CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 21121723441225004

Job options:

ID        	=	 21121723441225004
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   17-DEC-21 1MOD    1       21:17
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.953
REMARK   3  GMQE    0.89
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.87
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    GLC
REMARK   3  BIND    A.136
REMARK   3  BIND 2  A.137
REMARK   3  BIND 3  A.140
REMARK   3  BIND 4  A.285
REMARK   3  BIND 5  A.378
REMARK   3  BIND 6  A.456
REMARK   3  BIND 7  A.485
REMARK   3  BIND 8  A.574
REMARK   3  BIND 9  A.673
REMARK   3  BIND 10  A.674
REMARK   3  BIND 11  A.675
REMARK   3  BIND 12  A.676
REMARK   3  BIND 13  A.677
REMARK   3  BIND 14  _.1
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    GLC
REMARK   3  BIND    B.136
REMARK   3  BIND 2  B.137
REMARK   3  BIND 3  B.140
REMARK   3  BIND 4  B.285
REMARK   3  BIND 5  B.378
REMARK   3  BIND 6  B.456
REMARK   3  BIND 7  B.485
REMARK   3  BIND 8  B.574
REMARK   3  BIND 9  B.673
REMARK   3  BIND 10  B.674
REMARK   3  BIND 11  B.675
REMARK   3  BIND 12  B.676
REMARK   3  BIND 13  B.677
REMARK   3  BIND 14  _.4
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    IHU
REMARK   3  BIND    A.40
REMARK   3  BIND 2  A.41
REMARK   3  BIND 3  A.42
REMARK   3  BIND 4  A.43
REMARK   3  BIND 5  A.45
REMARK   3  BIND 6  A.46
REMARK   3  BIND 7  B.68
REMARK   3  BIND 8  B.69
REMARK   3  BIND 9  B.72
REMARK   3  BIND 10  B.73
REMARK   3  BIND 11  B.192
REMARK   3  BIND 12  B.194
REMARK   3  BIND 13  B.228
REMARK   3  BIND 14  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 4
REMARK   3  NAME    IHU
REMARK   3  BIND    A.68
REMARK   3  BIND 2  A.69
REMARK   3  BIND 3  A.72
REMARK   3  BIND 4  A.73
REMARK   3  BIND 5  A.192
REMARK   3  BIND 6  A.194
REMARK   3  BIND 7  A.228
REMARK   3  BIND 8  B.40
REMARK   3  BIND 9  B.41
REMARK   3  BIND 10  B.42
REMARK   3  BIND 11  B.43
REMARK   3  BIND 12  B.45
REMARK   3  BIND 13  B.46
REMARK   3  BIND 14  _.5
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   2ati
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2021-12-10
REMARK   3  SMTLE   2ati.1.A
REMARK   3  SMTLV   2021-12-15
REMARK   3  MTHD    X-RAY DIFFRACTION 1.90 A
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.93
REMARK   3  SIM     0.56
REMARK   3  SID     80.00
REMARK   3  OSTAT   homo-dimer
REMARK   3  LIGND   GLC
REMARK   3  LIGND 2 GLC
REMARK   3  LIGND 3 IHU
REMARK   3  LIGND 4 IHU
REMARK   3  LIGND 5 PLP
REMARK   3  LIGND 6 PLP
REMARK   3  ALN A TRG MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAH
REMARK   3  ALN A TRG TVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQL
REMARK   3  ALN A TRG GLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGG
REMARK   3  ALN A TRG WQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVP
REMARK   3  ALN A TRG GYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN A TRG ELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIP
REMARK   3  ALN A TRG ELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYE
REMARK   3  ALN A TRG INQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
REMARK   3  ALN A TRG KKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKL
REMARK   3  ALN A TRG LSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLN
REMARK   3  ALN A TRG CLHVITLYNRIKREPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVG
REMARK   3  ALN A TRG DRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN A TRG NVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPK
REMARK   3  ALN A TRG QPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKF
REMARK   3  ALN A TRG SSDRTIAQYAREIWGVEPSRQRLPAPDEAI
REMARK   3  ALN A TPL -AKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAH
REMARK   3  ALN A TPL TVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQL
REMARK   3  ALN A TPL GLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDG
REMARK   3  ALN A TPL WQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVP
REMARK   3  ALN A TPL GYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN A TPL ELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIP
REMARK   3  ALN A TPL ELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYE
REMARK   3  ALN A TPL INQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIV
REMARK   3  ALN A TPL KTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKL
REMARK   3  ALN A TPL HSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLN
REMARK   3  ALN A TPL CLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVG
REMARK   3  ALN A TPL SKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN A TPL NVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPK
REMARK   3  ALN A TPL QPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKF
REMARK   3  ALN A TPL SSDRTIKEYAQNIWNVEPSDLKISLSNES-
REMARK   3  ALN A OFF 0
ATOM      1  N   ASN A  24       8.806 102.655 127.849  1.00  0.83           N  
ATOM      2  CA  ASN A  24       7.387 102.272 127.493  1.00  0.83           C  
ATOM      3  C   ASN A  24       7.363 101.166 126.445  1.00  0.83           C  
ATOM      4  O   ASN A  24       8.419 100.768 125.968  1.00  0.83           O  
ATOM      5  CB  ASN A  24       6.573 103.536 127.072  1.00  0.83           C  
ATOM      6  CG  ASN A  24       7.238 104.208 125.867  1.00  0.83           C  
ATOM      7  OD1 ASN A  24       7.239 103.641 124.780  1.00  0.83           O  
ATOM      8  ND2 ASN A  24       7.929 105.331 126.139  1.00  0.83           N  
ATOM      9  N   VAL A  25       6.177 100.629 126.093  1.00  0.87           N  
ATOM     10  CA  VAL A  25       6.038  99.509 125.168  1.00  0.87           C  
ATOM     11  C   VAL A  25       6.506  99.797 123.746  1.00  0.87           C  
ATOM     12  O   VAL A  25       7.282  99.039 123.172  1.00  0.87           O  
ATOM     13  CB  VAL A  25       4.578  99.064 125.135  1.00  0.87           C  
ATOM     14  CG1 VAL A  25       4.346  97.914 124.133  1.00  0.87           C  
ATOM     15  CG2 VAL A  25       4.175  98.592 126.546  1.00  0.87           C  
ATOM     16  N   THR A  26       6.084 100.928 123.147  1.00  0.84           N  
ATOM     17  CA  THR A  26       6.385 101.288 121.760  1.00  0.84           C  
ATOM     18  C   THR A  26       7.863 101.477 121.492  1.00  0.84           C  
ATOM     19  O   THR A  26       8.403 100.965 120.510  1.00  0.84           O  
ATOM     20  CB  THR A  26       5.632 102.548 121.353  1.00  0.84           C  
ATOM     21  OG1 THR A  26       4.238 102.297 121.440  1.00  0.84           O  
ATOM     22  CG2 THR A  26       5.904 102.965 119.902  1.00  0.84           C  
ATOM     23  N   GLU A  27       8.581 102.172 122.395  1.00  0.79           N  
ATOM     24  CA  GLU A  27      10.028 102.279 122.341  1.00  0.79           C  
ATOM     25  C   GLU A  27      10.760 100.948 122.496  1.00  0.79           C  
ATOM     26  O   GLU A  27      11.723 100.672 121.782  1.00  0.79           O  
ATOM     27  CB  GLU A  27      10.546 103.259 123.406  1.00  0.79           C  
ATOM     28  CG  GLU A  27      10.141 104.723 123.134  1.00  0.79           C  
ATOM     29  CD  GLU A  27      10.880 105.635 124.100  1.00  0.79           C  
ATOM     30  OE1 GLU A  27      12.125 105.729 123.978  1.00  0.79           O  
ATOM     31  OE2 GLU A  27      10.202 106.179 125.009  1.00  0.79           O  
ATOM     32  N   LEU A  28      10.305 100.053 123.401  1.00  0.86           N  
ATOM     33  CA  LEU A  28      10.866  98.714 123.537  1.00  0.86           C  
ATOM     34  C   LEU A  28      10.737  97.870 122.270  1.00  0.86           C  
ATOM     35  O   LEU A  28      11.692  97.200 121.874  1.00  0.86           O  
ATOM     36  CB  LEU A  28      10.249  97.940 124.729  1.00  0.86           C  
ATOM     37  CG  LEU A  28      10.711  98.432 126.117  1.00  0.86           C  
ATOM     38  CD1 LEU A  28       9.799  97.857 127.207  1.00  0.86           C  
ATOM     39  CD2 LEU A  28      12.168  98.044 126.413  1.00  0.86           C  
ATOM     40  N   LYS A  29       9.581  97.925 121.566  1.00  0.81           N  
ATOM     41  CA  LYS A  29       9.410  97.279 120.269  1.00  0.81           C  
ATOM     42  C   LYS A  29      10.372  97.809 119.212  1.00  0.81           C  
ATOM     43  O   LYS A  29      11.022  97.047 118.496  1.00  0.81           O  
ATOM     44  CB  LYS A  29       7.970  97.451 119.712  1.00  0.81           C  
ATOM     45  CG  LYS A  29       6.885  96.829 120.600  1.00  0.81           C  
ATOM     46  CD  LYS A  29       5.549  96.567 119.881  1.00  0.81           C  
ATOM     47  CE  LYS A  29       4.869  97.801 119.282  1.00  0.81           C  
ATOM     48  NZ  LYS A  29       3.524  97.431 118.802  1.00  0.81           N  
ATOM     49  N   LYS A  30      10.539  99.146 119.137  1.00  0.80           N  
ATOM     50  CA  LYS A  30      11.490  99.779 118.243  1.00  0.80           C  
ATOM     51  C   LYS A  30      12.936  99.388 118.517  1.00  0.80           C  
ATOM     52  O   LYS A  30      13.713  99.170 117.587  1.00  0.80           O  
ATOM     53  CB  LYS A  30      11.372 101.326 118.281  1.00  0.80           C  
ATOM     54  CG  LYS A  30      10.135 101.851 117.529  1.00  0.80           C  
ATOM     55  CD  LYS A  30      10.163 103.364 117.232  1.00  0.80           C  
ATOM     56  CE  LYS A  30      10.802 103.753 115.888  1.00  0.80           C  
ATOM     57  NZ  LYS A  30      12.237 103.398 115.851  1.00  0.80           N  
ATOM     58  N   ASN A  31      13.336  99.297 119.799  1.00  0.82           N  
ATOM     59  CA  ASN A  31      14.658  98.852 120.208  1.00  0.82           C  
ATOM     60  C   ASN A  31      14.915  97.389 119.850  1.00  0.82           C  
ATOM     61  O   ASN A  31      15.974  97.051 119.321  1.00  0.82           O  
ATOM     62  CB  ASN A  31      14.885  99.109 121.724  1.00  0.82           C  
ATOM     63  CG  ASN A  31      14.920 100.609 122.023  1.00  0.82           C  
ATOM     64  OD1 ASN A  31      14.841 101.472 121.143  1.00  0.82           O  
ATOM     65  ND2 ASN A  31      15.120 100.959 123.313  1.00  0.82           N  
ATOM     66  N   PHE A  32      13.917  96.502 120.057  1.00  0.89           N  
ATOM     67  CA  PHE A  32      13.960  95.101 119.664  1.00  0.89           C  
ATOM     68  C   PHE A  32      14.127  94.927 118.157  1.00  0.89           C  
ATOM     69  O   PHE A  32      14.981  94.174 117.692  1.00  0.89           O  
ATOM     70  CB  PHE A  32      12.645  94.423 120.160  1.00  0.89           C  
ATOM     71  CG  PHE A  32      12.555  92.949 119.846  1.00  0.89           C  
ATOM     72  CD1 PHE A  32      12.048  92.518 118.607  1.00  0.89           C  
ATOM     73  CD2 PHE A  32      12.939  91.985 120.790  1.00  0.89           C  
ATOM     74  CE1 PHE A  32      11.927  91.155 118.311  1.00  0.89           C  
ATOM     75  CE2 PHE A  32      12.816  90.619 120.501  1.00  0.89           C  
ATOM     76  CZ  PHE A  32      12.313  90.206 119.263  1.00  0.89           C  
ATOM     77  N   ASN A  33      13.343  95.664 117.343  1.00  0.82           N  
ATOM     78  CA  ASN A  33      13.464  95.646 115.894  1.00  0.82           C  
ATOM     79  C   ASN A  33      14.813  96.168 115.407  1.00  0.82           C  
ATOM     80  O   ASN A  33      15.418  95.599 114.500  1.00  0.82           O  
ATOM     81  CB  ASN A  33      12.302  96.428 115.219  1.00  0.82           C  
ATOM     82  CG  ASN A  33      10.927  95.811 115.485  1.00  0.82           C  
ATOM     83  OD1 ASN A  33       9.917  96.509 115.569  1.00  0.82           O  
ATOM     84  ND2 ASN A  33      10.850  94.465 115.589  1.00  0.82           N  
ATOM     85  N   ARG A  34      15.343  97.237 116.036  1.00  0.78           N  
ATOM     86  CA  ARG A  34      16.670  97.760 115.756  1.00  0.78           C  
ATOM     87  C   ARG A  34      17.785  96.763 116.044  1.00  0.78           C  
ATOM     88  O   ARG A  34      18.672  96.558 115.218  1.00  0.78           O  
ATOM     89  CB  ARG A  34      16.907  99.041 116.597  1.00  0.78           C  
ATOM     90  CG  ARG A  34      18.144  99.870 116.192  1.00  0.78           C  
ATOM     91  CD  ARG A  34      18.480 101.017 117.154  1.00  0.78           C  
ATOM     92  NE  ARG A  34      17.287 101.932 117.212  1.00  0.78           N  
ATOM     93  CZ  ARG A  34      16.571 102.162 118.319  1.00  0.78           C  
ATOM     94  NH1 ARG A  34      16.920 101.691 119.503  1.00  0.78           N  
ATOM     95  NH2 ARG A  34      15.491 102.934 118.254  1.00  0.78           N  
ATOM     96  N   HIS A  35      17.741  96.077 117.205  1.00  0.82           N  
ATOM     97  CA  HIS A  35      18.679  95.010 117.518  1.00  0.82           C  
ATOM     98  C   HIS A  35      18.559  93.804 116.605  1.00  0.82           C  
ATOM     99  O   HIS A  35      19.563  93.247 116.171  1.00  0.82           O  
ATOM    100  CB  HIS A  35      18.586  94.556 118.992  1.00  0.82           C  
ATOM    101  CG  HIS A  35      19.396  95.438 119.887  1.00  0.82           C  
ATOM    102  ND1 HIS A  35      20.770  95.447 119.728  1.00  0.82           N  
ATOM    103  CD2 HIS A  35      19.026  96.300 120.870  1.00  0.82           C  
ATOM    104  CE1 HIS A  35      21.209  96.321 120.621  1.00  0.82           C  
ATOM    105  NE2 HIS A  35      20.195  96.860 121.335  1.00  0.82           N  
ATOM    106  N   LEU A  36      17.334  93.374 116.243  1.00  0.86           N  
ATOM    107  CA  LEU A  36      17.140  92.277 115.310  1.00  0.86           C  
ATOM    108  C   LEU A  36      17.760  92.564 113.943  1.00  0.86           C  
ATOM    109  O   LEU A  36      18.462  91.735 113.364  1.00  0.86           O  
ATOM    110  CB  LEU A  36      15.625  91.987 115.162  1.00  0.86           C  
ATOM    111  CG  LEU A  36      15.271  90.735 114.334  1.00  0.86           C  
ATOM    112  CD1 LEU A  36      15.762  89.449 115.015  1.00  0.86           C  
ATOM    113  CD2 LEU A  36      13.755  90.662 114.103  1.00  0.86           C  
ATOM    114  N   HIS A  37      17.566  93.793 113.431  1.00  0.80           N  
ATOM    115  CA  HIS A  37      18.180  94.226 112.192  1.00  0.80           C  
ATOM    116  C   HIS A  37      19.702  94.375 112.262  1.00  0.80           C  
ATOM    117  O   HIS A  37      20.428  93.666 111.576  1.00  0.80           O  
ATOM    118  CB  HIS A  37      17.551  95.572 111.752  1.00  0.80           C  
ATOM    119  CG  HIS A  37      17.950  96.023 110.380  1.00  0.80           C  
ATOM    120  ND1 HIS A  37      17.437  95.381 109.274  1.00  0.80           N  
ATOM    121  CD2 HIS A  37      18.778  97.029 109.996  1.00  0.80           C  
ATOM    122  CE1 HIS A  37      17.957  96.004 108.238  1.00  0.80           C  
ATOM    123  NE2 HIS A  37      18.776  97.012 108.619  1.00  0.80           N  
ATOM    124  N   PHE A  38      20.252  95.270 113.111  1.00  0.79           N  
ATOM    125  CA  PHE A  38      21.682  95.577 113.079  1.00  0.79           C  
ATOM    126  C   PHE A  38      22.569  94.564 113.797  1.00  0.79           C  
ATOM    127  O   PHE A  38      23.627  94.156 113.313  1.00  0.79           O  
ATOM    128  CB  PHE A  38      21.959  96.977 113.689  1.00  0.79           C  
ATOM    129  CG  PHE A  38      21.384  98.067 112.821  1.00  0.79           C  
ATOM    130  CD1 PHE A  38      21.999  98.400 111.603  1.00  0.79           C  
ATOM    131  CD2 PHE A  38      20.251  98.791 113.224  1.00  0.79           C  
ATOM    132  CE1 PHE A  38      21.500  99.441 110.808  1.00  0.79           C  
ATOM    133  CE2 PHE A  38      19.740  99.829 112.432  1.00  0.79           C  
ATOM    134  CZ  PHE A  38      20.368 100.155 111.223  1.00  0.79           C  
ATOM    135  N   THR A  39      22.166  94.130 115.003  1.00  0.78           N  
ATOM    136  CA  THR A  39      22.943  93.211 115.826  1.00  0.78           C  
ATOM    137  C   THR A  39      22.841  91.779 115.339  1.00  0.78           C  
ATOM    138  O   THR A  39      23.833  91.045 115.328  1.00  0.78           O  
ATOM    139  CB  THR A  39      22.566  93.292 117.302  1.00  0.78           C  
ATOM    140  OG1 THR A  39      22.702  94.635 117.735  1.00  0.78           O  
ATOM    141  CG2 THR A  39      23.522  92.472 118.177  1.00  0.78           C  
ATOM    142  N   LEU A  40      21.640  91.326 114.914  1.00  0.80           N  
ATOM    143  CA  LEU A  40      21.453  89.942 114.496  1.00  0.80           C  
ATOM    144  C   LEU A  40      21.494  89.734 112.987  1.00  0.80           C  
ATOM    145  O   LEU A  40      21.733  88.607 112.550  1.00  0.80           O  
ATOM    146  CB  LEU A  40      20.133  89.316 115.030  1.00  0.80           C  
ATOM    147  CG  LEU A  40      20.112  88.918 116.526  1.00  0.80           C  
ATOM    148  CD1 LEU A  40      21.254  87.951 116.874  1.00  0.80           C  
ATOM    149  CD2 LEU A  40      20.089  90.109 117.493  1.00  0.80           C  
ATOM    150  N   VAL A  41      21.329  90.794 112.165  1.00  0.80           N  
ATOM    151  CA  VAL A  41      21.361  90.739 110.700  1.00  0.80           C  
ATOM    152  C   VAL A  41      20.204  89.910 110.139  1.00  0.80           C  
ATOM    153  O   VAL A  41      20.365  89.005 109.317  1.00  0.80           O  
ATOM    154  CB  VAL A  41      22.729  90.384 110.095  1.00  0.80           C  
ATOM    155  CG1 VAL A  41      22.797  90.780 108.603  1.00  0.80           C  
ATOM    156  CG2 VAL A  41      23.853  91.127 110.849  1.00  0.80           C  
ATOM    157  N   LYS A  42      18.974  90.199 110.612  1.00  0.78           N  
ATOM    158  CA  LYS A  42      17.795  89.417 110.292  1.00  0.78           C  
ATOM    159  C   LYS A  42      16.561  90.289 110.111  1.00  0.78           C  
ATOM    160  O   LYS A  42      16.402  91.328 110.747  1.00  0.78           O  
ATOM    161  CB  LYS A  42      17.442  88.423 111.442  1.00  0.78           C  
ATOM    162  CG  LYS A  42      18.427  87.262 111.662  1.00  0.78           C  
ATOM    163  CD  LYS A  42      18.442  86.301 110.469  1.00  0.78           C  
ATOM    164  CE  LYS A  42      19.331  85.067 110.638  1.00  0.78           C  
ATOM    165  NZ  LYS A  42      18.702  83.997 111.442  1.00  0.78           N  
ATOM    166  N   ASP A  43      15.620  89.835 109.253  1.00  0.79           N  
ATOM    167  CA  ASP A  43      14.271  90.352 109.173  1.00  0.79           C  
ATOM    168  C   ASP A  43      13.332  89.428 109.960  1.00  0.79           C  
ATOM    169  O   ASP A  43      13.762  88.559 110.711  1.00  0.79           O  
ATOM    170  CB  ASP A  43      13.831  90.552 107.689  1.00  0.79           C  
ATOM    171  CG  ASP A  43      13.653  89.262 106.897  1.00  0.79           C  
ATOM    172  OD1 ASP A  43      13.962  88.165 107.427  1.00  0.79           O  
ATOM    173  OD2 ASP A  43      13.123  89.352 105.767  1.00  0.79           O  
ATOM    174  N   ARG A  44      11.999  89.568 109.823  1.00  0.76           N  
ATOM    175  CA  ARG A  44      11.075  88.643 110.465  1.00  0.76           C  
ATOM    176  C   ARG A  44      10.880  87.345 109.692  1.00  0.76           C  
ATOM    177  O   ARG A  44      10.326  86.395 110.240  1.00  0.76           O  
ATOM    178  CB  ARG A  44       9.685  89.287 110.724  1.00  0.76           C  
ATOM    179  CG  ARG A  44       9.689  90.445 111.750  1.00  0.76           C  
ATOM    180  CD  ARG A  44      10.150  90.092 113.177  1.00  0.76           C  
ATOM    181  NE  ARG A  44       9.262  89.023 113.739  1.00  0.76           N  
ATOM    182  CZ  ARG A  44       8.180  89.228 114.501  1.00  0.76           C  
ATOM    183  NH1 ARG A  44       7.714  90.439 114.779  1.00  0.76           N  
ATOM    184  NH2 ARG A  44       7.533  88.185 115.012  1.00  0.76           N  
ATOM    185  N   ASN A  45      11.327  87.263 108.421  1.00  0.68           N  
ATOM    186  CA  ASN A  45      11.184  86.076 107.598  1.00  0.68           C  
ATOM    187  C   ASN A  45      12.156  84.969 107.990  1.00  0.68           C  
ATOM    188  O   ASN A  45      11.784  83.799 108.044  1.00  0.68           O  
ATOM    189  CB  ASN A  45      11.390  86.410 106.097  1.00  0.68           C  
ATOM    190  CG  ASN A  45      10.322  87.384 105.611  1.00  0.68           C  
ATOM    191  OD1 ASN A  45       9.123  87.171 105.794  1.00  0.68           O  
ATOM    192  ND2 ASN A  45      10.745  88.475 104.940  1.00  0.68           N  
ATOM    193  N   VAL A  46      13.437  85.303 108.266  1.00  0.72           N  
ATOM    194  CA  VAL A  46      14.456  84.290 108.556  1.00  0.72           C  
ATOM    195  C   VAL A  46      15.078  84.414 109.951  1.00  0.72           C  
ATOM    196  O   VAL A  46      16.105  83.798 110.262  1.00  0.72           O  
ATOM    197  CB  VAL A  46      15.552  84.255 107.489  1.00  0.72           C  
ATOM    198  CG1 VAL A  46      14.948  83.753 106.160  1.00  0.72           C  
ATOM    199  CG2 VAL A  46      16.173  85.649 107.290  1.00  0.72           C  
ATOM    200  N   ALA A  47      14.482  85.212 110.858  1.00  0.84           N  
ATOM    201  CA  ALA A  47      14.844  85.233 112.266  1.00  0.84           C  
ATOM    202  C   ALA A  47      14.460  83.964 113.025  1.00  0.84           C  
ATOM    203  O   ALA A  47      13.367  83.422 112.882  1.00  0.84           O  
ATOM    204  CB  ALA A  47      14.217  86.438 112.986  1.00  0.84           C  
ATOM    205  N   THR A  48      15.370  83.472 113.885  1.00  0.82           N  
ATOM    206  CA  THR A  48      15.173  82.291 114.711  1.00  0.82           C  
ATOM    207  C   THR A  48      14.686  82.665 116.112  1.00  0.82           C  
ATOM    208  O   THR A  48      14.795  83.831 116.499  1.00  0.82           O  
ATOM    209  CB  THR A  48      16.430  81.417 114.807  1.00  0.82           C  
ATOM    210  OG1 THR A  48      17.475  82.055 115.524  1.00  0.82           O  
ATOM    211  CG2 THR A  48      17.014  81.110 113.436  1.00  0.82           C  
ATOM    212  N   PRO A  49      14.164  81.745 116.949  1.00  0.89           N  
ATOM    213  CA  PRO A  49      13.873  82.018 118.360  1.00  0.89           C  
ATOM    214  C   PRO A  49      15.096  82.501 119.119  1.00  0.89           C  
ATOM    215  O   PRO A  49      14.981  83.284 120.059  1.00  0.89           O  
ATOM    216  CB  PRO A  49      13.334  80.686 118.915  1.00  0.89           C  
ATOM    217  CG  PRO A  49      12.743  79.966 117.696  1.00  0.89           C  
ATOM    218  CD  PRO A  49      13.555  80.487 116.504  1.00  0.89           C  
ATOM    219  N   ARG A  50      16.293  82.042 118.708  1.00  0.82           N  
ATOM    220  CA  ARG A  50      17.556  82.469 119.258  1.00  0.82           C  
ATOM    221  C   ARG A  50      17.898  83.909 118.901  1.00  0.82           C  
ATOM    222  O   ARG A  50      18.335  84.675 119.759  1.00  0.82           O  
ATOM    223  CB  ARG A  50      18.661  81.452 118.882  1.00  0.82           C  
ATOM    224  CG  ARG A  50      20.039  81.770 119.491  1.00  0.82           C  
ATOM    225  CD  ARG A  50      21.061  80.628 119.407  1.00  0.82           C  
ATOM    226  NE  ARG A  50      20.740  79.638 120.494  1.00  0.82           N  
ATOM    227  CZ  ARG A  50      20.277  78.393 120.319  1.00  0.82           C  
ATOM    228  NH1 ARG A  50      19.991  77.917 119.112  1.00  0.82           N  
ATOM    229  NH2 ARG A  50      20.088  77.616 121.386  1.00  0.82           N  
ATOM    230  N   ASP A  51      17.635  84.339 117.648  1.00  0.86           N  
ATOM    231  CA  ASP A  51      17.766  85.727 117.230  1.00  0.86           C  
ATOM    232  C   ASP A  51      16.835  86.655 118.017  1.00  0.86           C  
ATOM    233  O   ASP A  51      17.237  87.719 118.490  1.00  0.86           O  
ATOM    234  CB  ASP A  51      17.487  85.898 115.712  1.00  0.86           C  
ATOM    235  CG  ASP A  51      18.455  85.081 114.884  1.00  0.86           C  
ATOM    236  OD1 ASP A  51      19.686  85.247 115.045  1.00  0.86           O  
ATOM    237  OD2 ASP A  51      17.978  84.256 114.054  1.00  0.86           O  
ATOM    238  N   TYR A  52      15.569  86.235 118.229  1.00  0.89           N  
ATOM    239  CA  TYR A  52      14.599  86.942 119.052  1.00  0.89           C  
ATOM    240  C   TYR A  52      15.002  87.053 120.524  1.00  0.89           C  
ATOM    241  O   TYR A  52      14.874  88.121 121.123  1.00  0.89           O  
ATOM    242  CB  TYR A  52      13.196  86.275 118.975  1.00  0.89           C  
ATOM    243  CG  TYR A  52      12.557  86.320 117.604  1.00  0.89           C  
ATOM    244  CD1 TYR A  52      12.627  87.455 116.774  1.00  0.89           C  
ATOM    245  CD2 TYR A  52      11.798  85.218 117.166  1.00  0.89           C  
ATOM    246  CE1 TYR A  52      11.965  87.479 115.538  1.00  0.89           C  
ATOM    247  CE2 TYR A  52      11.153  85.232 115.920  1.00  0.89           C  
ATOM    248  CZ  TYR A  52      11.235  86.367 115.107  1.00  0.89           C  
ATOM    249  OH  TYR A  52      10.576  86.409 113.857  1.00  0.89           O  
ATOM    250  N   TYR A  53      15.542  85.976 121.142  1.00  0.90           N  
ATOM    251  CA  TYR A  53      16.127  86.037 122.479  1.00  0.90           C  
ATOM    252  C   TYR A  53      17.267  87.055 122.552  1.00  0.90           C  
ATOM    253  O   TYR A  53      17.284  87.914 123.431  1.00  0.90           O  
ATOM    254  CB  TYR A  53      16.618  84.613 122.928  1.00  0.90           C  
ATOM    255  CG  TYR A  53      17.575  84.660 124.108  1.00  0.90           C  
ATOM    256  CD1 TYR A  53      17.130  85.061 125.379  1.00  0.90           C  
ATOM    257  CD2 TYR A  53      18.958  84.506 123.886  1.00  0.90           C  
ATOM    258  CE1 TYR A  53      18.055  85.369 126.389  1.00  0.90           C  
ATOM    259  CE2 TYR A  53      19.881  84.798 124.900  1.00  0.90           C  
ATOM    260  CZ  TYR A  53      19.424  85.249 126.140  1.00  0.90           C  
ATOM    261  OH  TYR A  53      20.341  85.614 127.138  1.00  0.90           O  
ATOM    262  N   PHE A  54      18.225  87.018 121.607  1.00  0.89           N  
ATOM    263  CA  PHE A  54      19.341  87.944 121.592  1.00  0.89           C  
ATOM    264  C   PHE A  54      18.923  89.395 121.393  1.00  0.89           C  
ATOM    265  O   PHE A  54      19.436  90.291 122.060  1.00  0.89           O  
ATOM    266  CB  PHE A  54      20.380  87.551 120.513  1.00  0.89           C  
ATOM    267  CG  PHE A  54      21.253  86.394 120.934  1.00  0.89           C  
ATOM    268  CD1 PHE A  54      21.944  86.406 122.161  1.00  0.89           C  
ATOM    269  CD2 PHE A  54      21.476  85.324 120.049  1.00  0.89           C  
ATOM    270  CE1 PHE A  54      22.830  85.372 122.490  1.00  0.89           C  
ATOM    271  CE2 PHE A  54      22.357  84.286 120.382  1.00  0.89           C  
ATOM    272  CZ  PHE A  54      23.030  84.307 121.607  1.00  0.89           C  
ATOM    273  N   ALA A  55      17.947  89.666 120.505  1.00  0.91           N  
ATOM    274  CA  ALA A  55      17.384  90.987 120.314  1.00  0.91           C  
ATOM    275  C   ALA A  55      16.724  91.548 121.576  1.00  0.91           C  
ATOM    276  O   ALA A  55      16.926  92.706 121.937  1.00  0.91           O  
ATOM    277  CB  ALA A  55      16.376  90.937 119.148  1.00  0.91           C  
ATOM    278  N   LEU A  56      15.952  90.724 122.316  1.00  0.92           N  
ATOM    279  CA  LEU A  56      15.416  91.097 123.618  1.00  0.92           C  
ATOM    280  C   LEU A  56      16.490  91.280 124.686  1.00  0.92           C  
ATOM    281  O   LEU A  56      16.475  92.260 125.428  1.00  0.92           O  
ATOM    282  CB  LEU A  56      14.351  90.068 124.081  1.00  0.92           C  
ATOM    283  CG  LEU A  56      13.645  90.364 125.426  1.00  0.92           C  
ATOM    284  CD1 LEU A  56      12.944  91.733 125.454  1.00  0.92           C  
ATOM    285  CD2 LEU A  56      12.621  89.262 125.734  1.00  0.92           C  
ATOM    286  N   ALA A  57      17.481  90.369 124.765  1.00  0.95           N  
ATOM    287  CA  ALA A  57      18.571  90.435 125.718  1.00  0.95           C  
ATOM    288  C   ALA A  57      19.447  91.673 125.565  1.00  0.95           C  
ATOM    289  O   ALA A  57      19.754  92.348 126.546  1.00  0.95           O  
ATOM    290  CB  ALA A  57      19.426  89.155 125.618  1.00  0.95           C  
ATOM    291  N   HIS A  58      19.818  92.048 124.322  1.00  0.86           N  
ATOM    292  CA  HIS A  58      20.506  93.305 124.053  1.00  0.86           C  
ATOM    293  C   HIS A  58      19.662  94.536 124.391  1.00  0.86           C  
ATOM    294  O   HIS A  58      20.139  95.434 125.077  1.00  0.86           O  
ATOM    295  CB  HIS A  58      21.026  93.372 122.599  1.00  0.86           C  
ATOM    296  CG  HIS A  58      22.298  92.590 122.386  1.00  0.86           C  
ATOM    297  ND1 HIS A  58      23.526  93.202 122.585  1.00  0.86           N  
ATOM    298  CD2 HIS A  58      22.486  91.300 121.994  1.00  0.86           C  
ATOM    299  CE1 HIS A  58      24.423  92.281 122.302  1.00  0.86           C  
ATOM    300  NE2 HIS A  58      23.849  91.112 121.943  1.00  0.86           N  
ATOM    301  N   THR A  59      18.357  94.569 124.021  1.00  0.88           N  
ATOM    302  CA  THR A  59      17.432  95.652 124.396  1.00  0.88           C  
ATOM    303  C   THR A  59      17.324  95.837 125.896  1.00  0.88           C  
ATOM    304  O   THR A  59      17.401  96.952 126.403  1.00  0.88           O  
ATOM    305  CB  THR A  59      16.007  95.416 123.881  1.00  0.88           C  
ATOM    306  OG1 THR A  59      15.977  95.537 122.471  1.00  0.88           O  
ATOM    307  CG2 THR A  59      14.996  96.458 124.390  1.00  0.88           C  
ATOM    308  N   VAL A  60      17.175  94.747 126.674  1.00  0.91           N  
ATOM    309  CA  VAL A  60      17.159  94.797 128.132  1.00  0.91           C  
ATOM    310  C   VAL A  60      18.491  95.264 128.709  1.00  0.91           C  
ATOM    311  O   VAL A  60      18.534  96.064 129.647  1.00  0.91           O  
ATOM    312  CB  VAL A  60      16.721  93.462 128.736  1.00  0.91           C  
ATOM    313  CG1 VAL A  60      16.845  93.468 130.274  1.00  0.91           C  
ATOM    314  CG2 VAL A  60      15.247  93.215 128.359  1.00  0.91           C  
ATOM    315  N   ARG A  61      19.627  94.811 128.143  1.00  0.84           N  
ATOM    316  CA  ARG A  61      20.944  95.239 128.568  1.00  0.84           C  
ATOM    317  C   ARG A  61      21.209  96.725 128.390  1.00  0.84           C  
ATOM    318  O   ARG A  61      21.788  97.360 129.269  1.00  0.84           O  
ATOM    319  CB  ARG A  61      22.051  94.435 127.861  1.00  0.84           C  
ATOM    320  CG  ARG A  61      23.442  94.631 128.500  1.00  0.84           C  
ATOM    321  CD  ARG A  61      24.555  93.926 127.731  1.00  0.84           C  
ATOM    322  NE  ARG A  61      24.688  94.671 126.444  1.00  0.84           N  
ATOM    323  CZ  ARG A  61      25.499  94.320 125.443  1.00  0.84           C  
ATOM    324  NH1 ARG A  61      26.201  93.194 125.473  1.00  0.84           N  
ATOM    325  NH2 ARG A  61      25.610  95.138 124.400  1.00  0.84           N  
ATOM    326  N   ASP A  62      20.754  97.339 127.284  1.00  0.86           N  
ATOM    327  CA  ASP A  62      20.891  98.762 127.022  1.00  0.86           C  
ATOM    328  C   ASP A  62      20.294  99.640 128.135  1.00  0.86           C  
ATOM    329  O   ASP A  62      20.862 100.658 128.531  1.00  0.86           O  
ATOM    330  CB  ASP A  62      20.262  99.093 125.644  1.00  0.86           C  
ATOM    331  CG  ASP A  62      21.095  98.542 124.492  1.00  0.86           C  
ATOM    332  OD1 ASP A  62      22.229  98.050 124.725  1.00  0.86           O  
ATOM    333  OD2 ASP A  62      20.591  98.637 123.340  1.00  0.86           O  
ATOM    334  N   HIS A  63      19.168  99.215 128.748  1.00  0.84           N  
ATOM    335  CA  HIS A  63      18.576  99.896 129.895  1.00  0.84           C  
ATOM    336  C   HIS A  63      19.385  99.799 131.197  1.00  0.84           C  
ATOM    337  O   HIS A  63      19.184 100.593 132.124  1.00  0.84           O  
ATOM    338  CB  HIS A  63      17.156  99.359 130.184  1.00  0.84           C  
ATOM    339  CG  HIS A  63      16.127  99.830 129.201  1.00  0.84           C  
ATOM    340  ND1 HIS A  63      15.345 100.922 129.521  1.00  0.84           N  
ATOM    341  CD2 HIS A  63      15.773  99.347 127.982  1.00  0.84           C  
ATOM    342  CE1 HIS A  63      14.535 101.081 128.495  1.00  0.84           C  
ATOM    343  NE2 HIS A  63      14.752 100.154 127.534  1.00  0.84           N  
ATOM    344  N   LEU A  64      20.332  98.843 131.323  1.00  0.86           N  
ATOM    345  CA  LEU A  64      21.331  98.859 132.383  1.00  0.86           C  
ATOM    346  C   LEU A  64      22.389  99.938 132.220  1.00  0.86           C  
ATOM    347  O   LEU A  64      22.744 100.617 133.183  1.00  0.86           O  
ATOM    348  CB  LEU A  64      22.126  97.528 132.465  1.00  0.86           C  
ATOM    349  CG  LEU A  64      21.290  96.345 132.963  1.00  0.86           C  
ATOM    350  CD1 LEU A  64      21.917  95.002 132.578  1.00  0.86           C  
ATOM    351  CD2 LEU A  64      21.146  96.444 134.482  1.00  0.86           C  
ATOM    352  N   VAL A  65      22.932 100.104 130.995  1.00  0.84           N  
ATOM    353  CA  VAL A  65      24.246 100.682 130.695  1.00  0.84           C  
ATOM    354  C   VAL A  65      24.522 102.026 131.331  1.00  0.84           C  
ATOM    355  O   VAL A  65      25.546 102.229 131.985  1.00  0.84           O  
ATOM    356  CB  VAL A  65      24.411 100.809 129.182  1.00  0.84           C  
ATOM    357  CG1 VAL A  65      25.628 101.665 128.775  1.00  0.84           C  
ATOM    358  CG2 VAL A  65      24.576  99.397 128.591  1.00  0.84           C  
ATOM    359  N   GLY A  66      23.575 102.979 131.221  1.00  0.84           N  
ATOM    360  CA  GLY A  66      23.746 104.294 131.819  1.00  0.84           C  
ATOM    361  C   GLY A  66      23.780 104.289 133.328  1.00  0.84           C  
ATOM    362  O   GLY A  66      24.332 105.202 133.929  1.00  0.84           O  
ATOM    363  N   ARG A  67      23.185 103.294 134.010  1.00  0.81           N  
ATOM    364  CA  ARG A  67      23.309 103.160 135.458  1.00  0.81           C  
ATOM    365  C   ARG A  67      24.578 102.430 135.854  1.00  0.81           C  
ATOM    366  O   ARG A  67      25.192 102.766 136.865  1.00  0.81           O  
ATOM    367  CB  ARG A  67      22.088 102.465 136.103  1.00  0.81           C  
ATOM    368  CG  ARG A  67      20.906 103.431 136.310  1.00  0.81           C  
ATOM    369  CD  ARG A  67      19.608 102.763 136.782  1.00  0.81           C  
ATOM    370  NE  ARG A  67      19.034 102.050 135.596  1.00  0.81           N  
ATOM    371  CZ  ARG A  67      17.776 101.597 135.535  1.00  0.81           C  
ATOM    372  NH1 ARG A  67      16.997 101.539 136.610  1.00  0.81           N  
ATOM    373  NH2 ARG A  67      17.295 101.201 134.357  1.00  0.81           N  
ATOM    374  N   TRP A  68      25.024 101.449 135.041  1.00  0.88           N  
ATOM    375  CA  TRP A  68      26.257 100.707 135.246  1.00  0.88           C  
ATOM    376  C   TRP A  68      27.507 101.577 135.179  1.00  0.88           C  
ATOM    377  O   TRP A  68      28.345 101.541 136.079  1.00  0.88           O  
ATOM    378  CB  TRP A  68      26.348  99.517 134.242  1.00  0.88           C  
ATOM    379  CG  TRP A  68      27.288  98.379 134.630  1.00  0.88           C  
ATOM    380  CD1 TRP A  68      27.873  98.099 135.838  1.00  0.88           C  
ATOM    381  CD2 TRP A  68      27.716  97.323 133.737  1.00  0.88           C  
ATOM    382  NE1 TRP A  68      28.628  96.945 135.764  1.00  0.88           N  
ATOM    383  CE2 TRP A  68      28.537  96.462 134.477  1.00  0.88           C  
ATOM    384  CE3 TRP A  68      27.445  97.086 132.386  1.00  0.88           C  
ATOM    385  CZ2 TRP A  68      29.114  95.334 133.900  1.00  0.88           C  
ATOM    386  CZ3 TRP A  68      28.041  95.957 131.795  1.00  0.88           C  
ATOM    387  CH2 TRP A  68      28.860  95.095 132.539  1.00  0.88           C  
ATOM    388  N   ILE A  69      27.623 102.462 134.161  1.00  0.84           N  
ATOM    389  CA  ILE A  69      28.708 103.443 134.075  1.00  0.84           C  
ATOM    390  C   ILE A  69      28.684 104.405 135.264  1.00  0.84           C  
ATOM    391  O   ILE A  69      29.698 104.637 135.921  1.00  0.84           O  
ATOM    392  CB  ILE A  69      28.666 104.227 132.753  1.00  0.84           C  
ATOM    393  CG1 ILE A  69      28.864 103.268 131.551  1.00  0.84           C  
ATOM    394  CG2 ILE A  69      29.744 105.342 132.726  1.00  0.84           C  
ATOM    395  CD1 ILE A  69      28.559 103.908 130.190  1.00  0.84           C  
ATOM    396  N   ARG A  70      27.495 104.942 135.624  1.00  0.79           N  
ATOM    397  CA  ARG A  70      27.338 105.859 136.746  1.00  0.79           C  
ATOM    398  C   ARG A  70      27.674 105.262 138.108  1.00  0.79           C  
ATOM    399  O   ARG A  70      28.360 105.893 138.908  1.00  0.79           O  
ATOM    400  CB  ARG A  70      25.909 106.464 136.793  1.00  0.79           C  
ATOM    401  CG  ARG A  70      25.715 107.638 135.807  1.00  0.79           C  
ATOM    402  CD  ARG A  70      24.328 108.304 135.862  1.00  0.79           C  
ATOM    403  NE  ARG A  70      23.372 107.346 135.235  1.00  0.79           N  
ATOM    404  CZ  ARG A  70      22.040 107.470 135.188  1.00  0.79           C  
ATOM    405  NH1 ARG A  70      21.354 106.634 134.412  1.00  0.79           N  
ATOM    406  NH2 ARG A  70      21.386 108.396 135.877  1.00  0.79           N  
ATOM    407  N   THR A  71      27.233 104.020 138.390  1.00  0.85           N  
ATOM    408  CA  THR A  71      27.552 103.286 139.617  1.00  0.85           C  
ATOM    409  C   THR A  71      29.057 103.094 139.778  1.00  0.85           C  
ATOM    410  O   THR A  71      29.642 103.428 140.807  1.00  0.85           O  
ATOM    411  CB  THR A  71      26.906 101.899 139.617  1.00  0.85           C  
ATOM    412  OG1 THR A  71      25.511 102.022 139.475  1.00  0.85           O  
ATOM    413  CG2 THR A  71      27.257 101.167 140.938  1.00  0.85           C  
ATOM    414  N   GLN A  72      29.767 102.624 138.726  1.00  0.81           N  
ATOM    415  CA  GLN A  72      31.218 102.450 138.771  1.00  0.81           C  
ATOM    416  C   GLN A  72      32.002 103.764 138.885  1.00  0.81           C  
ATOM    417  O   GLN A  72      32.965 103.861 139.650  1.00  0.81           O  
ATOM    418  CB  GLN A  72      31.736 101.565 137.602  1.00  0.81           C  
ATOM    419  CG  GLN A  72      31.055 100.169 137.519  1.00  0.81           C  
ATOM    420  CD  GLN A  72      31.123  99.402 138.844  1.00  0.81           C  
ATOM    421  OE1 GLN A  72      32.191  99.190 139.423  1.00  0.81           O  
ATOM    422  NE2 GLN A  72      29.946  98.982 139.363  1.00  0.81           N  
ATOM    423  N   GLN A  73      31.571 104.823 138.162  1.00  0.76           N  
ATOM    424  CA  GLN A  73      32.102 106.179 138.250  1.00  0.76           C  
ATOM    425  C   GLN A  73      31.952 106.798 139.634  1.00  0.76           C  
ATOM    426  O   GLN A  73      32.907 107.334 140.190  1.00  0.76           O  
ATOM    427  CB  GLN A  73      31.373 107.071 137.217  1.00  0.76           C  
ATOM    428  CG  GLN A  73      31.875 108.533 137.120  1.00  0.76           C  
ATOM    429  CD  GLN A  73      31.208 109.286 135.967  1.00  0.76           C  
ATOM    430  OE1 GLN A  73      31.839 109.949 135.150  1.00  0.76           O  
ATOM    431  NE2 GLN A  73      29.865 109.161 135.864  1.00  0.76           N  
ATOM    432  N   HIS A  74      30.769 106.651 140.271  1.00  0.77           N  
ATOM    433  CA  HIS A  74      30.495 107.091 141.636  1.00  0.77           C  
ATOM    434  C   HIS A  74      31.434 106.459 142.645  1.00  0.77           C  
ATOM    435  O   HIS A  74      31.982 107.118 143.528  1.00  0.77           O  
ATOM    436  CB  HIS A  74      29.045 106.710 142.040  1.00  0.77           C  
ATOM    437  CG  HIS A  74      28.655 107.011 143.462  1.00  0.77           C  
ATOM    438  ND1 HIS A  74      28.652 108.312 143.925  1.00  0.77           N  
ATOM    439  CD2 HIS A  74      28.221 106.165 144.436  1.00  0.77           C  
ATOM    440  CE1 HIS A  74      28.210 108.236 145.164  1.00  0.77           C  
ATOM    441  NE2 HIS A  74      27.936 106.960 145.523  1.00  0.77           N  
ATOM    442  N   TYR A  75      31.696 105.145 142.509  1.00  0.82           N  
ATOM    443  CA  TYR A  75      32.645 104.454 143.355  1.00  0.82           C  
ATOM    444  C   TYR A  75      34.069 104.989 143.209  1.00  0.82           C  
ATOM    445  O   TYR A  75      34.782 105.140 144.194  1.00  0.82           O  
ATOM    446  CB  TYR A  75      32.631 102.921 143.097  1.00  0.82           C  
ATOM    447  CG  TYR A  75      31.312 102.227 143.361  1.00  0.82           C  
ATOM    448  CD1 TYR A  75      30.308 102.765 144.193  1.00  0.82           C  
ATOM    449  CD2 TYR A  75      31.095 100.959 142.784  1.00  0.82           C  
ATOM    450  CE1 TYR A  75      29.115 102.064 144.418  1.00  0.82           C  
ATOM    451  CE2 TYR A  75      29.909 100.251 143.023  1.00  0.82           C  
ATOM    452  CZ  TYR A  75      28.918 100.812 143.833  1.00  0.82           C  
ATOM    453  OH  TYR A  75      27.715 100.125 144.076  1.00  0.82           O  
ATOM    454  N   TYR A  76      34.530 105.304 141.980  1.00  0.82           N  
ATOM    455  CA  TYR A  76      35.810 105.967 141.744  1.00  0.82           C  
ATOM    456  C   TYR A  76      35.856 107.381 142.340  1.00  0.82           C  
ATOM    457  O   TYR A  76      36.802 107.768 143.023  1.00  0.82           O  
ATOM    458  CB  TYR A  76      36.072 105.989 140.203  1.00  0.82           C  
ATOM    459  CG  TYR A  76      37.354 106.685 139.801  1.00  0.82           C  
ATOM    460  CD1 TYR A  76      38.605 106.086 140.030  1.00  0.82           C  
ATOM    461  CD2 TYR A  76      37.306 107.948 139.181  1.00  0.82           C  
ATOM    462  CE1 TYR A  76      39.788 106.741 139.649  1.00  0.82           C  
ATOM    463  CE2 TYR A  76      38.486 108.601 138.798  1.00  0.82           C  
ATOM    464  CZ  TYR A  76      39.725 107.997 139.035  1.00  0.82           C  
ATOM    465  OH  TYR A  76      40.906 108.657 138.644  1.00  0.82           O  
ATOM    466  N   GLU A  77      34.802 108.183 142.115  1.00  0.78           N  
ATOM    467  CA  GLU A  77      34.702 109.543 142.589  1.00  0.78           C  
ATOM    468  C   GLU A  77      34.598 109.711 144.090  1.00  0.78           C  
ATOM    469  O   GLU A  77      35.170 110.657 144.638  1.00  0.78           O  
ATOM    470  CB  GLU A  77      33.506 110.278 141.958  1.00  0.78           C  
ATOM    471  CG  GLU A  77      33.689 110.600 140.460  1.00  0.78           C  
ATOM    472  CD  GLU A  77      32.573 111.505 139.946  1.00  0.78           C  
ATOM    473  OE1 GLU A  77      31.756 111.971 140.784  1.00  0.78           O  
ATOM    474  OE2 GLU A  77      32.573 111.769 138.721  1.00  0.78           O  
ATOM    475  N   LYS A  78      33.840 108.863 144.799  1.00  0.78           N  
ATOM    476  CA  LYS A  78      33.644 109.047 146.226  1.00  0.78           C  
ATOM    477  C   LYS A  78      34.458 108.098 147.085  1.00  0.78           C  
ATOM    478  O   LYS A  78      34.525 108.315 148.290  1.00  0.78           O  
ATOM    479  CB  LYS A  78      32.134 108.915 146.569  1.00  0.78           C  
ATOM    480  CG  LYS A  78      31.307 110.151 146.165  1.00  0.78           C  
ATOM    481  CD  LYS A  78      31.495 111.335 147.134  1.00  0.78           C  
ATOM    482  CE  LYS A  78      30.852 112.648 146.672  1.00  0.78           C  
ATOM    483  NZ  LYS A  78      31.466 113.104 145.403  1.00  0.78           N  
ATOM    484  N   ASP A  79      35.109 107.062 146.506  1.00  0.85           N  
ATOM    485  CA  ASP A  79      35.844 106.036 147.231  1.00  0.85           C  
ATOM    486  C   ASP A  79      35.170 105.438 148.487  1.00  0.85           C  
ATOM    487  O   ASP A  79      35.800 105.387 149.548  1.00  0.85           O  
ATOM    488  CB  ASP A  79      37.279 106.510 147.516  1.00  0.85           C  
ATOM    489  CG  ASP A  79      38.210 106.086 146.425  1.00  0.85           C  
ATOM    490  OD1 ASP A  79      38.175 104.918 145.952  1.00  0.85           O  
ATOM    491  OD2 ASP A  79      39.235 106.831 146.374  1.00  0.85           O  
ATOM    492  N   PRO A  80      33.924 104.945 148.489  1.00  0.89           N  
ATOM    493  CA  PRO A  80      33.411 104.227 149.648  1.00  0.89           C  
ATOM    494  C   PRO A  80      34.123 102.897 149.818  1.00  0.89           C  
ATOM    495  O   PRO A  80      34.694 102.375 148.860  1.00  0.89           O  
ATOM    496  CB  PRO A  80      31.926 104.028 149.311  1.00  0.89           C  
ATOM    497  CG  PRO A  80      31.928 103.852 147.788  1.00  0.89           C  
ATOM    498  CD  PRO A  80      33.031 104.817 147.332  1.00  0.89           C  
ATOM    499  N   LYS A  81      34.123 102.324 151.038  1.00  0.87           N  
ATOM    500  CA  LYS A  81      34.755 101.041 151.272  1.00  0.87           C  
ATOM    501  C   LYS A  81      34.160  99.912 150.428  1.00  0.87           C  
ATOM    502  O   LYS A  81      32.947  99.719 150.352  1.00  0.87           O  
ATOM    503  CB  LYS A  81      34.765 100.672 152.775  1.00  0.87           C  
ATOM    504  CG  LYS A  81      35.465  99.335 153.055  1.00  0.87           C  
ATOM    505  CD  LYS A  81      35.646  99.003 154.538  1.00  0.87           C  
ATOM    506  CE  LYS A  81      36.481  97.730 154.668  1.00  0.87           C  
ATOM    507  NZ  LYS A  81      36.717  97.379 156.079  1.00  0.87           N  
ATOM    508  N   ARG A  82      35.036  99.158 149.739  1.00  0.87           N  
