558  1.00  0.91
ATOM   1083  CB  THR A 143     -15.799 -16.314  -8.504  1.00  0.91
ATOM   1084  OG1 THR A 143     -15.876 -14.894  -8.638  1.00  0.91
ATOM   1085  CG2 THR A 143     -14.667 -16.848  -9.387  1.00  0.91
ATOM   1086  H   THR A 143     -17.851 -16.243 -10.632  1.00 99.99
ATOM   1087  HG1 THR A 143     -14.986 -14.498  -8.395  1.00 99.99
ATOM   1088  N   ASP A 144     -18.431 -16.695  -6.761  1.00  0.93
ATOM   1089  CA  ASP A 144     -19.366 -16.028  -5.838  1.00  0.93
ATOM   1090  C   ASP A 144     -18.947 -16.295  -4.386  1.00  0.93
ATOM   1091  O   ASP A 144     -18.035 -17.084  -4.126  1.00  0.93
ATOM   1092  CB  ASP A 144     -20.797 -16.524  -6.097  1.00  0.93
ATOM   1093  CG  ASP A 144     -21.860 -15.459  -5.816  1.00  0.93
ATOM   1094  OD1 ASP A 144     -21.597 -14.529  -5.028  1.00  0.93
ATOM   1095  OD2 ASP A 144     -22.994 -15.634  -6.314  1.00  0.93
ATOM   1096  H   ASP A 144     -17.875 -17.429  -6.358  1.00 99.99
ATOM   1097  N   LEU A 145     -19.573 -15.553  -3.478  1.00  0.93
ATOM   1098  CA  LEU A 145     -19.436 -15.745  -2.026  1.00  0.93
ATOM   1099  C   LEU A 145     -20.105 -17.051  -1.583  1.00  0.93
ATOM   1100  O   LEU A 145     -21.192 -17.401  -2.051  1.00  0.93
ATOM   1101  CB  LEU A 145     -20.066 -14.564  -1.279  1.00  0.93
ATOM   1102  CG  LEU A 145     -19.449 -13.192  -1.591  1.00  0.93
ATOM   1103  CD1 LEU A 145     -20.109 -12.144  -0.695  1.00  0.93
ATOM   1104  CD2 LEU A 145     -17.928 -13.158  -1.396  1.00  0.93
ATOM   1105  H   LEU A 145     -20.207 -14.822  -3.744  1.00 99.99
ATOM   1106  N   VAL A 146     -19.373 -17.788  -0.761  1.00  0.95
ATOM   1107  CA  VAL A 146     -19.774 -19.119  -0.270  1.00  0.95
ATOM   1108  C   VAL A 146     -19.510 -19.171   1.243  1.00  0.95
ATOM   1109  O   VAL A 146     -18.469 -18.710   1.718  1.00  0.95
ATOM   1110  CB  VAL A 146     -18.982 -20.229  -0.998  1.00  0.95
ATOM   1111  CG1 VAL A 146     -19.482 -21.619  -0.599  1.00  0.95
ATOM   1112  CG2 VAL A 146     -19.056 -20.121  -2.526  1.00  0.95
ATOM   1113  H   VAL A 146     -18.466 -17.479  -0.453  1.00 99.99
ATOM   1114  N   SER A 147     -20.486 -19.716   1.957  1.00  0.95
ATOM   1115  CA  SER A 147     -20.390 -19.990   3.406  1.00  0.95
ATOM   1116  C   SER A 147     -20.940 -21.391   3.717  1.00  0.95
ATOM   1117  O   SER A 147     -21.671 -21.969   2.907  1.00  0.95
ATOM   1118  CB  SER A 147     -21.145 -18.914   4.200  1.00  0.95
ATOM   1119  OG  SER A 147     -21.006 -19.137   5.607  1.00  0.95
ATOM   1120  H   SER A 147     -21.328 -20.037   1.511  1.00 99.99
ATOM   1121  HG  SER A 147     -21.471 -18.403   6.109  1.00 99.99
ATOM   1122  N   ILE A 148     -20.527 -21.932   4.859  1.00  0.91
ATOM   1123  CA  ILE A 148     -20.997 -23.234   5.376  1.00  0.91
ATOM   1124  C   ILE A 148     -21.652 -22.938   6.741  1.00  0.91
ATOM   1125  O   ILE A 148     -20.921 -22.613   7.680  1.00  0.91
ATOM   1126  CB  ILE A 148     -19.821 -24.227   5.512  1.00  0.91
ATOM   1127  CG1 ILE A 148     -19.100 -24.416   4.163  1.00  0.91
ATOM   1128  CG2 ILE A 148     -20.325 -25.572   6.065  1.00  0.91
ATOM   1129  CD  ILE A 148     -17.775 -25.188   4.227  1.00  0.91
ATOM   1130  H   ILE A 148     -19.972 -21.401   5.504  1.00 99.99
ATOM   1131  N   PRO A 149     -22.989 -22.991   6.854  1.00  0.91
ATOM   1132  CA  PRO A 149     -23.704 -22.617   8.095  1.00  0.91
ATOM   1133  C   PRO A 149     -23.258 -23.379   9.353  1.00  0.91
ATOM   1134  O   PRO A 149     -22.993 -22.758  10.381  1.00  0.91
ATOM   1135  CB  PRO A 149     -25.181 -22.863   7.792  1.00  0.91
ATOM   1136  CG  PRO A 149     -25.257 -22.604   6.290  1.00  0.91
ATOM   1137  CD  PRO A 149     -23.955 -23.210   5.758  1.00  0.91
ATOM   1138  N   HIS A 150     -23.060 -24.689   9.231  1.00  0.85
ATOM   1139  CA  HIS A 150     -22.541 -25.529  10.331  1.00  0.85
ATOM   1140  C   HIS A 150     -21.045 -25.811  10.102  1.00  0.85
ATOM   1141  O   HIS A 150     -20.596 -26.953   9.993  1.00  0.85
ATOM   1142  CB  HIS A 150     -23.352 -26.829  10.412  1.00  0.85
ATOM   1143  CG  HIS A 150     -24.839 -26.565  10.645  1.00  0.85
ATOM   1144  ND1 HIS A 150     -25.359 -26.070  11.759  1.00  0.85
ATOM   1145  CD2 HIS A 150     -25.806 -26.679   9.740  1.00  0.85
ATOM   1146  CE1 HIS A 150     -26.649 -25.840  11.535  1.00  0.85
ATOM   1147  NE2 HIS A 150     -26.925 -26.218  10.289  1.00  0.85
ATOM   1148  H   HIS A 150     -23.308 -25.197   8.407  1.00 99.99
ATOM   1149  HD1 HIS A 150     -24.888 -26.010  12.641  1.00 99.99
ATOM   1150  N   GLY A 151     -20.329 -24.708   9.861  1.00  0.90
ATOM   1151  CA  GLY A 151     -18.892 -24.730   9.540  1.00  0.90
ATOM   1152  C   GLY A 151     -18.177 -23.582  10.267  1.00  0.90
ATOM   1153  O   GLY A 151     -18.643 -23.164  11.331  1.00  0.90
ATOM   1154  H   GLY A 151     -20.694 -23.774   9.986  1.00 99.99
ATOM   1155  N   PRO A 152     -17.051 -23.083   9.741  1.00  0.84
ATOM   1156  CA  PRO A 152     -16.377 -21.912  10.331  1.00  0.84
ATOM   1157  C   PRO A 152     -17.187 -20.663   9.969  1.00  0.84
ATOM   1158  O   PRO A 152     -17.663 -20.545   8.838  1.00  0.84
ATOM   1159  CB  PRO A 152     -15.007 -21.841   9.654  1.00  0.84
ATOM   1160  CG  PRO A 152     -14.819 -23.216   9.018  1.00  0.84
ATOM   1161  CD  PRO A 152     -16.237 -23.651   8.650  1.00  0.84
ATOM   1162  N   ASN A 153     -17.329 -19.748  10.923  1.00  0.81
ATOM   1163  CA  ASN A 153     -17.985 -18.448  10.679  1.00  0.81
ATOM   1164  C   ASN A 153     -17.090 -17.515   9.833  1.00  0.81
ATOM   1165  O   ASN A 153     -16.352 -16.683  10.355  1.00  0.81
ATOM   1166  CB  ASN A 153     -18.383 -17.835  12.031  1.00  0.81
ATOM   1167  CG  ASN A 153     -19.224 -16.562  11.888  1.00  0.81
ATOM   1168  OD1 ASN A 153     -19.842 -16.288  10.868  1.00  0.81
ATOM   1169  ND2 ASN A 153     -19.251 -15.749  12.922  1.00  0.81
ATOM   1170  H   ASN A 153     -17.060 -19.910  11.872  1.00 99.99
ATOM   1171 1HD2 ASN A 153     -19.799 -14.923  12.823  1.00 99.99
ATOM   1172 2HD2 ASN A 153     -18.747 -15.953  13.754  1.00 99.99
ATOM   1173  N   VAL A 154     -17.100 -17.776   8.529  1.00  0.86
ATOM   1174  CA  VAL A 154     -16.348 -17.062   7.471  1.00  0.86
ATOM   1175  C   VAL A 154     -17.185 -17.084   6.179  1.00  0.86
ATOM   1176  O   VAL A 154     -18.088 -17.909   6.029  1.00  0.86
ATOM   1177  CB  VAL A 154     -14.956 -17.677   7.180  1.00  0.86
ATOM   1178  CG1 VAL A 154     -13.990 -17.544   8.360  1.00  0.86
ATOM   1179  CG2 VAL A 154     -15.008 -19.141   6.722  1.00  0.86
ATOM   1180  H   VAL A 154     -17.677 -18.512   8.167  1.00 99.99
ATOM   1181  N   THR A 155     -16.898 -16.157   5.276  1.00  0.92
ATOM   1182  CA  THR A 155     -17.474 -16.141   3.914  1.00  0.92
ATOM   1183  C   THR A 155     -16.295 -15.934   2.962  1.00  0.92
ATOM   1184  O   THR A 155     -15.494 -15.025   3.178  1.00  0.92
ATOM   1185  CB  THR A 155     -18.486 -14.992   3.757  1.00  0.92
ATOM   1186  OG1 THR A 155     -19.550 -15.169   4.696  1.00  0.92
ATOM   1187  CG2 THR A 155     -19.073 -14.901   2.344  1.00  0.92
ATOM   1188  H   THR A 155     -16.186 -15.469   5.424  1.00 99.99
ATOM   1189  HG1 THR A 155     -19.420 -16.038   5.178  1.00 99.99
ATOM   1190  N   VAL A 156     -16.198 -16.780   1.946  1.00  0.94
ATOM   1191  CA  VAL A 156     -15.092 -16.706   0.968  1.00  0.94
ATOM   1192  C   VAL A 156     -15.617 -16.586  -0.464  1.00  0.94
ATOM   1193  O   VAL A 156     -16.729 -17.038  -0.748  1.00  0.94
ATOM   1194  CB  VAL A 156     -14.133 -17.909   1.080  1.00  0.94
ATOM   1195  CG1 VAL A 156     -13.375 -17.864   2.404  1.00  0.94
ATOM   1196  CG2 VAL A 156     -14.826 -19.270   0.925  1.00  0.94
ATOM   1197  H   VAL A 156     -16.882 -17.494   1.764  1.00 99.99
ATOM   1198  N   ARG A 157     -14.826 -15.982  -1.338  1.00  0.89
ATOM   1199  CA  ARG A 157     -15.112 -16.022  -2.782  1.00  0.89
ATOM   1200  C   ARG A 157     -14.441 -17.255  -3.403  1.00  0.89
ATOM   1201  O   ARG A 157     -13.215 -17.384  -3.406  1.00  0.89
ATOM   1202  CB  ARG A 157     -14.666 -14.727  -3.465  1.00  0.89
ATOM   1203  CG  ARG A 157     -14.996 -14.758  -4.962  1.00  0.89
ATOM   1204  CD  ARG A 157     -14.839 -13.385  -5.612  1.00  0.89
ATOM   1205  NE  ARG A 157     -15.946 -12.523  -5.170  1.00  0.89
ATOM   1206  CZ  ARG A 157     -17.159 -12.449  -5.717  1.00  0.89
ATOM   1207  NH1 ARG A 157     -17.507 -13.159  -6.783  1.00  0.89
ATOM   1208  NH2 ARG A 157     -18.067 -11.659  -5.173  1.00  0.89
ATOM   1209  H   ARG A 157     -13.974 -15.514  -1.066  1.00 99.99
ATOM   1210  HE  ARG A 157     -15.764 -11.964  -4.365  1.00 99.99
ATOM   1211 1HH1 ARG A 157     -18.430 -13.062  -7.160  1.00 99.99
ATOM   1212 2HH1 ARG A 157     -16.839 -13.741  -7.248  1.00 99.99
ATOM   1213 1HH2 ARG A 157     -18.970 -11.624  -5.609  1.00 99.99
ATOM   1214 2HH2 ARG A 157     -17.859 -11.090  -4.382  1.00 99.99
ATOM   1215  N   ALA A 158     -15.272 -18.144  -3.927  1.00  0.98
ATOM   1216  CA  ALA A 158     -14.804 -19.407  -4.521  1.00  0.98
ATOM   1217  C   ALA A 158     -15.302 -19.574  -5.959  1.00  0.98
ATOM   1218  O   ALA A 158     -16.308 -18.974  -6.354  1.00  0.98
ATOM   1219  CB  ALA A 158     -15.304 -20.567  -3.659  1.00  0.98
ATOM   1220  H   ALA A 158     -16.258 -17.963  -4.016  1.00 99.99
ATOM   1221  N   ASN A 159     -14.553 -20.356  -6.729  1.00  0.93
ATOM   1222  CA  ASN A 159     -14.998 -20.818  -8.057  1.00  0.93
ATOM   1223  C   ASN A 159     -16.209 -21.749  -7.919  1.00  0.93
ATOM   1224  O   ASN A 159     -16.219 -22.657  -7.085  1.00  0.93
ATOM   1225  CB  ASN A 159     -13.869 -21.576  -8.760  1.00  0.93
ATOM   1226  CG  ASN A 159     -12.706 -20.647  -9.104  1.00  0.93
ATOM   1227  OD1 ASN A 159     -12.846 -19.631  -9.768  1.00  0.93
ATOM   1228  ND2 ASN A 159     -11.525 -20.994  -8.651  1.00  0.93
ATOM   1229  H   ASN A 159     -13.647 -20.672  -6.446  1.00 99.99
ATOM   1230 1HD2 ASN A 159     -10.774 -20.379  -8.870  1.00 99.99
ATOM   1231 2HD2 ASN A 159     -11.403 -21.840  -8.123  1.00 99.99
ATOM   1232  N   ILE A 160     -17.229 -21.467  -8.715  1.00  0.93
ATOM   1233  CA  ILE A 160     -18.438 -22.305  -8.788  1.00  0.93
ATOM   1234  C   ILE A 160     -18.664 -22.653 -10.265  1.00  0.93
ATOM   1235  O   ILE A 160     -18.716 -21.769 -11.124  1.00  0.93
ATOM   1236  CB  ILE A 160     -19.684 -21.595  -8.209  1.00  0.93
ATOM   1237  CG1 ILE A 160     -19.437 -21.066  -6.782  1.00  0.93
ATOM   1238  CG2 ILE A 160     -20.874 -22.569  -8.232  1.00  0.93
ATOM   1239  CD  ILE A 160     -20.589 -20.257  -6.168  1.00  0.93
ATOM   1240  H   ILE A 160     -17.206 -20.688  -9.356  1.00 99.99
ATOM   1241  N   ALA A 161     -18.796 -23.946 -10.527  1.00  0.95
ATOM   1242  CA  ALA A 161     -19.269 -24.426 -11.835  1.00  0.95
ATOM   1243  C   ALA A 161     -20.790 -24.613 -11.767  1.00  0.95
ATOM   1244  O   ALA A 161     -21.302 -25.401 -10.965  1.00  0.95
ATOM   1245  CB  ALA A 161     -18.577 -25.737 -12.211  1.00  0.95
ATOM   1246  H   ALA A 161     -18.610 -24.657  -9.836  1.00 99.99
ATOM   1247  N   ALA A 162     -21.493 -23.749 -12.486  1.00  0.95
ATOM   1248  CA  ALA A 162     -22.962 -23.792 -12.583  1.00  0.95
ATOM   1249  C   ALA A 162     -23.385 -24.859 -13.604  1.00  0.95
ATOM   1250  O   ALA A 162     -23.161 -24.693 -14.808  1.00  0.95
ATOM   1251  CB  ALA A 162     -23.452 -22.401 -12.988  1.00  0.95
ATOM   1252  H   ALA A 162     -21.057 -23.048 -13.066  1.00 99.99
ATOM   1253  N   ILE A 163     -23.823 -26.012 -13.105  1.00  0.92
ATOM   1254  CA  ILE A 163     -24.212 -27.161 -13.952  1.00  0.92
ATOM   1255  C   ILE A 163     -25.505 -26.812 -14.702  1.00  0.92
ATOM   1256  O   ILE A 163     -26.575 -26.652 -14.113  1.00  0.92
ATOM   1257  CB  ILE A 163     -24.350 -28.469 -13.145  1.00  0.92
ATOM   1258  CG1 ILE A 163     -23.027 -28.792 -12.434  1.00  0.92
ATOM   1259  CG2 ILE A 163     -24.766 -29.642 -14.056  1.00  0.92
ATOM   1260  CD  ILE A 163     -23.170 -29.843 -11.329  1.00  0.92
ATOM   1261  H   ILE A 163     -24.032 -26.120 -12.123  1.00 99.99
ATOM   1262  N   THR A 164     -25.358 -26.859 -16.017  1.00  0.90
ATOM   1263  CA  THR A 164     -26.430 -26.506 -16.968  1.00  0.90
ATOM   1264  C   THR A 164     -27.042 -27.720 -17.681  1.00  0.90
ATOM   1265  O   THR A 164     -28.220 -27.698 -18.032  1.00  0.90
ATOM   1266  CB  THR A 164     -25.944 -25.456 -17.979  1.00  0.90
ATOM   1267  OG1 THR A 164     -24.717 -25.871 -18.596  1.00  0.90
ATOM   1268  CG2 THR A 164     -25.792 -24.089 -17.304  1.00  0.90
ATOM   1269  H   THR A 164     -24.471 -27.100 -16.414  1.00 99.99
ATOM   1270  HG1 THR A 164     -24.381 -26.707 -18.174  1.00 99.99
ATOM   1271  N   GLU A 165     -26.256 -28.784 -17.844  1.00  0.86
ATOM   1272  CA  GLU A 165     -26.725 -30.052 -18.433  1.00  0.86
ATOM   1273  C   GLU A 165     -25.942 -31.209 -17.796  1.00  0.86
ATOM   1274  O   GLU A 165     -24.781 -31.024 -17.421  1.00  0.86
ATOM   1275  CB  GLU A 165     -26.494 -30.007 -19.950  1.00  0.86
ATOM   1276  CG  GLU A 165     -27.352 -31.013 -20.727  1.00  0.86
ATOM   1277  CD  GLU A 165     -28.852 -30.744 -20.562  1.00  0.86
ATOM   1278  OE1 GLU A 165     -29.454 -31.457 -19.728  1.00  0.86
ATOM   1279  OE2 GLU A 165     -29.360 -29.864 -21.289  1.00  0.86
ATOM   1280  H   GLU A 165     -25.313 -28.821 -17.509  1.00 99.99
ATOM   1281  N   SER A 166     -26.577 -32.372 -17.676  1.00  0.88
ATOM   1282  CA  SER A 166     -25.928 -33.558 -17.075  1.00  0.88
ATOM   1283  C   SER A 166     -26.615 -34.868 -17.468  1.00  0.88
ATOM   1284  O   SER A 166     -27.744 -34.869 -17.963  1.00  0.88
ATOM   1285  CB  SER A 166     -25.832 -33.468 -15.539  1.00  0.88
ATOM   1286  OG  SER A 166     -27.090 -33.598 -14.865  1.00  0.88
ATOM   1287  H   SER A 166     -27.486 -32.543 -18.066  1.00 99.99
ATOM   1288  HG  SER A 166     -26.929 -33.494 -13.881  1.00 99.99
ATOM   1289  N   ASP A 167     -25.836 -35.941 -17.420  1.00  0.85
ATOM   1290  CA  ASP A 167     -26.358 -37.312 -17.536  1.00  0.85
ATOM   1291  C   ASP A 167     -25.760 -38.143 -16.400  1.00  0.85
ATOM   1292  O   ASP A 167     -24.556 -38.062 -16.155  1.00  0.85
ATOM   1293  CB  ASP A 167     -26.010 -37.938 -18.895  1.00  0.85
ATOM   1294  CG  ASP A 167     -26.585 -39.355 -19.044  1.00  0.85
ATOM   1295  OD1 ASP A 167     -27.726 -39.565 -18.569  1.00  0.85
ATOM   1296  OD2 ASP A 167     -25.819 -40.225 -19.505  1.00  0.85
ATOM   1297  H   ASP A 167     -24.863 -35.873 -17.162  1.00 99.99
ATOM   1298  N   LYS A 168     -26.645 -38.839 -15.691  1.00  0.82
ATOM   1299  CA  LYS A 168     -26.312 -39.767 -14.583  1.00  0.82
ATOM   1300  C   LYS A 168     -25.378 -39.153 -13.514  1.00  0.82
ATOM   1301  O   LYS A 168     -24.450 -39.780 -12.996  1.00  0.82
ATOM   1302  CB  LYS A 168     -25.765 -41.094 -15.134  1.00  0.82
ATOM   1303  CG  LYS A 168     -26.698 -41.766 -16.145  1.00  0.82
ATOM   1304  CD  LYS A 168     -26.138 -43.110 -16.622  1.00  0.82
ATOM   1305  CE  LYS A 168     -26.876 -43.639 -17.856  1.00  0.82
ATOM   1306  NZ  LYS A 168     -28.321 -43.787 -17.622  1.00  0.82
ATOM   1307  H   LYS A 168     -27.615 -38.837 -15.938  1.00 99.99
ATOM   1308  HZ1 LYS A 168     -28.762 -44.136 -18.449  1.00 99.99
ATOM   1309  HZ2 LYS A 168     -28.472 -44.420 -16.863  1.00 99.99
ATOM   1310  HZ3 LYS A 168     -28.700 -42.891 -17.394  1.00 99.99
ATOM   1311  N   PHE A 169     -25.676 -37.899 -13.190  1.00  0.85
ATOM   1312  CA  PHE A 169     -24.940 -37.106 -12.191  1.00  0.85
ATOM   1313  C   PHE A 169     -25.812 -36.959 -10.932  1.00  0.85
ATOM   1314  O   PHE A 169     -25.488 -37.508  -9.880  1.00  0.85
ATOM   1315  CB  PHE A 169     -24.566 -35.766 -12.837  1.00  0.85
ATOM   1316  CG  PHE A 169     -23.723 -34.876 -11.920  1.00  0.85
ATOM   1317  CD1 PHE A 169     -22.344 -35.009 -11.905  1.00  0.85
ATOM   1318  CD2 PHE A 169     -24.349 -33.927 -11.130  1.00  0.85
ATOM   1319  CE1 PHE A 169     -21.580 -34.172 -11.091  1.00  0.85
ATOM   1320  CE2 PHE A 169     -23.587 -33.101 -10.305  1.00  0.85
ATOM   1321  CZ  PHE A 169     -22.205 -33.219 -10.300  1.00  0.85
ATOM   1322  H   PHE A 169     -26.418 -37.413 -13.642  1.00 99.99
ATOM   1323  HD1 PHE A 169     -21.869 -35.784 -12.505  1.00 99.99
ATOM   1324  HD2 PHE A 169     -25.429 -33.816 -11.170  1.00 99.99
ATOM   1325  HE1 PHE A 169     -20.498 -34.293 -11.054  1.00 99.99
ATOM   1326  HE2 PHE A 169     -24.079 -32.411  -9.623  1.00 99.99
ATOM   1327  HZ  PHE A 169     -21.607 -32.567  -9.658  1.00 99.99
ATOM   1328  N   PHE A 170     -26.942 -36.272 -11.070  1.00  0.88
ATOM   1329  CA  PHE A 170     -27.960 -36.191 -10.003  1.00  0.88
ATOM   1330  C   PHE A 170     -28.687 -37.535  -9.852  1.00  0.88
ATOM   1331  O   PHE A 170     -29.021 -38.184 -10.845  1.00  0.88
ATOM   1332  CB  PHE A 170     -28.960 -35.074 -10.316  1.00  0.88
ATOM   1333  CG  PHE A 170     -28.259 -33.717 -10.447  1.00  0.88
ATOM   1334  CD1 PHE A 170     -27.517 -33.213  -9.386  1.00  0.88
ATOM   1335  CD2 PHE A 170     -28.333 -33.024 -11.645  1.00  0.88
ATOM   1336  CE1 PHE A 170     -26.848 -32.001  -9.525  1.00  0.88
ATOM   1337  CE2 PHE A 170     -27.662 -31.809 -11.785  1.00  0.88
ATOM   1338  CZ  PHE A 170     -26.919 -31.305 -10.723  1.00  0.88
ATOM   1339  H   PHE A 170     -27.152 -35.740 -11.886  1.00 99.99
ATOM   1340  HD1 PHE A 170     -27.452 -33.771  -8.453  1.00 99.99
ATOM   1341  HD2 PHE A 170     -28.941 -33.419 -12.459  1.00 99.99
ATOM   1342  HE1 PHE A 170     -26.286 -31.600  -8.681  1.00 99.99
ATOM   1343  HE2 PHE A 170     -27.773 -31.230 -12.702  1.00 99.99
ATOM   1344  HZ  PHE A 170     -26.382 -30.360 -10.827  1.00 99.99
ATOM   1345  N   ILE A 171     -28.972 -37.887  -8.603  1.00  0.88
ATOM   1346  CA  ILE A 171     -29.642 -39.158  -8.263  1.00  0.88
ATOM   1347  C   ILE A 171     -31.136 -38.868  -8.048  1.00  0.88
ATOM   1348  O   ILE A 171     -31.494 -38.007  -7.242  1.00  0.88
ATOM   1349  CB  ILE A 171     -29.001 -39.769  -6.995  1.00  0.88
ATOM   1350  CG1 ILE A 171     -27.517 -40.099  -7.237  1.00  0.88
ATOM   1351  CG2 ILE A 171     -29.766 -41.016  -6.512  1.00  0.88
ATOM   1352  CD  ILE A 171     -26.718 -40.368  -5.953  1.00  0.88
ATOM   1353  H   ILE A 171     -28.794 -37.283  -7.828  1.00 99.99
ATOM   1354  N   ASN A 172     -31.972 -39.679  -8.687  1.00  0.79
ATOM   1355  CA  ASN A 172     -33.431 -39.649  -8.467  1.00  0.79
ATOM   1356  C   ASN A 172     -33.770 -40.060  -7.023  1.00  0.79
ATOM   1357  O   ASN A 172     -33.413 -41.157  -6.588  1.00  0.79
ATOM   1358  CB  ASN A 172     -34.116 -40.578  -9.476  1.00  0.79
ATOM   1359  CG  ASN A 172     -35.632 -40.366  -9.521  1.00  0.79
ATOM   1360  OD1 ASN A 172     -36.173 -39.355  -9.093  1.00  0.79
ATOM   1361  ND2 ASN A 172     -36.349 -41.337 -10.041  1.00  0.79
ATOM   1362  H   ASN A 172     -31.662 -40.329  -9.379  1.00 99.99
ATOM   1363 1HD2 ASN A 172     -37.335 -41.196 -10.068  1.00 99.99
ATOM   1364 2HD2 ASN A 172     -35.923 -42.168 -10.380  1.00 99.99
ATOM   1365  N   GLY A 173     -34.282 -39.084  -6.265  1.00  0.78
ATOM   1366  CA  GLY A 173     -34.643 -39.301  -4.850  1.00  0.78
ATOM   1367  C   GLY A 173     -33.592 -38.851  -3.819  1.00  0.78
ATOM   1368  O   GLY A 173     -33.814 -39.066  -2.626  1.00  0.78
ATOM   1369  H   GLY A 173     -34.548 -38.177  -6.617  1.00 99.99
ATOM   1370  N   SER A 174     -32.440 -38.335  -4.250  1.00  0.83
ATOM   1371  CA  SER A 174     -31.459 -37.769  -3.293  1.00  0.83
ATOM   1372  C   SER A 174     -31.905 -36.394  -2.756  1.00  0.83
ATOM   1373  O   SER A 174     -33.008 -35.927  -3.042  1.00  0.83
ATOM   1374  CB  SER A 174     -30.019 -37.748  -3.837  1.00  0.83
ATOM   1375  OG  SER A 174     -29.746 -36.646  -4.709  1.00  0.83
ATOM   1376  H   SER A 174     -32.185 -38.292  -5.220  1.00 99.99
ATOM   1377  HG  SER A 174     -28.780 -36.667  -4.981  1.00 99.99
ATOM   1378  N   ASN A 175     -31.113 -35.843  -1.840  1.00  0.88
ATOM   1379  CA  ASN A 175     -31.368 -34.511  -1.259  1.00  0.88
ATOM   1380  C   ASN A 175     -30.105 -33.629  -1.343  1.00  0.88
ATOM   1381  O   ASN A 175     -29.794 -32.890  -0.408  1.00  0.88
ATOM   1382  CB  ASN A 175     -31.879 -34.704   0.180  1.00  0.88
ATOM   1383  CG  ASN A 175     -32.490 -33.440   0.796  1.00  0.88
ATOM   1384  OD1 ASN A 175     -33.260 -32.716   0.183  1.00  0.88
ATOM   1385  ND2 ASN A 175     -32.198 -33.184   2.053  1.00  0.88
ATOM   1386  H   ASN A 175     -30.251 -36.263  -1.571  1.00 99.99
ATOM   1387 1HD2 ASN A 175     -32.611 -32.378   2.467  1.00 99.99
ATOM   1388 2HD2 ASN A 175     -31.569 -33.771   2.573  1.00 99.99
ATOM   1389  N   TRP A 176     -29.305 -33.836  -2.388  1.00  0.93
ATOM   1390  CA  TRP A 176     -28.136 -32.983  -2.685  1.00  0.93
ATOM   1391  C   TRP A 176     -28.202 -32.445  -4.118  1.00  0.93
ATOM   1392  O   TRP A 176     -28.645 -33.126  -5.043  1.00  0.93
ATOM   1393  CB  TRP A 176     -26.790 -33.660  -2.377  1.00  0.93
ATOM   1394  CG  TRP A 176     -26.510 -34.981  -3.109  1.00  0.93
ATOM   1395  CD1 TRP A 176     -26.632 -36.196  -2.577  1.00  0.93
ATOM   1396  CD2 TRP A 176     -25.941 -35.130  -4.356  1.00  0.93
ATOM   1397  NE1 TRP A 176     -26.180 -37.103  -3.447  1.00  0.93
ATOM   1398  CE2 TRP A 176     -25.750 -36.495  -4.544  1.00  0.93
ATOM   1399  CE3 TRP A 176     -25.569 -34.228  -5.349  1.00  0.93
ATOM   1400  CZ2 TRP A 176     -25.190 -36.948  -5.737  1.00  0.93
ATOM   1401  CZ3 TRP A 176     -25.057 -34.683  -6.548  1.00  0.93
ATOM   1402  CH2 TRP A 176     -24.867 -36.056  -6.744  1.00  0.93
ATOM   1403  H   TRP A 176     -29.510 -34.510  -3.103  1.00 99.99
ATOM   1404  HD1 TRP A 176     -26.973 -36.409  -1.568  1.00 99.99
ATOM   1405  HE1 TRP A 176     -26.130 -38.093  -3.259  1.00 99.99
ATOM   1406  HE3 TRP A 176     -25.521 -33.165  -5.115  1.00 99.99
ATOM   1407  HZ2 TRP A 176     -24.852 -37.984  -5.819  1.00 99.99
ATOM   1408  HZ3 TRP A 176     -24.808 -33.974  -7.336  1.00 99.99
ATOM   1409  HH2 TRP A 176     -24.460 -36.424  -7.686  1.00 99.99
ATOM   1410  N   GLU A 177     -27.756 -31.204  -4.259  1.00  0.93
ATOM   1411  CA  GLU A 177     -27.897 -30.428  -5.508  1.00  0.93
ATOM   1412  C   GLU A 177     -26.550 -30.029  -6.137  1.00  0.93
ATOM   1413  O   GLU A 177     -26.512 -29.381  -7.185  1.00  0.93
ATOM   1414  CB  GLU A 177     -28.754 -29.177  -5.259  1.00  0.93
ATOM   1415  CG  GLU A 177     -30.154 -29.464  -4.692  1.00  0.93
ATOM   1416  CD  GLU A 177     -30.148 -29.673  -3.177  1.00  0.93
ATOM   1417  OE1 GLU A 177     -29.692 -28.745  -2.469  1.00  0.93
ATOM   1418  OE2 GLU A 177     -30.529 -30.781  -2.750  1.00  0.93
ATOM   1419  H   GLU A 177     -27.277 -30.736  -3.507  1.00 99.99
ATOM   1420  N   GLY A 178     -25.451 -30.422  -5.484  1.00  0.97
ATOM   1421  CA  GLY A 178     -24.098 -30.181  -6.012  1.00  0.97
ATOM   1422  C   GLY A 178     -23.051 -31.046  -5.312  1.00  0.97
ATOM   1423  O   GLY A 178     -23.369 -31.821  -4.409  1.00  0.97
ATOM   1424  H   GLY A 178     -25.453 -30.852  -4.571  1.00 99.99
ATOM   1425  N   ILE A 179     -21.820 -30.899  -5.784  1.00  0.93
ATOM   1426  CA  ILE A 179     -20.650 -31.628  -5.266  1.00  0.93
ATOM   1427  C   ILE A 179     -19.569 -30.614  -4.850  1.00  0.93
ATOM   1428  O   ILE A 179     -19.226 -29.707  -5.614  1.00  0.93
ATOM   1429  CB  ILE A 179     -20.140 -32.644  -6.317  1.00  0.93
ATOM   1430  CG1 ILE A 179     -21.237 -33.683  -6.637  1.00  0.93
ATOM   1431  CG2 ILE A 179     -18.828 -33.307  -5.861  1.00  0.93
ATOM   1432  CD  ILE A 179     -20.873 -34.818  -7.608  1.00  0.93
ATOM   1433  H   ILE A 179     -21.623 -30.221  -6.504  1.00 99.99
ATOM   1434  N   LEU A 180     -19.034 -30.841  -3.656  1.00  0.95
ATOM   1435  CA  LEU A 180     -17.881 -30.107  -3.108  1.00  0.95
ATOM   1436  C   LEU A 180     -16.631 -30.986  -3.215  1.00  0.95
ATOM   1437  O   LEU A 180     -16.428 -31.913  -2.422  1.00  0.95
ATOM   1438  CB  LEU A 180     -18.127 -29.738  -1.636  1.00  0.95
ATOM   1439  CG  LEU A 180     -17.011 -28.891  -1.012  1.00  0.95
ATOM   1440  CD1 LEU A 180     -16.927 -27.517  -1.677  1.00  0.95
ATOM   1441  CD2 LEU A 180     -17.240 -28.746   0.493  1.00  0.95
ATOM   1442  H   LEU A 180     -19.432 -31.514  -3.016  1.00 99.99
ATOM   1443  N   GLY A 181     -15.900 -30.765  -4.311  1.00  0.96
ATOM   1444  CA  GLY A 181     -14.586 -31.394  -4.518  1.00  0.96
ATOM   1445  C   GLY A 181     -13.546 -30.828  -3.542  1.00  0.96
ATOM   1446  O   GLY A 181     -13.196 -29.650  -3.616  1.00  0.96
ATOM   1447  H   GLY A 181     -16.185 -30.176  -5.085  1.00 99.99
ATOM   1448  N   LEU A 182     -13.081 -31.694  -2.648  1.00  0.96
ATOM   1449  CA  LEU A 182     -12.106 -31.350  -1.597  1.00  0.96
ATOM   1450  C   LEU A 182     -10.660 -31.775  -1.911  1.00  0.96
ATOM   1451  O   LEU A 182      -9.785 -31.614  -1.057  1.00  0.96
ATOM   1452  CB  LEU A 182     -12.557 -31.976  -0.268  1.00  0.96
ATOM   1453  CG  LEU A 182     -13.839 -31.363   0.309  1.00  0.96
ATOM   1454  CD1 LEU A 182     -14.351 -32.240   1.450  1.00  0.96
ATOM   1455  CD2 LEU A 182     -13.585 -29.948   0.838  1.00  0.96
ATOM   1456  H   LEU A 182     -13.409 -32.645  -2.620  1.00 99.99
ATOM   1457  N   ALA A 183     -10.428 -32.400  -3.066  1.00  0.98
ATOM   1458  CA  ALA A 183      -9.067 -32.773  -3.501  1.00  0.98
ATOM   1459  C   ALA A 183      -8.292 -31.566  -4.078  1.00  0.98
ATOM   1460  O   ALA A 183      -8.729 -30.417  -3.963  1.00  0.98
ATOM   1461  CB  ALA A 183      -9.160 -33.977  -4.448  1.00  0.98
ATOM   1462  H   ALA A 183     -11.145 -32.575  -3.750  1.00 99.99
ATOM   1463  N   TYR A 184      -7.134 -31.820  -4.681  1.00  0.93
ATOM   1464  CA  TYR A 184      -6.197 -30.756  -5.090  1.00  0.93
ATOM   1465  C   TYR A 184      -6.396 -30.271  -6.532  1.00  0.93
ATOM   1466  O   TYR A 184      -6.957 -30.974  -7.379  1.00  0.93
ATOM   1467  CB  TYR A 184      -4.757 -31.228  -4.879  1.00  0.93
ATOM   1468  CG  TYR A 184      -4.493 -31.565  -3.411  1.00  0.93
ATOM   1469  CD1 TYR A 184      -4.137 -30.563  -2.520  1.00  0.93
ATOM   1470  CD2 TYR A 184      -4.568 -32.884  -2.987  1.00  0.93
ATOM   1471  CE1 TYR A 184      -3.838 -30.884  -1.202  1.00  0.93
ATOM   1472  CE2 TYR A 184      -4.262 -33.210  -1.670  1.00  0.93
ATOM   1473  CZ  TYR A 184      -3.887 -32.207  -0.782  1.00  0.93
ATOM   1474  OH  TYR A 184      -3.474 -32.514   0.476  1.00  0.93
ATOM   1475  H   TYR A 184      -6.853 -32.752  -4.927  1.00 99.99
ATOM   1476  HD1 TYR A 184      -4.120 -29.526  -2.851  1.00 99.99
ATOM   1477  HD2 TYR A 184      -4.901 -33.653  -3.684  1.00 99.99
ATOM   1478  HE1 TYR A 184      -3.628 -30.087  -0.487  1.00 99.99
ATOM   1479  HE2 TYR A 184      -4.365 -34.244  -1.342  1.00 99.99
ATOM   1480  HH  TYR A 184      -3.572 -33.492   0.638  1.00 99.99
ATOM   1481  N   ALA A 185      -5.781 -29.126  -6.816  1.00  0.95
ATOM   1482  CA  ALA A 185      -5.893 -28.423  -8.110  1.00  0.95
ATOM   1483  C   ALA A 185      -5.499 -29.237  -9.354  1.00  0.95
ATOM   1484  O   ALA A 185      -6.148 -29.084 -10.389  1.00  0.95
ATOM   1485  CB  ALA A 185      -5.081 -27.127  -8.056  1.00  0.95
ATOM   1486  H   ALA A 185      -5.213 -28.657  -6.139  1.00 99.99
ATOM   1487  N   GLU A 186      -4.564 -30.179  -9.225  1.00  0.87
ATOM   1488  CA  GLU A 186      -4.065 -30.984 -10.362  1.00  0.87
ATOM   1489  C   GLU A 186      -5.171 -31.740 -11.129  1.00  0.87
ATOM   1490  O   GLU A 186      -5.066 -31.878 -12.348  1.00  0.87
ATOM   1491  CB  GLU A 186      -3.009 -31.974  -9.868  1.00  0.87
ATOM   1492  CG  GLU A 186      -2.067 -32.386 -11.004  1.00  0.87
ATOM   1493  CD  GLU A 186      -1.474 -33.768 -10.753  1.00  0.87
ATOM   1494  OE1 GLU A 186      -0.397 -33.821 -10.117  1.00  0.87
ATOM   1495  OE2 GLU A 186      -2.121 -34.729 -11.218  1.00  0.87
ATOM   1496  H   GLU A 186      -4.104 -30.367  -8.357  1.00 99.99
ATOM   1497  N   ILE A 187      -6.217 -32.177 -10.432  1.00  0.88
ATOM   1498  CA  ILE A 187      -7.349 -32.877 -11.079  1.00  0.88
ATOM   1499  C   ILE A 187      -8.600 -31.990 -11.259  1.00  0.88
ATOM   1500  O   ILE A 187      -9.662 -32.488 -11.619  1.00  0.88
ATOM   1501  CB  ILE A 187      -7.694 -34.202 -10.364  1.00  0.88
ATOM   1502  CG1 ILE A 187      -8.158 -33.971  -8.916  1.00  0.88
ATOM   1503  CG2 ILE A 187      -6.509 -35.177 -10.457  1.00  0.88
ATOM   1504  CD  ILE A 187      -8.789 -35.189  -8.232  1.00  0.88
ATOM   1505  H   ILE A 187      -6.295 -32.086  -9.438  1.00 99.99
ATOM   1506  N   ALA A 188      -8.509 -30.691 -10.976  1.00  0.90
ATOM   1507  CA  ALA A 188      -9.621 -29.756 -11.242  1.00  0.90
ATOM   1508  C   ALA A 188      -9.920 -29.677 -12.749  1.00  0.90
ATOM   1509  O   ALA A 188      -9.023 -29.754 -13.592  1.00  0.90
ATOM   1510  CB  ALA A 188      -9.286 -28.365 -10.697  1.00  0.90
ATOM   1511  H   ALA A 188      -7.673 -30.263 -10.624  1.00 99.99
ATOM   1512  N   ARG A 189     -11.192 -29.487 -13.067  1.00  0.82
ATOM   1513  CA  ARG A 189     -11.637 -29.359 -14.467  1.00  0.82
ATOM   1514  C   ARG A 189     -11.979 -27.878 -14.689  1.00  0.82
ATOM   1515  O   ARG A 189     -12.710 -27.319 -13.869  1.00  0.82
ATOM   1516  CB  ARG A 189     -12.888 -30.209 -14.736  1.00  0.82
ATOM   1517  CG  ARG A 189     -12.839 -31.681 -14.299  1.00  0.82
ATOM   1518  CD  ARG A 189     -11.676 -32.491 -14.879  1.00  0.82
ATOM   1519  NE  ARG A 189     -12.045 -33.918 -14.855  1.00  0.82
ATOM   1520  CZ  ARG A 189     -11.701 -34.841 -13.947  1.00  0.82
ATOM   1521  NH1 ARG A 189     -10.945 -34.562 -12.898  1.00  0.82
ATOM   1522  NH2 ARG A 189     -12.131 -36.086 -14.065  1.00  0.82
ATOM   1523  H   ARG A 189     -11.916 -29.435 -12.371  1.00 99.99
ATOM   1524  HE  ARG A 189     -12.610 -34.210 -15.621  1.00 99.99
ATOM   1525 1HH1 ARG A 189     -10.705 -35.268 -12.236  1.00 99.99
ATOM   1526 2HH1 ARG A 189     -10.599 -33.629 -12.767  1.00 99.99
ATOM   1527 1HH2 ARG A 189     -11.863 -36.758 -13.374  1.00 99.99
ATOM   1528 2HH2 ARG A 189     -12.703 -36.358 -14.835  1.00 99.99
ATOM   1529  N   PRO A 190     -11.525 -27.261 -15.790  1.00  0.89
ATOM   1530  CA  PRO A 190     -10.778 -27.862 -16.915  1.00  0.89
ATOM   1531  C   PRO A 190      -9.261 -28.030 -16.723  1.00  0.89
ATOM   1532  O   PRO A 190      -8.625 -28.787 -17.450  1.00  0.89
ATOM   1533  CB  PRO A 190     -11.076 -26.920 -18.083  1.00  0.89
ATOM   1534  CG  PRO A 190     -11.197 -25.548 -17.420  1.00  0.89
ATOM   1535  CD  PRO A 190     -11.836 -25.845 -16.064  1.00  0.89
ATOM   1536  N   ASP A 191      -8.684 -27.218 -15.843  1.00  0.83
ATOM   1537  CA  ASP A 191      -7.226 -27.126 -15.664  1.00  0.83
ATOM   1538  C   ASP A 191      -6.927 -26.716 -14.208  1.00  0.83
ATOM   1539  O   ASP A 191      -7.828 -26.285 -13.485  1.00  0.83
ATOM   1540  CB  ASP A 191      -6.661 -26.182 -16.747  1.00  0.83
ATOM   1541  CG  ASP A 191      -7.278 -24.785 -16.713  1.00  0.83
ATOM   1542  OD1 ASP A 191      -7.004 -24.146 -15.684  1.00  0.83
ATOM   1543  OD2 ASP A 191      -8.002 -24.406 -17.657  1.00  0.83
ATOM   1544  H   ASP A 191      -9.204 -26.733 -15.139  1.00 99.99
ATOM   1545  N   ASP A 192      -5.665 -26.825 -13.811  1.00  0.88
ATOM   1546  CA  ASP A 192      -5.231 -26.564 -12.420  1.00  0.88
ATOM   1547  C   ASP A 192      -5.270 -25.087 -11.983  1.00  0.88
ATOM   1548  O   ASP A 192      -5.105 -24.798 -10.797  1.00  0.88
ATOM   1549  CB  ASP A 192      -3.875 -27.232 -12.135  1.00  0.88
ATOM   1550  CG  ASP A 192      -2.686 -26.770 -12.990  1.00  0.88
ATOM   1551  OD1 ASP A 192      -2.926 -26.080 -14.009  1.00  0.88
ATOM   1552  OD2 ASP A 192      -1.564 -27.202 -12.658  1.00  0.88
ATOM   1553  H   ASP A 192      -4.918 -26.989 -14.455  1.00 99.99
ATOM   1554  N   SER A 193      -5.452 -24.172 -12.937  1.00  0.87
ATOM   1555  CA  SER A 193      -5.652 -22.740 -12.627  1.00  0.87
ATOM   1556  C   SER A 193      -7.021 -22.452 -11.976  1.00  0.87
ATOM   1557  O   SER A 193      -7.188 -21.400 -11.352  1.00  0.87
ATOM   1558  CB  SER A 193      -5.395 -21.820 -13.832  1.00  0.87
ATOM   1559  OG  SER A 193      -6.510 -21.765 -14.724  1.00  0.87
ATOM   1560  H   SER A 193      -5.527 -24.397 -13.909  1.00 99.99
ATOM   1561  HG  SER A 193      -6.285 -21.223 -15.535  1.00 99.99
ATOM   1562  N   LEU A 194      -7.976 -23.379 -12.073  1.00  0.87
ATOM   1563  CA  LEU A 194      -9.261 -23.261 -11.350  1.00  0.87
ATOM   1564  C   LEU A 194      -9.111 -23.731  -9.889  1.00  0.87
ATOM   1565  O   LEU A 194      -9.279 -24.909  -9.564  1.00  0.87
ATOM   1566  CB  LEU A 194     -10.376 -24.032 -12.074  1.00  0.87
ATOM   1567  CG  LEU A 194     -11.770 -23.585 -11.610  1.00  0.87
ATOM   1568  CD1 LEU A 194     -12.170 -22.263 -12.271  1.00  0.87
ATOM   1569  CD2 LEU A 194     -12.816 -24.667 -11.877  1.00  0.87
ATOM   1570  H   LEU A 194      -7.881 -24.204 -12.637  1.00 99.99
ATOM   1571  N   GLU A 195      -8.790 -22.780  -9.016  1.00  0.90
ATOM   1572  CA  GLU A 195      -8.602 -22.996  -7.562  1.00  0.90
ATOM   1573  C   GLU A 195      -9.796 -23.731  -6.899  1.00  0.90
ATOM   1574  O   GLU A 195     -10.923 -23.238  -6.993  1.00  0.90
ATOM   1575  CB  GLU A 195      -8.359 -21.620  -6.924  1.00  0.90
ATOM   1576  CG  GLU A 195      -7.981 -21.679  -5.440  1.00  0.90
ATOM   1577  CD  GLU A 195      -7.452 -20.334  -4.940  1.00  0.90
ATOM   1578  OE1 GLU A 195      -6.225 -20.157  -5.039  1.00  0.90
ATOM   1579  OE2 GLU A 195      -8.280 -19.536  -4.453  1.00  0.90
ATOM   1580  H   GLU A 195      -8.529 -21.870  -9.346  1.00 99.99
ATOM   1581  N   PRO A 196      -9.557 -24.870  -6.225  1.00  0.97
ATOM   1582  CA  PRO A 196     -10.598 -25.605  -5.472  1.00  0.97
ATOM   1583  C   PRO A 196     -11.081 -24.780  -4.267  1.00  0.97
ATOM   1584  O   PRO A 196     -10.337 -23.936  -3.751  1.00  0.97
ATOM   1585  CB  PRO A 196      -9.920 -26.892  -4.991  1.00  0.97
ATOM   1586  CG  PRO A 196      -8.756 -27.080  -5.962  1.00  0.97
ATOM   1587  CD  PRO A 196      -8.303 -25.649  -6.254  1.00  0.97
ATOM   1588  N   PHE A 197     -12.263 -25.123  -3.758  1.00  0.96
ATOM   1589  CA  PHE A 197     -12.896 -24.421  -2.618  1.00  0.96
ATOM   1590  C   PHE A 197     -12.031 -24.391  -1.346  1.00  0.96
ATOM   1591  O   PHE A 197     -11.873 -23.329  -0.743  1.00  0.96
ATOM   1592  CB  PHE A 197     -14.266 -25.051  -2.332  1.00  0.96
ATOM   1593  CG  PHE A 197     -14.932 -24.513  -1.057  1.00  0.96
ATOM   1594  CD1 PHE A 197     -15.616 -23.308  -1.092  1.00  0.96
ATOM   1595  CD2 PHE A 197     -14.750 -25.173   0.150  1.00  0.96
ATOM   1596  CE1 PHE A 197     -16.099 -22.747   0.086  1.00  0.96
ATOM   1597  CE2 PHE A 197     -15.234 -24.613   1.332  1.00  0.96
ATOM   1598  CZ  PHE A 197     -15.904 -23.399   1.297  1.00  0.96
ATOM   1599  H   PHE A 197     -12.806 -25.879  -4.127  1.00 99.99
ATOM   1600  HD1 PHE A 197     -15.773 -22.808  -2.044  1.00 99.99
ATOM   1601  HD2 PHE A 197     -14.225 -26.127   0.171  1.00 99.99
ATOM   1602  HE1 PHE A 197     -16.610 -21.786   0.051  1.00 99.99
ATOM   1603  HE2 PHE A 197     -15.053 -25.111   2.284  1.00 99.99
ATOM   1604  HZ  PHE A 197     -16.247 -22.938   2.227  1.00 99.99
ATOM   1605  N   PHE A 198     -11.419 -25.518  -0.996  1.00  0.96
ATOM   1606  CA  PHE A 198     -10.598 -25.596   0.229  1.00  0.96
ATOM   1607  C   PHE A 198      -9.329 -24.725   0.159  1.00  0.96
ATOM   1608  O   PHE A 198      -9.014 -24.000   1.106  1.00  0.96
ATOM   1609  CB  PHE A 198     -10.282 -27.055   0.557  1.00  0.96
ATOM   1610  CG  PHE A 198     -10.148 -27.209   2.074  1.00  0.96
ATOM   1611  CD1 PHE A 198     -11.273 -27.475   2.841  1.00  0.96
ATOM   1612  CD2 PHE A 198      -8.929 -26.962   2.684  1.00  0.96
ATOM   1613  CE1 PHE A 198     -11.180 -27.479   4.233  1.00  0.96
ATOM   1614  CE2 PHE A 198      -8.832 -26.974   4.072  1.00  0.96
ATOM   1615  CZ  PHE A 198      -9.961 -27.225   4.844  1.00  0.96
ATOM   1616  H   PHE A 198     -11.560 -26.386  -1.474  1.00 99.99
ATOM   1617  HD1 PHE A 198     -12.226 -27.670   2.353  1.00 99.99
ATOM   1618  HD2 PHE A 198      -8.053 -26.743   2.073  1.00 99.99
ATOM   1619  HE1 PHE A 198     -12.070 -27.657   4.836  1.00 99.99
ATOM   1620  HE2 PHE A 198      -7.866 -26.787   4.538  1.00 99.99
ATOM   1621  HZ  PHE A 198      -9.899 -27.168   5.934  1.00 99.99
ATOM   1622  N   ASP A 199      -8.732 -24.660  -1.028  1.00  0.93
ATOM   1623  CA  ASP A 199      -7.629 -23.727  -1.335  1.00  0.93
ATOM   1624  C   ASP A 199      -8.058 -22.248  -1.267  1.00  0.93
ATOM   1625  O   ASP A 199      -7.361 -21.457  -0.632  1.00  0.93
ATOM   1626  CB  ASP A 199      -7.014 -24.079  -2.692  1.00  0.93
ATOM   1627  CG  ASP A 199      -6.312 -25.437  -2.632  1.00  0.93
ATOM   1628  OD1 ASP A 199      -7.034 -26.446  -2.803  1.00  0.93
ATOM   1629  OD2 ASP A 199      -5.081 -25.437  -2.426  1.00  0.93
ATOM   1630  H   ASP A 199      -8.947 -25.315  -1.754  1.00 99.99
ATOM   1631  N   SER A 200      -9.245 -21.919  -1.783  1.00  0.95
ATOM   1632  CA  SER A 200      -9.847 -20.568  -1.622  1.00  0.95
ATOM   1633  C   SER A 200     -10.077 -20.228  -0.138  1.00  0.95
ATOM   1634  O   SER A 200      -9.674 -19.158   0.322  1.00  0.95
ATOM   1635  CB  SER A 200     -11.218 -20.423  -2.301  1.00  0.95
ATOM   1636  OG  SER A 200     -11.212 -20.776  -3.688  1.00  0.95
ATOM   1637  H   SER A 200      -9.803 -22.567  -2.310  1.00 99.99
ATOM   1638  HG  SER A 200     -10.285 -20.989  -3.979  1.00 99.99
ATOM   1639  N   LEU A 201     -10.590 -21.205   0.608  1.00  0.92
ATOM   1640  CA  LEU A 201     -10.941 -21.084   2.035  1.00  0.92
ATOM   1641  C   LEU A 201      -9.731 -20.784   2.930  1.00  0.92
ATOM   1642  O   LEU A 201      -9.790 -19.848   3.723  1.00  0.92
ATOM   1643  CB  LEU A 201     -11.659 -22.368   2.476  1.00  0.92
ATOM   1644  CG  LEU A 201     -12.059 -22.422   3.958  1.00  0.92
ATOM   1645  CD1 LEU A 201     -13.117 -21.374   4.311  1.00  0.92
ATOM   1646  CD2 LEU A 201     -12.566 -23.823   4.291  1.00  0.92
ATOM   1647  H   LEU A 201     -10.833 -22.095   0.211  1.00 99.99
ATOM   1648  N   VAL A 202      -8.642 -21.523   2.741  1.00  0.90
ATOM   1649  CA  VAL A 202      -7.414 -21.325   3.539  1.00  0.90
ATOM   1650  C   VAL A 202      -6.645 -20.046   3.161  1.00  0.90
ATOM   1651  O   VAL A 202      -6.079 -19.393   4.036  1.00  0.90
ATOM   1652  CB  VAL A 202      -6.505 -22.571   3.563  1.00  0.90
ATOM   1653  CG1 VAL A 202      -7.251 -23.769   4.158  1.00  0.90
ATOM   1654  CG2 VAL A 202      -5.905 -22.932   2.199  1.00  0.90
ATOM   1655  H   VAL A 202      -8.615 -22.297   2.104  1.00 99.99
ATOM   1656  N   LYS A 203      -6.663 -19.679   1.881  1.00  0.89
ATOM   1657  CA  LYS A 203      -5.993 -18.453   1.398  1.00  0.89
ATOM   1658  C   LYS A 203      -6.696 -17.149   1.806  1.00  0.89
ATOM   1659  O   LYS A 203      -6.027 -16.138   2.020  1.00  0.89
ATOM   1660  CB  LYS A 203      -5.799 -18.489  -0.121  1.00  0.89
ATOM   1661  CG  LYS A 203      -4.753 -19.531  -0.528  1.00  0.89
ATOM   1662  CD  LYS A 203      -4.720 -19.711  -2.046  1.00  0.89
ATOM   1663  CE  LYS A 203      -3.950 -20.980  -2.423  1.00  0.89
ATOM   1664  NZ  LYS A 203      -3.957 -21.186  -3.879  1.00  0.89
ATOM   1665  H   LYS A 203      -7.094 -20.229   1.161  1.00 99.99
ATOM   1666  HZ1 LYS A 203      -3.479 -22.029  -4.121  1.00 99.99
ATOM   1667  HZ2 LYS A 203      -4.903 -21.214  -4.205  1.00 99.99
ATOM   1668  HZ3 LYS A 203      -3.516 -20.406  -4.323  1.00 99.99
ATOM   1669  N   GLN A 204      -8.019 -17.185   1.940  1.00  0.87
ATOM   1670  CA  GLN A 204      -8.815 -15.975   2.236  1.00  0.87
ATOM   1671  C   GLN A 204      -9.196 -15.814   3.715  1.00  0.87
ATOM   1672  O   GLN A 204      -9.846 -14.832   4.082  1.00  0.87
ATOM   1673  CB  GLN A 204     -10.084 -15.968   1.380  1.00  0.87
ATOM   1674  CG  GLN A 204      -9.784 -15.775  -0.108  1.00  0.87
ATOM   1675  CD  GLN A 204     -11.042 -15.955  -0.959  1.00  0.87
ATOM   1676  OE1 GLN A 204     -12.130 -15.464  -0.678  1.00  0.87
ATOM   1677  NE2 GLN A 204     -10.881 -16.646  -2.064  1.00  0.87
ATOM   1678  H   GLN A 204      -8.560 -18.022   1.828  1.00 99.99
ATOM   1679 1HE2 GLN A 204     -11.691 -16.802  -2.640  1.00 99.99
ATOM   1680 2HE2 GLN A 204      -9.993 -17.026  -2.297  1.00 99.99
ATOM   1681  N   THR A 205      -8.868 -16.805   4.540  1.00  0.85
ATOM   1682  CA  THR A 205      -9.222 -16.783   5.975  1.00  0.85
ATOM   1683  C   THR A 205      -8.071 -17.367   6.802  1.00  0.85
ATOM   1684  O   THR A 205      -7.076 -17.851   6.263  1.00  0.85
ATOM   1685  CB  THR A 205     -10.530 -17.534   6.313  1.00  0.85
ATOM   1686  OG1 THR A 205     -10.334 -18.950   6.357  1.00  0.85
ATOM   1687  CG2 THR A 205     -11.701 -17.166   5.401  1.00  0.85
ATOM   1688  H   THR A 205      -8.218 -17.528   4.289  1.00 99.99
ATOM   1689  HG1 THR A 205     -11.227 -19.403   6.396  1.00 99.99
ATOM   1690  N   HIS A 206      -8.263 -17.385   8.114  1.00  0.78
ATOM   1691  CA  HIS A 206      -7.314 -18.035   9.033  1.00  0.78
ATOM   1692  C   HIS A 206      -7.679 -19.503   9.342  1.00  0.78
ATOM   1693  O   HIS A 206      -7.144 -20.074  10.296  1.00  0.78
ATOM   1694  CB  HIS A 206      -7.229 -17.216  10.325  1.00  0.78
ATOM   1695  CG  HIS A 206      -6.654 -15.813  10.119  1.00  0.78
ATOM   1696  ND1 HIS A 206      -5.364 -15.519  10.028  1.00  0.78
ATOM   1697  CD2 HIS A 206      -7.345 -14.677  10.076  1.00  0.78
ATOM   1698  CE1 HIS A 206      -5.254 -14.200   9.898  1.00  0.78
ATOM   1699  NE2 HIS A 206      -6.477 -13.680   9.940  1.00  0.78
ATOM   1700  H   HIS A 206      -9.040 -16.930   8.544  1.00 99.99
ATOM   1701  HD1 HIS A 206      -4.612 -16.159  10.187  1.00 99.99
ATOM   1702  N   VAL A 207      -8.565 -20.125   8.564  1.00  0.84
ATOM   1703  CA  VAL A 207      -8.921 -21.555   8.753  1.00  0.84
ATOM   1704  C   VAL A 207      -7.682 -22.447   8.488  1.00  0.84
ATOM   1705  O   VAL A 207      -7.131 -22.381   7.387  1.00  0.84
ATOM   1706  CB  VAL A 207     -10.128 -21.940   7.870  1.00  0.84
ATOM   1707  CG1 VAL A 207     -10.459 -23.437   7.917  1.00  0.84
ATOM   1708  CG2 VAL A 207     -11.387 -21.184   8.308  1.00  0.84
ATOM   1709  H   VAL A 207      -9.020 -19.672   7.787  1.00 99.99
ATOM   1710  N   PRO A 208      -7.253 -23.275   9.454  1.00  0.88
ATOM   1711  CA  PRO A 208      -6.100 -24.187   9.278  1.00  0.88
ATOM   1712  C   PRO A 208      -6.310 -25.119   8.072  1.00  0.88
ATOM   1713  O   PRO A 208      -7.432 -25.551   7.807  1.00  0.88
ATOM   1714  CB  PRO A 208      -6.038 -24.985  10.582  1.00  0.88
ATOM   1715  CG  PRO A 208      -6.589 -24.003  11.615  1.00  0.88
ATOM   1716  CD  PRO A 208      -7.717 -23.301  10.858  1.00  0.88
ATOM   1717  N   ASN A 209      -5.221 -25.426   7.364  1.00  0.87
ATOM   1718  CA  ASN A 209      -5.249 -26.270   6.147  1.00  0.87
ATOM   1719  C   ASN A 209      -5.394 -27.770   6.487  1.00  0.87
ATOM   1720  O   ASN A 209      -4.480 -28.582   6.309  1.00  0.87
ATOM   1721  CB  ASN A 209      -3.996 -25.945   5.312  1.00  0.87
ATOM   1722  CG  ASN A 209      -3.995 -26.551   3.902  1.00  0.87
ATOM   1723  OD1 ASN A 209      -5.024 -26.824   3.302  1.00  0.87
ATOM   1724  ND2 ASN A 209      -2.821 -26.755   3.341  1.00  0.87
ATOM   1725  H   ASN A 209      -4.315 -25.080   7.609  1.00 99.99
ATOM   1726 1HD2 ASN A 209      -2.801 -27.148   2.425  1.00 99.99
ATOM   1727 2HD2 ASN A 209      -1.973 -26.509   3.805  1.00 99.99
ATOM   1728  N   LEU A 210      -6.564 -28.112   7.013  1.00  0.91
ATOM   1729  CA  LEU A 210      -6.914 -29.462   7.495  1.00  0.91
ATOM   1730  C   LEU A 210      -8.442 -29.564   7.560  1.00  0.91
ATOM   1731  O   LEU A 210      -9.128 -28.585   7.849  1.00  0.91
ATOM   1732  CB  LEU A 210      -6.309 -29.640   8.902  1.00  0.91
ATOM   1733  CG  LEU A 210      -6.431 -31.036   9.530  1.00  0.91
ATOM   1734  CD1 LEU A 210      -5.241 -31.269  10.461  1.00  0.91
ATOM   1735  CD2 LEU A 210      -7.706 -31.167  10.368  1.00  0.91
ATOM   1736  H   LEU A 210      -7.280 -27.421   7.176  1.00 99.99
ATOM   1737  N   PHE A 211      -8.960 -30.736   7.235  1.00  0.97
ATOM   1738  CA  PHE A 211     -10.358 -31.079   7.560  1.00  0.97
ATOM   1739  C   PHE A 211     -10.423 -32.562   7.931  1.00  0.97
ATOM   1740  O   PHE A 211      -9.494 -33.319   7.644  1.00  0.97
ATOM   1741  CB  PHE A 211     -11.355 -30.722   6.445  1.00  0.97
ATOM   1742  CG  PHE A 211     -11.190 -31.543   5.164  1.00  0.97
ATOM   1743  CD1 PHE A 211     -10.312 -31.104   4.187  1.00  0.97
ATOM   1744  CD2 PHE A 211     -11.892 -32.729   5.005  1.00  0.97
ATOM   1745  CE1 PHE A 211     -10.118 -31.866   3.040  1.00  0.97
ATOM   1746  CE2 PHE A 211     -11.690 -33.499   3.859  1.00  0.97
ATOM   1747  CZ  PHE A 211     -10.803 -33.067   2.884  1.00  0.97
ATOM   1748  H   PHE A 211      -8.406 -31.493   6.876  1.00 99.99
ATOM   1749  HD1 PHE A 211      -9.780 -30.162   4.319  1.00 99.99
ATOM   1750  HD2 PHE A 211     -12.612 -33.039   5.761  1.00 99.99
ATOM   1751  HE1 PHE A 211      -9.433 -31.509   2.273  1.00 99.99
ATOM   1752  HE2 PHE A 211     -12.192 -34.461   3.759  1.00 99.99
ATOM   1753  HZ  PHE A 211     -10.591 -33.701   2.019  1.00 99.99
ATOM   1754  N   SER A 212     -11.423 -32.922   8.716  1.00  0.99
ATOM   1755  CA  SER A 212     -11.627 -34.334   9.076  1.00  0.99
ATOM   1756  C   SER A 212     -13.064 -34.782   8.823  1.00  0.99
ATOM   1757  O   SER A 212     -14.001 -33.980   8.848  1.00  0.99
ATOM   1758  CB  SER A 212     -11.218 -34.603  10.527  1.00  0.99
ATOM   1759  OG  SER A 212     -12.061 -33.897  11.439  1.00  0.99
ATOM   1760  H   SER A 212     -12.069 -32.265   9.117  1.00 99.99
ATOM   1761  HG  SER A 212     -11.825 -34.184  12.383  1.00 99.99
ATOM   1762  N   LEU A 213     -13.181 -36.061   8.499  1.00  0.97
ATOM   1763  CA  LEU A 213     -14.474 -36.702   8.224  1.00  0.97
ATOM   1764  C   LEU A 213     -14.702 -37.890   9.157  1.00  0.97
ATOM   1765  O   LEU A 213     -13.826 -38.742   9.331  1.00  0.97
ATOM   1766  CB  LEU A 213     -14.534 -37.185   6.767  1.00  0.97
ATOM   1767  CG  LEU A 213     -14.514 -36.056   5.729  1.00  0.97
ATOM   1768  CD1 LEU A 213     -14.426 -36.641   4.320  1.00  0.97
ATOM   1769  CD2 LEU A 213     -15.783 -35.212   5.820  1.00  0.97
ATOM   1770  H   LEU A 213     -12.385 -36.678   8.490  1.00 99.99
ATOM   1771  N   GLN A 214     -15.853 -37.855   9.810  1.00  0.94
ATOM   1772  CA  GLN A 214     -16.412 -39.031  10.493  1.00  0.94
ATOM   1773  C   GLN A 214     -17.704 -39.361   9.741  1.00  0.94
ATOM   1774  O   GLN A 214     -18.605 -38.524   9.666  1.00  0.94
ATOM   1775  CB  GLN A 214     -16.742 -38.709  11.953  1.00  0.94
ATOM   1776  CG  GLN A 214     -17.050 -39.981  12.752  1.00  0.94
ATOM   1777  CD  GLN A 214     -17.806 -39.669  14.045  1.00  0.94
ATOM   1778  OE1 GLN A 214     -18.796 -38.951  14.071  1.00  0.94
ATOM   1779  NE2 GLN A 214     -17.409 -40.297  15.128  1.00  0.94
ATOM   1780  H   GLN A 214     -16.421 -37.024   9.844  1.00 99.99
ATOM   1781 1HE2 GLN A 214     -17.893 -40.100  15.977  1.00 99.99
ATOM   1782 2HE2 GLN A 214     -16.598 -40.880  15.105  1.00 99.99
ATOM   1783  N   LEU A 215     -17.692 -40.486   9.041  1.00  0.95
ATOM   1784  CA  LEU A 215     -18.885 -40.956   8.316  1.00  0.95
ATOM   1785  C   LEU A 215     -19.436 -42.134   9.125  1.00  0.95
ATOM   1786  O   LEU A 215     -18.692 -43.078   9.401  1.00  0.95
ATOM   1787  CB  LEU A 215     -18.511 -41.381   6.884  1.00  0.95
ATOM   1788  CG  LEU A 215     -17.714 -40.345   6.068  1.00  0.95
ATOM   1789  CD1 LEU A 215     -17.457 -40.883   4.659  1.00  0.95
ATOM   1790  CD2 LEU A 215     -18.408 -38.983   5.973  1.00  0.95
ATOM   1791  H   LEU A 215     -16.923 -41.130   9.048  1.00 99.99
ATOM   1792  N   CYS A 216     -20.622 -41.954   9.693  1.00  0.87
ATOM   1793  CA  CYS A 216     -21.200 -42.950  10.622  1.00  0.87
ATOM   1794  C   CYS A 216     -22.054 -44.042   9.968  1.00  0.87
ATOM   1795  O   CYS A 216     -22.315 -45.079  10.581  1.00  0.87
ATOM   1796  CB  CYS A 216     -22.004 -42.241  11.714  1.00  0.87
ATOM   1797  SG  CYS A 216     -20.976 -41.124  12.735  1.00  0.87
ATOM   1798  H   CYS A 216     -21.188 -41.133   9.562  1.00 99.99
ATOM   1799  N   GLY A 217     -22.493 -43.794   8.727  1.00  0.77
ATOM   1800  CA  GLY A 217     -23.396 -44.714   8.014  1.00  0.77
ATOM   1801  C   GLY A 217     -24.732 -44.851   8.749  1.00  0.77
ATOM   1802  O   GLY A 217     -25.353 -43.864   9.141  1.00  0.77
ATOM   1803  H   GLY A 217     -22.214 -42.998   8.170  1.00 99.99
ATOM   1804  N   ALA A 218     -25.166 -46.104   8.815  1.00  0.72
ATOM   1805  CA  ALA A 218     -26.454 -46.481   9.412  1.00  0.72
ATOM   1806  C   ALA A 218     -26.301 -47.683  10.364  1.00  0.72
ATOM   1807  O   ALA A 218     -26.317 -47.524  11.583  1.00  0.72
ATOM   1808  CB  ALA A 218     -27.454 -46.717   8.270  1.00  0.72
ATOM   1809  H   ALA A 218     -24.588 -46.866   8.536  1.00 99.99
ATOM   1810  N   GLY A 219     -26.135 -48.883   9.784  1.00  0.65
ATOM   1811  CA  GLY A 219     -26.088 -50.146  10.547  1.00  0.65
ATOM   1812  C   GLY A 219     -27.491 -50.747  10.701  1.00  0.65
ATOM   1813  O   GLY A 219     -27.999 -51.375   9.771  1.00  0.65
ATOM   1814  H   GLY A 219     -26.032 -49.009   8.792  1.00 99.99
ATOM   1815  N   PHE A 220     -28.126 -50.460  11.835  1.00  0.39
ATOM   1816  CA  PHE A 220     -29.494 -50.947  12.123  1.00  0.39
ATOM   1817  C   PHE A 220     -30.640 -49.917  12.289  1.00  0.39
ATOM   1818  O   PHE A 220     -31.756 -50.359  12.583  1.00  0.39
ATOM   1819  CB  PHE A 220     -29.452 -51.803  13.397  1.00  0.39
ATOM   1820  CG  PHE A 220     -28.619 -53.077  13.246  1.00  0.39
ATOM   1821  CD1 PHE A 220     -29.147 -54.153  12.552  1.00  0.39
ATOM   1822  CD2 PHE A 220     -27.377 -53.166  13.853  1.00  0.39
ATOM   1823  CE1 PHE A 220     -28.417 -55.338  12.453  1.00  0.39
ATOM   1824  CE2 PHE A 220     -26.646 -54.351  13.756  1.00  0.39
ATOM   1825  CZ  PHE A 220     -27.167 -55.427  13.051  1.00  0.39
ATOM   1826  H   PHE A 220     -27.690 -49.943  12.573  1.00 99.99
ATOM   1827  HD1 PHE A 220     -30.130 -54.066  12.094  1.00 99.99
ATOM   1828  HD2 PHE A 220     -26.991 -52.324  14.426  1.00 99.99
ATOM   1829  HE1 PHE A 220     -28.852 -56.202  11.954  1.00 99.99
ATOM   1830  HE2 PHE A 220     -25.691 -54.441  14.272  1.00 99.99
ATOM   1831  HZ  PHE A 220     -26.591 -56.351  12.966  1.00 99.99
ATOM   1832  N   PRO A 221     -30.487 -48.613  12.003  1.00  0.39
ATOM   1833  CA  PRO A 221     -31.410 -47.589  12.532  1.00  0.39
ATOM   1834  C   PRO A 221     -32.840 -47.609  11.971  1.00  0.39
ATOM   1835  O   PRO A 221     -33.796 -47.549  12.740  1.00  0.39
ATOM   1836  CB  PRO A 221     -30.715 -46.258  12.247  1.00  0.39
ATOM   1837  CG  PRO A 221     -30.017 -46.520  10.915  1.00  0.39
ATOM   1838  CD  PRO A 221     -29.589 -47.988  11.011  1.00  0.39
ATOM   1839  N   LEU A 222     -32.972 -47.706  10.649  1.00  0.42
ATOM   1840  CA  LEU A 222     -34.281 -47.598   9.976  1.00  0.42
ATOM   1841  C   LEU A 222     -34.616 -48.847   9.144  1.00  0.42
ATOM   1842  O   LEU A 222     -35.611 -48.853   8.411  1.00  0.42
ATOM   1843  CB  LEU A 222     -34.310 -46.341   9.089  1.00  0.42
ATOM   1844  CG  LEU A 222     -34.106 -45.002   9.819  1.00  0.42
ATOM   1845  CD1 LEU A 222     -34.088 -43.865   8.797  1.00  0.42
ATOM   1846  CD2 LEU A 222     -35.196 -44.731  10.861  1.00  0.42
ATOM   1847  H   LEU A 222     -32.202 -47.895  10.041  1.00 99.99
ATOM   1848  N   ASN A 223     -33.930 -49.948   9.444  1.00  0.42
ATOM   1849  CA  ASN A 223     -34.082 -51.241   8.738  1.00  0.42
ATOM   1850  C   ASN A 223     -35.492 -51.838   8.903  1.00  0.42
ATOM   1851  O   ASN A 223     -35.890 -52.709   8.130  1.00  0.42
ATOM   1852  CB  ASN A 223     -33.039 -52.252   9.237  1.00  0.42
ATOM   1853  CG  ASN A 223     -31.570 -51.860   9.021  1.00  0.42
ATOM   1854  OD1 ASN A 223     -31.200 -50.721   8.760  1.00  0.42
ATOM   1855  ND2 ASN A 223     -30.687 -52.810   9.242  1.00  0.42