ATOM    509  CA  ARG A  82      34.651  98.216 148.713  1.00  0.87           C  
ATOM    510  C   ARG A  82      34.625  96.786 149.214  1.00  0.87           C  
ATOM    511  O   ARG A  82      35.472  96.357 149.996  1.00  0.87           O  
ATOM    512  CB  ARG A  82      35.622  98.299 147.512  1.00  0.87           C  
ATOM    513  CG  ARG A  82      35.682  99.702 146.877  1.00  0.87           C  
ATOM    514  CD  ARG A  82      36.864  99.863 145.924  1.00  0.87           C  
ATOM    515  NE  ARG A  82      36.912 101.279 145.441  1.00  0.87           N  
ATOM    516  CZ  ARG A  82      36.282 101.716 144.349  1.00  0.87           C  
ATOM    517  NH1 ARG A  82      35.346 100.979 143.763  1.00  0.87           N  
ATOM    518  NH2 ARG A  82      36.639 102.884 143.831  1.00  0.87           N  
ATOM    519  N   ILE A  83      33.636  96.007 148.744  1.00  0.95           N  
ATOM    520  CA  ILE A  83      33.415  94.637 149.171  1.00  0.95           C  
ATOM    521  C   ILE A  83      33.740  93.720 148.021  1.00  0.95           C  
ATOM    522  O   ILE A  83      33.167  93.801 146.937  1.00  0.95           O  
ATOM    523  CB  ILE A  83      31.981  94.350 149.625  1.00  0.95           C  
ATOM    524  CG1 ILE A  83      31.538  95.294 150.768  1.00  0.95           C  
ATOM    525  CG2 ILE A  83      31.848  92.870 150.070  1.00  0.95           C  
ATOM    526  CD1 ILE A  83      30.919  96.612 150.280  1.00  0.95           C  
ATOM    527  N   TYR A  84      34.682  92.796 148.228  1.00  0.96           N  
ATOM    528  CA  TYR A  84      35.079  91.858 147.209  1.00  0.96           C  
ATOM    529  C   TYR A  84      34.672  90.479 147.657  1.00  0.96           C  
ATOM    530  O   TYR A  84      35.204  89.914 148.612  1.00  0.96           O  
ATOM    531  CB  TYR A  84      36.604  91.907 146.982  1.00  0.96           C  
ATOM    532  CG  TYR A  84      36.977  93.268 146.460  1.00  0.96           C  
ATOM    533  CD1 TYR A  84      36.681  93.611 145.137  1.00  0.96           C  
ATOM    534  CD2 TYR A  84      37.595  94.221 147.281  1.00  0.96           C  
ATOM    535  CE1 TYR A  84      37.031  94.867 144.620  1.00  0.96           C  
ATOM    536  CE2 TYR A  84      37.975  95.470 146.766  1.00  0.96           C  
ATOM    537  CZ  TYR A  84      37.725  95.778 145.422  1.00  0.96           C  
ATOM    538  OH  TYR A  84      38.245  96.960 144.855  1.00  0.96           O  
ATOM    539  N   TYR A  85      33.689  89.889 146.960  1.00  0.97           N  
ATOM    540  CA  TYR A  85      33.238  88.553 147.260  1.00  0.97           C  
ATOM    541  C   TYR A  85      34.001  87.601 146.359  1.00  0.97           C  
ATOM    542  O   TYR A  85      33.756  87.509 145.155  1.00  0.97           O  
ATOM    543  CB  TYR A  85      31.705  88.433 147.074  1.00  0.97           C  
ATOM    544  CG  TYR A  85      31.188  87.271 147.875  1.00  0.97           C  
ATOM    545  CD1 TYR A  85      30.939  87.419 149.252  1.00  0.97           C  
ATOM    546  CD2 TYR A  85      30.985  86.020 147.271  1.00  0.97           C  
ATOM    547  CE1 TYR A  85      30.487  86.330 150.012  1.00  0.97           C  
ATOM    548  CE2 TYR A  85      30.517  84.939 148.028  1.00  0.97           C  
ATOM    549  CZ  TYR A  85      30.266  85.096 149.394  1.00  0.97           C  
ATOM    550  OH  TYR A  85      29.762  84.014 150.135  1.00  0.97           O  
ATOM    551  N   LEU A  86      34.988  86.896 146.937  1.00  0.97           N  
ATOM    552  CA  LEU A  86      35.916  86.077 146.192  1.00  0.97           C  
ATOM    553  C   LEU A  86      35.502  84.625 146.302  1.00  0.97           C  
ATOM    554  O   LEU A  86      35.452  84.032 147.382  1.00  0.97           O  
ATOM    555  CB  LEU A  86      37.359  86.312 146.709  1.00  0.97           C  
ATOM    556  CG  LEU A  86      38.479  85.532 145.984  1.00  0.97           C  
ATOM    557  CD1 LEU A  86      38.439  85.679 144.455  1.00  0.97           C  
ATOM    558  CD2 LEU A  86      39.859  85.964 146.508  1.00  0.97           C  
ATOM    559  N   SER A  87      35.157  84.015 145.155  1.00  0.96           N  
ATOM    560  CA  SER A  87      34.624  82.669 145.137  1.00  0.96           C  
ATOM    561  C   SER A  87      35.070  81.924 143.907  1.00  0.96           C  
ATOM    562  O   SER A  87      35.353  82.489 142.854  1.00  0.96           O  
ATOM    563  CB  SER A  87      33.071  82.648 145.162  1.00  0.96           C  
ATOM    564  OG  SER A  87      32.566  81.317 145.300  1.00  0.96           O  
ATOM    565  N   LEU A  88      35.109  80.589 144.019  1.00  0.96           N  
ATOM    566  CA  LEU A  88      35.338  79.704 142.903  1.00  0.96           C  
ATOM    567  C   LEU A  88      34.011  79.361 142.238  1.00  0.96           C  
ATOM    568  O   LEU A  88      33.999  78.780 141.155  1.00  0.96           O  
ATOM    569  CB  LEU A  88      36.025  78.398 143.394  1.00  0.96           C  
ATOM    570  CG  LEU A  88      37.574  78.431 143.389  1.00  0.96           C  
ATOM    571  CD1 LEU A  88      38.131  78.449 141.958  1.00  0.96           C  
ATOM    572  CD2 LEU A  88      38.176  79.583 144.209  1.00  0.96           C  
ATOM    573  N   GLU A  89      32.866  79.733 142.849  1.00  0.94           N  
ATOM    574  CA  GLU A  89      31.552  79.401 142.338  1.00  0.94           C  
ATOM    575  C   GLU A  89      30.563  80.564 142.345  1.00  0.94           C  
ATOM    576  O   GLU A  89      30.366  81.254 143.344  1.00  0.94           O  
ATOM    577  CB  GLU A  89      30.892  78.279 143.168  1.00  0.94           C  
ATOM    578  CG  GLU A  89      31.605  76.912 143.105  1.00  0.94           C  
ATOM    579  CD  GLU A  89      30.778  75.805 143.745  1.00  0.94           C  
ATOM    580  OE1 GLU A  89      31.344  74.698 143.907  1.00  0.94           O  
ATOM    581  OE2 GLU A  89      29.558  76.002 144.005  1.00  0.94           O  
ATOM    582  N   PHE A  90      29.862  80.763 141.212  1.00  0.95           N  
ATOM    583  CA  PHE A  90      28.778  81.722 141.078  1.00  0.95           C  
ATOM    584  C   PHE A  90      27.630  81.063 140.327  1.00  0.95           C  
ATOM    585  O   PHE A  90      27.568  81.050 139.100  1.00  0.95           O  
ATOM    586  CB  PHE A  90      29.221  82.996 140.305  1.00  0.95           C  
ATOM    587  CG  PHE A  90      30.011  83.899 141.209  1.00  0.95           C  
ATOM    588  CD1 PHE A  90      31.413  83.828 141.255  1.00  0.95           C  
ATOM    589  CD2 PHE A  90      29.348  84.817 142.043  1.00  0.95           C  
ATOM    590  CE1 PHE A  90      32.136  84.647 142.130  1.00  0.95           C  
ATOM    591  CE2 PHE A  90      30.071  85.638 142.920  1.00  0.95           C  
ATOM    592  CZ  PHE A  90      31.467  85.549 142.966  1.00  0.95           C  
ATOM    593  N   TYR A  91      26.646  80.503 141.056  1.00  0.94           N  
ATOM    594  CA  TYR A  91      25.553  79.732 140.480  1.00  0.94           C  
ATOM    595  C   TYR A  91      24.396  80.653 140.113  1.00  0.94           C  
ATOM    596  O   TYR A  91      23.320  80.669 140.719  1.00  0.94           O  
ATOM    597  CB  TYR A  91      25.134  78.618 141.478  1.00  0.94           C  
ATOM    598  CG  TYR A  91      24.532  77.357 140.900  1.00  0.94           C  
ATOM    599  CD1 TYR A  91      24.534  77.006 139.533  1.00  0.94           C  
ATOM    600  CD2 TYR A  91      24.014  76.436 141.824  1.00  0.94           C  
ATOM    601  CE1 TYR A  91      24.039  75.758 139.117  1.00  0.94           C  
ATOM    602  CE2 TYR A  91      23.530  75.189 141.414  1.00  0.94           C  
ATOM    603  CZ  TYR A  91      23.553  74.847 140.060  1.00  0.94           C  
ATOM    604  OH  TYR A  91      23.105  73.572 139.666  1.00  0.94           O  
ATOM    605  N   MET A  92      24.651  81.519 139.122  1.00  0.94           N  
ATOM    606  CA  MET A  92      23.791  82.618 138.740  1.00  0.94           C  
ATOM    607  C   MET A  92      22.457  82.177 138.162  1.00  0.94           C  
ATOM    608  O   MET A  92      21.418  82.692 138.573  1.00  0.94           O  
ATOM    609  CB  MET A  92      24.529  83.567 137.765  1.00  0.94           C  
ATOM    610  CG  MET A  92      25.809  84.183 138.367  1.00  0.94           C  
ATOM    611  SD  MET A  92      25.533  85.236 139.825  1.00  0.94           S  
ATOM    612  CE  MET A  92      25.025  86.739 138.942  1.00  0.94           C  
ATOM    613  N   GLY A  93      22.445  81.174 137.256  1.00  0.97           N  
ATOM    614  CA  GLY A  93      21.258  80.792 136.492  1.00  0.97           C  
ATOM    615  C   GLY A  93      21.060  81.680 135.292  1.00  0.97           C  
ATOM    616  O   GLY A  93      22.022  82.192 134.727  1.00  0.97           O  
ATOM    617  N   ARG A  94      19.806  81.868 134.847  1.00  0.91           N  
ATOM    618  CA  ARG A  94      19.489  82.778 133.755  1.00  0.91           C  
ATOM    619  C   ARG A  94      19.393  84.228 134.217  1.00  0.91           C  
ATOM    620  O   ARG A  94      18.977  84.513 135.341  1.00  0.91           O  
ATOM    621  CB  ARG A  94      18.149  82.402 133.100  1.00  0.91           C  
ATOM    622  CG  ARG A  94      18.202  81.075 132.335  1.00  0.91           C  
ATOM    623  CD  ARG A  94      16.853  80.800 131.690  1.00  0.91           C  
ATOM    624  NE  ARG A  94      16.986  79.528 130.939  1.00  0.91           N  
ATOM    625  CZ  ARG A  94      15.983  78.684 130.735  1.00  0.91           C  
ATOM    626  NH1 ARG A  94      14.795  78.900 131.288  1.00  0.91           N  
ATOM    627  NH2 ARG A  94      16.120  77.655 129.909  1.00  0.91           N  
ATOM    628  N   THR A  95      19.764  85.190 133.359  1.00  0.96           N  
ATOM    629  CA  THR A  95      19.880  86.596 133.726  1.00  0.96           C  
ATOM    630  C   THR A  95      18.749  87.424 133.150  1.00  0.96           C  
ATOM    631  O   THR A  95      18.370  88.432 133.748  1.00  0.96           O  
ATOM    632  CB  THR A  95      21.210  87.168 133.232  1.00  0.96           C  
ATOM    633  OG1 THR A  95      22.285  86.550 133.924  1.00  0.96           O  
ATOM    634  CG2 THR A  95      21.375  88.675 133.487  1.00  0.96           C  
ATOM    635  N   LEU A  96      18.117  87.034 132.012  1.00  0.94           N  
ATOM    636  CA  LEU A  96      17.162  87.903 131.319  1.00  0.94           C  
ATOM    637  C   LEU A  96      15.960  88.329 132.149  1.00  0.94           C  
ATOM    638  O   LEU A  96      15.719  89.522 132.340  1.00  0.94           O  
ATOM    639  CB  LEU A  96      16.658  87.233 130.007  1.00  0.94           C  
ATOM    640  CG  LEU A  96      15.579  88.001 129.199  1.00  0.94           C  
ATOM    641  CD1 LEU A  96      16.019  89.418 128.802  1.00  0.94           C  
ATOM    642  CD2 LEU A  96      15.171  87.222 127.939  1.00  0.94           C  
ATOM    643  N   GLN A  97      15.220  87.371 132.742  1.00  0.91           N  
ATOM    644  CA  GLN A  97      14.041  87.677 133.534  1.00  0.91           C  
ATOM    645  C   GLN A  97      14.373  88.469 134.798  1.00  0.91           C  
ATOM    646  O   GLN A  97      13.713  89.440 135.159  1.00  0.91           O  
ATOM    647  CB  GLN A  97      13.240  86.394 133.854  1.00  0.91           C  
ATOM    648  CG  GLN A  97      11.716  86.651 133.871  1.00  0.91           C  
ATOM    649  CD  GLN A  97      10.939  85.515 134.533  1.00  0.91           C  
ATOM    650  OE1 GLN A  97      11.397  84.376 134.632  1.00  0.91           O  
ATOM    651  NE2 GLN A  97       9.748  85.861 135.068  1.00  0.91           N  
ATOM    652  N   ASN A  98      15.488  88.104 135.468  1.00  0.94           N  
ATOM    653  CA  ASN A  98      15.993  88.746 136.672  1.00  0.94           C  
ATOM    654  C   ASN A  98      16.362  90.212 136.451  1.00  0.94           C  
ATOM    655  O   ASN A  98      15.971  91.083 137.224  1.00  0.94           O  
ATOM    656  CB  ASN A  98      17.194  87.896 137.180  1.00  0.94           C  
ATOM    657  CG  ASN A  98      17.725  88.233 138.572  1.00  0.94           C  
ATOM    658  OD1 ASN A  98      18.936  88.316 138.763  1.00  0.94           O  
ATOM    659  ND2 ASN A  98      16.846  88.343 139.589  1.00  0.94           N  
ATOM    660  N   THR A  99      17.059  90.530 135.342  1.00  0.94           N  
ATOM    661  CA  THR A  99      17.328  91.904 134.921  1.00  0.94           C  
ATOM    662  C   THR A  99      16.057  92.665 134.585  1.00  0.94           C  
ATOM    663  O   THR A  99      15.876  93.800 135.018  1.00  0.94           O  
ATOM    664  CB  THR A  99      18.292  91.966 133.742  1.00  0.94           C  
ATOM    665  OG1 THR A  99      19.532  91.394 134.125  1.00  0.94           O  
ATOM    666  CG2 THR A  99      18.624  93.409 133.347  1.00  0.94           C  
ATOM    667  N   MET A 100      15.092  92.062 133.853  1.00  0.90           N  
ATOM    668  CA  MET A 100      13.819  92.716 133.567  1.00  0.90           C  
ATOM    669  C   MET A 100      13.018  93.068 134.816  1.00  0.90           C  
ATOM    670  O   MET A 100      12.501  94.178 134.932  1.00  0.90           O  
ATOM    671  CB  MET A 100      12.922  91.872 132.626  1.00  0.90           C  
ATOM    672  CG  MET A 100      13.469  91.781 131.191  1.00  0.90           C  
ATOM    673  SD  MET A 100      12.323  91.075 129.971  1.00  0.90           S  
ATOM    674  CE  MET A 100      12.027  89.479 130.774  1.00  0.90           C  
ATOM    675  N   VAL A 101      12.932  92.150 135.797  1.00  0.91           N  
ATOM    676  CA  VAL A 101      12.298  92.390 137.087  1.00  0.91           C  
ATOM    677  C   VAL A 101      13.003  93.460 137.912  1.00  0.91           C  
ATOM    678  O   VAL A 101      12.372  94.410 138.377  1.00  0.91           O  
ATOM    679  CB  VAL A 101      12.212  91.080 137.870  1.00  0.91           C  
ATOM    680  CG1 VAL A 101      11.883  91.285 139.364  1.00  0.91           C  
ATOM    681  CG2 VAL A 101      11.131  90.201 137.215  1.00  0.91           C  
ATOM    682  N   ASN A 102      14.345  93.391 138.065  1.00  0.90           N  
ATOM    683  CA  ASN A 102      15.099  94.347 138.869  1.00  0.90           C  
ATOM    684  C   ASN A 102      15.052  95.771 138.304  1.00  0.90           C  
ATOM    685  O   ASN A 102      15.061  96.744 139.059  1.00  0.90           O  
ATOM    686  CB  ASN A 102      16.558  93.873 139.155  1.00  0.90           C  
ATOM    687  CG  ASN A 102      16.574  92.745 140.195  1.00  0.90           C  
ATOM    688  OD1 ASN A 102      15.548  92.152 140.530  1.00  0.90           O  
ATOM    689  ND2 ASN A 102      17.765  92.448 140.765  1.00  0.90           N  
ATOM    690  N   LEU A 103      14.929  95.933 136.968  1.00  0.89           N  
ATOM    691  CA  LEU A 103      14.812  97.238 136.338  1.00  0.89           C  
ATOM    692  C   LEU A 103      13.372  97.731 136.196  1.00  0.89           C  
ATOM    693  O   LEU A 103      13.169  98.860 135.750  1.00  0.89           O  
ATOM    694  CB  LEU A 103      15.402  97.203 134.900  1.00  0.89           C  
ATOM    695  CG  LEU A 103      16.905  96.867 134.800  1.00  0.89           C  
ATOM    696  CD1 LEU A 103      17.344  96.892 133.327  1.00  0.89           C  
ATOM    697  CD2 LEU A 103      17.782  97.800 135.644  1.00  0.89           C  
ATOM    698  N   ALA A 104      12.361  96.913 136.577  1.00  0.89           N  
ATOM    699  CA  ALA A 104      10.935  97.208 136.489  1.00  0.89           C  
ATOM    700  C   ALA A 104      10.383  97.221 135.065  1.00  0.89           C  
ATOM    701  O   ALA A 104       9.437  97.937 134.745  1.00  0.89           O  
ATOM    702  CB  ALA A 104      10.561  98.513 137.231  1.00  0.89           C  
ATOM    703  N   LEU A 105      10.947  96.391 134.170  1.00  0.86           N  
ATOM    704  CA  LEU A 105      10.588  96.394 132.761  1.00  0.86           C  
ATOM    705  C   LEU A 105       9.817  95.163 132.307  1.00  0.86           C  
ATOM    706  O   LEU A 105       9.359  95.129 131.167  1.00  0.86           O  
ATOM    707  CB  LEU A 105      11.867  96.483 131.885  1.00  0.86           C  
ATOM    708  CG  LEU A 105      12.617  97.827 131.980  1.00  0.86           C  
ATOM    709  CD1 LEU A 105      13.982  97.740 131.283  1.00  0.86           C  
ATOM    710  CD2 LEU A 105      11.808  98.978 131.360  1.00  0.86           C  
ATOM    711  N   GLU A 106       9.611  94.133 133.156  1.00  0.85           N  
ATOM    712  CA  GLU A 106       9.038  92.850 132.745  1.00  0.85           C  
ATOM    713  C   GLU A 106       7.652  92.925 132.111  1.00  0.85           C  
ATOM    714  O   GLU A 106       7.446  92.436 131.004  1.00  0.85           O  
ATOM    715  CB  GLU A 106       9.013  91.905 133.970  1.00  0.85           C  
ATOM    716  CG  GLU A 106       8.487  90.472 133.700  1.00  0.85           C  
ATOM    717  CD  GLU A 106       8.505  89.618 134.967  1.00  0.85           C  
ATOM    718  OE1 GLU A 106       7.825  90.016 135.946  1.00  0.85           O  
ATOM    719  OE2 GLU A 106       9.207  88.575 134.971  1.00  0.85           O  
ATOM    720  N   ASN A 107       6.688  93.641 132.729  1.00  0.79           N  
ATOM    721  CA  ASN A 107       5.359  93.864 132.170  1.00  0.79           C  
ATOM    722  C   ASN A 107       5.383  94.606 130.835  1.00  0.79           C  
ATOM    723  O   ASN A 107       4.656  94.283 129.900  1.00  0.79           O  
ATOM    724  CB  ASN A 107       4.494  94.694 133.157  1.00  0.79           C  
ATOM    725  CG  ASN A 107       4.488  94.037 134.531  1.00  0.79           C  
ATOM    726  OD1 ASN A 107       5.367  94.316 135.346  1.00  0.79           O  
ATOM    727  ND2 ASN A 107       3.496  93.159 134.795  1.00  0.79           N  
ATOM    728  N   ALA A 108       6.247  95.633 130.713  1.00  0.88           N  
ATOM    729  CA  ALA A 108       6.415  96.386 129.488  1.00  0.88           C  
ATOM    730  C   ALA A 108       7.031  95.565 128.357  1.00  0.88           C  
ATOM    731  O   ALA A 108       6.610  95.658 127.206  1.00  0.88           O  
ATOM    732  CB  ALA A 108       7.253  97.651 129.767  1.00  0.88           C  
ATOM    733  N   CYS A 109       8.043  94.732 128.671  1.00  0.89           N  
ATOM    734  CA  CYS A 109       8.652  93.797 127.741  1.00  0.89           C  
ATOM    735  C   CYS A 109       7.707  92.702 127.280  1.00  0.89           C  
ATOM    736  O   CYS A 109       7.685  92.388 126.095  1.00  0.89           O  
ATOM    737  CB  CYS A 109       9.926  93.149 128.336  1.00  0.89           C  
ATOM    738  SG  CYS A 109      11.296  94.353 128.463  1.00  0.89           S  
ATOM    739  N   ASP A 110       6.894  92.125 128.189  1.00  0.86           N  
ATOM    740  CA  ASP A 110       5.904  91.095 127.903  1.00  0.86           C  
ATOM    741  C   ASP A 110       4.837  91.574 126.914  1.00  0.86           C  
ATOM    742  O   ASP A 110       4.549  90.956 125.890  1.00  0.86           O  
ATOM    743  CB  ASP A 110       5.264  90.703 129.263  1.00  0.86           C  
ATOM    744  CG  ASP A 110       4.501  89.389 129.220  1.00  0.86           C  
ATOM    745  OD1 ASP A 110       3.690  89.176 130.157  1.00  0.86           O  
ATOM    746  OD2 ASP A 110       4.728  88.584 128.287  1.00  0.86           O  
ATOM    747  N   GLU A 111       4.299  92.787 127.151  1.00  0.81           N  
ATOM    748  CA  GLU A 111       3.415  93.477 126.226  1.00  0.81           C  
ATOM    749  C   GLU A 111       4.090  93.785 124.888  1.00  0.81           C  
ATOM    750  O   GLU A 111       3.539  93.570 123.807  1.00  0.81           O  
ATOM    751  CB  GLU A 111       2.905  94.769 126.912  1.00  0.81           C  
ATOM    752  CG  GLU A 111       1.847  95.592 126.134  1.00  0.81           C  
ATOM    753  CD  GLU A 111       0.591  94.803 125.770  1.00  0.81           C  
ATOM    754  OE1 GLU A 111      -0.035  94.222 126.684  1.00  0.81           O  
ATOM    755  OE2 GLU A 111       0.223  94.825 124.566  1.00  0.81           O  
ATOM    756  N   ALA A 112       5.358  94.248 124.901  1.00  0.90           N  
ATOM    757  CA  ALA A 112       6.113  94.490 123.688  1.00  0.90           C  
ATOM    758  C   ALA A 112       6.355  93.245 122.829  1.00  0.90           C  
ATOM    759  O   ALA A 112       6.169  93.286 121.613  1.00  0.90           O  
ATOM    760  CB  ALA A 112       7.448  95.183 124.037  1.00  0.90           C  
ATOM    761  N   THR A 113       6.739  92.100 123.434  1.00  0.86           N  
ATOM    762  CA  THR A 113       6.934  90.820 122.746  1.00  0.86           C  
ATOM    763  C   THR A 113       5.640  90.243 122.207  1.00  0.86           C  
ATOM    764  O   THR A 113       5.586  89.803 121.056  1.00  0.86           O  
ATOM    765  CB  THR A 113       7.660  89.762 123.574  1.00  0.86           C  
ATOM    766  OG1 THR A 113       7.026  89.581 124.824  1.00  0.86           O  
ATOM    767  CG2 THR A 113       9.084  90.241 123.875  1.00  0.86           C  
ATOM    768  N   TYR A 114       4.543  90.303 122.991  1.00  0.87           N  
ATOM    769  CA  TYR A 114       3.206  89.886 122.601  1.00  0.87           C  
ATOM    770  C   TYR A 114       2.708  90.646 121.369  1.00  0.87           C  
ATOM    771  O   TYR A 114       2.246  90.062 120.389  1.00  0.87           O  
ATOM    772  CB  TYR A 114       2.262  90.106 123.823  1.00  0.87           C  
ATOM    773  CG  TYR A 114       0.812  89.824 123.524  1.00  0.87           C  
ATOM    774  CD1 TYR A 114       0.387  88.525 123.196  1.00  0.87           C  
ATOM    775  CD2 TYR A 114      -0.121  90.875 123.516  1.00  0.87           C  
ATOM    776  CE1 TYR A 114      -0.950  88.285 122.846  1.00  0.87           C  
ATOM    777  CE2 TYR A 114      -1.458  90.636 123.166  1.00  0.87           C  
ATOM    778  CZ  TYR A 114      -1.868  89.341 122.828  1.00  0.87           C  
ATOM    779  OH  TYR A 114      -3.207  89.102 122.465  1.00  0.87           O  
ATOM    780  N   GLN A 115       2.893  91.980 121.341  1.00  0.84           N  
ATOM    781  CA  GLN A 115       2.507  92.818 120.220  1.00  0.84           C  
ATOM    782  C   GLN A 115       3.393  92.655 118.993  1.00  0.84           C  
ATOM    783  O   GLN A 115       3.087  93.177 117.922  1.00  0.84           O  
ATOM    784  CB  GLN A 115       2.553  94.313 120.591  1.00  0.84           C  
ATOM    785  CG  GLN A 115       1.444  94.767 121.558  1.00  0.84           C  
ATOM    786  CD  GLN A 115       1.539  96.273 121.776  1.00  0.84           C  
ATOM    787  OE1 GLN A 115       2.098  97.009 120.956  1.00  0.84           O  
ATOM    788  NE2 GLN A 115       0.991  96.775 122.890  1.00  0.84           N  
ATOM    789  N   LEU A 116       4.522  91.941 119.108  1.00  0.87           N  
ATOM    790  CA  LEU A 116       5.354  91.593 117.977  1.00  0.87           C  
ATOM    791  C   LEU A 116       5.027  90.189 117.488  1.00  0.87           C  
ATOM    792  O   LEU A 116       5.634  89.705 116.528  1.00  0.87           O  
ATOM    793  CB  LEU A 116       6.848  91.679 118.366  1.00  0.87           C  
ATOM    794  CG  LEU A 116       7.352  93.127 118.538  1.00  0.87           C  
ATOM    795  CD1 LEU A 116       8.668  93.123 119.321  1.00  0.87           C  
ATOM    796  CD2 LEU A 116       7.536  93.850 117.194  1.00  0.87           C  
ATOM    797  N   GLY A 117       4.031  89.515 118.103  1.00  0.88           N  
ATOM    798  CA  GLY A 117       3.561  88.199 117.691  1.00  0.88           C  
ATOM    799  C   GLY A 117       4.432  87.090 118.193  1.00  0.88           C  
ATOM    800  O   GLY A 117       4.606  86.083 117.516  1.00  0.88           O  
ATOM    801  N   LEU A 118       5.025  87.258 119.385  1.00  0.84           N  
ATOM    802  CA  LEU A 118       5.941  86.295 119.960  1.00  0.84           C  
ATOM    803  C   LEU A 118       5.560  86.037 121.404  1.00  0.84           C  
ATOM    804  O   LEU A 118       4.855  86.826 122.025  1.00  0.84           O  
ATOM    805  CB  LEU A 118       7.396  86.841 119.959  1.00  0.84           C  
ATOM    806  CG  LEU A 118       7.973  87.163 118.566  1.00  0.84           C  
ATOM    807  CD1 LEU A 118       9.343  87.845 118.699  1.00  0.84           C  
ATOM    808  CD2 LEU A 118       8.091  85.900 117.702  1.00  0.84           C  
ATOM    809  N   ASP A 119       6.046  84.922 121.979  1.00  0.85           N  
ATOM    810  CA  ASP A 119       5.864  84.600 123.379  1.00  0.85           C  
ATOM    811  C   ASP A 119       7.186  84.848 124.094  1.00  0.85           C  
ATOM    812  O   ASP A 119       8.252  84.420 123.652  1.00  0.85           O  
ATOM    813  CB  ASP A 119       5.398  83.124 123.507  1.00  0.85           C  
ATOM    814  CG  ASP A 119       5.011  82.708 124.920  1.00  0.85           C  
ATOM    815  OD1 ASP A 119       4.023  81.947 125.054  1.00  0.85           O  
ATOM    816  OD2 ASP A 119       5.706  83.129 125.877  1.00  0.85           O  
ATOM    817  N   MET A 120       7.146  85.590 125.216  1.00  0.85           N  
ATOM    818  CA  MET A 120       8.300  85.888 126.036  1.00  0.85           C  
ATOM    819  C   MET A 120       8.908  84.670 126.718  1.00  0.85           C  
ATOM    820  O   MET A 120      10.131  84.513 126.698  1.00  0.85           O  
ATOM    821  CB  MET A 120       7.952  86.963 127.085  1.00  0.85           C  
ATOM    822  CG  MET A 120       9.192  87.555 127.785  1.00  0.85           C  
ATOM    823  SD  MET A 120       8.869  89.072 128.728  1.00  0.85           S  
ATOM    824  CE  MET A 120       7.911  88.227 130.020  1.00  0.85           C  
ATOM    825  N   GLU A 121       8.075  83.744 127.261  1.00  0.81           N  
ATOM    826  CA  GLU A 121       8.521  82.532 127.944  1.00  0.81           C  
ATOM    827  C   GLU A 121       9.317  81.640 126.995  1.00  0.81           C  
ATOM    828  O   GLU A 121      10.337  81.042 127.345  1.00  0.81           O  
ATOM    829  CB  GLU A 121       7.348  81.684 128.531  1.00  0.81           C  
ATOM    830  CG  GLU A 121       6.730  82.218 129.852  1.00  0.81           C  
ATOM    831  CD  GLU A 121       6.185  81.113 130.751  1.00  0.81           C  
ATOM    832  OE1 GLU A 121       6.954  80.215 131.189  1.00  0.81           O  
ATOM    833  OE2 GLU A 121       4.976  81.080 131.100  1.00  0.81           O  
ATOM    834  N   GLU A 122       8.878  81.574 125.721  1.00  0.82           N  
ATOM    835  CA  GLU A 122       9.579  80.885 124.652  1.00  0.82           C  
ATOM    836  C   GLU A 122      10.980  81.444 124.376  1.00  0.82           C  
ATOM    837  O   GLU A 122      11.951  80.700 124.239  1.00  0.82           O  
ATOM    838  CB  GLU A 122       8.725  80.901 123.358  1.00  0.82           C  
ATOM    839  CG  GLU A 122       9.101  79.787 122.351  1.00  0.82           C  
ATOM    840  CD  GLU A 122       8.256  79.828 121.080  1.00  0.82           C  
ATOM    841  OE1 GLU A 122       7.232  79.102 121.031  1.00  0.82           O  
ATOM    842  OE2 GLU A 122       8.653  80.564 120.139  1.00  0.82           O  
ATOM    843  N   LEU A 123      11.149  82.789 124.344  1.00  0.89           N  
ATOM    844  CA  LEU A 123      12.453  83.422 124.175  1.00  0.89           C  
ATOM    845  C   LEU A 123      13.386  83.166 125.353  1.00  0.89           C  
ATOM    846  O   LEU A 123      14.570  82.879 125.190  1.00  0.89           O  
ATOM    847  CB  LEU A 123      12.364  84.961 123.955  1.00  0.89           C  
ATOM    848  CG  LEU A 123      11.356  85.432 122.883  1.00  0.89           C  
ATOM    849  CD1 LEU A 123      11.538  86.926 122.567  1.00  0.89           C  
ATOM    850  CD2 LEU A 123      11.392  84.602 121.590  1.00  0.89           C  
ATOM    851  N   GLU A 124      12.854  83.238 126.585  1.00  0.88           N  
ATOM    852  CA  GLU A 124      13.566  83.003 127.829  1.00  0.88           C  
ATOM    853  C   GLU A 124      14.149  81.610 127.973  1.00  0.88           C  
ATOM    854  O   GLU A 124      15.232  81.431 128.531  1.00  0.88           O  
ATOM    855  CB  GLU A 124      12.628  83.314 129.005  1.00  0.88           C  
ATOM    856  CG  GLU A 124      12.455  84.839 129.173  1.00  0.88           C  
ATOM    857  CD  GLU A 124      11.326  85.220 130.117  1.00  0.88           C  
ATOM    858  OE1 GLU A 124      11.235  86.443 130.393  1.00  0.88           O  
ATOM    859  OE2 GLU A 124      10.568  84.327 130.559  1.00  0.88           O  
ATOM    860  N   GLU A 125      13.477  80.570 127.440  1.00  0.85           N  
ATOM    861  CA  GLU A 125      14.010  79.219 127.460  1.00  0.85           C  
ATOM    862  C   GLU A 125      15.220  78.982 126.558  1.00  0.85           C  
ATOM    863  O   GLU A 125      15.956  78.019 126.758  1.00  0.85           O  
ATOM    864  CB  GLU A 125      12.920  78.158 127.176  1.00  0.85           C  
ATOM    865  CG  GLU A 125      11.952  77.921 128.371  1.00  0.85           C  
ATOM    866  CD  GLU A 125      12.639  77.495 129.651  1.00  0.85           C  
ATOM    867  OE1 GLU A 125      13.644  76.748 129.591  1.00  0.85           O  
ATOM    868  OE2 GLU A 125      12.255  77.928 130.770  1.00  0.85           O  
ATOM    869  N   ILE A 126      15.504  79.876 125.587  1.00  0.89           N  
ATOM    870  CA  ILE A 126      16.746  79.867 124.814  1.00  0.89           C  
ATOM    871  C   ILE A 126      17.989  80.133 125.667  1.00  0.89           C  
ATOM    872  O   ILE A 126      19.072  79.626 125.379  1.00  0.89           O  
ATOM    873  CB  ILE A 126      16.699  80.875 123.658  1.00  0.89           C  
ATOM    874  CG1 ILE A 126      15.557  80.562 122.656  1.00  0.89           C  
ATOM    875  CG2 ILE A 126      18.055  80.976 122.916  1.00  0.89           C  
ATOM    876  CD1 ILE A 126      15.745  79.269 121.847  1.00  0.89           C  
ATOM    877  N   GLU A 127      17.885  80.970 126.721  1.00  0.92           N  
ATOM    878  CA  GLU A 127      19.017  81.321 127.563  1.00  0.92           C  
ATOM    879  C   GLU A 127      19.623  80.153 128.336  1.00  0.92           C  
ATOM    880  O   GLU A 127      18.985  79.526 129.176  1.00  0.92           O  
ATOM    881  CB  GLU A 127      18.637  82.453 128.552  1.00  0.92           C  
ATOM    882  CG  GLU A 127      19.840  83.060 129.321  1.00  0.92           C  
ATOM    883  CD  GLU A 127      19.479  84.242 130.215  1.00  0.92           C  
ATOM    884  OE1 GLU A 127      18.279  84.535 130.442  1.00  0.92           O  
ATOM    885  OE2 GLU A 127      20.425  84.880 130.743  1.00  0.92           O  
ATOM    886  N   GLU A 128      20.898  79.826 128.087  1.00  0.90           N  
ATOM    887  CA  GLU A 128      21.642  78.875 128.888  1.00  0.90           C  
ATOM    888  C   GLU A 128      21.802  79.326 130.346  1.00  0.90           C  
ATOM    889  O   GLU A 128      22.088  80.493 130.621  1.00  0.90           O  
ATOM    890  CB  GLU A 128      23.032  78.620 128.248  1.00  0.90           C  
ATOM    891  CG  GLU A 128      22.993  78.161 126.761  1.00  0.90           C  
ATOM    892  CD  GLU A 128      22.283  76.835 126.466  1.00  0.90           C  
ATOM    893  OE1 GLU A 128      22.185  76.519 125.247  1.00  0.90           O  
ATOM    894  OE2 GLU A 128      21.828  76.141 127.404  1.00  0.90           O  
ATOM    895  N   ASP A 129      21.624  78.425 131.345  1.00  0.93           N  
ATOM    896  CA  ASP A 129      21.948  78.735 132.731  1.00  0.93           C  
ATOM    897  C   ASP A 129      23.437  79.046 132.889  1.00  0.93           C  
ATOM    898  O   ASP A 129      24.284  78.249 132.504  1.00  0.93           O  
ATOM    899  CB  ASP A 129      21.685  77.541 133.707  1.00  0.93           C  
ATOM    900  CG  ASP A 129      20.231  77.271 134.007  1.00  0.93           C  
ATOM    901  OD1 ASP A 129      19.733  77.673 135.092  1.00  0.93           O  
ATOM    902  OD2 ASP A 129      19.565  76.584 133.197  1.00  0.93           O  
ATOM    903  N   ALA A 130      23.824  80.171 133.529  1.00  0.95           N  
ATOM    904  CA  ALA A 130      25.200  80.358 133.955  1.00  0.95           C  
ATOM    905  C   ALA A 130      25.495  79.461 135.163  1.00  0.95           C  
ATOM    906  O   ALA A 130      25.430  79.865 136.326  1.00  0.95           O  
ATOM    907  CB  ALA A 130      25.515  81.839 134.251  1.00  0.95           C  
ATOM    908  N   GLY A 131      25.773  78.171 134.877  1.00  0.87           N  
ATOM    909  CA  GLY A 131      25.893  77.058 135.807  1.00  0.87           C  
ATOM    910  C   GLY A 131      27.217  76.952 136.495  1.00  0.87           C  
ATOM    911  O   GLY A 131      27.747  75.866 136.696  1.00  0.87           O  
ATOM    912  N   LEU A 132      27.811  78.079 136.898  1.00  0.91           N  
ATOM    913  CA  LEU A 132      29.177  78.139 137.381  1.00  0.91           C  
ATOM    914  C   LEU A 132      29.270  77.858 138.875  1.00  0.91           C  
ATOM    915  O   LEU A 132      30.070  78.458 139.587  1.00  0.91           O  
ATOM    916  CB  LEU A 132      29.794  79.523 137.054  1.00  0.91           C  
ATOM    917  CG  LEU A 132      29.587  79.988 135.596  1.00  0.91           C  
ATOM    918  CD1 LEU A 132      30.195  81.382 135.401  1.00  0.91           C  
ATOM    919  CD2 LEU A 132      30.161  79.016 134.556  1.00  0.91           C  
ATOM    920  N   GLY A 133      28.438  76.931 139.388  1.00  0.93           N  
ATOM    921  CA  GLY A 133      28.435  76.533 140.785  1.00  0.93           C  
ATOM    922  C   GLY A 133      27.868  75.160 140.982  1.00  0.93           C  
ATOM    923  O   GLY A 133      27.057  74.681 140.200  1.00  0.93           O  
ATOM    924  N   ASN A 134      28.300  74.473 142.048  1.00  0.86           N  
ATOM    925  CA  ASN A 134      27.872  73.130 142.372  1.00  0.86           C  
ATOM    926  C   ASN A 134      26.517  73.077 143.046  1.00  0.86           C  
ATOM    927  O   ASN A 134      25.698  72.206 142.740  1.00  0.86           O  
ATOM    928  CB  ASN A 134      28.906  72.466 143.315  1.00  0.86           C  
ATOM    929  CG  ASN A 134      29.991  71.834 142.462  1.00  0.86           C  
ATOM    930  OD1 ASN A 134      29.724  70.805 141.829  1.00  0.86           O  
ATOM    931  ND2 ASN A 134      31.191  72.435 142.420  1.00  0.86           N  
ATOM    932  N   GLY A 135      26.264  73.987 144.003  1.00  0.93           N  
ATOM    933  CA  GLY A 135      25.100  73.852 144.862  1.00  0.93           C  
ATOM    934  C   GLY A 135      24.831  75.055 145.716  1.00  0.93           C  
ATOM    935  O   GLY A 135      24.656  76.172 145.236  1.00  0.93           O  
ATOM    936  N   GLY A 136      24.735  74.862 147.046  1.00  0.93           N  
ATOM    937  CA  GLY A 136      24.299  75.916 147.962  1.00  0.93           C  
ATOM    938  C   GLY A 136      25.318  77.006 148.148  1.00  0.93           C  
ATOM    939  O   GLY A 136      24.964  78.173 148.282  1.00  0.93           O  
ATOM    940  N   LEU A 137      26.606  76.624 148.119  1.00  0.90           N  
ATOM    941  CA  LEU A 137      27.783  77.472 148.197  1.00  0.90           C  
ATOM    942  C   LEU A 137      27.861  78.498 147.071  1.00  0.90           C  
ATOM    943  O   LEU A 137      27.874  79.706 147.311  1.00  0.90           O  
ATOM    944  CB  LEU A 137      28.981  76.482 148.171  1.00  0.90           C  
ATOM    945  CG  LEU A 137      30.410  77.018 147.947  1.00  0.90           C  
ATOM    946  CD1 LEU A 137      30.819  78.025 149.023  1.00  0.90           C  
ATOM    947  CD2 LEU A 137      31.380  75.824 147.941  1.00  0.90           C  
ATOM    948  N   GLY A 138      27.799  78.057 145.796  1.00  0.95           N  
ATOM    949  CA  GLY A 138      27.741  78.965 144.659  1.00  0.95           C  
ATOM    950  C   GLY A 138      26.456  79.734 144.519  1.00  0.95           C  
ATOM    951  O   GLY A 138      26.427  80.837 143.975  1.00  0.95           O  
ATOM    952  N   ARG A 139      25.320  79.176 144.982  1.00  0.90           N  
ATOM    953  CA  ARG A 139      24.051  79.879 144.923  1.00  0.90           C  
ATOM    954  C   ARG A 139      23.926  80.967 145.972  1.00  0.90           C  
ATOM    955  O   ARG A 139      23.274  81.988 145.742  1.00  0.90           O  
ATOM    956  CB  ARG A 139      22.847  78.902 144.978  1.00  0.90           C  
ATOM    957  CG  ARG A 139      21.471  79.562 144.730  1.00  0.90           C  
ATOM    958  CD  ARG A 139      21.361  80.292 143.379  1.00  0.90           C  
ATOM    959  NE  ARG A 139      21.020  81.723 143.651  1.00  0.90           N  
ATOM    960  CZ  ARG A 139      20.812  82.635 142.692  1.00  0.90           C  
ATOM    961  NH1 ARG A 139      20.979  82.337 141.411  1.00  0.90           N  
ATOM    962  NH2 ARG A 139      20.472  83.873 143.045  1.00  0.90           N  
ATOM    963  N   LEU A 140      24.591  80.807 147.131  1.00  0.96           N  
ATOM    964  CA  LEU A 140      24.706  81.839 148.142  1.00  0.96           C  
ATOM    965  C   LEU A 140      25.417  83.069 147.604  1.00  0.96           C  
ATOM    966  O   LEU A 140      24.942  84.190 147.761  1.00  0.96           O  
ATOM    967  CB  LEU A 140      25.475  81.293 149.366  1.00  0.96           C  
ATOM    968  CG  LEU A 140      25.432  82.207 150.603  1.00  0.96           C  
ATOM    969  CD1 LEU A 140      24.030  82.220 151.232  1.00  0.96           C  
ATOM    970  CD2 LEU A 140      26.473  81.754 151.635  1.00  0.96           C  
ATOM    971  N   ALA A 141      26.523  82.867 146.857  1.00  0.98           N  
ATOM    972  CA  ALA A 141      27.259  83.922 146.193  1.00  0.98           C  
ATOM    973  C   ALA A 141      26.409  84.711 145.200  1.00  0.98           C  
ATOM    974  O   ALA A 141      26.376  85.939 145.213  1.00  0.98           O  
ATOM    975  CB  ALA A 141      28.459  83.284 145.468  1.00  0.98           C  
ATOM    976  N   ALA A 142      25.625  84.009 144.365  1.00  0.98           N  
ATOM    977  CA  ALA A 142      24.651  84.598 143.474  1.00  0.98           C  
ATOM    978  C   ALA A 142      23.498  85.341 144.157  1.00  0.98           C  
ATOM    979  O   ALA A 142      23.053  86.386 143.686  1.00  0.98           O  
ATOM    980  CB  ALA A 142      24.104  83.482 142.573  1.00  0.98           C  
ATOM    981  N   CYS A 143      22.958  84.834 145.287  1.00  0.98           N  
ATOM    982  CA  CYS A 143      21.991  85.576 146.095  1.00  0.98           C  
ATOM    983  C   CYS A 143      22.588  86.838 146.690  1.00  0.98           C  
ATOM    984  O   CYS A 143      21.994  87.913 146.648  1.00  0.98           O  
ATOM    985  CB  CYS A 143      21.406  84.705 147.235  1.00  0.98           C  
ATOM    986  SG  CYS A 143      20.325  83.390 146.581  1.00  0.98           S  
ATOM    987  N   PHE A 144      23.821  86.728 147.210  1.00  0.97           N  
ATOM    988  CA  PHE A 144      24.555  87.815 147.816  1.00  0.97           C  
ATOM    989  C   PHE A 144      24.843  88.954 146.847  1.00  0.97           C  
ATOM    990  O   PHE A 144      24.713  90.116 147.221  1.00  0.97           O  
ATOM    991  CB  PHE A 144      25.874  87.305 148.470  1.00  0.97           C  
ATOM    992  CG  PHE A 144      25.700  86.606 149.809  1.00  0.97           C  
ATOM    993  CD1 PHE A 144      24.457  86.300 150.403  1.00  0.97           C  
ATOM    994  CD2 PHE A 144      26.868  86.284 150.521  1.00  0.97           C  
ATOM    995  CE1 PHE A 144      24.392  85.702 151.670  1.00  0.97           C  
ATOM    996  CE2 PHE A 144      26.812  85.687 151.787  1.00  0.97           C  
ATOM    997  CZ  PHE A 144      25.570  85.396 152.361  1.00  0.97           C  
ATOM    998  N   LEU A 145      25.194  88.679 145.569  1.00  0.97           N  
ATOM    999  CA  LEU A 145      25.402  89.732 144.579  1.00  0.97           C  
ATOM   1000  C   LEU A 145      24.165  90.611 144.340  1.00  0.97           C  
ATOM   1001  O   LEU A 145      24.272  91.839 144.338  1.00  0.97           O  
ATOM   1002  CB  LEU A 145      25.890  89.176 143.209  1.00  0.97           C  
ATOM   1003  CG  LEU A 145      27.273  88.483 143.187  1.00  0.97           C  
ATOM   1004  CD1 LEU A 145      27.669  88.163 141.738  1.00  0.97           C  
ATOM   1005  CD2 LEU A 145      28.384  89.310 143.850  1.00  0.97           C  
ATOM   1006  N   ASP A 146      22.959  90.006 144.199  1.00  0.96           N  
ATOM   1007  CA  ASP A 146      21.682  90.704 144.075  1.00  0.96           C  
ATOM   1008  C   ASP A 146      21.392  91.570 145.310  1.00  0.96           C  
ATOM   1009  O   ASP A 146      21.109  92.766 145.209  1.00  0.96           O  
ATOM   1010  CB  ASP A 146      20.592  89.600 143.869  1.00  0.96           C  
ATOM   1011  CG  ASP A 146      19.140  90.045 143.896  1.00  0.96           C  
ATOM   1012  OD1 ASP A 146      18.394  89.908 142.904  1.00  0.96           O  
ATOM   1013  OD2 ASP A 146      18.682  90.427 144.999  1.00  0.96           O  
ATOM   1014  N   SER A 147      21.533  90.986 146.522  1.00  0.97           N  
ATOM   1015  CA  SER A 147      21.333  91.691 147.789  1.00  0.97           C  
ATOM   1016  C   SER A 147      22.270  92.837 148.023  1.00  0.97           C  
ATOM   1017  O   SER A 147      21.848  93.912 148.440  1.00  0.97           O  
ATOM   1018  CB  SER A 147      21.490  90.827 149.041  1.00  0.97           C  
ATOM   1019  OG  SER A 147      20.389  89.946 149.042  1.00  0.97           O  
ATOM   1020  N   MET A 148      23.579  92.677 147.736  1.00  0.95           N  
ATOM   1021  CA  MET A 148      24.555  93.752 147.852  1.00  0.95           C  
ATOM   1022  C   MET A 148      24.259  94.907 146.902  1.00  0.95           C  
ATOM   1023  O   MET A 148      24.357  96.070 147.286  1.00  0.95           O  
ATOM   1024  CB  MET A 148      26.019  93.253 147.686  1.00  0.95           C  
ATOM   1025  CG  MET A 148      26.492  92.358 148.855  1.00  0.95           C  
ATOM   1026  SD  MET A 148      28.255  91.913 148.868  1.00  0.95           S  
ATOM   1027  CE  MET A 148      28.210  90.765 147.467  1.00  0.95           C  
ATOM   1028  N   ALA A 149      23.840  94.623 145.651  1.00  0.97           N  
ATOM   1029  CA  ALA A 149      23.367  95.637 144.726  1.00  0.97           C  
ATOM   1030  C   ALA A 149      22.064  96.341 145.150  1.00  0.97           C  
ATOM   1031  O   ALA A 149      21.951  97.565 145.109  1.00  0.97           O  
ATOM   1032  CB  ALA A 149      23.236  95.002 143.329  1.00  0.97           C  
ATOM   1033  N   THR A 150      21.048  95.596 145.636  1.00  0.95           N  
ATOM   1034  CA  THR A 150      19.777  96.114 146.170  1.00  0.95           C  
ATOM   1035  C   THR A 150      19.946  97.021 147.387  1.00  0.95           C  
ATOM   1036  O   THR A 150      19.201  97.988 147.596  1.00  0.95           O  
ATOM   1037  CB  THR A 150      18.803  94.985 146.493  1.00  0.95           C  
ATOM   1038  OG1 THR A 150      18.475  94.302 145.291  1.00  0.95           O  
ATOM   1039  CG2 THR A 150      17.465  95.500 147.042  1.00  0.95           C  
ATOM   1040  N   LEU A 151      20.966  96.750 148.221  1.00  0.92           N  
ATOM   1041  CA  LEU A 151      21.319  97.569 149.369  1.00  0.92           C  
ATOM   1042  C   LEU A 151      22.374  98.621 149.033  1.00  0.92           C  
ATOM   1043  O   LEU A 151      22.818  99.358 149.909  1.00  0.92           O  
ATOM   1044  CB  LEU A 151      21.865  96.670 150.507  1.00  0.92           C  
ATOM   1045  CG  LEU A 151      20.811  95.740 151.145  1.00  0.92           C  
ATOM   1046  CD1 LEU A 151      21.506  94.728 152.063  1.00  0.92           C  
ATOM   1047  CD2 LEU A 151      19.744  96.514 151.936  1.00  0.92           C  
ATOM   1048  N   GLY A 152      22.785  98.734 147.751  1.00  0.93           N  
ATOM   1049  CA  GLY A 152      23.665  99.792 147.261  1.00  0.93           C  
ATOM   1050  C   GLY A 152      25.095  99.744 147.719  1.00  0.93           C  
ATOM   1051  O   GLY A 152      25.815 100.736 147.670  1.00  0.93           O  
ATOM   1052  N   LEU A 153      25.568  98.581 148.190  1.00  0.92           N  
ATOM   1053  CA  LEU A 153      26.946  98.418 148.595  1.00  0.92           C  
ATOM   1054  C   LEU A 153      27.911  98.436 147.419  1.00  0.92           C  
ATOM   1055  O   LEU A 153      27.619  97.909 146.346  1.00  0.92           O  
ATOM   1056  CB  LEU A 153      27.162  97.102 149.381  1.00  0.92           C  
ATOM   1057  CG  LEU A 153      26.337  96.952 150.675  1.00  0.92           C  
ATOM   1058  CD1 LEU A 153      26.711  95.633 151.366  1.00  0.92           C  
ATOM   1059  CD2 LEU A 153      26.566  98.121 151.641  1.00  0.92           C  
ATOM   1060  N   ALA A 154      29.126  98.997 147.619  1.00  0.92           N  
ATOM   1061  CA  ALA A 154      30.196  99.014 146.641  1.00  0.92           C  
ATOM   1062  C   ALA A 154      30.854  97.650 146.470  1.00  0.92           C  
ATOM   1063  O   ALA A 154      32.008  97.419 146.830  1.00  0.92           O  
ATOM   1064  CB  ALA A 154      31.228 100.091 147.031  1.00  0.92           C  
ATOM   1065  N   ALA A 155      30.089  96.697 145.918  1.00  0.96           N  
ATOM   1066  CA  ALA A 155      30.405  95.296 145.951  1.00  0.96           C  
ATOM   1067  C   ALA A 155      30.677  94.692 144.592  1.00  0.96           C  
ATOM   1068  O   ALA A 155      30.000  94.950 143.599  1.00  0.96           O  
ATOM   1069  CB  ALA A 155      29.257  94.514 146.599  1.00  0.96           C  
ATOM   1070  N   TYR A 156      31.705  93.837 144.548  1.00  0.95           N  
ATOM   1071  CA  TYR A 156      32.145  93.159 143.356  1.00  0.95           C  
ATOM   1072  C   TYR A 156      32.145  91.664 143.600  1.00  0.95           C  
ATOM   1073  O   TYR A 156      32.603  91.182 144.637  1.00  0.95           O  
ATOM   1074  CB  TYR A 156      33.600  93.542 142.983  1.00  0.95           C  
ATOM   1075  CG  TYR A 156      33.767  94.987 142.584  1.00  0.95           C  
ATOM   1076  CD1 TYR A 156      33.948  95.360 141.238  1.00  0.95           C  
ATOM   1077  CD2 TYR A 156      33.827  95.983 143.573  1.00  0.95           C  