ATOM   1856  H   ASN A 223     -33.235 -49.966  10.167  1.00 99.99
ATOM   1857 1HD2 ASN A 223     -29.720 -52.568   9.136  1.00 99.99
ATOM   1858 2HD2 ASN A 223     -30.971 -53.719   9.531  1.00 99.99
ATOM   1859  N   GLN A 224     -36.202 -51.381   9.931  1.00  0.36
ATOM   1860  CA  GLN A 224     -37.576 -51.813  10.254  1.00  0.36
ATOM   1861  C   GLN A 224     -38.670 -50.919   9.631  1.00  0.36
ATOM   1862  O   GLN A 224     -39.856 -51.125   9.897  1.00  0.36
ATOM   1863  CB  GLN A 224     -37.737 -51.839  11.781  1.00  0.36
ATOM   1864  CG  GLN A 224     -36.758 -52.774  12.508  1.00  0.36
ATOM   1865  CD  GLN A 224     -36.976 -54.252  12.174  1.00  0.36
ATOM   1866  OE1 GLN A 224     -38.048 -54.816  12.333  1.00  0.36
ATOM   1867  NE2 GLN A 224     -35.920 -54.922  11.763  1.00  0.36
ATOM   1868  H   GLN A 224     -35.841 -50.690  10.556  1.00 99.99
ATOM   1869 1HE2 GLN A 224     -36.057 -55.885  11.544  1.00 99.99
ATOM   1870 2HE2 GLN A 224     -35.035 -54.481  11.669  1.00 99.99
ATOM   1871  N   SER A 225     -38.296 -49.915   8.839  1.00  0.39
ATOM   1872  CA  SER A 225     -39.276 -49.039   8.161  1.00  0.39
ATOM   1873  C   SER A 225     -39.107 -49.099   6.640  1.00  0.39
ATOM   1874  O   SER A 225     -37.998 -49.316   6.149  1.00  0.39
ATOM   1875  CB  SER A 225     -39.181 -47.587   8.653  1.00  0.39
ATOM   1876  OG  SER A 225     -37.957 -46.946   8.275  1.00  0.39
ATOM   1877  H   SER A 225     -37.335 -49.734   8.603  1.00 99.99
ATOM   1878  HG  SER A 225     -37.347 -47.584   7.794  1.00 99.99
ATOM   1879  N   GLU A 226     -40.197 -48.862   5.917  1.00  0.35
ATOM   1880  CA  GLU A 226     -40.196 -48.841   4.436  1.00  0.35
ATOM   1881  C   GLU A 226     -39.637 -47.511   3.880  1.00  0.35
ATOM   1882  O   GLU A 226     -40.294 -46.795   3.120  1.00  0.35
ATOM   1883  CB  GLU A 226     -41.613 -49.122   3.915  1.00  0.35
ATOM   1884  CG  GLU A 226     -42.166 -50.498   4.313  1.00  0.35
ATOM   1885  CD  GLU A 226     -43.595 -50.767   3.814  1.00  0.35
ATOM   1886  OE1 GLU A 226     -44.267 -49.816   3.353  1.00  0.35
ATOM   1887  OE2 GLU A 226     -44.001 -51.945   3.914  1.00  0.35
ATOM   1888  H   GLU A 226     -41.081 -48.665   6.341  1.00 99.99
ATOM   1889  N   VAL A 227     -38.447 -47.148   4.350  1.00  0.46
ATOM   1890  CA  VAL A 227     -37.755 -45.881   4.028  1.00  0.46
ATOM   1891  C   VAL A 227     -36.266 -46.214   3.833  1.00  0.46
ATOM   1892  O   VAL A 227     -35.692 -46.964   4.628  1.00  0.46
ATOM   1893  CB  VAL A 227     -37.927 -44.872   5.191  1.00  0.46
ATOM   1894  CG1 VAL A 227     -37.218 -43.539   4.922  1.00  0.46
ATOM   1895  CG2 VAL A 227     -39.397 -44.568   5.510  1.00  0.46
ATOM   1896  H   VAL A 227     -37.904 -47.773   4.922  1.00 99.99
ATOM   1897  N   LEU A 228     -35.651 -45.649   2.797  1.00  0.49
ATOM   1898  CA  LEU A 228     -34.188 -45.732   2.593  1.00  0.49
ATOM   1899  C   LEU A 228     -33.473 -45.045   3.772  1.00  0.49
ATOM   1900  O   LEU A 228     -33.747 -43.883   4.070  1.00  0.49
ATOM   1901  CB  LEU A 228     -33.834 -45.060   1.258  1.00  0.49
ATOM   1902  CG  LEU A 228     -32.357 -45.177   0.852  1.00  0.49
ATOM   1903  CD1 LEU A 228     -31.946 -46.632   0.610  1.00  0.49
ATOM   1904  CD2 LEU A 228     -32.103 -44.366  -0.419  1.00  0.49
ATOM   1905  H   LEU A 228     -36.151 -45.123   2.107  1.00 99.99
ATOM   1906  N   ALA A 229     -32.596 -45.782   4.451  1.00  0.65
ATOM   1907  CA  ALA A 229     -31.978 -45.312   5.709  1.00  0.65
ATOM   1908  C   ALA A 229     -31.191 -44.002   5.568  1.00  0.65
ATOM   1909  O   ALA A 229     -30.441 -43.795   4.609  1.00  0.65
ATOM   1910  CB  ALA A 229     -31.088 -46.392   6.329  1.00  0.65
ATOM   1911  H   ALA A 229     -32.324 -46.695   4.161  1.00 99.99
ATOM   1912  N   SER A 230     -31.428 -43.137   6.548  1.00  0.72
ATOM   1913  CA  SER A 230     -30.749 -41.837   6.680  1.00  0.72
ATOM   1914  C   SER A 230     -29.394 -42.064   7.354  1.00  0.72
ATOM   1915  O   SER A 230     -29.306 -42.758   8.369  1.00  0.72
ATOM   1916  CB  SER A 230     -31.594 -40.904   7.554  1.00  0.72
ATOM   1917  OG  SER A 230     -31.022 -39.595   7.591  1.00  0.72
ATOM   1918  H   SER A 230     -32.047 -43.359   7.300  1.00 99.99
ATOM   1919  HG  SER A 230     -31.576 -39.008   8.183  1.00 99.99
ATOM   1920  N   VAL A 231     -28.355 -41.529   6.730  1.00  0.76
ATOM   1921  CA  VAL A 231     -26.983 -41.638   7.264  1.00  0.76
ATOM   1922  C   VAL A 231     -26.527 -40.266   7.781  1.00  0.76
ATOM   1923  O   VAL A 231     -26.965 -39.232   7.271  1.00  0.76
ATOM   1924  CB  VAL A 231     -25.999 -42.249   6.240  1.00  0.76
ATOM   1925  CG1 VAL A 231     -26.461 -43.636   5.779  1.00  0.76
ATOM   1926  CG2 VAL A 231     -25.736 -41.363   5.018  1.00  0.76
ATOM   1927  H   VAL A 231     -28.464 -40.958   5.915  1.00 99.99
ATOM   1928  N   GLY A 232     -25.669 -40.299   8.804  1.00  0.91
ATOM   1929  CA  GLY A 232     -25.137 -39.072   9.424  1.00  0.91
ATOM   1930  C   GLY A 232     -23.613 -39.115   9.550  1.00  0.91
ATOM   1931  O   GLY A 232     -22.969 -40.144   9.320  1.00  0.91
ATOM   1932  H   GLY A 232     -25.312 -41.149   9.213  1.00 99.99
ATOM   1933  N   GLY A 233     -23.070 -37.960   9.936  1.00  0.95
ATOM   1934  CA  GLY A 233     -21.623 -37.821  10.164  1.00  0.95
ATOM   1935  C   GLY A 233     -21.223 -36.369  10.422  1.00  0.95
ATOM   1936  O   GLY A 233     -22.065 -35.477  10.546  1.00  0.95
ATOM   1937  H   GLY A 233     -23.606 -37.123  10.119  1.00 99.99
ATOM   1938  N   SER A 234     -19.918 -36.167  10.519  1.00  0.94
ATOM   1939  CA  SER A 234     -19.324 -34.852  10.823  1.00  0.94
ATOM   1940  C   SER A 234     -18.169 -34.537   9.874  1.00  0.94
ATOM   1941  O   SER A 234     -17.308 -35.390   9.640  1.00  0.94
ATOM   1942  CB  SER A 234     -18.757 -34.832  12.247  1.00  0.94
ATOM   1943  OG  SER A 234     -19.801 -35.044  13.199  1.00  0.94
ATOM   1944  H   SER A 234     -19.263 -36.901  10.297  1.00 99.99
ATOM   1945  HG  SER A 234     -20.594 -35.410  12.710  1.00 99.99
ATOM   1946  N   MET A 235     -18.167 -33.308   9.378  1.00  0.93
ATOM   1947  CA  MET A 235     -17.011 -32.719   8.686  1.00  0.93
ATOM   1948  C   MET A 235     -16.511 -31.539   9.526  1.00  0.93
ATOM   1949  O   MET A 235     -17.163 -30.495   9.606  1.00  0.93
ATOM   1950  CB  MET A 235     -17.390 -32.263   7.272  1.00  0.93
ATOM   1951  CG  MET A 235     -16.184 -31.683   6.518  1.00  0.93
ATOM   1952  SD  MET A 235     -16.473 -31.395   4.734  1.00  0.93
ATOM   1953  CE  MET A 235     -17.765 -30.173   4.805  1.00  0.93
ATOM   1954  H   MET A 235     -18.986 -32.714   9.415  1.00 99.99
ATOM   1955  N   ILE A 236     -15.378 -31.751  10.181  1.00  0.94
ATOM   1956  CA  ILE A 236     -14.763 -30.694  11.008  1.00  0.94
ATOM   1957  C   ILE A 236     -13.762 -29.943  10.116  1.00  0.94
ATOM   1958  O   ILE A 236     -12.773 -30.507   9.648  1.00  0.94
ATOM   1959  CB  ILE A 236     -14.099 -31.264  12.278  1.00  0.94
ATOM   1960  CG1 ILE A 236     -14.986 -32.266  13.047  1.00  0.94
ATOM   1961  CG2 ILE A 236     -13.622 -30.127  13.196  1.00  0.94
ATOM   1962  CD  ILE A 236     -16.341 -31.753  13.563  1.00  0.94
ATOM   1963  H   ILE A 236     -14.844 -32.597  10.075  1.00 99.99
ATOM   1964  N   ILE A 237     -14.090 -28.684   9.854  1.00  0.92
ATOM   1965  CA  ILE A 237     -13.347 -27.833   8.902  1.00  0.92
ATOM   1966  C   ILE A 237     -12.339 -26.976   9.682  1.00  0.92
ATOM   1967  O   ILE A 237     -12.731 -26.140  10.498  1.00  0.92
ATOM   1968  CB  ILE A 237     -14.337 -26.951   8.117  1.00  0.92
ATOM   1969  CG1 ILE A 237     -15.380 -27.806   7.383  1.00  0.92
ATOM   1970  CG2 ILE A 237     -13.591 -26.075   7.099  1.00  0.92
ATOM   1971  CD  ILE A 237     -16.738 -27.108   7.274  1.00  0.92
ATOM   1972  H   ILE A 237     -14.849 -28.226  10.318  1.00 99.99
ATOM   1973  N   GLY A 238     -11.056 -27.218   9.396  1.00  0.92
ATOM   1974  CA  GLY A 238      -9.943 -26.489  10.033  1.00  0.92
ATOM   1975  C   GLY A 238      -9.567 -26.996  11.430  1.00  0.92
ATOM   1976  O   GLY A 238      -8.922 -26.267  12.182  1.00  0.92
ATOM   1977  H   GLY A 238     -10.729 -27.893   8.716  1.00 99.99
ATOM   1978  N   GLY A 239      -9.950 -28.238  11.757  1.00  0.92
ATOM   1979  CA  GLY A 239      -9.522 -28.853  13.026  1.00  0.92
ATOM   1980  C   GLY A 239      -9.933 -30.317  13.175  1.00  0.92
ATOM   1981  O   GLY A 239     -10.455 -30.946  12.254  1.00  0.92
ATOM   1982  H   GLY A 239     -10.636 -28.778  11.251  1.00 99.99
ATOM   1983  N   ILE A 240      -9.674 -30.814  14.376  1.00  0.89
ATOM   1984  CA  ILE A 240      -9.952 -32.203  14.780  1.00  0.89
ATOM   1985  C   ILE A 240     -10.784 -32.135  16.068  1.00  0.89
ATOM   1986  O   ILE A 240     -10.352 -31.528  17.048  1.00  0.89
ATOM   1987  CB  ILE A 240      -8.608 -32.933  15.017  1.00  0.89
ATOM   1988  CG1 ILE A 240      -7.829 -33.086  13.701  1.00  0.89
ATOM   1989  CG2 ILE A 240      -8.788 -34.302  15.696  1.00  0.89
ATOM   1990  CD  ILE A 240      -6.325 -33.316  13.902  1.00  0.89
ATOM   1991  H   ILE A 240      -9.321 -30.236  15.115  1.00 99.99
ATOM   1992  N   ASP A 241     -11.946 -32.773  16.058  1.00  0.88
ATOM   1993  CA  ASP A 241     -12.649 -33.066  17.318  1.00  0.88
ATOM   1994  C   ASP A 241     -12.150 -34.439  17.802  1.00  0.88
ATOM   1995  O   ASP A 241     -12.056 -35.395  17.031  1.00  0.88
ATOM   1996  CB  ASP A 241     -14.169 -33.032  17.099  1.00  0.88
ATOM   1997  CG  ASP A 241     -14.994 -33.049  18.395  1.00  0.88
ATOM   1998  OD1 ASP A 241     -14.531 -33.692  19.362  1.00  0.88
ATOM   1999  OD2 ASP A 241     -16.031 -32.358  18.426  1.00  0.88
ATOM   2000  H   ASP A 241     -12.395 -33.095  15.220  1.00 99.99
ATOM   2001  N   HIS A 242     -11.792 -34.483  19.079  1.00  0.85
ATOM   2002  CA  HIS A 242     -11.270 -35.692  19.741  1.00  0.85
ATOM   2003  C   HIS A 242     -12.367 -36.604  20.311  1.00  0.85
ATOM   2004  O   HIS A 242     -12.071 -37.733  20.702  1.00  0.85
ATOM   2005  CB  HIS A 242     -10.286 -35.290  20.842  1.00  0.85
ATOM   2006  CG  HIS A 242      -9.102 -34.511  20.262  1.00  0.85
ATOM   2007  ND1 HIS A 242      -8.144 -35.036  19.513  1.00  0.85
ATOM   2008  CD2 HIS A 242      -8.884 -33.203  20.368  1.00  0.85
ATOM   2009  CE1 HIS A 242      -7.340 -34.048  19.127  1.00  0.85
ATOM   2010  NE2 HIS A 242      -7.798 -32.918  19.657  1.00  0.85
ATOM   2011  H   HIS A 242     -11.880 -33.692  19.684  1.00 99.99
ATOM   2012  HD1 HIS A 242      -7.984 -36.016  19.396  1.00 99.99
ATOM   2013  N   SER A 243     -13.611 -36.133  20.345  1.00  0.86
ATOM   2014  CA  SER A 243     -14.760 -36.963  20.770  1.00  0.86
ATOM   2015  C   SER A 243     -15.245 -37.917  19.665  1.00  0.86
ATOM   2016  O   SER A 243     -15.974 -38.867  19.947  1.00  0.86
ATOM   2017  CB  SER A 243     -15.935 -36.136  21.310  1.00  0.86
ATOM   2018  OG  SER A 243     -16.647 -35.435  20.283  1.00  0.86
ATOM   2019  H   SER A 243     -13.867 -35.209  20.035  1.00 99.99
ATOM   2020  HG  SER A 243     -17.450 -34.996  20.696  1.00 99.99
ATOM   2021  N   LEU A 244     -14.774 -37.704  18.436  1.00  0.91
ATOM   2022  CA  LEU A 244     -15.189 -38.494  17.260  1.00  0.91
ATOM   2023  C   LEU A 244     -14.378 -39.786  17.043  1.00  0.91
ATOM   2024  O   LEU A 244     -14.695 -40.564  16.137  1.00  0.91
ATOM   2025  CB  LEU A 244     -15.139 -37.621  15.998  1.00  0.91
ATOM   2026  CG  LEU A 244     -16.001 -36.348  16.043  1.00  0.91
ATOM   2027  CD1 LEU A 244     -15.813 -35.584  14.734  1.00  0.91
ATOM   2028  CD2 LEU A 244     -17.491 -36.634  16.258  1.00  0.91
ATOM   2029  H   LEU A 244     -14.077 -37.016  18.243  1.00 99.99
ATOM   2030  N   TYR A 245     -13.350 -40.021  17.856  1.00  0.91
ATOM   2031  CA  TYR A 245     -12.523 -41.237  17.730  1.00  0.91
ATOM   2032  C   TYR A 245     -12.086 -41.819  19.081  1.00  0.91
ATOM   2033  O   TYR A 245     -12.206 -41.167  20.118  1.00  0.91
ATOM   2034  CB  TYR A 245     -11.316 -40.981  16.814  1.00  0.91
ATOM   2035  CG  TYR A 245     -10.202 -40.111  17.403  1.00  0.91
ATOM   2036  CD1 TYR A 245     -10.214 -38.735  17.223  1.00  0.91
ATOM   2037  CD2 TYR A 245      -9.094 -40.722  17.975  1.00  0.91
ATOM   2038  CE1 TYR A 245      -9.114 -37.971  17.587  1.00  0.91
ATOM   2039  CE2 TYR A 245      -7.995 -39.962  18.355  1.00  0.91
ATOM   2040  CZ  TYR A 245      -7.999 -38.588  18.156  1.00  0.91
ATOM   2041  OH  TYR A 245      -6.903 -37.861  18.503  1.00  0.91
ATOM   2042  H   TYR A 245     -13.148 -39.469  18.669  1.00 99.99
ATOM   2043  HD1 TYR A 245     -11.106 -38.259  16.817  1.00 99.99
ATOM   2044  HD2 TYR A 245      -9.090 -41.803  18.111  1.00 99.99
ATOM   2045  HE1 TYR A 245      -9.144 -36.897  17.415  1.00 99.99
ATOM   2046  HE2 TYR A 245      -7.164 -40.448  18.872  1.00 99.99
ATOM   2047  HH  TYR A 245      -6.977 -36.924  18.179  1.00 99.99
ATOM   2048  N   THR A 246     -11.658 -43.074  19.035  1.00  0.91
ATOM   2049  CA  THR A 246     -11.051 -43.771  20.188  1.00  0.91
ATOM   2050  C   THR A 246      -9.639 -44.248  19.813  1.00  0.91
ATOM   2051  O   THR A 246      -9.317 -44.410  18.630  1.00  0.91
ATOM   2052  CB  THR A 246     -11.917 -44.942  20.687  1.00  0.91
ATOM   2053  OG1 THR A 246     -12.068 -45.936  19.671  1.00  0.91
ATOM   2054  CG2 THR A 246     -13.284 -44.468  21.194  1.00  0.91
ATOM   2055  H   THR A 246     -11.694 -43.619  18.190  1.00 99.99
ATOM   2056  HG1 THR A 246     -12.653 -46.673  20.019  1.00 99.99
ATOM   2057  N   GLY A 247      -8.784 -44.389  20.834  1.00  0.95
ATOM   2058  CA  GLY A 247      -7.358 -44.730  20.637  1.00  0.95
ATOM   2059  C   GLY A 247      -6.549 -43.538  20.099  1.00  0.95
ATOM   2060  O   GLY A 247      -6.755 -42.401  20.522  1.00  0.95
ATOM   2061  H   GLY A 247      -9.045 -44.267  21.799  1.00 99.99
ATOM   2062  N   SER A 248      -5.602 -43.828  19.211  1.00  0.93
ATOM   2063  CA  SER A 248      -4.704 -42.799  18.640  1.00  0.93
ATOM   2064  C   SER A 248      -4.865 -42.682  17.119  1.00  0.93
ATOM   2065  O   SER A 248      -5.229 -43.655  16.453  1.00  0.93
ATOM   2066  CB  SER A 248      -3.243 -43.149  18.950  1.00  0.93
ATOM   2067  OG  SER A 248      -2.410 -42.020  18.671  1.00  0.93
ATOM   2068  H   SER A 248      -5.505 -44.741  18.816  1.00 99.99
ATOM   2069  HG  SER A 248      -1.449 -42.253  18.829  1.00 99.99
ATOM   2070  N   LEU A 249      -4.645 -41.474  16.608  1.00  0.94
ATOM   2071  CA  LEU A 249      -4.512 -41.228  15.158  1.00  0.94
ATOM   2072  C   LEU A 249      -3.163 -41.749  14.639  1.00  0.94
ATOM   2073  O   LEU A 249      -2.106 -41.446  15.195  1.00  0.94
ATOM   2074  CB  LEU A 249      -4.616 -39.726  14.862  1.00  0.94
ATOM   2075  CG  LEU A 249      -6.049 -39.185  14.893  1.00  0.94
ATOM   2076  CD1 LEU A 249      -6.022 -37.671  15.106  1.00  0.94
ATOM   2077  CD2 LEU A 249      -6.752 -39.480  13.566  1.00  0.94
ATOM   2078  H   LEU A 249      -4.456 -40.686  17.195  1.00 99.99
ATOM   2079  N   TRP A 250      -3.229 -42.495  13.546  1.00  0.93
ATOM   2080  CA  TRP A 250      -2.042 -42.982  12.819  1.00  0.93
ATOM   2081  C   TRP A 250      -2.065 -42.384  11.409  1.00  0.93
ATOM   2082  O   TRP A 250      -3.089 -42.452  10.725  1.00  0.93
ATOM   2083  CB  TRP A 250      -2.068 -44.511  12.744  1.00  0.93
ATOM   2084  CG  TRP A 250      -1.735 -45.176  14.085  1.00  0.93
ATOM   2085  CD1 TRP A 250      -2.590 -45.491  15.058  1.00  0.93
ATOM   2086  CD2 TRP A 250      -0.478 -45.553  14.498  1.00  0.93
ATOM   2087  NE1 TRP A 250      -1.917 -46.061  16.062  1.00  0.93
ATOM   2088  CE2 TRP A 250      -0.626 -46.119  15.757  1.00  0.93
ATOM   2089  CE3 TRP A 250       0.780 -45.429  13.914  1.00  0.93
ATOM   2090  CZ2 TRP A 250       0.505 -46.573  16.431  1.00  0.93
ATOM   2091  CZ3 TRP A 250       1.898 -45.881  14.583  1.00  0.93
ATOM   2092  CH2 TRP A 250       1.760 -46.442  15.859  1.00  0.93
ATOM   2093  H   TRP A 250      -4.111 -42.791  13.162  1.00 99.99
ATOM   2094  HD1 TRP A 250      -3.657 -45.281  15.050  1.00 99.99
ATOM   2095  HE1 TRP A 250      -2.338 -46.395  16.909  1.00 99.99
ATOM   2096  HE3 TRP A 250       0.892 -44.844  13.000  1.00 99.99
ATOM   2097  HZ2 TRP A 250       0.397 -47.159  17.347  1.00 99.99
ATOM   2098  HZ3 TRP A 250       2.875 -45.826  14.105  1.00 99.99
ATOM   2099  HH2 TRP A 250       2.644 -46.717  16.428  1.00 99.99
ATOM   2100  N   TYR A 251      -0.945 -41.806  10.996  1.00  0.94
ATOM   2101  CA  TYR A 251      -0.882 -41.040   9.735  1.00  0.94
ATOM   2102  C   TYR A 251      -0.110 -41.781   8.636  1.00  0.94
ATOM   2103  O   TYR A 251       0.954 -42.352   8.887  1.00  0.94
ATOM   2104  CB  TYR A 251      -0.224 -39.674   9.976  1.00  0.94
ATOM   2105  CG  TYR A 251      -1.011 -38.749  10.911  1.00  0.94
ATOM   2106  CD1 TYR A 251      -1.951 -37.875  10.386  1.00  0.94
ATOM   2107  CD2 TYR A 251      -0.758 -38.748  12.276  1.00  0.94
ATOM   2108  CE1 TYR A 251      -2.645 -37.005  11.221  1.00  0.94
ATOM   2109  CE2 TYR A 251      -1.451 -37.882  13.117  1.00  0.94
ATOM   2110  CZ  TYR A 251      -2.393 -37.007  12.587  1.00  0.94
ATOM   2111  OH  TYR A 251      -3.095 -36.167  13.397  1.00  0.94
ATOM   2112  H   TYR A 251      -0.081 -41.887  11.492  1.00 99.99
ATOM   2113  HD1 TYR A 251      -2.137 -37.877   9.314  1.00 99.99
ATOM   2114  HD2 TYR A 251       0.016 -39.400  12.678  1.00 99.99
ATOM   2115  HE1 TYR A 251      -3.407 -36.348  10.803  1.00 99.99
ATOM   2116  HE2 TYR A 251      -1.268 -37.927  14.191  1.00 99.99
ATOM   2117  HH  TYR A 251      -2.775 -36.273  14.338  1.00 99.99
ATOM   2118  N   THR A 252      -0.679 -41.736   7.438  1.00  0.94
ATOM   2119  CA  THR A 252      -0.039 -42.199   6.185  1.00  0.94
ATOM   2120  C   THR A 252       0.272 -40.956   5.331  1.00  0.94
ATOM   2121  O   THR A 252      -0.538 -40.022   5.345  1.00  0.94
ATOM   2122  CB  THR A 252      -0.937 -43.193   5.413  1.00  0.94
ATOM   2123  OG1 THR A 252      -0.275 -43.649   4.230  1.00  0.94
ATOM   2124  CG2 THR A 252      -2.311 -42.633   5.028  1.00  0.94
ATOM   2125  H   THR A 252      -1.589 -41.322   7.316  1.00 99.99
ATOM   2126  HG1 THR A 252      -0.857 -44.319   3.776  1.00 99.99
ATOM   2127  N   PRO A 253       1.425 -40.882   4.657  1.00  0.94
ATOM   2128  CA  PRO A 253       1.772 -39.696   3.851  1.00  0.94
ATOM   2129  C   PRO A 253       0.867 -39.605   2.615  1.00  0.94
ATOM   2130  O   PRO A 253       0.574 -40.619   1.975  1.00  0.94
ATOM   2131  CB  PRO A 253       3.221 -39.923   3.414  1.00  0.94
ATOM   2132  CG  PRO A 253       3.766 -40.940   4.418  1.00  0.94
ATOM   2133  CD  PRO A 253       2.558 -41.824   4.726  1.00  0.94
ATOM   2134  N   ILE A 254       0.377 -38.403   2.321  1.00  0.92
ATOM   2135  CA  ILE A 254      -0.166 -38.097   0.978  1.00  0.92
ATOM   2136  C   ILE A 254       1.041 -38.112   0.032  1.00  0.92
ATOM   2137  O   ILE A 254       1.969 -37.319   0.169  1.00  0.92
ATOM   2138  CB  ILE A 254      -0.909 -36.748   0.907  1.00  0.92
ATOM   2139  CG1 ILE A 254      -2.144 -36.795   1.815  1.00  0.92
ATOM   2140  CG2 ILE A 254      -1.322 -36.406  -0.538  1.00  0.92
ATOM   2141  CD  ILE A 254      -2.760 -35.423   2.117  1.00  0.92
ATOM   2142  H   ILE A 254       0.478 -37.613   2.938  1.00 99.99
ATOM   2143  N   ARG A 255       1.009 -39.067  -0.883  1.00  0.85
ATOM   2144  CA  ARG A 255       2.123 -39.290  -1.819  1.00  0.85
ATOM   2145  C   ARG A 255       2.323 -38.116  -2.798  1.00  0.85
ATOM   2146  O   ARG A 255       3.434 -37.633  -3.003  1.00  0.85
ATOM   2147  CB  ARG A 255       1.824 -40.583  -2.570  1.00  0.85
ATOM   2148  CG  ARG A 255       3.056 -41.077  -3.317  1.00  0.85
ATOM   2149  CD  ARG A 255       2.579 -42.053  -4.378  1.00  0.85
ATOM   2150  NE  ARG A 255       3.732 -42.676  -5.033  1.00  0.85
ATOM   2151  CZ  ARG A 255       3.676 -43.393  -6.149  1.00  0.85
ATOM   2152  NH1 ARG A 255       2.527 -43.651  -6.762  1.00  0.85
ATOM   2153  NH2 ARG A 255       4.795 -43.858  -6.672  1.00  0.85
ATOM   2154  H   ARG A 255       0.239 -39.712  -0.938  1.00 99.99
ATOM   2155  HE  ARG A 255       4.583 -42.677  -4.515  1.00 99.99
ATOM   2156 1HH1 ARG A 255       2.526 -44.187  -7.605  1.00 99.99
ATOM   2157 2HH1 ARG A 255       1.667 -43.300  -6.389  1.00 99.99
ATOM   2158 1HH2 ARG A 255       4.714 -44.405  -7.511  1.00 99.99
ATOM   2159 2HH2 ARG A 255       5.686 -43.691  -6.261  1.00 99.99
ATOM   2160  N   ARG A 256       1.213 -37.685  -3.388  1.00  0.85
ATOM   2161  CA  ARG A 256       1.150 -36.635  -4.416  1.00  0.85
ATOM   2162  C   ARG A 256      -0.179 -35.903  -4.201  1.00  0.85
ATOM   2163  O   ARG A 256      -1.189 -36.523  -3.855  1.00  0.85
ATOM   2164  CB  ARG A 256       1.187 -37.337  -5.779  1.00  0.85
ATOM   2165  CG  ARG A 256       1.121 -36.405  -6.991  1.00  0.85
ATOM   2166  CD  ARG A 256       1.061 -37.269  -8.248  1.00  0.85
ATOM   2167  NE  ARG A 256       0.768 -36.466  -9.447  1.00  0.85
ATOM   2168  CZ  ARG A 256       0.507 -36.961 -10.659  1.00  0.85
ATOM   2169  NH1 ARG A 256       0.398 -38.265 -10.872  1.00  0.85
ATOM   2170  NH2 ARG A 256       0.403 -36.154 -11.701  1.00  0.85
ATOM   2171  H   ARG A 256       0.314 -38.009  -3.098  1.00 99.99
ATOM   2172  HE  ARG A 256       0.625 -35.487  -9.299  1.00 99.99
ATOM   2173 1HH1 ARG A 256       0.196 -38.613 -11.783  1.00 99.99
ATOM   2174 2HH1 ARG A 256       0.501 -38.883 -10.097  1.00 99.99
ATOM   2175 1HH2 ARG A 256       0.189 -36.520 -12.604  1.00 99.99
ATOM   2176 2HH2 ARG A 256       0.475 -35.168 -11.560  1.00 99.99
ATOM   2177  N   GLU A 257      -0.159 -34.598  -4.434  1.00  0.90
ATOM   2178  CA  GLU A 257      -1.332 -33.738  -4.204  1.00  0.90
ATOM   2179  C   GLU A 257      -2.149 -33.571  -5.500  1.00  0.90
ATOM   2180  O   GLU A 257      -1.989 -32.606  -6.251  1.00  0.90
ATOM   2181  CB  GLU A 257      -0.849 -32.396  -3.634  1.00  0.90
ATOM   2182  CG  GLU A 257      -0.198 -32.542  -2.250  1.00  0.90
ATOM   2183  CD  GLU A 257       1.191 -31.895  -2.186  1.00  0.90
ATOM   2184  OE1 GLU A 257       2.031 -32.252  -3.046  1.00  0.90
ATOM   2185  OE2 GLU A 257       1.394 -31.061  -1.278  1.00  0.90
ATOM   2186  H   GLU A 257       0.662 -34.126  -4.758  1.00 99.99
ATOM   2187  N   TRP A 258      -2.972 -34.577  -5.776  1.00  0.92
ATOM   2188  CA  TRP A 258      -3.877 -34.590  -6.943  1.00  0.92
ATOM   2189  C   TRP A 258      -5.247 -35.092  -6.461  1.00  0.92
ATOM   2190  O   TRP A 258      -6.058 -34.299  -5.978  1.00  0.92
ATOM   2191  CB  TRP A 258      -3.248 -35.339  -8.135  1.00  0.92
ATOM   2192  CG  TRP A 258      -2.887 -36.831  -8.009  1.00  0.92
ATOM   2193  CD1 TRP A 258      -2.401 -37.483  -6.953  1.00  0.92
ATOM   2194  CD2 TRP A 258      -2.937 -37.733  -9.051  1.00  0.92
ATOM   2195  NE1 TRP A 258      -2.168 -38.754  -7.291  1.00  0.92
ATOM   2196  CE2 TRP A 258      -2.494 -38.953  -8.558  1.00  0.92
ATOM   2197  CE3 TRP A 258      -3.356 -37.629 -10.375  1.00  0.92
ATOM   2198  CZ2 TRP A 258      -2.501 -40.076  -9.383  1.00  0.92
ATOM   2199  CZ3 TRP A 258      -3.365 -38.740 -11.192  1.00  0.92
ATOM   2200  CH2 TRP A 258      -2.929 -39.974 -10.696  1.00  0.92
ATOM   2201  H   TRP A 258      -3.091 -35.352  -5.148  1.00 99.99
ATOM   2202  HD1 TRP A 258      -2.162 -37.045  -5.990  1.00 99.99
ATOM   2203  HE1 TRP A 258      -1.724 -39.430  -6.693  1.00 99.99
ATOM   2204  HE3 TRP A 258      -3.522 -36.643 -10.810  1.00 99.99
ATOM   2205  HZ2 TRP A 258      -2.277 -41.063  -8.972  1.00 99.99
ATOM   2206  HZ3 TRP A 258      -3.722 -38.651 -12.217  1.00 99.99
ATOM   2207  HH2 TRP A 258      -2.908 -40.849 -11.345  1.00 99.99
ATOM   2208  N   TYR A 259      -5.406 -36.409  -6.450  1.00  0.96
ATOM   2209  CA  TYR A 259      -6.297 -37.104  -5.501  1.00  0.96
ATOM   2210  C   TYR A 259      -5.591 -37.156  -4.134  1.00  0.96
ATOM   2211  O   TYR A 259      -4.403 -36.833  -4.024  1.00  0.96
ATOM   2212  CB  TYR A 259      -6.504 -38.551  -5.954  1.00  0.96
ATOM   2213  CG  TYR A 259      -7.149 -38.681  -7.331  1.00  0.96
ATOM   2214  CD1 TYR A 259      -8.530 -38.694  -7.449  1.00  0.96
ATOM   2215  CD2 TYR A 259      -6.350 -38.798  -8.459  1.00  0.96
ATOM   2216  CE1 TYR A 259      -9.116 -38.807  -8.700  1.00  0.96
ATOM   2217  CE2 TYR A 259      -6.932 -38.912  -9.714  1.00  0.96
ATOM   2218  CZ  TYR A 259      -8.316 -38.910  -9.838  1.00  0.96
ATOM   2219  OH  TYR A 259      -8.892 -38.971 -11.068  1.00  0.96
ATOM   2220  H   TYR A 259      -4.912 -37.001  -7.090  1.00 99.99
ATOM   2221  HD1 TYR A 259      -9.150 -38.608  -6.557  1.00 99.99
ATOM   2222  HD2 TYR A 259      -5.269 -38.837  -8.348  1.00 99.99
ATOM   2223  HE1 TYR A 259     -10.204 -38.808  -8.776  1.00 99.99
ATOM   2224  HE2 TYR A 259      -6.289 -39.041 -10.586  1.00 99.99
ATOM   2225  HH  TYR A 259      -8.182 -39.039 -11.769  1.00 99.99
ATOM   2226  N   TYR A 260      -6.320 -37.565  -3.102  1.00  0.96
ATOM   2227  CA  TYR A 260      -5.688 -37.977  -1.831  1.00  0.96
ATOM   2228  C   TYR A 260      -5.051 -39.373  -1.964  1.00  0.96
ATOM   2229  O   TYR A 260      -5.642 -40.385  -1.569  1.00  0.96
ATOM   2230  CB  TYR A 260      -6.710 -37.931  -0.688  1.00  0.96
ATOM   2231  CG  TYR A 260      -7.045 -36.494  -0.303  1.00  0.96
ATOM   2232  CD1 TYR A 260      -6.123 -35.740   0.407  1.00  0.96
ATOM   2233  CD2 TYR A 260      -8.246 -35.928  -0.701  1.00  0.96
ATOM   2234  CE1 TYR A 260      -6.388 -34.411   0.698  1.00  0.96
ATOM   2235  CE2 TYR A 260      -8.520 -34.598  -0.411  1.00  0.96
ATOM   2236  CZ  TYR A 260      -7.586 -33.834   0.277  1.00  0.96
ATOM   2237  OH  TYR A 260      -7.824 -32.520   0.518  1.00  0.96
ATOM   2238  H   TYR A 260      -7.322 -37.568  -3.113  1.00 99.99
ATOM   2239  HD1 TYR A 260      -5.196 -36.209   0.734  1.00 99.99
ATOM   2240  HD2 TYR A 260      -8.973 -36.546  -1.222  1.00 99.99
ATOM   2241  HE1 TYR A 260      -5.663 -33.830   1.267  1.00 99.99
ATOM   2242  HE2 TYR A 260      -9.483 -34.176  -0.700  1.00 99.99
ATOM   2243  HH  TYR A 260      -8.678 -32.227   0.053  1.00 99.99
ATOM   2244  N   GLU A 261      -3.882 -39.412  -2.596  1.00  0.94
ATOM   2245  CA  GLU A 261      -3.166 -40.673  -2.881  1.00  0.94
ATOM   2246  C   GLU A 261      -2.326 -41.119  -1.674  1.00  0.94
ATOM   2247  O   GLU A 261      -1.543 -40.342  -1.126  1.00  0.94
ATOM   2248  CB  GLU A 261      -2.277 -40.483  -4.113  1.00  0.94
ATOM   2249  CG  GLU A 261      -1.688 -41.805  -4.628  1.00  0.94
ATOM   2250  CD  GLU A 261      -0.590 -41.639  -5.685  1.00  0.94
ATOM   2251  OE1 GLU A 261      -0.296 -40.486  -6.073  1.00  0.94
ATOM   2252  OE2 GLU A 261      -0.080 -42.697  -6.102  1.00  0.94
ATOM   2253  H   GLU A 261      -3.420 -38.578  -2.914  1.00 99.99
ATOM   2254  N   VAL A 262      -2.457 -42.400  -1.361  1.00  0.97
ATOM   2255  CA  VAL A 262      -1.737 -43.089  -0.269  1.00  0.97
ATOM   2256  C   VAL A 262      -1.057 -44.357  -0.819  1.00  0.97
ATOM   2257  O   VAL A 262      -1.300 -44.734  -1.969  1.00  0.97
ATOM   2258  CB  VAL A 262      -2.692 -43.417   0.902  1.00  0.97
ATOM   2259  CG1 VAL A 262      -3.261 -42.134   1.514  1.00  0.97
ATOM   2260  CG2 VAL A 262      -3.835 -44.368   0.517  1.00  0.97
ATOM   2261  H   VAL A 262      -3.044 -43.010  -1.907  1.00 99.99
ATOM   2262  N   ILE A 263      -0.243 -45.012   0.005  1.00  0.93
ATOM   2263  CA  ILE A 263       0.397 -46.289  -0.375  1.00  0.93
ATOM   2264  C   ILE A 263      -0.007 -47.398   0.614  1.00  0.93
ATOM   2265  O   ILE A 263       0.244 -47.294   1.820  1.00  0.93
ATOM   2266  CB  ILE A 263       1.928 -46.105  -0.510  1.00  0.93
ATOM   2267  CG1 ILE A 263       2.247 -45.163  -1.686  1.00  0.93
ATOM   2268  CG2 ILE A 263       2.653 -47.450  -0.686  1.00  0.93
ATOM   2269  CD  ILE A 263       3.703 -44.684  -1.766  1.00  0.93
ATOM   2270  H   ILE A 263      -0.025 -44.683   0.923  1.00 99.99
ATOM   2271  N   ILE A 264      -0.604 -48.447   0.058  1.00  0.95
ATOM   2272  CA  ILE A 264      -0.931 -49.694   0.781  1.00  0.95
ATOM   2273  C   ILE A 264       0.276 -50.631   0.614  1.00  0.95
ATOM   2274  O   ILE A 264       0.690 -50.947  -0.501  1.00  0.95
ATOM   2275  CB  ILE A 264      -2.216 -50.344   0.224  1.00  0.95
ATOM   2276  CG1 ILE A 264      -3.400 -49.366   0.322  1.00  0.95
ATOM   2277  CG2 ILE A 264      -2.522 -51.663   0.958  1.00  0.95
ATOM   2278  CD  ILE A 264      -4.677 -49.831  -0.386  1.00  0.95
ATOM   2279  H   ILE A 264      -0.841 -48.460  -0.926  1.00 99.99
ATOM   2280  N   VAL A 265       0.752 -51.148   1.734  1.00  0.93
ATOM   2281  CA  VAL A 265       1.993 -51.951   1.751  1.00  0.93
ATOM   2282  C   VAL A 265       1.795 -53.461   1.978  1.00  0.93
ATOM   2283  O   VAL A 265       2.689 -54.252   1.677  1.00  0.93
ATOM   2284  CB  VAL A 265       3.034 -51.346   2.714  1.00  0.93
ATOM   2285  CG1 VAL A 265       3.405 -49.922   2.285  1.00  0.93
ATOM   2286  CG2 VAL A 265       2.579 -51.349   4.177  1.00  0.93
ATOM   2287  H   VAL A 265       0.351 -50.929   2.630  1.00 99.99
ATOM   2288  N   ARG A 266       0.630 -53.846   2.496  1.00  0.86
ATOM   2289  CA  ARG A 266       0.292 -55.244   2.835  1.00  0.86
ATOM   2290  C   ARG A 266      -1.228 -55.336   3.040  1.00  0.86
ATOM   2291  O   ARG A 266      -1.858 -54.365   3.463  1.00  0.86
ATOM   2292  CB  ARG A 266       1.051 -55.598   4.123  1.00  0.86
ATOM   2293  CG  ARG A 266       0.884 -57.030   4.630  1.00  0.86
ATOM   2294  CD  ARG A 266       1.676 -57.177   5.928  1.00  0.86
ATOM   2295  NE  ARG A 266       1.394 -58.482   6.544  1.00  0.86
ATOM   2296  CZ  ARG A 266       2.216 -59.529   6.631  1.00  0.86
ATOM   2297  NH1 ARG A 266       3.404 -59.536   6.046  1.00  0.86
ATOM   2298  NH2 ARG A 266       1.886 -60.565   7.386  1.00  0.86
ATOM   2299  H   ARG A 266      -0.102 -53.192   2.697  1.00 99.99
ATOM   2300  HE  ARG A 266       0.494 -58.571   6.967  1.00 99.99
ATOM   2301 1HH1 ARG A 266       4.002 -60.329   6.136  1.00 99.99
ATOM   2302 2HH1 ARG A 266       3.665 -58.765   5.470  1.00 99.99
ATOM   2303 1HH2 ARG A 266       2.507 -61.340   7.486  1.00 99.99
ATOM   2304 2HH2 ARG A 266       1.027 -60.541   7.902  1.00 99.99
ATOM   2305  N   VAL A 267      -1.805 -56.467   2.644  1.00  0.94
ATOM   2306  CA  VAL A 267      -3.252 -56.726   2.796  1.00  0.94
ATOM   2307  C   VAL A 267      -3.414 -58.112   3.434  1.00  0.94
ATOM   2308  O   VAL A 267      -2.807 -59.088   2.980  1.00  0.94
ATOM   2309  CB  VAL A 267      -3.989 -56.652   1.440  1.00  0.94
ATOM   2310  CG1 VAL A 267      -5.490 -56.931   1.585  1.00  0.94
ATOM   2311  CG2 VAL A 267      -3.841 -55.275   0.785  1.00  0.94
ATOM   2312  H   VAL A 267      -1.283 -57.248   2.301  1.00 99.99
ATOM   2313  N   GLU A 268      -4.195 -58.153   4.505  1.00  0.91
ATOM   2314  CA  GLU A 268      -4.500 -59.413   5.208  1.00  0.91
ATOM   2315  C   GLU A 268      -6.011 -59.645   5.297  1.00  0.91
ATOM   2316  O   GLU A 268      -6.779 -58.709   5.524  1.00  0.91
ATOM   2317  CB  GLU A 268      -3.919 -59.402   6.624  1.00  0.91
ATOM   2318  CG  GLU A 268      -2.387 -59.413   6.668  1.00  0.91
ATOM   2319  CD  GLU A 268      -1.834 -59.367   8.099  1.00  0.91
ATOM   2320  OE1 GLU A 268      -2.585 -59.025   9.039  1.00  0.91
ATOM   2321  OE2 GLU A 268      -0.613 -59.556   8.222  1.00  0.91
ATOM   2322  H   GLU A 268      -4.687 -57.337   4.838  1.00 99.99
ATOM   2323  N   ILE A 269      -6.392 -60.910   5.178  1.00  0.91
ATOM   2324  CA  ILE A 269      -7.789 -61.360   5.356  1.00  0.91
ATOM   2325  C   ILE A 269      -7.779 -62.306   6.567  1.00  0.91
ATOM   2326  O   ILE A 269      -7.041 -63.293   6.554  1.00  0.91
ATOM   2327  CB  ILE A 269      -8.287 -62.091   4.089  1.00  0.91
ATOM   2328  CG1 ILE A 269      -8.134 -61.273   2.791  1.00  0.91
ATOM   2329  CG2 ILE A 269      -9.720 -62.615   4.259  1.00  0.91
ATOM   2330  CD  ILE A 269      -8.906 -59.948   2.706  1.00  0.91
ATOM   2331  H   ILE A 269      -5.739 -61.638   4.933  1.00 99.99
ATOM   2332  N   ASN A 270      -8.406 -61.877   7.660  1.00  0.90
ATOM   2333  CA  ASN A 270      -8.389 -62.590   8.964  1.00  0.90
ATOM   2334  C   ASN A 270      -6.965 -62.830   9.510  1.00  0.90
ATOM   2335  O   ASN A 270      -6.648 -63.888  10.060  1.00  0.90
ATOM   2336  CB  ASN A 270      -9.197 -63.898   8.869  1.00  0.90
ATOM   2337  CG  ASN A 270     -10.512 -63.865   9.655  1.00  0.90
ATOM   2338  OD1 ASN A 270     -11.004 -62.829  10.089  1.00  0.90
ATOM   2339  ND2 ASN A 270     -11.122 -65.021   9.813  1.00  0.90
ATOM   2340  H   ASN A 270      -9.020 -61.076   7.628  1.00 99.99
ATOM   2341 1HD2 ASN A 270     -11.981 -65.037  10.320  1.00 99.99
ATOM   2342 2HD2 ASN A 270     -10.739 -65.858   9.429  1.00 99.99
ATOM   2343  N   GLY A 271      -6.090 -61.836   9.296  1.00  0.92
ATOM   2344  CA  GLY A 271      -4.662 -61.918   9.671  1.00  0.92
ATOM   2345  C   GLY A 271      -3.812 -62.822   8.759  1.00  0.92
ATOM   2346  O   GLY A 271      -2.616 -62.977   9.006  1.00  0.92
ATOM   2347  H   GLY A 271      -6.337 -60.955   8.878  1.00 99.99
ATOM   2348  N   GLN A 272      -4.360 -63.225   7.614  1.00  0.85
ATOM   2349  CA  GLN A 272      -3.625 -64.029   6.620  1.00  0.85
ATOM   2350  C   GLN A 272      -3.252 -63.157   5.417  1.00  0.85
ATOM   2351  O   GLN A 272      -4.117 -62.596   4.738  1.00  0.85
ATOM   2352  CB  GLN A 272      -4.480 -65.212   6.156  1.00  0.85
ATOM   2353  CG  GLN A 272      -3.718 -66.546   6.181  1.00  0.85
ATOM   2354  CD  GLN A 272      -3.365 -67.086   7.578  1.00  0.85
ATOM   2355  OE1 GLN A 272      -2.470 -67.902   7.740  1.00  0.85
ATOM   2356  NE2 GLN A 272      -4.091 -66.694   8.607  1.00  0.85
ATOM   2357  H   GLN A 272      -5.338 -63.111   7.410  1.00 99.99
ATOM   2358 1HE2 GLN A 272      -3.860 -67.066   9.502  1.00 99.99
ATOM   2359 2HE2 GLN A 272      -4.832 -66.040   8.487  1.00 99.99
ATOM   2360  N   ASP A 273      -1.953 -62.903   5.321  1.00  0.88
ATOM   2361  CA  ASP A 273      -1.322 -62.114   4.246  1.00  0.88
ATOM   2362  C   ASP A 273      -1.670 -62.689   2.857  1.00  0.88
ATOM   2363  O   ASP A 273      -1.539 -63.890   2.634  1.00  0.88
ATOM   2364  CB  ASP A 273       0.186 -62.192   4.526  1.00  0.88
ATOM   2365  CG  ASP A 273       1.112 -61.315   3.674  1.00  0.88
ATOM   2366  OD1 ASP A 273       0.605 -60.648   2.740  1.00  0.88
ATOM   2367  OD2 ASP A 273       2.332 -61.411   3.909  1.00  0.88
ATOM   2368  H   ASP A 273      -1.311 -63.286   5.987  1.00 99.99
ATOM   2369  N   LEU A 274      -2.062 -61.803   1.944  1.00  0.88
ATOM   2370  CA  LEU A 274      -2.311 -62.167   0.532  1.00  0.88
ATOM   2371  C   LEU A 274      -1.026 -62.516  -0.244  1.00  0.88
ATOM   2372  O   LEU A 274      -1.099 -63.118  -1.316  1.00  0.88
ATOM   2373  CB  LEU A 274      -3.117 -61.084  -0.202  1.00  0.88
ATOM   2374  CG  LEU A 274      -4.577 -60.915   0.253  1.00  0.88
ATOM   2375  CD1 LEU A 274      -5.250 -59.828  -0.586  1.00  0.88
ATOM   2376  CD2 LEU A 274      -5.394 -62.204   0.116  1.00  0.88
ATOM   2377  H   LEU A 274      -2.213 -60.836   2.164  1.00 99.99
ATOM   2378  N   LYS A 275       0.117 -62.023   0.237  1.00  0.81
ATOM   2379  CA  LYS A 275       1.477 -62.346  -0.262  1.00  0.81
ATOM   2380  C   LYS A 275       1.735 -61.962  -1.734  1.00  0.81
ATOM   2381  O   LYS A 275       2.588 -62.540  -2.412  1.00  0.81
ATOM   2382  CB  LYS A 275       1.815 -63.831  -0.033  1.00  0.81
ATOM   2383  CG  LYS A 275       1.745 -64.267   1.431  1.00  0.81
ATOM   2384  CD  LYS A 275       1.955 -65.780   1.540  1.00  0.81
ATOM   2385  CE  LYS A 275       1.237 -66.372   2.758  1.00  0.81
ATOM   2386  NZ  LYS A 275       1.743 -65.827   4.025  1.00  0.81
ATOM   2387  H   LYS A 275       0.122 -61.404   1.025  1.00 99.99
ATOM   2388  HZ1 LYS A 275       1.236 -66.236   4.784  1.00 99.99
ATOM   2389  HZ2 LYS A 275       2.714 -66.049   4.110  1.00 99.99
ATOM   2390  HZ3 LYS A 275       1.621 -64.837   4.024  1.00 99.99
ATOM   2391  N   MET A 276       1.053 -60.922  -2.205  1.00  0.84
ATOM   2392  CA  MET A 276       1.310 -60.344  -3.537  1.00  0.84
ATOM   2393  C   MET A 276       2.440 -59.310  -3.470  1.00  0.84
ATOM   2394  O   MET A 276       2.774 -58.807  -2.394  1.00  0.84
ATOM   2395  CB  MET A 276       0.046 -59.668  -4.073  1.00  0.84
ATOM   2396  CG  MET A 276      -0.953 -60.687  -4.622  1.00  0.84
ATOM   2397  SD  MET A 276      -2.488 -59.898  -5.224  1.00  0.84
ATOM   2398  CE  MET A 276      -3.316 -59.754  -3.660  1.00  0.84
ATOM   2399  H   MET A 276       0.341 -60.460  -1.677  1.00 99.99
ATOM   2400  N   ASP A 277       3.004 -58.981  -4.631  1.00  0.85
ATOM   2401  CA  ASP A 277       3.865 -57.788  -4.759  1.00  0.85
ATOM   2402  C   ASP A 277       3.011 -56.574  -4.346  1.00  0.85
ATOM   2403  O   ASP A 277       1.865 -56.429  -4.780  1.00  0.85
ATOM   2404  CB  ASP A 277       4.361 -57.656  -6.208  1.00  0.85
ATOM   2405  CG  ASP A 277       5.418 -56.560  -6.412  1.00  0.85
ATOM   2406  OD1 ASP A 277       5.123 -55.405  -6.029  1.00  0.85
ATOM   2407  OD2 ASP A 277       6.498 -56.896  -6.935  1.00  0.85
ATOM   2408  H   ASP A 277       2.879 -59.531  -5.457  1.00 99.99
ATOM   2409  N   CYS A 278       3.593 -55.719  -3.515  1.00  0.88
ATOM   2410  CA  CYS A 278       2.863 -54.557  -2.979  1.00  0.88
ATOM   2411  C   CYS A 278       2.545 -53.452  -4.005  1.00  0.88
ATOM   2412  O   CYS A 278       1.645 -52.646  -3.763  1.00  0.88
ATOM   2413  CB  CYS A 278       3.517 -54.040  -1.698  1.00  0.88
ATOM   2414  SG  CYS A 278       5.200 -53.365  -1.912  1.00  0.88
ATOM   2415  H   CYS A 278       4.538 -55.817  -3.201  1.00 99.99
ATOM   2416  N   LYS A 279       3.160 -53.506  -5.186  1.00  0.85
ATOM   2417  CA  LYS A 279       2.744 -52.687  -6.347  1.00  0.85
ATOM   2418  C   LYS A 279       1.325 -53.001  -6.840  1.00  0.85
ATOM   2419  O   LYS A 279       0.565 -52.076  -7.128  1.00  0.85
ATOM   2420  CB  LYS A 279       3.698 -52.826  -7.533  1.00  0.85
ATOM   2421  CG  LYS A 279       4.875 -51.865  -7.401  1.00  0.85
ATOM   2422  CD  LYS A 279       5.810 -51.993  -8.604  1.00  0.85
ATOM   2423  CE  LYS A 279       7.095 -51.190  -8.400  1.00  0.85
ATOM   2424  NZ  LYS A 279       7.952 -51.794  -7.369  1.00  0.85
ATOM   2425  H   LYS A 279       3.981 -54.065  -5.346  1.00 99.99
ATOM   2426  HZ1 LYS A 279       8.764 -51.228  -7.230  1.00 99.99
ATOM   2427  HZ2 LYS A 279       7.434 -51.797  -6.505  1.00 99.99
ATOM   2428  HZ3 LYS A 279       8.211 -52.725  -7.619  1.00 99.99
ATOM   2429  N   GLU A 280       0.943 -54.280  -6.812  1.00  0.86
ATOM   2430  CA  GLU A 280      -0.404 -54.737  -7.222  1.00  0.86
ATOM   2431  C   GLU A 280      -1.520 -54.067  -6.394  1.00  0.86
ATOM   2432  O   GLU A 280      -2.559 -53.716  -6.958  1.00  0.86
ATOM   2433  CB  GLU A 280      -0.512 -56.268  -7.135  1.00  0.86
ATOM   2434  CG  GLU A 280       0.381 -57.025  -8.136  1.00  0.86
ATOM   2435  CD  GLU A 280      -0.175 -57.229  -9.557  1.00  0.86
ATOM   2436  OE1 GLU A 280      -1.230 -56.642  -9.890  1.00  0.86
ATOM   2437  OE2 GLU A 280       0.454 -58.033 -10.279  1.00  0.86
ATOM   2438  H   GLU A 280       1.540 -55.007  -6.468  1.00 99.99
ATOM   2439  N   TYR A 281      -1.252 -53.786  -5.119  1.00  0.92
ATOM   2440  CA  TYR A 281      -2.169 -53.050  -4.219  1.00  0.92
ATOM   2441  C   TYR A 281      -2.406 -51.586  -4.623  1.00  0.92
ATOM   2442  O   TYR A 281      -3.450 -51.028  -4.292  1.00  0.92
ATOM   2443  CB  TYR A 281      -1.642 -53.057  -2.779  1.00  0.92
ATOM   2444  CG  TYR A 281      -1.449 -54.449  -2.168  1.00  0.92
ATOM   2445  CD1 TYR A 281      -2.337 -55.485  -2.423  1.00  0.92
ATOM   2446  CD2 TYR A 281      -0.338 -54.684  -1.372  1.00  0.92
ATOM   2447  CE1 TYR A 281      -2.114 -56.748  -1.897  1.00  0.92
ATOM   2448  CE2 TYR A 281      -0.105 -55.950  -0.844  1.00  0.92
ATOM   2449  CZ  TYR A 281      -0.990 -56.990  -1.110  1.00  0.92
ATOM   2450  OH  TYR A 281      -0.767 -58.235  -0.600  1.00  0.92
ATOM   2451  H   TYR A 281      -0.397 -54.060  -4.673  1.00 99.99
ATOM   2452  HD1 TYR A 281      -3.235 -55.285  -3.004  1.00 99.99
ATOM   2453  HD2 TYR A 281       0.334 -53.855  -1.146  1.00 99.99
ATOM   2454  HE1 TYR A 281      -2.863 -57.521  -2.058  1.00 99.99
ATOM   2455  HE2 TYR A 281       0.767 -56.102  -0.206  1.00 99.99
ATOM   2456  HH  TYR A 281       0.108 -58.235  -0.114  1.00 99.99
ATOM   2457  N   ASN A 282      -1.446 -50.989  -5.323  1.00  0.93
ATOM   2458  CA  ASN A 282      -1.485 -49.556  -5.675  1.00  0.93
ATOM   2459  C   ASN A 282      -1.396 -49.326  -7.195  1.00  0.93
ATOM   2460  O   ASN A 282      -0.901 -48.287  -7.633  1.00  0.93
ATOM   2461  CB  ASN A 282      -0.333 -48.823  -4.966  1.00  0.93
ATOM   2462  CG  ASN A 282      -0.268 -49.081  -3.460  1.00  0.93
ATOM   2463  OD1 ASN A 282      -1.036 -48.583  -2.654  1.00  0.93
ATOM   2464  ND2 ASN A 282       0.678 -49.892  -3.060  1.00  0.93
ATOM   2465  H   ASN A 282      -0.652 -51.482  -5.686  1.00 99.99
ATOM   2466 1HD2 ASN A 282       0.733 -50.130  -2.085  1.00 99.99
ATOM   2467 2HD2 ASN A 282       1.361 -50.248  -3.702  1.00 99.99
ATOM   2468  N   TYR A 283      -1.902 -50.260  -7.993  1.00  0.89
ATOM   2469  CA  TYR A 283      -1.854 -50.185  -9.468  1.00  0.89
ATOM   2470  C   TYR A 283      -3.183 -49.630 -10.021  1.00  0.89
ATOM   2471  O   TYR A 283      -4.210 -50.302  -9.918  1.00  0.89
ATOM   2472  CB  TYR A 283      -1.584 -51.608  -9.984  1.00  0.89
ATOM   2473  CG  TYR A 283      -1.533 -51.745 -11.510  1.00  0.89
ATOM   2474  CD1 TYR A 283      -0.830 -50.827 -12.278  1.00  0.89
ATOM   2475  CD2 TYR A 283      -2.236 -52.766 -12.139  1.00  0.89
ATOM   2476  CE1 TYR A 283      -0.833 -50.916 -13.661  1.00  0.89
ATOM   2477  CE2 TYR A 283      -2.239 -52.865 -13.528  1.00  0.89
ATOM   2478  CZ  TYR A 283      -1.542 -51.936 -14.291  1.00  0.89
ATOM   2479  OH  TYR A 283      -1.551 -52.007 -15.649  1.00  0.89
ATOM   2480  H   TYR A 283      -2.289 -51.114  -7.637  1.00 99.99
ATOM   2481  HD1 TYR A 283      -0.264 -50.040 -11.784  1.00 99.99
ATOM   2482  HD2 TYR A 283      -2.778 -53.492 -11.534  1.00 99.99
ATOM   2483  HE1 TYR A 283      -0.269 -50.184 -14.240  1.00 99.99
ATOM   2484  HE2 TYR A 283      -2.753 -53.702 -14.002  1.00 99.99
ATOM   2485  HH  TYR A 283      -2.111 -52.774 -15.957  1.00 99.99
ATOM   2486  N   ASP A 284      -3.265 -48.420 -10.561  1.00  0.90
ATOM   2487  CA  ASP A 284      -2.228 -47.386 -10.812  1.00  0.90
ATOM   2488  C   ASP A 284      -1.938 -46.455  -9.617  1.00  0.90
ATOM   2489  O   ASP A 284      -0.983 -45.681  -9.654  1.00  0.90
ATOM   2490  CB  ASP A 284      -2.651 -46.536 -12.026  1.00  0.90
ATOM   2491  CG  ASP A 284      -3.982 -45.782 -11.860  1.00  0.90
ATOM   2492  OD1 ASP A 284      -4.990 -46.463 -11.556  1.00  0.90
ATOM   2493  OD2 ASP A 284      -3.956 -44.540 -11.977  1.00  0.90
ATOM   2494  H   ASP A 284      -4.174 -48.118 -10.855  1.00 99.99
ATOM   2495  N   LYS A 285      -2.874 -46.422  -8.672  1.00  0.90
ATOM   2496  CA  LYS A 285      -2.820 -45.567  -7.469  1.00  0.90
ATOM   2497  C   LYS A 285      -3.719 -46.165  -6.373  1.00  0.90
ATOM   2498  O   LYS A 285      -4.410 -47.162  -6.596  1.00  0.90
ATOM   2499  CB  LYS A 285      -3.274 -44.141  -7.830  1.00  0.90
ATOM   2500  CG  LYS A 285      -4.712 -44.095  -8.359  1.00  0.90
ATOM   2501  CD  LYS A 285      -5.076 -42.717  -8.911  1.00  0.90
ATOM   2502  CE  LYS A 285      -6.443 -42.747  -9.600  1.00  0.90
ATOM   2503  NZ  LYS A 285      -6.438 -43.692 -10.727  1.00  0.90
ATOM   2504  H   LYS A 285      -3.638 -47.067  -8.659  1.00 99.99
ATOM   2505  HZ1 LYS A 285      -7.333 -43.710 -11.170  1.00 99.99
ATOM   2506  HZ2 LYS A 285      -5.724 -43.446 -11.383  1.00 99.99
ATOM   2507  HZ3 LYS A 285      -6.254 -44.611 -10.370  1.00 99.99
ATOM   2508  N   SER A 286      -3.600 -45.624  -5.168  1.00  0.98
ATOM   2509  CA  SER A 286      -4.542 -45.903  -4.065  1.00  0.98
ATOM   2510  C   SER A 286      -5.018 -44.578  -3.478  1.00  0.98
ATOM   2511  O   SER A 286      -4.188 -43.736  -3.125  1.00  0.98
ATOM   2512  CB  SER A 286      -3.877 -46.721  -2.959  1.00  0.98
ATOM   2513  OG  SER A 286      -3.736 -48.070  -3.399  1.00  0.98
ATOM   2514  H   SER A 286      -2.886 -44.957  -4.950  1.00 99.99
ATOM   2515  HG  SER A 286      -3.928 -48.139  -4.378  1.00 99.99
ATOM   2516  N   ILE A 287      -6.329 -44.376  -3.447  1.00  0.98
ATOM   2517  CA  ILE A 287      -6.901 -43.074  -3.031  1.00  0.98
ATOM   2518  C   ILE A 287      -7.926 -43.214  -1.897  1.00  0.98
ATOM   2519  O   ILE A 287      -8.578 -44.255  -1.765  1.00  0.98
ATOM   2520  CB  ILE A 287      -7.488 -42.269  -4.215  1.00  0.98
ATOM   2521  CG1 ILE A 287      -8.769 -42.893  -4.799  1.00  0.98
ATOM   2522  CG2 ILE A 287      -6.407 -42.060  -5.288  1.00  0.98
ATOM   2523  CD  ILE A 287      -9.543 -41.971  -5.751  1.00  0.98
ATOM   2524  H   ILE A 287      -6.992 -45.101  -3.671  1.00 99.99
ATOM   2525  N   VAL A 288      -8.093 -42.136  -1.139  1.00  0.99
ATOM   2526  CA  VAL A 288      -9.132 -42.044  -0.090  1.00  0.99
ATOM   2527  C   VAL A 288     -10.245 -41.133  -0.627  1.00  0.99
ATOM   2528  O   VAL A 288     -10.050 -39.929  -0.799  1.00  0.99
ATOM   2529  CB  VAL A 288      -8.571 -41.498   1.239  1.00  0.99
ATOM   2530  CG1 VAL A 288      -9.642 -41.504   2.336  1.00  0.99
ATOM   2531  CG2 VAL A 288      -7.365 -42.306   1.729  1.00  0.99
ATOM   2532  H   VAL A 288      -7.479 -41.343  -1.209  1.00 99.99
ATOM   2533  N   ASP A 289     -11.404 -41.739  -0.858  1.00  0.96
ATOM   2534  CA  ASP A 289     -12.506 -41.083  -1.576  1.00  0.96
ATOM   2535  C   ASP A 289     -13.838 -41.196  -0.818  1.00  0.96
ATOM   2536  O   ASP A 289     -14.380 -42.294  -0.694  1.00  0.96
ATOM   2537  CB  ASP A 289     -12.556 -41.762  -2.951  1.00  0.96
ATOM   2538  CG  ASP A 289     -13.604 -41.234  -3.930  1.00  0.96
ATOM   2539  OD1 ASP A 289     -14.289 -40.245  -3.580  1.00  0.96
ATOM   2540  OD2 ASP A 289     -13.679 -41.828  -5.021  1.00  0.96
ATOM   2541  H   ASP A 289     -11.614 -42.656  -0.502  1.00 99.99
ATOM   2542  N   SER A 290     -14.397 -40.058  -0.420  1.00  0.96
ATOM   2543  CA  SER A 290     -15.744 -40.016   0.198  1.00  0.96
ATOM   2544  C   SER A 290     -16.913 -40.000  -0.801  1.00  0.96
ATOM   2545  O   SER A 290     -18.061 -40.198  -0.401  1.00  0.96
ATOM   2546  CB  SER A 290     -15.900 -38.879   1.213  1.00  0.96
ATOM   2547  OG  SER A 290     -15.620 -37.610   0.619  1.00  0.96
ATOM   2548  H   SER A 290     -13.908 -39.177  -0.441  1.00 99.99
ATOM   2549  HG  SER A 290     -15.968 -36.907   1.253  1.00 99.99
ATOM   2550  N   GLY A 291     -16.603 -39.789  -2.088  1.00  0.94
ATOM   2551  CA  GLY A 291     -17.582 -39.860  -3.193  1.00  0.94
ATOM   2552  C   GLY A 291     -17.896 -41.295  -3.662  1.00  0.94
ATOM   2553  O   GLY A 291     -18.896 -41.502  -4.344  1.00  0.94
ATOM   2554  H   GLY A 291     -15.665 -39.638  -2.430  1.00 99.99
ATOM   2555  N   THR A 292     -17.045 -42.263  -3.306  1.00  0.91
ATOM   2556  CA  THR A 292     -17.214 -43.680  -3.708  1.00  0.91
ATOM   2557  C   THR A 292     -17.787 -44.490  -2.537  1.00  0.91
ATOM   2558  O   THR A 292     -17.217 -44.493  -1.446  1.00  0.91
ATOM   2559  CB  THR A 292     -15.875 -44.287  -4.190  1.00  0.91
ATOM   2560  OG1 THR A 292     -15.544 -43.750  -5.467  1.00  0.91
ATOM   2561  CG2 THR A 292     -15.864 -45.814  -4.333  1.00  0.91
ATOM   2562  H   THR A 292     -16.316 -42.096  -2.646  1.00 99.99
ATOM   2563  HG1 THR A 292     -14.671 -44.136  -5.776  1.00 99.99
ATOM   2564  N   THR A 293     -18.796 -45.303  -2.831  1.00  0.89
ATOM   2565  CA  THR A 293     -19.390 -46.220  -1.827  1.00  0.89
ATOM   2566  C   THR A 293     -18.470 -47.399  -1.452  1.00  0.89
ATOM   2567  O   THR A 293     -18.209 -47.620  -0.265  1.00  0.89
ATOM   2568  CB  THR A 293     -20.765 -46.743  -2.283  1.00  0.89
ATOM   2569  OG1 THR A 293     -21.617 -45.634  -2.580  1.00  0.89
ATOM   2570  CG2 THR A 293     -21.452 -47.617  -1.226  1.00  0.89
ATOM   2571  H   THR A 293     -19.310 -45.218  -3.688  1.00 99.99
ATOM   2572  HG1 THR A 293     -22.524 -45.978  -2.837  1.00 99.99
ATOM   2573  N   ASN A 294     -17.975 -48.118  -2.452  1.00  0.89
ATOM   2574  CA  ASN A 294     -17.275 -49.408  -2.258  1.00  0.89
ATOM   2575  C   ASN A 294     -15.796 -49.278  -1.870  1.00  0.89
ATOM   2576  O   ASN A 294     -15.167 -48.237  -2.079  1.00  0.89
ATOM   2577  CB  ASN A 294     -17.349 -50.228  -3.553  1.00  0.89
ATOM   2578  CG  ASN A 294     -18.720 -50.829  -3.880  1.00  0.89
ATOM   2579  OD1 ASN A 294     -19.768 -50.460  -3.365  1.00  0.89
ATOM   2580  ND2 ASN A 294     -18.715 -51.763  -4.805  1.00  0.89
ATOM   2581  H   ASN A 294     -17.994 -47.798  -3.400  1.00 99.99
ATOM   2582 1HD2 ASN A 294     -19.587 -52.185  -5.042  1.00 99.99
ATOM   2583 2HD2 ASN A 294     -17.847 -52.075  -5.196  1.00 99.99
ATOM   2584  N   LEU A 295     -15.265 -50.323  -1.243  1.00  0.95
ATOM   2585  CA  LEU A 295     -13.819 -50.608  -1.341  1.00  0.95
ATOM   2586  C   LEU A 295     -13.562 -51.196  -2.734  1.00  0.95
ATOM   2587  O   LEU A 295     -14.015 -52.295  -3.059  1.00  0.95
ATOM   2588  CB  LEU A 295     -13.328 -51.584  -0.260  1.00  0.95
ATOM   2589  CG  LEU A 295     -11.871 -52.059  -0.392  1.00  0.95
ATOM   2590  CD1 LEU A 295     -10.862 -50.905  -0.355  1.00  0.95
ATOM   2591  CD2 LEU A 295     -11.567 -53.068   0.716  1.00  0.95
ATOM   2592  H   LEU A 295     -15.818 -50.989  -0.732  1.00 99.99
ATOM   2593  N   ARG A 296     -12.858 -50.431  -3.551  1.00  0.89
ATOM   2594  CA  ARG A 296     -12.553 -50.879  -4.922  1.00  0.89
ATOM   2595  C   ARG A 296     -11.079 -51.280  -4.946  1.00  0.89
ATOM   2596  O   ARG A 296     -10.239 -50.558  -4.407  1.00  0.89
ATOM   2597  CB  ARG A 296     -12.815 -49.764  -5.939  1.00  0.89
ATOM   2598  CG  ARG A 296     -14.246 -49.216  -5.869  1.00  0.89
ATOM   2599  CD  ARG A 296     -14.508 -48.163  -6.947  1.00  0.89
ATOM   2600  NE  ARG A 296     -14.478 -48.810  -8.269  1.00  0.89
ATOM   2601  CZ  ARG A 296     -14.007 -48.289  -9.405  1.00  0.89
ATOM   2602  NH1 ARG A 296     -13.507 -47.060  -9.463  1.00  0.89
ATOM   2603  NH2 ARG A 296     -14.015 -49.016 -10.510  1.00  0.89
ATOM   2604  H   ARG A 296     -12.374 -49.607  -3.239  1.00 99.99
ATOM   2605  HE  ARG A 296     -14.826 -49.745  -8.283  1.00 99.99
ATOM   2606 1HH1 ARG A 296     -13.167 -46.688 -10.326  1.00 99.99
ATOM   2607 2HH1 ARG A 296     -13.506 -46.498  -8.640  1.00 99.99
ATOM   2608 1HH2 ARG A 296     -13.673 -48.619 -11.359  1.00 99.99
ATOM   2609 2HH2 ARG A 296     -14.366 -49.952 -10.496  1.00 99.99
ATOM   2610  N   LEU A 297     -10.808 -52.463  -5.478  1.00  0.95
ATOM   2611  CA  LEU A 297      -9.448 -53.032  -5.521  1.00  0.95
ATOM   2612  C   LEU A 297      -9.031 -53.283  -6.979  1.00  0.95
ATOM   2613  O   LEU A 297      -9.894 -53.639  -7.786  1.00  0.95
ATOM   2614  CB  LEU A 297      -9.413 -54.367  -4.758  1.00  0.95
ATOM   2615  CG  LEU A 297      -9.713 -54.272  -3.255  1.00  0.95
ATOM   2616  CD1 LEU A 297      -9.848 -55.682  -2.682  1.00  0.95
ATOM   2617  CD2 LEU A 297      -8.606 -53.528  -2.500  1.00  0.95
ATOM   2618  H   LEU A 297     -11.517 -53.011  -5.939  1.00 99.99
ATOM   2619  N   PRO A 298      -7.736 -53.183  -7.319  1.00  0.96
ATOM   2620  CA  PRO A 298      -7.224 -53.593  -8.646  1.00  0.96
ATOM   2621  C   PRO A 298      -7.647 -55.051  -8.914  1.00  0.96
ATOM   2622  O   PRO A 298      -7.733 -55.847  -7.974  1.00  0.96
ATOM   2623  CB  PRO A 298      -5.704 -53.473  -8.510  1.00  0.96
ATOM   2624  CG  PRO A 298      -5.524 -52.348  -7.492  1.00  0.96
ATOM   2625  CD  PRO A 298      -6.662 -52.587  -6.502  1.00  0.96
ATOM   2626  N   LYS A 299      -7.845 -55.417 -10.181  1.00  0.89
ATOM   2627  CA  LYS A 299      -8.443 -56.722 -10.566  1.00  0.89
ATOM   2628  C   LYS A 299      -7.762 -57.955  -9.936  1.00  0.89