ATOM   1078  CE1 TYR A 156      34.195  96.704 140.894  1.00  0.95           C  
ATOM   1079  CE2 TYR A 156      34.055  97.318 143.234  1.00  0.95           C  
ATOM   1080  CZ  TYR A 156      34.243  97.681 141.904  1.00  0.95           C  
ATOM   1081  OH  TYR A 156      34.377  99.057 141.645  1.00  0.95           O  
ATOM   1082  N   GLY A 157      31.661  90.874 142.623  1.00  0.99           N  
ATOM   1083  CA  GLY A 157      31.894  89.433 142.634  1.00  0.99           C  
ATOM   1084  C   GLY A 157      33.120  89.123 141.834  1.00  0.99           C  
ATOM   1085  O   GLY A 157      33.299  89.665 140.749  1.00  0.99           O  
ATOM   1086  N   TYR A 158      33.992  88.243 142.341  1.00  0.97           N  
ATOM   1087  CA  TYR A 158      35.204  87.867 141.642  1.00  0.97           C  
ATOM   1088  C   TYR A 158      35.321  86.357 141.571  1.00  0.97           C  
ATOM   1089  O   TYR A 158      35.384  85.670 142.591  1.00  0.97           O  
ATOM   1090  CB  TYR A 158      36.447  88.447 142.355  1.00  0.97           C  
ATOM   1091  CG  TYR A 158      36.811  89.799 141.803  1.00  0.97           C  
ATOM   1092  CD1 TYR A 158      36.364  90.984 142.406  1.00  0.97           C  
ATOM   1093  CD2 TYR A 158      37.673  89.888 140.700  1.00  0.97           C  
ATOM   1094  CE1 TYR A 158      36.829  92.228 141.948  1.00  0.97           C  
ATOM   1095  CE2 TYR A 158      38.178  91.125 140.278  1.00  0.97           C  
ATOM   1096  CZ  TYR A 158      37.757  92.299 140.908  1.00  0.97           C  
ATOM   1097  OH  TYR A 158      38.247  93.560 140.505  1.00  0.97           O  
ATOM   1098  N   GLY A 159      35.344  85.806 140.338  1.00  0.99           N  
ATOM   1099  CA  GLY A 159      35.387  84.364 140.123  1.00  0.99           C  
ATOM   1100  C   GLY A 159      36.040  83.963 138.827  1.00  0.99           C  
ATOM   1101  O   GLY A 159      36.727  84.741 138.169  1.00  0.99           O  
ATOM   1102  N   ILE A 160      35.822  82.705 138.405  1.00  0.96           N  
ATOM   1103  CA  ILE A 160      36.362  82.169 137.162  1.00  0.96           C  
ATOM   1104  C   ILE A 160      35.264  82.053 136.125  1.00  0.96           C  
ATOM   1105  O   ILE A 160      34.177  81.532 136.372  1.00  0.96           O  
ATOM   1106  CB  ILE A 160      37.039  80.807 137.339  1.00  0.96           C  
ATOM   1107  CG1 ILE A 160      38.200  80.942 138.347  1.00  0.96           C  
ATOM   1108  CG2 ILE A 160      37.566  80.267 135.986  1.00  0.96           C  
ATOM   1109  CD1 ILE A 160      38.940  79.633 138.631  1.00  0.96           C  
ATOM   1110  N   ARG A 161      35.538  82.541 134.900  1.00  0.91           N  
ATOM   1111  CA  ARG A 161      34.682  82.349 133.750  1.00  0.91           C  
ATOM   1112  C   ARG A 161      34.912  80.969 133.172  1.00  0.91           C  
ATOM   1113  O   ARG A 161      35.644  80.794 132.199  1.00  0.91           O  
ATOM   1114  CB  ARG A 161      34.966  83.425 132.677  1.00  0.91           C  
ATOM   1115  CG  ARG A 161      33.978  83.438 131.495  1.00  0.91           C  
ATOM   1116  CD  ARG A 161      34.266  84.613 130.567  1.00  0.91           C  
ATOM   1117  NE  ARG A 161      33.451  84.472 129.328  1.00  0.91           N  
ATOM   1118  CZ  ARG A 161      33.934  83.989 128.180  1.00  0.91           C  
ATOM   1119  NH1 ARG A 161      35.027  83.232 128.139  1.00  0.91           N  
ATOM   1120  NH2 ARG A 161      33.307  84.264 127.045  1.00  0.91           N  
ATOM   1121  N   TYR A 162      34.326  79.924 133.793  1.00  0.92           N  
ATOM   1122  CA  TYR A 162      34.467  78.576 133.281  1.00  0.92           C  
ATOM   1123  C   TYR A 162      33.848  78.448 131.902  1.00  0.92           C  
ATOM   1124  O   TYR A 162      32.726  78.894 131.670  1.00  0.92           O  
ATOM   1125  CB  TYR A 162      33.866  77.467 134.182  1.00  0.92           C  
ATOM   1126  CG  TYR A 162      34.387  77.518 135.590  1.00  0.92           C  
ATOM   1127  CD1 TYR A 162      35.668  77.034 135.908  1.00  0.92           C  
ATOM   1128  CD2 TYR A 162      33.563  77.994 136.623  1.00  0.92           C  
ATOM   1129  CE1 TYR A 162      36.107  77.013 137.241  1.00  0.92           C  
ATOM   1130  CE2 TYR A 162      34.002  77.982 137.953  1.00  0.92           C  
ATOM   1131  CZ  TYR A 162      35.271  77.480 138.260  1.00  0.92           C  
ATOM   1132  OH  TYR A 162      35.705  77.429 139.597  1.00  0.92           O  
ATOM   1133  N   GLU A 163      34.574  77.836 130.949  1.00  0.86           N  
ATOM   1134  CA  GLU A 163      34.059  77.578 129.616  1.00  0.86           C  
ATOM   1135  C   GLU A 163      32.907  76.583 129.658  1.00  0.86           C  
ATOM   1136  O   GLU A 163      31.903  76.722 128.963  1.00  0.86           O  
ATOM   1137  CB  GLU A 163      35.181  77.115 128.655  1.00  0.86           C  
ATOM   1138  CG  GLU A 163      34.749  77.171 127.167  1.00  0.86           C  
ATOM   1139  CD  GLU A 163      35.819  76.727 126.176  1.00  0.86           C  
ATOM   1140  OE1 GLU A 163      37.005  76.578 126.577  1.00  0.86           O  
ATOM   1141  OE2 GLU A 163      35.452  76.541 124.988  1.00  0.86           O  
ATOM   1142  N   PHE A 164      33.038  75.586 130.552  1.00  0.88           N  
ATOM   1143  CA  PHE A 164      32.026  74.604 130.871  1.00  0.88           C  
ATOM   1144  C   PHE A 164      31.681  74.688 132.359  1.00  0.88           C  
ATOM   1145  O   PHE A 164      32.560  74.620 133.221  1.00  0.88           O  
ATOM   1146  CB  PHE A 164      32.535  73.167 130.550  1.00  0.88           C  
ATOM   1147  CG  PHE A 164      32.869  73.043 129.083  1.00  0.88           C  
ATOM   1148  CD1 PHE A 164      31.881  72.682 128.157  1.00  0.88           C  
ATOM   1149  CD2 PHE A 164      34.155  73.348 128.603  1.00  0.88           C  
ATOM   1150  CE1 PHE A 164      32.153  72.678 126.782  1.00  0.88           C  
ATOM   1151  CE2 PHE A 164      34.431  73.367 127.232  1.00  0.88           C  
ATOM   1152  CZ  PHE A 164      33.422  73.046 126.319  1.00  0.88           C  
ATOM   1153  N   GLY A 165      30.388  74.844 132.721  1.00  0.91           N  
ATOM   1154  CA  GLY A 165      29.948  74.879 134.113  1.00  0.91           C  
ATOM   1155  C   GLY A 165      29.700  73.511 134.702  1.00  0.91           C  
ATOM   1156  O   GLY A 165      30.370  72.526 134.395  1.00  0.91           O  
ATOM   1157  N   ILE A 166      28.714  73.400 135.615  1.00  0.84           N  
ATOM   1158  CA  ILE A 166      28.236  72.113 136.099  1.00  0.84           C  
ATOM   1159  C   ILE A 166      27.576  71.313 134.975  1.00  0.84           C  
ATOM   1160  O   ILE A 166      26.694  71.800 134.274  1.00  0.84           O  
ATOM   1161  CB  ILE A 166      27.325  72.240 137.333  1.00  0.84           C  
ATOM   1162  CG1 ILE A 166      27.001  70.882 138.003  1.00  0.84           C  
ATOM   1163  CG2 ILE A 166      26.021  73.002 137.005  1.00  0.84           C  
ATOM   1164  CD1 ILE A 166      28.208  70.245 138.696  1.00  0.84           C  
ATOM   1165  N   PHE A 167      27.988  70.043 134.767  1.00  0.85           N  
ATOM   1166  CA  PHE A 167      27.534  69.199 133.669  1.00  0.85           C  
ATOM   1167  C   PHE A 167      26.025  69.140 133.463  1.00  0.85           C  
ATOM   1168  O   PHE A 167      25.234  69.148 134.409  1.00  0.85           O  
ATOM   1169  CB  PHE A 167      28.112  67.753 133.776  1.00  0.85           C  
ATOM   1170  CG  PHE A 167      27.685  67.042 135.040  1.00  0.85           C  
ATOM   1171  CD1 PHE A 167      28.452  67.134 136.215  1.00  0.85           C  
ATOM   1172  CD2 PHE A 167      26.494  66.292 135.064  1.00  0.85           C  
ATOM   1173  CE1 PHE A 167      28.013  66.529 137.400  1.00  0.85           C  
ATOM   1174  CE2 PHE A 167      26.050  65.689 136.245  1.00  0.85           C  
ATOM   1175  CZ  PHE A 167      26.810  65.815 137.411  1.00  0.85           C  
ATOM   1176  N   ASN A 168      25.567  69.062 132.199  1.00  0.84           N  
ATOM   1177  CA  ASN A 168      24.195  68.712 131.914  1.00  0.84           C  
ATOM   1178  C   ASN A 168      23.978  67.254 132.273  1.00  0.84           C  
ATOM   1179  O   ASN A 168      24.732  66.373 131.879  1.00  0.84           O  
ATOM   1180  CB  ASN A 168      23.784  68.961 130.442  1.00  0.84           C  
ATOM   1181  CG  ASN A 168      23.707  70.440 130.067  1.00  0.84           C  
ATOM   1182  OD1 ASN A 168      23.975  70.798 128.924  1.00  0.84           O  
ATOM   1183  ND2 ASN A 168      23.296  71.321 131.007  1.00  0.84           N  
ATOM   1184  N   GLN A 169      22.958  66.972 133.090  1.00  0.84           N  
ATOM   1185  CA  GLN A 169      22.684  65.621 133.517  1.00  0.84           C  
ATOM   1186  C   GLN A 169      21.625  65.034 132.624  1.00  0.84           C  
ATOM   1187  O   GLN A 169      20.591  65.653 132.383  1.00  0.84           O  
ATOM   1188  CB  GLN A 169      22.164  65.632 134.968  1.00  0.84           C  
ATOM   1189  CG  GLN A 169      21.863  64.249 135.589  1.00  0.84           C  
ATOM   1190  CD  GLN A 169      21.087  64.437 136.891  1.00  0.84           C  
ATOM   1191  OE1 GLN A 169      20.156  65.242 136.959  1.00  0.84           O  
ATOM   1192  NE2 GLN A 169      21.493  63.719 137.957  1.00  0.84           N  
ATOM   1193  N   LYS A 170      21.867  63.824 132.119  1.00  0.83           N  
ATOM   1194  CA  LYS A 170      20.882  63.071 131.387  1.00  0.83           C  
ATOM   1195  C   LYS A 170      20.689  61.763 132.103  1.00  0.83           C  
ATOM   1196  O   LYS A 170      21.618  61.239 132.719  1.00  0.83           O  
ATOM   1197  CB  LYS A 170      21.381  62.746 129.966  1.00  0.83           C  
ATOM   1198  CG  LYS A 170      21.605  63.967 129.063  1.00  0.83           C  
ATOM   1199  CD  LYS A 170      20.315  64.659 128.585  1.00  0.83           C  
ATOM   1200  CE  LYS A 170      20.532  65.832 127.610  1.00  0.83           C  
ATOM   1201  NZ  LYS A 170      21.156  65.374 126.358  1.00  0.83           N  
ATOM   1202  N   ILE A 171      19.482  61.190 132.036  1.00  0.87           N  
ATOM   1203  CA  ILE A 171      19.249  59.857 132.551  1.00  0.87           C  
ATOM   1204  C   ILE A 171      19.107  58.898 131.384  1.00  0.87           C  
ATOM   1205  O   ILE A 171      18.262  59.036 130.505  1.00  0.87           O  
ATOM   1206  CB  ILE A 171      18.052  59.812 133.490  1.00  0.87           C  
ATOM   1207  CG1 ILE A 171      18.270  60.745 134.712  1.00  0.87           C  
ATOM   1208  CG2 ILE A 171      17.747  58.369 133.943  1.00  0.87           C  
ATOM   1209  CD1 ILE A 171      19.427  60.374 135.648  1.00  0.87           C  
ATOM   1210  N   SER A 172      19.976  57.871 131.326  1.00  0.88           N  
ATOM   1211  CA  SER A 172      19.894  56.845 130.295  1.00  0.88           C  
ATOM   1212  C   SER A 172      19.981  55.496 130.960  1.00  0.88           C  
ATOM   1213  O   SER A 172      20.869  55.230 131.768  1.00  0.88           O  
ATOM   1214  CB  SER A 172      20.999  56.958 129.218  1.00  0.88           C  
ATOM   1215  OG  SER A 172      20.774  56.038 128.147  1.00  0.88           O  
ATOM   1216  N   GLY A 173      18.993  54.612 130.697  1.00  0.92           N  
ATOM   1217  CA  GLY A 173      18.892  53.292 131.324  1.00  0.92           C  
ATOM   1218  C   GLY A 173      18.688  53.340 132.821  1.00  0.92           C  
ATOM   1219  O   GLY A 173      18.996  52.395 133.544  1.00  0.92           O  
ATOM   1220  N   GLY A 174      18.172  54.477 133.326  1.00  0.92           N  
ATOM   1221  CA  GLY A 174      18.014  54.751 134.746  1.00  0.92           C  
ATOM   1222  C   GLY A 174      19.245  55.289 135.443  1.00  0.92           C  
ATOM   1223  O   GLY A 174      19.200  55.535 136.645  1.00  0.92           O  
ATOM   1224  N   TRP A 175      20.369  55.503 134.734  1.00  0.88           N  
ATOM   1225  CA  TRP A 175      21.621  55.947 135.331  1.00  0.88           C  
ATOM   1226  C   TRP A 175      21.952  57.381 134.946  1.00  0.88           C  
ATOM   1227  O   TRP A 175      21.651  57.819 133.837  1.00  0.88           O  
ATOM   1228  CB  TRP A 175      22.819  55.090 134.838  1.00  0.88           C  
ATOM   1229  CG  TRP A 175      22.730  53.601 135.100  1.00  0.88           C  
ATOM   1230  CD1 TRP A 175      22.229  52.613 134.296  1.00  0.88           C  
ATOM   1231  CD2 TRP A 175      23.280  52.933 136.255  1.00  0.88           C  
ATOM   1232  NE1 TRP A 175      22.423  51.369 134.871  1.00  0.88           N  
ATOM   1233  CE2 TRP A 175      23.075  51.559 136.074  1.00  0.88           C  
ATOM   1234  CE3 TRP A 175      23.934  53.431 137.385  1.00  0.88           C  
ATOM   1235  CZ2 TRP A 175      23.509  50.632 137.017  1.00  0.88           C  
ATOM   1236  CZ3 TRP A 175      24.378  52.497 138.337  1.00  0.88           C  
ATOM   1237  CH2 TRP A 175      24.168  51.122 138.159  1.00  0.88           C  
ATOM   1238  N   GLN A 176      22.618  58.149 135.848  1.00  0.87           N  
ATOM   1239  CA  GLN A 176      23.217  59.430 135.489  1.00  0.87           C  
ATOM   1240  C   GLN A 176      24.287  59.307 134.416  1.00  0.87           C  
ATOM   1241  O   GLN A 176      25.251  58.555 134.549  1.00  0.87           O  
ATOM   1242  CB  GLN A 176      23.836  60.191 136.704  1.00  0.87           C  
ATOM   1243  CG  GLN A 176      24.652  61.458 136.315  1.00  0.87           C  
ATOM   1244  CD  GLN A 176      25.075  62.290 137.527  1.00  0.87           C  
ATOM   1245  OE1 GLN A 176      24.248  62.853 138.252  1.00  0.87           O  
ATOM   1246  NE2 GLN A 176      26.401  62.394 137.748  1.00  0.87           N  
ATOM   1247  N   MET A 177      24.127  60.110 133.354  1.00  0.84           N  
ATOM   1248  CA  MET A 177      25.077  60.305 132.293  1.00  0.84           C  
ATOM   1249  C   MET A 177      25.430  61.780 132.282  1.00  0.84           C  
ATOM   1250  O   MET A 177      24.553  62.641 132.373  1.00  0.84           O  
ATOM   1251  CB  MET A 177      24.433  59.911 130.944  1.00  0.84           C  
ATOM   1252  CG  MET A 177      24.061  58.419 130.877  1.00  0.84           C  
ATOM   1253  SD  MET A 177      25.437  57.275 131.185  1.00  0.84           S  
ATOM   1254  CE  MET A 177      24.378  55.812 131.144  1.00  0.84           C  
ATOM   1255  N   GLU A 178      26.730  62.110 132.213  1.00  0.83           N  
ATOM   1256  CA  GLU A 178      27.199  63.479 132.177  1.00  0.83           C  
ATOM   1257  C   GLU A 178      27.344  63.999 130.741  1.00  0.83           C  
ATOM   1258  O   GLU A 178      27.861  63.307 129.867  1.00  0.83           O  
ATOM   1259  CB  GLU A 178      28.571  63.592 132.894  1.00  0.83           C  
ATOM   1260  CG  GLU A 178      28.547  63.328 134.430  1.00  0.83           C  
ATOM   1261  CD  GLU A 178      28.819  61.906 134.924  1.00  0.83           C  
ATOM   1262  OE1 GLU A 178      29.735  61.198 134.445  1.00  0.83           O  
ATOM   1263  OE2 GLU A 178      28.151  61.502 135.914  1.00  0.83           O  
ATOM   1264  N   GLU A 179      26.891  65.244 130.465  1.00  0.82           N  
ATOM   1265  CA  GLU A 179      27.155  65.944 129.216  1.00  0.82           C  
ATOM   1266  C   GLU A 179      27.754  67.318 129.465  1.00  0.82           C  
ATOM   1267  O   GLU A 179      27.568  67.944 130.506  1.00  0.82           O  
ATOM   1268  CB  GLU A 179      25.897  66.201 128.374  1.00  0.82           C  
ATOM   1269  CG  GLU A 179      25.414  64.968 127.620  1.00  0.82           C  
ATOM   1270  CD  GLU A 179      24.179  65.272 126.831  1.00  0.82           C  
ATOM   1271  OE1 GLU A 179      23.528  64.262 126.470  1.00  0.82           O  
ATOM   1272  OE2 GLU A 179      23.775  66.440 126.590  1.00  0.82           O  
ATOM   1273  N   ALA A 180      28.502  67.856 128.483  1.00  0.85           N  
ATOM   1274  CA  ALA A 180      29.218  69.100 128.659  1.00  0.85           C  
ATOM   1275  C   ALA A 180      28.354  70.350 128.498  1.00  0.85           C  
ATOM   1276  O   ALA A 180      27.754  70.584 127.452  1.00  0.85           O  
ATOM   1277  CB  ALA A 180      30.407  69.166 127.679  1.00  0.85           C  
ATOM   1278  N   ASP A 181      28.329  71.200 129.543  1.00  0.84           N  
ATOM   1279  CA  ASP A 181      27.682  72.499 129.607  1.00  0.84           C  
ATOM   1280  C   ASP A 181      28.394  73.562 128.742  1.00  0.84           C  
ATOM   1281  O   ASP A 181      29.109  74.431 129.226  1.00  0.84           O  
ATOM   1282  CB  ASP A 181      27.635  72.852 131.122  1.00  0.84           C  
ATOM   1283  CG  ASP A 181      26.917  74.151 131.448  1.00  0.84           C  
ATOM   1284  OD1 ASP A 181      25.686  74.209 131.228  1.00  0.84           O  
ATOM   1285  OD2 ASP A 181      27.593  75.081 131.958  1.00  0.84           O  
ATOM   1286  N   ASP A 182      28.231  73.505 127.401  1.00  0.82           N  
ATOM   1287  CA  ASP A 182      28.890  74.345 126.399  1.00  0.82           C  
ATOM   1288  C   ASP A 182      28.182  75.706 126.287  1.00  0.82           C  
ATOM   1289  O   ASP A 182      27.860  76.198 125.207  1.00  0.82           O  
ATOM   1290  CB  ASP A 182      28.890  73.525 125.064  1.00  0.82           C  
ATOM   1291  CG  ASP A 182      29.951  73.862 124.015  1.00  0.82           C  
ATOM   1292  OD1 ASP A 182      30.817  74.752 124.159  1.00  0.82           O  
ATOM   1293  OD2 ASP A 182      29.944  73.134 122.982  1.00  0.82           O  
ATOM   1294  N   TRP A 183      27.914  76.342 127.451  1.00  0.83           N  
ATOM   1295  CA  TRP A 183      27.014  77.467 127.666  1.00  0.83           C  
ATOM   1296  C   TRP A 183      27.382  78.716 126.884  1.00  0.83           C  
ATOM   1297  O   TRP A 183      26.540  79.531 126.514  1.00  0.83           O  
ATOM   1298  CB  TRP A 183      26.848  77.787 129.190  1.00  0.83           C  
ATOM   1299  CG  TRP A 183      28.019  78.446 129.917  1.00  0.83           C  
ATOM   1300  CD1 TRP A 183      29.225  77.905 130.270  1.00  0.83           C  
ATOM   1301  CD2 TRP A 183      28.052  79.817 130.382  1.00  0.83           C  
ATOM   1302  NE1 TRP A 183      30.028  78.857 130.875  1.00  0.83           N  
ATOM   1303  CE2 TRP A 183      29.315  80.031 130.952  1.00  0.83           C  
ATOM   1304  CE3 TRP A 183      27.096  80.837 130.337  1.00  0.83           C  
ATOM   1305  CZ2 TRP A 183      29.676  81.270 131.477  1.00  0.83           C  
ATOM   1306  CZ3 TRP A 183      27.452  82.086 130.878  1.00  0.83           C  
ATOM   1307  CH2 TRP A 183      28.722  82.302 131.434  1.00  0.83           C  
ATOM   1308  N   LEU A 184      28.677  78.878 126.572  1.00  0.85           N  
ATOM   1309  CA  LEU A 184      29.184  79.999 125.817  1.00  0.85           C  
ATOM   1310  C   LEU A 184      29.230  79.744 124.316  1.00  0.85           C  
ATOM   1311  O   LEU A 184      29.679  80.609 123.567  1.00  0.85           O  
ATOM   1312  CB  LEU A 184      30.631  80.295 126.279  1.00  0.85           C  
ATOM   1313  CG  LEU A 184      30.738  80.813 127.725  1.00  0.85           C  
ATOM   1314  CD1 LEU A 184      32.204  80.849 128.169  1.00  0.85           C  
ATOM   1315  CD2 LEU A 184      30.109  82.204 127.882  1.00  0.85           C  
ATOM   1316  N   ARG A 185      28.739  78.589 123.802  1.00  0.77           N  
ATOM   1317  CA  ARG A 185      28.866  78.223 122.392  1.00  0.77           C  
ATOM   1318  C   ARG A 185      28.276  79.239 121.429  1.00  0.77           C  
ATOM   1319  O   ARG A 185      28.855  79.542 120.389  1.00  0.77           O  
ATOM   1320  CB  ARG A 185      28.177  76.860 122.112  1.00  0.77           C  
ATOM   1321  CG  ARG A 185      28.246  76.374 120.645  1.00  0.77           C  
ATOM   1322  CD  ARG A 185      27.330  75.186 120.348  1.00  0.77           C  
ATOM   1323  NE  ARG A 185      27.877  74.008 121.061  1.00  0.77           N  
ATOM   1324  CZ  ARG A 185      27.232  72.863 121.283  1.00  0.77           C  
ATOM   1325  NH1 ARG A 185      26.032  72.597 120.813  1.00  0.77           N  
ATOM   1326  NH2 ARG A 185      27.842  71.943 122.009  1.00  0.77           N  
ATOM   1327  N   TYR A 186      27.102  79.800 121.758  1.00  0.81           N  
ATOM   1328  CA  TYR A 186      26.416  80.731 120.886  1.00  0.81           C  
ATOM   1329  C   TYR A 186      26.617  82.167 121.337  1.00  0.81           C  
ATOM   1330  O   TYR A 186      26.003  83.085 120.795  1.00  0.81           O  
ATOM   1331  CB  TYR A 186      24.900  80.398 120.829  1.00  0.81           C  
ATOM   1332  CG  TYR A 186      24.677  78.990 120.320  1.00  0.81           C  
ATOM   1333  CD1 TYR A 186      23.928  78.071 121.077  1.00  0.81           C  
ATOM   1334  CD2 TYR A 186      25.228  78.562 119.097  1.00  0.81           C  
ATOM   1335  CE1 TYR A 186      23.723  76.761 120.618  1.00  0.81           C  
ATOM   1336  CE2 TYR A 186      25.010  77.257 118.626  1.00  0.81           C  
ATOM   1337  CZ  TYR A 186      24.250  76.360 119.385  1.00  0.81           C  
ATOM   1338  OH  TYR A 186      24.065  75.035 118.938  1.00  0.81           O  
ATOM   1339  N   GLY A 187      27.517  82.397 122.316  1.00  0.84           N  
ATOM   1340  CA  GLY A 187      27.782  83.717 122.868  1.00  0.84           C  
ATOM   1341  C   GLY A 187      26.918  84.085 124.045  1.00  0.84           C  
ATOM   1342  O   GLY A 187      25.781  83.651 124.203  1.00  0.84           O  
ATOM   1343  N   ASN A 188      27.464  84.947 124.916  1.00  0.88           N  
ATOM   1344  CA  ASN A 188      26.820  85.428 126.118  1.00  0.88           C  
ATOM   1345  C   ASN A 188      26.591  86.930 125.936  1.00  0.88           C  
ATOM   1346  O   ASN A 188      27.566  87.664 125.779  1.00  0.88           O  
ATOM   1347  CB  ASN A 188      27.758  85.133 127.322  1.00  0.88           C  
ATOM   1348  CG  ASN A 188      27.229  85.610 128.671  1.00  0.88           C  
ATOM   1349  OD1 ASN A 188      26.088  86.055 128.814  1.00  0.88           O  
ATOM   1350  ND2 ASN A 188      28.095  85.533 129.707  1.00  0.88           N  
ATOM   1351  N   PRO A 189      25.375  87.475 125.933  1.00  0.92           N  
ATOM   1352  CA  PRO A 189      25.175  88.901 125.723  1.00  0.92           C  
ATOM   1353  C   PRO A 189      25.371  89.678 127.010  1.00  0.92           C  
ATOM   1354  O   PRO A 189      25.456  90.905 126.961  1.00  0.92           O  
ATOM   1355  CB  PRO A 189      23.723  88.971 125.227  1.00  0.92           C  
ATOM   1356  CG  PRO A 189      23.016  87.804 125.930  1.00  0.92           C  
ATOM   1357  CD  PRO A 189      24.112  86.742 126.071  1.00  0.92           C  
ATOM   1358  N   TRP A 190      25.434  89.005 128.171  1.00  0.88           N  
ATOM   1359  CA  TRP A 190      25.452  89.652 129.465  1.00  0.88           C  
ATOM   1360  C   TRP A 190      26.860  89.858 129.977  1.00  0.88           C  
ATOM   1361  O   TRP A 190      27.040  90.357 131.078  1.00  0.88           O  
ATOM   1362  CB  TRP A 190      24.685  88.797 130.510  1.00  0.88           C  
ATOM   1363  CG  TRP A 190      23.267  88.454 130.105  1.00  0.88           C  
ATOM   1364  CD1 TRP A 190      22.764  87.237 129.737  1.00  0.88           C  
ATOM   1365  CD2 TRP A 190      22.173  89.389 130.009  1.00  0.88           C  
ATOM   1366  NE1 TRP A 190      21.435  87.351 129.398  1.00  0.88           N  
ATOM   1367  CE2 TRP A 190      21.060  88.667 129.541  1.00  0.88           C  
ATOM   1368  CE3 TRP A 190      22.086  90.755 130.287  1.00  0.88           C  
ATOM   1369  CZ2 TRP A 190      19.843  89.294 129.309  1.00  0.88           C  
ATOM   1370  CZ3 TRP A 190      20.850  91.387 130.066  1.00  0.88           C  
ATOM   1371  CH2 TRP A 190      19.750  90.670 129.570  1.00  0.88           C  
ATOM   1372  N   GLU A 191      27.897  89.526 129.196  1.00  0.90           N  
ATOM   1373  CA  GLU A 191      29.272  89.759 129.582  1.00  0.90           C  
ATOM   1374  C   GLU A 191      29.946  90.733 128.638  1.00  0.90           C  
ATOM   1375  O   GLU A 191      29.616  90.859 127.460  1.00  0.90           O  
ATOM   1376  CB  GLU A 191      30.083  88.443 129.598  1.00  0.90           C  
ATOM   1377  CG  GLU A 191      30.315  87.833 128.193  1.00  0.90           C  
ATOM   1378  CD  GLU A 191      30.933  86.447 128.219  1.00  0.90           C  
ATOM   1379  OE1 GLU A 191      31.080  85.845 129.313  1.00  0.90           O  
ATOM   1380  OE2 GLU A 191      31.279  85.928 127.127  1.00  0.90           O  
ATOM   1381  N   LYS A 192      30.933  91.478 129.149  1.00  0.81           N  
ATOM   1382  CA  LYS A 192      31.788  92.307 128.338  1.00  0.81           C  
ATOM   1383  C   LYS A 192      33.236  92.101 128.740  1.00  0.81           C  
ATOM   1384  O   LYS A 192      33.640  92.380 129.868  1.00  0.81           O  
ATOM   1385  CB  LYS A 192      31.386  93.796 128.503  1.00  0.81           C  
ATOM   1386  CG  LYS A 192      32.242  94.818 127.733  1.00  0.81           C  
ATOM   1387  CD  LYS A 192      32.123  94.701 126.204  1.00  0.81           C  
ATOM   1388  CE  LYS A 192      33.041  95.670 125.449  1.00  0.81           C  
ATOM   1389  NZ  LYS A 192      34.465  95.303 125.606  1.00  0.81           N  
ATOM   1390  N   ALA A 193      34.092  91.633 127.803  1.00  0.86           N  
ATOM   1391  CA  ALA A 193      35.531  91.582 128.001  1.00  0.86           C  
ATOM   1392  C   ALA A 193      36.140  92.951 128.284  1.00  0.86           C  
ATOM   1393  O   ALA A 193      35.723  93.960 127.702  1.00  0.86           O  
ATOM   1394  CB  ALA A 193      36.245  90.999 126.763  1.00  0.86           C  
ATOM   1395  N   ARG A 194      37.145  93.008 129.179  1.00  0.80           N  
ATOM   1396  CA  ARG A 194      37.848  94.228 129.538  1.00  0.80           C  
ATOM   1397  C   ARG A 194      39.333  94.150 129.179  1.00  0.80           C  
ATOM   1398  O   ARG A 194      40.147  93.825 130.050  1.00  0.80           O  
ATOM   1399  CB  ARG A 194      37.722  94.504 131.054  1.00  0.80           C  
ATOM   1400  CG  ARG A 194      36.279  94.538 131.590  1.00  0.80           C  
ATOM   1401  CD  ARG A 194      35.370  95.581 130.934  1.00  0.80           C  
ATOM   1402  NE  ARG A 194      36.092  96.898 130.966  1.00  0.80           N  
ATOM   1403  CZ  ARG A 194      35.946  97.808 131.932  1.00  0.80           C  
ATOM   1404  NH1 ARG A 194      35.153  97.627 132.983  1.00  0.80           N  
ATOM   1405  NH2 ARG A 194      36.651  98.932 131.847  1.00  0.80           N  
ATOM   1406  N   PRO A 195      39.756  94.411 127.933  1.00  0.78           N  
ATOM   1407  CA  PRO A 195      41.121  94.182 127.469  1.00  0.78           C  
ATOM   1408  C   PRO A 195      42.192  94.929 128.223  1.00  0.78           C  
ATOM   1409  O   PRO A 195      43.324  94.445 128.268  1.00  0.78           O  
ATOM   1410  CB  PRO A 195      41.095  94.645 126.000  1.00  0.78           C  
ATOM   1411  CG  PRO A 195      39.645  94.428 125.579  1.00  0.78           C  
ATOM   1412  CD  PRO A 195      38.891  94.847 126.835  1.00  0.78           C  
ATOM   1413  N   GLU A 196      41.858  96.107 128.784  1.00  0.79           N  
ATOM   1414  CA  GLU A 196      42.753  96.988 129.494  1.00  0.79           C  
ATOM   1415  C   GLU A 196      43.125  96.466 130.869  1.00  0.79           C  
ATOM   1416  O   GLU A 196      44.108  96.893 131.474  1.00  0.79           O  
ATOM   1417  CB  GLU A 196      42.141  98.419 129.597  1.00  0.79           C  
ATOM   1418  CG  GLU A 196      40.832  98.621 130.431  1.00  0.79           C  
ATOM   1419  CD  GLU A 196      39.500  98.299 129.750  1.00  0.79           C  
ATOM   1420  OE1 GLU A 196      38.508  99.048 130.000  1.00  0.79           O  
ATOM   1421  OE2 GLU A 196      39.404  97.307 128.993  1.00  0.79           O  
ATOM   1422  N   PHE A 197      42.364  95.488 131.397  1.00  0.82           N  
ATOM   1423  CA  PHE A 197      42.591  94.978 132.730  1.00  0.82           C  
ATOM   1424  C   PHE A 197      43.188  93.585 132.755  1.00  0.82           C  
ATOM   1425  O   PHE A 197      43.392  93.042 133.839  1.00  0.82           O  
ATOM   1426  CB  PHE A 197      41.284  95.023 133.569  1.00  0.82           C  
ATOM   1427  CG  PHE A 197      40.876  96.443 133.886  1.00  0.82           C  
ATOM   1428  CD1 PHE A 197      41.811  97.419 134.284  1.00  0.82           C  
ATOM   1429  CD2 PHE A 197      39.523  96.811 133.807  1.00  0.82           C  
ATOM   1430  CE1 PHE A 197      41.413  98.730 134.566  1.00  0.82           C  
ATOM   1431  CE2 PHE A 197      39.117  98.119 134.105  1.00  0.82           C  
ATOM   1432  CZ  PHE A 197      40.064  99.082 134.474  1.00  0.82           C  
ATOM   1433  N   THR A 198      43.556  93.007 131.592  1.00  0.85           N  
ATOM   1434  CA  THR A 198      44.287  91.739 131.459  1.00  0.85           C  
ATOM   1435  C   THR A 198      45.573  91.712 132.274  1.00  0.85           C  
ATOM   1436  O   THR A 198      46.358  92.658 132.251  1.00  0.85           O  
ATOM   1437  CB  THR A 198      44.650  91.436 130.001  1.00  0.85           C  
ATOM   1438  OG1 THR A 198      43.483  91.329 129.197  1.00  0.85           O  
ATOM   1439  CG2 THR A 198      45.409  90.109 129.825  1.00  0.85           C  
ATOM   1440  N   LEU A 199      45.807  90.628 133.042  1.00  0.90           N  
ATOM   1441  CA  LEU A 199      46.915  90.540 133.983  1.00  0.90           C  
ATOM   1442  C   LEU A 199      47.693  89.234 133.834  1.00  0.90           C  
ATOM   1443  O   LEU A 199      47.107  88.223 133.444  1.00  0.90           O  
ATOM   1444  CB  LEU A 199      46.388  90.595 135.440  1.00  0.90           C  
ATOM   1445  CG  LEU A 199      45.985  92.004 135.913  1.00  0.90           C  
ATOM   1446  CD1 LEU A 199      45.052  91.910 137.125  1.00  0.90           C  
ATOM   1447  CD2 LEU A 199      47.210  92.867 136.242  1.00  0.90           C  
ATOM   1448  N   PRO A 200      48.994  89.175 134.119  1.00  0.92           N  
ATOM   1449  CA  PRO A 200      49.734  87.922 134.159  1.00  0.92           C  
ATOM   1450  C   PRO A 200      49.611  87.195 135.497  1.00  0.92           C  
ATOM   1451  O   PRO A 200      49.670  87.799 136.567  1.00  0.92           O  
ATOM   1452  CB  PRO A 200      51.180  88.378 133.904  1.00  0.92           C  
ATOM   1453  CG  PRO A 200      51.262  89.758 134.566  1.00  0.92           C  
ATOM   1454  CD  PRO A 200      49.861  90.339 134.348  1.00  0.92           C  
ATOM   1455  N   VAL A 201      49.472  85.861 135.454  1.00  0.93           N  
ATOM   1456  CA  VAL A 201      49.499  84.980 136.606  1.00  0.93           C  
ATOM   1457  C   VAL A 201      50.685  84.044 136.440  1.00  0.93           C  
ATOM   1458  O   VAL A 201      50.937  83.518 135.359  1.00  0.93           O  
ATOM   1459  CB  VAL A 201      48.215  84.163 136.755  1.00  0.93           C  
ATOM   1460  CG1 VAL A 201      48.285  83.252 137.998  1.00  0.93           C  
ATOM   1461  CG2 VAL A 201      47.015  85.123 136.882  1.00  0.93           C  
ATOM   1462  N   HIS A 202      51.466  83.834 137.517  1.00  0.90           N  
ATOM   1463  CA  HIS A 202      52.720  83.096 137.485  1.00  0.90           C  
ATOM   1464  C   HIS A 202      52.622  81.756 138.187  1.00  0.90           C  
ATOM   1465  O   HIS A 202      52.055  81.652 139.268  1.00  0.90           O  
ATOM   1466  CB  HIS A 202      53.826  83.890 138.215  1.00  0.90           C  
ATOM   1467  CG  HIS A 202      54.195  85.142 137.490  1.00  0.90           C  
ATOM   1468  ND1 HIS A 202      55.088  85.074 136.445  1.00  0.90           N  
ATOM   1469  CD2 HIS A 202      53.746  86.413 137.645  1.00  0.90           C  
ATOM   1470  CE1 HIS A 202      55.172  86.305 135.977  1.00  0.90           C  
ATOM   1471  NE2 HIS A 202      54.377  87.154 136.669  1.00  0.90           N  
ATOM   1472  N   PHE A 203      53.197  80.697 137.593  1.00  0.91           N  
ATOM   1473  CA  PHE A 203      53.196  79.356 138.152  1.00  0.91           C  
ATOM   1474  C   PHE A 203      54.592  78.749 138.086  1.00  0.91           C  
ATOM   1475  O   PHE A 203      55.421  79.153 137.272  1.00  0.91           O  
ATOM   1476  CB  PHE A 203      52.263  78.418 137.338  1.00  0.91           C  
ATOM   1477  CG  PHE A 203      50.820  78.824 137.449  1.00  0.91           C  
ATOM   1478  CD1 PHE A 203      50.050  78.394 138.543  1.00  0.91           C  
ATOM   1479  CD2 PHE A 203      50.207  79.598 136.447  1.00  0.91           C  
ATOM   1480  CE1 PHE A 203      48.686  78.701 138.619  1.00  0.91           C  
ATOM   1481  CE2 PHE A 203      48.845  79.916 136.528  1.00  0.91           C  
ATOM   1482  CZ  PHE A 203      48.083  79.462 137.612  1.00  0.91           C  
ATOM   1483  N   TYR A 204      54.876  77.726 138.922  1.00  0.89           N  
ATOM   1484  CA  TYR A 204      56.161  77.032 139.003  1.00  0.89           C  
ATOM   1485  C   TYR A 204      57.330  77.962 139.345  1.00  0.89           C  
ATOM   1486  O   TYR A 204      57.234  78.764 140.266  1.00  0.89           O  
ATOM   1487  CB  TYR A 204      56.459  76.154 137.741  1.00  0.89           C  
ATOM   1488  CG  TYR A 204      55.336  75.159 137.477  1.00  0.89           C  
ATOM   1489  CD1 TYR A 204      55.154  73.972 138.215  1.00  0.89           C  
ATOM   1490  CD2 TYR A 204      54.397  75.474 136.486  1.00  0.89           C  
ATOM   1491  CE1 TYR A 204      54.079  73.113 137.937  1.00  0.89           C  
ATOM   1492  CE2 TYR A 204      53.295  74.661 136.228  1.00  0.89           C  
ATOM   1493  CZ  TYR A 204      53.280  73.394 136.831  1.00  0.89           C  
ATOM   1494  OH  TYR A 204      52.554  72.381 136.250  1.00  0.89           O  
ATOM   1495  N   GLY A 205      58.473  77.881 138.630  1.00  0.90           N  
ATOM   1496  CA  GLY A 205      59.668  78.664 138.938  1.00  0.90           C  
ATOM   1497  C   GLY A 205      60.346  78.384 140.252  1.00  0.90           C  
ATOM   1498  O   GLY A 205      60.067  77.406 140.935  1.00  0.90           O  
ATOM   1499  N   HIS A 206      61.306  79.249 140.611  1.00  0.84           N  
ATOM   1500  CA  HIS A 206      62.135  79.086 141.791  1.00  0.84           C  
ATOM   1501  C   HIS A 206      62.236  80.399 142.548  1.00  0.84           C  
ATOM   1502  O   HIS A 206      61.871  81.464 142.052  1.00  0.84           O  
ATOM   1503  CB  HIS A 206      63.559  78.599 141.428  1.00  0.84           C  
ATOM   1504  CG  HIS A 206      63.563  77.210 140.869  1.00  0.84           C  
ATOM   1505  ND1 HIS A 206      63.368  76.146 141.727  1.00  0.84           N  
ATOM   1506  CD2 HIS A 206      63.694  76.767 139.591  1.00  0.84           C  
ATOM   1507  CE1 HIS A 206      63.378  75.075 140.958  1.00  0.84           C  
ATOM   1508  NE2 HIS A 206      63.573  75.395 139.655  1.00  0.84           N  
ATOM   1509  N   VAL A 207      62.714  80.351 143.808  1.00  0.89           N  
ATOM   1510  CA  VAL A 207      62.761  81.517 144.682  1.00  0.89           C  
ATOM   1511  C   VAL A 207      64.193  81.881 145.004  1.00  0.89           C  
ATOM   1512  O   VAL A 207      64.953  81.064 145.521  1.00  0.89           O  
ATOM   1513  CB  VAL A 207      62.053  81.309 146.023  1.00  0.89           C  
ATOM   1514  CG1 VAL A 207      61.895  82.662 146.749  1.00  0.89           C  
ATOM   1515  CG2 VAL A 207      60.668  80.675 145.807  1.00  0.89           C  
ATOM   1516  N   GLU A 208      64.570  83.144 144.754  1.00  0.82           N  
ATOM   1517  CA  GLU A 208      65.863  83.685 145.107  1.00  0.82           C  
ATOM   1518  C   GLU A 208      65.680  84.774 146.137  1.00  0.82           C  
ATOM   1519  O   GLU A 208      64.872  85.687 145.987  1.00  0.82           O  
ATOM   1520  CB  GLU A 208      66.581  84.315 143.899  1.00  0.82           C  
ATOM   1521  CG  GLU A 208      67.158  83.285 142.905  1.00  0.82           C  
ATOM   1522  CD  GLU A 208      67.953  83.971 141.796  1.00  0.82           C  
ATOM   1523  OE1 GLU A 208      67.903  85.227 141.713  1.00  0.82           O  
ATOM   1524  OE2 GLU A 208      68.639  83.234 141.046  1.00  0.82           O  
ATOM   1525  N   HIS A 209      66.440  84.707 147.238  1.00  0.81           N  
ATOM   1526  CA  HIS A 209      66.393  85.709 148.284  1.00  0.81           C  
ATOM   1527  C   HIS A 209      67.571  86.646 148.120  1.00  0.81           C  
ATOM   1528  O   HIS A 209      68.657  86.385 148.632  1.00  0.81           O  
ATOM   1529  CB  HIS A 209      66.453  85.034 149.669  1.00  0.81           C  
ATOM   1530  CG  HIS A 209      65.435  83.941 149.792  1.00  0.81           C  
ATOM   1531  ND1 HIS A 209      64.114  84.258 150.035  1.00  0.81           N  
ATOM   1532  CD2 HIS A 209      65.576  82.597 149.638  1.00  0.81           C  
ATOM   1533  CE1 HIS A 209      63.476  83.105 150.032  1.00  0.81           C  
ATOM   1534  NE2 HIS A 209      64.315  82.068 149.794  1.00  0.81           N  
ATOM   1535  N   THR A 210      67.415  87.749 147.363  1.00  0.85           N  
ATOM   1536  CA  THR A 210      68.530  88.639 147.056  1.00  0.85           C  
ATOM   1537  C   THR A 210      68.602  89.791 148.039  1.00  0.85           C  
ATOM   1538  O   THR A 210      67.764  89.960 148.923  1.00  0.85           O  
ATOM   1539  CB  THR A 210      68.572  89.162 145.611  1.00  0.85           C  
ATOM   1540  OG1 THR A 210      67.656  90.219 145.357  1.00  0.85           O  
ATOM   1541  CG2 THR A 210      68.238  88.041 144.618  1.00  0.85           C  
ATOM   1542  N   SER A 211      69.612  90.672 147.887  1.00  0.80           N  
ATOM   1543  CA  SER A 211      69.770  91.866 148.708  1.00  0.80           C  
ATOM   1544  C   SER A 211      68.759  92.948 148.363  1.00  0.80           C  
ATOM   1545  O   SER A 211      68.644  93.954 149.053  1.00  0.80           O  
ATOM   1546  CB  SER A 211      71.207  92.453 148.619  1.00  0.80           C  
ATOM   1547  OG  SER A 211      71.579  92.784 147.276  1.00  0.80           O  
ATOM   1548  N   GLN A 212      67.985  92.748 147.278  1.00  0.74           N  
ATOM   1549  CA  GLN A 212      66.971  93.660 146.792  1.00  0.74           C  
ATOM   1550  C   GLN A 212      65.580  93.065 146.978  1.00  0.74           C  
ATOM   1551  O   GLN A 212      64.643  93.360 146.224  1.00  0.74           O  
ATOM   1552  CB  GLN A 212      67.198  93.979 145.294  1.00  0.74           C  
ATOM   1553  CG  GLN A 212      68.651  94.390 144.949  1.00  0.74           C  
ATOM   1554  CD  GLN A 212      69.093  95.654 145.693  1.00  0.74           C  
ATOM   1555  OE1 GLN A 212      68.474  96.712 145.570  1.00  0.74           O  
ATOM   1556  NE2 GLN A 212      70.196  95.549 146.469  1.00  0.74           N  
ATOM   1557  N   GLY A 213      65.429  92.182 147.984  1.00  0.84           N  
ATOM   1558  CA  GLY A 213      64.194  91.485 148.318  1.00  0.84           C  
ATOM   1559  C   GLY A 213      64.052  90.165 147.622  1.00  0.84           C  
ATOM   1560  O   GLY A 213      64.754  89.851 146.667  1.00  0.84           O  
ATOM   1561  N   ALA A 214      63.112  89.332 148.091  1.00  0.88           N  
ATOM   1562  CA  ALA A 214      62.832  88.049 147.487  1.00  0.88           C  
ATOM   1563  C   ALA A 214      62.292  88.142 146.065  1.00  0.88           C  
ATOM   1564  O   ALA A 214      61.519  89.035 145.713  1.00  0.88           O  
ATOM   1565  CB  ALA A 214      61.908  87.197 148.375  1.00  0.88           C  
ATOM   1566  N   LYS A 215      62.739  87.224 145.194  1.00  0.86           N  
ATOM   1567  CA  LYS A 215      62.357  87.179 143.803  1.00  0.86           C  
ATOM   1568  C   LYS A 215      61.835  85.803 143.456  1.00  0.86           C  
ATOM   1569  O   LYS A 215      62.442  84.781 143.765  1.00  0.86           O  
ATOM   1570  CB  LYS A 215      63.538  87.507 142.847  1.00  0.86           C  
ATOM   1571  CG  LYS A 215      64.309  88.805 143.157  1.00  0.86           C  
ATOM   1572  CD  LYS A 215      63.442  90.074 143.152  1.00  0.86           C  
ATOM   1573  CE  LYS A 215      64.188  91.285 143.710  1.00  0.86           C  
ATOM   1574  NZ  LYS A 215      63.233  92.352 144.066  1.00  0.86           N  
ATOM   1575  N   TRP A 216      60.680  85.749 142.776  1.00  0.83           N  
ATOM   1576  CA  TRP A 216      60.134  84.532 142.225  1.00  0.83           C  
ATOM   1577  C   TRP A 216      60.412  84.606 140.734  1.00  0.83           C  
ATOM   1578  O   TRP A 216      59.954  85.528 140.064  1.00  0.83           O  
ATOM   1579  CB  TRP A 216      58.616  84.454 142.552  1.00  0.83           C  
ATOM   1580  CG  TRP A 216      57.892  83.160 142.213  1.00  0.83           C  
ATOM   1581  CD1 TRP A 216      58.397  81.920 141.929  1.00  0.83           C  
ATOM   1582  CD2 TRP A 216      56.458  83.037 142.155  1.00  0.83           C  
ATOM   1583  NE1 TRP A 216      57.369  81.037 141.705  1.00  0.83           N  
ATOM   1584  CE2 TRP A 216      56.175  81.693 141.820  1.00  0.83           C  
ATOM   1585  CE3 TRP A 216      55.431  83.956 142.354  1.00  0.83           C  
ATOM   1586  CZ2 TRP A 216      54.870  81.252 141.661  1.00  0.83           C  
ATOM   1587  CZ3 TRP A 216      54.110  83.508 142.206  1.00  0.83           C  
ATOM   1588  CH2 TRP A 216      53.832  82.173 141.865  1.00  0.83           C  
ATOM   1589  N   VAL A 217      61.239  83.683 140.210  1.00  0.88           N  
ATOM   1590  CA  VAL A 217      61.779  83.765 138.858  1.00  0.88           C  
ATOM   1591  C   VAL A 217      61.655  82.425 138.154  1.00  0.88           C  
ATOM   1592  O   VAL A 217      61.312  81.414 138.766  1.00  0.88           O  
ATOM   1593  CB  VAL A 217      63.231  84.253 138.791  1.00  0.88           C  
ATOM   1594  CG1 VAL A 217      63.328  85.699 139.319  1.00  0.88           C  
ATOM   1595  CG2 VAL A 217      64.185  83.328 139.573  1.00  0.88           C  
ATOM   1596  N   ASP A 218      61.871  82.414 136.818  1.00  0.86           N  
ATOM   1597  CA  ASP A 218      61.741  81.270 135.925  1.00  0.86           C  
ATOM   1598  C   ASP A 218      60.365  80.618 135.959  1.00  0.86           C  
ATOM   1599  O   ASP A 218      60.183  79.401 135.926  1.00  0.86           O  
ATOM   1600  CB  ASP A 218      62.916  80.285 136.109  1.00  0.86           C  
ATOM   1601  CG  ASP A 218      64.225  80.998 135.814  1.00  0.86           C  
ATOM   1602  OD1 ASP A 218      64.212  81.967 135.010  1.00  0.86           O  
ATOM   1603  OD2 ASP A 218      65.250  80.567 136.395  1.00  0.86           O  
ATOM   1604  N   THR A 219      59.338  81.475 136.004  1.00  0.86           N  
ATOM   1605  CA  THR A 219      57.943  81.115 136.124  1.00  0.86           C  
ATOM   1606  C   THR A 219      57.282  80.878 134.789  1.00  0.86           C  
ATOM   1607  O   THR A 219      57.677  81.378 133.739  1.00  0.86           O  
ATOM   1608  CB  THR A 219      57.132  82.170 136.866  1.00  0.86           C  
ATOM   1609  OG1 THR A 219      57.405  83.473 136.366  1.00  0.86           O  
ATOM   1610  CG2 THR A 219      57.570  82.167 138.333  1.00  0.86           C  
ATOM   1611  N   GLN A 220      56.206  80.079 134.807  1.00  0.79           N  
ATOM   1612  CA  GLN A 220      55.349  79.875 133.663  1.00  0.79           C  
ATOM   1613  C   GLN A 220      54.191  80.844 133.773  1.00  0.79           C  
ATOM   1614  O   GLN A 220      53.547  80.941 134.816  1.00  0.79           O  
ATOM   1615  CB  GLN A 220      54.821  78.421 133.605  1.00  0.79           C  
ATOM   1616  CG  GLN A 220      55.951  77.364 133.539  1.00  0.79           C  
ATOM   1617  CD  GLN A 220      56.777  77.519 132.261  1.00  0.79           C  
ATOM   1618  OE1 GLN A 220      56.238  77.537 131.157  1.00  0.79           O  
ATOM   1619  NE2 GLN A 220      58.117  77.629 132.404  1.00  0.79           N  
ATOM   1620  N   VAL A 221      53.914  81.615 132.707  1.00  0.85           N  
ATOM   1621  CA  VAL A 221      52.948  82.700 132.766  1.00  0.85           C  
ATOM   1622  C   VAL A 221      51.662  82.296 132.075  1.00  0.85           C  
ATOM   1623  O   VAL A 221      51.657  81.781 130.960  1.00  0.85           O  
ATOM   1624  CB  VAL A 221      53.468  83.997 132.139  1.00  0.85           C  
ATOM   1625  CG1 VAL A 221      52.457  85.149 132.343  1.00  0.85           C  
ATOM   1626  CG2 VAL A 221      54.816  84.375 132.782  1.00  0.85           C  
ATOM   1627  N   VAL A 222      50.515  82.539 132.727  1.00  0.90           N  
ATOM   1628  CA  VAL A 222      49.199  82.411 132.130  1.00  0.90           C  
ATOM   1629  C   VAL A 222      48.551  83.775 132.233  1.00  0.90           C  
ATOM   1630  O   VAL A 222      48.642  84.447 133.255  1.00  0.90           O  
ATOM   1631  CB  VAL A 222      48.343  81.351 132.813  1.00  0.90           C  
ATOM   1632  CG1 VAL A 222      46.961  81.234 132.138  1.00  0.90           C  
ATOM   1633  CG2 VAL A 222      49.082  80.002 132.713  1.00  0.90           C  
ATOM   1634  N   LEU A 223      47.902  84.263 131.165  1.00  0.88           N  
ATOM   1635  CA  LEU A 223      47.234  85.550 131.179  1.00  0.88           C  
ATOM   1636  C   LEU A 223      45.817  85.378 131.684  1.00  0.88           C  
ATOM   1637  O   LEU A 223      45.130  84.411 131.368  1.00  0.88           O  
ATOM   1638  CB  LEU A 223      47.210  86.200 129.766  1.00  0.88           C  
ATOM   1639  CG  LEU A 223      48.312  87.246 129.480  1.00  0.88           C  
ATOM   1640  CD1 LEU A 223      49.701  86.844 130.001  1.00  0.88           C  
ATOM   1641  CD2 LEU A 223      48.378  87.523 127.969  1.00  0.88           C  
ATOM   1642  N   ALA A 224      45.344  86.337 132.487  1.00  0.94           N  
ATOM   1643  CA  ALA A 224      44.004  86.362 133.008  1.00  0.94           C  
ATOM   1644  C   ALA A 224      43.243  87.505 132.366  1.00  0.94           C  
ATOM   1645  O   ALA A 224      43.543  88.679 132.581  1.00  0.94           O  