ATOM   2629  O   LYS A 299      -8.436 -58.778  -9.309  1.00  0.89
ATOM   2630  CB  LYS A 299      -8.505 -56.826 -12.100  1.00  0.89
ATOM   2631  CG  LYS A 299      -9.108 -58.141 -12.614  1.00  0.89
ATOM   2632  CD  LYS A 299      -9.305 -58.130 -14.134  1.00  0.89
ATOM   2633  CE  LYS A 299      -9.759 -59.483 -14.699  1.00  0.89
ATOM   2634  NZ  LYS A 299     -11.008 -59.962 -14.089  1.00  0.89
ATOM   2635  H   LYS A 299      -7.630 -54.809 -10.947  1.00 99.99
ATOM   2636  HZ1 LYS A 299     -11.265 -60.846 -14.482  1.00 99.99
ATOM   2637  HZ2 LYS A 299     -10.824 -60.116 -13.114  1.00 99.99
ATOM   2638  HZ3 LYS A 299     -11.747 -59.300 -14.209  1.00 99.99
ATOM   2639  N   LYS A 300      -6.434 -57.988  -9.986  1.00  0.88
ATOM   2640  CA  LYS A 300      -5.623 -59.098  -9.445  1.00  0.88
ATOM   2641  C   LYS A 300      -5.725 -59.218  -7.911  1.00  0.88
ATOM   2642  O   LYS A 300      -5.931 -60.313  -7.381  1.00  0.88
ATOM   2643  CB  LYS A 300      -4.187 -58.876  -9.923  1.00  0.88
ATOM   2644  CG  LYS A 300      -3.352 -60.160  -9.909  1.00  0.88
ATOM   2645  CD  LYS A 300      -2.115 -60.028 -10.803  1.00  0.88
ATOM   2646  CE  LYS A 300      -2.448 -60.092 -12.299  1.00  0.88
ATOM   2647  NZ  LYS A 300      -1.278 -59.707 -13.101  1.00  0.88
ATOM   2648  H   LYS A 300      -5.905 -57.284 -10.461  1.00 99.99
ATOM   2649  HZ1 LYS A 300      -1.488 -59.783 -14.077  1.00 99.99
ATOM   2650  HZ2 LYS A 300      -1.032 -58.762 -12.886  1.00 99.99
ATOM   2651  HZ3 LYS A 300      -0.506 -60.304 -12.881  1.00 99.99
ATOM   2652  N   VAL A 301      -5.751 -58.070  -7.237  1.00  0.94
ATOM   2653  CA  VAL A 301      -5.935 -57.974  -5.771  1.00  0.94
ATOM   2654  C   VAL A 301      -7.346 -58.431  -5.357  1.00  0.94
ATOM   2655  O   VAL A 301      -7.482 -59.202  -4.405  1.00  0.94
ATOM   2656  CB  VAL A 301      -5.640 -56.544  -5.278  1.00  0.94
ATOM   2657  CG1 VAL A 301      -5.787 -56.404  -3.757  1.00  0.94
ATOM   2658  CG2 VAL A 301      -4.219 -56.128  -5.662  1.00  0.94
ATOM   2659  H   VAL A 301      -5.608 -57.189  -7.687  1.00 99.99
ATOM   2660  N   PHE A 302      -8.352 -58.023  -6.123  1.00  0.94
ATOM   2661  CA  PHE A 302      -9.751 -58.439  -5.915  1.00  0.94
ATOM   2662  C   PHE A 302      -9.919 -59.968  -6.006  1.00  0.94
ATOM   2663  O   PHE A 302     -10.480 -60.580  -5.097  1.00  0.94
ATOM   2664  CB  PHE A 302     -10.618 -57.708  -6.945  1.00  0.94
ATOM   2665  CG  PHE A 302     -12.083 -58.147  -6.895  1.00  0.94
ATOM   2666  CD1 PHE A 302     -12.951 -57.553  -5.991  1.00  0.94
ATOM   2667  CD2 PHE A 302     -12.513 -59.168  -7.727  1.00  0.94
ATOM   2668  CE1 PHE A 302     -14.274 -57.988  -5.929  1.00  0.94
ATOM   2669  CE2 PHE A 302     -13.835 -59.606  -7.661  1.00  0.94
ATOM   2670  CZ  PHE A 302     -14.710 -58.999  -6.769  1.00  0.94
ATOM   2671  H   PHE A 302      -8.223 -57.361  -6.869  1.00 99.99
ATOM   2672  HD1 PHE A 302     -12.593 -56.771  -5.325  1.00 99.99
ATOM   2673  HD2 PHE A 302     -11.811 -59.643  -8.410  1.00 99.99
ATOM   2674  HE1 PHE A 302     -14.950 -57.581  -5.177  1.00 99.99
ATOM   2675  HE2 PHE A 302     -14.153 -60.475  -8.235  1.00 99.99
ATOM   2676  HZ  PHE A 302     -15.757 -59.305  -6.738  1.00 99.99
ATOM   2677  N   GLU A 303      -9.311 -60.569  -7.024  1.00  0.88
ATOM   2678  CA  GLU A 303      -9.385 -62.025  -7.268  1.00  0.88
ATOM   2679  C   GLU A 303      -8.746 -62.863  -6.151  1.00  0.88
ATOM   2680  O   GLU A 303      -9.383 -63.789  -5.644  1.00  0.88
ATOM   2681  CB  GLU A 303      -8.809 -62.329  -8.653  1.00  0.88
ATOM   2682  CG  GLU A 303      -9.796 -61.765  -9.676  1.00  0.88
ATOM   2683  CD  GLU A 303      -9.326 -61.626 -11.120  1.00  0.88
ATOM   2684  OE1 GLU A 303      -8.134 -61.833 -11.436  1.00  0.88
ATOM   2685  OE2 GLU A 303     -10.225 -61.218 -11.874  1.00  0.88
ATOM   2686  H   GLU A 303      -8.788 -60.054  -7.710  1.00 99.99
ATOM   2687  N   ALA A 304      -7.601 -62.403  -5.653  1.00  0.94
ATOM   2688  CA  ALA A 304      -6.959 -62.990  -4.461  1.00  0.94
ATOM   2689  C   ALA A 304      -7.733 -62.738  -3.151  1.00  0.94
ATOM   2690  O   ALA A 304      -7.940 -63.672  -2.371  1.00  0.94
ATOM   2691  CB  ALA A 304      -5.530 -62.466  -4.353  1.00  0.94
ATOM   2692  H   ALA A 304      -7.056 -61.701  -6.120  1.00 99.99
ATOM   2693  N   ALA A 305      -8.247 -61.522  -2.967  1.00  0.95
ATOM   2694  CA  ALA A 305      -9.042 -61.154  -1.776  1.00  0.95
ATOM   2695  C   ALA A 305     -10.356 -61.945  -1.674  1.00  0.95
ATOM   2696  O   ALA A 305     -10.600 -62.573  -0.642  1.00  0.95
ATOM   2697  CB  ALA A 305      -9.319 -59.648  -1.759  1.00  0.95
ATOM   2698  H   ALA A 305      -8.075 -60.759  -3.600  1.00 99.99
ATOM   2699  N   VAL A 306     -11.085 -62.057  -2.783  1.00  0.92
ATOM   2700  CA  VAL A 306     -12.321 -62.866  -2.867  1.00  0.92
ATOM   2701  C   VAL A 306     -12.040 -64.362  -2.632  1.00  0.92
ATOM   2702  O   VAL A 306     -12.774 -64.984  -1.863  1.00  0.92
ATOM   2703  CB  VAL A 306     -13.065 -62.580  -4.188  1.00  0.92
ATOM   2704  CG1 VAL A 306     -14.187 -63.578  -4.506  1.00  0.92
ATOM   2705  CG2 VAL A 306     -13.704 -61.191  -4.114  1.00  0.92
ATOM   2706  H   VAL A 306     -10.863 -61.547  -3.624  1.00 99.99
ATOM   2707  N   LYS A 307     -10.956 -64.888  -3.196  1.00  0.87
ATOM   2708  CA  LYS A 307     -10.537 -66.290  -2.971  1.00  0.87
ATOM   2709  C   LYS A 307     -10.296 -66.569  -1.473  1.00  0.87
ATOM   2710  O   LYS A 307     -10.812 -67.553  -0.937  1.00  0.87
ATOM   2711  CB  LYS A 307      -9.278 -66.576  -3.800  1.00  0.87
ATOM   2712  CG  LYS A 307      -8.770 -68.018  -3.682  1.00  0.87
ATOM   2713  CD  LYS A 307      -7.391 -68.144  -4.335  1.00  0.87
ATOM   2714  CE  LYS A 307      -6.698 -69.477  -4.027  1.00  0.87
ATOM   2715  NZ  LYS A 307      -7.357 -70.624  -4.668  1.00  0.87
ATOM   2716  H   LYS A 307     -10.386 -64.382  -3.852  1.00 99.99
ATOM   2717  HZ1 LYS A 307      -6.863 -71.464  -4.439  1.00 99.99
ATOM   2718  HZ2 LYS A 307      -8.298 -70.693  -4.337  1.00 99.99
ATOM   2719  HZ3 LYS A 307      -7.355 -70.497  -5.659  1.00 99.99
ATOM   2720  N   SER A 308      -9.620 -65.641  -0.799  1.00  0.90
ATOM   2721  CA  SER A 308      -9.359 -65.729   0.654  1.00  0.90
ATOM   2722  C   SER A 308     -10.626 -65.538   1.511  1.00  0.90
ATOM   2723  O   SER A 308     -10.876 -66.344   2.411  1.00  0.90
ATOM   2724  CB  SER A 308      -8.269 -64.727   1.043  1.00  0.90
ATOM   2725  OG  SER A 308      -7.805 -64.986   2.370  1.00  0.90
ATOM   2726  H   SER A 308      -9.178 -64.867  -1.262  1.00 99.99
ATOM   2727  HG  SER A 308      -7.067 -64.353   2.600  1.00 99.99
ATOM   2728  N   ILE A 309     -11.493 -64.593   1.137  1.00  0.90
ATOM   2729  CA  ILE A 309     -12.800 -64.384   1.810  1.00  0.90
ATOM   2730  C   ILE A 309     -13.712 -65.621   1.637  1.00  0.90
ATOM   2731  O   ILE A 309     -14.252 -66.095   2.640  1.00  0.90
ATOM   2732  CB  ILE A 309     -13.492 -63.074   1.366  1.00  0.90
ATOM   2733  CG1 ILE A 309     -12.618 -61.850   1.688  1.00  0.90
ATOM   2734  CG2 ILE A 309     -14.856 -62.903   2.060  1.00  0.90
ATOM   2735  CD  ILE A 309     -13.005 -60.597   0.891  1.00  0.90
ATOM   2736  H   ILE A 309     -11.278 -63.928   0.413  1.00 99.99
ATOM   2737  N   LYS A 310     -13.776 -66.183   0.431  1.00  0.85
ATOM   2738  CA  LYS A 310     -14.509 -67.440   0.136  1.00  0.85
ATOM   2739  C   LYS A 310     -14.014 -68.614   0.999  1.00  0.85
ATOM   2740  O   LYS A 310     -14.823 -69.393   1.505  1.00  0.85
ATOM   2741  CB  LYS A 310     -14.355 -67.862  -1.333  1.00  0.85
ATOM   2742  CG  LYS A 310     -15.228 -67.126  -2.355  1.00  0.85
ATOM   2743  CD  LYS A 310     -14.924 -67.682  -3.750  1.00  0.85
ATOM   2744  CE  LYS A 310     -15.854 -67.128  -4.829  1.00  0.85
ATOM   2745  NZ  LYS A 310     -15.542 -67.720  -6.137  1.00  0.85
ATOM   2746  H   LYS A 310     -13.352 -65.760  -0.380  1.00 99.99
ATOM   2747  HZ1 LYS A 310     -16.207 -67.375  -6.809  1.00 99.99
ATOM   2748  HZ2 LYS A 310     -14.618 -67.481  -6.431  1.00 99.99
ATOM   2749  HZ3 LYS A 310     -15.652 -68.713  -6.099  1.00 99.99
ATOM   2750  N   ALA A 311     -12.695 -68.720   1.157  1.00  0.89
ATOM   2751  CA  ALA A 311     -12.057 -69.769   1.976  1.00  0.89
ATOM   2752  C   ALA A 311     -12.328 -69.603   3.481  1.00  0.89
ATOM   2753  O   ALA A 311     -12.644 -70.581   4.161  1.00  0.89
ATOM   2754  CB  ALA A 311     -10.553 -69.790   1.695  1.00  0.89
ATOM   2755  H   ALA A 311     -12.050 -68.114   0.684  1.00 99.99
ATOM   2756  N   ALA A 312     -12.267 -68.365   3.964  1.00  0.89
ATOM   2757  CA  ALA A 312     -12.556 -68.019   5.369  1.00  0.89
ATOM   2758  C   ALA A 312     -14.029 -68.207   5.775  1.00  0.89
ATOM   2759  O   ALA A 312     -14.293 -68.720   6.864  1.00  0.89
ATOM   2760  CB  ALA A 312     -12.107 -66.582   5.633  1.00  0.89
ATOM   2761  H   ALA A 312     -11.938 -67.595   3.407  1.00 99.99
ATOM   2762  N   SER A 313     -14.959 -67.913   4.867  1.00  0.88
ATOM   2763  CA  SER A 313     -16.408 -68.052   5.133  1.00  0.88
ATOM   2764  C   SER A 313     -17.017 -69.334   4.534  1.00  0.88
ATOM   2765  O   SER A 313     -18.246 -69.486   4.550  1.00  0.88
ATOM   2766  CB  SER A 313     -17.166 -66.820   4.615  1.00  0.88
ATOM   2767  OG  SER A 313     -17.102 -66.718   3.187  1.00  0.88
ATOM   2768  H   SER A 313     -14.742 -67.534   3.961  1.00 99.99
ATOM   2769  HG  SER A 313     -17.628 -65.922   2.894  1.00 99.99
ATOM   2770  N   SER A 314     -16.173 -70.346   4.325  1.00  0.86
ATOM   2771  CA  SER A 314     -16.536 -71.596   3.613  1.00  0.86
ATOM   2772  C   SER A 314     -17.611 -72.478   4.273  1.00  0.86
ATOM   2773  O   SER A 314     -18.121 -73.410   3.651  1.00  0.86
ATOM   2774  CB  SER A 314     -15.298 -72.437   3.285  1.00  0.86
ATOM   2775  OG  SER A 314     -14.670 -72.923   4.475  1.00  0.86
ATOM   2776  H   SER A 314     -15.209 -70.310   4.605  1.00 99.99
ATOM   2777  HG  SER A 314     -13.854 -73.442   4.212  1.00 99.99
ATOM   2778  N   THR A 315     -17.945 -72.173   5.525  1.00  0.81
ATOM   2779  CA  THR A 315     -19.079 -72.784   6.254  1.00  0.81
ATOM   2780  C   THR A 315     -20.448 -72.568   5.579  1.00  0.81
ATOM   2781  O   THR A 315     -21.312 -73.442   5.657  1.00  0.81
ATOM   2782  CB  THR A 315     -19.113 -72.315   7.715  1.00  0.81
ATOM   2783  OG1 THR A 315     -19.020 -70.886   7.789  1.00  0.81
ATOM   2784  CG2 THR A 315     -18.010 -72.991   8.535  1.00  0.81
ATOM   2785  H   THR A 315     -17.395 -71.530   6.057  1.00 99.99
ATOM   2786  HG1 THR A 315     -18.824 -70.495   6.890  1.00 99.99
ATOM   2787  N   GLU A 316     -20.649 -71.413   4.943  1.00  0.80
ATOM   2788  CA  GLU A 316     -21.814 -71.178   4.064  1.00  0.80
ATOM   2789  C   GLU A 316     -21.328 -70.919   2.630  1.00  0.80
ATOM   2790  O   GLU A 316     -20.378 -70.165   2.417  1.00  0.80
ATOM   2791  CB  GLU A 316     -22.667 -70.000   4.556  1.00  0.80
ATOM   2792  CG  GLU A 316     -23.544 -70.366   5.761  1.00  0.80
ATOM   2793  CD  GLU A 316     -24.369 -69.192   6.305  1.00  0.80
ATOM   2794  OE1 GLU A 316     -24.996 -68.464   5.497  1.00  0.80
ATOM   2795  OE2 GLU A 316     -24.421 -69.074   7.548  1.00  0.80
ATOM   2796  H   GLU A 316     -19.966 -70.677   4.924  1.00 99.99
ATOM   2797  N   LYS A 317     -22.004 -71.532   1.664  1.00  0.78
ATOM   2798  CA  LYS A 317     -21.636 -71.376   0.244  1.00  0.78
ATOM   2799  C   LYS A 317     -22.580 -70.402  -0.470  1.00  0.78
ATOM   2800  O   LYS A 317     -23.803 -70.548  -0.440  1.00  0.78
ATOM   2801  CB  LYS A 317     -21.604 -72.736  -0.471  1.00  0.78
ATOM   2802  CG  LYS A 317     -20.227 -73.018  -1.089  1.00  0.78
ATOM   2803  CD  LYS A 317     -19.933 -72.109  -2.288  1.00  0.78
ATOM   2804  CE  LYS A 317     -18.435 -71.998  -2.577  1.00  0.78
ATOM   2805  NZ  LYS A 317     -18.198 -70.998  -3.629  1.00  0.78
ATOM   2806  H   LYS A 317     -22.785 -72.128   1.847  1.00 99.99
ATOM   2807  HZ1 LYS A 317     -17.215 -70.896  -3.784  1.00 99.99
ATOM   2808  HZ2 LYS A 317     -18.640 -71.298  -4.473  1.00 99.99
ATOM   2809  HZ3 LYS A 317     -18.583 -70.120  -3.346  1.00 99.99
ATOM   2810  N   PHE A 318     -21.963 -69.427  -1.124  1.00  0.87
ATOM   2811  CA  PHE A 318     -22.670 -68.362  -1.860  1.00  0.87
ATOM   2812  C   PHE A 318     -22.366 -68.488  -3.363  1.00  0.87
ATOM   2813  O   PHE A 318     -21.266 -68.925  -3.714  1.00  0.87
ATOM   2814  CB  PHE A 318     -22.210 -66.984  -1.365  1.00  0.87
ATOM   2815  CG  PHE A 318     -22.312 -66.853   0.158  1.00  0.87
ATOM   2816  CD1 PHE A 318     -23.547 -66.775   0.778  1.00  0.87
ATOM   2817  CD2 PHE A 318     -21.157 -66.925   0.912  1.00  0.87
ATOM   2818  CE1 PHE A 318     -23.616 -66.771   2.172  1.00  0.87
ATOM   2819  CE2 PHE A 318     -21.216 -66.924   2.303  1.00  0.87
ATOM   2820  CZ  PHE A 318     -22.455 -66.839   2.927  1.00  0.87
ATOM   2821  H   PHE A 318     -20.965 -69.364  -1.150  1.00 99.99
ATOM   2822  HD1 PHE A 318     -24.451 -66.759   0.176  1.00 99.99
ATOM   2823  HD2 PHE A 318     -20.208 -67.038   0.406  1.00 99.99
ATOM   2824  HE1 PHE A 318     -24.586 -66.749   2.665  1.00 99.99
ATOM   2825  HE2 PHE A 318     -20.309 -67.091   2.885  1.00 99.99
ATOM   2826  HZ  PHE A 318     -22.517 -66.827   4.017  1.00 99.99
ATOM   2827  N   PRO A 319     -23.301 -68.094  -4.244  1.00  0.90
ATOM   2828  CA  PRO A 319     -23.089 -68.127  -5.707  1.00  0.90
ATOM   2829  C   PRO A 319     -21.945 -67.172  -6.086  1.00  0.90
ATOM   2830  O   PRO A 319     -21.708 -66.177  -5.402  1.00  0.90
ATOM   2831  CB  PRO A 319     -24.399 -67.616  -6.313  1.00  0.90
ATOM   2832  CG  PRO A 319     -25.440 -67.827  -5.214  1.00  0.90
ATOM   2833  CD  PRO A 319     -24.653 -67.593  -3.926  1.00  0.90
ATOM   2834  N   ASP A 320     -21.319 -67.417  -7.237  1.00  0.85
ATOM   2835  CA  ASP A 320     -20.247 -66.539  -7.757  1.00  0.85
ATOM   2836  C   ASP A 320     -20.665 -65.087  -8.054  1.00  0.85
ATOM   2837  O   ASP A 320     -19.945 -64.155  -7.689  1.00  0.85
ATOM   2838  CB  ASP A 320     -19.558 -67.203  -8.955  1.00  0.85
ATOM   2839  CG  ASP A 320     -18.499 -68.189  -8.458  1.00  0.85
ATOM   2840  OD1 ASP A 320     -17.764 -67.759  -7.557  1.00  0.85
ATOM   2841  OD2 ASP A 320     -18.506 -69.356  -8.899  1.00  0.85
ATOM   2842  H   ASP A 320     -21.525 -68.220  -7.796  1.00 99.99
ATOM   2843  N   GLY A 321     -21.910 -64.923  -8.525  1.00  0.91
ATOM   2844  CA  GLY A 321     -22.527 -63.605  -8.782  1.00  0.91
ATOM   2845  C   GLY A 321     -22.621 -62.696  -7.545  1.00  0.91
ATOM   2846  O   GLY A 321     -22.553 -61.473  -7.692  1.00  0.91
ATOM   2847  H   GLY A 321     -22.513 -65.680  -8.800  1.00 99.99
ATOM   2848  N   PHE A 322     -22.745 -63.277  -6.354  1.00  0.90
ATOM   2849  CA  PHE A 322     -22.729 -62.513  -5.088  1.00  0.90
ATOM   2850  C   PHE A 322     -21.398 -61.769  -4.874  1.00  0.90
ATOM   2851  O   PHE A 322     -21.401 -60.555  -4.667  1.00  0.90
ATOM   2852  CB  PHE A 322     -23.036 -63.451  -3.913  1.00  0.90
ATOM   2853  CG  PHE A 322     -22.778 -62.803  -2.545  1.00  0.90
ATOM   2854  CD1 PHE A 322     -23.490 -61.675  -2.159  1.00  0.90
ATOM   2855  CD2 PHE A 322     -21.731 -63.275  -1.770  1.00  0.90
ATOM   2856  CE1 PHE A 322     -23.138 -61.007  -0.986  1.00  0.90
ATOM   2857  CE2 PHE A 322     -21.390 -62.620  -0.588  1.00  0.90
ATOM   2858  CZ  PHE A 322     -22.096 -61.484  -0.208  1.00  0.90
ATOM   2859  H   PHE A 322     -22.843 -64.267  -6.235  1.00 99.99
ATOM   2860  HD1 PHE A 322     -24.313 -61.314  -2.773  1.00 99.99
ATOM   2861  HD2 PHE A 322     -21.148 -64.132  -2.107  1.00 99.99
ATOM   2862  HE1 PHE A 322     -23.720 -60.148  -0.652  1.00 99.99
ATOM   2863  HE2 PHE A 322     -20.616 -63.032   0.059  1.00 99.99
ATOM   2864  HZ  PHE A 322     -21.854 -60.981   0.727  1.00 99.99
ATOM   2865  N   TRP A 323     -20.296 -62.468  -5.118  1.00  0.91
ATOM   2866  CA  TRP A 323     -18.935 -61.923  -4.942  1.00  0.91
ATOM   2867  C   TRP A 323     -18.576 -60.874  -6.004  1.00  0.91
ATOM   2868  O   TRP A 323     -17.764 -59.985  -5.754  1.00  0.91
ATOM   2869  CB  TRP A 323     -17.913 -63.061  -4.955  1.00  0.91
ATOM   2870  CG  TRP A 323     -18.236 -64.116  -3.890  1.00  0.91
ATOM   2871  CD1 TRP A 323     -18.706 -65.339  -4.128  1.00  0.91
ATOM   2872  CD2 TRP A 323     -17.995 -64.017  -2.538  1.00  0.91
ATOM   2873  NE1 TRP A 323     -18.742 -66.025  -2.982  1.00  0.91
ATOM   2874  CE2 TRP A 323     -18.311 -65.254  -1.991  1.00  0.91
ATOM   2875  CE3 TRP A 323     -17.593 -62.963  -1.720  1.00  0.91
ATOM   2876  CZ2 TRP A 323     -18.185 -65.435  -0.616  1.00  0.91
ATOM   2877  CZ3 TRP A 323     -17.465 -63.154  -0.360  1.00  0.91
ATOM   2878  CH2 TRP A 323     -17.757 -64.403   0.198  1.00  0.91
ATOM   2879  H   TRP A 323     -20.310 -63.414  -5.445  1.00 99.99
ATOM   2880  HD1 TRP A 323     -19.002 -65.717  -5.102  1.00 99.99
ATOM   2881  HE1 TRP A 323     -19.038 -66.980  -2.901  1.00 99.99
ATOM   2882  HE3 TRP A 323     -17.543 -61.953  -2.129  1.00 99.99
ATOM   2883  HZ2 TRP A 323     -18.440 -66.392  -0.168  1.00 99.99
ATOM   2884  HZ3 TRP A 323     -17.167 -62.320   0.274  1.00 99.99
ATOM   2885  HH2 TRP A 323     -17.633 -64.571   1.265  1.00 99.99
ATOM   2886  N   LEU A 324     -19.205 -60.988  -7.170  1.00  0.88
ATOM   2887  CA  LEU A 324     -19.051 -60.028  -8.280  1.00  0.88
ATOM   2888  C   LEU A 324     -19.989 -58.811  -8.157  1.00  0.88
ATOM   2889  O   LEU A 324     -19.871 -57.866  -8.939  1.00  0.88
ATOM   2890  CB  LEU A 324     -19.260 -60.768  -9.609  1.00  0.88
ATOM   2891  CG  LEU A 324     -18.201 -61.849  -9.877  1.00  0.88
ATOM   2892  CD1 LEU A 324     -18.683 -62.774 -10.995  1.00  0.88
ATOM   2893  CD2 LEU A 324     -16.852 -61.231 -10.265  1.00  0.88
ATOM   2894  H   LEU A 324     -19.854 -61.728  -7.348  1.00 99.99
ATOM   2895  N   GLY A 325     -20.942 -58.878  -7.213  1.00  0.89
ATOM   2896  CA  GLY A 325     -21.941 -57.815  -6.969  1.00  0.89
ATOM   2897  C   GLY A 325     -23.115 -57.814  -7.963  1.00  0.89
ATOM   2898  O   GLY A 325     -23.913 -56.880  -7.988  1.00  0.89
ATOM   2899  H   GLY A 325     -21.032 -59.639  -6.554  1.00 99.99
ATOM   2900  N   GLU A 326     -23.286 -58.934  -8.660  1.00  0.79
ATOM   2901  CA  GLU A 326     -24.361 -59.158  -9.647  1.00  0.79
ATOM   2902  C   GLU A 326     -25.706 -59.539  -8.998  1.00  0.79
ATOM   2903  O   GLU A 326     -26.749 -59.454  -9.647  1.00  0.79
ATOM   2904  CB  GLU A 326     -23.931 -60.249 -10.634  1.00  0.79
ATOM   2905  CG  GLU A 326     -22.669 -59.882 -11.429  1.00  0.79
ATOM   2906  CD  GLU A 326     -22.077 -61.054 -12.227  1.00  0.79
ATOM   2907  OE1 GLU A 326     -22.399 -62.221 -11.903  1.00  0.79
ATOM   2908  OE2 GLU A 326     -21.257 -60.765 -13.124  1.00  0.79
ATOM   2909  H   GLU A 326     -22.684 -59.723  -8.523  1.00 99.99
ATOM   2910  N   GLN A 327     -25.660 -60.068  -7.777  1.00  0.81
ATOM   2911  CA  GLN A 327     -26.862 -60.467  -7.021  1.00  0.81
ATOM   2912  C   GLN A 327     -26.658 -60.229  -5.519  1.00  0.81
ATOM   2913  O   GLN A 327     -25.525 -60.154  -5.039  1.00  0.81
ATOM   2914  CB  GLN A 327     -27.226 -61.933  -7.317  1.00  0.81
ATOM   2915  CG  GLN A 327     -26.185 -62.949  -6.829  1.00  0.81
ATOM   2916  CD  GLN A 327     -26.549 -64.383  -7.209  1.00  0.81
ATOM   2917  OE1 GLN A 327     -25.878 -65.033  -8.001  1.00  0.81
ATOM   2918  NE2 GLN A 327     -27.539 -64.937  -6.540  1.00  0.81
ATOM   2919  H   GLN A 327     -24.812 -60.124  -7.246  1.00 99.99
ATOM   2920 1HE2 GLN A 327     -27.790 -65.872  -6.771  1.00 99.99
ATOM   2921 2HE2 GLN A 327     -28.031 -64.415  -5.846  1.00 99.99
ATOM   2922  N   LEU A 328     -27.773 -60.122  -4.809  1.00  0.86
ATOM   2923  CA  LEU A 328     -27.764 -59.995  -3.341  1.00  0.86
ATOM   2924  C   LEU A 328     -27.822 -61.387  -2.693  1.00  0.86
ATOM   2925  O   LEU A 328     -28.218 -62.366  -3.330  1.00  0.86
ATOM   2926  CB  LEU A 328     -28.968 -59.157  -2.880  1.00  0.86
ATOM   2927  CG  LEU A 328     -29.113 -57.798  -3.584  1.00  0.86
ATOM   2928  CD1 LEU A 328     -30.350 -57.080  -3.054  1.00  0.86
ATOM   2929  CD2 LEU A 328     -27.884 -56.904  -3.410  1.00  0.86
ATOM   2930  H   LEU A 328     -28.679 -60.162  -5.228  1.00 99.99
ATOM   2931  N   VAL A 329     -27.350 -61.463  -1.454  1.00  0.87
ATOM   2932  CA  VAL A 329     -27.578 -62.647  -0.603  1.00  0.87
ATOM   2933  C   VAL A 329     -28.519 -62.213   0.529  1.00  0.87
ATOM   2934  O   VAL A 329     -28.385 -61.109   1.060  1.00  0.87
ATOM   2935  CB  VAL A 329     -26.255 -63.254  -0.087  1.00  0.87
ATOM   2936  CG1 VAL A 329     -25.500 -62.367   0.911  1.00  0.87
ATOM   2937  CG2 VAL A 329     -26.500 -64.643   0.509  1.00  0.87
ATOM   2938  H   VAL A 329     -26.904 -60.684  -1.003  1.00 99.99
ATOM   2939  N   CYS A 330     -29.492 -63.057   0.838  1.00  0.83
ATOM   2940  CA  CYS A 330     -30.495 -62.715   1.858  1.00  0.83
ATOM   2941  C   CYS A 330     -30.534 -63.793   2.946  1.00  0.83
ATOM   2942  O   CYS A 330     -30.345 -64.978   2.672  1.00  0.83
ATOM   2943  CB  CYS A 330     -31.870 -62.571   1.196  1.00  0.83
ATOM   2944  SG  CYS A 330     -31.907 -61.503  -0.294  1.00  0.83
ATOM   2945  H   CYS A 330     -29.550 -63.988   0.475  1.00 99.99
ATOM   2946  N   TRP A 331     -30.738 -63.327   4.169  1.00  0.72
ATOM   2947  CA  TRP A 331     -30.946 -64.165   5.365  1.00  0.72
ATOM   2948  C   TRP A 331     -32.256 -63.714   6.038  1.00  0.72
ATOM   2949  O   TRP A 331     -32.769 -62.632   5.738  1.00  0.72
ATOM   2950  CB  TRP A 331     -29.762 -64.028   6.337  1.00  0.72
ATOM   2951  CG  TRP A 331     -28.442 -64.672   5.870  1.00  0.72
ATOM   2952  CD1 TRP A 331     -28.119 -65.963   5.970  1.00  0.72
ATOM   2953  CD2 TRP A 331     -27.331 -64.017   5.379  1.00  0.72
ATOM   2954  NE1 TRP A 331     -26.857 -66.143   5.563  1.00  0.72
ATOM   2955  CE2 TRP A 331     -26.342 -64.979   5.192  1.00  0.72
ATOM   2956  CE3 TRP A 331     -27.055 -62.677   5.121  1.00  0.72
ATOM   2957  CZ2 TRP A 331     -25.079 -64.595   4.742  1.00  0.72
ATOM   2958  CZ3 TRP A 331     -25.817 -62.303   4.637  1.00  0.72
ATOM   2959  CH2 TRP A 331     -24.820 -63.268   4.444  1.00  0.72
ATOM   2960  H   TRP A 331     -30.866 -62.342   4.325  1.00 99.99
ATOM   2961  HD1 TRP A 331     -28.779 -66.750   6.325  1.00 99.99
ATOM   2962  HE1 TRP A 331     -26.374 -67.026   5.555  1.00 99.99
ATOM   2963  HE3 TRP A 331     -27.752 -61.912   5.466  1.00 99.99
ATOM   2964  HZ2 TRP A 331     -24.251 -65.307   4.767  1.00 99.99
ATOM   2965  HZ3 TRP A 331     -25.620 -61.257   4.407  1.00 99.99
ATOM   2966  HH2 TRP A 331     -23.848 -62.979   4.049  1.00 99.99
ATOM   2967  N   GLN A 332     -32.817 -64.535   6.919  1.00  0.63
ATOM   2968  CA  GLN A 332     -34.061 -64.195   7.651  1.00  0.63
ATOM   2969  C   GLN A 332     -33.935 -62.895   8.468  1.00  0.63
ATOM   2970  O   GLN A 332     -32.858 -62.619   9.009  1.00  0.63
ATOM   2971  CB  GLN A 332     -34.449 -65.357   8.569  1.00  0.63
ATOM   2972  CG  GLN A 332     -35.077 -66.514   7.785  1.00  0.63
ATOM   2973  CD  GLN A 332     -35.100 -67.807   8.604  1.00  0.63
ATOM   2974  OE1 GLN A 332     -35.477 -67.866   9.766  1.00  0.63
ATOM   2975  NE2 GLN A 332     -34.651 -68.880   7.989  1.00  0.63
ATOM   2976  H   GLN A 332     -32.403 -65.412   7.167  1.00 99.99
ATOM   2977 1HE2 GLN A 332     -34.646 -69.729   8.510  1.00 99.99
ATOM   2978 2HE2 GLN A 332     -34.353 -68.840   7.041  1.00 99.99
ATOM   2979  N   ALA A 333     -35.060 -62.187   8.567  1.00  0.53
ATOM   2980  CA  ALA A 333     -35.296 -60.877   9.227  1.00  0.53
ATOM   2981  C   ALA A 333     -34.555 -60.463  10.518  1.00  0.53
ATOM   2982  O   ALA A 333     -34.617 -59.293  10.898  1.00  0.53
ATOM   2983  CB  ALA A 333     -36.808 -60.748   9.436  1.00  0.53
ATOM   2984  H   ALA A 333     -35.886 -62.504   8.096  1.00 99.99
ATOM   2985  N   GLY A 334     -33.976 -61.431  11.240  1.00  0.51
ATOM   2986  CA  GLY A 334     -33.156 -61.143  12.435  1.00  0.51
ATOM   2987  C   GLY A 334     -31.793 -61.853  12.523  1.00  0.51
ATOM   2988  O   GLY A 334     -31.140 -61.741  13.559  1.00  0.51
ATOM   2989  H   GLY A 334     -34.017 -62.404  10.994  1.00 99.99
ATOM   2990  N   THR A 335     -31.378 -62.582  11.485  1.00  0.64
ATOM   2991  CA  THR A 335     -30.128 -63.384  11.551  1.00  0.64
ATOM   2992  C   THR A 335     -28.845 -62.668  11.078  1.00  0.64
ATOM   2993  O   THR A 335     -28.373 -61.770  11.773  1.00  0.64
ATOM   2994  CB  THR A 335     -30.280 -64.796  10.950  1.00  0.64
ATOM   2995  OG1 THR A 335     -30.633 -64.742   9.560  1.00  0.64
ATOM   2996  CG2 THR A 335     -31.263 -65.651  11.755  1.00  0.64
ATOM   2997  H   THR A 335     -31.917 -62.663  10.645  1.00 99.99
ATOM   2998  HG1 THR A 335     -30.895 -63.810   9.302  1.00 99.99
ATOM   2999  N   THR A 336     -28.329 -63.023   9.896  1.00  0.71
ATOM   3000  CA  THR A 336     -27.029 -62.575   9.335  1.00  0.71
ATOM   3001  C   THR A 336     -25.863 -63.083  10.209  1.00  0.71
ATOM   3002  O   THR A 336     -25.678 -62.622  11.335  1.00  0.71
ATOM   3003  CB  THR A 336     -26.908 -61.050   9.156  1.00  0.71
ATOM   3004  OG1 THR A 336     -28.022 -60.540   8.423  1.00  0.71
ATOM   3005  CG2 THR A 336     -25.632 -60.666   8.395  1.00  0.71
ATOM   3006  H   THR A 336     -28.804 -63.689   9.321  1.00 99.99
ATOM   3007  HG1 THR A 336     -27.823 -59.562   8.286  1.00 99.99
ATOM   3008  N   PRO A 337     -25.032 -63.989   9.678  1.00  0.78
ATOM   3009  CA  PRO A 337     -23.935 -64.553  10.475  1.00  0.78
ATOM   3010  C   PRO A 337     -22.638 -63.765  10.238  1.00  0.78
ATOM   3011  O   PRO A 337     -21.731 -64.222   9.538  1.00  0.78
ATOM   3012  CB  PRO A 337     -23.909 -66.020  10.037  1.00  0.78
ATOM   3013  CG  PRO A 337     -24.349 -65.994   8.570  1.00  0.78
ATOM   3014  CD  PRO A 337     -25.237 -64.753   8.434  1.00  0.78