ATOM   1646  CB  ALA A 224      44.035  86.550 134.537  1.00  0.94           C  
ATOM   1647  N   MET A 225      42.227  87.177 131.547  1.00  0.90           N  
ATOM   1648  CA  MET A 225      41.405  88.145 130.848  1.00  0.90           C  
ATOM   1649  C   MET A 225      40.075  88.318 131.576  1.00  0.90           C  
ATOM   1650  O   MET A 225      39.329  87.341 131.689  1.00  0.90           O  
ATOM   1651  CB  MET A 225      41.123  87.678 129.401  1.00  0.90           C  
ATOM   1652  CG  MET A 225      40.289  88.670 128.560  1.00  0.90           C  
ATOM   1653  SD  MET A 225      39.960  88.090 126.871  1.00  0.90           S  
ATOM   1654  CE  MET A 225      41.639  88.394 126.263  1.00  0.90           C  
ATOM   1655  N   PRO A 226      39.721  89.482 132.107  1.00  0.96           N  
ATOM   1656  CA  PRO A 226      38.476  89.657 132.835  1.00  0.96           C  
ATOM   1657  C   PRO A 226      37.304  89.972 131.934  1.00  0.96           C  
ATOM   1658  O   PRO A 226      37.422  90.712 130.955  1.00  0.96           O  
ATOM   1659  CB  PRO A 226      38.750  90.836 133.773  1.00  0.96           C  
ATOM   1660  CG  PRO A 226      39.831  91.658 133.065  1.00  0.96           C  
ATOM   1661  CD  PRO A 226      40.599  90.647 132.215  1.00  0.96           C  
ATOM   1662  N   TYR A 227      36.143  89.414 132.293  1.00  0.92           N  
ATOM   1663  CA  TYR A 227      34.874  89.698 131.671  1.00  0.92           C  
ATOM   1664  C   TYR A 227      33.953  90.236 132.755  1.00  0.92           C  
ATOM   1665  O   TYR A 227      33.776  89.611 133.799  1.00  0.92           O  
ATOM   1666  CB  TYR A 227      34.233  88.421 131.055  1.00  0.92           C  
ATOM   1667  CG  TYR A 227      34.943  87.938 129.803  1.00  0.92           C  
ATOM   1668  CD1 TYR A 227      34.291  87.965 128.554  1.00  0.92           C  
ATOM   1669  CD2 TYR A 227      36.232  87.376 129.867  1.00  0.92           C  
ATOM   1670  CE1 TYR A 227      34.918  87.462 127.401  1.00  0.92           C  
ATOM   1671  CE2 TYR A 227      36.870  86.902 128.712  1.00  0.92           C  
ATOM   1672  CZ  TYR A 227      36.219  86.953 127.478  1.00  0.92           C  
ATOM   1673  OH  TYR A 227      36.897  86.513 126.322  1.00  0.92           O  
ATOM   1674  N   ASP A 228      33.356  91.421 132.526  1.00  0.92           N  
ATOM   1675  CA  ASP A 228      32.448  92.058 133.459  1.00  0.92           C  
ATOM   1676  C   ASP A 228      30.992  91.755 133.091  1.00  0.92           C  
ATOM   1677  O   ASP A 228      30.560  91.953 131.956  1.00  0.92           O  
ATOM   1678  CB  ASP A 228      32.637  93.605 133.462  1.00  0.92           C  
ATOM   1679  CG  ASP A 228      33.907  94.083 134.139  1.00  0.92           C  
ATOM   1680  OD1 ASP A 228      34.215  95.305 134.024  1.00  0.92           O  
ATOM   1681  OD2 ASP A 228      34.628  93.302 134.805  1.00  0.92           O  
ATOM   1682  N   THR A 229      30.199  91.292 134.075  1.00  0.95           N  
ATOM   1683  CA  THR A 229      28.772  90.997 133.947  1.00  0.95           C  
ATOM   1684  C   THR A 229      28.003  91.936 134.867  1.00  0.95           C  
ATOM   1685  O   THR A 229      28.388  92.057 136.035  1.00  0.95           O  
ATOM   1686  CB  THR A 229      28.436  89.555 134.339  1.00  0.95           C  
ATOM   1687  OG1 THR A 229      28.966  88.662 133.371  1.00  0.95           O  
ATOM   1688  CG2 THR A 229      26.927  89.264 134.403  1.00  0.95           C  
ATOM   1689  N   PRO A 230      26.942  92.639 134.449  1.00  0.96           N  
ATOM   1690  CA  PRO A 230      26.205  93.542 135.320  1.00  0.96           C  
ATOM   1691  C   PRO A 230      25.340  92.815 136.334  1.00  0.96           C  
ATOM   1692  O   PRO A 230      24.691  91.819 136.024  1.00  0.96           O  
ATOM   1693  CB  PRO A 230      25.316  94.332 134.347  1.00  0.96           C  
ATOM   1694  CG  PRO A 230      25.032  93.340 133.217  1.00  0.96           C  
ATOM   1695  CD  PRO A 230      26.334  92.553 133.120  1.00  0.96           C  
ATOM   1696  N   VAL A 231      25.304  93.340 137.565  1.00  0.97           N  
ATOM   1697  CA  VAL A 231      24.452  92.864 138.634  1.00  0.97           C  
ATOM   1698  C   VAL A 231      23.494  93.993 139.016  1.00  0.97           C  
ATOM   1699  O   VAL A 231      23.908  94.915 139.726  1.00  0.97           O  
ATOM   1700  CB  VAL A 231      25.283  92.486 139.858  1.00  0.97           C  
ATOM   1701  CG1 VAL A 231      24.367  91.941 140.968  1.00  0.97           C  
ATOM   1702  CG2 VAL A 231      26.340  91.429 139.474  1.00  0.97           C  
ATOM   1703  N   PRO A 232      22.228  94.009 138.611  1.00  0.98           N  
ATOM   1704  CA  PRO A 232      21.332  95.112 138.941  1.00  0.98           C  
ATOM   1705  C   PRO A 232      20.737  94.982 140.324  1.00  0.98           C  
ATOM   1706  O   PRO A 232      20.275  93.907 140.706  1.00  0.98           O  
ATOM   1707  CB  PRO A 232      20.220  95.016 137.882  1.00  0.98           C  
ATOM   1708  CG  PRO A 232      20.212  93.543 137.456  1.00  0.98           C  
ATOM   1709  CD  PRO A 232      21.682  93.139 137.565  1.00  0.98           C  
ATOM   1710  N   GLY A 233      20.682  96.090 141.085  1.00  0.96           N  
ATOM   1711  CA  GLY A 233      19.868  96.164 142.285  1.00  0.96           C  
ATOM   1712  C   GLY A 233      18.400  96.228 141.964  1.00  0.96           C  
ATOM   1713  O   GLY A 233      17.983  96.722 140.919  1.00  0.96           O  
ATOM   1714  N   TYR A 234      17.547  95.737 142.875  1.00  0.92           N  
ATOM   1715  CA  TYR A 234      16.112  95.847 142.717  1.00  0.92           C  
ATOM   1716  C   TYR A 234      15.604  97.278 142.884  1.00  0.92           C  
ATOM   1717  O   TYR A 234      15.597  97.831 143.984  1.00  0.92           O  
ATOM   1718  CB  TYR A 234      15.397  94.894 143.706  1.00  0.92           C  
ATOM   1719  CG  TYR A 234      13.898  94.921 143.524  1.00  0.92           C  
ATOM   1720  CD1 TYR A 234      13.299  94.269 142.434  1.00  0.92           C  
ATOM   1721  CD2 TYR A 234      13.092  95.674 144.396  1.00  0.92           C  
ATOM   1722  CE1 TYR A 234      11.916  94.361 142.221  1.00  0.92           C  
ATOM   1723  CE2 TYR A 234      11.708  95.766 144.190  1.00  0.92           C  
ATOM   1724  CZ  TYR A 234      11.124  95.108 143.103  1.00  0.92           C  
ATOM   1725  OH  TYR A 234       9.741  95.229 142.867  1.00  0.92           O  
ATOM   1726  N   ARG A 235      15.135  97.879 141.769  1.00  0.83           N  
ATOM   1727  CA  ARG A 235      14.485  99.176 141.707  1.00  0.83           C  
ATOM   1728  C   ARG A 235      15.264 100.321 142.333  1.00  0.83           C  
ATOM   1729  O   ARG A 235      14.729 101.148 143.070  1.00  0.83           O  
ATOM   1730  CB  ARG A 235      13.026  99.134 142.227  1.00  0.83           C  
ATOM   1731  CG  ARG A 235      12.111  98.251 141.359  1.00  0.83           C  
ATOM   1732  CD  ARG A 235      10.638  98.259 141.778  1.00  0.83           C  
ATOM   1733  NE  ARG A 235      10.063  99.618 141.497  1.00  0.83           N  
ATOM   1734  CZ  ARG A 235       8.945 100.039 142.105  1.00  0.83           C  
ATOM   1735  NH1 ARG A 235       8.505 101.284 141.966  1.00  0.83           N  
ATOM   1736  NH2 ARG A 235       8.245  99.228 142.877  1.00  0.83           N  
ATOM   1737  N   ASN A 236      16.562 100.411 142.011  1.00  0.86           N  
ATOM   1738  CA  ASN A 236      17.404 101.485 142.476  1.00  0.86           C  
ATOM   1739  C   ASN A 236      18.293 101.969 141.335  1.00  0.86           C  
ATOM   1740  O   ASN A 236      18.069 101.681 140.156  1.00  0.86           O  
ATOM   1741  CB  ASN A 236      18.154 101.091 143.791  1.00  0.86           C  
ATOM   1742  CG  ASN A 236      19.204  99.994 143.616  1.00  0.86           C  
ATOM   1743  OD1 ASN A 236      19.612  99.638 142.516  1.00  0.86           O  
ATOM   1744  ND2 ASN A 236      19.715  99.475 144.754  1.00  0.86           N  
ATOM   1745  N   ASN A 237      19.327 102.761 141.663  1.00  0.72           N  
ATOM   1746  CA  ASN A 237      20.224 103.307 140.668  1.00  0.72           C  
ATOM   1747  C   ASN A 237      21.490 102.479 140.536  1.00  0.72           C  
ATOM   1748  O   ASN A 237      22.364 102.819 139.743  1.00  0.72           O  
ATOM   1749  CB  ASN A 237      20.601 104.757 141.054  1.00  0.72           C  
ATOM   1750  CG  ASN A 237      19.334 105.596 140.976  1.00  0.72           C  
ATOM   1751  OD1 ASN A 237      18.755 105.749 139.898  1.00  0.72           O  
ATOM   1752  ND2 ASN A 237      18.875 106.129 142.130  1.00  0.72           N  
ATOM   1753  N   VAL A 238      21.604 101.369 141.290  1.00  0.89           N  
ATOM   1754  CA  VAL A 238      22.839 100.626 141.453  1.00  0.89           C  
ATOM   1755  C   VAL A 238      22.906  99.436 140.525  1.00  0.89           C  
ATOM   1756  O   VAL A 238      22.051  98.550 140.499  1.00  0.89           O  
ATOM   1757  CB  VAL A 238      23.041 100.174 142.899  1.00  0.89           C  
ATOM   1758  CG1 VAL A 238      24.295  99.287 143.067  1.00  0.89           C  
ATOM   1759  CG2 VAL A 238      23.182 101.435 143.772  1.00  0.89           C  
ATOM   1760  N   VAL A 239      23.982  99.386 139.729  1.00  0.94           N  
ATOM   1761  CA  VAL A 239      24.343  98.210 138.965  1.00  0.94           C  
ATOM   1762  C   VAL A 239      25.789  97.876 139.292  1.00  0.94           C  
ATOM   1763  O   VAL A 239      26.727  98.599 138.958  1.00  0.94           O  
ATOM   1764  CB  VAL A 239      24.142  98.382 137.465  1.00  0.94           C  
ATOM   1765  CG1 VAL A 239      24.440  97.060 136.733  1.00  0.94           C  
ATOM   1766  CG2 VAL A 239      22.690  98.805 137.168  1.00  0.94           C  
ATOM   1767  N   ASN A 240      26.003  96.747 139.986  1.00  0.94           N  
ATOM   1768  CA  ASN A 240      27.311  96.287 140.407  1.00  0.94           C  
ATOM   1769  C   ASN A 240      27.914  95.361 139.364  1.00  0.94           C  
ATOM   1770  O   ASN A 240      27.305  95.048 138.346  1.00  0.94           O  
ATOM   1771  CB  ASN A 240      27.253  95.615 141.807  1.00  0.94           C  
ATOM   1772  CG  ASN A 240      27.220  96.696 142.883  1.00  0.94           C  
ATOM   1773  OD1 ASN A 240      27.558  97.858 142.657  1.00  0.94           O  
ATOM   1774  ND2 ASN A 240      26.846  96.304 144.121  1.00  0.94           N  
ATOM   1775  N   THR A 241      29.164  94.926 139.582  1.00  0.95           N  
ATOM   1776  CA  THR A 241      29.919  94.167 138.594  1.00  0.95           C  
ATOM   1777  C   THR A 241      30.285  92.814 139.151  1.00  0.95           C  
ATOM   1778  O   THR A 241      30.872  92.691 140.225  1.00  0.95           O  
ATOM   1779  CB  THR A 241      31.209  94.879 138.191  1.00  0.95           C  
ATOM   1780  OG1 THR A 241      30.891  96.043 137.444  1.00  0.95           O  
ATOM   1781  CG2 THR A 241      32.117  94.023 137.294  1.00  0.95           C  
ATOM   1782  N   MET A 242      29.978  91.742 138.402  1.00  0.95           N  
ATOM   1783  CA  MET A 242      30.588  90.447 138.610  1.00  0.95           C  
ATOM   1784  C   MET A 242      31.711  90.324 137.593  1.00  0.95           C  
ATOM   1785  O   MET A 242      31.480  90.413 136.392  1.00  0.95           O  
ATOM   1786  CB  MET A 242      29.558  89.300 138.452  1.00  0.95           C  
ATOM   1787  CG  MET A 242      30.150  87.896 138.704  1.00  0.95           C  
ATOM   1788  SD  MET A 242      28.972  86.515 138.595  1.00  0.95           S  
ATOM   1789  CE  MET A 242      28.618  86.697 136.826  1.00  0.95           C  
ATOM   1790  N   ARG A 243      32.963  90.158 138.053  1.00  0.93           N  
ATOM   1791  CA  ARG A 243      34.130  90.074 137.200  1.00  0.93           C  
ATOM   1792  C   ARG A 243      34.636  88.647 137.201  1.00  0.93           C  
ATOM   1793  O   ARG A 243      35.042  88.088 138.220  1.00  0.93           O  
ATOM   1794  CB  ARG A 243      35.234  91.062 137.661  1.00  0.93           C  
ATOM   1795  CG  ARG A 243      36.535  91.029 136.822  1.00  0.93           C  
ATOM   1796  CD  ARG A 243      37.460  92.246 137.016  1.00  0.93           C  
ATOM   1797  NE  ARG A 243      36.778  93.413 136.385  1.00  0.93           N  
ATOM   1798  CZ  ARG A 243      37.332  94.597 136.110  1.00  0.93           C  
ATOM   1799  NH1 ARG A 243      38.508  95.000 136.579  1.00  0.93           N  
ATOM   1800  NH2 ARG A 243      36.646  95.427 135.328  1.00  0.93           N  
ATOM   1801  N   LEU A 244      34.596  88.002 136.026  1.00  0.96           N  
ATOM   1802  CA  LEU A 244      34.971  86.613 135.892  1.00  0.96           C  
ATOM   1803  C   LEU A 244      36.184  86.490 134.988  1.00  0.96           C  
ATOM   1804  O   LEU A 244      36.211  86.992 133.866  1.00  0.96           O  
ATOM   1805  CB  LEU A 244      33.819  85.759 135.313  1.00  0.96           C  
ATOM   1806  CG  LEU A 244      32.522  85.688 136.143  1.00  0.96           C  
ATOM   1807  CD1 LEU A 244      31.534  84.747 135.439  1.00  0.96           C  
ATOM   1808  CD2 LEU A 244      32.753  85.187 137.576  1.00  0.96           C  
ATOM   1809  N   TRP A 245      37.246  85.818 135.471  1.00  0.92           N  
ATOM   1810  CA  TRP A 245      38.506  85.715 134.752  1.00  0.92           C  
ATOM   1811  C   TRP A 245      38.575  84.494 133.836  1.00  0.92           C  
ATOM   1812  O   TRP A 245      38.180  83.389 134.205  1.00  0.92           O  
ATOM   1813  CB  TRP A 245      39.719  85.656 135.723  1.00  0.92           C  
ATOM   1814  CG  TRP A 245      39.820  86.798 136.719  1.00  0.92           C  
ATOM   1815  CD1 TRP A 245      39.383  86.850 138.016  1.00  0.92           C  
ATOM   1816  CD2 TRP A 245      40.484  88.060 136.481  1.00  0.92           C  
ATOM   1817  NE1 TRP A 245      39.738  88.046 138.607  1.00  0.92           N  
ATOM   1818  CE2 TRP A 245      40.383  88.810 137.657  1.00  0.92           C  
ATOM   1819  CE3 TRP A 245      41.158  88.553 135.361  1.00  0.92           C  
ATOM   1820  CZ2 TRP A 245      40.903  90.098 137.742  1.00  0.92           C  
ATOM   1821  CZ3 TRP A 245      41.748  89.825 135.471  1.00  0.92           C  
ATOM   1822  CH2 TRP A 245      41.586  90.600 136.624  1.00  0.92           C  
ATOM   1823  N   SER A 246      39.114  84.679 132.615  1.00  0.93           N  
ATOM   1824  CA  SER A 246      39.334  83.627 131.625  1.00  0.93           C  
ATOM   1825  C   SER A 246      40.825  83.500 131.382  1.00  0.93           C  
ATOM   1826  O   SER A 246      41.505  84.488 131.106  1.00  0.93           O  
ATOM   1827  CB  SER A 246      38.690  83.965 130.240  1.00  0.93           C  
ATOM   1828  OG  SER A 246      37.630  83.079 129.869  1.00  0.93           O  
ATOM   1829  N   ALA A 247      41.379  82.278 131.476  1.00  0.92           N  
ATOM   1830  CA  ALA A 247      42.768  81.992 131.162  1.00  0.92           C  
ATOM   1831  C   ALA A 247      43.113  82.133 129.677  1.00  0.92           C  
ATOM   1832  O   ALA A 247      42.299  81.841 128.803  1.00  0.92           O  
ATOM   1833  CB  ALA A 247      43.155  80.592 131.677  1.00  0.92           C  
ATOM   1834  N   LYS A 248      44.334  82.607 129.357  1.00  0.84           N  
ATOM   1835  CA  LYS A 248      44.823  82.767 127.997  1.00  0.84           C  
ATOM   1836  C   LYS A 248      46.339  82.560 127.948  1.00  0.84           C  
ATOM   1837  O   LYS A 248      47.081  82.956 128.842  1.00  0.84           O  
ATOM   1838  CB  LYS A 248      44.497  84.179 127.411  1.00  0.84           C  
ATOM   1839  CG  LYS A 248      42.998  84.503 127.207  1.00  0.84           C  
ATOM   1840  CD  LYS A 248      42.344  83.634 126.115  1.00  0.84           C  
ATOM   1841  CE  LYS A 248      40.855  83.899 125.872  1.00  0.84           C  
ATOM   1842  NZ  LYS A 248      40.374  82.976 124.816  1.00  0.84           N  
ATOM   1843  N   ALA A 249      46.876  81.914 126.891  1.00  0.84           N  
ATOM   1844  CA  ALA A 249      48.305  81.648 126.803  1.00  0.84           C  
ATOM   1845  C   ALA A 249      49.166  82.855 126.354  1.00  0.84           C  
ATOM   1846  O   ALA A 249      48.728  83.621 125.490  1.00  0.84           O  
ATOM   1847  CB  ALA A 249      48.527  80.411 125.914  1.00  0.84           C  
ATOM   1848  N   PRO A 250      50.385  83.091 126.873  1.00  0.81           N  
ATOM   1849  CA  PRO A 250      51.072  84.383 126.770  1.00  0.81           C  
ATOM   1850  C   PRO A 250      51.529  84.722 125.370  1.00  0.81           C  
ATOM   1851  O   PRO A 250      51.511  85.913 125.066  1.00  0.81           O  
ATOM   1852  CB  PRO A 250      52.238  84.278 127.768  1.00  0.81           C  
ATOM   1853  CG  PRO A 250      52.452  82.780 127.972  1.00  0.81           C  
ATOM   1854  CD  PRO A 250      51.023  82.249 127.883  1.00  0.81           C  
ATOM   1855  N   ASN A 251      51.871  83.710 124.536  1.00  0.70           N  
ATOM   1856  CA  ASN A 251      52.030  83.752 123.081  1.00  0.70           C  
ATOM   1857  C   ASN A 251      53.433  83.453 122.626  1.00  0.70           C  
ATOM   1858  O   ASN A 251      53.583  82.497 121.869  1.00  0.70           O  
ATOM   1859  CB  ASN A 251      51.352  84.984 122.399  1.00  0.70           C  
ATOM   1860  CG  ASN A 251      51.108  84.667 120.949  1.00  0.70           C  
ATOM   1861  OD1 ASN A 251      52.032  84.481 120.184  1.00  0.70           O  
ATOM   1862  ND2 ASN A 251      49.822  84.532 120.561  1.00  0.70           N  
ATOM   1863  N   ASP A 252      54.439  84.188 123.121  1.00  0.72           N  
ATOM   1864  CA  ASP A 252      55.859  83.951 122.872  1.00  0.72           C  
ATOM   1865  C   ASP A 252      56.288  82.541 123.334  1.00  0.72           C  
ATOM   1866  O   ASP A 252      56.001  82.133 124.460  1.00  0.72           O  
ATOM   1867  CB  ASP A 252      56.662  85.086 123.589  1.00  0.72           C  
ATOM   1868  CG  ASP A 252      58.150  85.155 123.255  1.00  0.72           C  
ATOM   1869  OD1 ASP A 252      58.704  84.181 122.690  1.00  0.72           O  
ATOM   1870  OD2 ASP A 252      58.752  86.208 123.592  1.00  0.72           O  
ATOM   1871  N   PHE A 253      56.943  81.769 122.441  1.00  0.55           N  
ATOM   1872  CA  PHE A 253      57.551  80.479 122.704  1.00  0.55           C  
ATOM   1873  C   PHE A 253      58.627  80.293 121.644  1.00  0.55           C  
ATOM   1874  O   PHE A 253      58.493  80.782 120.527  1.00  0.55           O  
ATOM   1875  CB  PHE A 253      56.556  79.289 122.557  1.00  0.55           C  
ATOM   1876  CG  PHE A 253      55.587  79.210 123.702  1.00  0.55           C  
ATOM   1877  CD1 PHE A 253      56.036  78.968 125.013  1.00  0.55           C  
ATOM   1878  CD2 PHE A 253      54.210  79.370 123.471  1.00  0.55           C  
ATOM   1879  CE1 PHE A 253      55.125  78.910 126.076  1.00  0.55           C  
ATOM   1880  CE2 PHE A 253      53.294  79.289 124.528  1.00  0.55           C  
ATOM   1881  CZ  PHE A 253      53.754  79.067 125.833  1.00  0.55           C  
ATOM   1882  N   ASN A 254      59.723  79.559 121.922  1.00  0.43           N  
ATOM   1883  CA  ASN A 254      60.800  79.433 120.953  1.00  0.43           C  
ATOM   1884  C   ASN A 254      61.226  77.983 120.802  1.00  0.43           C  
ATOM   1885  O   ASN A 254      60.813  77.118 121.566  1.00  0.43           O  
ATOM   1886  CB  ASN A 254      61.972  80.390 121.316  1.00  0.43           C  
ATOM   1887  CG  ASN A 254      62.672  79.947 122.597  1.00  0.43           C  
ATOM   1888  OD1 ASN A 254      63.521  79.055 122.540  1.00  0.43           O  
ATOM   1889  ND2 ASN A 254      62.279  80.541 123.737  1.00  0.43           N  
ATOM   1890  N   LEU A 255      62.083  77.673 119.805  1.00  0.35           N  
ATOM   1891  CA  LEU A 255      62.524  76.318 119.505  1.00  0.35           C  
ATOM   1892  C   LEU A 255      63.140  75.556 120.672  1.00  0.35           C  
ATOM   1893  O   LEU A 255      63.025  74.336 120.733  1.00  0.35           O  
ATOM   1894  CB  LEU A 255      63.570  76.309 118.361  1.00  0.35           C  
ATOM   1895  CG  LEU A 255      63.039  76.704 116.967  1.00  0.35           C  
ATOM   1896  CD1 LEU A 255      64.218  76.919 116.007  1.00  0.35           C  
ATOM   1897  CD2 LEU A 255      62.101  75.636 116.384  1.00  0.35           C  
ATOM   1898  N   LYS A 256      63.809  76.240 121.623  1.00  0.48           N  
ATOM   1899  CA  LYS A 256      64.462  75.584 122.737  1.00  0.48           C  
ATOM   1900  C   LYS A 256      63.480  75.282 123.861  1.00  0.48           C  
ATOM   1901  O   LYS A 256      63.732  74.407 124.686  1.00  0.48           O  
ATOM   1902  CB  LYS A 256      65.640  76.462 123.239  1.00  0.48           C  
ATOM   1903  CG  LYS A 256      66.754  76.626 122.183  1.00  0.48           C  
ATOM   1904  CD  LYS A 256      67.890  77.566 122.625  1.00  0.48           C  
ATOM   1905  CE  LYS A 256      69.040  77.639 121.611  1.00  0.48           C  
ATOM   1906  NZ  LYS A 256      70.097  78.555 122.100  1.00  0.48           N  
ATOM   1907  N   ASP A 257      62.305  75.939 123.856  1.00  0.59           N  
ATOM   1908  CA  ASP A 257      61.229  75.675 124.790  1.00  0.59           C  
ATOM   1909  C   ASP A 257      60.179  74.740 124.184  1.00  0.59           C  
ATOM   1910  O   ASP A 257      59.243  74.303 124.852  1.00  0.59           O  
ATOM   1911  CB  ASP A 257      60.469  76.987 125.116  1.00  0.59           C  
ATOM   1912  CG  ASP A 257      61.342  78.067 125.725  1.00  0.59           C  
ATOM   1913  OD1 ASP A 257      62.475  77.798 126.184  1.00  0.59           O  
ATOM   1914  OD2 ASP A 257      60.858  79.229 125.694  1.00  0.59           O  
ATOM   1915  N   PHE A 258      60.268  74.401 122.883  1.00  0.55           N  
ATOM   1916  CA  PHE A 258      59.269  73.580 122.221  1.00  0.55           C  
ATOM   1917  C   PHE A 258      59.321  72.107 122.629  1.00  0.55           C  
ATOM   1918  O   PHE A 258      60.136  71.343 122.120  1.00  0.55           O  
ATOM   1919  CB  PHE A 258      59.437  73.626 120.671  1.00  0.55           C  
ATOM   1920  CG  PHE A 258      58.875  74.833 119.955  1.00  0.55           C  
ATOM   1921  CD1 PHE A 258      58.194  75.895 120.581  1.00  0.55           C  
ATOM   1922  CD2 PHE A 258      59.013  74.863 118.556  1.00  0.55           C  
ATOM   1923  CE1 PHE A 258      57.690  76.963 119.822  1.00  0.55           C  
ATOM   1924  CE2 PHE A 258      58.504  75.924 117.797  1.00  0.55           C  
ATOM   1925  CZ  PHE A 258      57.843  76.978 118.432  1.00  0.55           C  
ATOM   1926  N   ASN A 259      58.375  71.648 123.478  1.00  0.42           N  
ATOM   1927  CA  ASN A 259      58.303  70.298 124.034  1.00  0.42           C  
ATOM   1928  C   ASN A 259      58.401  69.143 123.036  1.00  0.42           C  
ATOM   1929  O   ASN A 259      59.048  68.133 123.297  1.00  0.42           O  
ATOM   1930  CB  ASN A 259      56.938  70.110 124.756  1.00  0.42           C  
ATOM   1931  CG  ASN A 259      56.852  70.966 126.012  1.00  0.42           C  
ATOM   1932  OD1 ASN A 259      57.842  71.220 126.693  1.00  0.42           O  
ATOM   1933  ND2 ASN A 259      55.621  71.403 126.360  1.00  0.42           N  
ATOM   1934  N   VAL A 260      57.739  69.255 121.871  1.00  0.43           N  
ATOM   1935  CA  VAL A 260      57.690  68.196 120.868  1.00  0.43           C  
ATOM   1936  C   VAL A 260      58.472  68.627 119.625  1.00  0.43           C  
ATOM   1937  O   VAL A 260      58.515  67.966 118.591  1.00  0.43           O  
ATOM   1938  CB  VAL A 260      56.225  67.900 120.547  1.00  0.43           C  
ATOM   1939  CG1 VAL A 260      56.061  66.716 119.574  1.00  0.43           C  
ATOM   1940  CG2 VAL A 260      55.480  67.565 121.859  1.00  0.43           C  
ATOM   1941  N   GLY A 261      59.166  69.779 119.697  1.00  0.44           N  
ATOM   1942  CA  GLY A 261      60.017  70.254 118.608  1.00  0.44           C  
ATOM   1943  C   GLY A 261      59.306  70.645 117.334  1.00  0.44           C  
ATOM   1944  O   GLY A 261      59.745  70.315 116.239  1.00  0.44           O  
ATOM   1945  N   GLY A 262      58.161  71.348 117.417  1.00  0.60           N  
ATOM   1946  CA  GLY A 262      57.394  71.663 116.219  1.00  0.60           C  
ATOM   1947  C   GLY A 262      56.394  72.765 116.429  1.00  0.60           C  
ATOM   1948  O   GLY A 262      55.708  72.817 117.445  1.00  0.60           O  
ATOM   1949  N   TYR A 263      56.270  73.671 115.430  1.00  0.48           N  
ATOM   1950  CA  TYR A 263      55.414  74.854 115.474  1.00  0.48           C  
ATOM   1951  C   TYR A 263      53.939  74.540 115.712  1.00  0.48           C  
ATOM   1952  O   TYR A 263      53.315  75.142 116.580  1.00  0.48           O  
ATOM   1953  CB  TYR A 263      55.586  75.679 114.148  1.00  0.48           C  
ATOM   1954  CG  TYR A 263      54.546  76.775 113.964  1.00  0.48           C  
ATOM   1955  CD1 TYR A 263      54.617  77.976 114.691  1.00  0.48           C  
ATOM   1956  CD2 TYR A 263      53.432  76.553 113.130  1.00  0.48           C  
ATOM   1957  CE1 TYR A 263      53.585  78.925 114.599  1.00  0.48           C  
ATOM   1958  CE2 TYR A 263      52.399  77.497 113.041  1.00  0.48           C  
ATOM   1959  CZ  TYR A 263      52.474  78.681 113.779  1.00  0.48           C  
ATOM   1960  OH  TYR A 263      51.415  79.612 113.712  1.00  0.48           O  
ATOM   1961  N   ILE A 264      53.344  73.575 114.972  1.00  0.54           N  
ATOM   1962  CA  ILE A 264      51.922  73.261 115.100  1.00  0.54           C  
ATOM   1963  C   ILE A 264      51.587  72.790 116.500  1.00  0.54           C  
ATOM   1964  O   ILE A 264      50.658  73.296 117.124  1.00  0.54           O  
ATOM   1965  CB  ILE A 264      51.468  72.230 114.062  1.00  0.54           C  
ATOM   1966  CG1 ILE A 264      51.635  72.775 112.619  1.00  0.54           C  
ATOM   1967  CG2 ILE A 264      50.005  71.781 114.305  1.00  0.54           C  
ATOM   1968  CD1 ILE A 264      50.714  73.952 112.260  1.00  0.54           C  
ATOM   1969  N   GLN A 265      52.404  71.881 117.068  1.00  0.58           N  
ATOM   1970  CA  GLN A 265      52.227  71.398 118.421  1.00  0.58           C  
ATOM   1971  C   GLN A 265      52.372  72.483 119.473  1.00  0.58           C  
ATOM   1972  O   GLN A 265      51.562  72.570 120.384  1.00  0.58           O  
ATOM   1973  CB  GLN A 265      53.184  70.222 118.714  1.00  0.58           C  
ATOM   1974  CG  GLN A 265      52.833  69.455 120.011  1.00  0.58           C  
ATOM   1975  CD  GLN A 265      51.434  68.837 119.940  1.00  0.58           C  
ATOM   1976  OE1 GLN A 265      51.069  68.177 118.964  1.00  0.58           O  
ATOM   1977  NE2 GLN A 265      50.621  69.054 120.993  1.00  0.58           N  
ATOM   1978  N   ALA A 266      53.348  73.403 119.333  1.00  0.68           N  
ATOM   1979  CA  ALA A 266      53.486  74.549 120.214  1.00  0.68           C  
ATOM   1980  C   ALA A 266      52.260  75.468 120.234  1.00  0.68           C  
ATOM   1981  O   ALA A 266      51.842  75.971 121.278  1.00  0.68           O  
ATOM   1982  CB  ALA A 266      54.738  75.340 119.795  1.00  0.68           C  
ATOM   1983  N   VAL A 267      51.615  75.690 119.070  1.00  0.65           N  
ATOM   1984  CA  VAL A 267      50.329  76.370 119.003  1.00  0.65           C  
ATOM   1985  C   VAL A 267      49.203  75.576 119.673  1.00  0.65           C  
ATOM   1986  O   VAL A 267      48.395  76.143 120.406  1.00  0.65           O  
ATOM   1987  CB  VAL A 267      49.963  76.783 117.580  1.00  0.65           C  
ATOM   1988  CG1 VAL A 267      48.643  77.581 117.562  1.00  0.65           C  
ATOM   1989  CG2 VAL A 267      51.077  77.691 117.025  1.00  0.65           C  
ATOM   1990  N   LEU A 268      49.127  74.240 119.484  1.00  0.64           N  
ATOM   1991  CA  LEU A 268      48.163  73.384 120.172  1.00  0.64           C  
ATOM   1992  C   LEU A 268      48.357  73.337 121.695  1.00  0.64           C  
ATOM   1993  O   LEU A 268      47.394  73.446 122.455  1.00  0.64           O  
ATOM   1994  CB  LEU A 268      48.153  71.934 119.608  1.00  0.64           C  
ATOM   1995  CG  LEU A 268      47.859  71.795 118.093  1.00  0.64           C  
ATOM   1996  CD1 LEU A 268      47.831  70.318 117.673  1.00  0.64           C  
ATOM   1997  CD2 LEU A 268      46.572  72.505 117.652  1.00  0.64           C  
ATOM   1998  N   ASP A 269      49.616  73.249 122.182  1.00  0.65           N  
ATOM   1999  CA  ASP A 269      50.014  73.196 123.585  1.00  0.65           C  
ATOM   2000  C   ASP A 269      49.594  74.438 124.386  1.00  0.65           C  
ATOM   2001  O   ASP A 269      49.528  74.416 125.615  1.00  0.65           O  
ATOM   2002  CB  ASP A 269      51.557  73.009 123.720  1.00  0.65           C  
ATOM   2003  CG  ASP A 269      52.045  71.603 123.388  1.00  0.65           C  
ATOM   2004  OD1 ASP A 269      51.211  70.718 123.071  1.00  0.65           O  
ATOM   2005  OD2 ASP A 269      53.285  71.390 123.484  1.00  0.65           O  
ATOM   2006  N   ARG A 270      49.193  75.542 123.710  1.00  0.70           N  
ATOM   2007  CA  ARG A 270      48.532  76.698 124.312  1.00  0.70           C  
ATOM   2008  C   ARG A 270      47.273  76.322 125.088  1.00  0.70           C  
ATOM   2009  O   ARG A 270      46.960  76.924 126.117  1.00  0.70           O  
ATOM   2010  CB  ARG A 270      48.114  77.754 123.249  1.00  0.70           C  
ATOM   2011  CG  ARG A 270      49.311  78.478 122.591  1.00  0.70           C  
ATOM   2012  CD  ARG A 270      48.989  79.339 121.363  1.00  0.70           C  
ATOM   2013  NE  ARG A 270      48.008  80.384 121.751  1.00  0.70           N  
ATOM   2014  CZ  ARG A 270      48.151  81.533 122.417  1.00  0.70           C  
ATOM   2015  NH1 ARG A 270      49.274  81.892 122.929  1.00  0.70           N  
ATOM   2016  NH2 ARG A 270      47.084  82.284 122.541  1.00  0.70           N  
ATOM   2017  N   ASN A 271      46.560  75.261 124.641  1.00  0.82           N  
ATOM   2018  CA  ASN A 271      45.376  74.709 125.278  1.00  0.82           C  
ATOM   2019  C   ASN A 271      45.620  74.327 126.735  1.00  0.82           C  
ATOM   2020  O   ASN A 271      44.731  74.461 127.567  1.00  0.82           O  
ATOM   2021  CB  ASN A 271      44.857  73.445 124.531  1.00  0.82           C  
ATOM   2022  CG  ASN A 271      44.270  73.696 123.139  1.00  0.82           C  
ATOM   2023  OD1 ASN A 271      43.982  72.743 122.414  1.00  0.82           O  
ATOM   2024  ND2 ASN A 271      44.035  74.964 122.739  1.00  0.82           N  
ATOM   2025  N   LEU A 272      46.844  73.887 127.094  1.00  0.77           N  
ATOM   2026  CA  LEU A 272      47.240  73.575 128.458  1.00  0.77           C  
ATOM   2027  C   LEU A 272      47.130  74.753 129.427  1.00  0.77           C  
ATOM   2028  O   LEU A 272      46.680  74.591 130.561  1.00  0.77           O  
ATOM   2029  CB  LEU A 272      48.692  73.032 128.491  1.00  0.77           C  
ATOM   2030  CG  LEU A 272      48.931  71.778 127.620  1.00  0.77           C  
ATOM   2031  CD1 LEU A 272      50.427  71.429 127.583  1.00  0.77           C  
ATOM   2032  CD2 LEU A 272      48.116  70.566 128.096  1.00  0.77           C  
ATOM   2033  N   ALA A 273      47.513  75.977 129.005  1.00  0.82           N  
ATOM   2034  CA  ALA A 273      47.331  77.190 129.787  1.00  0.82           C  
ATOM   2035  C   ALA A 273      45.865  77.592 129.939  1.00  0.82           C  
ATOM   2036  O   ALA A 273      45.397  77.944 131.020  1.00  0.82           O  
ATOM   2037  CB  ALA A 273      48.121  78.337 129.130  1.00  0.82           C  
ATOM   2038  N   GLU A 274      45.084  77.496 128.846  1.00  0.84           N  
ATOM   2039  CA  GLU A 274      43.661  77.792 128.838  1.00  0.84           C  
ATOM   2040  C   GLU A 274      42.818  76.787 129.612  1.00  0.84           C  
ATOM   2041  O   GLU A 274      41.723  77.096 130.081  1.00  0.84           O  
ATOM   2042  CB  GLU A 274      43.151  77.825 127.390  1.00  0.84           C  
ATOM   2043  CG  GLU A 274      43.618  79.072 126.617  1.00  0.84           C  
ATOM   2044  CD  GLU A 274      43.160  78.988 125.175  1.00  0.84           C  
ATOM   2045  OE1 GLU A 274      41.925  78.856 124.971  1.00  0.84           O  
ATOM   2046  OE2 GLU A 274      44.047  79.041 124.286  1.00  0.84           O  
ATOM   2047  N   ASN A 275      43.334  75.559 129.825  1.00  0.85           N  
ATOM   2048  CA  ASN A 275      42.652  74.502 130.549  1.00  0.85           C  
ATOM   2049  C   ASN A 275      42.390  74.823 132.012  1.00  0.85           C  
ATOM   2050  O   ASN A 275      41.521  74.218 132.638  1.00  0.85           O  
ATOM   2051  CB  ASN A 275      43.391  73.143 130.425  1.00  0.85           C  
ATOM   2052  CG  ASN A 275      43.065  72.511 129.075  1.00  0.85           C  
ATOM   2053  OD1 ASN A 275      42.163  72.945 128.358  1.00  0.85           O  
ATOM   2054  ND2 ASN A 275      43.775  71.411 128.734  1.00  0.85           N  
ATOM   2055  N   ILE A 276      43.082  75.829 132.578  1.00  0.90           N  
ATOM   2056  CA  ILE A 276      42.820  76.354 133.906  1.00  0.90           C  
ATOM   2057  C   ILE A 276      41.400  76.916 134.038  1.00  0.90           C  
ATOM   2058  O   ILE A 276      40.685  76.578 134.977  1.00  0.90           O  
ATOM   2059  CB  ILE A 276      43.887  77.380 134.282  1.00  0.90           C  
ATOM   2060  CG1 ILE A 276      45.283  76.702 134.283  1.00  0.90           C  
ATOM   2061  CG2 ILE A 276      43.582  77.993 135.667  1.00  0.90           C  
ATOM   2062  CD1 ILE A 276      46.446  77.693 134.393  1.00  0.90           C  
ATOM   2063  N   SER A 277      40.885  77.710 133.072  1.00  0.90           N  
ATOM   2064  CA  SER A 277      39.498  78.180 133.137  1.00  0.90           C  
ATOM   2065  C   SER A 277      38.542  77.332 132.316  1.00  0.90           C  
ATOM   2066  O   SER A 277      37.442  77.769 131.997  1.00  0.90           O  
ATOM   2067  CB  SER A 277      39.275  79.678 132.772  1.00  0.90           C  
ATOM   2068  OG  SER A 277      39.565  79.963 131.408  1.00  0.90           O  
ATOM   2069  N   ARG A 278      38.911  76.100 131.916  1.00  0.82           N  
ATOM   2070  CA  ARG A 278      38.041  75.288 131.077  1.00  0.82           C  
ATOM   2071  C   ARG A 278      36.780  74.768 131.749  1.00  0.82           C  
ATOM   2072  O   ARG A 278      35.693  74.880 131.195  1.00  0.82           O  
ATOM   2073  CB  ARG A 278      38.816  74.072 130.518  1.00  0.82           C  
ATOM   2074  CG  ARG A 278      38.198  73.403 129.269  1.00  0.82           C  
ATOM   2075  CD  ARG A 278      38.322  74.254 127.993  1.00  0.82           C  
ATOM   2076  NE  ARG A 278      39.753  74.232 127.539  1.00  0.82           N  
ATOM   2077  CZ  ARG A 278      40.283  75.139 126.708  1.00  0.82           C  
ATOM   2078  NH1 ARG A 278      39.587  76.122 126.154  1.00  0.82           N  
ATOM   2079  NH2 ARG A 278      41.573  75.032 126.409  1.00  0.82           N  
ATOM   2080  N   VAL A 279      36.868  74.192 132.961  1.00  0.88           N  
ATOM   2081  CA  VAL A 279      35.728  73.484 133.533  1.00  0.88           C  
ATOM   2082  C   VAL A 279      35.663  73.588 135.047  1.00  0.88           C  
ATOM   2083  O   VAL A 279      36.664  73.485 135.756  1.00  0.88           O  
ATOM   2084  CB  VAL A 279      35.681  72.025 133.061  1.00  0.88           C  
ATOM   2085  CG1 VAL A 279      36.947  71.243 133.470  1.00  0.88           C  
ATOM   2086  CG2 VAL A 279      34.401  71.302 133.533  1.00  0.88           C  
ATOM   2087  N   LEU A 280      34.448  73.819 135.588  1.00  0.90           N  
ATOM   2088  CA  LEU A 280      34.150  73.715 137.005  1.00  0.90           C  
ATOM   2089  C   LEU A 280      34.348  72.295 137.535  1.00  0.90           C  
ATOM   2090  O   LEU A 280      33.870  71.316 136.962  1.00  0.90           O  
ATOM   2091  CB  LEU A 280      32.687  74.167 137.256  1.00  0.90           C  
ATOM   2092  CG  LEU A 280      32.132  73.999 138.690  1.00  0.90           C  
ATOM   2093  CD1 LEU A 280      32.800  74.933 139.709  1.00  0.90           C  
ATOM   2094  CD2 LEU A 280      30.618  74.232 138.681  1.00  0.90           C  
ATOM   2095  N   TYR A 281      35.047  72.135 138.678  1.00  0.88           N  
ATOM   2096  CA  TYR A 281      35.145  70.848 139.346  1.00  0.88           C  
ATOM   2097  C   TYR A 281      33.800  70.465 139.984  1.00  0.88           C  
ATOM   2098  O   TYR A 281      33.343  71.190 140.869  1.00  0.88           O  
ATOM   2099  CB  TYR A 281      36.258  70.836 140.434  1.00  0.88           C  
ATOM   2100  CG  TYR A 281      37.560  70.364 139.838  1.00  0.88           C  
ATOM   2101  CD1 TYR A 281      38.024  69.060 140.094  1.00  0.88           C  
ATOM   2102  CD2 TYR A 281      38.302  71.188 138.973  1.00  0.88           C  
ATOM   2103  CE1 TYR A 281      39.199  68.587 139.494  1.00  0.88           C  
ATOM   2104  CE2 TYR A 281      39.471  70.713 138.360  1.00  0.88           C  
ATOM   2105  CZ  TYR A 281      39.910  69.409 138.616  1.00  0.88           C  
ATOM   2106  OH  TYR A 281      41.043  68.910 137.950  1.00  0.88           O  
ATOM   2107  N   PRO A 282      33.121  69.378 139.611  1.00  0.89           N  
ATOM   2108  CA  PRO A 282      31.731  69.118 139.999  1.00  0.89           C  
ATOM   2109  C   PRO A 282      31.586  68.487 141.377  1.00  0.89           C  
ATOM   2110  O   PRO A 282      30.660  67.702 141.598  1.00  0.89           O  
ATOM   2111  CB  PRO A 282      31.278  68.130 138.915  1.00  0.89           C  
ATOM   2112  CG  PRO A 282      32.543  67.332 138.609  1.00  0.89           C  
ATOM   2113  CD  PRO A 282      33.610  68.410 138.628  1.00  0.89           C  
ATOM   2114  N   ASN A 283      32.444  68.850 142.337  1.00  0.84           N  
ATOM   2115  CA  ASN A 283      32.449  68.279 143.664  1.00  0.84           C  
ATOM   2116  C   ASN A 283      31.705  69.179 144.645  1.00  0.84           C  
ATOM   2117  O   ASN A 283      32.124  70.295 144.931  1.00  0.84           O  
ATOM   2118  CB  ASN A 283      33.911  68.077 144.131  1.00  0.84           C  
ATOM   2119  CG  ASN A 283      34.577  67.016 143.255  1.00  0.84           C  
ATOM   2120  OD1 ASN A 283      34.014  65.943 143.036  1.00  0.84           O  
ATOM   2121  ND2 ASN A 283      35.794  67.318 142.748  1.00  0.84           N  
ATOM   2122  N   ASP A 284      30.581  68.686 145.203  1.00  0.83           N  
ATOM   2123  CA  ASP A 284      29.816  69.359 146.231  1.00  0.83           C  
ATOM   2124  C   ASP A 284      30.173  68.667 147.536  1.00  0.83           C  
ATOM   2125  O   ASP A 284      30.067  67.447 147.654  1.00  0.83           O  
ATOM   2126  CB  ASP A 284      28.300  69.266 145.913  1.00  0.83           C  
ATOM   2127  CG  ASP A 284      27.444  70.176 146.771  1.00  0.83           C  
ATOM   2128  OD1 ASP A 284      27.253  69.823 147.950  1.00  0.83           O  
ATOM   2129  OD2 ASP A 284      26.900  71.191 146.277  1.00  0.83           O  
ATOM   2130  N   ASN A 285      30.686  69.439 148.519  1.00  0.78           N  
ATOM   2131  CA  ASN A 285      31.072  68.959 149.838  1.00  0.78           C  
ATOM   2132  C   ASN A 285      32.069  67.797 149.829  1.00  0.78           C  
ATOM   2133  O   ASN A 285      31.986  66.871 150.633  1.00  0.78           O  
ATOM   2134  CB  ASN A 285      29.815  68.597 150.672  1.00  0.78           C  
ATOM   2135  CG  ASN A 285      29.101  69.871 151.099  1.00  0.78           C  
ATOM   2136  OD1 ASN A 285      29.491  70.522 152.068  1.00  0.78           O  
ATOM   2137  ND2 ASN A 285      28.018  70.256 150.399  1.00  0.78           N  
ATOM   2138  N   PHE A 286      33.059  67.845 148.920  1.00  0.84           N  
ATOM   2139  CA  PHE A 286      34.066  66.815 148.797  1.00  0.84           C  
ATOM   2140  C   PHE A 286      35.352  67.439 148.272  1.00  0.84           C  
ATOM   2141  O   PHE A 286      35.328  68.249 147.347  1.00  0.84           O  
ATOM   2142  CB  PHE A 286      33.563  65.704 147.829  1.00  0.84           C  
ATOM   2143  CG  PHE A 286      34.507  64.532 147.762  1.00  0.84           C  
ATOM   2144  CD1 PHE A 286      34.645  63.668 148.861  1.00  0.84           C  
ATOM   2145  CD2 PHE A 286      35.283  64.305 146.612  1.00  0.84           C  
ATOM   2146  CE1 PHE A 286      35.552  62.600 148.817  1.00  0.84           C  
ATOM   2147  CE2 PHE A 286      36.194  63.241 146.565  1.00  0.84           C  
ATOM   2148  CZ  PHE A 286      36.330  62.391 147.670  1.00  0.84           C  
ATOM   2149  N   PHE A 287      36.511  67.064 148.844  1.00  0.85           N  
ATOM   2150  CA  PHE A 287      37.808  67.561 148.426  1.00  0.85           C  
ATOM   2151  C   PHE A 287      38.504  66.547 147.519  1.00  0.85           C  
ATOM   2152  O   PHE A 287      38.851  65.438 147.921  1.00  0.85           O  
ATOM   2153  CB  PHE A 287      38.675  67.899 149.678  1.00  0.85           C  
ATOM   2154  CG  PHE A 287      40.096  68.292 149.336  1.00  0.85           C  
ATOM   2155  CD1 PHE A 287      40.370  69.360 148.465  1.00  0.85           C  
ATOM   2156  CD2 PHE A 287      41.171  67.555 149.861  1.00  0.85           C  
ATOM   2157  CE1 PHE A 287      41.690  69.690 148.134  1.00  0.85           C  
ATOM   2158  CE2 PHE A 287      42.491  67.872 149.518  1.00  0.85           C  
ATOM   2159  CZ  PHE A 287      42.753  68.945 148.657  1.00  0.85           C  
ATOM   2160  N   GLU A 288      38.769  66.944 146.258  1.00  0.79           N  
ATOM   2161  CA  GLU A 288      39.506  66.135 145.308  1.00  0.79           C  
ATOM   2162  C   GLU A 288      40.820  66.842 145.003  1.00  0.79           C  
ATOM   2163  O   GLU A 288      40.862  67.905 144.389  1.00  0.79           O  
ATOM   2164  CB  GLU A 288      38.723  65.911 143.989  1.00  0.79           C  
ATOM   2165  CG  GLU A 288      39.414  64.880 143.063  1.00  0.79           C  
ATOM   2166  CD  GLU A 288      38.979  64.931 141.603  1.00  0.79           C  
ATOM   2167  OE1 GLU A 288      37.933  65.538 141.273  1.00  0.79           O  
ATOM   2168  OE2 GLU A 288      39.747  64.343 140.790  1.00  0.79           O  
ATOM   2169  N   GLY A 289      41.958  66.262 145.441  1.00  0.87           N  
ATOM   2170  CA  GLY A 289      43.267  66.923 145.433  1.00  0.87           C  
ATOM   2171  C   GLY A 289      44.007  66.964 144.117  1.00  0.87           C  
ATOM   2172  O   GLY A 289      45.206  66.706 144.061  1.00  0.87           O  
ATOM   2173  N   LYS A 290      43.319  67.280 143.012  1.00  0.83           N  
ATOM   2174  CA  LYS A 290      43.905  67.406 141.689  1.00  0.83           C  
ATOM   2175  C   LYS A 290      44.666  68.717 141.482  1.00  0.83           C  
ATOM   2176  O   LYS A 290      44.215  69.790 141.873  1.00  0.83           O  
ATOM   2177  CB  LYS A 290      42.787  67.295 140.624  1.00  0.83           C  
ATOM   2178  CG  LYS A 290      42.246  65.871 140.446  1.00  0.83           C  
ATOM   2179  CD  LYS A 290      43.153  64.977 139.586  1.00  0.83           C  
ATOM   2180  CE  LYS A 290      42.570  63.586 139.309  1.00  0.83           C  
ATOM   2181  NZ  LYS A 290      42.424  62.824 140.566  1.00  0.83           N  
ATOM   2182  N   GLU A 291      45.841  68.674 140.805  1.00  0.86           N  
ATOM   2183  CA  GLU A 291      46.699  69.837 140.569  1.00  0.86           C  
ATOM   2184  C   GLU A 291      46.012  70.959 139.802  1.00  0.86           C  
ATOM   2185  O   GLU A 291      46.150  72.139 140.111  1.00  0.86           O  
ATOM   2186  CB  GLU A 291      47.974  69.446 139.776  1.00  0.86           C  
ATOM   2187  CG  GLU A 291      49.042  70.567 139.676  1.00  0.86           C  
ATOM   2188  CD  GLU A 291      50.028  70.317 138.532  1.00  0.86           C  
ATOM   2189  OE1 GLU A 291      49.675  70.566 137.349  1.00  0.86           O  
ATOM   2190  OE2 GLU A 291      51.177  69.912 138.792  1.00  0.86           O  
ATOM   2191  N   LEU A 292      45.202  70.618 138.782  1.00  0.89           N  
ATOM   2192  CA  LEU A 292      44.461  71.590 138.000  1.00  0.89           C  
ATOM   2193  C   LEU A 292      43.491  72.432 138.824  1.00  0.89           C  
ATOM   2194  O   LEU A 292      43.374  73.633 138.601  1.00  0.89           O  
ATOM   2195  CB  LEU A 292      43.715  70.892 136.843  1.00  0.89           C  
ATOM   2196  CG  LEU A 292      43.001  71.843 135.857  1.00  0.89           C  
ATOM   2197  CD1 LEU A 292      44.009  72.659 135.032  1.00  0.89           C  
ATOM   2198  CD2 LEU A 292      42.075  71.058 134.919  1.00  0.89           C  
ATOM   2199  N   ARG A 293      42.815  71.848 139.835  1.00  0.86           N  
ATOM   2200  CA  ARG A 293      41.983  72.592 140.766  1.00  0.86           C  
ATOM   2201  C   ARG A 293      42.777  73.622 141.568  1.00  0.86           C  
ATOM   2202  O   ARG A 293      42.378  74.776 141.689  1.00  0.86           O  
ATOM   2203  CB  ARG A 293      41.271  71.612 141.729  1.00  0.86           C  
ATOM   2204  CG  ARG A 293      40.451  72.293 142.841  1.00  0.86           C  
ATOM   2205  CD  ARG A 293      39.333  73.211 142.338  1.00  0.86           C  
ATOM   2206  NE  ARG A 293      38.750  73.741 143.585  1.00  0.86           N  
ATOM   2207  CZ  ARG A 293      37.535  74.238 143.805  1.00  0.86           C  
ATOM   2208  NH1 ARG A 293      36.635  74.384 142.846  1.00  0.86           N  
ATOM   2209  NH2 ARG A 293      37.286  74.604 145.057  1.00  0.86           N  
ATOM   2210  N   LEU A 294      43.970  73.246 142.060  1.00  0.93           N  
ATOM   2211  CA  LEU A 294      44.898  74.135 142.739  1.00  0.93           C  
ATOM   2212  C   LEU A 294      45.362  75.296 141.859  1.00  0.93           C  
ATOM   2213  O   LEU A 294      45.440  76.453 142.280  1.00  0.93           O  
ATOM   2214  CB  LEU A 294      46.111  73.293 143.213  1.00  0.93           C  
ATOM   2215  CG  LEU A 294      47.156  74.037 144.059  1.00  0.93           C  
ATOM   2216  CD1 LEU A 294      46.527  74.615 145.330  1.00  0.93           C  
ATOM   2217  CD2 LEU A 294      48.317  73.100 144.426  1.00  0.93           C  
ATOM   2218  N   LYS A 295      45.625  75.026 140.562  1.00  0.92           N  
ATOM   2219  CA  LYS A 295      45.884  76.064 139.581  1.00  0.92           C  
ATOM   2220  C   LYS A 295      44.728  77.041 139.413  1.00  0.92           C  
ATOM   2221  O   LYS A 295      44.957  78.242 139.307  1.00  0.92           O  
ATOM   2222  CB  LYS A 295      46.245  75.488 138.195  1.00  0.92           C  
ATOM   2223  CG  LYS A 295      47.559  74.712 138.170  1.00  0.92           C  
ATOM   2224  CD  LYS A 295      47.854  74.212 136.750  1.00  0.92           C  
ATOM   2225  CE  LYS A 295      49.173  73.461 136.736  1.00  0.92           C  
ATOM   2226  NZ  LYS A 295      49.460  72.784 135.459  1.00  0.92           N  
ATOM   2227  N   GLN A 296      43.461  76.568 139.423  1.00  0.93           N  
ATOM   2228  CA  GLN A 296      42.281  77.423 139.395  1.00  0.93           C  
ATOM   2229  C   GLN A 296      42.178  78.349 140.591  1.00  0.93           C  
ATOM   2230  O   GLN A 296      41.914  79.544 140.457  1.00  0.93           O  
ATOM   2231  CB  GLN A 296      40.970  76.591 139.360  1.00  0.93           C  
ATOM   2232  CG  GLN A 296      40.847  75.758 138.074  1.00  0.93           C  
ATOM   2233  CD  GLN A 296      39.542  74.967 137.982  1.00  0.93           C  
ATOM   2234  OE1 GLN A 296      38.984  74.486 138.970  1.00  0.93           O  
ATOM   2235  NE2 GLN A 296      39.059  74.802 136.729  1.00  0.93           N  
ATOM   2236  N   GLU A 297      42.417  77.810 141.794  1.00  0.94           N  
ATOM   2237  CA  GLU A 297      42.354  78.538 143.040  1.00  0.94           C  
ATOM   2238  C   GLU A 297      43.400  79.624 143.146  1.00  0.94           C  
ATOM   2239  O   GLU A 297      43.102  80.758 143.518  1.00  0.94           O  
ATOM   2240  CB  GLU A 297      42.448  77.533 144.193  1.00  0.94           C  
ATOM   2241  CG  GLU A 297      41.188  76.643 144.222  1.00  0.94           C  
ATOM   2242  CD  GLU A 297      41.284  75.507 145.227  1.00  0.94           C  
ATOM   2243  OE1 GLU A 297      42.396  75.200 145.714  1.00  0.94           O  
ATOM   2244  OE2 GLU A 297      40.215  74.872 145.428  1.00  0.94           O  
ATOM   2245  N   TYR A 298      44.654  79.344 142.744  1.00  0.96           N  
ATOM   2246  CA  TYR A 298      45.654  80.385 142.597  1.00  0.96           C  
ATOM   2247  C   TYR A 298      45.348  81.387 141.474  1.00  0.96           C  
ATOM   2248  O   TYR A 298      45.527  82.591 141.647  1.00  0.96           O  
ATOM   2249  CB  TYR A 298      47.071  79.777 142.438  1.00  0.96           C  
ATOM   2250  CG  TYR A 298      48.105  80.872 142.512  1.00  0.96           C  
ATOM   2251  CD1 TYR A 298      48.240  81.646 143.679  1.00  0.96           C  
ATOM   2252  CD2 TYR A 298      48.848  81.223 141.374  1.00  0.96           C  
ATOM   2253  CE1 TYR A 298      49.088  82.762 143.695  1.00  0.96           C  
ATOM   2254  CE2 TYR A 298      49.710  82.325 141.398  1.00  0.96           C  
ATOM   2255  CZ  TYR A 298      49.835  83.087 142.560  1.00  0.96           C  
ATOM   2256  OH  TYR A 298      50.695  84.197 142.566  1.00  0.96           O  
ATOM   2257  N   PHE A 299      44.855  80.931 140.302  1.00  0.96           N  
ATOM   2258  CA  PHE A 299      44.545  81.786 139.164  1.00  0.96           C  
ATOM   2259  C   PHE A 299      43.533  82.882 139.496  1.00  0.96           C  
ATOM   2260  O   PHE A 299      43.764  84.061 139.224  1.00  0.96           O  
ATOM   2261  CB  PHE A 299      44.046  80.879 137.995  1.00  0.96           C  
ATOM   2262  CG  PHE A 299      43.597  81.630 136.772  1.00  0.96           C  
ATOM   2263  CD1 PHE A 299      44.531  82.185 135.882  1.00  0.96           C  
ATOM   2264  CD2 PHE A 299      42.224  81.798 136.524  1.00  0.96           C  
ATOM   2265  CE1 PHE A 299      44.098  82.931 134.778  1.00  0.96           C  
ATOM   2266  CE2 PHE A 299      41.787  82.545 135.425  1.00  0.96           C  
ATOM   2267  CZ  PHE A 299      42.726  83.126 134.565  1.00  0.96           C  
ATOM   2268  N   VAL A 300      42.410  82.527 140.154  1.00  0.97           N  
ATOM   2269  CA  VAL A 300      41.414  83.501 140.573  1.00  0.97           C  
ATOM   2270  C   VAL A 300      41.924  84.449 141.651  1.00  0.97           C  
ATOM   2271  O   VAL A 300      41.645  85.646 141.633  1.00  0.97           O  
ATOM   2272  CB  VAL A 300      40.101  82.833 140.962  1.00  0.97           C  
ATOM   2273  CG1 VAL A 300      40.211  82.027 142.268  1.00  0.97           C  
ATOM   2274  CG2 VAL A 300      38.968  83.872 141.041  1.00  0.97           C  
ATOM   2275  N   VAL A 301      42.713  83.938 142.614  1.00  0.98           N  
ATOM   2276  CA  VAL A 301      43.327  84.705 143.681  1.00  0.98           C  
ATOM   2277  C   VAL A 301      44.328  85.740 143.192  1.00  0.98           C  
ATOM   2278  O   VAL A 301      44.241  86.915 143.549  1.00  0.98           O  
ATOM   2279  CB  VAL A 301      43.974  83.715 144.648  1.00  0.98           C  
ATOM   2280  CG1 VAL A 301      45.194  84.279 145.397  1.00  0.98           C  
ATOM   2281  CG2 VAL A 301      42.885  83.234 145.627  1.00  0.98           C  
ATOM   2282  N   ALA A 302      45.280  85.342 142.325  1.00  0.98           N  
ATOM   2283  CA  ALA A 302      46.318  86.217 141.832  1.00  0.98           C  
ATOM   2284  C   ALA A 302      45.787  87.326 140.944  1.00  0.98           C  
ATOM   2285  O   ALA A 302      46.157  88.491 141.086  1.00  0.98           O  
ATOM   2286  CB  ALA A 302      47.351  85.368 141.075  1.00  0.98           C  
ATOM   2287  N   ALA A 303      44.867  86.994 140.018  1.00  0.97           N  
ATOM   2288  CA  ALA A 303      44.249  87.970 139.150  1.00  0.97           C  
ATOM   2289  C   ALA A 303      43.381  88.978 139.902  1.00  0.97           C  
ATOM   2290  O   ALA A 303      43.497  90.189 139.716  1.00  0.97           O  
ATOM   2291  CB  ALA A 303      43.442  87.208 138.086  1.00  0.97           C  
ATOM   2292  N   THR A 304      42.538  88.498 140.839  1.00  0.97           N  
ATOM   2293  CA  THR A 304      41.699  89.336 141.691  1.00  0.97           C  
ATOM   2294  C   THR A 304      42.493  90.268 142.584  1.00  0.97           C  
ATOM   2295  O   THR A 304      42.234  91.469 142.620  1.00  0.97           O  
ATOM   2296  CB  THR A 304      40.800  88.473 142.567  1.00  0.97           C  
ATOM   2297  OG1 THR A 304      39.848  87.803 141.754  1.00  0.97           O  
ATOM   2298  CG2 THR A 304      39.999  89.283 143.593  1.00  0.97           C  
ATOM   2299  N   LEU A 305      43.525  89.776 143.303  1.00  0.96           N  
ATOM   2300  CA  LEU A 305      44.323  90.622 144.180  1.00  0.96           C  
ATOM   2301  C   LEU A 305      45.120  91.693 143.456  1.00  0.96           C  
ATOM   2302  O   LEU A 305      45.160  92.843 143.894  1.00  0.96           O  
ATOM   2303  CB  LEU A 305      45.239  89.793 145.108  1.00  0.96           C  
ATOM   2304  CG  LEU A 305      44.482  89.162 146.294  1.00  0.96           C  
ATOM   2305  CD1 LEU A 305      45.400  88.210 147.059  1.00  0.96           C  
ATOM   2306  CD2 LEU A 305      43.960  90.226 147.269  1.00  0.96           C  
ATOM   2307  N   GLN A 306      45.722  91.369 142.294  1.00  0.92           N  
ATOM   2308  CA  GLN A 306      46.380  92.350 141.445  1.00  0.92           C  
ATOM   2309  C   GLN A 306      45.426  93.443 140.946  1.00  0.92           C  
ATOM   2310  O   GLN A 306      45.757  94.629 140.964  1.00  0.92           O  
ATOM   2311  CB  GLN A 306      47.047  91.656 140.232  1.00  0.92           C  
ATOM   2312  CG  GLN A 306      48.335  90.868 140.567  1.00  0.92           C  
ATOM   2313  CD  GLN A 306      48.927  90.249 139.297  1.00  0.92           C  
ATOM   2314  OE1 GLN A 306      49.494  90.937 138.448  1.00  0.92           O  
ATOM   2315  NE2 GLN A 306      48.787  88.913 139.153  1.00  0.92           N  
ATOM   2316  N   ASP A 307      44.195  93.077 140.524  1.00  0.92           N  
ATOM   2317  CA  ASP A 307      43.157  94.011 140.110  1.00  0.92           C  
ATOM   2318  C   ASP A 307      42.670  94.927 141.246  1.00  0.92           C  
ATOM   2319  O   ASP A 307      42.521  96.137 141.067  1.00  0.92           O  
ATOM   2320  CB  ASP A 307      42.000  93.196 139.462  1.00  0.92           C  
ATOM   2321  CG  ASP A 307      41.156  93.993 138.488  1.00  0.92           C  
ATOM   2322  OD1 ASP A 307      41.736  94.700 137.624  1.00  0.92           O  
ATOM   2323  OD2 ASP A 307      39.899  93.874 138.548  1.00  0.92           O  
ATOM   2324  N   ILE A 308      42.458  94.383 142.469  1.00  0.93           N  
ATOM   2325  CA  ILE A 308      42.086  95.148 143.662  1.00  0.93           C  
ATOM   2326  C   ILE A 308      43.147  96.162 144.064  1.00  0.93           C  
ATOM   2327  O   ILE A 308      42.842  97.325 144.330  1.00  0.93           O  
ATOM   2328  CB  ILE A 308      41.798  94.220 144.852  1.00  0.93           C  
ATOM   2329  CG1 ILE A 308      40.525  93.388 144.576  1.00  0.93           C  
ATOM   2330  CG2 ILE A 308      41.641  94.996 146.187  1.00  0.93           C  
ATOM   2331  CD1 ILE A 308      40.319  92.247 145.577  1.00  0.93           C  
ATOM   2332  N   ILE A 309      44.432  95.756 144.088  1.00  0.89           N  
ATOM   2333  CA  ILE A 309      45.566  96.618 144.402  1.00  0.89           C  
ATOM   2334  C   ILE A 309      45.764  97.704 143.360  1.00  0.89           C  
ATOM   2335  O   ILE A 309      45.971  98.869 143.694  1.00  0.89           O  
ATOM   2336  CB  ILE A 309      46.821  95.782 144.629  1.00  0.89           C  
ATOM   2337  CG1 ILE A 309      46.671  95.051 145.984  1.00  0.89           C  
ATOM   2338  CG2 ILE A 309      48.117  96.628 144.604  1.00  0.89           C  
ATOM   2339  CD1 ILE A 309      47.623  93.866 146.133  1.00  0.89           C  
ATOM   2340  N   ARG A 310      45.631  97.371 142.061  1.00  0.83           N  
ATOM   2341  CA  ARG A 310      45.671  98.339 140.979  1.00  0.83           C  
ATOM   2342  C   ARG A 310      44.574  99.391 141.087  1.00  0.83           C  
ATOM   2343  O   ARG A 310      44.838 100.581 140.943  1.00  0.83           O  
ATOM   2344  CB  ARG A 310      45.585  97.585 139.629  1.00  0.83           C  
ATOM   2345  CG  ARG A 310      45.679  98.463 138.364  1.00  0.83           C  
ATOM   2346  CD  ARG A 310      45.906  97.672 137.064  1.00  0.83           C  
ATOM   2347  NE  ARG A 310      44.781  96.698 136.896  1.00  0.83           N  
ATOM   2348  CZ  ARG A 310      44.716  95.790 135.913  1.00  0.83           C  
ATOM   2349  NH1 ARG A 310      45.527  95.843 134.860  1.00  0.83           N  
ATOM   2350  NH2 ARG A 310      43.805  94.825 135.968  1.00  0.83           N  
ATOM   2351  N   ARG A 311      43.331  98.976 141.413  1.00  0.81           N  
ATOM   2352  CA  ARG A 311      42.219  99.867 141.700  1.00  0.81           C  
ATOM   2353  C   ARG A 311      42.425 100.724 142.942  1.00  0.81           C  
ATOM   2354  O   ARG A 311      42.049 101.892 142.973  1.00  0.81           O  
ATOM   2355  CB  ARG A 311      40.903  99.052 141.808  1.00  0.81           C  
ATOM   2356  CG  ARG A 311      39.613  99.906 141.830  1.00  0.81           C  
ATOM   2357  CD  ARG A 311      38.311  99.111 142.020  1.00  0.81           C  
ATOM   2358  NE  ARG A 311      38.074  98.280 140.796  1.00  0.81           N  
ATOM   2359  CZ  ARG A 311      38.172  96.946 140.732  1.00  0.81           C  
ATOM   2360  NH1 ARG A 311      38.478  96.195 141.781  1.00  0.81           N  
ATOM   2361  NH2 ARG A 311      37.938  96.335 139.574  1.00  0.81           N  
ATOM   2362  N   PHE A 312      43.030 100.179 144.019  1.00  0.85           N  
ATOM   2363  CA  PHE A 312      43.394 100.961 145.191  1.00  0.85           C  
ATOM   2364  C   PHE A 312      44.442 102.049 144.827  1.00  0.85           C  
ATOM   2365  O   PHE A 312      44.333 103.237 145.105  1.00  0.85           O  
ATOM   2366  CB  PHE A 312      43.933  99.982 146.286  1.00  0.85           C  
ATOM   2367  CG  PHE A 312      44.434 100.679 147.527  1.00  0.85           C  
ATOM   2368  CD1 PHE A 312      43.545 101.102 148.530  1.00  0.85           C  
ATOM   2369  CD2 PHE A 312      45.811 100.906 147.700  1.00  0.85           C  
ATOM   2370  CE1 PHE A 312      44.020 101.765 149.670  1.00  0.85           C  
ATOM   2371  CE2 PHE A 312      46.294 101.530 148.857  1.00  0.85           C  
ATOM   2372  CZ  PHE A 312      45.396 101.966 149.839  1.00  0.85           C  
ATOM   2373  N   LYS A 313      45.507 101.710 144.112  1.00  0.79           N  
ATOM   2374  CA  LYS A 313      46.580 102.638 143.783  1.00  0.79           C  
ATOM   2375  C   LYS A 313      46.199 103.688 142.744  1.00  0.79           C  
ATOM   2376  O   LYS A 313      46.840 104.732 142.670  1.00  0.79           O  
ATOM   2377  CB  LYS A 313      47.848 101.882 143.284  1.00  0.79           C  
ATOM   2378  CG  LYS A 313      48.500 100.975 144.346  1.00  0.79           C  
ATOM   2379  CD  LYS A 313      49.688 100.135 143.829  1.00  0.79           C  
ATOM   2380  CE  LYS A 313      51.040 100.860 143.841  1.00  0.79           C  
ATOM   2381  NZ  LYS A 313      52.124  99.905 143.566  1.00  0.79           N  
ATOM   2382  N   SER A 314      45.139 103.466 141.940  1.00  0.78           N  
ATOM   2383  CA  SER A 314      44.681 104.436 140.950  1.00  0.78           C  
ATOM   2384  C   SER A 314      43.574 105.333 141.457  1.00  0.78           C  
ATOM   2385  O   SER A 314      43.112 106.238 140.769  1.00  0.78           O  
ATOM   2386  CB  SER A 314      44.155 103.730 139.671  1.00  0.78           C  
ATOM   2387  OG  SER A 314      43.037 102.875 139.930  1.00  0.78           O  
ATOM   2388  N   SER A 315      43.130 105.118 142.698  1.00  0.76           N  
ATOM   2389  CA  SER A 315      42.073 105.896 143.300  1.00  0.76           C  
ATOM   2390  C   SER A 315      42.567 107.178 143.931  1.00  0.76           C  
ATOM   2391  O   SER A 315      43.766 107.419 144.034  1.00  0.76           O  
ATOM   2392  CB  SER A 315      41.332 105.070 144.340  1.00  0.76           C  
ATOM   2393  OG  SER A 315      42.116 104.778 145.455  1.00  0.76           O  
ATOM   2394  N   LYS A 316      41.653 108.058 144.399  1.00  0.63           N  
ATOM   2395  CA  LYS A 316      42.004 109.380 144.898  1.00  0.63           C  
ATOM   2396  C   LYS A 316      42.900 109.347 146.103  1.00  0.63           C  
ATOM   2397  O   LYS A 316      43.744 110.219 146.271  1.00  0.63           O  
ATOM   2398  CB  LYS A 316      40.762 110.209 145.286  1.00  0.63           C  
ATOM   2399  CG  LYS A 316      40.018 110.770 144.074  1.00  0.63           C  
ATOM   2400  CD  LYS A 316      38.720 111.473 144.482  1.00  0.63           C  
ATOM   2401  CE  LYS A 316      37.996 112.075 143.280  1.00  0.63           C  
ATOM   2402  NZ  LYS A 316      36.703 112.618 143.721  1.00  0.63           N  
ATOM   2403  N   PHE A 317      42.745 108.339 146.977  1.00  0.54           N  
ATOM   2404  CA  PHE A 317      43.682 108.141 148.067  1.00  0.54           C  
ATOM   2405  C   PHE A 317      45.092 107.866 147.553  1.00  0.54           C  
ATOM   2406  O   PHE A 317      46.041 108.515 147.970  1.00  0.54           O  
ATOM   2407  CB  PHE A 317      43.265 106.962 148.989  1.00  0.54           C  
ATOM   2408  CG  PHE A 317      42.231 107.349 150.020  1.00  0.54           C  
ATOM   2409  CD1 PHE A 317      41.021 107.995 149.694  1.00  0.54           C  
ATOM   2410  CD2 PHE A 317      42.465 107.000 151.364  1.00  0.54           C  
ATOM   2411  CE1 PHE A 317      40.068 108.268 150.685  1.00  0.54           C  
ATOM   2412  CE2 PHE A 317      41.519 107.280 152.357  1.00  0.54           C  
ATOM   2413  CZ  PHE A 317      40.319 107.913 152.015  1.00  0.54           C  
ATOM   2414  N   GLY A 318      45.248 106.959 146.566  1.00  0.57           N  
ATOM   2415  CA  GLY A 318      46.557 106.529 146.086  1.00  0.57           C  
ATOM   2416  C   GLY A 318      47.307 107.560 145.297  1.00  0.57           C  
ATOM   2417  O   GLY A 318      48.531 107.595 145.309  1.00  0.57           O  
ATOM   2418  N   CYS A 319      46.587 108.444 144.593  1.00  0.48           N  
ATOM   2419  CA  CYS A 319      47.195 109.537 143.864  1.00  0.48           C  
ATOM   2420  C   CYS A 319      47.393 110.802 144.679  1.00  0.48           C  
ATOM   2421  O   CYS A 319      48.119 111.689 144.246  1.00  0.48           O  
ATOM   2422  CB  CYS A 319      46.318 109.941 142.651  1.00  0.48           C  
ATOM   2423  SG  CYS A 319      46.165 108.584 141.441  1.00  0.48           S  
ATOM   2424  N   ARG A 320      46.750 110.964 145.852  1.00  0.39           N  
ATOM   2425  CA  ARG A 320      46.921 112.176 146.643  1.00  0.39           C  
ATOM   2426  C   ARG A 320      47.750 111.950 147.882  1.00  0.39           C  
ATOM   2427  O   ARG A 320      48.121 112.912 148.552  1.00  0.39           O  
ATOM   2428  CB  ARG A 320      45.567 112.735 147.140  1.00  0.39           C  
ATOM   2429  CG  ARG A 320      44.659 113.261 146.018  1.00  0.39           C  
ATOM   2430  CD  ARG A 320      43.285 113.649 146.557  1.00  0.39           C  
ATOM   2431  NE  ARG A 320      42.483 114.118 145.385  1.00  0.39           N  
ATOM   2432  CZ  ARG A 320      41.299 114.732 145.490  1.00  0.39           C  
ATOM   2433  NH1 ARG A 320      40.739 115.265 144.406  1.00  0.39           N  
ATOM   2434  NH2 ARG A 320      40.672 114.821 146.656  1.00  0.39           N  
ATOM   2435  N   ASP A 321      48.047 110.690 148.233  1.00  0.47           N  
ATOM   2436  CA  ASP A 321      48.887 110.373 149.356  1.00  0.47           C  
ATOM   2437  C   ASP A 321      50.362 110.746 149.122  1.00  0.47           C  
ATOM   2438  O   ASP A 321      50.910 110.451 148.057  1.00  0.47           O  
ATOM   2439  CB  ASP A 321      48.694 108.889 149.729  1.00  0.47           C  
ATOM   2440  CG  ASP A 321      49.376 108.572 151.035  1.00  0.47           C  
ATOM   2441  OD1 ASP A 321      49.232 109.358 152.005  1.00  0.47           O  
ATOM   2442  OD2 ASP A 321      50.114 107.566 151.072  1.00  0.47           O  
ATOM   2443  N   PRO A 322      51.049 111.372 150.078  1.00  0.52           N  
ATOM   2444  CA  PRO A 322      52.470 111.627 149.935  1.00  0.52           C  
ATOM   2445  C   PRO A 322      53.206 110.749 150.919  1.00  0.52           C  
ATOM   2446  O   PRO A 322      54.418 110.899 151.073  1.00  0.52           O  
ATOM   2447  CB  PRO A 322      52.579 113.107 150.316  1.00  0.52           C  
ATOM   2448  CG  PRO A 322      51.536 113.287 151.427  1.00  0.52           C  
ATOM   2449  CD  PRO A 322      50.426 112.305 151.032  1.00  0.52           C  
ATOM   2450  N   VAL A 323      52.525 109.806 151.594  1.00  0.57           N  
ATOM   2451  CA  VAL A 323      53.179 108.826 152.432  1.00  0.57           C  
ATOM   2452  C   VAL A 323      53.783 107.746 151.553  1.00  0.57           C  
ATOM   2453  O   VAL A 323      53.141 107.155 150.695  1.00  0.57           O  
ATOM   2454  CB  VAL A 323      52.218 108.209 153.439  1.00  0.57           C  
ATOM   2455  CG1 VAL A 323      52.884 107.162 154.346  1.00  0.57           C  
ATOM   2456  CG2 VAL A 323      51.613 109.320 154.309  1.00  0.57           C  
ATOM   2457  N   ARG A 324      55.081 107.422 151.729  1.00  0.44           N  
ATOM   2458  CA  ARG A 324      55.727 106.448 150.861  1.00  0.44           C  
ATOM   2459  C   ARG A 324      55.178 105.039 151.065  1.00  0.44           C  
ATOM   2460  O   ARG A 324      55.263 104.193 150.184  1.00  0.44           O  
ATOM   2461  CB  ARG A 324      57.269 106.455 151.056  1.00  0.44           C  
ATOM   2462  CG  ARG A 324      57.960 107.740 150.542  1.00  0.44           C  
ATOM   2463  CD  ARG A 324      59.478 107.748 150.768  1.00  0.44           C  
ATOM   2464  NE  ARG A 324      60.023 109.022 150.188  1.00  0.44           N  
ATOM   2465  CZ  ARG A 324      61.303 109.407 150.300  1.00  0.44           C  
ATOM   2466  NH1 ARG A 324      61.702 110.549 149.745  1.00  0.44           N  
ATOM   2467  NH2 ARG A 324      62.191 108.668 150.958  1.00  0.44           N  
ATOM   2468  N   THR A 325      54.580 104.771 152.238  1.00  0.61           N  
ATOM   2469  CA  THR A 325      53.844 103.547 152.516  1.00  0.61           C  
ATOM   2470  C   THR A 325      52.505 103.391 151.787  1.00  0.61           C  
ATOM   2471  O   THR A 325      52.272 102.355 151.173  1.00  0.61           O  
ATOM   2472  CB  THR A 325      53.571 103.428 154.012  1.00  0.61           C  
ATOM   2473  OG1 THR A 325      54.780 103.594 154.739  1.00  0.61           O  
ATOM   2474  CG2 THR A 325      53.012 102.054 154.389  1.00  0.61           C  
ATOM   2475  N   ASN A 326      51.570 104.377 151.854  1.00  0.69           N  
ATOM   2476  CA  ASN A 326      50.249 104.470 151.223  1.00  0.69           C  
ATOM   2477  C   ASN A 326      49.252 103.378 151.672  1.00  0.69           C  
ATOM   2478  O   ASN A 326      48.083 103.622 151.890  1.00  0.69           O  
ATOM   2479  CB  ASN A 326      50.418 104.633 149.673  1.00  0.69           C  
ATOM   2480  CG  ASN A 326      49.127 104.922 148.902  1.00  0.69           C  
ATOM   2481  OD1 ASN A 326      48.088 105.322 149.418  1.00  0.69           O  
ATOM   2482  ND2 ASN A 326      49.152 104.678 147.567  1.00  0.69           N  
ATOM   2483  N   PHE A 327      49.650 102.132 151.965  1.00  0.82           N  
ATOM   2484  CA  PHE A 327      48.754 100.995 152.142  1.00  0.82           C  
ATOM   2485  C   PHE A 327      48.178 100.865 153.546  1.00  0.82           C  
ATOM   2486  O   PHE A 327      47.472  99.906 153.855  1.00  0.82           O  
ATOM   2487  CB  PHE A 327      49.523  99.679 151.833  1.00  0.82           C  
ATOM   2488  CG  PHE A 327      49.619  99.438 150.352  1.00  0.82           C  
ATOM   2489  CD1 PHE A 327      50.749  99.833 149.617  1.00  0.82           C  
ATOM   2490  CD2 PHE A 327      48.575  98.773 149.686  1.00  0.82           C  
ATOM   2491  CE1 PHE A 327      50.831  99.585 148.242  1.00  0.82           C  
ATOM   2492  CE2 PHE A 327      48.655  98.513 148.312  1.00  0.82           C  
ATOM   2493  CZ  PHE A 327      49.785  98.919 147.593  1.00  0.82           C  
ATOM   2494  N   ASP A 328      48.401 101.857 154.424  1.00  0.82           N  
ATOM   2495  CA  ASP A 328      47.817 101.941 155.751  1.00  0.82           C  
ATOM   2496  C   ASP A 328      46.295 102.033 155.710  1.00  0.82           C  
ATOM   2497  O   ASP A 328      45.620 101.436 156.545  1.00  0.82           O  
ATOM   2498  CB  ASP A 328      48.461 103.102 156.561  1.00  0.82           C  
ATOM   2499  CG  ASP A 328      49.756 102.599 157.184  1.00  0.82           C  
ATOM   2500  OD1 ASP A 328      50.477 101.829 156.500  1.00  0.82           O  
ATOM   2501  OD2 ASP A 328      49.995 102.837 158.404  1.00  0.82           O  
ATOM   2502  N   ALA A 329      45.723 102.714 154.694  1.00  0.84           N  
ATOM   2503  CA  ALA A 329      44.287 102.845 154.525  1.00  0.84           C  
ATOM   2504  C   ALA A 329      43.679 101.731 153.672  1.00  0.84           C  
ATOM   2505  O   ALA A 329      42.515 101.789 153.279  1.00  0.84           O  
ATOM   2506  CB  ALA A 329      43.996 104.196 153.836  1.00  0.84           C  
ATOM   2507  N   PHE A 330      44.439 100.663 153.352  1.00  0.88           N  
ATOM   2508  CA  PHE A 330      43.930  99.529 152.593  1.00  0.88           C  
ATOM   2509  C   PHE A 330      42.787  98.771 153.288  1.00  0.88           C  
ATOM   2510  O   PHE A 330      41.779  98.552 152.612  1.00  0.88           O  
ATOM   2511  CB  PHE A 330      45.113  98.610 152.161  1.00  0.88           C  
ATOM   2512  CG  PHE A 330      44.742  97.556 151.148  1.00  0.88           C  
ATOM   2513  CD1 PHE A 330      44.736  97.860 149.777  1.00  0.88           C  
ATOM   2514  CD2 PHE A 330      44.455  96.241 151.549  1.00  0.88           C  
ATOM   2515  CE1 PHE A 330      44.451  96.876 148.820  1.00  0.88           C  
ATOM   2516  CE2 PHE A 330      44.173  95.251 150.598  1.00  0.88           C  
ATOM   2517  CZ  PHE A 330      44.171  95.568 149.233  1.00  0.88           C  
ATOM   2518  N   PRO A 331      42.769  98.405 154.580  1.00  0.96           N  
ATOM   2519  CA  PRO A 331      41.646  97.663 155.153  1.00  0.96           C  
ATOM   2520  C   PRO A 331      40.431  98.529 155.376  1.00  0.96           C  
ATOM   2521  O   PRO A 331      39.368  98.002 155.693  1.00  0.96           O  
ATOM   2522  CB  PRO A 331      42.175  97.143 156.500  1.00  0.96           C  
ATOM   2523  CG  PRO A 331      43.695  97.170 156.342  1.00  0.96           C  
ATOM   2524  CD  PRO A 331      43.905  98.427 155.504  1.00  0.96           C  
ATOM   2525  N   ASP A 332      40.556  99.854 155.229  1.00  0.90           N  
ATOM   2526  CA  ASP A 332      39.460 100.778 155.389  1.00  0.90           C  
ATOM   2527  C   ASP A 332      38.834 101.095 154.035  1.00  0.90           C  
ATOM   2528  O   ASP A 332      37.757 101.679 153.947  1.00  0.90           O  
ATOM   2529  CB  ASP A 332      40.007 102.046 156.073  1.00  0.90           C  
ATOM   2530  CG  ASP A 332      40.560 101.612 157.420  1.00  0.90           C  
ATOM   2531  OD1 ASP A 332      39.747 101.158 158.264  1.00  0.90           O  
ATOM   2532  OD2 ASP A 332      41.806 101.664 157.583  1.00  0.90           O  
ATOM   2533  N   LYS A 333      39.462 100.643 152.928  1.00  0.88           N  
ATOM   2534  CA  LYS A 333      38.927 100.794 151.588  1.00  0.88           C  
ATOM   2535  C   LYS A 333      38.605  99.458 150.936  1.00  0.88           C  
ATOM   2536  O   LYS A 333      37.857  99.404 149.961  1.00  0.88           O  
ATOM   2537  CB  LYS A 333      39.947 101.544 150.691  1.00  0.88           C  
ATOM   2538  CG  LYS A 333      40.124 103.009 151.124  1.00  0.88           C  
ATOM   2539  CD  LYS A 333      40.764 103.921 150.071  1.00  0.88           C  
ATOM   2540  CE  LYS A 333      39.820 104.186 148.911  1.00  0.88           C  
ATOM   2541  NZ  LYS A 333      40.425 105.146 148.000  1.00  0.88           N  
ATOM   2542  N   VAL A 334      39.136  98.341 151.464  1.00  0.95           N  
ATOM   2543  CA  VAL A 334      39.009  97.020 150.870  1.00  0.95           C  
ATOM   2544  C   VAL A 334      38.579  96.003 151.920  1.00  0.95           C  
ATOM   2545  O   VAL A 334      39.183  95.877 152.981  1.00  0.95           O  
ATOM   2546  CB  VAL A 334      40.346  96.589 150.251  1.00  0.95           C  
ATOM   2547  CG1 VAL A 334      40.332  95.133 149.747  1.00  0.95           C  
ATOM   2548  CG2 VAL A 334      40.720  97.539 149.092  1.00  0.95           C  
ATOM   2549  N   ALA A 335      37.508  95.233 151.645  1.00  0.98           N  
ATOM   2550  CA  ALA A 335      37.169  94.029 152.380  1.00  0.98           C  
ATOM   2551  C   ALA A 335      37.130  92.872 151.399  1.00  0.98           C  
ATOM   2552  O   ALA A 335      36.524  92.977 150.335  1.00  0.98           O  
ATOM   2553  CB  ALA A 335      35.786  94.132 153.063  1.00  0.98           C  
ATOM   2554  N   ILE A 336      37.780  91.735 151.717  1.00  0.97           N  
ATOM   2555  CA  ILE A 336      37.744  90.549 150.866  1.00  0.97           C  
ATOM   2556  C   ILE A 336      37.149  89.392 151.647  1.00  0.97           C  
ATOM   2557  O   ILE A 336      37.682  88.946 152.661  1.00  0.97           O  
ATOM   2558  CB  ILE A 336      39.111  90.159 150.295  1.00  0.97           C  
ATOM   2559  CG1 ILE A 336      39.714  91.340 149.496  1.00  0.97           C  
ATOM   2560  CG2 ILE A 336      38.965  88.917 149.380  1.00  0.97           C  
ATOM   2561  CD1 ILE A 336      41.183  91.151 149.115  1.00  0.97           C  
ATOM   2562  N   GLN A 337      36.005  88.858 151.177  1.00  0.96           N  
ATOM   2563  CA  GLN A 337      35.362  87.719 151.801  1.00  0.96           C  
ATOM   2564  C   GLN A 337      35.755  86.446 151.080  1.00  0.96           C  
ATOM   2565  O   GLN A 337      35.515  86.281 149.883  1.00  0.96           O  
ATOM   2566  CB  GLN A 337      33.817  87.846 151.781  1.00  0.96           C  
ATOM   2567  CG  GLN A 337      33.071  86.834 152.693  1.00  0.96           C  
ATOM   2568  CD  GLN A 337      33.280  87.136 154.179  1.00  0.96           C  
ATOM   2569  OE1 GLN A 337      33.363  88.293 154.591  1.00  0.96           O  
ATOM   2570  NE2 GLN A 337      33.323  86.079 155.015  1.00  0.96           N  
ATOM   2571  N   LEU A 338      36.368  85.502 151.813  1.00  0.97           N  
ATOM   2572  CA  LEU A 338      36.710  84.188 151.320  1.00  0.97           C  
ATOM   2573  C   LEU A 338      35.486  83.299 151.403  1.00  0.97           C  
ATOM   2574  O   LEU A 338      34.981  82.971 152.479  1.00  0.97           O  
ATOM   2575  CB  LEU A 338      37.861  83.533 152.142  1.00  0.97           C  
ATOM   2576  CG  LEU A 338      39.317  83.945 151.793  1.00  0.97           C  
ATOM   2577  CD1 LEU A 338      39.453  85.147 150.843  1.00  0.97           C  
ATOM   2578  CD2 LEU A 338      40.116  84.206 153.080  1.00  0.97           C  
ATOM   2579  N   ASN A 339      34.980  82.875 150.230  1.00  0.93           N  
ATOM   2580  CA  ASN A 339      33.896  81.928 150.142  1.00  0.93           C  
ATOM   2581  C   ASN A 339      34.475  80.514 150.214  1.00  0.93           C  
ATOM   2582  O   ASN A 339      35.088  80.031 149.265  1.00  0.93           O  
ATOM   2583  CB  ASN A 339      33.102  82.184 148.826  1.00  0.93           C  
ATOM   2584  CG  ASN A 339      31.669  81.658 148.786  1.00  0.93           C  
ATOM   2585  OD1 ASN A 339      31.034  81.599 147.734  1.00  0.93           O  
ATOM   2586  ND2 ASN A 339      31.074  81.330 149.949  1.00  0.93           N  
ATOM   2587  N   ASP A 340      34.303  79.855 151.379  1.00  0.91           N  
ATOM   2588  CA  ASP A 340      34.956  78.612 151.772  1.00  0.91           C  
ATOM   2589  C   ASP A 340      36.498  78.651 151.799  1.00  0.91           C  
ATOM   2590  O   ASP A 340      37.111  79.720 151.804  1.00  0.91           O  
ATOM   2591  CB  ASP A 340      34.372  77.413 150.974  1.00  0.91           C  
ATOM   2592  CG  ASP A 340      34.194  76.208 151.881  1.00  0.91           C  
ATOM   2593  OD1 ASP A 340      35.229  75.649 152.312  1.00  0.91           O  
ATOM   2594  OD2 ASP A 340      33.032  75.873 152.218  1.00  0.91           O  
ATOM   2595  N   THR A 341      37.181  77.488 151.866  1.00  0.92           N  
ATOM   2596  CA  THR A 341      38.659  77.455 151.843  1.00  0.92           C  
ATOM   2597  C   THR A 341      39.265  77.582 150.488  1.00  0.92           C  
ATOM   2598  O   THR A 341      40.471  77.772 150.373  1.00  0.92           O  
ATOM   2599  CB  THR A 341      39.387  76.359 152.512  1.00  0.92           C  
ATOM   2600  OG1 THR A 341      38.981  75.197 151.939  1.00  0.92           O  
ATOM   2601  CG2 THR A 341      38.901  76.327 154.005  1.00  0.92           C  
ATOM   2602  N   HIS A 342      38.436  77.521 149.447  1.00  0.91           N  
ATOM   2603  CA  HIS A 342      38.864  77.544 148.065  1.00  0.91           C  
ATOM   2604  C   HIS A 342      39.689  78.770 147.657  1.00  0.91           C  
ATOM   2605  O   HIS A 342      40.558  78.606 146.807  1.00  0.91           O  
ATOM   2606  CB  HIS A 342      37.654  77.397 147.116  1.00  0.91           C  
ATOM   2607  CG  HIS A 342      36.728  76.266 147.452  1.00  0.91           C  
ATOM   2608  ND1 HIS A 342      35.500  76.206 146.817  1.00  0.91           N  
ATOM   2609  CD2 HIS A 342      36.818  75.280 148.379  1.00  0.91           C  
ATOM   2610  CE1 HIS A 342      34.866  75.197 147.393  1.00  0.91           C  
ATOM   2611  NE2 HIS A 342      35.624  74.605 148.340  1.00  0.91           N  
ATOM   2612  N   PRO A 343      39.560  80.011 148.155  1.00  0.98           N  
ATOM   2613  CA  PRO A 343      40.484  81.059 147.740  1.00  0.98           C  
ATOM   2614  C   PRO A 343      41.390  81.408 148.904  1.00  0.98           C  
ATOM   2615  O   PRO A 343      41.857  82.541 148.996  1.00  0.98           O  
ATOM   2616  CB  PRO A 343      39.530  82.194 147.358  1.00  0.98           C  
ATOM   2617  CG  PRO A 343      38.366  82.077 148.346  1.00  0.98           C  
ATOM   2618  CD  PRO A 343      38.307  80.580 148.676  1.00  0.98           C  
ATOM   2619  N   SER A 344      41.736  80.425 149.764  1.00  0.96           N  
ATOM   2620  CA  SER A 344      42.616  80.573 150.931  1.00  0.96           C  
ATOM   2621  C   SER A 344      43.993  81.111 150.578  1.00  0.96           C  
ATOM   2622  O   SER A 344      44.574  81.922 151.301  1.00  0.96           O  
ATOM   2623  CB  SER A 344      42.758  79.221 151.687  1.00  0.96           C  
ATOM   2624  OG  SER A 344      43.573  79.298 152.859  1.00  0.96           O  
ATOM   2625  N   LEU A 345      44.522  80.743 149.390  1.00  0.96           N  
ATOM   2626  CA  LEU A 345      45.759  81.279 148.838  1.00  0.96           C  
ATOM   2627  C   LEU A 345      45.813  82.798 148.663  1.00  0.96           C  
ATOM   2628  O   LEU A 345      46.888  83.356 148.449  1.00  0.96           O  
ATOM   2629  CB  LEU A 345      46.088  80.608 147.482  1.00  0.96           C  
ATOM   2630  CG  LEU A 345      46.551  79.144 147.621  1.00  0.96           C  
ATOM   2631  CD1 LEU A 345      46.559  78.456 146.251  1.00  0.96           C  
ATOM   2632  CD2 LEU A 345      47.947  79.043 148.261  1.00  0.96           C  
ATOM   2633  N   ALA A 346      44.684  83.524 148.824  1.00  0.98           N  
ATOM   2634  CA  ALA A 346      44.652  84.970 148.881  1.00  0.98           C  
ATOM   2635  C   ALA A 346      45.492  85.550 150.010  1.00  0.98           C  
ATOM   2636  O   ALA A 346      46.183  86.545 149.830  1.00  0.98           O  
ATOM   2637  CB  ALA A 346      43.197  85.453 149.034  1.00  0.98           C  
ATOM   2638  N   ILE A 347      45.481  84.923 151.200  1.00  0.96           N  
ATOM   2639  CA  ILE A 347      46.262  85.349 152.357  1.00  0.96           C  
ATOM   2640  C   ILE A 347      47.776  85.319 152.118  1.00  0.96           C  
ATOM   2641  O   ILE A 347      48.405  86.356 152.347  1.00  0.96           O  
ATOM   2642  CB  ILE A 347      45.844  84.544 153.589  1.00  0.96           C  
ATOM   2643  CG1 ILE A 347      44.381  84.892 153.954  1.00  0.96           C  
ATOM   2644  CG2 ILE A 347      46.777  84.783 154.803  1.00  0.96           C  
ATOM   2645  CD1 ILE A 347      43.685  83.760 154.709  1.00  0.96           C  
ATOM   2646  N   PRO A 348      48.450  84.277 151.604  1.00  0.98           N  
ATOM   2647  CA  PRO A 348      49.868  84.385 151.293  1.00  0.98           C  
ATOM   2648  C   PRO A 348      50.125  85.197 150.039  1.00  0.98           C  
ATOM   2649  O   PRO A 348      51.197  85.787 149.953  1.00  0.98           O  
ATOM   2650  CB  PRO A 348      50.353  82.931 151.161  1.00  0.98           C  
ATOM   2651  CG  PRO A 348      49.091  82.135 150.824  1.00  0.98           C  
ATOM   2652  CD  PRO A 348      48.006  82.879 151.607  1.00  0.98           C  
ATOM   2653  N   GLU A 349      49.205  85.254 149.054  1.00  0.95           N  
ATOM   2654  CA  GLU A 349      49.366  86.117 147.891  1.00  0.95           C  
ATOM   2655  C   GLU A 349      49.343  87.604 148.229  1.00  0.95           C  
ATOM   2656  O   GLU A 349      50.177  88.377 147.759  1.00  0.95           O  
ATOM   2657  CB  GLU A 349      48.319  85.778 146.800  1.00  0.95           C  
ATOM   2658  CG  GLU A 349      48.372  86.648 145.508  1.00  0.95           C  
ATOM   2659  CD  GLU A 349      49.685  86.614 144.736  1.00  0.95           C  
ATOM   2660  OE1 GLU A 349      50.615  85.858 145.111  1.00  0.95           O  
ATOM   2661  OE2 GLU A 349      49.826  87.378 143.746  1.00  0.95           O  
ATOM   2662  N   LEU A 350      48.432  88.055 149.120  1.00  0.96           N  
ATOM   2663  CA  LEU A 350      48.383  89.438 149.573  1.00  0.96           C  
ATOM   2664  C   LEU A 350      49.667  89.822 150.305  1.00  0.96           C  
ATOM   2665  O   LEU A 350      50.281  90.850 150.033  1.00  0.96           O  
ATOM   2666  CB  LEU A 350      47.133  89.688 150.472  1.00  0.96           C  
ATOM   2667  CG  LEU A 350      46.404  91.055 150.338  1.00  0.96           C  
ATOM   2668  CD1 LEU A 350      46.061  91.630 151.719  1.00  0.96           C  
ATOM   2669  CD2 LEU A 350      47.127  92.124 149.507  1.00  0.96           C  
ATOM   2670  N   MET A 351      50.167  88.923 151.178  1.00  0.93           N  
ATOM   2671  CA  MET A 351      51.472  89.040 151.808  1.00  0.93           C  
ATOM   2672  C   MET A 351      52.638  89.082 150.828  1.00  0.93           C  
ATOM   2673  O   MET A 351      53.546  89.897 150.979  1.00  0.93           O  
ATOM   2674  CB  MET A 351      51.707  87.853 152.774  1.00  0.93           C  
ATOM   2675  CG  MET A 351      50.832  87.908 154.037  1.00  0.93           C  
ATOM   2676  SD  MET A 351      51.166  89.351 155.080  1.00  0.93           S  
ATOM   2677  CE  MET A 351      52.758  88.819 155.772  1.00  0.93           C  
ATOM   2678  N   ARG A 352      52.637  88.236 149.778  1.00  0.90           N  
ATOM   2679  CA  ARG A 352      53.646  88.249 148.731  1.00  0.90           C  
ATOM   2680  C   ARG A 352      53.702  89.572 147.979  1.00  0.90           C  
ATOM   2681  O   ARG A 352      54.771  90.125 147.741  1.00  0.90           O  
ATOM   2682  CB  ARG A 352      53.382  87.116 147.707  1.00  0.90           C  
ATOM   2683  CG  ARG A 352      54.537  86.890 146.710  1.00  0.90           C  
ATOM   2684  CD  ARG A 352      54.230  85.850 145.627  1.00  0.90           C  
ATOM   2685  NE  ARG A 352      53.173  86.405 144.721  1.00  0.90           N  
ATOM   2686  CZ  ARG A 352      53.365  87.263 143.714  1.00  0.90           C  
ATOM   2687  NH1 ARG A 352      54.564  87.753 143.417  1.00  0.90           N  
ATOM   2688  NH2 ARG A 352      52.325  87.643 142.981  1.00  0.90           N  
ATOM   2689  N   ILE A 353      52.545  90.152 147.603  1.00  0.92           N  
ATOM   2690  CA  ILE A 353      52.508  91.456 146.951  1.00  0.92           C  
ATOM   2691  C   ILE A 353      52.970  92.575 147.879  1.00  0.92           C  
ATOM   2692  O   ILE A 353      53.778  93.421 147.494  1.00  0.92           O  
ATOM   2693  CB  ILE A 353      51.139  91.775 146.352  1.00  0.92           C  
ATOM   2694  CG1 ILE A 353      50.713  90.670 145.353  1.00  0.92           C  
ATOM   2695  CG2 ILE A 353      51.188  93.152 145.645  1.00  0.92           C  
ATOM   2696  CD1 ILE A 353      49.218  90.700 145.018  1.00  0.92           C  
ATOM   2697  N   LEU A 354      52.516  92.583 149.151  1.00  0.89           N  
ATOM   2698  CA  LEU A 354      52.930  93.576 150.131  1.00  0.89           C  
ATOM   2699  C   LEU A 354      54.424  93.541 150.445  1.00  0.89           C  
ATOM   2700  O   LEU A 354      55.080  94.579 150.478  1.00  0.89           O  
ATOM   2701  CB  LEU A 354      52.148  93.415 151.466  1.00  0.89           C  
ATOM   2702  CG  LEU A 354      50.634  93.711 151.368  1.00  0.89           C  
ATOM   2703  CD1 LEU A 354      49.880  93.195 152.605  1.00  0.89           C  
ATOM   2704  CD2 LEU A 354      50.324  95.195 151.133  1.00  0.89           C  
ATOM   2705  N   VAL A 355      55.008  92.347 150.669  1.00  0.87           N  
ATOM   2706  CA  VAL A 355      56.413  92.217 151.043  1.00  0.87           C  
ATOM   2707  C   VAL A 355      57.354  92.233 149.843  1.00  0.87           C  
ATOM   2708  O   VAL A 355      58.313  93.003 149.804  1.00  0.87           O  
ATOM   2709  CB  VAL A 355      56.650  90.950 151.874  1.00  0.87           C  
ATOM   2710  CG1 VAL A 355      58.135  90.804 152.274  1.00  0.87           C  
ATOM   2711  CG2 VAL A 355      55.787  91.019 153.152  1.00  0.87           C  
ATOM   2712  N   ASP A 356      57.123  91.396 148.812  1.00  0.89           N  
ATOM   2713  CA  ASP A 356      58.084  91.227 147.733  1.00  0.89           C  
ATOM   2714  C   ASP A 356      58.025  92.348 146.696  1.00  0.89           C  
ATOM   2715  O   ASP A 356      59.052  92.816 146.194  1.00  0.89           O  
ATOM   2716  CB  ASP A 356      57.902  89.855 147.021  1.00  0.89           C  
ATOM   2717  CG  ASP A 356      58.072  88.675 147.963  1.00  0.89           C  
ATOM   2718  OD1 ASP A 356      58.605  88.830 149.091  1.00  0.89           O  
ATOM   2719  OD2 ASP A 356      57.687  87.540 147.572  1.00  0.89           O  
ATOM   2720  N   LEU A 357      56.805  92.797 146.325  1.00  0.85           N  
ATOM   2721  CA  LEU A 357      56.627  93.819 145.306  1.00  0.85           C  
ATOM   2722  C   LEU A 357      56.586  95.231 145.869  1.00  0.85           C  
ATOM   2723  O   LEU A 357      57.360  96.085 145.440  1.00  0.85           O  
ATOM   2724  CB  LEU A 357      55.345  93.561 144.470  1.00  0.85           C  
ATOM   2725  CG  LEU A 357      55.385  92.269 143.624  1.00  0.85           C  
ATOM   2726  CD1 LEU A 357      54.043  92.049 142.911  1.00  0.85           C  
ATOM   2727  CD2 LEU A 357      56.512  92.309 142.581  1.00  0.85           C  
ATOM   2728  N   GLU A 358      55.719  95.518 146.863  1.00  0.79           N  
ATOM   2729  CA  GLU A 358      55.512  96.886 147.335  1.00  0.79           C  
ATOM   2730  C   GLU A 358      56.457  97.236 148.487  1.00  0.79           C  
ATOM   2731  O   GLU A 358      56.491  98.367 148.966  1.00  0.79           O  
ATOM   2732  CB  GLU A 358      54.053  97.088 147.829  1.00  0.79           C  
ATOM   2733  CG  GLU A 358      52.935  96.782 146.788  1.00  0.79           C  
ATOM   2734  CD  GLU A 358      52.698  97.815 145.704  1.00  0.79           C  
ATOM   2735  OE1 GLU A 358      51.792  97.598 144.850  1.00  0.79           O  
ATOM   2736  OE2 GLU A 358      53.353  98.885 145.670  1.00  0.79           O  
ATOM   2737  N   ARG A 359      57.282  96.260 148.922  1.00  0.75           N  
ATOM   2738  CA  ARG A 359      58.372  96.397 149.880  1.00  0.75           C  
ATOM   2739  C   ARG A 359      57.981  96.850 151.280  1.00  0.75           C  
ATOM   2740  O   ARG A 359      58.647  97.678 151.899  1.00  0.75           O  
ATOM   2741  CB  ARG A 359      59.537  97.269 149.339  1.00  0.75           C  
ATOM   2742  CG  ARG A 359      60.175  96.729 148.046  1.00  0.75           C  
ATOM   2743  CD  ARG A 359      61.340  97.600 147.573  1.00  0.75           C  
ATOM   2744  NE  ARG A 359      61.846  96.990 146.304  1.00  0.75           N  
ATOM   2745  CZ  ARG A 359      62.904  97.450 145.622  1.00  0.75           C  
ATOM   2746  NH1 ARG A 359      63.235  96.879 144.467  1.00  0.75           N  
ATOM   2747  NH2 ARG A 359      63.619  98.482 146.060  1.00  0.75           N  
ATOM   2748  N   MET A 360      56.908  96.275 151.841  1.00  0.78           N  
ATOM   2749  CA  MET A 360      56.480  96.559 153.191  1.00  0.78           C  
ATOM   2750  C   MET A 360      56.958  95.478 154.141  1.00  0.78           C  
ATOM   2751  O   MET A 360      56.882  94.289 153.842  1.00  0.78           O  
ATOM   2752  CB  MET A 360      54.937  96.617 153.271  1.00  0.78           C  
ATOM   2753  CG  MET A 360      54.315  97.766 152.460  1.00  0.78           C  
ATOM   2754  SD  MET A 360      52.503  97.728 152.466  1.00  0.78           S  
ATOM   2755  CE  MET A 360      52.184  98.072 154.222  1.00  0.78           C  
ATOM   2756  N   ASP A 361      57.442  95.858 155.340  1.00  0.79           N  
ATOM   2757  CA  ASP A 361      57.828  94.936 156.388  1.00  0.79           C  
ATOM   2758  C   ASP A 361      56.749  93.933 156.780  1.00  0.79           C  
ATOM   2759  O   ASP A 361      55.548  94.211 156.741  1.00  0.79           O  
ATOM   2760  CB  ASP A 361      58.243  95.698 157.667  1.00  0.79           C  
ATOM   2761  CG  ASP A 361      59.440  96.584 157.385  1.00  0.79           C  
ATOM   2762  OD1 ASP A 361      60.344  96.130 156.644  1.00  0.79           O  
ATOM   2763  OD2 ASP A 361      59.446  97.721 157.914  1.00  0.79           O  
ATOM   2764  N   TRP A 362      57.178  92.718 157.185  1.00  0.83           N  
ATOM   2765  CA  TRP A 362      56.308  91.578 157.425  1.00  0.83           C  
ATOM   2766  C   TRP A 362      55.206  91.854 158.440  1.00  0.83           C  
ATOM   2767  O   TRP A 362      54.042  91.549 158.188  1.00  0.83           O  
ATOM   2768  CB  TRP A 362      57.162  90.368 157.914  1.00  0.83           C  
ATOM   2769  CG  TRP A 362      56.366  89.136 158.326  1.00  0.83           C  
ATOM   2770  CD1 TRP A 362      55.740  88.891 159.519  1.00  0.83           C  
ATOM   2771  CD2 TRP A 362      55.997  88.047 157.457  1.00  0.83           C  
ATOM   2772  NE1 TRP A 362      55.032  87.707 159.470  1.00  0.83           N  
ATOM   2773  CE2 TRP A 362      55.188  87.183 158.202  1.00  0.83           C  
ATOM   2774  CE3 TRP A 362      56.303  87.795 156.117  1.00  0.83           C  
ATOM   2775  CZ2 TRP A 362      54.659  86.023 157.643  1.00  0.83           C  
ATOM   2776  CZ3 TRP A 362      55.770  86.626 155.546  1.00  0.83           C  
ATOM   2777  CH2 TRP A 362      54.966  85.755 156.297  1.00  0.83           C  
ATOM   2778  N   ASP A 363      55.543  92.458 159.596  1.00  0.85           N  
ATOM   2779  CA  ASP A 363      54.584  92.755 160.643  1.00  0.85           C  
ATOM   2780  C   ASP A 363      53.499  93.728 160.184  1.00  0.85           C  
ATOM   2781  O   ASP A 363      52.310  93.471 160.349  1.00  0.85           O  
ATOM   2782  CB  ASP A 363      55.330  93.287 161.897  1.00  0.85           C  