ATOM   3015  N   TRP A 338     -22.520 -62.635  10.933  1.00  0.78
ATOM   3016  CA  TRP A 338     -21.349 -61.732  10.825  1.00  0.78
ATOM   3017  C   TRP A 338     -20.021 -62.445  11.143  1.00  0.78
ATOM   3018  O   TRP A 338     -19.064 -62.328  10.380  1.00  0.78
ATOM   3019  CB  TRP A 338     -21.499 -60.522  11.758  1.00  0.78
ATOM   3020  CG  TRP A 338     -22.756 -59.680  11.490  1.00  0.78
ATOM   3021  CD1 TRP A 338     -23.800 -59.546  12.307  1.00  0.78
ATOM   3022  CD2 TRP A 338     -22.962 -58.833  10.422  1.00  0.78
ATOM   3023  NE1 TRP A 338     -24.659 -58.662  11.787  1.00  0.78
ATOM   3024  CE2 TRP A 338     -24.181 -58.201  10.637  1.00  0.78
ATOM   3025  CE3 TRP A 338     -22.214 -58.553   9.283  1.00  0.78
ATOM   3026  CZ2 TRP A 338     -24.649 -57.282   9.699  1.00  0.78
ATOM   3027  CZ3 TRP A 338     -22.697 -57.675   8.335  1.00  0.78
ATOM   3028  CH2 TRP A 338     -23.923 -57.032   8.546  1.00  0.78
ATOM   3029  H   TRP A 338     -23.250 -62.286  11.527  1.00 99.99
ATOM   3030  HD1 TRP A 338     -23.920 -60.049  13.263  1.00 99.99
ATOM   3031  HE1 TRP A 338     -25.542 -58.416  12.197  1.00 99.99
ATOM   3032  HE3 TRP A 338     -21.184 -58.904   9.221  1.00 99.99
ATOM   3033  HZ2 TRP A 338     -25.508 -56.650   9.934  1.00 99.99
ATOM   3034  HZ3 TRP A 338     -22.124 -57.484   7.429  1.00 99.99
ATOM   3035  HH2 TRP A 338     -24.291 -56.315   7.813  1.00 99.99
ATOM   3036  N   ASN A 339     -20.088 -63.352  12.115  1.00  0.83
ATOM   3037  CA  ASN A 339     -18.948 -64.132  12.638  1.00  0.83
ATOM   3038  C   ASN A 339     -18.279 -65.057  11.605  1.00  0.83
ATOM   3039  O   ASN A 339     -17.076 -65.299  11.717  1.00  0.83
ATOM   3040  CB  ASN A 339     -19.395 -64.924  13.878  1.00  0.83
ATOM   3041  CG  ASN A 339     -19.851 -64.053  15.063  1.00  0.83
ATOM   3042  OD1 ASN A 339     -20.241 -62.896  14.946  1.00  0.83
ATOM   3043  ND2 ASN A 339     -19.894 -64.631  16.243  1.00  0.83
ATOM   3044  H   ASN A 339     -20.928 -63.478  12.641  1.00 99.99
ATOM   3045 1HD2 ASN A 339     -20.189 -64.076  17.016  1.00 99.99
ATOM   3046 2HD2 ASN A 339     -19.614 -65.580  16.364  1.00 99.99
ATOM   3047  N   ILE A 340     -19.031 -65.585  10.639  1.00  0.86
ATOM   3048  CA  ILE A 340     -18.437 -66.422   9.565  1.00  0.86
ATOM   3049  C   ILE A 340     -17.580 -65.623   8.563  1.00  0.86
ATOM   3050  O   ILE A 340     -16.732 -66.198   7.879  1.00  0.86
ATOM   3051  CB  ILE A 340     -19.429 -67.338   8.817  1.00  0.86
ATOM   3052  CG1 ILE A 340     -20.397 -66.573   7.901  1.00  0.86
ATOM   3053  CG2 ILE A 340     -20.177 -68.235   9.815  1.00  0.86
ATOM   3054  CD  ILE A 340     -20.882 -67.420   6.721  1.00  0.86
ATOM   3055  H   ILE A 340     -20.028 -65.492  10.599  1.00 99.99
ATOM   3056  N   PHE A 341     -17.862 -64.331   8.422  1.00  0.91
ATOM   3057  CA  PHE A 341     -17.120 -63.464   7.489  1.00  0.91
ATOM   3058  C   PHE A 341     -15.842 -62.914   8.139  1.00  0.91
ATOM   3059  O   PHE A 341     -15.898 -62.474   9.284  1.00  0.91
ATOM   3060  CB  PHE A 341     -18.008 -62.318   7.012  1.00  0.91
ATOM   3061  CG  PHE A 341     -19.032 -62.795   5.982  1.00  0.91
ATOM   3062  CD1 PHE A 341     -18.687 -62.792   4.640  1.00  0.91
ATOM   3063  CD2 PHE A 341     -20.287 -63.212   6.393  1.00  0.91
ATOM   3064  CE1 PHE A 341     -19.616 -63.216   3.689  1.00  0.91
ATOM   3065  CE2 PHE A 341     -21.216 -63.636   5.442  1.00  0.91
ATOM   3066  CZ  PHE A 341     -20.876 -63.633   4.096  1.00  0.91
ATOM   3067  H   PHE A 341     -18.477 -63.838   9.042  1.00 99.99
ATOM   3068  HD1 PHE A 341     -17.694 -62.457   4.342  1.00 99.99
ATOM   3069  HD2 PHE A 341     -20.541 -63.203   7.453  1.00 99.99
ATOM   3070  HE1 PHE A 341     -19.338 -63.249   2.637  1.00 99.99
ATOM   3071  HE2 PHE A 341     -22.193 -63.992   5.765  1.00 99.99
ATOM   3072  HZ  PHE A 341     -21.605 -63.960   3.349  1.00 99.99
ATOM   3073  N   PRO A 342     -14.710 -62.932   7.424  1.00  0.95
ATOM   3074  CA  PRO A 342     -13.413 -62.477   7.959  1.00  0.95
ATOM   3075  C   PRO A 342     -13.314 -60.954   8.115  1.00  0.95
ATOM   3076  O   PRO A 342     -14.055 -60.194   7.484  1.00  0.95
ATOM   3077  CB  PRO A 342     -12.399 -62.983   6.934  1.00  0.95
ATOM   3078  CG  PRO A 342     -13.172 -62.924   5.619  1.00  0.95
ATOM   3079  CD  PRO A 342     -14.571 -63.386   6.025  1.00  0.95
ATOM   3080  N   VAL A 343     -12.361 -60.531   8.938  1.00  0.95
ATOM   3081  CA  VAL A 343     -11.924 -59.120   8.967  1.00  0.95
ATOM   3082  C   VAL A 343     -10.924 -58.859   7.829  1.00  0.95
ATOM   3083  O   VAL A 343     -10.194 -59.760   7.408  1.00  0.95
ATOM   3084  CB  VAL A 343     -11.345 -58.697  10.332  1.00  0.95
ATOM   3085  CG1 VAL A 343     -12.427 -58.777  11.410  1.00  0.95
ATOM   3086  CG2 VAL A 343     -10.102 -59.490  10.756  1.00  0.95
ATOM   3087  H   VAL A 343     -11.869 -61.154   9.556  1.00 99.99
ATOM   3088  N   ILE A 344     -10.911 -57.627   7.339  1.00  0.94
ATOM   3089  CA  ILE A 344      -9.984 -57.226   6.262  1.00  0.94
ATOM   3090  C   ILE A 344      -9.092 -56.105   6.801  1.00  0.94
ATOM   3091  O   ILE A 344      -9.592 -55.066   7.236  1.00  0.94
ATOM   3092  CB  ILE A 344     -10.761 -56.818   4.994  1.00  0.94
ATOM   3093  CG1 ILE A 344     -11.577 -58.029   4.509  1.00  0.94
ATOM   3094  CG2 ILE A 344      -9.820 -56.280   3.899  1.00  0.94
ATOM   3095  CD  ILE A 344     -12.524 -57.745   3.346  1.00  0.94
ATOM   3096  H   ILE A 344     -11.478 -56.893   7.726  1.00 99.99
ATOM   3097  N   SER A 345      -7.792 -56.325   6.667  1.00  0.96
ATOM   3098  CA  SER A 345      -6.775 -55.387   7.174  1.00  0.96
ATOM   3099  C   SER A 345      -5.951 -54.845   6.007  1.00  0.96
ATOM   3100  O   SER A 345      -5.399 -55.616   5.214  1.00  0.96
ATOM   3101  CB  SER A 345      -5.806 -56.076   8.144  1.00  0.96
ATOM   3102  OG  SER A 345      -6.496 -56.770   9.187  1.00  0.96
ATOM   3103  H   SER A 345      -7.433 -57.143   6.203  1.00 99.99
ATOM   3104  HG  SER A 345      -5.829 -57.100   9.858  1.00 99.99
ATOM   3105  N   LEU A 346      -5.849 -53.524   5.957  1.00  0.97
ATOM   3106  CA  LEU A 346      -4.976 -52.827   4.996  1.00  0.97
ATOM   3107  C   LEU A 346      -3.850 -52.148   5.779  1.00  0.97
ATOM   3108  O   LEU A 346      -4.116 -51.395   6.719  1.00  0.97
ATOM   3109  CB  LEU A 346      -5.731 -51.739   4.216  1.00  0.97
ATOM   3110  CG  LEU A 346      -6.971 -52.193   3.435  1.00  0.97
ATOM   3111  CD1 LEU A 346      -7.601 -50.975   2.756  1.00  0.97
ATOM   3112  CD2 LEU A 346      -6.643 -53.249   2.377  1.00  0.97
ATOM   3113  H   LEU A 346      -6.335 -52.931   6.612  1.00 99.99
ATOM   3114  N   TYR A 347      -2.618 -52.544   5.491  1.00  0.95
ATOM   3115  CA  TYR A 347      -1.443 -51.846   6.045  1.00  0.95
ATOM   3116  C   TYR A 347      -1.104 -50.657   5.148  1.00  0.95
ATOM   3117  O   TYR A 347      -0.930 -50.808   3.937  1.00  0.95
ATOM   3118  CB  TYR A 347      -0.220 -52.761   6.137  1.00  0.95
ATOM   3119  CG  TYR A 347      -0.326 -53.812   7.237  1.00  0.95
ATOM   3120  CD1 TYR A 347      -1.238 -54.855   7.133  1.00  0.95
ATOM   3121  CD2 TYR A 347       0.553 -53.768   8.311  1.00  0.95
ATOM   3122  CE1 TYR A 347      -1.286 -55.841   8.103  1.00  0.95
ATOM   3123  CE2 TYR A 347       0.517 -54.760   9.279  1.00  0.95
ATOM   3124  CZ  TYR A 347      -0.408 -55.797   9.184  1.00  0.95
ATOM   3125  OH  TYR A 347      -0.473 -56.733  10.166  1.00  0.95
ATOM   3126  H   TYR A 347      -2.418 -53.289   4.844  1.00 99.99
ATOM   3127  HD1 TYR A 347      -1.907 -54.895   6.275  1.00 99.99
ATOM   3128  HD2 TYR A 347       1.269 -52.951   8.387  1.00 99.99
ATOM   3129  HE1 TYR A 347      -2.040 -56.621   8.018  1.00 99.99
ATOM   3130  HE2 TYR A 347       1.234 -54.728  10.101  1.00 99.99
ATOM   3131  HH  TYR A 347      -1.211 -57.386   9.997  1.00 99.99
ATOM   3132  N   LEU A 348      -0.957 -49.508   5.788  1.00  0.96
ATOM   3133  CA  LEU A 348      -0.617 -48.252   5.103  1.00  0.96
ATOM   3134  C   LEU A 348       0.800 -47.832   5.502  1.00  0.96
ATOM   3135  O   LEU A 348       1.254 -48.127   6.613  1.00  0.96
ATOM   3136  CB  LEU A 348      -1.620 -47.161   5.506  1.00  0.96
ATOM   3137  CG  LEU A 348      -3.072 -47.461   5.103  1.00  0.96
ATOM   3138  CD1 LEU A 348      -4.008 -46.441   5.752  1.00  0.96
ATOM   3139  CD2 LEU A 348      -3.256 -47.420   3.584  1.00  0.96
ATOM   3140  H   LEU A 348      -0.991 -49.453   6.793  1.00 99.99
ATOM   3141  N   MET A 349       1.506 -47.238   4.545  1.00  0.90
ATOM   3142  CA  MET A 349       2.839 -46.642   4.775  1.00  0.90
ATOM   3143  C   MET A 349       2.767 -45.621   5.930  1.00  0.90
ATOM   3144  O   MET A 349       1.812 -44.850   6.017  1.00  0.90
ATOM   3145  CB  MET A 349       3.243 -45.967   3.460  1.00  0.90
ATOM   3146  CG  MET A 349       4.606 -45.272   3.511  1.00  0.90
ATOM   3147  SD  MET A 349       4.971 -44.364   1.968  1.00  0.90
ATOM   3148  CE  MET A 349       5.875 -45.625   1.102  1.00  0.90
ATOM   3149  H   MET A 349       1.156 -47.146   3.608  1.00 99.99
ATOM   3150  N   GLY A 350       3.723 -45.714   6.861  1.00  0.93
ATOM   3151  CA  GLY A 350       3.766 -44.800   8.020  1.00  0.93
ATOM   3152  C   GLY A 350       4.520 -43.501   7.713  1.00  0.93
ATOM   3153  O   GLY A 350       4.971 -43.256   6.593  1.00  0.93
ATOM   3154  H   GLY A 350       4.482 -46.381   6.854  1.00 99.99
ATOM   3155  N   GLU A 351       4.714 -42.724   8.770  1.00  0.86
ATOM   3156  CA  GLU A 351       5.476 -41.461   8.714  1.00  0.86
ATOM   3157  C   GLU A 351       7.002 -41.675   8.705  1.00  0.86
ATOM   3158  O   GLU A 351       7.750 -40.786   8.295  1.00  0.86
ATOM   3159  CB  GLU A 351       5.074 -40.534   9.869  1.00  0.86
ATOM   3160  CG  GLU A 351       3.570 -40.238   9.869  1.00  0.86
ATOM   3161  CD  GLU A 351       3.233 -39.019  10.721  1.00  0.86
ATOM   3162  OE1 GLU A 351       2.955 -39.204  11.928  1.00  0.86
ATOM   3163  OE2 GLU A 351       3.243 -37.927  10.118  1.00  0.86
ATOM   3164  H   GLU A 351       4.345 -42.954   9.669  1.00 99.99
ATOM   3165  N   VAL A 352       7.453 -42.843   9.161  1.00  0.80
ATOM   3166  CA  VAL A 352       8.890 -43.141   9.353  1.00  0.80
ATOM   3167  C   VAL A 352       9.335 -44.285   8.419  1.00  0.80
ATOM   3168  O   VAL A 352       8.591 -45.244   8.189  1.00  0.80
ATOM   3169  CB  VAL A 352       9.145 -43.500  10.837  1.00  0.80
ATOM   3170  CG1 VAL A 352      10.629 -43.734  11.143  1.00  0.80
ATOM   3171  CG2 VAL A 352       8.626 -42.425  11.802  1.00  0.80
ATOM   3172  H   VAL A 352       6.836 -43.598   9.397  1.00 99.99
ATOM   3173  N   THR A 353      10.578 -44.191   7.945  1.00  0.67
ATOM   3174  CA  THR A 353      11.287 -45.259   7.196  1.00  0.67
ATOM   3175  C   THR A 353      11.096 -46.632   7.865  1.00  0.67
ATOM   3176  O   THR A 353      11.446 -46.828   9.029  1.00  0.67
ATOM   3177  CB  THR A 353      12.794 -44.945   7.125  1.00  0.67
ATOM   3178  OG1 THR A 353      12.980 -43.648   6.555  1.00  0.67
ATOM   3179  CG2 THR A 353      13.593 -45.968   6.304  1.00  0.67
ATOM   3180  H   THR A 353      11.074 -43.320   7.958  1.00 99.99
ATOM   3181  HG1 THR A 353      13.963 -43.466   6.466  1.00 99.99
ATOM   3182  N   ASN A 354      10.583 -47.562   7.065  1.00  0.76
ATOM   3183  CA  ASN A 354      10.311 -48.971   7.435  1.00  0.76
ATOM   3184  C   ASN A 354       9.227 -49.177   8.513  1.00  0.76
ATOM   3185  O   ASN A 354       9.027 -50.307   8.972  1.00  0.76
ATOM   3186  CB  ASN A 354      11.606 -49.713   7.818  1.00  0.76
ATOM   3187  CG  ASN A 354      12.639 -49.789   6.687  1.00  0.76
ATOM   3188  OD1 ASN A 354      12.357 -49.616   5.505  1.00  0.76
ATOM   3189  ND2 ASN A 354      13.877 -50.064   7.039  1.00  0.76
ATOM   3190  H   ASN A 354      10.320 -47.336   6.128  1.00 99.99
ATOM   3191 1HD2 ASN A 354      14.561 -50.118   6.318  1.00 99.99
ATOM   3192 2HD2 ASN A 354      14.108 -50.233   7.994  1.00 99.99
ATOM   3193  N   GLN A 355       8.394 -48.165   8.741  1.00  0.82
ATOM   3194  CA  GLN A 355       7.294 -48.223   9.724  1.00  0.82
ATOM   3195  C   GLN A 355       5.944 -48.140   9.003  1.00  0.82
ATOM   3196  O   GLN A 355       5.739 -47.294   8.135  1.00  0.82
ATOM   3197  CB  GLN A 355       7.482 -47.079  10.735  1.00  0.82
ATOM   3198  CG  GLN A 355       6.354 -46.897  11.763  1.00  0.82
ATOM   3199  CD  GLN A 355       5.284 -45.892  11.314  1.00  0.82
ATOM   3200  OE1 GLN A 355       5.554 -44.757  10.933  1.00  0.82
ATOM   3201  NE2 GLN A 355       4.028 -46.273  11.427  1.00  0.82
ATOM   3202  H   GLN A 355       8.469 -47.277   8.273  1.00 99.99
ATOM   3203 1HE2 GLN A 355       3.323 -45.626  11.151  1.00 99.99
ATOM   3204 2HE2 GLN A 355       3.792 -47.196  11.730  1.00 99.99
ATOM   3205  N   SER A 356       5.059 -49.058   9.358  1.00  0.91
ATOM   3206  CA  SER A 356       3.672 -49.075   8.861  1.00  0.91
ATOM   3207  C   SER A 356       2.695 -49.180  10.039  1.00  0.91
ATOM   3208  O   SER A 356       3.104 -49.237  11.203  1.00  0.91
ATOM   3209  CB  SER A 356       3.452 -50.234   7.876  1.00  0.91
ATOM   3210  OG  SER A 356       3.430 -51.505   8.533  1.00  0.91
ATOM   3211  H   SER A 356       5.283 -49.788  10.016  1.00 99.99
ATOM   3212  HG  SER A 356       3.402 -52.223   7.825  1.00 99.99
ATOM   3213  N   PHE A 357       1.427 -48.965   9.728  1.00  0.94
ATOM   3214  CA  PHE A 357       0.315 -49.268  10.645  1.00  0.94
ATOM   3215  C   PHE A 357      -0.778 -49.969   9.824  1.00  0.94
ATOM   3216  O   PHE A 357      -0.741 -49.935   8.591  1.00  0.94
ATOM   3217  CB  PHE A 357      -0.193 -47.987  11.328  1.00  0.94
ATOM   3218  CG  PHE A 357      -0.875 -47.002  10.374  1.00  0.94
ATOM   3219  CD1 PHE A 357      -0.108 -46.124   9.625  1.00  0.94
ATOM   3220  CD2 PHE A 357      -2.259 -46.973  10.295  1.00  0.94
ATOM   3221  CE1 PHE A 357      -0.729 -45.207   8.783  1.00  0.94
ATOM   3222  CE2 PHE A 357      -2.883 -46.041   9.465  1.00  0.94
ATOM   3223  CZ  PHE A 357      -2.116 -45.161   8.714  1.00  0.94
ATOM   3224  H   PHE A 357       1.138 -48.731   8.794  1.00 99.99
ATOM   3225  HD1 PHE A 357       0.977 -46.145   9.705  1.00 99.99
ATOM   3226  HD2 PHE A 357      -2.850 -47.665  10.893  1.00 99.99
ATOM   3227  HE1 PHE A 357      -0.116 -44.561   8.155  1.00 99.99
ATOM   3228  HE2 PHE A 357      -3.969 -45.974   9.446  1.00 99.99
ATOM   3229  HZ  PHE A 357      -2.607 -44.399   8.104  1.00 99.99
ATOM   3230  N   ARG A 358      -1.703 -50.633  10.500  1.00  0.91
ATOM   3231  CA  ARG A 358      -2.829 -51.274   9.796  1.00  0.91
ATOM   3232  C   ARG A 358      -4.176 -50.699  10.239  1.00  0.91
ATOM   3233  O   ARG A 358      -4.330 -50.253  11.381  1.00  0.91
ATOM   3234  CB  ARG A 358      -2.824 -52.809   9.909  1.00  0.91
ATOM   3235  CG  ARG A 358      -3.114 -53.363  11.307  1.00  0.91
ATOM   3236  CD  ARG A 358      -3.318 -54.878  11.269  1.00  0.91
ATOM   3237  NE  ARG A 358      -3.548 -55.340  12.647  1.00  0.91
ATOM   3238  CZ  ARG A 358      -2.936 -56.339  13.291  1.00  0.91
ATOM   3239  NH1 ARG A 358      -2.034 -57.115  12.710  1.00  0.91
ATOM   3240  NH2 ARG A 358      -3.209 -56.563  14.565  1.00  0.91
ATOM   3241  H   ARG A 358      -1.774 -50.576  11.502  1.00 99.99
ATOM   3242  HE  ARG A 358      -4.228 -54.814  13.157  1.00 99.99
ATOM   3243 1HH1 ARG A 358      -1.590 -57.846  13.224  1.00 99.99
ATOM   3244 2HH1 ARG A 358      -1.773 -56.932  11.765  1.00 99.99
ATOM   3245 1HH2 ARG A 358      -2.748 -57.299  15.059  1.00 99.99
ATOM   3246 2HH2 ARG A 358      -3.895 -56.010  15.037  1.00 99.99
ATOM   3247  N   ILE A 359      -5.091 -50.674   9.281  1.00  0.96
ATOM   3248  CA  ILE A 359      -6.512 -50.369   9.528  1.00  0.96
ATOM   3249  C   ILE A 359      -7.315 -51.642   9.212  1.00  0.96
ATOM   3250  O   ILE A 359      -7.059 -52.307   8.204  1.00  0.96
ATOM   3251  CB  ILE A 359      -7.000 -49.138   8.729  1.00  0.96
ATOM   3252  CG1 ILE A 359      -6.954 -49.332   7.203  1.00  0.96
ATOM   3253  CG2 ILE A 359      -6.203 -47.899   9.168  1.00  0.96
ATOM   3254  CD  ILE A 359      -7.749 -48.276   6.427  1.00  0.96
ATOM   3255  H   ILE A 359      -4.861 -50.894   8.326  1.00 99.99
ATOM   3256  N   THR A 360      -8.248 -51.976  10.092  1.00  0.95
ATOM   3257  CA  THR A 360      -8.994 -53.251  10.021  1.00  0.95
ATOM   3258  C   THR A 360     -10.498 -52.961   9.980  1.00  0.95
ATOM   3259  O   THR A 360     -11.027 -52.328  10.897  1.00  0.95
ATOM   3260  CB  THR A 360      -8.667 -54.144  11.236  1.00  0.95
ATOM   3261  OG1 THR A 360      -7.255 -54.354  11.339  1.00  0.95
ATOM   3262  CG2 THR A 360      -9.370 -55.506  11.178  1.00  0.95
ATOM   3263  H   THR A 360      -8.473 -51.378  10.868  1.00 99.99
ATOM   3264  HG1 THR A 360      -7.073 -54.977  12.102  1.00 99.99
ATOM   3265  N   ILE A 361     -11.161 -53.507   8.967  1.00  0.94
ATOM   3266  CA  ILE A 361     -12.630 -53.411   8.833  1.00  0.94
ATOM   3267  C   ILE A 361     -13.318 -54.770   9.036  1.00  0.94
ATOM   3268  O   ILE A 361     -12.734 -55.832   8.811  1.00  0.94
ATOM   3269  CB  ILE A 361     -13.101 -52.751   7.520  1.00  0.94
ATOM   3270  CG1 ILE A 361     -12.673 -53.522   6.261  1.00  0.94
ATOM   3271  CG2 ILE A 361     -12.659 -51.281   7.496  1.00  0.94
ATOM   3272  CD  ILE A 361     -13.534 -53.185   5.037  1.00  0.94
ATOM   3273  H   ILE A 361     -10.686 -54.023   8.242  1.00 99.99
ATOM   3274  N   LEU A 362     -14.591 -54.673   9.394  1.00  0.94
ATOM   3275  CA  LEU A 362     -15.472 -55.814   9.700  1.00  0.94
ATOM   3276  C   LEU A 362     -16.427 -56.062   8.515  1.00  0.94
ATOM   3277  O   LEU A 362     -16.626 -55.146   7.708  1.00  0.94
ATOM   3278  CB  LEU A 362     -16.315 -55.451  10.933  1.00  0.94
ATOM   3279  CG  LEU A 362     -15.546 -54.960  12.166  1.00  0.94
ATOM   3280  CD1 LEU A 362     -16.552 -54.691  13.280  1.00  0.94
ATOM   3281  CD2 LEU A 362     -14.489 -55.955  12.652  1.00  0.94
ATOM   3282  H   LEU A 362     -15.057 -53.793   9.445  1.00 99.99
ATOM   3283  N   PRO A 363     -17.091 -57.228   8.448  1.00  0.96
ATOM   3284  CA  PRO A 363     -18.175 -57.462   7.477  1.00  0.96
ATOM   3285  C   PRO A 363     -19.342 -56.469   7.576  1.00  0.96
ATOM   3286  O   PRO A 363     -19.952 -56.187   6.546  1.00  0.96
ATOM   3287  CB  PRO A 363     -18.625 -58.902   7.701  1.00  0.96
ATOM   3288  CG  PRO A 363     -18.189 -59.196   9.135  1.00  0.96
ATOM   3289  CD  PRO A 363     -16.865 -58.442   9.258  1.00  0.96
ATOM   3290  N   GLN A 364     -19.558 -55.853   8.739  1.00  0.86
ATOM   3291  CA  GLN A 364     -20.550 -54.767   8.909  1.00  0.86
ATOM   3292  C   GLN A 364     -20.290 -53.567   7.980  1.00  0.86
ATOM   3293  O   GLN A 364     -21.236 -52.920   7.530  1.00  0.86
ATOM   3294  CB  GLN A 364     -20.633 -54.288  10.366  1.00  0.86
ATOM   3295  CG  GLN A 364     -21.342 -55.270  11.311  1.00  0.86
ATOM   3296  CD  GLN A 364     -20.465 -56.388  11.888  1.00  0.86
ATOM   3297  OE1 GLN A 364     -19.397 -56.744  11.400  1.00  0.86
ATOM   3298  NE2 GLN A 364     -20.901 -56.929  13.003  1.00  0.86
ATOM   3299  H   GLN A 364     -19.145 -56.156   9.604  1.00 99.99
ATOM   3300 1HE2 GLN A 364     -20.349 -57.667  13.398  1.00 99.99
ATOM   3301 2HE2 GLN A 364     -21.768 -56.646  13.402  1.00 99.99
ATOM   3302  N   GLN A 365     -19.019 -53.310   7.676  1.00  0.89
ATOM   3303  CA  GLN A 365     -18.618 -52.313   6.665  1.00  0.89
ATOM   3304  C   GLN A 365     -18.754 -52.800   5.211  1.00  0.89
ATOM   3305  O   GLN A 365     -19.337 -52.088   4.390  1.00  0.89
ATOM   3306  CB  GLN A 365     -17.182 -51.830   6.898  1.00  0.89
ATOM   3307  CG  GLN A 365     -17.039 -50.759   7.987  1.00  0.89
ATOM   3308  CD  GLN A 365     -17.271 -51.278   9.408  1.00  0.89
ATOM   3309  OE1 GLN A 365     -18.301 -51.076  10.032  1.00  0.89
ATOM   3310  NE2 GLN A 365     -16.259 -51.904   9.973  1.00  0.89
ATOM   3311  H   GLN A 365     -18.257 -53.758   8.144  1.00 99.99
ATOM   3312 1HE2 GLN A 365     -16.404 -52.221  10.907  1.00 99.99
ATOM   3313 2HE2 GLN A 365     -15.380 -51.921   9.509  1.00 99.99
ATOM   3314  N   TYR A 366     -18.316 -54.022   4.913  1.00  0.90
ATOM   3315  CA  TYR A 366     -18.218 -54.464   3.504  1.00  0.90
ATOM   3316  C   TYR A 366     -19.410 -55.274   2.959  1.00  0.90
ATOM   3317  O   TYR A 366     -19.473 -55.543   1.756  1.00  0.90
ATOM   3318  CB  TYR A 366     -16.860 -55.108   3.183  1.00  0.90
ATOM   3319  CG  TYR A 366     -16.593 -56.470   3.832  1.00  0.90
ATOM   3320  CD1 TYR A 366     -17.150 -57.612   3.275  1.00  0.90
ATOM   3321  CD2 TYR A 366     -15.702 -56.579   4.890  1.00  0.90
ATOM   3322  CE1 TYR A 366     -16.829 -58.864   3.786  1.00  0.90
ATOM   3323  CE2 TYR A 366     -15.372 -57.831   5.401  1.00  0.90
ATOM   3324  CZ  TYR A 366     -15.937 -58.974   4.843  1.00  0.90
ATOM   3325  OH  TYR A 366     -15.628 -60.210   5.318  1.00  0.90
ATOM   3326  H   TYR A 366     -18.177 -54.736   5.602  1.00 99.99
ATOM   3327  HD1 TYR A 366     -17.819 -57.522   2.419  1.00 99.99
ATOM   3328  HD2 TYR A 366     -15.238 -55.680   5.293  1.00 99.99
ATOM   3329  HE1 TYR A 366     -17.332 -59.749   3.395  1.00 99.99
ATOM   3330  HE2 TYR A 366     -14.697 -57.903   6.255  1.00 99.99
ATOM   3331  HH  TYR A 366     -14.987 -60.137   6.101  1.00 99.99
ATOM   3332  N   LEU A 367     -20.310 -55.697   3.840  1.00  0.91
ATOM   3333  CA  LEU A 367     -21.608 -56.283   3.459  1.00  0.91
ATOM   3334  C   LEU A 367     -22.687 -55.238   3.757  1.00  0.91
ATOM   3335  O   LEU A 367     -23.083 -55.036   4.908  1.00  0.91
ATOM   3336  CB  LEU A 367     -21.918 -57.557   4.259  1.00  0.91
ATOM   3337  CG  LEU A 367     -20.933 -58.713   4.066  1.00  0.91
ATOM   3338  CD1 LEU A 367     -21.319 -59.858   5.003  1.00  0.91
ATOM   3339  CD2 LEU A 367     -20.939 -59.213   2.621  1.00  0.91
ATOM   3340  H   LEU A 367     -20.173 -55.645   4.836  1.00 99.99
ATOM   3341  N   ARG A 368     -23.063 -54.502   2.722  1.00  0.76
ATOM   3342  CA  ARG A 368     -24.048 -53.415   2.866  1.00  0.76
ATOM   3343  C   ARG A 368     -25.489 -53.926   2.721  1.00  0.76
ATOM   3344  O   ARG A 368     -25.779 -54.624   1.745  1.00  0.76
ATOM   3345  CB  ARG A 368     -23.752 -52.297   1.862  1.00  0.76
ATOM   3346  CG  ARG A 368     -22.475 -51.551   2.257  1.00  0.76
ATOM   3347  CD  ARG A 368     -22.235 -50.352   1.342  1.00  0.76
ATOM   3348  NE  ARG A 368     -21.945 -49.186   2.191  1.00  0.76
ATOM   3349  CZ  ARG A 368     -22.705 -48.092   2.300  1.00  0.76
ATOM   3350  NH1 ARG A 368     -22.368 -47.144   3.148  1.00  0.76
ATOM   3351  NH2 ARG A 368     -23.807 -47.909   1.587  1.00  0.76
ATOM   3352  H   ARG A 368     -22.736 -54.677   1.787  1.00 99.99
ATOM   3353  HE  ARG A 368     -21.120 -49.261   2.750  1.00 99.99
ATOM   3354 1HH1 ARG A 368     -22.926 -46.323   3.250  1.00 99.99
ATOM   3355 2HH1 ARG A 368     -21.572 -47.275   3.741  1.00 99.99
ATOM   3356 1HH2 ARG A 368     -24.347 -47.083   1.710  1.00 99.99
ATOM   3357 2HH2 ARG A 368     -24.086 -48.620   0.945  1.00 99.99
ATOM   3358  N   PRO A 369     -26.373 -53.651   3.693  1.00  0.75
ATOM   3359  CA  PRO A 369     -27.790 -54.046   3.591  1.00  0.75
ATOM   3360  C   PRO A 369     -28.483 -53.246   2.479  1.00  0.75
ATOM   3361  O   PRO A 369     -28.149 -52.089   2.223  1.00  0.75
ATOM   3362  CB  PRO A 369     -28.376 -53.754   4.975  1.00  0.75
ATOM   3363  CG  PRO A 369     -27.520 -52.600   5.498  1.00  0.75
ATOM   3364  CD  PRO A 369     -26.124 -52.898   4.941  1.00  0.75
ATOM   3365  N   VAL A 370     -29.411 -53.898   1.789  1.00  0.75
ATOM   3366  CA  VAL A 370     -30.209 -53.252   0.731  1.00  0.75
ATOM   3367  C   VAL A 370     -31.668 -53.286   1.192  1.00  0.75
ATOM   3368  O   VAL A 370     -32.341 -54.314   1.140  1.00  0.75
ATOM   3369  CB  VAL A 370     -30.024 -53.924  -0.644  1.00  0.75
ATOM   3370  CG1 VAL A 370     -30.817 -53.195  -1.737  1.00  0.75
ATOM   3371  CG2 VAL A 370     -28.550 -53.956  -1.058  1.00  0.75
ATOM   3372  H   VAL A 370     -29.600 -54.878   1.930  1.00 99.99
ATOM   3373  N   GLU A 371     -32.128 -52.106   1.576  1.00  0.58
ATOM   3374  CA  GLU A 371     -33.486 -51.902   2.121  1.00  0.58
ATOM   3375  C   GLU A 371     -34.511 -51.463   1.058  1.00  0.58
ATOM   3376  O   GLU A 371     -35.679 -51.233   1.362  1.00  0.58
ATOM   3377  CB  GLU A 371     -33.385 -50.903   3.279  1.00  0.58
ATOM   3378  CG  GLU A 371     -32.793 -49.551   2.858  1.00  0.58
ATOM   3379  CD  GLU A 371     -31.794 -49.002   3.878  1.00  0.58
ATOM   3380  OE1 GLU A 371     -32.010 -49.176   5.093  1.00  0.58
ATOM   3381  OE2 GLU A 371     -30.842 -48.343   3.411  1.00  0.58
ATOM   3382  H   GLU A 371     -31.572 -51.278   1.508  1.00 99.99
ATOM   3383  N   ASP A 372     -34.053 -51.413  -0.189  1.00  0.47
ATOM   3384  CA  ASP A 372     -34.869 -51.050  -1.360  1.00  0.47
ATOM   3385  C   ASP A 372     -35.520 -52.297  -2.001  1.00  0.47
ATOM   3386  O   ASP A 372     -36.205 -52.188  -3.018  1.00  0.47
ATOM   3387  CB  ASP A 372     -33.925 -50.346  -2.343  1.00  0.47
ATOM   3388  CG  ASP A 372     -34.532 -49.176  -3.131  1.00  0.47
ATOM   3389  OD1 ASP A 372     -35.753 -48.939  -3.015  1.00  0.47
ATOM   3390  OD2 ASP A 372     -33.722 -48.509  -3.811  1.00  0.47
ATOM   3391  H   ASP A 372     -33.109 -51.653  -0.409  1.00 99.99
ATOM   3392  N   VAL A 373     -35.211 -53.478  -1.470  1.00  0.53
ATOM   3393  CA  VAL A 373     -35.752 -54.768  -1.952  1.00  0.53
ATOM   3394  C   VAL A 373     -37.272 -54.885  -1.756  1.00  0.53
ATOM   3395  O   VAL A 373     -37.808 -54.535  -0.704  1.00  0.53
ATOM   3396  CB  VAL A 373     -35.027 -55.966  -1.301  1.00  0.53
ATOM   3397  CG1 VAL A 373     -33.549 -55.973  -1.692  1.00  0.53
ATOM   3398  CG2 VAL A 373     -35.162 -56.038   0.228  1.00  0.53
ATOM   3399  H   VAL A 373     -34.623 -53.566  -0.665  1.00 99.99
ATOM   3400  N   ALA A 374     -37.926 -55.481  -2.746  1.00  0.57
ATOM   3401  CA  ALA A 374     -39.353 -55.849  -2.643  1.00  0.57