ATOM   2783  CG  ASP A 363      56.086  92.175 162.588  1.00  0.85           C  
ATOM   2784  OD1 ASP A 363      55.634  91.008 162.492  1.00  0.85           O  
ATOM   2785  OD2 ASP A 363      57.131  92.426 163.226  1.00  0.85           O  
ATOM   2786  N   LYS A 364      53.873  94.824 159.486  1.00  0.79           N  
ATOM   2787  CA  LYS A 364      52.906  95.738 158.894  1.00  0.79           C  
ATOM   2788  C   LYS A 364      52.038  95.100 157.811  1.00  0.79           C  
ATOM   2789  O   LYS A 364      50.829  95.330 157.735  1.00  0.79           O  
ATOM   2790  CB  LYS A 364      53.591  97.000 158.302  1.00  0.79           C  
ATOM   2791  CG  LYS A 364      52.598  98.121 157.942  1.00  0.79           C  
ATOM   2792  CD  LYS A 364      51.924  98.751 159.176  1.00  0.79           C  
ATOM   2793  CE  LYS A 364      50.978  99.878 158.765  1.00  0.79           C  
ATOM   2794  NZ  LYS A 364      50.420 100.621 159.914  1.00  0.79           N  
ATOM   2795  N   ALA A 365      52.634  94.258 156.942  1.00  0.90           N  
ATOM   2796  CA  ALA A 365      51.915  93.498 155.943  1.00  0.90           C  
ATOM   2797  C   ALA A 365      50.895  92.526 156.539  1.00  0.90           C  
ATOM   2798  O   ALA A 365      49.761  92.426 156.071  1.00  0.90           O  
ATOM   2799  CB  ALA A 365      52.928  92.728 155.071  1.00  0.90           C  
ATOM   2800  N   TRP A 366      51.264  91.804 157.615  1.00  0.87           N  
ATOM   2801  CA  TRP A 366      50.397  90.887 158.335  1.00  0.87           C  
ATOM   2802  C   TRP A 366      49.227  91.582 159.020  1.00  0.87           C  
ATOM   2803  O   TRP A 366      48.082  91.145 158.881  1.00  0.87           O  
ATOM   2804  CB  TRP A 366      51.239  90.043 159.327  1.00  0.87           C  
ATOM   2805  CG  TRP A 366      50.504  88.930 160.058  1.00  0.87           C  
ATOM   2806  CD1 TRP A 366      50.304  88.803 161.404  1.00  0.87           C  
ATOM   2807  CD2 TRP A 366      49.850  87.790 159.451  1.00  0.87           C  
ATOM   2808  NE1 TRP A 366      49.583  87.657 161.688  1.00  0.87           N  
ATOM   2809  CE2 TRP A 366      49.292  87.033 160.490  1.00  0.87           C  
ATOM   2810  CE3 TRP A 366      49.715  87.399 158.116  1.00  0.87           C  
ATOM   2811  CZ2 TRP A 366      48.579  85.863 160.233  1.00  0.87           C  
ATOM   2812  CZ3 TRP A 366      48.978  86.233 157.850  1.00  0.87           C  
ATOM   2813  CH2 TRP A 366      48.423  85.475 158.890  1.00  0.87           C  
ATOM   2814  N   ASP A 367      49.462  92.738 159.682  1.00  0.89           N  
ATOM   2815  CA  ASP A 367      48.414  93.579 160.234  1.00  0.89           C  
ATOM   2816  C   ASP A 367      47.394  94.006 159.183  1.00  0.89           C  
ATOM   2817  O   ASP A 367      46.182  94.015 159.413  1.00  0.89           O  
ATOM   2818  CB  ASP A 367      48.999  94.912 160.777  1.00  0.89           C  
ATOM   2819  CG  ASP A 367      49.821  94.764 162.045  1.00  0.89           C  
ATOM   2820  OD1 ASP A 367      49.787  93.687 162.683  1.00  0.89           O  
ATOM   2821  OD2 ASP A 367      50.435  95.807 162.400  1.00  0.89           O  
ATOM   2822  N   VAL A 368      47.850  94.421 157.984  1.00  0.92           N  
ATOM   2823  CA  VAL A 368      46.964  94.778 156.882  1.00  0.92           C  
ATOM   2824  C   VAL A 368      46.185  93.582 156.351  1.00  0.92           C  
ATOM   2825  O   VAL A 368      44.970  93.660 156.192  1.00  0.92           O  
ATOM   2826  CB  VAL A 368      47.720  95.491 155.762  1.00  0.92           C  
ATOM   2827  CG1 VAL A 368      46.842  95.708 154.511  1.00  0.92           C  
ATOM   2828  CG2 VAL A 368      48.206  96.863 156.278  1.00  0.92           C  
ATOM   2829  N   THR A 369      46.840  92.427 156.127  1.00  0.94           N  
ATOM   2830  CA  THR A 369      46.218  91.200 155.622  1.00  0.94           C  
ATOM   2831  C   THR A 369      45.114  90.674 156.514  1.00  0.94           C  
ATOM   2832  O   THR A 369      44.022  90.376 156.030  1.00  0.94           O  
ATOM   2833  CB  THR A 369      47.252  90.099 155.408  1.00  0.94           C  
ATOM   2834  OG1 THR A 369      48.131  90.488 154.364  1.00  0.94           O  
ATOM   2835  CG2 THR A 369      46.629  88.774 154.944  1.00  0.94           C  
ATOM   2836  N   VAL A 370      45.329  90.622 157.848  1.00  0.94           N  
ATOM   2837  CA  VAL A 370      44.322  90.164 158.802  1.00  0.94           C  
ATOM   2838  C   VAL A 370      43.066  91.023 158.784  1.00  0.94           C  
ATOM   2839  O   VAL A 370      41.956  90.512 158.824  1.00  0.94           O  
ATOM   2840  CB  VAL A 370      44.892  90.068 160.222  1.00  0.94           C  
ATOM   2841  CG1 VAL A 370      43.808  89.747 161.277  1.00  0.94           C  
ATOM   2842  CG2 VAL A 370      45.962  88.957 160.259  1.00  0.94           C  
ATOM   2843  N   ARG A 371      43.196  92.360 158.689  1.00  0.89           N  
ATOM   2844  CA  ARG A 371      42.048  93.253 158.686  1.00  0.89           C  
ATOM   2845  C   ARG A 371      41.319  93.335 157.340  1.00  0.89           C  
ATOM   2846  O   ARG A 371      40.182  93.794 157.257  1.00  0.89           O  
ATOM   2847  CB  ARG A 371      42.518  94.670 159.105  1.00  0.89           C  
ATOM   2848  CG  ARG A 371      43.008  94.753 160.567  1.00  0.89           C  
ATOM   2849  CD  ARG A 371      43.540  96.137 160.966  1.00  0.89           C  
ATOM   2850  NE  ARG A 371      44.860  96.300 160.286  1.00  0.89           N  
ATOM   2851  CZ  ARG A 371      45.477  97.465 160.064  1.00  0.89           C  
ATOM   2852  NH1 ARG A 371      46.600  97.473 159.351  1.00  0.89           N  
ATOM   2853  NH2 ARG A 371      44.994  98.617 160.514  1.00  0.89           N  
ATOM   2854  N   THR A 372      41.968  92.912 156.240  1.00  0.96           N  
ATOM   2855  CA  THR A 372      41.371  92.820 154.909  1.00  0.96           C  
ATOM   2856  C   THR A 372      40.445  91.629 154.751  1.00  0.96           C  
ATOM   2857  O   THR A 372      39.391  91.715 154.114  1.00  0.96           O  
ATOM   2858  CB  THR A 372      42.439  92.699 153.826  1.00  0.96           C  
ATOM   2859  OG1 THR A 372      43.256  93.860 153.817  1.00  0.96           O  
ATOM   2860  CG2 THR A 372      41.833  92.636 152.420  1.00  0.96           C  
ATOM   2861  N   CYS A 373      40.846  90.461 155.284  1.00  0.97           N  
ATOM   2862  CA  CYS A 373      40.226  89.192 154.951  1.00  0.97           C  
ATOM   2863  C   CYS A 373      39.229  88.711 155.986  1.00  0.97           C  
ATOM   2864  O   CYS A 373      39.397  88.852 157.195  1.00  0.97           O  
ATOM   2865  CB  CYS A 373      41.278  88.071 154.723  1.00  0.97           C  
ATOM   2866  SG  CYS A 373      42.231  88.326 153.182  1.00  0.97           S  
ATOM   2867  N   ALA A 374      38.152  88.069 155.507  1.00  0.98           N  
ATOM   2868  CA  ALA A 374      37.202  87.392 156.355  1.00  0.98           C  
ATOM   2869  C   ALA A 374      36.813  86.063 155.720  1.00  0.98           C  
ATOM   2870  O   ALA A 374      36.776  85.930 154.500  1.00  0.98           O  
ATOM   2871  CB  ALA A 374      35.973  88.282 156.591  1.00  0.98           C  
ATOM   2872  N   TYR A 375      36.550  85.022 156.538  1.00  0.96           N  
ATOM   2873  CA  TYR A 375      36.375  83.649 156.073  1.00  0.96           C  
ATOM   2874  C   TYR A 375      34.995  83.086 156.400  1.00  0.96           C  
ATOM   2875  O   TYR A 375      34.568  83.010 157.551  1.00  0.96           O  
ATOM   2876  CB  TYR A 375      37.528  82.766 156.665  1.00  0.96           C  
ATOM   2877  CG  TYR A 375      37.345  81.251 156.660  1.00  0.96           C  
ATOM   2878  CD1 TYR A 375      37.063  80.537 155.480  1.00  0.96           C  
ATOM   2879  CD2 TYR A 375      37.546  80.521 157.850  1.00  0.96           C  
ATOM   2880  CE1 TYR A 375      36.939  79.139 155.507  1.00  0.96           C  
ATOM   2881  CE2 TYR A 375      37.420  79.123 157.877  1.00  0.96           C  
ATOM   2882  CZ  TYR A 375      37.095  78.437 156.705  1.00  0.96           C  
ATOM   2883  OH  TYR A 375      36.977  77.037 156.698  1.00  0.96           O  
ATOM   2884  N   THR A 376      34.274  82.621 155.357  1.00  0.96           N  
ATOM   2885  CA  THR A 376      32.988  81.950 155.519  1.00  0.96           C  
ATOM   2886  C   THR A 376      33.174  80.454 155.384  1.00  0.96           C  
ATOM   2887  O   THR A 376      33.509  79.954 154.316  1.00  0.96           O  
ATOM   2888  CB  THR A 376      31.924  82.347 154.498  1.00  0.96           C  
ATOM   2889  OG1 THR A 376      31.724  83.750 154.465  1.00  0.96           O  
ATOM   2890  CG2 THR A 376      30.572  81.730 154.872  1.00  0.96           C  
ATOM   2891  N   ASN A 377      32.931  79.691 156.463  1.00  0.89           N  
ATOM   2892  CA  ASN A 377      33.061  78.246 156.483  1.00  0.89           C  
ATOM   2893  C   ASN A 377      31.707  77.597 156.191  1.00  0.89           C  
ATOM   2894  O   ASN A 377      30.747  77.842 156.915  1.00  0.89           O  
ATOM   2895  CB  ASN A 377      33.587  77.862 157.895  1.00  0.89           C  
ATOM   2896  CG  ASN A 377      33.957  76.395 158.066  1.00  0.89           C  
ATOM   2897  OD1 ASN A 377      35.126  76.066 158.243  1.00  0.89           O  
ATOM   2898  ND2 ASN A 377      32.967  75.487 158.046  1.00  0.89           N  
ATOM   2899  N   HIS A 378      31.590  76.726 155.160  1.00  0.89           N  
ATOM   2900  CA  HIS A 378      30.322  76.069 154.829  1.00  0.89           C  
ATOM   2901  C   HIS A 378      30.323  74.591 155.151  1.00  0.89           C  
ATOM   2902  O   HIS A 378      29.307  73.914 155.034  1.00  0.89           O  
ATOM   2903  CB  HIS A 378      30.028  76.138 153.313  1.00  0.89           C  
ATOM   2904  CG  HIS A 378      30.049  77.540 152.823  1.00  0.89           C  
ATOM   2905  ND1 HIS A 378      28.870  78.256 152.743  1.00  0.89           N  
ATOM   2906  CD2 HIS A 378      31.110  78.348 152.589  1.00  0.89           C  
ATOM   2907  CE1 HIS A 378      29.238  79.484 152.463  1.00  0.89           C  
ATOM   2908  NE2 HIS A 378      30.581  79.593 152.367  1.00  0.89           N  
ATOM   2909  N   THR A 379      31.469  74.033 155.554  1.00  0.81           N  
ATOM   2910  CA  THR A 379      31.661  72.596 155.658  1.00  0.81           C  
ATOM   2911  C   THR A 379      31.443  72.061 157.057  1.00  0.81           C  
ATOM   2912  O   THR A 379      31.535  72.775 158.057  1.00  0.81           O  
ATOM   2913  CB  THR A 379      33.047  72.182 155.180  1.00  0.81           C  
ATOM   2914  OG1 THR A 379      34.054  72.964 155.803  1.00  0.81           O  
ATOM   2915  CG2 THR A 379      33.145  72.456 153.676  1.00  0.81           C  
ATOM   2916  N   VAL A 380      31.110  70.755 157.148  1.00  0.79           N  
ATOM   2917  CA  VAL A 380      31.055  70.031 158.417  1.00  0.79           C  
ATOM   2918  C   VAL A 380      31.820  68.720 158.298  1.00  0.79           C  
ATOM   2919  O   VAL A 380      32.508  68.280 159.215  1.00  0.79           O  
ATOM   2920  CB  VAL A 380      29.624  69.681 158.848  1.00  0.79           C  
ATOM   2921  CG1 VAL A 380      29.631  69.348 160.354  1.00  0.79           C  
ATOM   2922  CG2 VAL A 380      28.661  70.852 158.575  1.00  0.79           C  
ATOM   2923  N   LEU A 381      31.719  68.055 157.129  1.00  0.82           N  
ATOM   2924  CA  LEU A 381      32.328  66.770 156.850  1.00  0.82           C  
ATOM   2925  C   LEU A 381      33.866  66.765 156.782  1.00  0.82           C  
ATOM   2926  O   LEU A 381      34.429  67.662 156.150  1.00  0.82           O  
ATOM   2927  CB  LEU A 381      31.776  66.215 155.516  1.00  0.82           C  
ATOM   2928  CG  LEU A 381      30.238  66.085 155.436  1.00  0.82           C  
ATOM   2929  CD1 LEU A 381      29.840  65.540 154.058  1.00  0.82           C  
ATOM   2930  CD2 LEU A 381      29.679  65.166 156.534  1.00  0.82           C  
ATOM   2931  N   PRO A 382      34.600  65.784 157.337  1.00  0.85           N  
ATOM   2932  CA  PRO A 382      36.059  65.708 157.233  1.00  0.85           C  
ATOM   2933  C   PRO A 382      36.561  65.592 155.811  1.00  0.85           C  
ATOM   2934  O   PRO A 382      37.616  66.138 155.493  1.00  0.85           O  
ATOM   2935  CB  PRO A 382      36.434  64.458 158.052  1.00  0.85           C  
ATOM   2936  CG  PRO A 382      35.309  64.345 159.082  1.00  0.85           C  
ATOM   2937  CD  PRO A 382      34.082  64.805 158.295  1.00  0.85           C  
ATOM   2938  N   GLU A 383      35.821  64.887 154.935  1.00  0.84           N  
ATOM   2939  CA  GLU A 383      36.186  64.676 153.552  1.00  0.84           C  
ATOM   2940  C   GLU A 383      35.985  65.910 152.679  1.00  0.84           C  
ATOM   2941  O   GLU A 383      36.480  65.987 151.556  1.00  0.84           O  
ATOM   2942  CB  GLU A 383      35.405  63.470 152.966  1.00  0.84           C  
ATOM   2943  CG  GLU A 383      33.851  63.583 152.972  1.00  0.84           C  
ATOM   2944  CD  GLU A 383      33.128  63.050 154.207  1.00  0.84           C  
ATOM   2945  OE1 GLU A 383      33.675  63.034 155.339  1.00  0.84           O  
ATOM   2946  OE2 GLU A 383      31.959  62.613 154.047  1.00  0.84           O  
ATOM   2947  N   ALA A 384      35.268  66.930 153.187  1.00  0.87           N  
ATOM   2948  CA  ALA A 384      35.071  68.183 152.497  1.00  0.87           C  
ATOM   2949  C   ALA A 384      36.179  69.199 152.762  1.00  0.87           C  
ATOM   2950  O   ALA A 384      36.276  70.209 152.070  1.00  0.87           O  
ATOM   2951  CB  ALA A 384      33.729  68.781 152.959  1.00  0.87           C  
ATOM   2952  N   LEU A 385      37.049  68.963 153.765  1.00  0.88           N  
ATOM   2953  CA  LEU A 385      38.081  69.907 154.157  1.00  0.88           C  
ATOM   2954  C   LEU A 385      39.317  69.868 153.277  1.00  0.88           C  
ATOM   2955  O   LEU A 385      39.955  68.829 153.099  1.00  0.88           O  
ATOM   2956  CB  LEU A 385      38.584  69.646 155.598  1.00  0.88           C  
ATOM   2957  CG  LEU A 385      37.512  69.711 156.700  1.00  0.88           C  
ATOM   2958  CD1 LEU A 385      38.149  69.358 158.051  1.00  0.88           C  
ATOM   2959  CD2 LEU A 385      36.849  71.093 156.774  1.00  0.88           C  
ATOM   2960  N   GLU A 386      39.724  71.028 152.731  1.00  0.88           N  
ATOM   2961  CA  GLU A 386      40.904  71.119 151.905  1.00  0.88           C  
ATOM   2962  C   GLU A 386      42.217  70.992 152.633  1.00  0.88           C  
ATOM   2963  O   GLU A 386      42.592  71.768 153.517  1.00  0.88           O  
ATOM   2964  CB  GLU A 386      40.919  72.381 151.051  1.00  0.88           C  
ATOM   2965  CG  GLU A 386      39.632  72.456 150.213  1.00  0.88           C  
ATOM   2966  CD  GLU A 386      39.639  73.603 149.208  1.00  0.88           C  
ATOM   2967  OE1 GLU A 386      39.896  74.774 149.585  1.00  0.88           O  
ATOM   2968  OE2 GLU A 386      39.275  73.335 148.044  1.00  0.88           O  
ATOM   2969  N   ARG A 387      42.951  69.946 152.238  1.00  0.83           N  
ATOM   2970  CA  ARG A 387      44.222  69.594 152.809  1.00  0.83           C  
ATOM   2971  C   ARG A 387      45.157  69.270 151.669  1.00  0.83           C  
ATOM   2972  O   ARG A 387      45.274  68.124 151.225  1.00  0.83           O  
ATOM   2973  CB  ARG A 387      44.071  68.405 153.777  1.00  0.83           C  
ATOM   2974  CG  ARG A 387      43.267  68.783 155.038  1.00  0.83           C  
ATOM   2975  CD  ARG A 387      42.452  67.631 155.620  1.00  0.83           C  
ATOM   2976  NE  ARG A 387      43.453  66.671 156.145  1.00  0.83           N  
ATOM   2977  CZ  ARG A 387      43.473  65.344 155.986  1.00  0.83           C  
ATOM   2978  NH1 ARG A 387      42.619  64.700 155.205  1.00  0.83           N  
ATOM   2979  NH2 ARG A 387      44.415  64.669 156.628  1.00  0.83           N  
ATOM   2980  N   TRP A 388      45.837  70.302 151.144  1.00  0.88           N  
ATOM   2981  CA  TRP A 388      46.670  70.209 149.961  1.00  0.88           C  
ATOM   2982  C   TRP A 388      48.071  69.696 150.312  1.00  0.88           C  
ATOM   2983  O   TRP A 388      48.689  70.260 151.217  1.00  0.88           O  
ATOM   2984  CB  TRP A 388      46.802  71.588 149.262  1.00  0.88           C  
ATOM   2985  CG  TRP A 388      45.567  72.081 148.519  1.00  0.88           C  
ATOM   2986  CD1 TRP A 388      44.748  73.140 148.806  1.00  0.88           C  
ATOM   2987  CD2 TRP A 388      45.105  71.546 147.267  1.00  0.88           C  
ATOM   2988  NE1 TRP A 388      43.761  73.251 147.854  1.00  0.88           N  
ATOM   2989  CE2 TRP A 388      43.960  72.296 146.897  1.00  0.88           C  
ATOM   2990  CE3 TRP A 388      45.588  70.530 146.450  1.00  0.88           C  
ATOM   2991  CZ2 TRP A 388      43.271  72.019 145.730  1.00  0.88           C  
ATOM   2992  CZ3 TRP A 388      44.896  70.258 145.262  1.00  0.88           C  
ATOM   2993  CH2 TRP A 388      43.738  70.977 144.919  1.00  0.88           C  
ATOM   2994  N   PRO A 389      48.620  68.642 149.690  1.00  0.91           N  
ATOM   2995  CA  PRO A 389      49.992  68.184 149.913  1.00  0.91           C  
ATOM   2996  C   PRO A 389      51.069  69.246 149.757  1.00  0.91           C  
ATOM   2997  O   PRO A 389      51.044  69.987 148.774  1.00  0.91           O  
ATOM   2998  CB  PRO A 389      50.180  67.027 148.915  1.00  0.91           C  
ATOM   2999  CG  PRO A 389      48.757  66.527 148.658  1.00  0.91           C  
ATOM   3000  CD  PRO A 389      47.944  67.818 148.686  1.00  0.91           C  
ATOM   3001  N   VAL A 390      52.049  69.320 150.684  1.00  0.89           N  
ATOM   3002  CA  VAL A 390      53.118  70.317 150.633  1.00  0.89           C  
ATOM   3003  C   VAL A 390      53.971  70.234 149.375  1.00  0.89           C  
ATOM   3004  O   VAL A 390      54.285  71.253 148.775  1.00  0.89           O  
ATOM   3005  CB  VAL A 390      54.023  70.344 151.863  1.00  0.89           C  
ATOM   3006  CG1 VAL A 390      53.186  70.697 153.106  1.00  0.89           C  
ATOM   3007  CG2 VAL A 390      54.784  69.019 152.069  1.00  0.89           C  
ATOM   3008  N   HIS A 391      54.293  69.012 148.900  1.00  0.84           N  
ATOM   3009  CA  HIS A 391      55.046  68.742 147.678  1.00  0.84           C  
ATOM   3010  C   HIS A 391      54.401  69.321 146.419  1.00  0.84           C  
ATOM   3011  O   HIS A 391      55.056  69.843 145.519  1.00  0.84           O  
ATOM   3012  CB  HIS A 391      55.142  67.205 147.481  1.00  0.84           C  
ATOM   3013  CG  HIS A 391      56.025  66.775 146.351  1.00  0.84           C  
ATOM   3014  ND1 HIS A 391      57.380  66.952 146.490  1.00  0.84           N  
ATOM   3015  CD2 HIS A 391      55.742  66.224 145.141  1.00  0.84           C  
ATOM   3016  CE1 HIS A 391      57.908  66.516 145.368  1.00  0.84           C  
ATOM   3017  NE2 HIS A 391      56.959  66.060 144.513  1.00  0.84           N  
ATOM   3018  N   LEU A 392      53.058  69.243 146.321  1.00  0.87           N  
ATOM   3019  CA  LEU A 392      52.299  69.816 145.223  1.00  0.87           C  
ATOM   3020  C   LEU A 392      52.376  71.345 145.209  1.00  0.87           C  
ATOM   3021  O   LEU A 392      52.624  71.977 144.183  1.00  0.87           O  
ATOM   3022  CB  LEU A 392      50.825  69.341 145.338  1.00  0.87           C  
ATOM   3023  CG  LEU A 392      49.990  69.426 144.043  1.00  0.87           C  
ATOM   3024  CD1 LEU A 392      50.489  68.427 142.988  1.00  0.87           C  
ATOM   3025  CD2 LEU A 392      48.508  69.151 144.346  1.00  0.87           C  
ATOM   3026  N   LEU A 393      52.219  71.965 146.398  1.00  0.90           N  
ATOM   3027  CA  LEU A 393      52.368  73.392 146.626  1.00  0.90           C  
ATOM   3028  C   LEU A 393      53.787  73.897 146.424  1.00  0.90           C  
ATOM   3029  O   LEU A 393      53.972  74.943 145.815  1.00  0.90           O  
ATOM   3030  CB  LEU A 393      51.839  73.784 148.033  1.00  0.90           C  
ATOM   3031  CG  LEU A 393      50.303  73.662 148.149  1.00  0.90           C  
ATOM   3032  CD1 LEU A 393      49.822  73.643 149.598  1.00  0.90           C  
ATOM   3033  CD2 LEU A 393      49.576  74.759 147.363  1.00  0.90           C  
ATOM   3034  N   GLU A 394      54.827  73.171 146.879  1.00  0.86           N  
ATOM   3035  CA  GLU A 394      56.226  73.527 146.678  1.00  0.86           C  
ATOM   3036  C   GLU A 394      56.616  73.579 145.214  1.00  0.86           C  
ATOM   3037  O   GLU A 394      57.208  74.544 144.741  1.00  0.86           O  
ATOM   3038  CB  GLU A 394      57.141  72.509 147.401  1.00  0.86           C  
ATOM   3039  CG  GLU A 394      58.624  72.949 147.514  1.00  0.86           C  
ATOM   3040  CD  GLU A 394      59.452  72.047 148.431  1.00  0.86           C  
ATOM   3041  OE1 GLU A 394      60.657  72.366 148.606  1.00  0.86           O  
ATOM   3042  OE2 GLU A 394      58.891  71.069 148.988  1.00  0.86           O  
ATOM   3043  N   THR A 395      56.205  72.560 144.435  1.00  0.88           N  
ATOM   3044  CA  THR A 395      56.369  72.535 142.986  1.00  0.88           C  
ATOM   3045  C   THR A 395      55.622  73.668 142.286  1.00  0.88           C  
ATOM   3046  O   THR A 395      56.170  74.359 141.430  1.00  0.88           O  
ATOM   3047  CB  THR A 395      55.863  71.205 142.414  1.00  0.88           C  
ATOM   3048  OG1 THR A 395      56.656  70.121 142.876  1.00  0.88           O  
ATOM   3049  CG2 THR A 395      55.945  71.142 140.884  1.00  0.88           C  
ATOM   3050  N   LEU A 396      54.335  73.904 142.618  1.00  0.90           N  
ATOM   3051  CA  LEU A 396      53.523  74.886 141.911  1.00  0.90           C  
ATOM   3052  C   LEU A 396      53.716  76.338 142.338  1.00  0.90           C  
ATOM   3053  O   LEU A 396      53.702  77.242 141.502  1.00  0.90           O  
ATOM   3054  CB  LEU A 396      52.021  74.526 142.024  1.00  0.90           C  
ATOM   3055  CG  LEU A 396      51.093  75.319 141.074  1.00  0.90           C  
ATOM   3056  CD1 LEU A 396      51.312  74.927 139.604  1.00  0.90           C  
ATOM   3057  CD2 LEU A 396      49.627  75.109 141.465  1.00  0.90           C  
ATOM   3058  N   LEU A 397      53.872  76.597 143.648  1.00  0.92           N  
ATOM   3059  CA  LEU A 397      53.831  77.918 144.250  1.00  0.92           C  
ATOM   3060  C   LEU A 397      54.901  78.058 145.340  1.00  0.92           C  
ATOM   3061  O   LEU A 397      54.560  78.246 146.515  1.00  0.92           O  
ATOM   3062  CB  LEU A 397      52.456  78.168 144.929  1.00  0.92           C  
ATOM   3063  CG  LEU A 397      51.215  78.115 144.019  1.00  0.92           C  
ATOM   3064  CD1 LEU A 397      49.958  78.338 144.870  1.00  0.92           C  
ATOM   3065  CD2 LEU A 397      51.273  79.167 142.904  1.00  0.92           C  
ATOM   3066  N   PRO A 398      56.201  77.973 145.049  1.00  0.92           N  
ATOM   3067  CA  PRO A 398      57.242  77.827 146.068  1.00  0.92           C  
ATOM   3068  C   PRO A 398      57.348  79.018 147.001  1.00  0.92           C  
ATOM   3069  O   PRO A 398      57.658  78.845 148.179  1.00  0.92           O  
ATOM   3070  CB  PRO A 398      58.526  77.617 145.245  1.00  0.92           C  
ATOM   3071  CG  PRO A 398      58.228  78.269 143.891  1.00  0.92           C  
ATOM   3072  CD  PRO A 398      56.754  77.928 143.690  1.00  0.92           C  
ATOM   3073  N   ARG A 399      57.106  80.252 146.517  1.00  0.88           N  
ATOM   3074  CA  ARG A 399      57.094  81.429 147.362  1.00  0.88           C  
ATOM   3075  C   ARG A 399      55.955  81.444 148.376  1.00  0.88           C  
ATOM   3076  O   ARG A 399      56.154  81.747 149.551  1.00  0.88           O  
ATOM   3077  CB  ARG A 399      57.076  82.715 146.499  1.00  0.88           C  
ATOM   3078  CG  ARG A 399      57.233  84.026 147.305  1.00  0.88           C  
ATOM   3079  CD  ARG A 399      58.454  84.045 148.238  1.00  0.88           C  
ATOM   3080  NE  ARG A 399      58.488  85.364 148.932  1.00  0.88           N  
ATOM   3081  CZ  ARG A 399      58.942  85.555 150.176  1.00  0.88           C  
ATOM   3082  NH1 ARG A 399      59.466  84.571 150.900  1.00  0.88           N  
ATOM   3083  NH2 ARG A 399      58.881  86.771 150.704  1.00  0.88           N  
ATOM   3084  N   HIS A 400      54.732  81.063 147.968  1.00  0.92           N  
ATOM   3085  CA  HIS A 400      53.586  80.937 148.848  1.00  0.92           C  
ATOM   3086  C   HIS A 400      53.773  79.920 149.955  1.00  0.92           C  
ATOM   3087  O   HIS A 400      53.390  80.179 151.091  1.00  0.92           O  
ATOM   3088  CB  HIS A 400      52.303  80.587 148.068  1.00  0.92           C  
ATOM   3089  CG  HIS A 400      51.974  81.656 147.077  1.00  0.92           C  
ATOM   3090  ND1 HIS A 400      52.693  81.748 145.899  1.00  0.92           N  
ATOM   3091  CD2 HIS A 400      51.106  82.693 147.186  1.00  0.92           C  
ATOM   3092  CE1 HIS A 400      52.238  82.836 145.310  1.00  0.92           C  
ATOM   3093  NE2 HIS A 400      51.289  83.444 146.052  1.00  0.92           N  
ATOM   3094  N   LEU A 401      54.406  78.758 149.682  1.00  0.91           N  
ATOM   3095  CA  LEU A 401      54.724  77.780 150.717  1.00  0.91           C  
ATOM   3096  C   LEU A 401      55.654  78.330 151.801  1.00  0.91           C  
ATOM   3097  O   LEU A 401      55.431  78.121 152.992  1.00  0.91           O  
ATOM   3098  CB  LEU A 401      55.328  76.487 150.113  1.00  0.91           C  
ATOM   3099  CG  LEU A 401      55.587  75.360 151.143  1.00  0.91           C  
ATOM   3100  CD1 LEU A 401      54.303  74.882 151.831  1.00  0.91           C  
ATOM   3101  CD2 LEU A 401      56.263  74.156 150.482  1.00  0.91           C  
ATOM   3102  N   GLN A 402      56.688  79.118 151.421  1.00  0.88           N  
ATOM   3103  CA  GLN A 402      57.553  79.821 152.366  1.00  0.88           C  
ATOM   3104  C   GLN A 402      56.786  80.797 153.248  1.00  0.88           C  
ATOM   3105  O   GLN A 402      56.967  80.839 154.462  1.00  0.88           O  
ATOM   3106  CB  GLN A 402      58.635  80.667 151.636  1.00  0.88           C  
ATOM   3107  CG  GLN A 402      59.678  79.847 150.843  1.00  0.88           C  
ATOM   3108  CD  GLN A 402      60.616  80.756 150.047  1.00  0.88           C  
ATOM   3109  OE1 GLN A 402      60.443  81.975 149.970  1.00  0.88           O  
ATOM   3110  NE2 GLN A 402      61.646  80.147 149.416  1.00  0.88           N  
ATOM   3111  N   ILE A 403      55.877  81.588 152.648  1.00  0.92           N  
ATOM   3112  CA  ILE A 403      55.021  82.528 153.358  1.00  0.92           C  
ATOM   3113  C   ILE A 403      54.075  81.806 154.317  1.00  0.92           C  
ATOM   3114  O   ILE A 403      53.923  82.214 155.464  1.00  0.92           O  
ATOM   3115  CB  ILE A 403      54.289  83.447 152.377  1.00  0.92           C  
ATOM   3116  CG1 ILE A 403      55.325  84.296 151.596  1.00  0.92           C  
ATOM   3117  CG2 ILE A 403      53.291  84.377 153.105  1.00  0.92           C  
ATOM   3118  CD1 ILE A 403      54.735  85.049 150.400  1.00  0.92           C  
ATOM   3119  N   ILE A 404      53.466  80.669 153.905  1.00  0.92           N  
ATOM   3120  CA  ILE A 404      52.652  79.807 154.766  1.00  0.92           C  
ATOM   3121  C   ILE A 404      53.448  79.220 155.930  1.00  0.92           C  
ATOM   3122  O   ILE A 404      52.980  79.216 157.070  1.00  0.92           O  
ATOM   3123  CB  ILE A 404      51.946  78.692 153.978  1.00  0.92           C  
ATOM   3124  CG1 ILE A 404      50.896  79.298 153.015  1.00  0.92           C  
ATOM   3125  CG2 ILE A 404      51.252  77.687 154.931  1.00  0.92           C  
ATOM   3126  CD1 ILE A 404      50.389  78.306 151.958  1.00  0.92           C  
ATOM   3127  N   TYR A 405      54.693  78.750 155.697  1.00  0.90           N  
ATOM   3128  CA  TYR A 405      55.586  78.305 156.758  1.00  0.90           C  
ATOM   3129  C   TYR A 405      55.933  79.409 157.757  1.00  0.90           C  
ATOM   3130  O   TYR A 405      55.856  79.190 158.963  1.00  0.90           O  
ATOM   3131  CB  TYR A 405      56.923  77.728 156.197  1.00  0.90           C  
ATOM   3132  CG  TYR A 405      56.838  76.346 155.579  1.00  0.90           C  
ATOM   3133  CD1 TYR A 405      55.954  75.344 156.034  1.00  0.90           C  
ATOM   3134  CD2 TYR A 405      57.768  76.008 154.577  1.00  0.90           C  
ATOM   3135  CE1 TYR A 405      56.004  74.047 155.497  1.00  0.90           C  
ATOM   3136  CE2 TYR A 405      57.821  74.712 154.043  1.00  0.90           C  
ATOM   3137  CZ  TYR A 405      56.938  73.732 154.505  1.00  0.90           C  
ATOM   3138  OH  TYR A 405      56.994  72.425 153.978  1.00  0.90           O  
ATOM   3139  N   GLU A 406      56.267  80.630 157.291  1.00  0.86           N  
ATOM   3140  CA  GLU A 406      56.520  81.783 158.150  1.00  0.86           C  
ATOM   3141  C   GLU A 406      55.293  82.230 158.956  1.00  0.86           C  
ATOM   3142  O   GLU A 406      55.366  82.489 160.158  1.00  0.86           O  
ATOM   3143  CB  GLU A 406      57.109  82.949 157.319  1.00  0.86           C  
ATOM   3144  CG  GLU A 406      57.661  84.141 158.149  1.00  0.86           C  
ATOM   3145  CD  GLU A 406      58.671  83.738 159.225  1.00  0.86           C  
ATOM   3146  OE1 GLU A 406      59.663  83.055 158.871  1.00  0.86           O  
ATOM   3147  OE2 GLU A 406      58.464  84.128 160.406  1.00  0.86           O  
ATOM   3148  N   ILE A 407      54.082  82.241 158.340  1.00  0.91           N  
ATOM   3149  CA  ILE A 407      52.814  82.451 159.045  1.00  0.91           C  
ATOM   3150  C   ILE A 407      52.615  81.404 160.139  1.00  0.91           C  
ATOM   3151  O   ILE A 407      52.289  81.736 161.278  1.00  0.91           O  
ATOM   3152  CB  ILE A 407      51.608  82.424 158.086  1.00  0.91           C  
ATOM   3153  CG1 ILE A 407      51.618  83.640 157.127  1.00  0.91           C  
ATOM   3154  CG2 ILE A 407      50.266  82.401 158.860  1.00  0.91           C  
ATOM   3155  CD1 ILE A 407      50.692  83.461 155.913  1.00  0.91           C  
ATOM   3156  N   ASN A 408      52.874  80.111 159.835  1.00  0.89           N  
ATOM   3157  CA  ASN A 408      52.803  79.020 160.795  1.00  0.89           C  
ATOM   3158  C   ASN A 408      53.805  79.181 161.939  1.00  0.89           C  
ATOM   3159  O   ASN A 408      53.475  78.967 163.101  1.00  0.89           O  
ATOM   3160  CB  ASN A 408      53.010  77.646 160.087  1.00  0.89           C  
ATOM   3161  CG  ASN A 408      52.490  76.490 160.941  1.00  0.89           C  
ATOM   3162  OD1 ASN A 408      51.493  76.610 161.650  1.00  0.89           O  
ATOM   3163  ND2 ASN A 408      53.142  75.312 160.844  1.00  0.89           N  
ATOM   3164  N   GLN A 409      55.054  79.595 161.648  1.00  0.84           N  
ATOM   3165  CA  GLN A 409      56.073  79.830 162.653  1.00  0.84           C  
ATOM   3166  C   GLN A 409      55.728  80.949 163.626  1.00  0.84           C  
ATOM   3167  O   GLN A 409      55.807  80.778 164.842  1.00  0.84           O  
ATOM   3168  CB  GLN A 409      57.425  80.155 161.970  1.00  0.84           C  
ATOM   3169  CG  GLN A 409      58.649  80.088 162.916  1.00  0.84           C  
ATOM   3170  CD  GLN A 409      58.855  78.668 163.444  1.00  0.84           C  
ATOM   3171  OE1 GLN A 409      59.244  77.750 162.723  1.00  0.84           O  
ATOM   3172  NE2 GLN A 409      58.569  78.453 164.748  1.00  0.84           N  
ATOM   3173  N   ARG A 410      55.259  82.114 163.126  1.00  0.82           N  
ATOM   3174  CA  ARG A 410      54.782  83.204 163.964  1.00  0.82           C  
ATOM   3175  C   ARG A 410      53.583  82.780 164.819  1.00  0.82           C  
ATOM   3176  O   ARG A 410      53.520  83.100 166.006  1.00  0.82           O  
ATOM   3177  CB  ARG A 410      54.443  84.465 163.116  1.00  0.82           C  
ATOM   3178  CG  ARG A 410      55.667  85.138 162.443  1.00  0.82           C  
ATOM   3179  CD  ARG A 410      56.690  85.809 163.374  1.00  0.82           C  
ATOM   3180  NE  ARG A 410      56.016  86.955 164.077  1.00  0.82           N  
ATOM   3181  CZ  ARG A 410      56.119  88.225 163.678  1.00  0.82           C  
ATOM   3182  NH1 ARG A 410      55.482  89.198 164.322  1.00  0.82           N  
ATOM   3183  NH2 ARG A 410      56.828  88.595 162.622  1.00  0.82           N  
ATOM   3184  N   PHE A 411      52.636  82.012 164.241  1.00  0.87           N  
ATOM   3185  CA  PHE A 411      51.486  81.433 164.919  1.00  0.87           C  
ATOM   3186  C   PHE A 411      51.839  80.454 166.050  1.00  0.87           C  
ATOM   3187  O   PHE A 411      51.386  80.607 167.185  1.00  0.87           O  
ATOM   3188  CB  PHE A 411      50.614  80.717 163.845  1.00  0.87           C  
ATOM   3189  CG  PHE A 411      49.204  80.509 164.310  1.00  0.87           C  
ATOM   3190  CD1 PHE A 411      48.739  79.225 164.633  1.00  0.87           C  
ATOM   3191  CD2 PHE A 411      48.327  81.603 164.417  1.00  0.87           C  
ATOM   3192  CE1 PHE A 411      47.420  79.041 165.062  1.00  0.87           C  
ATOM   3193  CE2 PHE A 411      47.008  81.421 164.853  1.00  0.87           C  
ATOM   3194  CZ  PHE A 411      46.557  80.137 165.177  1.00  0.87           C  
ATOM   3195  N   LEU A 412      52.713  79.456 165.795  1.00  0.82           N  
ATOM   3196  CA  LEU A 412      53.146  78.479 166.788  1.00  0.82           C  
ATOM   3197  C   LEU A 412      53.943  79.074 167.940  1.00  0.82           C  
ATOM   3198  O   LEU A 412      53.775  78.678 169.094  1.00  0.82           O  
ATOM   3199  CB  LEU A 412      53.949  77.322 166.142  1.00  0.82           C  
ATOM   3200  CG  LEU A 412      53.117  76.416 165.206  1.00  0.82           C  
ATOM   3201  CD1 LEU A 412      54.012  75.356 164.547  1.00  0.82           C  
ATOM   3202  CD2 LEU A 412      51.947  75.728 165.928  1.00  0.82           C  
ATOM   3203  N   ASN A 413      54.806  80.076 167.669  1.00  0.79           N  
ATOM   3204  CA  ASN A 413      55.568  80.799 168.681  1.00  0.79           C  
ATOM   3205  C   ASN A 413      54.674  81.478 169.727  1.00  0.79           C  
ATOM   3206  O   ASN A 413      54.983  81.498 170.917  1.00  0.79           O  
ATOM   3207  CB  ASN A 413      56.465  81.883 168.020  1.00  0.79           C  
ATOM   3208  CG  ASN A 413      57.573  81.268 167.166  1.00  0.79           C  
ATOM   3209  OD1 ASN A 413      57.860  80.073 167.173  1.00  0.79           O  
ATOM   3210  ND2 ASN A 413      58.257  82.133 166.381  1.00  0.79           N  
ATOM   3211  N   ARG A 414      53.515  82.036 169.313  1.00  0.73           N  
ATOM   3212  CA  ARG A 414      52.501  82.538 170.231  1.00  0.73           C  
ATOM   3213  C   ARG A 414      51.873  81.465 171.113  1.00  0.73           C  
ATOM   3214  O   ARG A 414      51.668  81.681 172.305  1.00  0.73           O  
ATOM   3215  CB  ARG A 414      51.366  83.257 169.460  1.00  0.73           C  
ATOM   3216  CG  ARG A 414      51.809  84.570 168.786  1.00  0.73           C  
ATOM   3217  CD  ARG A 414      52.037  85.708 169.790  1.00  0.73           C  
ATOM   3218  NE  ARG A 414      52.448  86.938 169.029  1.00  0.73           N  
ATOM   3219  CZ  ARG A 414      51.599  87.775 168.414  1.00  0.73           C  
ATOM   3220  NH1 ARG A 414      50.296  87.525 168.341  1.00  0.73           N  
ATOM   3221  NH2 ARG A 414      52.072  88.890 167.860  1.00  0.73           N  
ATOM   3222  N   VAL A 415      51.557  80.279 170.556  1.00  0.77           N  
ATOM   3223  CA  VAL A 415      51.017  79.151 171.310  1.00  0.77           C  
ATOM   3224  C   VAL A 415      51.999  78.638 172.355  1.00  0.77           C  
ATOM   3225  O   VAL A 415      51.625  78.438 173.507  1.00  0.77           O  
ATOM   3226  CB  VAL A 415      50.540  78.027 170.393  1.00  0.77           C  
ATOM   3227  CG1 VAL A 415      50.007  76.826 171.208  1.00  0.77           C  
ATOM   3228  CG2 VAL A 415      49.418  78.582 169.492  1.00  0.77           C  
ATOM   3229  N   ALA A 416      53.297  78.499 172.010  1.00  0.77           N  
ATOM   3230  CA  ALA A 416      54.364  78.196 172.951  1.00  0.77           C  
ATOM   3231  C   ALA A 416      54.505  79.222 174.078  1.00  0.77           C  
ATOM   3232  O   ALA A 416      54.666  78.861 175.239  1.00  0.77           O  
ATOM   3233  CB  ALA A 416      55.706  78.092 172.190  1.00  0.77           C  
ATOM   3234  N   ALA A 417      54.416  80.533 173.777  1.00  0.77           N  
ATOM   3235  CA  ALA A 417      54.437  81.591 174.771  1.00  0.77           C  
ATOM   3236  C   ALA A 417      53.242  81.594 175.729  1.00  0.77           C  
ATOM   3237  O   ALA A 417      53.367  81.970 176.892  1.00  0.77           O  
ATOM   3238  CB  ALA A 417      54.592  82.958 174.070  1.00  0.77           C  
ATOM   3239  N   ALA A 418      52.043  81.210 175.252  1.00  0.76           N  
ATOM   3240  CA  ALA A 418      50.838  81.156 176.058  1.00  0.76           C  
ATOM   3241  C   ALA A 418      50.646  79.848 176.829  1.00  0.76           C  
ATOM   3242  O   ALA A 418      50.217  79.850 177.982  1.00  0.76           O  
ATOM   3243  CB  ALA A 418      49.626  81.405 175.140  1.00  0.76           C  
ATOM   3244  N   PHE A 419      50.962  78.690 176.214  1.00  0.75           N  
ATOM   3245  CA  PHE A 419      50.735  77.369 176.785  1.00  0.75           C  
ATOM   3246  C   PHE A 419      51.981  76.489 176.643  1.00  0.75           C  
ATOM   3247  O   PHE A 419      52.005  75.617 175.773  1.00  0.75           O  
ATOM   3248  CB  PHE A 419      49.570  76.640 176.052  1.00  0.75           C  
ATOM   3249  CG  PHE A 419      48.281  77.400 176.176  1.00  0.75           C  
ATOM   3250  CD1 PHE A 419      47.740  78.075 175.068  1.00  0.75           C  
ATOM   3251  CD2 PHE A 419      47.599  77.445 177.402  1.00  0.75           C  
ATOM   3252  CE1 PHE A 419      46.542  78.790 175.187  1.00  0.75           C  
ATOM   3253  CE2 PHE A 419      46.401  78.162 177.526  1.00  0.75           C  
ATOM   3254  CZ  PHE A 419      45.872  78.834 176.416  1.00  0.75           C  
ATOM   3255  N   PRO A 420      53.039  76.620 177.452  1.00  0.79           N  
ATOM   3256  CA  PRO A 420      54.332  76.001 177.146  1.00  0.79           C  
ATOM   3257  C   PRO A 420      54.342  74.488 177.246  1.00  0.79           C  
ATOM   3258  O   PRO A 420      55.159  73.839 176.603  1.00  0.79           O  
ATOM   3259  CB  PRO A 420      55.293  76.599 178.191  1.00  0.79           C  
ATOM   3260  CG  PRO A 420      54.659  77.940 178.567  1.00  0.79           C  
ATOM   3261  CD  PRO A 420      53.162  77.647 178.493  1.00  0.79           C  
ATOM   3262  N   GLY A 421      53.493  73.909 178.116  1.00  0.74           N  
ATOM   3263  CA  GLY A 421      53.458  72.478 178.396  1.00  0.74           C  
ATOM   3264  C   GLY A 421      52.526  71.695 177.506  1.00  0.74           C  
ATOM   3265  O   GLY A 421      52.423  70.482 177.636  1.00  0.74           O  
ATOM   3266  N   ASP A 422      51.804  72.357 176.586  1.00  0.80           N  
ATOM   3267  CA  ASP A 422      50.766  71.747 175.775  1.00  0.80           C  
ATOM   3268  C   ASP A 422      51.293  71.472 174.364  1.00  0.80           C  
ATOM   3269  O   ASP A 422      51.033  72.171 173.383  1.00  0.80           O  
ATOM   3270  CB  ASP A 422      49.491  72.624 175.805  1.00  0.80           C  
ATOM   3271  CG  ASP A 422      48.289  71.935 175.189  1.00  0.80           C  
ATOM   3272  OD1 ASP A 422      47.202  72.567 175.204  1.00  0.80           O  
ATOM   3273  OD2 ASP A 422      48.412  70.796 174.662  1.00  0.80           O  
ATOM   3274  N   VAL A 423      52.098  70.401 174.238  1.00  0.81           N  
ATOM   3275  CA  VAL A 423      52.674  69.985 172.970  1.00  0.81           C  
ATOM   3276  C   VAL A 423      51.685  69.389 171.968  1.00  0.81           C  
ATOM   3277  O   VAL A 423      51.913  69.489 170.763  1.00  0.81           O  
ATOM   3278  CB  VAL A 423      53.868  69.048 173.132  1.00  0.81           C  
ATOM   3279  CG1 VAL A 423      55.041  69.836 173.749  1.00  0.81           C  
ATOM   3280  CG2 VAL A 423      53.516  67.819 173.992  1.00  0.81           C  
ATOM   3281  N   ASP A 424      50.550  68.773 172.394  1.00  0.82           N  
ATOM   3282  CA  ASP A 424      49.522  68.331 171.452  1.00  0.82           C  
ATOM   3283  C   ASP A 424      48.832  69.537 170.817  1.00  0.82           C  
ATOM   3284  O   ASP A 424      48.643  69.572 169.607  1.00  0.82           O  
ATOM   3285  CB  ASP A 424      48.505  67.331 172.075  1.00  0.82           C  
ATOM   3286  CG  ASP A 424      47.582  66.722 171.041  1.00  0.82           C  
ATOM   3287  OD1 ASP A 424      46.385  67.090 170.947  1.00  0.82           O  
ATOM   3288  OD2 ASP A 424      48.071  65.828 170.309  1.00  0.82           O  
ATOM   3289  N   ARG A 425      48.512  70.605 171.580  1.00  0.80           N  
ATOM   3290  CA  ARG A 425      47.902  71.820 171.051  1.00  0.80           C  
ATOM   3291  C   ARG A 425      48.666  72.451 169.897  1.00  0.80           C  
ATOM   3292  O   ARG A 425      48.066  72.888 168.919  1.00  0.80           O  
ATOM   3293  CB  ARG A 425      47.693  72.843 172.176  1.00  0.80           C  
ATOM   3294  CG  ARG A 425      46.700  73.981 171.909  1.00  0.80           C  
ATOM   3295  CD  ARG A 425      46.351  74.757 173.180  1.00  0.80           C  
ATOM   3296  NE  ARG A 425      45.360  75.785 172.761  1.00  0.80           N  
ATOM   3297  CZ  ARG A 425      44.283  76.102 173.469  1.00  0.80           C  
ATOM   3298  NH1 ARG A 425      43.942  75.493 174.599  1.00  0.80           N  
ATOM   3299  NH2 ARG A 425      43.439  77.023 173.020  1.00  0.80           N  
ATOM   3300  N   LEU A 426      50.016  72.428 169.921  1.00  0.83           N  
ATOM   3301  CA  LEU A 426      50.839  72.812 168.779  1.00  0.83           C  
ATOM   3302  C   LEU A 426      50.573  72.043 167.481  1.00  0.83           C  
ATOM   3303  O   LEU A 426      50.436  72.647 166.422  1.00  0.83           O  
ATOM   3304  CB  LEU A 426      52.349  72.638 169.089  1.00  0.83           C  
ATOM   3305  CG  LEU A 426      52.914  73.575 170.176  1.00  0.83           C  
ATOM   3306  CD1 LEU A 426      54.349  73.165 170.542  1.00  0.83           C  
ATOM   3307  CD2 LEU A 426      52.899  75.040 169.717  1.00  0.83           C  
ATOM   3308  N   ARG A 427      50.440  70.700 167.502  1.00  0.77           N  
ATOM   3309  CA  ARG A 427      50.194  69.939 166.282  1.00  0.77           C  
ATOM   3310  C   ARG A 427      48.715  69.925 165.893  1.00  0.77           C  
ATOM   3311  O   ARG A 427      48.330  69.449 164.829  1.00  0.77           O  
ATOM   3312  CB  ARG A 427      50.703  68.480 166.413  1.00  0.77           C  
ATOM   3313  CG  ARG A 427      49.917  67.625 167.422  1.00  0.77           C  
ATOM   3314  CD  ARG A 427      49.644  66.204 166.934  1.00  0.77           C  
ATOM   3315  NE  ARG A 427      48.485  65.719 167.727  1.00  0.77           N  
ATOM   3316  CZ  ARG A 427      47.199  65.718 167.367  1.00  0.77           C  
ATOM   3317  NH1 ARG A 427      46.791  66.176 166.194  1.00  0.77           N  
ATOM   3318  NH2 ARG A 427      46.324  65.307 168.281  1.00  0.77           N  
ATOM   3319  N   ARG A 428      47.836  70.413 166.785  1.00  0.82           N  
ATOM   3320  CA  ARG A 428      46.420  70.589 166.542  1.00  0.82           C  
ATOM   3321  C   ARG A 428      46.137  71.916 165.851  1.00  0.82           C  
ATOM   3322  O   ARG A 428      45.256  72.014 164.999  1.00  0.82           O  
ATOM   3323  CB  ARG A 428      45.681  70.493 167.901  1.00  0.82           C  
ATOM   3324  CG  ARG A 428      44.474  69.536 167.921  1.00  0.82           C  
ATOM   3325  CD  ARG A 428      44.223  68.930 169.311  1.00  0.82           C  
ATOM   3326  NE  ARG A 428      43.973  70.049 170.279  1.00  0.82           N  
ATOM   3327  CZ  ARG A 428      44.462  70.114 171.525  1.00  0.82           C  
ATOM   3328  NH1 ARG A 428      45.237  69.177 172.059  1.00  0.82           N  
ATOM   3329  NH2 ARG A 428      44.183  71.169 172.286  1.00  0.82           N  
ATOM   3330  N   MET A 429      46.901  72.968 166.211  1.00  0.88           N  
ATOM   3331  CA  MET A 429      46.727  74.312 165.687  1.00  0.88           C  
ATOM   3332  C   MET A 429      47.710  74.686 164.582  1.00  0.88           C  
ATOM   3333  O   MET A 429      47.618  75.772 164.011  1.00  0.88           O  
ATOM   3334  CB  MET A 429      46.944  75.331 166.832  1.00  0.88           C  
ATOM   3335  CG  MET A 429      45.883  75.268 167.941  1.00  0.88           C  
ATOM   3336  SD  MET A 429      46.100  76.559 169.209  1.00  0.88           S  
ATOM   3337  CE  MET A 429      45.371  77.906 168.238  1.00  0.88           C  
ATOM   3338  N   SER A 430      48.675  73.807 164.250  1.00  0.91           N  
ATOM   3339  CA  SER A 430      49.587  73.976 163.119  1.00  0.91           C  
ATOM   3340  C   SER A 430      48.869  74.046 161.786  1.00  0.91           C  
ATOM   3341  O   SER A 430      47.937  73.294 161.522  1.00  0.91           O  
ATOM   3342  CB  SER A 430      50.612  72.804 163.027  1.00  0.91           C  
ATOM   3343  OG  SER A 430      51.585  72.949 161.983  1.00  0.91           O  
ATOM   3344  N   LEU A 431      49.334  74.914 160.863  1.00  0.93           N  
ATOM   3345  CA  LEU A 431      48.774  74.977 159.522  1.00  0.93           C  
ATOM   3346  C   LEU A 431      49.198  73.775 158.690  1.00  0.93           C  
ATOM   3347  O   LEU A 431      48.654  73.516 157.621  1.00  0.93           O  
ATOM   3348  CB  LEU A 431      49.192  76.236 158.708  1.00  0.93           C  
ATOM   3349  CG  LEU A 431      49.109  77.603 159.417  1.00  0.93           C  
ATOM   3350  CD1 LEU A 431      49.280  78.718 158.375  1.00  0.93           C  