ATOM   3402  C   ALA A 374     -39.572 -57.082  -1.743  1.00  0.57
ATOM   3403  O   ALA A 374     -40.684 -57.348  -1.285  1.00  0.57
ATOM   3404  CB  ALA A 374     -39.930 -56.069  -4.043  1.00  0.57
ATOM   3405  H   ALA A 374     -37.497 -55.688  -3.625  1.00 99.99
ATOM   3406  N   THR A 375     -38.504 -57.848  -1.529  1.00  0.50
ATOM   3407  CA  THR A 375     -38.475 -59.027  -0.638  1.00  0.50
ATOM   3408  C   THR A 375     -38.400 -58.602   0.841  1.00  0.50
ATOM   3409  O   THR A 375     -37.481 -58.982   1.574  1.00  0.50
ATOM   3410  CB  THR A 375     -37.301 -59.938  -1.042  1.00  0.50
ATOM   3411  OG1 THR A 375     -36.091 -59.180  -1.165  1.00  0.50
ATOM   3412  CG2 THR A 375     -37.583 -60.664  -2.361  1.00  0.50
ATOM   3413  H   THR A 375     -37.606 -57.639  -1.916  1.00 99.99
ATOM   3414  HG1 THR A 375     -35.335 -59.812  -1.344  1.00 99.99
ATOM   3415  N   SER A 376     -39.502 -58.021   1.312  1.00  0.54
ATOM   3416  CA  SER A 376     -39.634 -57.429   2.666  1.00  0.54
ATOM   3417  C   SER A 376     -39.393 -58.384   3.845  1.00  0.54
ATOM   3418  O   SER A 376     -39.100 -57.941   4.954  1.00  0.54
ATOM   3419  CB  SER A 376     -41.004 -56.764   2.841  1.00  0.54
ATOM   3420  OG  SER A 376     -42.071 -57.718   2.733  1.00  0.54
ATOM   3421  H   SER A 376     -40.310 -57.882   0.729  1.00 99.99
ATOM   3422  HG  SER A 376     -42.941 -57.219   2.813  1.00 99.99
ATOM   3423  N   GLN A 377     -39.580 -59.676   3.606  1.00  0.51
ATOM   3424  CA  GLN A 377     -39.428 -60.728   4.630  1.00  0.51
ATOM   3425  C   GLN A 377     -37.961 -61.112   4.916  1.00  0.51
ATOM   3426  O   GLN A 377     -37.657 -61.678   5.969  1.00  0.51
ATOM   3427  CB  GLN A 377     -40.242 -61.961   4.212  1.00  0.51
ATOM   3428  CG  GLN A 377     -41.713 -61.668   3.870  1.00  0.51
ATOM   3429  CD  GLN A 377     -42.512 -61.060   5.028  1.00  0.51
ATOM   3430  OE1 GLN A 377     -42.947 -61.741   5.944  1.00  0.51
ATOM   3431  NE2 GLN A 377     -42.734 -59.762   4.990  1.00  0.51
ATOM   3432  H   GLN A 377     -39.848 -60.010   2.703  1.00 99.99
ATOM   3433 1HE2 GLN A 377     -43.244 -59.375   5.754  1.00 99.99
ATOM   3434 2HE2 GLN A 377     -42.388 -59.192   4.244  1.00 99.99
ATOM   3435  N   ASP A 378     -37.062 -60.838   3.969  1.00  0.58
ATOM   3436  CA  ASP A 378     -35.649 -61.258   4.069  1.00  0.58
ATOM   3437  C   ASP A 378     -34.688 -60.059   4.096  1.00  0.58
ATOM   3438  O   ASP A 378     -34.766 -59.170   3.247  1.00  0.58
ATOM   3439  CB  ASP A 378     -35.309 -62.150   2.867  1.00  0.58
ATOM   3440  CG  ASP A 378     -36.177 -63.410   2.756  1.00  0.58
ATOM   3441  OD1 ASP A 378     -36.291 -64.130   3.773  1.00  0.58
ATOM   3442  OD2 ASP A 378     -36.707 -63.624   1.644  1.00  0.58
ATOM   3443  H   ASP A 378     -37.265 -60.231   3.192  1.00 99.99
ATOM   3444  N   ASP A 379     -33.736 -60.095   5.022  1.00  0.61
ATOM   3445  CA  ASP A 379     -32.609 -59.139   5.077  1.00  0.61
ATOM   3446  C   ASP A 379     -31.578 -59.441   3.976  1.00  0.61
ATOM   3447  O   ASP A 379     -30.845 -60.430   4.071  1.00  0.61
ATOM   3448  CB  ASP A 379     -31.943 -59.198   6.458  1.00  0.61
ATOM   3449  CG  ASP A 379     -32.573 -58.287   7.518  1.00  0.61
ATOM   3450  OD1 ASP A 379     -33.770 -57.954   7.385  1.00  0.61
ATOM   3451  OD2 ASP A 379     -31.810 -57.941   8.446  1.00  0.61
ATOM   3452  H   ASP A 379     -33.689 -60.843   5.691  1.00 99.99
ATOM   3453  N   CYS A 380     -31.528 -58.587   2.959  1.00  0.74
ATOM   3454  CA  CYS A 380     -30.645 -58.793   1.791  1.00  0.74
ATOM   3455  C   CYS A 380     -29.436 -57.847   1.813  1.00  0.74
ATOM   3456  O   CYS A 380     -29.575 -56.653   2.085  1.00  0.74
ATOM   3457  CB  CYS A 380     -31.448 -58.580   0.506  1.00  0.74
ATOM   3458  SG  CYS A 380     -32.821 -59.767   0.263  1.00  0.74
ATOM   3459  H   CYS A 380     -32.079 -57.749   2.931  1.00 99.99
ATOM   3460  N   TYR A 381     -28.278 -58.400   1.475  1.00  0.82
ATOM   3461  CA  TYR A 381     -26.979 -57.697   1.506  1.00  0.82
ATOM   3462  C   TYR A 381     -26.275 -57.734   0.143  1.00  0.82
ATOM   3463  O   TYR A 381     -26.359 -58.724  -0.590  1.00  0.82
ATOM   3464  CB  TYR A 381     -26.053 -58.329   2.557  1.00  0.82
ATOM   3465  CG  TYR A 381     -26.581 -58.188   3.986  1.00  0.82
ATOM   3466  CD1 TYR A 381     -26.151 -57.147   4.799  1.00  0.82
ATOM   3467  CD2 TYR A 381     -27.547 -59.070   4.454  1.00  0.82
ATOM   3468  CE1 TYR A 381     -26.694 -56.985   6.067  1.00  0.82
ATOM   3469  CE2 TYR A 381     -28.102 -58.906   5.712  1.00  0.82
ATOM   3470  CZ  TYR A 381     -27.678 -57.859   6.530  1.00  0.82
ATOM   3471  OH  TYR A 381     -28.166 -57.739   7.797  1.00  0.82
ATOM   3472  H   TYR A 381     -28.226 -59.366   1.189  1.00 99.99
ATOM   3473  HD1 TYR A 381     -25.372 -56.472   4.442  1.00 99.99
ATOM   3474  HD2 TYR A 381     -27.847 -59.910   3.828  1.00 99.99
ATOM   3475  HE1 TYR A 381     -26.327 -56.171   6.695  1.00 99.99
ATOM   3476  HE2 TYR A 381     -28.866 -59.611   6.041  1.00 99.99
ATOM   3477  HH  TYR A 381     -28.987 -58.300   7.935  1.00 99.99
ATOM   3478  N   LYS A 382     -25.544 -56.657  -0.116  1.00  0.82
ATOM   3479  CA  LYS A 382     -24.680 -56.459  -1.296  1.00  0.82
ATOM   3480  C   LYS A 382     -23.217 -56.526  -0.832  1.00  0.82
ATOM   3481  O   LYS A 382     -22.839 -55.851   0.132  1.00  0.82
ATOM   3482  CB  LYS A 382     -24.971 -55.051  -1.846  1.00  0.82
ATOM   3483  CG  LYS A 382     -24.086 -54.567  -3.004  1.00  0.82
ATOM   3484  CD  LYS A 382     -24.487 -55.137  -4.369  1.00  0.82
ATOM   3485  CE  LYS A 382     -23.554 -54.661  -5.491  1.00  0.82
ATOM   3486  NZ  LYS A 382     -23.565 -53.202  -5.688  1.00  0.82
ATOM   3487  H   LYS A 382     -25.544 -55.877   0.523  1.00 99.99
ATOM   3488  HZ1 LYS A 382     -22.952 -52.967  -6.442  1.00 99.99
ATOM   3489  HZ2 LYS A 382     -24.492 -52.899  -5.907  1.00 99.99
ATOM   3490  HZ3 LYS A 382     -23.251 -52.757  -4.849  1.00 99.99
ATOM   3491  N   PHE A 383     -22.424 -57.353  -1.504  1.00  0.91
ATOM   3492  CA  PHE A 383     -20.958 -57.329  -1.340  1.00  0.91
ATOM   3493  C   PHE A 383     -20.430 -56.001  -1.915  1.00  0.91
ATOM   3494  O   PHE A 383     -20.665 -55.675  -3.079  1.00  0.91
ATOM   3495  CB  PHE A 383     -20.362 -58.546  -2.054  1.00  0.91
ATOM   3496  CG  PHE A 383     -18.880 -58.768  -1.727  1.00  0.91
ATOM   3497  CD1 PHE A 383     -18.486 -59.073  -0.432  1.00  0.91
ATOM   3498  CD2 PHE A 383     -17.950 -58.754  -2.753  1.00  0.91
ATOM   3499  CE1 PHE A 383     -17.149 -59.365  -0.158  1.00  0.91
ATOM   3500  CE2 PHE A 383     -16.615 -59.058  -2.485  1.00  0.91
ATOM   3501  CZ  PHE A 383     -16.221 -59.363  -1.190  1.00  0.91
ATOM   3502  H   PHE A 383     -22.764 -58.035  -2.154  1.00 99.99
ATOM   3503  HD1 PHE A 383     -19.226 -59.097   0.363  1.00 99.99
ATOM   3504  HD2 PHE A 383     -18.263 -58.497  -3.764  1.00 99.99
ATOM   3505  HE1 PHE A 383     -16.827 -59.533   0.869  1.00 99.99
ATOM   3506  HE2 PHE A 383     -15.887 -59.043  -3.295  1.00 99.99
ATOM   3507  HZ  PHE A 383     -15.170 -59.575  -0.977  1.00 99.99
ATOM   3508  N   ALA A 384     -19.788 -55.220  -1.052  1.00  0.95
ATOM   3509  CA  ALA A 384     -19.371 -53.843  -1.381  1.00  0.95
ATOM   3510  C   ALA A 384     -17.848 -53.682  -1.541  1.00  0.95
ATOM   3511  O   ALA A 384     -17.263 -52.615  -1.329  1.00  0.95
ATOM   3512  CB  ALA A 384     -19.947 -52.907  -0.317  1.00  0.95
ATOM   3513  H   ALA A 384     -19.560 -55.515  -0.118  1.00 99.99
ATOM   3514  N   ILE A 385     -17.215 -54.786  -1.921  1.00  0.94
ATOM   3515  CA  ILE A 385     -15.832 -54.786  -2.428  1.00  0.94
ATOM   3516  C   ILE A 385     -15.969 -55.137  -3.915  1.00  0.94
ATOM   3517  O   ILE A 385     -16.702 -56.061  -4.269  1.00  0.94
ATOM   3518  CB  ILE A 385     -14.969 -55.812  -1.673  1.00  0.94
ATOM   3519  CG1 ILE A 385     -14.949 -55.474  -0.175  1.00  0.94
ATOM   3520  CG2 ILE A 385     -13.542 -55.845  -2.248  1.00  0.94
ATOM   3521  CD  ILE A 385     -14.351 -56.582   0.691  1.00  0.94
ATOM   3522  H   ILE A 385     -17.665 -55.680  -1.947  1.00 99.99
ATOM   3523  N   SER A 386     -15.269 -54.393  -4.760  1.00  0.94
ATOM   3524  CA  SER A 386     -15.399 -54.556  -6.223  1.00  0.94
ATOM   3525  C   SER A 386     -14.104 -54.270  -6.983  1.00  0.94
ATOM   3526  O   SER A 386     -13.149 -53.713  -6.434  1.00  0.94
ATOM   3527  CB  SER A 386     -16.558 -53.729  -6.806  1.00  0.94
ATOM   3528  OG  SER A 386     -16.399 -52.321  -6.600  1.00  0.94
ATOM   3529  H   SER A 386     -14.549 -53.765  -4.449  1.00 99.99
ATOM   3530  HG  SER A 386     -17.099 -51.836  -7.134  1.00 99.99
ATOM   3531  N   GLN A 387     -14.037 -54.816  -8.190  1.00  0.90
ATOM   3532  CA  GLN A 387     -12.888 -54.633  -9.102  1.00  0.90
ATOM   3533  C   GLN A 387     -12.792 -53.174  -9.588  1.00  0.90
ATOM   3534  O   GLN A 387     -13.782 -52.450  -9.682  1.00  0.90
ATOM   3535  CB  GLN A 387     -12.965 -55.552 -10.334  1.00  0.90
ATOM   3536  CG  GLN A 387     -13.766 -56.847 -10.140  1.00  0.90
ATOM   3537  CD  GLN A 387     -13.561 -57.835 -11.285  1.00  0.90
ATOM   3538  OE1 GLN A 387     -14.279 -57.882 -12.273  1.00  0.90
ATOM   3539  NE2 GLN A 387     -12.558 -58.671 -11.135  1.00  0.90
ATOM   3540  H   GLN A 387     -14.771 -55.396  -8.548  1.00 99.99
ATOM   3541 1HE2 GLN A 387     -12.411 -59.337 -11.860  1.00 99.99
ATOM   3542 2HE2 GLN A 387     -11.995 -58.624 -10.318  1.00 99.99
ATOM   3543  N   SER A 388     -11.561 -52.765  -9.872  1.00  0.94
ATOM   3544  CA  SER A 388     -11.234 -51.435 -10.416  1.00  0.94
ATOM   3545  C   SER A 388     -10.065 -51.567 -11.390  1.00  0.94
ATOM   3546  O   SER A 388      -9.158 -52.385 -11.203  1.00  0.94
ATOM   3547  CB  SER A 388     -10.844 -50.464  -9.292  1.00  0.94
ATOM   3548  OG  SER A 388     -10.489 -49.160  -9.780  1.00  0.94
ATOM   3549  H   SER A 388     -10.769 -53.354  -9.705  1.00 99.99
ATOM   3550  HG  SER A 388     -10.282 -48.611  -8.954  1.00 99.99
ATOM   3551  N   SER A 389     -10.157 -50.757 -12.432  1.00  0.90
ATOM   3552  CA  SER A 389      -9.068 -50.524 -13.399  1.00  0.90
ATOM   3553  C   SER A 389      -8.421 -49.147 -13.177  1.00  0.90
ATOM   3554  O   SER A 389      -7.485 -48.779 -13.889  1.00  0.90
ATOM   3555  CB  SER A 389      -9.629 -50.606 -14.823  1.00  0.90
ATOM   3556  OG  SER A 389     -10.769 -49.746 -14.951  1.00  0.90
ATOM   3557  H   SER A 389     -10.991 -50.241 -12.639  1.00 99.99
ATOM   3558  HG  SER A 389     -11.088 -49.768 -15.902  1.00 99.99
ATOM   3559  N   THR A 390      -8.850 -48.455 -12.122  1.00  0.91
ATOM   3560  CA  THR A 390      -8.325 -47.122 -11.750  1.00  0.91
ATOM   3561  C   THR A 390      -7.658 -47.131 -10.361  1.00  0.91
ATOM   3562  O   THR A 390      -7.540 -46.101  -9.705  1.00  0.91
ATOM   3563  CB  THR A 390      -9.413 -46.028 -11.844  1.00  0.91
ATOM   3564  OG1 THR A 390     -10.516 -46.270 -10.959  1.00  0.91
ATOM   3565  CG2 THR A 390      -9.926 -45.856 -13.279  1.00  0.91
ATOM   3566  H   THR A 390      -9.557 -48.813 -11.503  1.00 99.99
ATOM   3567  HG1 THR A 390     -10.404 -47.126 -10.459  1.00 99.99
ATOM   3568  N   GLY A 391      -7.195 -48.317  -9.932  1.00  0.96
ATOM   3569  CA  GLY A 391      -6.497 -48.499  -8.641  1.00  0.96
ATOM   3570  C   GLY A 391      -7.441 -48.680  -7.444  1.00  0.96
ATOM   3571  O   GLY A 391      -8.665 -48.740  -7.602  1.00  0.96
ATOM   3572  H   GLY A 391      -7.324 -49.175 -10.439  1.00 99.99
ATOM   3573  N   THR A 392      -6.842 -48.854  -6.266  1.00  0.97
ATOM   3574  CA  THR A 392      -7.609 -48.973  -5.006  1.00  0.97
ATOM   3575  C   THR A 392      -8.317 -47.651  -4.702  1.00  0.97
ATOM   3576  O   THR A 392      -7.708 -46.584  -4.624  1.00  0.97
ATOM   3577  CB  THR A 392      -6.765 -49.378  -3.782  1.00  0.97
ATOM   3578  OG1 THR A 392      -6.154 -50.637  -4.038  1.00  0.97
ATOM   3579  CG2 THR A 392      -7.600 -49.545  -2.505  1.00  0.97
ATOM   3580  H   THR A 392      -5.846 -48.858  -6.169  1.00 99.99
ATOM   3581  HG1 THR A 392      -5.543 -50.864  -3.270  1.00 99.99
ATOM   3582  N   VAL A 393      -9.593 -47.802  -4.387  1.00  0.97
ATOM   3583  CA  VAL A 393     -10.413 -46.676  -3.919  1.00  0.97
ATOM   3584  C   VAL A 393     -10.968 -47.038  -2.537  1.00  0.97
ATOM   3585  O   VAL A 393     -11.781 -47.957  -2.402  1.00  0.97
ATOM   3586  CB  VAL A 393     -11.533 -46.319  -4.914  1.00  0.97
ATOM   3587  CG1 VAL A 393     -12.246 -45.047  -4.456  1.00  0.97
ATOM   3588  CG2 VAL A 393     -11.014 -46.094  -6.340  1.00  0.97
ATOM   3589  H   VAL A 393     -10.036 -48.705  -4.418  1.00 99.99
ATOM   3590  N   MET A 394     -10.425 -46.369  -1.529  1.00  0.96
ATOM   3591  CA  MET A 394     -10.875 -46.511  -0.131  1.00  0.96
ATOM   3592  C   MET A 394     -12.126 -45.646   0.096  1.00  0.96
ATOM   3593  O   MET A 394     -12.039 -44.479   0.497  1.00  0.96
ATOM   3594  CB  MET A 394      -9.728 -46.112   0.805  1.00  0.96
ATOM   3595  CG  MET A 394      -8.540 -47.076   0.720  1.00  0.96
ATOM   3596  SD  MET A 394      -7.014 -46.436   1.503  1.00  0.96
ATOM   3597  CE  MET A 394      -7.513 -46.344   3.209  1.00  0.96
ATOM   3598  H   MET A 394      -9.697 -45.683  -1.666  1.00 99.99
ATOM   3599  N   GLY A 395     -13.257 -46.203  -0.355  1.00  0.98
ATOM   3600  CA  GLY A 395     -14.568 -45.532  -0.276  1.00  0.98
ATOM   3601  C   GLY A 395     -15.204 -45.560   1.120  1.00  0.98
ATOM   3602  O   GLY A 395     -14.559 -45.882   2.124  1.00  0.98
ATOM   3603  H   GLY A 395     -13.298 -47.097  -0.825  1.00 99.99
ATOM   3604  N   ALA A 396     -16.523 -45.400   1.116  1.00  0.95
ATOM   3605  CA  ALA A 396     -17.361 -45.364   2.329  1.00  0.95
ATOM   3606  C   ALA A 396     -17.246 -46.620   3.203  1.00  0.95
ATOM   3607  O   ALA A 396     -17.140 -46.468   4.421  1.00  0.95
ATOM   3608  CB  ALA A 396     -18.821 -45.103   1.953  1.00  0.95
ATOM   3609  H   ALA A 396     -17.017 -45.215   0.258  1.00 99.99
ATOM   3610  N   VAL A 397     -17.103 -47.806   2.617  1.00  0.89
ATOM   3611  CA  VAL A 397     -16.893 -49.038   3.422  1.00  0.89
ATOM   3612  C   VAL A 397     -15.609 -48.975   4.283  1.00  0.89
ATOM   3613  O   VAL A 397     -15.572 -49.533   5.379  1.00  0.89
ATOM   3614  CB  VAL A 397     -17.014 -50.368   2.639  1.00  0.89
ATOM   3615  CG1 VAL A 397     -18.090 -50.333   1.551  1.00  0.89
ATOM   3616  CG2 VAL A 397     -15.705 -50.932   2.086  1.00  0.89
ATOM   3617  H   VAL A 397     -17.364 -47.958   1.656  1.00 99.99
ATOM   3618  N   ILE A 398     -14.559 -48.328   3.778  1.00  0.94
ATOM   3619  CA  ILE A 398     -13.352 -48.068   4.595  1.00  0.94
ATOM   3620  C   ILE A 398     -13.649 -46.926   5.581  1.00  0.94
ATOM   3621  O   ILE A 398     -13.526 -47.105   6.793  1.00  0.94
ATOM   3622  CB  ILE A 398     -12.102 -47.784   3.730  1.00  0.94
ATOM   3623  CG1 ILE A 398     -11.677 -49.015   2.909  1.00  0.94
ATOM   3624  CG2 ILE A 398     -10.922 -47.211   4.538  1.00  0.94
ATOM   3625  CD  ILE A 398     -11.224 -50.245   3.714  1.00  0.94
ATOM   3626  H   ILE A 398     -14.581 -47.871   2.885  1.00 99.99
ATOM   3627  N   MET A 399     -14.110 -45.801   5.043  1.00  0.94
ATOM   3628  CA  MET A 399     -14.278 -44.555   5.814  1.00  0.94
ATOM   3629  C   MET A 399     -15.301 -44.624   6.962  1.00  0.94
ATOM   3630  O   MET A 399     -15.048 -44.055   8.023  1.00  0.94
ATOM   3631  CB  MET A 399     -14.559 -43.380   4.874  1.00  0.94
ATOM   3632  CG  MET A 399     -13.372 -43.094   3.944  1.00  0.94
ATOM   3633  SD  MET A 399     -13.574 -41.590   2.921  1.00  0.94
ATOM   3634  CE  MET A 399     -13.383 -40.338   4.174  1.00  0.94
ATOM   3635  H   MET A 399     -14.359 -45.733   4.071  1.00 99.99
ATOM   3636  N   GLU A 400     -16.355 -45.422   6.811  1.00  0.91
ATOM   3637  CA  GLU A 400     -17.372 -45.653   7.865  1.00  0.91
ATOM   3638  C   GLU A 400     -16.821 -46.348   9.126  1.00  0.91
ATOM   3639  O   GLU A 400     -17.398 -46.208  10.206  1.00  0.91
ATOM   3640  CB  GLU A 400     -18.599 -46.373   7.287  1.00  0.91
ATOM   3641  CG  GLU A 400     -19.380 -45.402   6.390  1.00  0.91
ATOM   3642  CD  GLU A 400     -20.439 -45.994   5.456  1.00  0.91
ATOM   3643  OE1 GLU A 400     -20.496 -47.234   5.287  1.00  0.91
ATOM   3644  OE2 GLU A 400     -21.137 -45.143   4.855  1.00  0.91
ATOM   3645  H   GLU A 400     -16.541 -45.910   5.949  1.00 99.99
ATOM   3646  N   GLY A 401     -15.689 -47.054   8.985  1.00  0.92
ATOM   3647  CA  GLY A 401     -14.972 -47.663  10.126  1.00  0.92
ATOM   3648  C   GLY A 401     -14.105 -46.680  10.936  1.00  0.92
ATOM   3649  O   GLY A 401     -13.786 -46.949  12.098  1.00  0.92
ATOM   3650  H   GLY A 401     -15.211 -47.195   8.106  1.00 99.99
ATOM   3651  N   PHE A 402     -13.750 -45.545  10.339  1.00  0.95
ATOM   3652  CA  PHE A 402     -12.682 -44.686  10.884  1.00  0.95
ATOM   3653  C   PHE A 402     -13.050 -43.204  10.915  1.00  0.95
ATOM   3654  O   PHE A 402     -13.964 -42.734  10.240  1.00  0.95
ATOM   3655  CB  PHE A 402     -11.391 -44.838  10.069  1.00  0.95
ATOM   3656  CG  PHE A 402     -10.950 -46.297   9.946  1.00  0.95
ATOM   3657  CD1 PHE A 402     -10.582 -47.018  11.072  1.00  0.95
ATOM   3658  CD2 PHE A 402     -11.111 -46.929   8.727  1.00  0.95
ATOM   3659  CE1 PHE A 402     -10.398 -48.398  10.978  1.00  0.95
ATOM   3660  CE2 PHE A 402     -10.932 -48.306   8.631  1.00  0.95
ATOM   3661  CZ  PHE A 402     -10.575 -49.035   9.761  1.00  0.95
ATOM   3662  H   PHE A 402     -14.288 -45.118   9.605  1.00 99.99
ATOM   3663  HD1 PHE A 402     -10.448 -46.504  12.022  1.00 99.99
ATOM   3664  HD2 PHE A 402     -11.370 -46.339   7.848  1.00 99.99
ATOM   3665  HE1 PHE A 402     -10.146 -48.974  11.868  1.00 99.99
ATOM   3666  HE2 PHE A 402     -11.130 -48.806   7.685  1.00 99.99
ATOM   3667  HZ  PHE A 402     -10.449 -50.117   9.699  1.00 99.99
ATOM   3668  N   TYR A 403     -12.328 -42.503  11.771  1.00  0.96
ATOM   3669  CA  TYR A 403     -12.272 -41.041  11.732  1.00  0.96
ATOM   3670  C   TYR A 403     -11.029 -40.681  10.908  1.00  0.96
ATOM   3671  O   TYR A 403      -9.925 -41.151  11.204  1.00  0.96
ATOM   3672  CB  TYR A 403     -12.180 -40.564  13.177  1.00  0.96
ATOM   3673  CG  TYR A 403     -12.052 -39.050  13.276  1.00  0.96
ATOM   3674  CD1 TYR A 403     -13.003 -38.205  12.723  1.00  0.96
ATOM   3675  CD2 TYR A 403     -10.991 -38.536  13.998  1.00  0.96
ATOM   3676  CE1 TYR A 403     -12.906 -36.833  12.925  1.00  0.96
ATOM   3677  CE2 TYR A 403     -10.891 -37.170  14.204  1.00  0.96
ATOM   3678  CZ  TYR A 403     -11.856 -36.316  13.676  1.00  0.96
ATOM   3679  OH  TYR A 403     -11.777 -34.978  13.923  1.00  0.96
ATOM   3680  H   TYR A 403     -11.710 -42.939  12.435  1.00 99.99
ATOM   3681  HD1 TYR A 403     -13.805 -38.625  12.117  1.00 99.99
ATOM   3682  HD2 TYR A 403     -10.229 -39.217  14.379  1.00 99.99
ATOM   3683  HE1 TYR A 403     -13.681 -36.181  12.519  1.00 99.99
ATOM   3684  HE2 TYR A 403     -10.047 -36.798  14.782  1.00 99.99
ATOM   3685  HH  TYR A 403     -11.019 -34.842  14.565  1.00 99.99
ATOM   3686  N   VAL A 404     -11.259 -39.953   9.823  1.00  0.99
ATOM   3687  CA  VAL A 404     -10.210 -39.714   8.812  1.00  0.99
ATOM   3688  C   VAL A 404      -9.874 -38.219   8.787  1.00  0.99
ATOM   3689  O   VAL A 404     -10.727 -37.376   8.504  1.00  0.99
ATOM   3690  CB  VAL A 404     -10.640 -40.222   7.419  1.00  0.99
ATOM   3691  CG1 VAL A 404      -9.473 -40.158   6.431  1.00  0.99
ATOM   3692  CG2 VAL A 404     -11.164 -41.664   7.442  1.00  0.99
ATOM   3693  H   VAL A 404     -12.146 -39.511   9.640  1.00 99.99
ATOM   3694  N   VAL A 405      -8.610 -37.936   9.066  1.00  1.00
ATOM   3695  CA  VAL A 405      -8.081 -36.562   9.122  1.00  1.00
ATOM   3696  C   VAL A 405      -7.273 -36.314   7.843  1.00  1.00
ATOM   3697  O   VAL A 405      -6.226 -36.928   7.632  1.00  1.00
ATOM   3698  CB  VAL A 405      -7.207 -36.375  10.381  1.00  1.00
ATOM   3699  CG1 VAL A 405      -6.572 -34.982  10.443  1.00  1.00
ATOM   3700  CG2 VAL A 405      -8.022 -36.589  11.660  1.00  1.00
ATOM   3701  H   VAL A 405      -7.941 -38.671   9.236  1.00 99.99
ATOM   3702  N   PHE A 406      -7.706 -35.318   7.089  1.00  0.98
ATOM   3703  CA  PHE A 406      -7.000 -34.875   5.876  1.00  0.98
ATOM   3704  C   PHE A 406      -6.107 -33.679   6.245  1.00  0.98
ATOM   3705  O   PHE A 406      -6.488 -32.510   6.127  1.00  0.98
ATOM   3706  CB  PHE A 406      -8.031 -34.525   4.794  1.00  0.98
ATOM   3707  CG  PHE A 406      -8.858 -35.744   4.359  1.00  0.98
ATOM   3708  CD1 PHE A 406      -9.952 -36.150   5.109  1.00  0.98
ATOM   3709  CD2 PHE A 406      -8.503 -36.434   3.211  1.00  0.98
ATOM   3710  CE1 PHE A 406     -10.690 -37.266   4.712  1.00  0.98
ATOM   3711  CE2 PHE A 406      -9.240 -37.549   2.810  1.00  0.98
ATOM   3712  CZ  PHE A 406     -10.330 -37.959   3.564  1.00  0.98
ATOM   3713  H   PHE A 406      -8.530 -34.781   7.311  1.00 99.99
ATOM   3714  HD1 PHE A 406     -10.228 -35.601   6.008  1.00 99.99
ATOM   3715  HD2 PHE A 406      -7.647 -36.100   2.629  1.00 99.99
ATOM   3716  HE1 PHE A 406     -11.513 -37.618   5.333  1.00 99.99
ATOM   3717  HE2 PHE A 406      -8.926 -38.119   1.937  1.00 99.99
ATOM   3718  HZ  PHE A 406     -10.878 -38.861   3.283  1.00 99.99
ATOM   3719  N   ASP A 407      -4.973 -34.019   6.853  1.00  0.96
ATOM   3720  CA  ASP A 407      -3.950 -33.049   7.286  1.00  0.96
ATOM   3721  C   ASP A 407      -3.140 -32.582   6.059  1.00  0.96
ATOM   3722  O   ASP A 407      -2.008 -33.020   5.825  1.00  0.96
ATOM   3723  CB  ASP A 407      -3.083 -33.726   8.363  1.00  0.96
ATOM   3724  CG  ASP A 407      -2.144 -32.800   9.151  1.00  0.96
ATOM   3725  OD1 ASP A 407      -2.028 -31.613   8.775  1.00  0.96
ATOM   3726  OD2 ASP A 407      -1.557 -33.309  10.128  1.00  0.96
ATOM   3727  H   ASP A 407      -4.717 -34.981   6.984  1.00 99.99
ATOM   3728  N   ARG A 408      -3.745 -31.667   5.308  1.00  0.87
ATOM   3729  CA  ARG A 408      -3.158 -31.066   4.086  1.00  0.87
ATOM   3730  C   ARG A 408      -1.872 -30.279   4.400  1.00  0.87
ATOM   3731  O   ARG A 408      -0.843 -30.496   3.755  1.00  0.87
ATOM   3732  CB  ARG A 408      -4.182 -30.137   3.424  1.00  0.87
ATOM   3733  CG  ARG A 408      -5.414 -30.858   2.860  1.00  0.87
ATOM   3734  CD  ARG A 408      -6.573 -29.906   2.537  1.00  0.87
ATOM   3735  NE  ARG A 408      -6.157 -28.812   1.638  1.00  0.87
ATOM   3736  CZ  ARG A 408      -6.497 -28.643   0.358  1.00  0.87
ATOM   3737  NH1 ARG A 408      -7.215 -29.538  -0.308  1.00  0.87
ATOM   3738  NH2 ARG A 408      -6.172 -27.524  -0.262  1.00  0.87
ATOM   3739  H   ARG A 408      -4.674 -31.345   5.513  1.00 99.99
ATOM   3740  HE  ARG A 408      -5.548 -28.139   2.062  1.00 99.99
ATOM   3741 1HH1 ARG A 408      -7.464 -29.394  -1.263  1.00 99.99
ATOM   3742 2HH1 ARG A 408      -7.456 -30.393   0.152  1.00 99.99
ATOM   3743 1HH2 ARG A 408      -6.436 -27.414  -1.220  1.00 99.99
ATOM   3744 2HH2 ARG A 408      -5.657 -26.809   0.211  1.00 99.99
ATOM   3745  N   ALA A 409      -1.894 -29.587   5.537  1.00  0.90
ATOM   3746  CA  ALA A 409      -0.782 -28.786   6.091  1.00  0.90
ATOM   3747  C   ALA A 409       0.501 -29.565   6.430  1.00  0.90
ATOM   3748  O   ALA A 409       1.526 -28.947   6.720  1.00  0.90
ATOM   3749  CB  ALA A 409      -1.287 -28.050   7.335  1.00  0.90
ATOM   3750  H   ALA A 409      -2.747 -29.487   6.058  1.00 99.99
ATOM   3751  N   ARG A 410       0.389 -30.883   6.567  1.00  0.80
ATOM   3752  CA  ARG A 410       1.563 -31.759   6.766  1.00  0.80
ATOM   3753  C   ARG A 410       1.639 -32.894   5.730  1.00  0.80
ATOM   3754  O   ARG A 410       2.337 -33.890   5.932  1.00  0.80
ATOM   3755  CB  ARG A 410       1.571 -32.324   8.192  1.00  0.80
ATOM   3756  CG  ARG A 410       1.727 -31.227   9.244  1.00  0.80
ATOM   3757  CD  ARG A 410       1.872 -31.823  10.641  1.00  0.80
ATOM   3758  NE  ARG A 410       1.848 -30.719  11.615  1.00  0.80
ATOM   3759  CZ  ARG A 410       0.804 -30.378  12.377  1.00  0.80
ATOM   3760  NH1 ARG A 410      -0.348 -31.034  12.303  1.00  0.80
ATOM   3761  NH2 ARG A 410       0.893 -29.361  13.220  1.00  0.80
ATOM   3762  H   ARG A 410      -0.487 -31.361   6.495  1.00 99.99
ATOM   3763  HE  ARG A 410       2.691 -30.190  11.675  1.00 99.99
ATOM   3764 1HH1 ARG A 410      -1.122 -30.770  12.872  1.00 99.99
ATOM   3765 2HH1 ARG A 410      -0.416 -31.798  11.662  1.00 99.99
ATOM   3766 1HH2 ARG A 410       0.103 -29.111  13.778  1.00 99.99
ATOM   3767 2HH2 ARG A 410       1.744 -28.847  13.303  1.00 99.99
ATOM   3768  N   LYS A 411       0.858 -32.758   4.655  1.00  0.87
ATOM   3769  CA  LYS A 411       0.784 -33.706   3.524  1.00  0.87
ATOM   3770  C   LYS A 411       0.568 -35.165   3.990  1.00  0.87
ATOM   3771  O   LYS A 411       1.263 -36.097   3.580  1.00  0.87
ATOM   3772  CB  LYS A 411       2.046 -33.506   2.669  1.00  0.87
ATOM   3773  CG  LYS A 411       1.909 -34.102   1.267  1.00  0.87
ATOM   3774  CD  LYS A 411       3.175 -33.833   0.459  1.00  0.87
ATOM   3775  CE  LYS A 411       3.099 -34.479  -0.923  1.00  0.87
ATOM   3776  NZ  LYS A 411       4.138 -33.908  -1.789  1.00  0.87
ATOM   3777  H   LYS A 411       0.291 -31.940   4.524  1.00 99.99
ATOM   3778  HZ1 LYS A 411       4.086 -34.331  -2.693  1.00 99.99
ATOM   3779  HZ2 LYS A 411       3.988 -32.923  -1.861  1.00 99.99
ATOM   3780  HZ3 LYS A 411       5.035 -34.080  -1.381  1.00 99.99
ATOM   3781  N   ARG A 412      -0.436 -35.373   4.838  1.00  0.88
ATOM   3782  CA  ARG A 412      -0.701 -36.702   5.431  1.00  0.88
ATOM   3783  C   ARG A 412      -2.179 -36.933   5.780  1.00  0.88
ATOM   3784  O   ARG A 412      -2.951 -35.984   5.936  1.00  0.88
ATOM   3785  CB  ARG A 412       0.213 -36.915   6.651  1.00  0.88
ATOM   3786  CG  ARG A 412      -0.068 -35.934   7.792  1.00  0.88
ATOM   3787  CD  ARG A 412       0.946 -36.075   8.924  1.00  0.88