ATOM   3351  CD2 LEU A 431      47.806  77.808 160.197  1.00  0.93           C  
ATOM   3352  N   VAL A 432      50.205  73.022 159.164  1.00  0.90           N  
ATOM   3353  CA  VAL A 432      50.750  71.857 158.502  1.00  0.90           C  
ATOM   3354  C   VAL A 432      50.360  70.607 159.282  1.00  0.90           C  
ATOM   3355  O   VAL A 432      50.510  70.523 160.498  1.00  0.90           O  
ATOM   3356  CB  VAL A 432      52.273  71.955 158.389  1.00  0.90           C  
ATOM   3357  CG1 VAL A 432      52.868  70.724 157.674  1.00  0.90           C  
ATOM   3358  CG2 VAL A 432      52.660  73.240 157.625  1.00  0.90           C  
ATOM   3359  N   GLU A 433      49.827  69.587 158.582  1.00  0.82           N  
ATOM   3360  CA  GLU A 433      49.550  68.284 159.148  1.00  0.82           C  
ATOM   3361  C   GLU A 433      50.765  67.389 158.944  1.00  0.82           C  
ATOM   3362  O   GLU A 433      51.053  66.959 157.830  1.00  0.82           O  
ATOM   3363  CB  GLU A 433      48.313  67.603 158.488  1.00  0.82           C  
ATOM   3364  CG  GLU A 433      46.962  68.306 158.792  1.00  0.82           C  
ATOM   3365  CD  GLU A 433      45.778  67.611 158.154  1.00  0.82           C  
ATOM   3366  OE1 GLU A 433      45.918  66.431 157.747  1.00  0.82           O  
ATOM   3367  OE2 GLU A 433      44.691  68.233 158.025  1.00  0.82           O  
ATOM   3368  N   GLU A 434      51.513  67.061 160.022  1.00  0.71           N  
ATOM   3369  CA  GLU A 434      52.686  66.193 159.947  1.00  0.71           C  
ATOM   3370  C   GLU A 434      52.381  64.722 159.671  1.00  0.71           C  
ATOM   3371  O   GLU A 434      53.285  63.975 159.297  1.00  0.71           O  
ATOM   3372  CB  GLU A 434      53.547  66.256 161.248  1.00  0.71           C  
ATOM   3373  CG  GLU A 434      54.651  67.339 161.228  1.00  0.71           C  
ATOM   3374  CD  GLU A 434      54.078  68.730 161.022  1.00  0.71           C  
ATOM   3375  OE1 GLU A 434      54.533  69.396 160.058  1.00  0.71           O  
ATOM   3376  OE2 GLU A 434      53.181  69.113 161.814  1.00  0.71           O  
ATOM   3377  N   GLY A 435      51.122  64.263 159.861  1.00  0.56           N  
ATOM   3378  CA  GLY A 435      50.704  62.869 159.697  1.00  0.56           C  
ATOM   3379  C   GLY A 435      50.873  62.276 158.319  1.00  0.56           C  
ATOM   3380  O   GLY A 435      50.142  62.615 157.394  1.00  0.56           O  
ATOM   3381  N   ALA A 436      51.817  61.322 158.173  1.00  0.61           N  
ATOM   3382  CA  ALA A 436      52.173  60.702 156.910  1.00  0.61           C  
ATOM   3383  C   ALA A 436      52.752  61.677 155.882  1.00  0.61           C  
ATOM   3384  O   ALA A 436      53.798  62.294 156.090  1.00  0.61           O  
ATOM   3385  CB  ALA A 436      50.989  59.874 156.355  1.00  0.61           C  
ATOM   3386  N   VAL A 437      52.101  61.815 154.713  1.00  0.70           N  
ATOM   3387  CA  VAL A 437      52.516  62.757 153.690  1.00  0.70           C  
ATOM   3388  C   VAL A 437      51.989  64.127 154.060  1.00  0.70           C  
ATOM   3389  O   VAL A 437      50.782  64.328 154.150  1.00  0.70           O  
ATOM   3390  CB  VAL A 437      52.010  62.372 152.303  1.00  0.70           C  
ATOM   3391  CG1 VAL A 437      52.483  63.379 151.231  1.00  0.70           C  
ATOM   3392  CG2 VAL A 437      52.516  60.959 151.957  1.00  0.70           C  
ATOM   3393  N   LYS A 438      52.896  65.095 154.309  1.00  0.80           N  
ATOM   3394  CA  LYS A 438      52.553  66.402 154.840  1.00  0.80           C  
ATOM   3395  C   LYS A 438      51.602  67.223 153.980  1.00  0.80           C  
ATOM   3396  O   LYS A 438      51.741  67.331 152.760  1.00  0.80           O  
ATOM   3397  CB  LYS A 438      53.819  67.240 155.150  1.00  0.80           C  
ATOM   3398  CG  LYS A 438      54.688  66.644 156.265  1.00  0.80           C  
ATOM   3399  CD  LYS A 438      56.035  67.372 156.396  1.00  0.80           C  
ATOM   3400  CE  LYS A 438      56.835  66.999 157.649  1.00  0.80           C  
ATOM   3401  NZ  LYS A 438      56.941  65.526 157.776  1.00  0.80           N  
ATOM   3402  N   ARG A 439      50.604  67.840 154.636  1.00  0.84           N  
ATOM   3403  CA  ARG A 439      49.540  68.573 153.981  1.00  0.84           C  
ATOM   3404  C   ARG A 439      49.323  69.893 154.681  1.00  0.84           C  
ATOM   3405  O   ARG A 439      49.588  70.031 155.870  1.00  0.84           O  
ATOM   3406  CB  ARG A 439      48.196  67.793 154.008  1.00  0.84           C  
ATOM   3407  CG  ARG A 439      48.283  66.417 153.327  1.00  0.84           C  
ATOM   3408  CD  ARG A 439      47.039  65.544 153.488  1.00  0.84           C  
ATOM   3409  NE  ARG A 439      46.184  65.757 152.275  1.00  0.84           N  
ATOM   3410  CZ  ARG A 439      45.994  64.874 151.289  1.00  0.84           C  
ATOM   3411  NH1 ARG A 439      46.541  63.666 151.305  1.00  0.84           N  
ATOM   3412  NH2 ARG A 439      45.226  65.234 150.263  1.00  0.84           N  
ATOM   3413  N   ILE A 440      48.820  70.907 153.959  1.00  0.92           N  
ATOM   3414  CA  ILE A 440      48.473  72.192 154.545  1.00  0.92           C  
ATOM   3415  C   ILE A 440      46.988  72.205 154.826  1.00  0.92           C  
ATOM   3416  O   ILE A 440      46.178  71.961 153.936  1.00  0.92           O  
ATOM   3417  CB  ILE A 440      48.839  73.398 153.676  1.00  0.92           C  
ATOM   3418  CG1 ILE A 440      50.331  73.295 153.292  1.00  0.92           C  
ATOM   3419  CG2 ILE A 440      48.514  74.706 154.439  1.00  0.92           C  
ATOM   3420  CD1 ILE A 440      50.924  74.501 152.567  1.00  0.92           C  
ATOM   3421  N   ASN A 441      46.588  72.507 156.075  1.00  0.92           N  
ATOM   3422  CA  ASN A 441      45.207  72.696 156.458  1.00  0.92           C  
ATOM   3423  C   ASN A 441      44.777  74.116 156.078  1.00  0.92           C  
ATOM   3424  O   ASN A 441      45.145  75.110 156.707  1.00  0.92           O  
ATOM   3425  CB  ASN A 441      45.072  72.422 157.982  1.00  0.92           C  
ATOM   3426  CG  ASN A 441      43.621  72.313 158.433  1.00  0.92           C  
ATOM   3427  OD1 ASN A 441      42.828  73.247 158.289  1.00  0.92           O  
ATOM   3428  ND2 ASN A 441      43.241  71.137 158.980  1.00  0.92           N  
ATOM   3429  N   MET A 442      43.982  74.252 154.996  1.00  0.94           N  
ATOM   3430  CA  MET A 442      43.660  75.558 154.443  1.00  0.94           C  
ATOM   3431  C   MET A 442      42.640  76.328 155.259  1.00  0.94           C  
ATOM   3432  O   MET A 442      42.579  77.556 155.192  1.00  0.94           O  
ATOM   3433  CB  MET A 442      43.128  75.446 152.998  1.00  0.94           C  
ATOM   3434  CG  MET A 442      44.062  74.695 152.034  1.00  0.94           C  
ATOM   3435  SD  MET A 442      45.806  75.237 152.028  1.00  0.94           S  
ATOM   3436  CE  MET A 442      45.657  76.687 150.946  1.00  0.94           C  
ATOM   3437  N   ALA A 443      41.837  75.622 156.082  1.00  0.95           N  
ATOM   3438  CA  ALA A 443      40.927  76.214 157.041  1.00  0.95           C  
ATOM   3439  C   ALA A 443      41.658  76.934 158.162  1.00  0.95           C  
ATOM   3440  O   ALA A 443      41.333  78.065 158.516  1.00  0.95           O  
ATOM   3441  CB  ALA A 443      40.009  75.123 157.624  1.00  0.95           C  
ATOM   3442  N   HIS A 444      42.724  76.319 158.712  1.00  0.93           N  
ATOM   3443  CA  HIS A 444      43.579  76.943 159.711  1.00  0.93           C  
ATOM   3444  C   HIS A 444      44.286  78.188 159.189  1.00  0.93           C  
ATOM   3445  O   HIS A 444      44.337  79.216 159.866  1.00  0.93           O  
ATOM   3446  CB  HIS A 444      44.618  75.944 160.262  1.00  0.93           C  
ATOM   3447  CG  HIS A 444      44.009  74.788 161.001  1.00  0.93           C  
ATOM   3448  ND1 HIS A 444      44.855  73.827 161.495  1.00  0.93           N  
ATOM   3449  CD2 HIS A 444      42.729  74.517 161.372  1.00  0.93           C  
ATOM   3450  CE1 HIS A 444      44.092  72.984 162.160  1.00  0.93           C  
ATOM   3451  NE2 HIS A 444      42.790  73.356 162.116  1.00  0.93           N  
ATOM   3452  N   LEU A 445      44.793  78.147 157.933  1.00  0.96           N  
ATOM   3453  CA  LEU A 445      45.374  79.304 157.257  1.00  0.96           C  
ATOM   3454  C   LEU A 445      44.379  80.459 157.129  1.00  0.96           C  
ATOM   3455  O   LEU A 445      44.684  81.608 157.458  1.00  0.96           O  
ATOM   3456  CB  LEU A 445      45.917  78.873 155.863  1.00  0.96           C  
ATOM   3457  CG  LEU A 445      46.456  79.991 154.936  1.00  0.96           C  
ATOM   3458  CD1 LEU A 445      47.593  80.809 155.568  1.00  0.96           C  
ATOM   3459  CD2 LEU A 445      46.931  79.384 153.606  1.00  0.96           C  
ATOM   3460  N   CYS A 446      43.125  80.158 156.736  1.00  0.97           N  
ATOM   3461  CA  CYS A 446      42.029  81.111 156.697  1.00  0.97           C  
ATOM   3462  C   CYS A 446      41.667  81.742 158.037  1.00  0.97           C  
ATOM   3463  O   CYS A 446      41.371  82.932 158.097  1.00  0.97           O  
ATOM   3464  CB  CYS A 446      40.743  80.455 156.142  1.00  0.97           C  
ATOM   3465  SG  CYS A 446      40.735  80.279 154.339  1.00  0.97           S  
ATOM   3466  N   ILE A 447      41.645  80.972 159.145  1.00  0.94           N  
ATOM   3467  CA  ILE A 447      41.333  81.487 160.478  1.00  0.94           C  
ATOM   3468  C   ILE A 447      42.393  82.453 160.988  1.00  0.94           C  
ATOM   3469  O   ILE A 447      42.086  83.538 161.486  1.00  0.94           O  
ATOM   3470  CB  ILE A 447      41.136  80.354 161.490  1.00  0.94           C  
ATOM   3471  CG1 ILE A 447      39.922  79.485 161.095  1.00  0.94           C  
ATOM   3472  CG2 ILE A 447      40.921  80.899 162.924  1.00  0.94           C  
ATOM   3473  CD1 ILE A 447      39.958  78.093 161.729  1.00  0.94           C  
ATOM   3474  N   ALA A 448      43.688  82.102 160.852  1.00  0.94           N  
ATOM   3475  CA  ALA A 448      44.782  82.959 161.272  1.00  0.94           C  
ATOM   3476  C   ALA A 448      44.885  84.239 160.442  1.00  0.94           C  
ATOM   3477  O   ALA A 448      45.067  85.325 160.983  1.00  0.94           O  
ATOM   3478  CB  ALA A 448      46.106  82.167 161.263  1.00  0.94           C  
ATOM   3479  N   GLY A 449      44.720  84.139 159.106  1.00  0.96           N  
ATOM   3480  CA  GLY A 449      44.839  85.252 158.164  1.00  0.96           C  
ATOM   3481  C   GLY A 449      43.664  86.189 158.035  1.00  0.96           C  
ATOM   3482  O   GLY A 449      43.725  87.122 157.242  1.00  0.96           O  
ATOM   3483  N   SER A 450      42.566  85.955 158.770  1.00  0.96           N  
ATOM   3484  CA  SER A 450      41.331  86.734 158.687  1.00  0.96           C  
ATOM   3485  C   SER A 450      40.980  87.337 160.028  1.00  0.96           C  
ATOM   3486  O   SER A 450      41.289  86.752 161.060  1.00  0.96           O  
ATOM   3487  CB  SER A 450      40.119  85.831 158.343  1.00  0.96           C  
ATOM   3488  OG  SER A 450      40.145  85.394 156.985  1.00  0.96           O  
ATOM   3489  N   HIS A 451      40.299  88.508 160.088  1.00  0.94           N  
ATOM   3490  CA  HIS A 451      39.845  89.085 161.352  1.00  0.94           C  
ATOM   3491  C   HIS A 451      38.517  88.521 161.813  1.00  0.94           C  
ATOM   3492  O   HIS A 451      38.161  88.635 162.984  1.00  0.94           O  
ATOM   3493  CB  HIS A 451      39.696  90.631 161.315  1.00  0.94           C  
ATOM   3494  CG  HIS A 451      38.595  91.158 160.439  1.00  0.94           C  
ATOM   3495  ND1 HIS A 451      38.816  91.249 159.089  1.00  0.94           N  
ATOM   3496  CD2 HIS A 451      37.342  91.597 160.740  1.00  0.94           C  
ATOM   3497  CE1 HIS A 451      37.707  91.741 158.579  1.00  0.94           C  
ATOM   3498  NE2 HIS A 451      36.777  91.971 159.537  1.00  0.94           N  
ATOM   3499  N   ALA A 452      37.766  87.877 160.905  1.00  0.97           N  
ATOM   3500  CA  ALA A 452      36.460  87.340 161.201  1.00  0.97           C  
ATOM   3501  C   ALA A 452      36.266  85.996 160.525  1.00  0.97           C  
ATOM   3502  O   ALA A 452      36.642  85.780 159.372  1.00  0.97           O  
ATOM   3503  CB  ALA A 452      35.347  88.307 160.751  1.00  0.97           C  
ATOM   3504  N   VAL A 453      35.679  85.044 161.268  1.00  0.96           N  
ATOM   3505  CA  VAL A 453      35.349  83.716 160.790  1.00  0.96           C  
ATOM   3506  C   VAL A 453      33.888  83.483 161.084  1.00  0.96           C  
ATOM   3507  O   VAL A 453      33.433  83.699 162.205  1.00  0.96           O  
ATOM   3508  CB  VAL A 453      36.169  82.624 161.476  1.00  0.96           C  
ATOM   3509  CG1 VAL A 453      35.735  81.224 160.991  1.00  0.96           C  
ATOM   3510  CG2 VAL A 453      37.661  82.847 161.171  1.00  0.96           C  
ATOM   3511  N   ASN A 454      33.087  83.030 160.101  1.00  0.94           N  
ATOM   3512  CA  ASN A 454      31.696  82.725 160.376  1.00  0.94           C  
ATOM   3513  C   ASN A 454      31.219  81.403 159.807  1.00  0.94           C  
ATOM   3514  O   ASN A 454      31.662  80.937 158.759  1.00  0.94           O  
ATOM   3515  CB  ASN A 454      30.740  83.885 159.973  1.00  0.94           C  
ATOM   3516  CG  ASN A 454      30.618  84.085 158.464  1.00  0.94           C  
ATOM   3517  OD1 ASN A 454      31.376  84.818 157.833  1.00  0.94           O  
ATOM   3518  ND2 ASN A 454      29.591  83.439 157.867  1.00  0.94           N  
ATOM   3519  N   GLY A 455      30.248  80.789 160.511  1.00  0.95           N  
ATOM   3520  CA  GLY A 455      29.397  79.738 159.965  1.00  0.95           C  
ATOM   3521  C   GLY A 455      28.115  80.303 159.416  1.00  0.95           C  
ATOM   3522  O   GLY A 455      27.864  81.509 159.500  1.00  0.95           O  
ATOM   3523  N   VAL A 456      27.271  79.429 158.840  1.00  0.95           N  
ATOM   3524  CA  VAL A 456      26.160  79.843 157.985  1.00  0.95           C  
ATOM   3525  C   VAL A 456      24.770  79.530 158.545  1.00  0.95           C  
ATOM   3526  O   VAL A 456      23.750  79.760 157.887  1.00  0.95           O  
ATOM   3527  CB  VAL A 456      26.295  79.211 156.604  1.00  0.95           C  
ATOM   3528  CG1 VAL A 456      27.422  79.916 155.829  1.00  0.95           C  
ATOM   3529  CG2 VAL A 456      26.601  77.707 156.695  1.00  0.95           C  
ATOM   3530  N   ALA A 457      24.692  79.038 159.794  1.00  0.95           N  
ATOM   3531  CA  ALA A 457      23.472  78.874 160.569  1.00  0.95           C  
ATOM   3532  C   ALA A 457      23.903  78.832 162.024  1.00  0.95           C  
ATOM   3533  O   ALA A 457      25.075  78.568 162.298  1.00  0.95           O  
ATOM   3534  CB  ALA A 457      22.709  77.577 160.228  1.00  0.95           C  
ATOM   3535  N   ARG A 458      23.008  79.117 162.998  1.00  0.87           N  
ATOM   3536  CA  ARG A 458      23.370  79.243 164.414  1.00  0.87           C  
ATOM   3537  C   ARG A 458      24.027  77.995 164.996  1.00  0.87           C  
ATOM   3538  O   ARG A 458      25.112  78.053 165.575  1.00  0.87           O  
ATOM   3539  CB  ARG A 458      22.109  79.551 165.270  1.00  0.87           C  
ATOM   3540  CG  ARG A 458      21.623  81.009 165.164  1.00  0.87           C  
ATOM   3541  CD  ARG A 458      20.316  81.291 165.921  1.00  0.87           C  
ATOM   3542  NE  ARG A 458      20.036  82.745 165.679  1.00  0.87           N  
ATOM   3543  CZ  ARG A 458      18.948  83.386 166.118  1.00  0.87           C  
ATOM   3544  NH1 ARG A 458      18.876  84.711 165.999  1.00  0.87           N  
ATOM   3545  NH2 ARG A 458      17.924  82.770 166.683  1.00  0.87           N  
ATOM   3546  N   ILE A 459      23.403  76.828 164.753  1.00  0.89           N  
ATOM   3547  CA  ILE A 459      23.864  75.500 165.130  1.00  0.89           C  
ATOM   3548  C   ILE A 459      25.224  75.152 164.526  1.00  0.89           C  
ATOM   3549  O   ILE A 459      26.123  74.641 165.190  1.00  0.89           O  
ATOM   3550  CB  ILE A 459      22.788  74.475 164.742  1.00  0.89           C  
ATOM   3551  CG1 ILE A 459      23.127  73.045 165.223  1.00  0.89           C  
ATOM   3552  CG2 ILE A 459      22.487  74.518 163.226  1.00  0.89           C  
ATOM   3553  CD1 ILE A 459      21.978  72.052 165.013  1.00  0.89           C  
ATOM   3554  N   HIS A 460      25.444  75.473 163.234  1.00  0.89           N  
ATOM   3555  CA  HIS A 460      26.706  75.262 162.548  1.00  0.89           C  
ATOM   3556  C   HIS A 460      27.822  76.127 163.088  1.00  0.89           C  
ATOM   3557  O   HIS A 460      28.909  75.636 163.378  1.00  0.89           O  
ATOM   3558  CB  HIS A 460      26.547  75.537 161.040  1.00  0.89           C  
ATOM   3559  CG  HIS A 460      27.795  75.367 160.228  1.00  0.89           C  
ATOM   3560  ND1 HIS A 460      28.213  76.388 159.396  1.00  0.89           N  
ATOM   3561  CD2 HIS A 460      28.583  74.271 160.068  1.00  0.89           C  
ATOM   3562  CE1 HIS A 460      29.243  75.884 158.741  1.00  0.89           C  
ATOM   3563  NE2 HIS A 460      29.510  74.610 159.109  1.00  0.89           N  
ATOM   3564  N   SER A 461      27.563  77.433 163.309  1.00  0.92           N  
ATOM   3565  CA  SER A 461      28.533  78.354 163.886  1.00  0.92           C  
ATOM   3566  C   SER A 461      28.977  77.941 165.270  1.00  0.92           C  
ATOM   3567  O   SER A 461      30.158  78.040 165.605  1.00  0.92           O  
ATOM   3568  CB  SER A 461      27.997  79.796 164.041  1.00  0.92           C  
ATOM   3569  OG  SER A 461      27.778  80.411 162.774  1.00  0.92           O  
ATOM   3570  N   GLU A 462      28.043  77.445 166.106  1.00  0.84           N  
ATOM   3571  CA  GLU A 462      28.332  76.919 167.425  1.00  0.84           C  
ATOM   3572  C   GLU A 462      29.290  75.737 167.396  1.00  0.84           C  
ATOM   3573  O   GLU A 462      30.277  75.715 168.123  1.00  0.84           O  
ATOM   3574  CB  GLU A 462      27.022  76.501 168.130  1.00  0.84           C  
ATOM   3575  CG  GLU A 462      27.218  76.078 169.608  1.00  0.84           C  
ATOM   3576  CD  GLU A 462      25.912  75.723 170.317  1.00  0.84           C  
ATOM   3577  OE1 GLU A 462      24.851  75.665 169.646  1.00  0.84           O  
ATOM   3578  OE2 GLU A 462      25.990  75.512 171.554  1.00  0.84           O  
ATOM   3579  N   ILE A 463      29.072  74.761 166.488  1.00  0.84           N  
ATOM   3580  CA  ILE A 463      29.961  73.621 166.283  1.00  0.84           C  
ATOM   3581  C   ILE A 463      31.332  74.038 165.756  1.00  0.84           C  
ATOM   3582  O   ILE A 463      32.362  73.551 166.225  1.00  0.84           O  
ATOM   3583  CB  ILE A 463      29.316  72.567 165.378  1.00  0.84           C  
ATOM   3584  CG1 ILE A 463      28.025  72.025 166.042  1.00  0.84           C  
ATOM   3585  CG2 ILE A 463      30.292  71.398 165.096  1.00  0.84           C  
ATOM   3586  CD1 ILE A 463      27.109  71.254 165.083  1.00  0.84           C  
ATOM   3587  N   LEU A 464      31.403  74.983 164.790  1.00  0.86           N  
ATOM   3588  CA  LEU A 464      32.658  75.524 164.283  1.00  0.86           C  
ATOM   3589  C   LEU A 464      33.476  76.207 165.362  1.00  0.86           C  
ATOM   3590  O   LEU A 464      34.673  75.964 165.500  1.00  0.86           O  
ATOM   3591  CB  LEU A 464      32.426  76.580 163.169  1.00  0.86           C  
ATOM   3592  CG  LEU A 464      31.811  76.057 161.858  1.00  0.86           C  
ATOM   3593  CD1 LEU A 464      31.607  77.235 160.902  1.00  0.86           C  
ATOM   3594  CD2 LEU A 464      32.658  74.965 161.199  1.00  0.86           C  
ATOM   3595  N   LYS A 465      32.816  77.053 166.179  1.00  0.78           N  
ATOM   3596  CA  LYS A 465      33.426  77.701 167.313  1.00  0.78           C  
ATOM   3597  C   LYS A 465      33.762  76.689 168.400  1.00  0.78           C  
ATOM   3598  O   LYS A 465      34.913  76.365 168.624  1.00  0.78           O  
ATOM   3599  CB  LYS A 465      32.491  78.813 167.864  1.00  0.78           C  
ATOM   3600  CG  LYS A 465      33.133  79.735 168.913  1.00  0.78           C  
ATOM   3601  CD  LYS A 465      32.173  80.854 169.351  1.00  0.78           C  
ATOM   3602  CE  LYS A 465      32.810  81.844 170.332  1.00  0.78           C  
ATOM   3603  NZ  LYS A 465      31.841  82.898 170.706  1.00  0.78           N  
ATOM   3604  N   LYS A 466      32.783  76.091 169.092  1.00  0.73           N  
ATOM   3605  CA  LYS A 466      33.043  75.362 170.317  1.00  0.73           C  
ATOM   3606  C   LYS A 466      33.642  73.976 170.145  1.00  0.73           C  
ATOM   3607  O   LYS A 466      34.208  73.450 171.101  1.00  0.73           O  
ATOM   3608  CB  LYS A 466      31.748  75.256 171.158  1.00  0.73           C  
ATOM   3609  CG  LYS A 466      31.231  76.601 171.711  1.00  0.73           C  
ATOM   3610  CD  LYS A 466      32.116  77.228 172.808  1.00  0.73           C  
ATOM   3611  CE  LYS A 466      32.089  76.468 174.142  1.00  0.73           C  
ATOM   3612  NZ  LYS A 466      33.057  77.070 175.087  1.00  0.73           N  
ATOM   3613  N   THR A 467      33.559  73.364 168.948  1.00  0.81           N  
ATOM   3614  CA  THR A 467      34.046  72.001 168.717  1.00  0.81           C  
ATOM   3615  C   THR A 467      35.168  71.952 167.697  1.00  0.81           C  
ATOM   3616  O   THR A 467      36.304  71.640 168.045  1.00  0.81           O  
ATOM   3617  CB  THR A 467      32.941  71.033 168.298  1.00  0.81           C  
ATOM   3618  OG1 THR A 467      31.968  70.953 169.326  1.00  0.81           O  
ATOM   3619  CG2 THR A 467      33.458  69.601 168.096  1.00  0.81           C  
ATOM   3620  N   ILE A 468      34.903  72.211 166.393  1.00  0.84           N  
ATOM   3621  CA  ILE A 468      35.865  71.981 165.304  1.00  0.84           C  
ATOM   3622  C   ILE A 468      37.131  72.824 165.415  1.00  0.84           C  
ATOM   3623  O   ILE A 468      38.244  72.321 165.268  1.00  0.84           O  
ATOM   3624  CB  ILE A 468      35.208  72.169 163.925  1.00  0.84           C  
ATOM   3625  CG1 ILE A 468      34.216  71.010 163.664  1.00  0.84           C  
ATOM   3626  CG2 ILE A 468      36.247  72.248 162.777  1.00  0.84           C  
ATOM   3627  CD1 ILE A 468      33.302  71.214 162.448  1.00  0.84           C  
ATOM   3628  N   PHE A 469      37.004  74.129 165.716  1.00  0.89           N  
ATOM   3629  CA  PHE A 469      38.137  75.029 165.817  1.00  0.89           C  
ATOM   3630  C   PHE A 469      38.283  75.515 167.242  1.00  0.89           C  
ATOM   3631  O   PHE A 469      38.645  76.664 167.493  1.00  0.89           O  
ATOM   3632  CB  PHE A 469      38.013  76.227 164.839  1.00  0.89           C  
ATOM   3633  CG  PHE A 469      37.988  75.731 163.419  1.00  0.89           C  
ATOM   3634  CD1 PHE A 469      36.890  76.008 162.587  1.00  0.89           C  
ATOM   3635  CD2 PHE A 469      39.058  74.974 162.906  1.00  0.89           C  
ATOM   3636  CE1 PHE A 469      36.851  75.524 161.273  1.00  0.89           C  
ATOM   3637  CE2 PHE A 469      39.016  74.476 161.596  1.00  0.89           C  
ATOM   3638  CZ  PHE A 469      37.910  74.750 160.781  1.00  0.89           C  
ATOM   3639  N   LYS A 470      38.021  74.621 168.221  1.00  0.84           N  
ATOM   3640  CA  LYS A 470      37.966  74.910 169.644  1.00  0.84           C  
ATOM   3641  C   LYS A 470      39.207  75.583 170.182  1.00  0.84           C  
ATOM   3642  O   LYS A 470      39.139  76.593 170.877  1.00  0.84           O  
ATOM   3643  CB  LYS A 470      37.766  73.601 170.457  1.00  0.84           C  
ATOM   3644  CG  LYS A 470      37.500  73.829 171.960  1.00  0.84           C  
ATOM   3645  CD  LYS A 470      37.385  72.563 172.824  1.00  0.84           C  
ATOM   3646  CE  LYS A 470      38.717  71.949 173.278  1.00  0.84           C  
ATOM   3647  NZ  LYS A 470      39.426  72.808 174.253  1.00  0.84           N  
ATOM   3648  N   ASP A 471      40.391  75.069 169.808  1.00  0.89           N  
ATOM   3649  CA  ASP A 471      41.656  75.644 170.194  1.00  0.89           C  
ATOM   3650  C   ASP A 471      41.834  77.090 169.722  1.00  0.89           C  
ATOM   3651  O   ASP A 471      42.418  77.905 170.434  1.00  0.89           O  
ATOM   3652  CB  ASP A 471      42.817  74.770 169.674  1.00  0.89           C  
ATOM   3653  CG  ASP A 471      42.793  73.411 170.335  1.00  0.89           C  
ATOM   3654  OD1 ASP A 471      42.881  73.355 171.588  1.00  0.89           O  
ATOM   3655  OD2 ASP A 471      42.726  72.376 169.626  1.00  0.89           O  
ATOM   3656  N   PHE A 472      41.333  77.432 168.515  1.00  0.90           N  
ATOM   3657  CA  PHE A 472      41.366  78.770 167.948  1.00  0.90           C  
ATOM   3658  C   PHE A 472      40.471  79.804 168.648  1.00  0.90           C  
ATOM   3659  O   PHE A 472      40.932  80.908 168.932  1.00  0.90           O  
ATOM   3660  CB  PHE A 472      41.025  78.771 166.425  1.00  0.90           C  
ATOM   3661  CG  PHE A 472      42.046  78.010 165.610  1.00  0.90           C  
ATOM   3662  CD1 PHE A 472      41.983  76.609 165.507  1.00  0.90           C  
ATOM   3663  CD2 PHE A 472      43.065  78.688 164.916  1.00  0.90           C  
ATOM   3664  CE1 PHE A 472      42.928  75.899 164.755  1.00  0.90           C  
ATOM   3665  CE2 PHE A 472      44.020  77.980 164.170  1.00  0.90           C  
ATOM   3666  CZ  PHE A 472      43.954  76.585 164.095  1.00  0.90           C  
ATOM   3667  N   TYR A 473      39.182  79.513 168.984  1.00  0.87           N  
ATOM   3668  CA  TYR A 473      38.334  80.524 169.635  1.00  0.87           C  
ATOM   3669  C   TYR A 473      38.778  80.881 171.044  1.00  0.87           C  
ATOM   3670  O   TYR A 473      38.519  81.983 171.514  1.00  0.87           O  
ATOM   3671  CB  TYR A 473      36.795  80.247 169.652  1.00  0.87           C  
ATOM   3672  CG  TYR A 473      36.341  79.340 170.766  1.00  0.87           C  
ATOM   3673  CD1 TYR A 473      36.107  79.842 172.058  1.00  0.87           C  
ATOM   3674  CD2 TYR A 473      36.320  77.969 170.574  1.00  0.87           C  
ATOM   3675  CE1 TYR A 473      35.864  78.979 173.135  1.00  0.87           C  
ATOM   3676  CE2 TYR A 473      35.981  77.105 171.624  1.00  0.87           C  
ATOM   3677  CZ  TYR A 473      35.796  77.600 172.916  1.00  0.87           C  
ATOM   3678  OH  TYR A 473      35.594  76.698 173.982  1.00  0.87           O  
ATOM   3679  N   GLU A 474      39.408  79.942 171.773  1.00  0.79           N  
ATOM   3680  CA  GLU A 474      39.922  80.169 173.110  1.00  0.79           C  
ATOM   3681  C   GLU A 474      40.945  81.293 173.145  1.00  0.79           C  
ATOM   3682  O   GLU A 474      40.968  82.105 174.067  1.00  0.79           O  
ATOM   3683  CB  GLU A 474      40.569  78.862 173.619  1.00  0.79           C  
ATOM   3684  CG  GLU A 474      39.515  77.762 173.938  1.00  0.79           C  
ATOM   3685  CD  GLU A 474      40.090  76.390 174.282  1.00  0.79           C  
ATOM   3686  OE1 GLU A 474      41.322  76.278 174.467  1.00  0.79           O  
ATOM   3687  OE2 GLU A 474      39.342  75.384 174.396  1.00  0.79           O  
ATOM   3688  N   LEU A 475      41.807  81.377 172.113  1.00  0.77           N  
ATOM   3689  CA  LEU A 475      42.696  82.508 171.912  1.00  0.77           C  
ATOM   3690  C   LEU A 475      41.989  83.807 171.524  1.00  0.77           C  
ATOM   3691  O   LEU A 475      42.319  84.871 172.044  1.00  0.77           O  
ATOM   3692  CB  LEU A 475      43.781  82.199 170.843  1.00  0.77           C  
ATOM   3693  CG  LEU A 475      45.017  81.439 171.378  1.00  0.77           C  
ATOM   3694  CD1 LEU A 475      44.699  80.012 171.840  1.00  0.77           C  
ATOM   3695  CD2 LEU A 475      46.129  81.397 170.320  1.00  0.77           C  
ATOM   3696  N   GLU A 476      41.013  83.768 170.595  1.00  0.81           N  
ATOM   3697  CA  GLU A 476      40.415  84.977 170.043  1.00  0.81           C  
ATOM   3698  C   GLU A 476      38.887  84.864 169.879  1.00  0.81           C  
ATOM   3699  O   GLU A 476      38.377  84.558 168.795  1.00  0.81           O  
ATOM   3700  CB  GLU A 476      41.146  85.360 168.725  1.00  0.81           C  
ATOM   3701  CG  GLU A 476      41.457  84.167 167.783  1.00  0.81           C  
ATOM   3702  CD  GLU A 476      42.346  84.526 166.611  1.00  0.81           C  
ATOM   3703  OE1 GLU A 476      42.647  83.625 165.780  1.00  0.81           O  
ATOM   3704  OE2 GLU A 476      42.702  85.717 166.434  1.00  0.81           O  
ATOM   3705  N   PRO A 477      38.081  85.122 170.929  1.00  0.90           N  
ATOM   3706  CA  PRO A 477      36.650  84.806 170.917  1.00  0.90           C  
ATOM   3707  C   PRO A 477      35.812  85.694 170.030  1.00  0.90           C  
ATOM   3708  O   PRO A 477      34.700  85.295 169.680  1.00  0.90           O  
ATOM   3709  CB  PRO A 477      36.203  84.993 172.379  1.00  0.90           C  
ATOM   3710  CG  PRO A 477      37.463  84.705 173.190  1.00  0.90           C  
ATOM   3711  CD  PRO A 477      38.572  85.277 172.306  1.00  0.90           C  
ATOM   3712  N   HIS A 478      36.285  86.914 169.719  1.00  0.83           N  
ATOM   3713  CA  HIS A 478      35.563  87.917 168.961  1.00  0.83           C  
ATOM   3714  C   HIS A 478      35.650  87.685 167.465  1.00  0.83           C  
ATOM   3715  O   HIS A 478      34.854  88.212 166.691  1.00  0.83           O  
ATOM   3716  CB  HIS A 478      36.138  89.318 169.293  1.00  0.83           C  
ATOM   3717  CG  HIS A 478      37.599  89.481 168.968  1.00  0.83           C  
ATOM   3718  ND1 HIS A 478      38.553  88.817 169.719  1.00  0.83           N  
ATOM   3719  CD2 HIS A 478      38.196  90.216 167.994  1.00  0.83           C  
ATOM   3720  CE1 HIS A 478      39.711  89.167 169.192  1.00  0.83           C  
ATOM   3721  NE2 HIS A 478      39.551  90.010 168.144  1.00  0.83           N  
ATOM   3722  N   LYS A 479      36.617  86.859 167.029  1.00  0.89           N  
ATOM   3723  CA  LYS A 479      36.787  86.442 165.654  1.00  0.89           C  
ATOM   3724  C   LYS A 479      35.640  85.584 165.129  1.00  0.89           C  
ATOM   3725  O   LYS A 479      35.214  85.715 163.982  1.00  0.89           O  
ATOM   3726  CB  LYS A 479      38.135  85.690 165.527  1.00  0.89           C  
ATOM   3727  CG  LYS A 479      38.452  85.220 164.099  1.00  0.89           C  
ATOM   3728  CD  LYS A 479      39.891  84.724 163.915  1.00  0.89           C  
ATOM   3729  CE  LYS A 479      40.922  85.851 163.974  1.00  0.89           C  
ATOM   3730  NZ  LYS A 479      42.256  85.304 163.659  1.00  0.89           N  
ATOM   3731  N   PHE A 480      35.106  84.668 165.961  1.00  0.91           N  
ATOM   3732  CA  PHE A 480      34.152  83.666 165.516  1.00  0.91           C  
ATOM   3733  C   PHE A 480      32.700  84.099 165.679  1.00  0.91           C  
ATOM   3734  O   PHE A 480      32.185  84.268 166.786  1.00  0.91           O  
ATOM   3735  CB  PHE A 480      34.338  82.321 166.262  1.00  0.91           C  
ATOM   3736  CG  PHE A 480      35.540  81.574 165.750  1.00  0.91           C  
ATOM   3737  CD1 PHE A 480      36.842  81.919 166.157  1.00  0.91           C  
ATOM   3738  CD2 PHE A 480      35.368  80.488 164.873  1.00  0.91           C  
ATOM   3739  CE1 PHE A 480      37.949  81.193 165.698  1.00  0.91           C  
ATOM   3740  CE2 PHE A 480      36.471  79.757 164.415  1.00  0.91           C  
ATOM   3741  CZ  PHE A 480      37.761  80.111 164.828  1.00  0.91           C  
ATOM   3742  N   GLN A 481      31.997  84.233 164.539  1.00  0.89           N  
ATOM   3743  CA  GLN A 481      30.661  84.777 164.432  1.00  0.89           C  
ATOM   3744  C   GLN A 481      29.667  83.820 163.761  1.00  0.89           C  
ATOM   3745  O   GLN A 481      29.973  82.749 163.232  1.00  0.89           O  
ATOM   3746  CB  GLN A 481      30.684  86.091 163.596  1.00  0.89           C  
ATOM   3747  CG  GLN A 481      31.513  87.253 164.203  1.00  0.89           C  
ATOM   3748  CD  GLN A 481      31.412  88.501 163.318  1.00  0.89           C  
ATOM   3749  OE1 GLN A 481      30.402  88.705 162.638  1.00  0.89           O  
ATOM   3750  NE2 GLN A 481      32.463  89.350 163.326  1.00  0.89           N  
ATOM   3751  N   ASN A 482      28.384  84.216 163.765  1.00  0.91           N  
ATOM   3752  CA  ASN A 482      27.326  83.584 163.010  1.00  0.91           C  
ATOM   3753  C   ASN A 482      26.807  84.587 162.002  1.00  0.91           C  
ATOM   3754  O   ASN A 482      26.619  85.760 162.313  1.00  0.91           O  
ATOM   3755  CB  ASN A 482      26.208  83.071 163.972  1.00  0.91           C  
ATOM   3756  CG  ASN A 482      24.926  82.652 163.258  1.00  0.91           C  
ATOM   3757  OD1 ASN A 482      23.849  83.179 163.527  1.00  0.91           O  
ATOM   3758  ND2 ASN A 482      25.051  81.731 162.285  1.00  0.91           N  
ATOM   3759  N   LYS A 483      26.584  84.133 160.755  1.00  0.91           N  
ATOM   3760  CA  LYS A 483      25.817  84.878 159.783  1.00  0.91           C  
ATOM   3761  C   LYS A 483      24.886  83.901 159.091  1.00  0.91           C  
ATOM   3762  O   LYS A 483      25.235  83.329 158.063  1.00  0.91           O  
ATOM   3763  CB  LYS A 483      26.728  85.552 158.720  1.00  0.91           C  
ATOM   3764  CG  LYS A 483      27.706  86.594 159.278  1.00  0.91           C  
ATOM   3765  CD  LYS A 483      26.989  87.893 159.667  1.00  0.91           C  
ATOM   3766  CE  LYS A 483      27.815  88.782 160.595  1.00  0.91           C  
ATOM   3767  NZ  LYS A 483      27.687  88.326 161.982  1.00  0.91           N  
ATOM   3768  N   THR A 484      23.671  83.667 159.649  1.00  0.96           N  
ATOM   3769  CA  THR A 484      22.673  82.745 159.089  1.00  0.96           C  
ATOM   3770  C   THR A 484      22.331  83.089 157.657  1.00  0.96           C  
ATOM   3771  O   THR A 484      21.964  84.225 157.361  1.00  0.96           O  
ATOM   3772  CB  THR A 484      21.376  82.664 159.903  1.00  0.96           C  
ATOM   3773  OG1 THR A 484      21.697  82.287 161.231  1.00  0.96           O  
ATOM   3774  CG2 THR A 484      20.380  81.632 159.342  1.00  0.96           C  
ATOM   3775  N   ASN A 485      22.483  82.125 156.725  1.00  0.95           N  
ATOM   3776  CA  ASN A 485      22.158  82.253 155.311  1.00  0.95           C  
ATOM   3777  C   ASN A 485      20.819  82.892 154.977  1.00  0.95           C  
ATOM   3778  O   ASN A 485      19.905  83.034 155.790  1.00  0.95           O  
ATOM   3779  CB  ASN A 485      22.258  80.907 154.542  1.00  0.95           C  
ATOM   3780  CG  ASN A 485      23.712  80.534 154.305  1.00  0.95           C  
ATOM   3781  OD1 ASN A 485      24.635  81.324 154.490  1.00  0.95           O  
ATOM   3782  ND2 ASN A 485      23.923  79.290 153.819  1.00  0.95           N  
ATOM   3783  N   GLY A 486      20.697  83.324 153.716  1.00  0.98           N  
ATOM   3784  CA  GLY A 486      19.444  83.820 153.204  1.00  0.98           C  
ATOM   3785  C   GLY A 486      19.393  83.609 151.726  1.00  0.98           C  
ATOM   3786  O   GLY A 486      20.373  83.208 151.101  1.00  0.98           O  
ATOM   3787  N   ILE A 487      18.238  83.913 151.129  1.00  0.97           N  
ATOM   3788  CA  ILE A 487      17.982  83.806 149.709  1.00  0.97           C  
ATOM   3789  C   ILE A 487      17.402  85.112 149.213  1.00  0.97           C  
ATOM   3790  O   ILE A 487      16.774  85.862 149.954  1.00  0.97           O  
ATOM   3791  CB  ILE A 487      16.994  82.695 149.385  1.00  0.97           C  
ATOM   3792  CG1 ILE A 487      15.746  82.773 150.295  1.00  0.97           C  
ATOM   3793  CG2 ILE A 487      17.722  81.345 149.551  1.00  0.97           C  
ATOM   3794  CD1 ILE A 487      14.524  82.107 149.672  1.00  0.97           C  
ATOM   3795  N   THR A 488      17.600  85.450 147.925  1.00  0.98           N  
ATOM   3796  CA  THR A 488      17.036  86.690 147.397  1.00  0.98           C  
ATOM   3797  C   THR A 488      15.544  86.551 147.097  1.00  0.98           C  
ATOM   3798  O   THR A 488      15.151  85.644 146.354  1.00  0.98           O  
ATOM   3799  CB  THR A 488      17.774  87.302 146.200  1.00  0.98           C  
ATOM   3800  OG1 THR A 488      17.061  88.396 145.635  1.00  0.98           O  
ATOM   3801  CG2 THR A 488      17.982  86.293 145.065  1.00  0.98           C  
ATOM   3802  N   PRO A 489      14.663  87.419 147.602  1.00  0.99           N  
ATOM   3803  CA  PRO A 489      13.249  87.364 147.267  1.00  0.99           C  
ATOM   3804  C   PRO A 489      12.990  87.865 145.857  1.00  0.99           C  
ATOM   3805  O   PRO A 489      11.864  87.753 145.380  1.00  0.99           O  
ATOM   3806  CB  PRO A 489      12.597  88.257 148.336  1.00  0.99           C  
ATOM   3807  CG  PRO A 489      13.672  89.290 148.685  1.00  0.99           C  
ATOM   3808  CD  PRO A 489      14.963  88.480 148.576  1.00  0.99           C  
ATOM   3809  N   ARG A 490      13.982  88.424 145.135  1.00  0.92           N  
ATOM   3810  CA  ARG A 490      13.765  88.810 143.752  1.00  0.92           C  
ATOM   3811  C   ARG A 490      13.704  87.588 142.848  1.00  0.92           C  
ATOM   3812  O   ARG A 490      12.709  87.341 142.171  1.00  0.92           O  
ATOM   3813  CB  ARG A 490      14.878  89.759 143.241  1.00  0.92           C  
ATOM   3814  CG  ARG A 490      14.703  91.240 143.639  1.00  0.92           C  
ATOM   3815  CD  ARG A 490      14.730  91.593 145.129  1.00  0.92           C  
ATOM   3816  NE  ARG A 490      16.118  91.408 145.617  1.00  0.92           N  
ATOM   3817  CZ  ARG A 490      16.522  91.747 146.846  1.00  0.92           C  
ATOM   3818  NH1 ARG A 490      15.707  92.241 147.762  1.00  0.92           N  
ATOM   3819  NH2 ARG A 490      17.800  91.576 147.148  1.00  0.92           N  
ATOM   3820  N   ARG A 491      14.743  86.733 142.861  1.00  0.93           N  
ATOM   3821  CA  ARG A 491      14.715  85.494 142.102  1.00  0.93           C  
ATOM   3822  C   ARG A 491      13.775  84.459 142.705  1.00  0.93           C  
ATOM   3823  O   ARG A 491      13.029  83.785 142.001  1.00  0.93           O  
ATOM   3824  CB  ARG A 491      16.135  84.911 141.909  1.00  0.93           C  
ATOM   3825  CG  ARG A 491      16.177  83.707 140.946  1.00  0.93           C  
ATOM   3826  CD  ARG A 491      17.577  83.172 140.647  1.00  0.93           C  
ATOM   3827  NE  ARG A 491      18.330  84.226 139.884  1.00  0.93           N  
ATOM   3828  CZ  ARG A 491      18.450  84.219 138.552  1.00  0.93           C  
ATOM   3829  NH1 ARG A 491      17.840  83.341 137.768  1.00  0.93           N  
ATOM   3830  NH2 ARG A 491      19.200  85.151 137.969  1.00  0.93           N  
ATOM   3831  N   TRP A 492      13.763  84.323 144.045  1.00  0.93           N  
ATOM   3832  CA  TRP A 492      13.085  83.215 144.697  1.00  0.93           C  
ATOM   3833  C   TRP A 492      11.704  83.568 145.220  1.00  0.93           C  
ATOM   3834  O   TRP A 492      11.125  82.825 146.007  1.00  0.93           O  
ATOM   3835  CB  TRP A 492      13.966  82.595 145.811  1.00  0.93           C  
ATOM   3836  CG  TRP A 492      15.309  82.121 145.294  1.00  0.93           C  
ATOM   3837  CD1 TRP A 492      16.547  82.666 145.488  1.00  0.93           C  
ATOM   3838  CD2 TRP A 492      15.504  81.024 144.372  1.00  0.93           C  
ATOM   3839  NE1 TRP A 492      17.512  81.980 144.766  1.00  0.93           N  
ATOM   3840  CE2 TRP A 492      16.863  80.982 144.061  1.00  0.93           C  
ATOM   3841  CE3 TRP A 492      14.593  80.128 143.803  1.00  0.93           C  
ATOM   3842  CZ2 TRP A 492      17.375  80.044 143.164  1.00  0.93           C  
ATOM   3843  CZ3 TRP A 492      15.099  79.198 142.879  1.00  0.93           C  
ATOM   3844  CH2 TRP A 492      16.463  79.161 142.560  1.00  0.93           C  
ATOM   3845  N   LEU A 493      11.116  84.679 144.746  1.00  0.97           N  
ATOM   3846  CA  LEU A 493       9.700  84.947 144.923  1.00  0.97           C  
ATOM   3847  C   LEU A 493       9.168  85.688 143.715  1.00  0.97           C  
ATOM   3848  O   LEU A 493       8.318  85.163 143.005  1.00  0.97           O  
ATOM   3849  CB  LEU A 493       9.415  85.718 146.235  1.00  0.97           C  
ATOM   3850  CG  LEU A 493       7.945  86.102 146.502  1.00  0.97           C  
ATOM   3851  CD1 LEU A 493       7.007  84.887 146.507  1.00  0.97           C  
ATOM   3852  CD2 LEU A 493       7.850  86.833 147.845  1.00  0.97           C  
ATOM   3853  N   VAL A 494       9.651  86.917 143.419  1.00  0.95           N  
ATOM   3854  CA  VAL A 494       9.088  87.746 142.348  1.00  0.95           C  
ATOM   3855  C   VAL A 494       9.183  87.099 140.970  1.00  0.95           C  
ATOM   3856  O   VAL A 494       8.198  87.023 140.241  1.00  0.95           O  
ATOM   3857  CB  VAL A 494       9.740  89.135 142.309  1.00  0.95           C  
ATOM   3858  CG1 VAL A 494       9.113  90.035 141.222  1.00  0.95           C  
ATOM   3859  CG2 VAL A 494       9.582  89.823 143.681  1.00  0.95           C  
ATOM   3860  N   LEU A 495      10.367  86.569 140.606  1.00  0.94           N  
ATOM   3861  CA  LEU A 495      10.593  85.899 139.337  1.00  0.94           C  
ATOM   3862  C   LEU A 495       9.935  84.531 139.231  1.00  0.94           C  
ATOM   3863  O   LEU A 495       9.196  84.247 138.291  1.00  0.94           O  
ATOM   3864  CB  LEU A 495      12.132  85.763 139.180  1.00  0.94           C  
ATOM   3865  CG  LEU A 495      12.707  85.377 137.801  1.00  0.94           C  
ATOM   3866  CD1 LEU A 495      14.195  85.748 137.770  1.00  0.94           C  
ATOM   3867  CD2 LEU A 495      12.582  83.886 137.454  1.00  0.94           C  
ATOM   3868  N   CYS A 496      10.167  83.629 140.210  1.00  0.95           N  
ATOM   3869  CA  CYS A 496       9.677  82.264 140.114  1.00  0.95           C  
ATOM   3870  C   CYS A 496       8.182  82.128 140.352  1.00  0.95           C  
ATOM   3871  O   CYS A 496       7.520  81.256 139.794  1.00  0.95           O  
ATOM   3872  CB  CYS A 496      10.471  81.312 141.053  1.00  0.95           C  
ATOM   3873  SG  CYS A 496      10.276  81.630 142.840  1.00  0.95           S  
ATOM   3874  N   ASN A 497       7.604  83.003 141.190  1.00  0.94           N  
ATOM   3875  CA  ASN A 497       6.237  82.873 141.640  1.00  0.94           C  
ATOM   3876  C   ASN A 497       5.521  84.219 141.562  1.00  0.94           C  
ATOM   3877  O   ASN A 497       5.147  84.776 142.601  1.00  0.94           O  
ATOM   3878  CB  ASN A 497       6.286  82.325 143.085  1.00  0.94           C  
ATOM   3879  CG  ASN A 497       4.983  81.689 143.541  1.00  0.94           C  
ATOM   3880  OD1 ASN A 497       3.891  81.887 143.005  1.00  0.94           O  
ATOM   3881  ND2 ASN A 497       5.101  80.868 144.610  1.00  0.94           N  
ATOM   3882  N   PRO A 498       5.294  84.783 140.363  1.00  0.93           N  
ATOM   3883  CA  PRO A 498       4.683  86.100 140.201  1.00  0.93           C  
ATOM   3884  C   PRO A 498       3.301  86.165 140.828  1.00  0.93           C  
ATOM   3885  O   PRO A 498       2.989  87.168 141.459  1.00  0.93           O  
ATOM   3886  CB  PRO A 498       4.687  86.335 138.676  1.00  0.93           C  
ATOM   3887  CG  PRO A 498       4.771  84.932 138.060  1.00  0.93           C  
ATOM   3888  CD  PRO A 498       5.650  84.194 139.065  1.00  0.93           C  
ATOM   3889  N   GLY A 499       2.495  85.086 140.717  1.00  0.92           N  
ATOM   3890  CA  GLY A 499       1.215  84.886 141.402  1.00  0.92           C  
ATOM   3891  C   GLY A 499       1.235  85.099 142.898  1.00  0.92           C  
ATOM   3892  O   GLY A 499       0.453  85.871 143.442  1.00  0.92           O  
ATOM   3893  N   LEU A 500       2.139  84.430 143.642  1.00  0.92           N  
ATOM   3894  CA  LEU A 500       2.275  84.644 145.079  1.00  0.92           C  
ATOM   3895  C   LEU A 500       2.784  86.032 145.417  1.00  0.92           C  
ATOM   3896  O   LEU A 500       2.296  86.680 146.341  1.00  0.92           O  
ATOM   3897  CB  LEU A 500       3.181  83.572 145.737  1.00  0.92           C  
ATOM   3898  CG  LEU A 500       3.206  83.563 147.283  1.00  0.92           C  
ATOM   3899  CD1 LEU A 500       1.806  83.355 147.881  1.00  0.92           C  
ATOM   3900  CD2 LEU A 500       4.165  82.483 147.809  1.00  0.92           C  
ATOM   3901  N   ALA A 501       3.756  86.551 144.639  1.00  0.92           N  
ATOM   3902  CA  ALA A 501       4.266  87.896 144.810  1.00  0.92           C  
ATOM   3903  C   ALA A 501       3.191  88.977 144.644  1.00  0.92           C  
ATOM   3904  O   ALA A 501       3.103  89.901 145.452  1.00  0.92           O  
ATOM   3905  CB  ALA A 501       5.439  88.124 143.833  1.00  0.92           C  
ATOM   3906  N   GLU A 502       2.315  88.839 143.625  1.00  0.84           N  
ATOM   3907  CA  GLU A 502       1.156  89.681 143.382  1.00  0.84           C  
ATOM   3908  C   GLU A 502       0.132  89.631 144.512  1.00  0.84           C  
ATOM   3909  O   GLU A 502      -0.223  90.665 145.074  1.00  0.84           O  
ATOM   3910  CB  GLU A 502       0.544  89.241 142.028  1.00  0.84           C  
ATOM   3911  CG  GLU A 502      -0.582  90.120 141.436  1.00  0.84           C  
ATOM   3912  CD  GLU A 502      -0.821  89.743 139.972  1.00  0.84           C  
ATOM   3913  OE1 GLU A 502      -0.689  90.644 139.102  1.00  0.84           O  
ATOM   3914  OE2 GLU A 502      -1.089  88.543 139.706  1.00  0.84           O  
ATOM   3915  N   VAL A 503      -0.257  88.421 144.975  1.00  0.86           N  
ATOM   3916  CA  VAL A 503      -1.195  88.216 146.081  1.00  0.86           C  
ATOM   3917  C   VAL A 503      -0.715  88.827 147.398  1.00  0.86           C  
ATOM   3918  O   VAL A 503      -1.477  89.438 148.153  1.00  0.86           O  
ATOM   3919  CB  VAL A 503      -1.478  86.718 146.256  1.00  0.86           C  