ATOM   3788  NE  ARG A 412       0.445 -35.309  10.076  1.00  0.88
ATOM   3789  CZ  ARG A 412       0.896 -35.325  11.328  1.00  0.88
ATOM   3790  NH1 ARG A 412       1.950 -36.034  11.693  1.00  0.88
ATOM   3791  NH2 ARG A 412       0.240 -34.655  12.260  1.00  0.88
ATOM   3792  H   ARG A 412      -1.022 -34.628   5.174  1.00 99.99
ATOM   3793  HE  ARG A 412      -0.305 -34.678   9.884  1.00 99.99
ATOM   3794 1HH1 ARG A 412       2.261 -36.053  12.638  1.00 99.99
ATOM   3795 2HH1 ARG A 412       2.450 -36.535  10.982  1.00 99.99
ATOM   3796 1HH2 ARG A 412       0.560 -34.673  13.203  1.00 99.99
ATOM   3797 2HH2 ARG A 412      -0.554 -34.106  12.003  1.00 99.99
ATOM   3798  N   ILE A 413      -2.563 -38.201   5.857  1.00  0.97
ATOM   3799  CA  ILE A 413      -3.934 -38.604   6.228  1.00  0.97
ATOM   3800  C   ILE A 413      -3.870 -39.471   7.493  1.00  0.97
ATOM   3801  O   ILE A 413      -3.211 -40.512   7.508  1.00  0.97
ATOM   3802  CB  ILE A 413      -4.639 -39.312   5.050  1.00  0.97
ATOM   3803  CG1 ILE A 413      -4.817 -38.335   3.878  1.00  0.97
ATOM   3804  CG2 ILE A 413      -6.010 -39.870   5.466  1.00  0.97
ATOM   3805  CD  ILE A 413      -5.135 -39.015   2.541  1.00  0.97
ATOM   3806  H   ILE A 413      -1.908 -38.958   5.731  1.00 99.99
ATOM   3807  N   GLY A 414      -4.611 -39.017   8.506  1.00  1.00
ATOM   3808  CA  GLY A 414      -4.714 -39.721   9.796  1.00  1.00
ATOM   3809  C   GLY A 414      -5.961 -40.605   9.853  1.00  1.00
ATOM   3810  O   GLY A 414      -7.048 -40.188   9.449  1.00  1.00
ATOM   3811  H   GLY A 414      -5.189 -38.187   8.431  1.00 99.99
ATOM   3812  N   PHE A 415      -5.763 -41.799  10.390  1.00  0.97
ATOM   3813  CA  PHE A 415      -6.829 -42.781  10.648  1.00  0.97
ATOM   3814  C   PHE A 415      -6.854 -43.112  12.138  1.00  0.97
ATOM   3815  O   PHE A 415      -5.805 -43.309  12.754  1.00  0.97
ATOM   3816  CB  PHE A 415      -6.555 -44.090   9.901  1.00  0.97
ATOM   3817  CG  PHE A 415      -6.747 -43.960   8.392  1.00  0.97
ATOM   3818  CD1 PHE A 415      -5.700 -43.517   7.601  1.00  0.97
ATOM   3819  CD2 PHE A 415      -7.972 -44.285   7.830  1.00  0.97
ATOM   3820  CE1 PHE A 415      -5.886 -43.385   6.229  1.00  0.97
ATOM   3821  CE2 PHE A 415      -8.159 -44.149   6.455  1.00  0.97
ATOM   3822  CZ  PHE A 415      -7.116 -43.696   5.661  1.00  0.97
ATOM   3823  H   PHE A 415      -4.840 -42.104  10.654  1.00 99.99
ATOM   3824  HD1 PHE A 415      -4.744 -43.265   8.058  1.00 99.99
ATOM   3825  HD2 PHE A 415      -8.776 -44.651   8.467  1.00 99.99
ATOM   3826  HE1 PHE A 415      -5.064 -43.034   5.609  1.00 99.99
ATOM   3827  HE2 PHE A 415      -9.131 -44.372   6.017  1.00 99.99
ATOM   3828  HZ  PHE A 415      -7.275 -43.545   4.591  1.00 99.99
ATOM   3829  N   ALA A 416      -8.052 -43.084  12.698  1.00  0.97
ATOM   3830  CA  ALA A 416      -8.313 -43.561  14.068  1.00  0.97
ATOM   3831  C   ALA A 416      -9.655 -44.295  14.077  1.00  0.97
ATOM   3832  O   ALA A 416     -10.474 -44.091  13.176  1.00  0.97
ATOM   3833  CB  ALA A 416      -8.360 -42.382  15.039  1.00  0.97
ATOM   3834  H   ALA A 416      -8.861 -42.746  12.207  1.00 99.99
ATOM   3835  N   VAL A 417      -9.862 -45.169  15.054  1.00  0.94
ATOM   3836  CA  VAL A 417     -11.148 -45.890  15.196  1.00  0.94
ATOM   3837  C   VAL A 417     -12.273 -44.870  15.457  1.00  0.94
ATOM   3838  O   VAL A 417     -12.174 -44.066  16.387  1.00  0.94
ATOM   3839  CB  VAL A 417     -11.061 -46.930  16.329  1.00  0.94
ATOM   3840  CG1 VAL A 417     -12.377 -47.695  16.512  1.00  0.94
ATOM   3841  CG2 VAL A 417      -9.945 -47.946  16.066  1.00  0.94
ATOM   3842  H   VAL A 417      -9.190 -45.340  15.778  1.00 99.99
ATOM   3843  N   SER A 418     -13.287 -44.873  14.596  1.00  0.93
ATOM   3844  CA  SER A 418     -14.454 -43.974  14.750  1.00  0.93
ATOM   3845  C   SER A 418     -15.224 -44.285  16.041  1.00  0.93
ATOM   3846  O   SER A 418     -15.452 -45.450  16.369  1.00  0.93
ATOM   3847  CB  SER A 418     -15.411 -44.123  13.561  1.00  0.93
ATOM   3848  OG  SER A 418     -16.545 -43.256  13.701  1.00  0.93
ATOM   3849  H   SER A 418     -13.339 -45.530  13.838  1.00 99.99
ATOM   3850  HG  SER A 418     -17.110 -43.343  12.871  1.00 99.99
ATOM   3851  N   ALA A 419     -15.683 -43.235  16.713  1.00  0.93
ATOM   3852  CA  ALA A 419     -16.600 -43.390  17.861  1.00  0.93
ATOM   3853  C   ALA A 419     -18.016 -43.866  17.471  1.00  0.93
ATOM   3854  O   ALA A 419     -18.769 -44.311  18.339  1.00  0.93
ATOM   3855  CB  ALA A 419     -16.648 -42.096  18.677  1.00  0.93
ATOM   3856  H   ALA A 419     -15.348 -42.303  16.548  1.00 99.99
ATOM   3857  N   CYS A 420     -18.356 -43.807  16.181  1.00  0.88
ATOM   3858  CA  CYS A 420     -19.693 -44.207  15.695  1.00  0.88
ATOM   3859  C   CYS A 420     -19.732 -45.391  14.703  1.00  0.88
ATOM   3860  O   CYS A 420     -20.775 -45.620  14.082  1.00  0.88
ATOM   3861  CB  CYS A 420     -20.385 -42.985  15.076  1.00  0.88
ATOM   3862  SG  CYS A 420     -19.599 -42.399  13.530  1.00  0.88
ATOM   3863  H   CYS A 420     -17.731 -43.471  15.472  1.00 99.99
ATOM   3864  N   HIS A 421     -18.655 -46.160  14.557  1.00  0.81
ATOM   3865  CA  HIS A 421     -18.675 -47.287  13.592  1.00  0.81
ATOM   3866  C   HIS A 421     -19.585 -48.442  14.068  1.00  0.81
ATOM   3867  O   HIS A 421     -19.815 -48.624  15.265  1.00  0.81
ATOM   3868  CB  HIS A 421     -17.263 -47.740  13.190  1.00  0.81
ATOM   3869  CG  HIS A 421     -16.607 -48.740  14.142  1.00  0.81
ATOM   3870  ND1 HIS A 421     -16.736 -50.056  14.044  1.00  0.81
ATOM   3871  CD2 HIS A 421     -15.939 -48.457  15.256  1.00  0.81
ATOM   3872  CE1 HIS A 421     -16.151 -50.587  15.107  1.00  0.81
ATOM   3873  NE2 HIS A 421     -15.663 -49.610  15.856  1.00  0.81
ATOM   3874  H   HIS A 421     -17.843 -46.086  15.141  1.00 99.99
ATOM   3875  HD1 HIS A 421     -17.298 -50.548  13.376  1.00 99.99
ATOM   3876  N   VAL A 422     -20.005 -49.284  13.127  1.00  0.80
ATOM   3877  CA  VAL A 422     -20.951 -50.387  13.408  1.00  0.80
ATOM   3878  C   VAL A 422     -20.170 -51.687  13.657  1.00  0.80
ATOM   3879  O   VAL A 422     -19.391 -52.137  12.815  1.00  0.80
ATOM   3880  CB  VAL A 422     -21.968 -50.535  12.256  1.00  0.80
ATOM   3881  CG1 VAL A 422     -22.976 -51.663  12.515  1.00  0.80
ATOM   3882  CG2 VAL A 422     -22.744 -49.232  12.029  1.00  0.80
ATOM   3883  H   VAL A 422     -19.731 -49.195  12.169  1.00 99.99
ATOM   3884  N   HIS A 423     -20.351 -52.232  14.855  1.00  0.74
ATOM   3885  CA  HIS A 423     -19.640 -53.451  15.287  1.00  0.74
ATOM   3886  C   HIS A 423     -20.503 -54.355  16.176  1.00  0.74
ATOM   3887  O   HIS A 423     -21.662 -54.047  16.453  1.00  0.74
ATOM   3888  CB  HIS A 423     -18.312 -53.086  15.969  1.00  0.74
ATOM   3889  CG  HIS A 423     -18.450 -52.249  17.243  1.00  0.74
ATOM   3890  ND1 HIS A 423     -18.587 -50.929  17.295  1.00  0.74
ATOM   3891  CD2 HIS A 423     -18.425 -52.719  18.486  1.00  0.74
ATOM   3892  CE1 HIS A 423     -18.680 -50.581  18.574  1.00  0.74
ATOM   3893  NE2 HIS A 423     -18.579 -51.687  19.307  1.00  0.74
ATOM   3894  H   HIS A 423     -21.063 -51.915  15.487  1.00 99.99
ATOM   3895  HD1 HIS A 423     -18.485 -50.294  16.527  1.00 99.99
ATOM   3896  N   ASP A 424     -19.919 -55.487  16.550  1.00  0.75
ATOM   3897  CA  ASP A 424     -20.582 -56.486  17.406  1.00  0.75
ATOM   3898  C   ASP A 424     -19.818 -56.679  18.733  1.00  0.75
ATOM   3899  O   ASP A 424     -18.766 -56.080  18.940  1.00  0.75
ATOM   3900  CB  ASP A 424     -20.784 -57.782  16.597  1.00  0.75
ATOM   3901  CG  ASP A 424     -19.502 -58.397  16.025  1.00  0.75
ATOM   3902  OD1 ASP A 424     -18.650 -58.764  16.859  1.00  0.75
ATOM   3903  OD2 ASP A 424     -19.398 -58.500  14.785  1.00  0.75
ATOM   3904  H   ASP A 424     -18.933 -55.617  16.421  1.00 99.99
ATOM   3905  N   GLU A 425     -20.295 -57.613  19.548  1.00  0.70
ATOM   3906  CA  GLU A 425     -19.718 -57.951  20.868  1.00  0.70
ATOM   3907  C   GLU A 425     -18.328 -58.612  20.782  1.00  0.70
ATOM   3908  O   GLU A 425     -17.581 -58.612  21.760  1.00  0.70
ATOM   3909  CB  GLU A 425     -20.658 -58.873  21.664  1.00  0.70
ATOM   3910  CG  GLU A 425     -22.097 -58.356  21.836  1.00  0.70
ATOM   3911  CD  GLU A 425     -23.062 -58.886  20.765  1.00  0.70
ATOM   3912  OE1 GLU A 425     -22.878 -58.517  19.581  1.00  0.70
ATOM   3913  OE2 GLU A 425     -23.920 -59.717  21.127  1.00  0.70
ATOM   3914  H   GLU A 425     -21.151 -58.093  19.342  1.00 99.99
ATOM   3915  N   PHE A 426     -18.013 -59.192  19.628  1.00  0.78
ATOM   3916  CA  PHE A 426     -16.783 -59.979  19.418  1.00  0.78
ATOM   3917  C   PHE A 426     -15.662 -59.221  18.692  1.00  0.78
ATOM   3918  O   PHE A 426     -14.489 -59.520  18.907  1.00  0.78
ATOM   3919  CB  PHE A 426     -17.105 -61.253  18.628  1.00  0.78
ATOM   3920  CG  PHE A 426     -18.090 -62.157  19.374  1.00  0.78
ATOM   3921  CD1 PHE A 426     -17.618 -63.004  20.363  1.00  0.78
ATOM   3922  CD2 PHE A 426     -19.441 -62.110  19.067  1.00  0.78
ATOM   3923  CE1 PHE A 426     -18.511 -63.815  21.063  1.00  0.78
ATOM   3924  CE2 PHE A 426     -20.335 -62.922  19.765  1.00  0.78
ATOM   3925  CZ  PHE A 426     -19.864 -63.771  20.758  1.00  0.78
ATOM   3926  H   PHE A 426     -18.580 -59.105  18.810  1.00 99.99
ATOM   3927  HD1 PHE A 426     -16.555 -63.016  20.601  1.00 99.99
ATOM   3928  HD2 PHE A 426     -19.792 -61.445  18.281  1.00 99.99
ATOM   3929  HE1 PHE A 426     -18.149 -64.441  21.878  1.00 99.99
ATOM   3930  HE2 PHE A 426     -21.403 -62.867  19.555  1.00 99.99
ATOM   3931  HZ  PHE A 426     -20.563 -64.403  21.312  1.00 99.99
ATOM   3932  N   ARG A 427     -16.024 -58.325  17.776  1.00  0.77
ATOM   3933  CA  ARG A 427     -15.057 -57.636  16.900  1.00  0.77
ATOM   3934  C   ARG A 427     -15.402 -56.157  16.712  1.00  0.77
ATOM   3935  O   ARG A 427     -16.576 -55.772  16.669  1.00  0.77
ATOM   3936  CB  ARG A 427     -14.969 -58.333  15.537  1.00  0.77
ATOM   3937  CG  ARG A 427     -14.444 -59.770  15.646  1.00  0.77
ATOM   3938  CD  ARG A 427     -14.248 -60.435  14.285  1.00  0.77
ATOM   3939  NE  ARG A 427     -15.530 -60.451  13.566  1.00  0.77
ATOM   3940  CZ  ARG A 427     -15.779 -61.047  12.405  1.00  0.77
ATOM   3941  NH1 ARG A 427     -14.854 -61.735  11.753  1.00  0.77
ATOM   3942  NH2 ARG A 427     -16.989 -60.958  11.882  1.00  0.77
ATOM   3943  H   ARG A 427     -16.971 -58.023  17.666  1.00 99.99
ATOM   3944  HE  ARG A 427     -16.272 -59.960  14.011  1.00 99.99
ATOM   3945 1HH1 ARG A 427     -15.102 -62.173  10.883  1.00 99.99
ATOM   3946 2HH1 ARG A 427     -13.939 -61.831  12.135  1.00 99.99
ATOM   3947 1HH2 ARG A 427     -17.183 -61.423  11.014  1.00 99.99
ATOM   3948 2HH2 ARG A 427     -17.715 -60.460  12.349  1.00 99.99
ATOM   3949  N   THR A 428     -14.345 -55.371  16.553  1.00  0.84
ATOM   3950  CA  THR A 428     -14.382 -53.897  16.453  1.00  0.84
ATOM   3951  C   THR A 428     -13.380 -53.499  15.357  1.00  0.84
ATOM   3952  O   THR A 428     -12.369 -54.184  15.177  1.00  0.84
ATOM   3953  CB  THR A 428     -13.927 -53.288  17.796  1.00  0.84
ATOM   3954  OG1 THR A 428     -14.677 -53.855  18.875  1.00  0.84
ATOM   3955  CG2 THR A 428     -14.064 -51.764  17.853  1.00  0.84
ATOM   3956  H   THR A 428     -13.431 -55.755  16.397  1.00 99.99
ATOM   3957  HG1 THR A 428     -15.416 -54.430  18.523  1.00 99.99
ATOM   3958  N   ALA A 429     -13.696 -52.463  14.585  1.00  0.92
ATOM   3959  CA  ALA A 429     -12.727 -51.848  13.651  1.00  0.92
ATOM   3960  C   ALA A 429     -11.516 -51.320  14.439  1.00  0.92
ATOM   3961  O   ALA A 429     -11.642 -50.865  15.574  1.00  0.92
ATOM   3962  CB  ALA A 429     -13.374 -50.704  12.867  1.00  0.92
ATOM   3963  H   ALA A 429     -14.571 -51.991  14.659  1.00 99.99
ATOM   3964  N   ALA A 430     -10.336 -51.512  13.861  1.00  0.94
ATOM   3965  CA  ALA A 430      -9.073 -51.228  14.565  1.00  0.94
ATOM   3966  C   ALA A 430      -8.067 -50.443  13.720  1.00  0.94
ATOM   3967  O   ALA A 430      -8.072 -50.539  12.492  1.00  0.94
ATOM   3968  CB  ALA A 430      -8.457 -52.558  15.010  1.00  0.94
ATOM   3969  H   ALA A 430     -10.254 -51.854  12.924  1.00 99.99
ATOM   3970  N   VAL A 431      -7.293 -49.606  14.401  1.00  0.93
ATOM   3971  CA  VAL A 431      -6.113 -48.937  13.820  1.00  0.93
ATOM   3972  C   VAL A 431      -4.961 -49.229  14.789  1.00  0.93
ATOM   3973  O   VAL A 431      -5.043 -48.900  15.973  1.00  0.93
ATOM   3974  CB  VAL A 431      -6.310 -47.418  13.647  1.00  0.93
ATOM   3975  CG1 VAL A 431      -5.115 -46.801  12.917  1.00  0.93
ATOM   3976  CG2 VAL A 431      -7.572 -47.081  12.850  1.00  0.93
ATOM   3977  H   VAL A 431      -7.447 -49.401  15.370  1.00 99.99
ATOM   3978  N   GLU A 432      -4.000 -50.000  14.301  1.00  0.91
ATOM   3979  CA  GLU A 432      -2.935 -50.573  15.146  1.00  0.91
ATOM   3980  C   GLU A 432      -1.568 -50.331  14.507  1.00  0.91
ATOM   3981  O   GLU A 432      -1.448 -50.348  13.280  1.00  0.91
ATOM   3982  CB  GLU A 432      -3.145 -52.085  15.290  1.00  0.91
ATOM   3983  CG  GLU A 432      -4.461 -52.463  15.977  1.00  0.91
ATOM   3984  CD  GLU A 432      -4.739 -53.953  15.792  1.00  0.91
ATOM   3985  OE1 GLU A 432      -5.219 -54.299  14.689  1.00  0.91
ATOM   3986  OE2 GLU A 432      -4.416 -54.727  16.718  1.00  0.91
ATOM   3987  H   GLU A 432      -3.867 -50.107  13.309  1.00 99.99
ATOM   3988  N   GLY A 433      -0.558 -50.188  15.365  1.00  0.94
ATOM   3989  CA  GLY A 433       0.834 -50.019  14.921  1.00  0.94
ATOM   3990  C   GLY A 433       1.749 -49.821  16.139  1.00  0.94
ATOM   3991  O   GLY A 433       1.246 -49.849  17.267  1.00  0.94
ATOM   3992  H   GLY A 433      -0.648 -50.177  16.372  1.00 99.99
ATOM   3993  N   PRO A 434       3.050 -49.600  15.910  1.00  0.93
ATOM   3994  CA  PRO A 434       3.722 -49.585  14.595  1.00  0.93
ATOM   3995  C   PRO A 434       4.145 -51.009  14.195  1.00  0.93
ATOM   3996  O   PRO A 434       4.370 -51.860  15.054  1.00  0.93
ATOM   3997  CB  PRO A 434       4.934 -48.683  14.839  1.00  0.93
ATOM   3998  CG  PRO A 434       5.329 -48.991  16.286  1.00  0.93
ATOM   3999  CD  PRO A 434       3.992 -49.240  16.988  1.00  0.93
ATOM   4000  N   PHE A 435       4.201 -51.266  12.896  1.00  0.88
ATOM   4001  CA  PHE A 435       4.751 -52.529  12.364  1.00  0.88
ATOM   4002  C   PHE A 435       5.968 -52.215  11.497  1.00  0.88
ATOM   4003  O   PHE A 435       6.048 -51.133  10.912  1.00  0.88
ATOM   4004  CB  PHE A 435       3.723 -53.267  11.501  1.00  0.88
ATOM   4005  CG  PHE A 435       2.520 -53.722  12.324  1.00  0.88
ATOM   4006  CD1 PHE A 435       2.585 -54.905  13.043  1.00  0.88
ATOM   4007  CD2 PHE A 435       1.382 -52.933  12.359  1.00  0.88
ATOM   4008  CE1 PHE A 435       1.498 -55.297  13.824  1.00  0.88
ATOM   4009  CE2 PHE A 435       0.295 -53.328  13.132  1.00  0.88
ATOM   4010  CZ  PHE A 435       0.359 -54.507  13.867  1.00  0.88
ATOM   4011  H   PHE A 435       3.911 -50.606  12.196  1.00 99.99
ATOM   4012  HD1 PHE A 435       3.483 -55.519  12.996  1.00 99.99
ATOM   4013  HD2 PHE A 435       1.344 -52.014  11.777  1.00 99.99
ATOM   4014  HE1 PHE A 435       1.561 -56.207  14.421  1.00 99.99
ATOM   4015  HE2 PHE A 435      -0.604 -52.716  13.144  1.00 99.99
ATOM   4016  HZ  PHE A 435      -0.480 -54.800  14.503  1.00 99.99
ATOM   4017  N   VAL A 436       6.925 -53.132  11.469  1.00  0.87
ATOM   4018  CA  VAL A 436       8.077 -52.992  10.555  1.00  0.87
ATOM   4019  C   VAL A 436       7.725 -53.613   9.194  1.00  0.87
ATOM   4020  O   VAL A 436       7.405 -54.797   9.097  1.00  0.87
ATOM   4021  CB  VAL A 436       9.371 -53.591  11.141  1.00  0.87
ATOM   4022  CG1 VAL A 436      10.560 -53.414  10.187  1.00  0.87
ATOM   4023  CG2 VAL A 436       9.729 -52.934  12.479  1.00  0.87
ATOM   4024  H   VAL A 436       6.946 -53.920  12.085  1.00 99.99
ATOM   4025  N   THR A 437       7.691 -52.762   8.177  1.00  0.80
ATOM   4026  CA  THR A 437       7.523 -53.202   6.777  1.00  0.80
ATOM   4027  C   THR A 437       8.692 -52.637   5.969  1.00  0.80
ATOM   4028  O   THR A 437       8.870 -51.421   5.892  1.00  0.80
ATOM   4029  CB  THR A 437       6.195 -52.731   6.156  1.00  0.80
ATOM   4030  OG1 THR A 437       5.103 -53.132   6.987  1.00  0.80
ATOM   4031  CG2 THR A 437       5.981 -53.322   4.756  1.00  0.80
ATOM   4032  H   THR A 437       7.914 -51.788   8.301  1.00 99.99
ATOM   4033  HG1 THR A 437       5.476 -53.658   7.758  1.00 99.99
ATOM   4034  N   LEU A 438       9.500 -53.536   5.423  1.00  0.71
ATOM   4035  CA  LEU A 438      10.586 -53.134   4.510  1.00  0.71
ATOM   4036  C   LEU A 438      10.041 -52.843   3.102  1.00  0.71
ATOM   4037  O   LEU A 438       8.892 -53.149   2.784  1.00  0.71
ATOM   4038  CB  LEU A 438      11.681 -54.212   4.463  1.00  0.71
ATOM   4039  CG  LEU A 438      12.283 -54.565   5.833  1.00  0.71
ATOM   4040  CD1 LEU A 438      13.299 -55.696   5.669  1.00  0.71
ATOM   4041  CD2 LEU A 438      12.956 -53.369   6.513  1.00  0.71
ATOM   4042  H   LEU A 438       9.384 -54.521   5.556  1.00 99.99
ATOM   4043  N   ASP A 439      10.823 -52.085   2.336  1.00  0.73
ATOM   4044  CA  ASP A 439      10.610 -51.843   0.888  1.00  0.73
ATOM   4045  C   ASP A 439       9.243 -51.215   0.534  1.00  0.73
ATOM   4046  O   ASP A 439       8.737 -51.365  -0.583  1.00  0.73
ATOM   4047  CB  ASP A 439      10.903 -53.148   0.118  1.00  0.73
ATOM   4048  CG  ASP A 439      12.250 -53.778   0.517  1.00  0.73
ATOM   4049  OD1 ASP A 439      13.183 -53.001   0.828  1.00  0.73
ATOM   4050  OD2 ASP A 439      12.277 -55.018   0.660  1.00  0.73
ATOM   4051  H   ASP A 439      11.681 -51.712   2.692  1.00 99.99
ATOM   4052  N   MET A 440       8.796 -50.308   1.400  1.00  0.76
ATOM   4053  CA  MET A 440       7.503 -49.607   1.247  1.00  0.76
ATOM   4054  C   MET A 440       7.449 -48.629   0.065  1.00  0.76
ATOM   4055  O   MET A 440       6.431 -48.557  -0.621  1.00  0.76
ATOM   4056  CB  MET A 440       7.118 -48.852   2.517  1.00  0.76
ATOM   4057  CG  MET A 440       6.867 -49.763   3.720  1.00  0.76
ATOM   4058  SD  MET A 440       6.094 -48.882   5.126  1.00  0.76
ATOM   4059  CE  MET A 440       7.320 -47.627   5.435  1.00  0.76
ATOM   4060  H   MET A 440       9.263 -50.128   2.268  1.00 99.99
ATOM   4061  N   GLU A 441       8.556 -47.937  -0.207  1.00  0.73
ATOM   4062  CA  GLU A 441       8.660 -47.012  -1.358  1.00  0.73
ATOM   4063  C   GLU A 441       8.499 -47.730  -2.709  1.00  0.73
ATOM   4064  O   GLU A 441       7.900 -47.183  -3.633  1.00  0.73
ATOM   4065  CB  GLU A 441       9.973 -46.220  -1.331  1.00  0.73
ATOM   4066  CG  GLU A 441      10.078 -45.247  -0.148  1.00  0.73
ATOM   4067  CD  GLU A 441       9.031 -44.131  -0.149  1.00  0.73
ATOM   4068  OE1 GLU A 441       8.745 -43.587  -1.238  1.00  0.73
ATOM   4069  OE2 GLU A 441       8.566 -43.838   0.972  1.00  0.73
ATOM   4070  H   GLU A 441       9.376 -47.997   0.361  1.00 99.99
ATOM   4071  N   ASP A 442       8.904 -48.998  -2.750  1.00  0.79
ATOM   4072  CA  ASP A 442       8.668 -49.879  -3.908  1.00  0.79
ATOM   4073  C   ASP A 442       7.188 -50.252  -4.103  1.00  0.79
ATOM   4074  O   ASP A 442       6.822 -50.736  -5.165  1.00  0.79
ATOM   4075  CB  ASP A 442       9.551 -51.131  -3.820  1.00  0.79
ATOM   4076  CG  ASP A 442      11.025 -50.884  -4.178  1.00  0.79
ATOM   4077  OD1 ASP A 442      11.453 -49.707  -4.179  1.00  0.79
ATOM   4078  OD2 ASP A 442      11.734 -51.904  -4.312  1.00  0.79
ATOM   4079  H   ASP A 442       9.360 -49.443  -1.980  1.00 99.99
ATOM   4080  N   CYS A 443       6.333 -50.078  -3.102  1.00  0.86
ATOM   4081  CA  CYS A 443       4.900 -50.406  -3.246  1.00  0.86
ATOM   4082  C   CYS A 443       4.116 -49.463  -4.173  1.00  0.86
ATOM   4083  O   CYS A 443       3.041 -49.840  -4.647  1.00  0.86
ATOM   4084  CB  CYS A 443       4.233 -50.503  -1.874  1.00  0.86
ATOM   4085  SG  CYS A 443       5.069 -51.690  -0.760  1.00  0.86
ATOM   4086  H   CYS A 443       6.578 -49.669  -2.220  1.00 99.99
ATOM   4087  N   GLY A 444       4.630 -48.244  -4.388  1.00  0.83
ATOM   4088  CA  GLY A 444       3.969 -47.276  -5.282  1.00  0.83
ATOM   4089  C   GLY A 444       4.016 -47.698  -6.759  1.00  0.83
ATOM   4090  O   GLY A 444       5.078 -48.022  -7.288  1.00  0.83
ATOM   4091  H   GLY A 444       5.511 -47.913  -4.021  1.00 99.99
ATOM   4092  N   TYR A 445       2.845 -47.697  -7.396  1.00  0.73
ATOM   4093  CA  TYR A 445       2.781 -47.561  -8.872  1.00  0.73
ATOM   4094  C   TYR A 445       2.847 -46.056  -9.212  1.00  0.73
ATOM   4095  O   TYR A 445       3.690 -45.422  -8.563  1.00  0.73
ATOM   4096  CB  TYR A 445       1.563 -48.252  -9.491  1.00  0.73
ATOM   4097  CG  TYR A 445       1.763 -48.468 -10.998  1.00  0.73
ATOM   4098  CD1 TYR A 445       1.278 -47.561 -11.931  1.00  0.73
ATOM   4099  CD2 TYR A 445       2.475 -49.578 -11.430  1.00  0.73
ATOM   4100  CE1 TYR A 445       1.510 -47.758 -13.289  1.00  0.73
ATOM   4101  CE2 TYR A 445       2.699 -49.788 -12.787  1.00  0.73
ATOM   4102  CZ  TYR A 445       2.211 -48.877 -13.717  1.00  0.73
ATOM   4103  OH  TYR A 445       2.355 -49.098 -15.053  1.00  0.73
ATOM   4104  H   TYR A 445       1.970 -47.717  -6.914  1.00 99.99
ATOM   4105  HD1 TYR A 445       0.725 -46.683 -11.598  1.00 99.99
ATOM   4106  HD2 TYR A 445       2.870 -50.273 -10.691  1.00 99.99
ATOM   4107  HE1 TYR A 445       1.207 -46.992 -14.004  1.00 99.99
ATOM   4108  HE2 TYR A 445       3.273 -50.658 -13.103  1.00 99.99
ATOM   4109  HH  TYR A 445       2.866 -49.939 -15.214  1.00 99.99
ATOM   4110  OXT TYR A 445       2.187 -45.547 -10.138  1.00  0.73
TER    4111      TYR A 445                                        
HETATM 4112  C1  B7E _   1     -15.156 -32.861 -11.681  1.00 26.57
HETATM 4113  C3  B7E _   1     -16.209 -34.972 -11.018  1.00 25.94
HETATM 4114  C7  B7E _   1     -17.633 -37.346  -9.813  1.00 25.03
HETATM 4115  C8  B7E _   1     -16.519 -37.499 -10.874  1.00 24.50
HETATM 4116  C9  B7E _   1     -16.357 -36.283 -11.817  1.00 25.51
HETATM 4117  C11 B7E _   1     -15.125 -36.528 -12.707  1.00 25.67
HETATM 4118  C12 B7E _   1     -19.041 -37.458 -10.472  1.00 25.80
HETATM 4119  C13 B7E _   1     -19.942 -38.022  -9.381  1.00 26.84
HETATM 4120  C14 B7E _   1     -21.336 -37.996  -9.254  1.00 27.69
HETATM 4121  C15 B7E _   1     -21.955 -38.592  -8.158  1.00 27.35
HETATM 4122  C16 B7E _   1     -21.174 -39.204  -7.155  1.00 27.47
HETATM 4123  C19 B7E _   1     -17.697 -38.528  -8.797  1.00 26.01
HETATM 4124  C20 B7E _   1     -17.181 -39.907  -9.288  1.00 26.29
HETATM 4125  C22 B7E _   1     -16.246 -39.373  -7.291  1.00 29.17
HETATM 4126  N23 B7E _   1     -16.879 -38.291  -7.599  1.00 26.68
HETATM 4127  N29 B7E _   1     -23.489 -41.326  -5.116  1.00 33.10
HETATM 4128  C30 B7E _   1     -23.008 -40.643  -6.154  1.00 32.53
HETATM 4129  O2  B7E _   1     -16.182 -33.841 -11.916  1.00 26.33
HETATM 4130  C5  B7E _   1     -17.383 -34.771 -10.036  1.00 26.40
HETATM 4131  C6  B7E _   1     -17.524 -35.980  -9.088  1.00 25.69
HETATM 4132  C17 B7E _   1     -19.771 -39.238  -7.300  1.00 25.47
HETATM 4133  C18 B7E _   1     -19.155 -38.651  -8.408  1.00 26.00
HETATM 4134  O21 B7E _   1     -16.459 -40.400  -8.129  1.00 28.62
HETATM 4135  N24 B7E _   1     -15.424 -39.447  -6.201  1.00 26.63
HETATM 4136  C25 B7E _   1     -21.808 -39.917  -6.006  1.00 31.13
HETATM 4137  C26 B7E _   1     -21.162 -40.018  -4.759  1.00 32.36
HETATM 4138  N27 B7E _   1     -21.697 -40.735  -3.777  1.00 33.07
HETATM 4139  C28 B7E _   1     -22.851 -41.365  -3.952  1.00 33.50
HETATM 4140  H4  B7E _   1     -15.282 -35.026 -10.437  1.00 26.27
HETATM 4141  H10 B7E _   1     -17.230 -36.200 -12.464  1.00 25.28
CONECT 4112 4129                             
CONECT 4113 4116 4129 4130 4140              
CONECT 4114 4115 4118 4123 4131              
CONECT 4115 4116                             
CONECT 4116 4117 4141                        
CONECT 4118 4119                             
CONECT 4119 4120 4133                        
CONECT 4120 4121                             
CONECT 4121 4122                             
CONECT 4122 4132 4136                        
CONECT 4123 4124 4126 4133                   
CONECT 4124 4134                             
CONECT 4125 4126 4134 4135                   
CONECT 4127 4128 4139                        
CONECT 4128 4136                             
CONECT 4130 4131                             
CONECT 4132 4133                             
CONECT 4136 4137                             
CONECT 4137 4138                             
CONECT 4138 4139                             
SPDBVT        1.0000000000         0.0000000000         0.0000000000 
SPDBVT        0.0000000000         1.0000000000         0.0000000000 
SPDBVT        0.0000000000         0.0000000000         1.0000000000 
SPDBVT        0.0000000000         0.0000000000         0.0000000000 
SPDBVT        0.0000000000         0.0000000000         0.0000000000 
SPDBVV default;
SPDBVV      8.228955557850    2013.305045964287      20.000000000000
SPDBVV        1.0000000000         0.0000000000         0.0000000000 
SPDBVV        0.0000000000         1.0000000000         0.0000000000 
SPDBVV        0.0000000000         0.0000000000         1.0000000000 
SPDBVV      -13.3920001984       -40.8974990845        -1.1564999819 
SPDBVV        0.0000000000         0.0000000000         0.0000000000 
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19
SPDBVf 19 19 19 19 19 19 19 19 19 17  3
SPDBVo 4112d B7E
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVl 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 
SPDBVb 0.00 0.00 0.20
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64    64    64    64    64    64    64    64    64    64
SPDBVg    64
SPDBVi        1 1 1 0 1 0 1 1 0 1 0 1 1 0  0
SPDBVp        0
END



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.