ATOM   3920  CG1 VAL A 503      -2.213  86.386 147.574  1.00  0.86           C  
ATOM   3921  CG2 VAL A 503      -2.319  86.239 145.056  1.00  0.86           C  
ATOM   3922  N   ILE A 504       0.590  88.701 147.723  1.00  0.87           N  
ATOM   3923  CA  ILE A 504       1.187  89.377 148.872  1.00  0.87           C  
ATOM   3924  C   ILE A 504       1.162  90.898 148.715  1.00  0.87           C  
ATOM   3925  O   ILE A 504       0.762  91.625 149.627  1.00  0.87           O  
ATOM   3926  CB  ILE A 504       2.607  88.864 149.137  1.00  0.87           C  
ATOM   3927  CG1 ILE A 504       2.566  87.363 149.520  1.00  0.87           C  
ATOM   3928  CG2 ILE A 504       3.296  89.670 150.263  1.00  0.87           C  
ATOM   3929  CD1 ILE A 504       3.950  86.703 149.567  1.00  0.87           C  
ATOM   3930  N   ALA A 505       1.534  91.422 147.528  1.00  0.89           N  
ATOM   3931  CA  ALA A 505       1.565  92.843 147.238  1.00  0.89           C  
ATOM   3932  C   ALA A 505       0.208  93.533 147.313  1.00  0.89           C  
ATOM   3933  O   ALA A 505       0.086  94.624 147.870  1.00  0.89           O  
ATOM   3934  CB  ALA A 505       2.195  93.069 145.852  1.00  0.89           C  
ATOM   3935  N   GLU A 506      -0.858  92.887 146.803  1.00  0.81           N  
ATOM   3936  CA  GLU A 506      -2.231  93.354 146.895  1.00  0.81           C  
ATOM   3937  C   GLU A 506      -2.711  93.538 148.331  1.00  0.81           C  
ATOM   3938  O   GLU A 506      -3.454  94.465 148.646  1.00  0.81           O  
ATOM   3939  CB  GLU A 506      -3.182  92.348 146.207  1.00  0.81           C  
ATOM   3940  CG  GLU A 506      -3.078  92.300 144.665  1.00  0.81           C  
ATOM   3941  CD  GLU A 506      -4.087  91.297 144.117  1.00  0.81           C  
ATOM   3942  OE1 GLU A 506      -5.014  91.735 143.389  1.00  0.81           O  
ATOM   3943  OE2 GLU A 506      -3.967  90.096 144.474  1.00  0.81           O  
ATOM   3944  N   ARG A 507      -2.313  92.642 149.256  1.00  0.81           N  
ATOM   3945  CA  ARG A 507      -2.748  92.722 150.638  1.00  0.81           C  
ATOM   3946  C   ARG A 507      -1.869  93.569 151.552  1.00  0.81           C  
ATOM   3947  O   ARG A 507      -2.394  94.212 152.460  1.00  0.81           O  
ATOM   3948  CB  ARG A 507      -2.904  91.309 151.249  1.00  0.81           C  
ATOM   3949  CG  ARG A 507      -3.973  90.434 150.554  1.00  0.81           C  
ATOM   3950  CD  ARG A 507      -5.411  90.960 150.651  1.00  0.81           C  
ATOM   3951  NE  ARG A 507      -6.295  89.966 149.953  1.00  0.81           N  
ATOM   3952  CZ  ARG A 507      -7.629  90.053 149.882  1.00  0.81           C  
ATOM   3953  NH1 ARG A 507      -8.332  89.089 149.287  1.00  0.81           N  
ATOM   3954  NH2 ARG A 507      -8.269  91.105 150.390  1.00  0.81           N  
ATOM   3955  N   ILE A 508      -0.523  93.592 151.391  1.00  0.87           N  
ATOM   3956  CA  ILE A 508       0.334  94.331 152.326  1.00  0.87           C  
ATOM   3957  C   ILE A 508       1.224  95.393 151.699  1.00  0.87           C  
ATOM   3958  O   ILE A 508       2.002  96.020 152.417  1.00  0.87           O  
ATOM   3959  CB  ILE A 508       1.206  93.427 153.210  1.00  0.87           C  
ATOM   3960  CG1 ILE A 508       2.163  92.520 152.405  1.00  0.87           C  
ATOM   3961  CG2 ILE A 508       0.286  92.587 154.120  1.00  0.87           C  
ATOM   3962  CD1 ILE A 508       3.357  92.028 153.232  1.00  0.87           C  
ATOM   3963  N   GLY A 509       1.100  95.673 150.385  1.00  0.89           N  
ATOM   3964  CA  GLY A 509       1.975  96.601 149.664  1.00  0.89           C  
ATOM   3965  C   GLY A 509       3.272  95.960 149.235  1.00  0.89           C  
ATOM   3966  O   GLY A 509       3.524  94.799 149.531  1.00  0.89           O  
ATOM   3967  N   GLU A 510       4.138  96.676 148.488  1.00  0.84           N  
ATOM   3968  CA  GLU A 510       5.309  96.053 147.877  1.00  0.84           C  
ATOM   3969  C   GLU A 510       6.616  96.243 148.634  1.00  0.84           C  
ATOM   3970  O   GLU A 510       7.659  95.730 148.226  1.00  0.84           O  
ATOM   3971  CB  GLU A 510       5.487  96.472 146.399  1.00  0.84           C  
ATOM   3972  CG  GLU A 510       5.529  97.994 146.116  1.00  0.84           C  
ATOM   3973  CD  GLU A 510       6.102  98.292 144.736  1.00  0.84           C  
ATOM   3974  OE1 GLU A 510       6.681  97.372 144.096  1.00  0.84           O  
ATOM   3975  OE2 GLU A 510       6.045  99.474 144.294  1.00  0.84           O  
ATOM   3976  N   ASP A 511       6.586  96.892 149.816  1.00  0.85           N  
ATOM   3977  CA  ASP A 511       7.735  97.091 150.689  1.00  0.85           C  
ATOM   3978  C   ASP A 511       8.440  95.799 151.114  1.00  0.85           C  
ATOM   3979  O   ASP A 511       9.644  95.774 151.369  1.00  0.85           O  
ATOM   3980  CB  ASP A 511       7.304  97.872 151.951  1.00  0.85           C  
ATOM   3981  CG  ASP A 511       6.922  99.293 151.580  1.00  0.85           C  
ATOM   3982  OD1 ASP A 511       5.881  99.769 152.096  1.00  0.85           O  
ATOM   3983  OD2 ASP A 511       7.658  99.905 150.765  1.00  0.85           O  
ATOM   3984  N   PHE A 512       7.719  94.655 151.140  1.00  0.90           N  
ATOM   3985  CA  PHE A 512       8.278  93.355 151.477  1.00  0.90           C  
ATOM   3986  C   PHE A 512       9.477  92.903 150.627  1.00  0.90           C  
ATOM   3987  O   PHE A 512      10.299  92.098 151.053  1.00  0.90           O  
ATOM   3988  CB  PHE A 512       7.200  92.233 151.574  1.00  0.90           C  
ATOM   3989  CG  PHE A 512       6.721  91.775 150.223  1.00  0.90           C  
ATOM   3990  CD1 PHE A 512       5.663  92.436 149.592  1.00  0.90           C  
ATOM   3991  CD2 PHE A 512       7.364  90.721 149.550  1.00  0.90           C  
ATOM   3992  CE1 PHE A 512       5.263  92.078 148.298  1.00  0.90           C  
ATOM   3993  CE2 PHE A 512       6.973  90.363 148.254  1.00  0.90           C  
ATOM   3994  CZ  PHE A 512       5.923  91.043 147.626  1.00  0.90           C  
ATOM   3995  N   ILE A 513       9.608  93.387 149.376  1.00  0.90           N  
ATOM   3996  CA  ILE A 513      10.701  93.013 148.486  1.00  0.90           C  
ATOM   3997  C   ILE A 513      12.059  93.526 148.970  1.00  0.90           C  
ATOM   3998  O   ILE A 513      13.091  92.893 148.737  1.00  0.90           O  
ATOM   3999  CB  ILE A 513      10.413  93.432 147.040  1.00  0.90           C  
ATOM   4000  CG1 ILE A 513       9.095  92.775 146.552  1.00  0.90           C  
ATOM   4001  CG2 ILE A 513      11.593  93.037 146.119  1.00  0.90           C  
ATOM   4002  CD1 ILE A 513       8.582  93.316 145.213  1.00  0.90           C  
ATOM   4003  N   SER A 514      12.097  94.691 149.653  1.00  0.87           N  
ATOM   4004  CA  SER A 514      13.318  95.291 150.177  1.00  0.87           C  
ATOM   4005  C   SER A 514      13.467  95.130 151.684  1.00  0.87           C  
ATOM   4006  O   SER A 514      14.570  95.288 152.204  1.00  0.87           O  
ATOM   4007  CB  SER A 514      13.349  96.811 149.849  1.00  0.87           C  
ATOM   4008  OG  SER A 514      12.137  97.442 150.264  1.00  0.87           O  
ATOM   4009  N   ASP A 515      12.382  94.779 152.398  1.00  0.84           N  
ATOM   4010  CA  ASP A 515      12.388  94.381 153.793  1.00  0.84           C  
ATOM   4011  C   ASP A 515      11.459  93.178 153.912  1.00  0.84           C  
ATOM   4012  O   ASP A 515      10.243  93.303 154.002  1.00  0.84           O  
ATOM   4013  CB  ASP A 515      11.904  95.561 154.697  1.00  0.84           C  
ATOM   4014  CG  ASP A 515      11.705  95.157 156.154  1.00  0.84           C  
ATOM   4015  OD1 ASP A 515      10.910  95.817 156.871  1.00  0.84           O  
ATOM   4016  OD2 ASP A 515      12.313  94.133 156.552  1.00  0.84           O  
ATOM   4017  N   LEU A 516      11.992  91.943 153.946  1.00  0.91           N  
ATOM   4018  CA  LEU A 516      11.146  90.759 153.915  1.00  0.91           C  
ATOM   4019  C   LEU A 516      10.505  90.478 155.268  1.00  0.91           C  
ATOM   4020  O   LEU A 516       9.530  89.735 155.380  1.00  0.91           O  
ATOM   4021  CB  LEU A 516      11.929  89.541 153.368  1.00  0.91           C  
ATOM   4022  CG  LEU A 516      11.067  88.404 152.766  1.00  0.91           C  
ATOM   4023  CD1 LEU A 516      10.372  88.840 151.468  1.00  0.91           C  
ATOM   4024  CD2 LEU A 516      11.902  87.141 152.498  1.00  0.91           C  
ATOM   4025  N   ASP A 517      10.969  91.154 156.339  1.00  0.88           N  
ATOM   4026  CA  ASP A 517      10.407  91.062 157.669  1.00  0.88           C  
ATOM   4027  C   ASP A 517       9.022  91.710 157.750  1.00  0.88           C  
ATOM   4028  O   ASP A 517       8.276  91.512 158.715  1.00  0.88           O  
ATOM   4029  CB  ASP A 517      11.371  91.697 158.696  1.00  0.88           C  
ATOM   4030  CG  ASP A 517      12.542  90.784 159.019  1.00  0.88           C  
ATOM   4031  OD1 ASP A 517      12.621  89.673 158.443  1.00  0.88           O  
ATOM   4032  OD2 ASP A 517      13.328  91.168 159.921  1.00  0.88           O  
ATOM   4033  N   GLN A 518       8.611  92.446 156.695  1.00  0.83           N  
ATOM   4034  CA  GLN A 518       7.256  92.928 156.502  1.00  0.83           C  
ATOM   4035  C   GLN A 518       6.245  91.826 156.197  1.00  0.83           C  
ATOM   4036  O   GLN A 518       5.038  92.036 156.330  1.00  0.83           O  
ATOM   4037  CB  GLN A 518       7.188  93.987 155.375  1.00  0.83           C  
ATOM   4038  CG  GLN A 518       7.971  95.278 155.704  1.00  0.83           C  
ATOM   4039  CD  GLN A 518       7.504  95.910 157.014  1.00  0.83           C  
ATOM   4040  OE1 GLN A 518       6.313  96.121 157.247  1.00  0.83           O  
ATOM   4041  NE2 GLN A 518       8.449  96.198 157.930  1.00  0.83           N  
ATOM   4042  N   LEU A 519       6.682  90.590 155.851  1.00  0.88           N  
ATOM   4043  CA  LEU A 519       5.774  89.460 155.664  1.00  0.88           C  
ATOM   4044  C   LEU A 519       5.029  89.066 156.937  1.00  0.88           C  
ATOM   4045  O   LEU A 519       3.954  88.473 156.878  1.00  0.88           O  
ATOM   4046  CB  LEU A 519       6.481  88.201 155.098  1.00  0.88           C  
ATOM   4047  CG  LEU A 519       6.999  88.328 153.648  1.00  0.88           C  
ATOM   4048  CD1 LEU A 519       7.613  86.998 153.191  1.00  0.88           C  
ATOM   4049  CD2 LEU A 519       5.896  88.729 152.660  1.00  0.88           C  
ATOM   4050  N   ARG A 520       5.521  89.482 158.127  1.00  0.80           N  
ATOM   4051  CA  ARG A 520       4.844  89.328 159.410  1.00  0.80           C  
ATOM   4052  C   ARG A 520       3.460  89.979 159.452  1.00  0.80           C  
ATOM   4053  O   ARG A 520       2.599  89.603 160.242  1.00  0.80           O  
ATOM   4054  CB  ARG A 520       5.703  89.908 160.565  1.00  0.80           C  
ATOM   4055  CG  ARG A 520       7.007  89.121 160.819  1.00  0.80           C  
ATOM   4056  CD  ARG A 520       7.878  89.682 161.949  1.00  0.80           C  
ATOM   4057  NE  ARG A 520       8.433  90.984 161.466  1.00  0.80           N  
ATOM   4058  CZ  ARG A 520       9.202  91.793 162.204  1.00  0.80           C  
ATOM   4059  NH1 ARG A 520       9.789  92.844 161.642  1.00  0.80           N  
ATOM   4060  NH2 ARG A 520       9.384  91.572 163.500  1.00  0.80           N  
ATOM   4061  N   LYS A 521       3.174  90.941 158.549  1.00  0.81           N  
ATOM   4062  CA  LYS A 521       1.860  91.541 158.400  1.00  0.81           C  
ATOM   4063  C   LYS A 521       0.823  90.589 157.799  1.00  0.81           C  
ATOM   4064  O   LYS A 521      -0.373  90.869 157.833  1.00  0.81           O  
ATOM   4065  CB  LYS A 521       1.920  92.824 157.527  1.00  0.81           C  
ATOM   4066  CG  LYS A 521       2.807  93.931 158.123  1.00  0.81           C  
ATOM   4067  CD  LYS A 521       3.040  95.154 157.211  1.00  0.81           C  
ATOM   4068  CE  LYS A 521       1.917  96.199 157.150  1.00  0.81           C  
ATOM   4069  NZ  LYS A 521       0.749  95.690 156.397  1.00  0.81           N  
ATOM   4070  N   LEU A 522       1.240  89.427 157.248  1.00  0.84           N  
ATOM   4071  CA  LEU A 522       0.329  88.410 156.749  1.00  0.84           C  
ATOM   4072  C   LEU A 522      -0.330  87.603 157.867  1.00  0.84           C  
ATOM   4073  O   LEU A 522      -1.342  86.938 157.652  1.00  0.84           O  
ATOM   4074  CB  LEU A 522       1.023  87.447 155.754  1.00  0.84           C  
ATOM   4075  CG  LEU A 522       1.489  88.113 154.440  1.00  0.84           C  
ATOM   4076  CD1 LEU A 522       2.372  87.148 153.635  1.00  0.84           C  
ATOM   4077  CD2 LEU A 522       0.307  88.589 153.579  1.00  0.84           C  
ATOM   4078  N   LEU A 523       0.182  87.697 159.117  1.00  0.82           N  
ATOM   4079  CA  LEU A 523      -0.416  87.094 160.304  1.00  0.82           C  
ATOM   4080  C   LEU A 523      -1.820  87.617 160.603  1.00  0.82           C  
ATOM   4081  O   LEU A 523      -2.636  86.940 161.223  1.00  0.82           O  
ATOM   4082  CB  LEU A 523       0.448  87.341 161.567  1.00  0.82           C  
ATOM   4083  CG  LEU A 523       1.863  86.724 161.537  1.00  0.82           C  
ATOM   4084  CD1 LEU A 523       2.667  87.212 162.751  1.00  0.82           C  
ATOM   4085  CD2 LEU A 523       1.838  85.189 161.517  1.00  0.82           C  
ATOM   4086  N   SER A 524      -2.149  88.834 160.129  1.00  0.80           N  
ATOM   4087  CA  SER A 524      -3.454  89.462 160.285  1.00  0.80           C  
ATOM   4088  C   SER A 524      -4.531  88.840 159.421  1.00  0.80           C  
ATOM   4089  O   SER A 524      -5.696  89.188 159.558  1.00  0.80           O  
ATOM   4090  CB  SER A 524      -3.441  90.972 159.928  1.00  0.80           C  
ATOM   4091  OG  SER A 524      -2.447  91.660 160.689  1.00  0.80           O  
ATOM   4092  N   PHE A 525      -4.173  87.932 158.490  1.00  0.82           N  
ATOM   4093  CA  PHE A 525      -5.118  87.311 157.574  1.00  0.82           C  
ATOM   4094  C   PHE A 525      -5.285  85.815 157.841  1.00  0.82           C  
ATOM   4095  O   PHE A 525      -5.658  85.050 156.956  1.00  0.82           O  
ATOM   4096  CB  PHE A 525      -4.676  87.508 156.096  1.00  0.82           C  
ATOM   4097  CG  PHE A 525      -4.609  88.971 155.741  1.00  0.82           C  
ATOM   4098  CD1 PHE A 525      -3.365  89.609 155.614  1.00  0.82           C  
ATOM   4099  CD2 PHE A 525      -5.778  89.720 155.521  1.00  0.82           C  
ATOM   4100  CE1 PHE A 525      -3.280  90.968 155.286  1.00  0.82           C  
ATOM   4101  CE2 PHE A 525      -5.702  91.082 155.193  1.00  0.82           C  
ATOM   4102  CZ  PHE A 525      -4.452  91.707 155.077  1.00  0.82           C  
ATOM   4103  N   VAL A 526      -5.004  85.329 159.069  1.00  0.78           N  
ATOM   4104  CA  VAL A 526      -5.121  83.913 159.431  1.00  0.78           C  
ATOM   4105  C   VAL A 526      -6.548  83.372 159.388  1.00  0.78           C  
ATOM   4106  O   VAL A 526      -6.775  82.212 159.044  1.00  0.78           O  
ATOM   4107  CB  VAL A 526      -4.462  83.634 160.786  1.00  0.78           C  
ATOM   4108  CG1 VAL A 526      -4.761  82.215 161.319  1.00  0.78           C  
ATOM   4109  CG2 VAL A 526      -2.938  83.781 160.621  1.00  0.78           C  
ATOM   4110  N   ASP A 527      -7.554  84.190 159.729  1.00  0.76           N  
ATOM   4111  CA  ASP A 527      -8.953  83.832 159.717  1.00  0.76           C  
ATOM   4112  C   ASP A 527      -9.677  84.279 158.443  1.00  0.76           C  
ATOM   4113  O   ASP A 527     -10.866  84.013 158.259  1.00  0.76           O  
ATOM   4114  CB  ASP A 527      -9.639  84.429 160.976  1.00  0.76           C  
ATOM   4115  CG  ASP A 527      -9.430  85.931 161.171  1.00  0.76           C  
ATOM   4116  OD1 ASP A 527      -8.508  86.517 160.548  1.00  0.76           O  
ATOM   4117  OD2 ASP A 527     -10.190  86.495 161.994  1.00  0.76           O  
ATOM   4118  N   ASP A 528      -8.962  84.907 157.489  1.00  0.81           N  
ATOM   4119  CA  ASP A 528      -9.481  85.252 156.180  1.00  0.81           C  
ATOM   4120  C   ASP A 528      -9.555  84.011 155.283  1.00  0.81           C  
ATOM   4121  O   ASP A 528      -8.634  83.654 154.548  1.00  0.81           O  
ATOM   4122  CB  ASP A 528      -8.633  86.411 155.577  1.00  0.81           C  
ATOM   4123  CG  ASP A 528      -9.170  86.993 154.274  1.00  0.81           C  
ATOM   4124  OD1 ASP A 528      -8.693  88.093 153.890  1.00  0.81           O  
ATOM   4125  OD2 ASP A 528     -10.023  86.340 153.615  1.00  0.81           O  
ATOM   4126  N   GLU A 529     -10.719  83.325 155.309  1.00  0.75           N  
ATOM   4127  CA  GLU A 529     -11.045  82.195 154.456  1.00  0.75           C  
ATOM   4128  C   GLU A 529     -10.967  82.539 152.961  1.00  0.75           C  
ATOM   4129  O   GLU A 529     -10.628  81.681 152.149  1.00  0.75           O  
ATOM   4130  CB  GLU A 529     -12.448  81.602 154.789  1.00  0.75           C  
ATOM   4131  CG  GLU A 529     -12.580  80.865 156.160  1.00  0.75           C  
ATOM   4132  CD  GLU A 529     -12.128  79.400 156.214  1.00  0.75           C  
ATOM   4133  OE1 GLU A 529     -12.735  78.560 155.489  1.00  0.75           O  
ATOM   4134  OE2 GLU A 529     -11.220  79.069 157.031  1.00  0.75           O  
ATOM   4135  N   ALA A 530     -11.262  83.791 152.527  1.00  0.83           N  
ATOM   4136  CA  ALA A 530     -11.081  84.188 151.137  1.00  0.83           C  
ATOM   4137  C   ALA A 530      -9.612  84.261 150.724  1.00  0.83           C  
ATOM   4138  O   ALA A 530      -9.228  83.656 149.727  1.00  0.83           O  
ATOM   4139  CB  ALA A 530     -11.781  85.531 150.840  1.00  0.83           C  
ATOM   4140  N   PHE A 531      -8.744  84.898 151.542  1.00  0.80           N  
ATOM   4141  CA  PHE A 531      -7.299  84.943 151.341  1.00  0.80           C  
ATOM   4142  C   PHE A 531      -6.682  83.546 151.344  1.00  0.80           C  
ATOM   4143  O   PHE A 531      -5.801  83.223 150.550  1.00  0.80           O  
ATOM   4144  CB  PHE A 531      -6.628  85.822 152.438  1.00  0.80           C  
ATOM   4145  CG  PHE A 531      -5.140  85.976 152.246  1.00  0.80           C  
ATOM   4146  CD1 PHE A 531      -4.639  86.730 151.174  1.00  0.80           C  
ATOM   4147  CD2 PHE A 531      -4.236  85.330 153.107  1.00  0.80           C  
ATOM   4148  CE1 PHE A 531      -3.258  86.839 150.963  1.00  0.80           C  
ATOM   4149  CE2 PHE A 531      -2.853  85.437 152.901  1.00  0.80           C  
ATOM   4150  CZ  PHE A 531      -2.365  86.191 151.826  1.00  0.80           C  
ATOM   4151  N   ILE A 532      -7.170  82.648 152.218  1.00  0.83           N  
ATOM   4152  CA  ILE A 532      -6.794  81.244 152.239  1.00  0.83           C  
ATOM   4153  C   ILE A 532      -7.105  80.538 150.916  1.00  0.83           C  
ATOM   4154  O   ILE A 532      -6.285  79.787 150.379  1.00  0.83           O  
ATOM   4155  CB  ILE A 532      -7.474  80.538 153.421  1.00  0.83           C  
ATOM   4156  CG1 ILE A 532      -6.821  80.978 154.756  1.00  0.83           C  
ATOM   4157  CG2 ILE A 532      -7.412  79.011 153.244  1.00  0.83           C  
ATOM   4158  CD1 ILE A 532      -7.554  80.488 156.012  1.00  0.83           C  
ATOM   4159  N   ARG A 533      -8.290  80.792 150.329  1.00  0.75           N  
ATOM   4160  CA  ARG A 533      -8.653  80.308 149.009  1.00  0.75           C  
ATOM   4161  C   ARG A 533      -7.789  80.875 147.885  1.00  0.75           C  
ATOM   4162  O   ARG A 533      -7.357  80.127 147.005  1.00  0.75           O  
ATOM   4163  CB  ARG A 533     -10.163  80.544 148.741  1.00  0.75           C  
ATOM   4164  CG  ARG A 533     -11.032  79.357 149.213  1.00  0.75           C  
ATOM   4165  CD  ARG A 533     -12.244  79.705 150.084  1.00  0.75           C  
ATOM   4166  NE  ARG A 533     -13.100  80.671 149.330  1.00  0.75           N  
ATOM   4167  CZ  ARG A 533     -14.338  81.015 149.708  1.00  0.75           C  
ATOM   4168  NH1 ARG A 533     -14.887  80.527 150.817  1.00  0.75           N  
ATOM   4169  NH2 ARG A 533     -15.039  81.858 148.955  1.00  0.75           N  
ATOM   4170  N   ASP A 534      -7.472  82.185 147.915  1.00  0.84           N  
ATOM   4171  CA  ASP A 534      -6.570  82.840 146.981  1.00  0.84           C  
ATOM   4172  C   ASP A 534      -5.150  82.233 147.010  1.00  0.84           C  
ATOM   4173  O   ASP A 534      -4.562  81.911 145.975  1.00  0.84           O  
ATOM   4174  CB  ASP A 534      -6.485  84.365 147.301  1.00  0.84           C  
ATOM   4175  CG  ASP A 534      -7.819  85.107 147.231  1.00  0.84           C  
ATOM   4176  OD1 ASP A 534      -8.745  84.615 146.540  1.00  0.84           O  
ATOM   4177  OD2 ASP A 534      -7.903  86.200 147.869  1.00  0.84           O  
ATOM   4178  N   VAL A 535      -4.591  81.983 148.219  1.00  0.88           N  
ATOM   4179  CA  VAL A 535      -3.311  81.304 148.446  1.00  0.88           C  
ATOM   4180  C   VAL A 535      -3.292  79.884 147.895  1.00  0.88           C  
ATOM   4181  O   VAL A 535      -2.336  79.458 147.241  1.00  0.88           O  
ATOM   4182  CB  VAL A 535      -2.988  81.258 149.948  1.00  0.88           C  
ATOM   4183  CG1 VAL A 535      -1.823  80.303 150.303  1.00  0.88           C  
ATOM   4184  CG2 VAL A 535      -2.629  82.672 150.442  1.00  0.88           C  
ATOM   4185  N   ALA A 536      -4.372  79.109 148.122  1.00  0.88           N  
ATOM   4186  CA  ALA A 536      -4.527  77.781 147.566  1.00  0.88           C  
ATOM   4187  C   ALA A 536      -4.590  77.765 146.039  1.00  0.88           C  
ATOM   4188  O   ALA A 536      -3.984  76.911 145.389  1.00  0.88           O  
ATOM   4189  CB  ALA A 536      -5.782  77.104 148.151  1.00  0.88           C  
ATOM   4190  N   LYS A 537      -5.299  78.733 145.418  1.00  0.83           N  
ATOM   4191  CA  LYS A 537      -5.384  78.851 143.972  1.00  0.83           C  
ATOM   4192  C   LYS A 537      -4.043  79.118 143.302  1.00  0.83           C  
ATOM   4193  O   LYS A 537      -3.709  78.461 142.319  1.00  0.83           O  
ATOM   4194  CB  LYS A 537      -6.402  79.931 143.536  1.00  0.83           C  
ATOM   4195  CG  LYS A 537      -6.708  79.866 142.029  1.00  0.83           C  
ATOM   4196  CD  LYS A 537      -7.658  80.966 141.537  1.00  0.83           C  
ATOM   4197  CE  LYS A 537      -7.722  81.071 140.008  1.00  0.83           C  
ATOM   4198  NZ  LYS A 537      -8.056  79.764 139.402  1.00  0.83           N  
ATOM   4199  N   VAL A 538      -3.210  80.022 143.869  1.00  0.89           N  
ATOM   4200  CA  VAL A 538      -1.856  80.303 143.387  1.00  0.89           C  
ATOM   4201  C   VAL A 538      -0.999  79.046 143.361  1.00  0.89           C  
ATOM   4202  O   VAL A 538      -0.306  78.746 142.386  1.00  0.89           O  
ATOM   4203  CB  VAL A 538      -1.169  81.347 144.275  1.00  0.89           C  
ATOM   4204  CG1 VAL A 538       0.354  81.428 144.020  1.00  0.89           C  
ATOM   4205  CG2 VAL A 538      -1.822  82.718 144.021  1.00  0.89           C  
ATOM   4206  N   LYS A 539      -1.063  78.229 144.435  1.00  0.90           N  
ATOM   4207  CA  LYS A 539      -0.377  76.954 144.488  1.00  0.90           C  
ATOM   4208  C   LYS A 539      -0.867  75.989 143.422  1.00  0.90           C  
ATOM   4209  O   LYS A 539      -0.071  75.379 142.713  1.00  0.90           O  
ATOM   4210  CB  LYS A 539      -0.524  76.314 145.894  1.00  0.90           C  
ATOM   4211  CG  LYS A 539       0.244  74.990 146.095  1.00  0.90           C  
ATOM   4212  CD  LYS A 539       1.769  75.088 145.890  1.00  0.90           C  
ATOM   4213  CE  LYS A 539       2.457  76.038 146.876  1.00  0.90           C  
ATOM   4214  NZ  LYS A 539       3.912  76.027 146.661  1.00  0.90           N  
ATOM   4215  N   GLN A 540      -2.193  75.879 143.230  1.00  0.86           N  
ATOM   4216  CA  GLN A 540      -2.777  75.033 142.212  1.00  0.86           C  
ATOM   4217  C   GLN A 540      -2.436  75.436 140.778  1.00  0.86           C  
ATOM   4218  O   GLN A 540      -2.157  74.580 139.938  1.00  0.86           O  
ATOM   4219  CB  GLN A 540      -4.308  74.927 142.410  1.00  0.86           C  
ATOM   4220  CG  GLN A 540      -4.962  73.776 141.608  1.00  0.86           C  
ATOM   4221  CD  GLN A 540      -4.351  72.421 141.992  1.00  0.86           C  
ATOM   4222  OE1 GLN A 540      -4.201  72.083 143.166  1.00  0.86           O  
ATOM   4223  NE2 GLN A 540      -3.960  71.625 140.974  1.00  0.86           N  
ATOM   4224  N   GLU A 541      -2.413  76.747 140.456  1.00  0.85           N  
ATOM   4225  CA  GLU A 541      -1.988  77.261 139.160  1.00  0.85           C  
ATOM   4226  C   GLU A 541      -0.515  76.981 138.865  1.00  0.85           C  
ATOM   4227  O   GLU A 541      -0.157  76.532 137.774  1.00  0.85           O  
ATOM   4228  CB  GLU A 541      -2.383  78.757 138.999  1.00  0.85           C  
ATOM   4229  CG  GLU A 541      -3.934  78.866 138.941  1.00  0.85           C  
ATOM   4230  CD  GLU A 541      -4.582  80.243 138.834  1.00  0.85           C  
ATOM   4231  OE1 GLU A 541      -4.358  81.090 139.730  1.00  0.85           O  
ATOM   4232  OE2 GLU A 541      -5.484  80.371 137.956  1.00  0.85           O  
ATOM   4233  N   ASN A 542       0.378  77.144 139.865  1.00  0.90           N  
ATOM   4234  CA  ASN A 542       1.768  76.717 139.771  1.00  0.90           C  
ATOM   4235  C   ASN A 542       1.927  75.205 139.577  1.00  0.90           C  
ATOM   4236  O   ASN A 542       2.719  74.755 138.749  1.00  0.90           O  
ATOM   4237  CB  ASN A 542       2.567  77.133 141.032  1.00  0.90           C  
ATOM   4238  CG  ASN A 542       2.706  78.651 141.110  1.00  0.90           C  
ATOM   4239  OD1 ASN A 542       2.665  79.374 140.117  1.00  0.90           O  
ATOM   4240  ND2 ASN A 542       2.939  79.150 142.346  1.00  0.90           N  
ATOM   4241  N   LYS A 543       1.148  74.375 140.307  1.00  0.89           N  
ATOM   4242  CA  LYS A 543       1.111  72.929 140.131  1.00  0.89           C  
ATOM   4243  C   LYS A 543       0.648  72.502 138.748  1.00  0.89           C  
ATOM   4244  O   LYS A 543       1.246  71.621 138.141  1.00  0.89           O  
ATOM   4245  CB  LYS A 543       0.216  72.247 141.195  1.00  0.89           C  
ATOM   4246  CG  LYS A 543       0.841  72.299 142.594  1.00  0.89           C  
ATOM   4247  CD  LYS A 543      -0.088  71.820 143.720  1.00  0.89           C  
ATOM   4248  CE  LYS A 543      -0.376  70.322 143.680  1.00  0.89           C  
ATOM   4249  NZ  LYS A 543      -0.906  69.892 144.976  1.00  0.89           N  
ATOM   4250  N   LEU A 544      -0.397  73.143 138.193  1.00  0.87           N  
ATOM   4251  CA  LEU A 544      -0.851  72.946 136.824  1.00  0.87           C  
ATOM   4252  C   LEU A 544       0.187  73.309 135.764  1.00  0.87           C  
ATOM   4253  O   LEU A 544       0.426  72.552 134.822  1.00  0.87           O  
ATOM   4254  CB  LEU A 544      -2.128  73.794 136.590  1.00  0.87           C  
ATOM   4255  CG  LEU A 544      -3.435  72.981 136.635  1.00  0.87           C  
ATOM   4256  CD1 LEU A 544      -4.608  73.874 137.068  1.00  0.87           C  
ATOM   4257  CD2 LEU A 544      -3.714  72.348 135.264  1.00  0.87           C  
ATOM   4258  N   LYS A 545       0.865  74.470 135.905  1.00  0.82           N  
ATOM   4259  CA  LYS A 545       1.902  74.912 134.981  1.00  0.82           C  
ATOM   4260  C   LYS A 545       3.108  73.979 134.984  1.00  0.82           C  
ATOM   4261  O   LYS A 545       3.675  73.642 133.944  1.00  0.82           O  
ATOM   4262  CB  LYS A 545       2.351  76.363 135.319  1.00  0.82           C  
ATOM   4263  CG  LYS A 545       3.130  77.101 134.207  1.00  0.82           C  
ATOM   4264  CD  LYS A 545       3.475  78.546 134.624  1.00  0.82           C  
ATOM   4265  CE  LYS A 545       3.900  79.498 133.488  1.00  0.82           C  
ATOM   4266  NZ  LYS A 545       5.201  79.108 132.913  1.00  0.82           N  
ATOM   4267  N   PHE A 546       3.518  73.519 136.182  1.00  0.88           N  
ATOM   4268  CA  PHE A 546       4.584  72.554 136.353  1.00  0.88           C  
ATOM   4269  C   PHE A 546       4.201  71.121 135.952  1.00  0.88           C  
ATOM   4270  O   PHE A 546       5.014  70.389 135.392  1.00  0.88           O  
ATOM   4271  CB  PHE A 546       5.157  72.660 137.790  1.00  0.88           C  
ATOM   4272  CG  PHE A 546       6.456  71.917 137.892  1.00  0.88           C  
ATOM   4273  CD1 PHE A 546       7.587  72.375 137.194  1.00  0.88           C  
ATOM   4274  CD2 PHE A 546       6.539  70.724 138.614  1.00  0.88           C  
ATOM   4275  CE1 PHE A 546       8.773  71.630 137.179  1.00  0.88           C  
ATOM   4276  CE2 PHE A 546       7.723  69.988 138.609  1.00  0.88           C  
ATOM   4277  CZ  PHE A 546       8.837  70.420 137.880  1.00  0.88           C  
ATOM   4278  N   ALA A 547       2.945  70.676 136.162  1.00  0.86           N  
ATOM   4279  CA  ALA A 547       2.444  69.398 135.676  1.00  0.86           C  
ATOM   4280  C   ALA A 547       2.520  69.273 134.159  1.00  0.86           C  
ATOM   4281  O   ALA A 547       2.926  68.241 133.632  1.00  0.86           O  
ATOM   4282  CB  ALA A 547       0.988  69.185 136.130  1.00  0.86           C  
ATOM   4283  N   ALA A 548       2.218  70.365 133.427  1.00  0.84           N  
ATOM   4284  CA  ALA A 548       2.419  70.467 131.994  1.00  0.84           C  
ATOM   4285  C   ALA A 548       3.876  70.287 131.560  1.00  0.84           C  
ATOM   4286  O   ALA A 548       4.158  69.696 130.522  1.00  0.84           O  
ATOM   4287  CB  ALA A 548       1.920  71.837 131.495  1.00  0.84           C  
ATOM   4288  N   TYR A 549       4.853  70.792 132.344  1.00  0.82           N  
ATOM   4289  CA  TYR A 549       6.271  70.495 132.162  1.00  0.82           C  
ATOM   4290  C   TYR A 549       6.576  69.013 132.383  1.00  0.82           C  
ATOM   4291  O   TYR A 549       7.251  68.382 131.573  1.00  0.82           O  
ATOM   4292  CB  TYR A 549       7.125  71.397 133.111  1.00  0.82           C  
ATOM   4293  CG  TYR A 549       8.618  71.270 132.903  1.00  0.82           C  
ATOM   4294  CD1 TYR A 549       9.409  70.542 133.812  1.00  0.82           C  
ATOM   4295  CD2 TYR A 549       9.243  71.882 131.804  1.00  0.82           C  
ATOM   4296  CE1 TYR A 549      10.794  70.414 133.614  1.00  0.82           C  
ATOM   4297  CE2 TYR A 549      10.626  71.749 131.601  1.00  0.82           C  
ATOM   4298  CZ  TYR A 549      11.399  71.005 132.498  1.00  0.82           C  
ATOM   4299  OH  TYR A 549      12.768  70.796 132.224  1.00  0.82           O  
ATOM   4300  N   LEU A 550       6.033  68.400 133.456  1.00  0.82           N  
ATOM   4301  CA  LEU A 550       6.212  66.986 133.730  1.00  0.82           C  
ATOM   4302  C   LEU A 550       5.646  66.075 132.652  1.00  0.82           C  
ATOM   4303  O   LEU A 550       6.352  65.195 132.179  1.00  0.82           O  
ATOM   4304  CB  LEU A 550       5.598  66.595 135.101  1.00  0.82           C  
ATOM   4305  CG  LEU A 550       6.339  67.176 136.324  1.00  0.82           C  
ATOM   4306  CD1 LEU A 550       5.601  66.850 137.634  1.00  0.82           C  
ATOM   4307  CD2 LEU A 550       7.781  66.659 136.399  1.00  0.82           C  
ATOM   4308  N   GLU A 551       4.406  66.294 132.182  1.00  0.74           N  
ATOM   4309  CA  GLU A 551       3.807  65.533 131.097  1.00  0.74           C  
ATOM   4310  C   GLU A 551       4.508  65.685 129.747  1.00  0.74           C  
ATOM   4311  O   GLU A 551       4.532  64.760 128.939  1.00  0.74           O  
ATOM   4312  CB  GLU A 551       2.292  65.833 130.969  1.00  0.74           C  
ATOM   4313  CG  GLU A 551       1.515  65.423 132.247  1.00  0.74           C  
ATOM   4314  CD  GLU A 551      -0.000  65.480 132.092  1.00  0.74           C  
ATOM   4315  OE1 GLU A 551      -0.510  66.524 131.612  1.00  0.74           O  
ATOM   4316  OE2 GLU A 551      -0.657  64.476 132.487  1.00  0.74           O  
ATOM   4317  N   ARG A 552       5.096  66.863 129.439  1.00  0.69           N  
ATOM   4318  CA  ARG A 552       5.882  67.034 128.224  1.00  0.69           C  
ATOM   4319  C   ARG A 552       7.235  66.332 128.252  1.00  0.69           C  
ATOM   4320  O   ARG A 552       7.600  65.658 127.291  1.00  0.69           O  
ATOM   4321  CB  ARG A 552       6.098  68.538 127.917  1.00  0.69           C  
ATOM   4322  CG  ARG A 552       4.801  69.244 127.477  1.00  0.69           C  
ATOM   4323  CD  ARG A 552       4.945  70.764 127.405  1.00  0.69           C  
ATOM   4324  NE  ARG A 552       3.583  71.309 127.101  1.00  0.69           N  
ATOM   4325  CZ  ARG A 552       3.322  72.611 126.933  1.00  0.69           C  
ATOM   4326  NH1 ARG A 552       2.072  73.005 126.700  1.00  0.69           N  
ATOM   4327  NH2 ARG A 552       4.289  73.521 126.992  1.00  0.69           N  
ATOM   4328  N   GLU A 553       8.013  66.472 129.345  1.00  0.71           N  
ATOM   4329  CA  GLU A 553       9.352  65.904 129.422  1.00  0.71           C  
ATOM   4330  C   GLU A 553       9.345  64.419 129.800  1.00  0.71           C  
ATOM   4331  O   GLU A 553      10.197  63.642 129.372  1.00  0.71           O  
ATOM   4332  CB  GLU A 553      10.225  66.681 130.443  1.00  0.71           C  
ATOM   4333  CG  GLU A 553      10.331  68.216 130.201  1.00  0.71           C  
ATOM   4334  CD  GLU A 553      11.226  68.687 129.052  1.00  0.71           C  
ATOM   4335  OE1 GLU A 553      11.105  69.898 128.719  1.00  0.71           O  
ATOM   4336  OE2 GLU A 553      12.067  67.904 128.550  1.00  0.71           O  
ATOM   4337  N   TYR A 554       8.366  63.965 130.614  1.00  0.73           N  
ATOM   4338  CA  TYR A 554       8.291  62.599 131.107  1.00  0.73           C  
ATOM   4339  C   TYR A 554       6.994  61.943 130.664  1.00  0.73           C  
ATOM   4340  O   TYR A 554       5.910  62.509 130.748  1.00  0.73           O  
ATOM   4341  CB  TYR A 554       8.308  62.517 132.665  1.00  0.73           C  
ATOM   4342  CG  TYR A 554       9.541  63.172 133.230  1.00  0.73           C  
ATOM   4343  CD1 TYR A 554       9.496  64.515 133.639  1.00  0.73           C  
ATOM   4344  CD2 TYR A 554      10.760  62.479 133.312  1.00  0.73           C  
ATOM   4345  CE1 TYR A 554      10.657  65.177 134.057  1.00  0.73           C  
ATOM   4346  CE2 TYR A 554      11.928  63.139 133.725  1.00  0.73           C  
ATOM   4347  CZ  TYR A 554      11.875  64.494 134.077  1.00  0.73           C  
ATOM   4348  OH  TYR A 554      13.055  65.191 134.393  1.00  0.73           O  
ATOM   4349  N   LYS A 555       7.049  60.674 130.215  1.00  0.65           N  
ATOM   4350  CA  LYS A 555       5.870  59.925 129.803  1.00  0.65           C  
ATOM   4351  C   LYS A 555       5.066  59.376 130.992  1.00  0.65           C  
ATOM   4352  O   LYS A 555       4.871  58.172 131.157  1.00  0.65           O  
ATOM   4353  CB  LYS A 555       6.313  58.799 128.835  1.00  0.65           C  
ATOM   4354  CG  LYS A 555       5.177  58.163 128.021  1.00  0.65           C  
ATOM   4355  CD  LYS A 555       5.715  57.101 127.052  1.00  0.65           C  
ATOM   4356  CE  LYS A 555       4.599  56.281 126.406  1.00  0.65           C  
ATOM   4357  NZ  LYS A 555       5.175  55.291 125.470  1.00  0.65           N  
ATOM   4358  N   VAL A 556       4.589  60.281 131.866  1.00  0.74           N  
ATOM   4359  CA  VAL A 556       3.882  59.969 133.095  1.00  0.74           C  
ATOM   4360  C   VAL A 556       2.710  60.917 133.228  1.00  0.74           C  
ATOM   4361  O   VAL A 556       2.851  62.126 133.105  1.00  0.74           O  
ATOM   4362  CB  VAL A 556       4.758  60.130 134.342  1.00  0.74           C  
ATOM   4363  CG1 VAL A 556       3.969  59.838 135.638  1.00  0.74           C  
ATOM   4364  CG2 VAL A 556       5.964  59.177 134.258  1.00  0.74           C  
ATOM   4365  N   HIS A 557       1.513  60.372 133.507  1.00  0.75           N  
ATOM   4366  CA  HIS A 557       0.312  61.139 133.775  1.00  0.75           C  
ATOM   4367  C   HIS A 557       0.315  61.636 135.217  1.00  0.75           C  
ATOM   4368  O   HIS A 557       0.621  60.885 136.146  1.00  0.75           O  
ATOM   4369  CB  HIS A 557      -0.911  60.237 133.497  1.00  0.75           C  
ATOM   4370  CG  HIS A 557      -2.245  60.896 133.626  1.00  0.75           C  
ATOM   4371  ND1 HIS A 557      -3.061  60.507 134.661  1.00  0.75           N  
ATOM   4372  CD2 HIS A 557      -2.885  61.787 132.827  1.00  0.75           C  
ATOM   4373  CE1 HIS A 557      -4.187  61.166 134.485  1.00  0.75           C  
ATOM   4374  NE2 HIS A 557      -4.134  61.957 133.385  1.00  0.75           N  
ATOM   4375  N   ILE A 558       0.024  62.932 135.440  1.00  0.86           N  
ATOM   4376  CA  ILE A 558       0.144  63.540 136.760  1.00  0.86           C  
ATOM   4377  C   ILE A 558      -1.231  63.889 137.301  1.00  0.86           C  
ATOM   4378  O   ILE A 558      -1.992  64.662 136.728  1.00  0.86           O  
ATOM   4379  CB  ILE A 558       1.027  64.797 136.778  1.00  0.86           C  
ATOM   4380  CG1 ILE A 558       2.460  64.530 136.245  1.00  0.86           C  
ATOM   4381  CG2 ILE A 558       1.091  65.413 138.199  1.00  0.86           C  
ATOM   4382  CD1 ILE A 558       3.299  63.540 137.069  1.00  0.86           C  
ATOM   4383  N   ASN A 559      -1.579  63.330 138.480  1.00  0.86           N  
ATOM   4384  CA  ASN A 559      -2.782  63.666 139.219  1.00  0.86           C  
ATOM   4385  C   ASN A 559      -2.749  65.136 139.688  1.00  0.86           C  
ATOM   4386  O   ASN A 559      -1.807  65.512 140.386  1.00  0.86           O  
ATOM   4387  CB  ASN A 559      -2.919  62.656 140.403  1.00  0.86           C  
ATOM   4388  CG  ASN A 559      -4.178  62.807 141.260  1.00  0.86           C  
ATOM   4389  OD1 ASN A 559      -4.899  63.806 141.253  1.00  0.86           O  
ATOM   4390  ND2 ASN A 559      -4.446  61.768 142.084  1.00  0.86           N  
ATOM   4391  N   PRO A 560      -3.710  66.012 139.379  1.00  0.83           N  
ATOM   4392  CA  PRO A 560      -3.604  67.426 139.730  1.00  0.83           C  
ATOM   4393  C   PRO A 560      -3.954  67.678 141.177  1.00  0.83           C  
ATOM   4394  O   PRO A 560      -3.627  68.752 141.677  1.00  0.83           O  
ATOM   4395  CB  PRO A 560      -4.620  68.119 138.802  1.00  0.83           C  
ATOM   4396  CG  PRO A 560      -5.627  67.021 138.445  1.00  0.83           C  
ATOM   4397  CD  PRO A 560      -4.743  65.780 138.367  1.00  0.83           C  
ATOM   4398  N   ASN A 561      -4.627  66.733 141.861  1.00  0.85           N  
ATOM   4399  CA  ASN A 561      -5.058  66.925 143.235  1.00  0.85           C  
ATOM   4400  C   ASN A 561      -4.069  66.294 144.204  1.00  0.85           C  
ATOM   4401  O   ASN A 561      -4.202  66.418 145.422  1.00  0.85           O  
ATOM   4402  CB  ASN A 561      -6.436  66.249 143.460  1.00  0.85           C  
ATOM   4403  CG  ASN A 561      -7.527  67.003 142.709  1.00  0.85           C  
ATOM   4404  OD1 ASN A 561      -7.510  68.222 142.556  1.00  0.85           O  
ATOM   4405  ND2 ASN A 561      -8.550  66.255 142.238  1.00  0.85           N  
ATOM   4406  N   SER A 562      -3.026  65.610 143.693  1.00  0.93           N  
ATOM   4407  CA  SER A 562      -1.984  65.025 144.519  1.00  0.93           C  
ATOM   4408  C   SER A 562      -1.123  66.033 145.253  1.00  0.93           C  
ATOM   4409  O   SER A 562      -0.949  67.180 144.845  1.00  0.93           O  
ATOM   4410  CB  SER A 562      -1.062  64.020 143.776  1.00  0.93           C  
ATOM   4411  OG  SER A 562      -0.210  64.667 142.834  1.00  0.93           O  
ATOM   4412  N   LEU A 563      -0.566  65.610 146.396  1.00  0.95           N  
ATOM   4413  CA  LEU A 563       0.445  66.345 147.122  1.00  0.95           C  
ATOM   4414  C   LEU A 563       1.769  66.277 146.364  1.00  0.95           C  
ATOM   4415  O   LEU A 563       2.258  65.199 146.028  1.00  0.95           O  
ATOM   4416  CB  LEU A 563       0.528  65.756 148.556  1.00  0.95           C  
ATOM   4417  CG  LEU A 563       1.374  66.513 149.600  1.00  0.95           C  
ATOM   4418  CD1 LEU A 563       1.005  66.046 151.014  1.00  0.95           C  
ATOM   4419  CD2 LEU A 563       2.875  66.294 149.434  1.00  0.95           C  
ATOM   4420  N   PHE A 564       2.379  67.434 146.047  1.00  0.95           N  
ATOM   4421  CA  PHE A 564       3.659  67.509 145.370  1.00  0.95           C  
ATOM   4422  C   PHE A 564       4.744  67.506 146.422  1.00  0.95           C  
ATOM   4423  O   PHE A 564       4.949  68.462 147.170  1.00  0.95           O  
ATOM   4424  CB  PHE A 564       3.821  68.746 144.439  1.00  0.95           C  
ATOM   4425  CG  PHE A 564       3.180  68.577 143.076  1.00  0.95           C  
ATOM   4426  CD1 PHE A 564       2.119  67.686 142.809  1.00  0.95           C  
ATOM   4427  CD2 PHE A 564       3.664  69.369 142.017  1.00  0.95           C  
ATOM   4428  CE1 PHE A 564       1.547  67.607 141.533  1.00  0.95           C  
ATOM   4429  CE2 PHE A 564       3.102  69.286 140.736  1.00  0.95           C  
ATOM   4430  CZ  PHE A 564       2.039  68.408 140.496  1.00  0.95           C  
ATOM   4431  N   ASP A 565       5.430  66.363 146.491  1.00  0.98           N  
ATOM   4432  CA  ASP A 565       6.319  65.942 147.537  1.00  0.98           C  
ATOM   4433  C   ASP A 565       7.729  65.973 146.961  1.00  0.98           C  
ATOM   4434  O   ASP A 565       8.058  65.211 146.055  1.00  0.98           O  
ATOM   4435  CB  ASP A 565       5.812  64.510 147.865  1.00  0.98           C  
ATOM   4436  CG  ASP A 565       6.492  63.880 149.053  1.00  0.98           C  
ATOM   4437  OD1 ASP A 565       7.379  64.533 149.630  1.00  0.98           O  
ATOM   4438  OD2 ASP A 565       6.084  62.749 149.433  1.00  0.98           O  
ATOM   4439  N   ILE A 566       8.575  66.935 147.388  1.00  0.98           N  
ATOM   4440  CA  ILE A 566       9.753  67.305 146.611  1.00  0.98           C  
ATOM   4441  C   ILE A 566      11.028  67.336 147.437  1.00  0.98           C  
ATOM   4442  O   ILE A 566      11.185  68.072 148.414  1.00  0.98           O  
ATOM   4443  CB  ILE A 566       9.563  68.644 145.870  1.00  0.98           C  
ATOM   4444  CG1 ILE A 566       8.508  68.529 144.741  1.00  0.98           C  
ATOM   4445  CG2 ILE A 566      10.885  69.139 145.236  1.00  0.98           C  
ATOM   4446  CD1 ILE A 566       7.846  69.843 144.330  1.00  0.98           C  
ATOM   4447  N   GLN A 567      12.031  66.560 146.976  1.00  0.96           N  
ATOM   4448  CA  GLN A 567      13.392  66.654 147.439  1.00  0.96           C  
ATOM   4449  C   GLN A 567      14.330  66.979 146.289  1.00  0.96           C  
ATOM   4450  O   GLN A 567      14.716  66.118 145.501  1.00  0.96           O  
ATOM   4451  CB  GLN A 567      13.851  65.333 148.089  1.00  0.96           C  
ATOM   4452  CG  GLN A 567      15.141  65.565 148.899  1.00  0.96           C  
ATOM   4453  CD  GLN A 567      15.673  64.351 149.643  1.00  0.96           C  
ATOM   4454  OE1 GLN A 567      16.696  64.473 150.316  1.00  0.96           O  
ATOM   4455  NE2 GLN A 567      15.030  63.178 149.521  1.00  0.96           N  
ATOM   4456  N   VAL A 568      14.769  68.247 146.183  1.00  0.98           N  
ATOM   4457  CA  VAL A 568      15.710  68.665 145.153  1.00  0.98           C  
ATOM   4458  C   VAL A 568      16.899  69.382 145.766  1.00  0.98           C  
ATOM   4459  O   VAL A 568      16.754  70.264 146.612  1.00  0.98           O  
ATOM   4460  CB  VAL A 568      15.098  69.488 144.024  1.00  0.98           C  
ATOM   4461  CG1 VAL A 568      14.194  68.587 143.160  1.00  0.98           C  
ATOM   4462  CG2 VAL A 568      14.305  70.686 144.569  1.00  0.98           C  
ATOM   4463  N   LYS A 569      18.117  68.960 145.358  1.00  0.91           N  
ATOM   4464  CA  LYS A 569      19.410  69.269 145.954  1.00  0.91           C  
ATOM   4465  C   LYS A 569      20.401  68.226 145.465  1.00  0.91           C  
ATOM   4466  O   LYS A 569      20.004  67.175 144.975  1.00  0.91           O  
ATOM   4467  CB  LYS A 569      19.425  69.280 147.514  1.00  0.91           C  
ATOM   4468  CG  LYS A 569      19.020  67.939 148.155  1.00  0.91           C  
ATOM   4469  CD  LYS A 569      18.684  68.022 149.654  1.00  0.91           C  
ATOM   4470  CE  LYS A 569      17.359  68.727 149.954  1.00  0.91           C  
ATOM   4471  NZ  LYS A 569      17.093  68.669 151.400  1.00  0.91           N  
ATOM   4472  N   ARG A 570      21.726  68.484 145.551  1.00  0.90           N  
ATOM   4473  CA  ARG A 570      22.759  67.531 145.152  1.00  0.90           C  
ATOM   4474  C   ARG A 570      22.660  66.176 145.859  1.00  0.90           C  
ATOM   4475  O   ARG A 570      22.271  66.082 147.022  1.00  0.90           O  
ATOM   4476  CB  ARG A 570      24.180  68.122 145.366  1.00  0.90           C  
ATOM   4477  CG  ARG A 570      24.518  69.340 144.474  1.00  0.90           C  
ATOM   4478  CD  ARG A 570      24.617  69.048 142.970  1.00  0.90           C  
ATOM   4479  NE  ARG A 570      25.747  68.086 142.749  1.00  0.90           N  
ATOM   4480  CZ  ARG A 570      26.985  68.451 142.389  1.00  0.90           C  
ATOM   4481  NH1 ARG A 570      27.275  69.716 142.130  1.00  0.90           N  
ATOM   4482  NH2 ARG A 570      27.941  67.532 142.276  1.00  0.90           N  
ATOM   4483  N   ILE A 571      22.972  65.076 145.142  1.00  0.96           N  
ATOM   4484  CA  ILE A 571      22.797  63.729 145.669  1.00  0.96           C  
ATOM   4485  C   ILE A 571      23.961  63.349 146.562  1.00  0.96           C  
ATOM   4486  O   ILE A 571      25.111  63.298 146.129  1.00  0.96           O  
ATOM   4487  CB  ILE A 571      22.618  62.674 144.580  1.00  0.96           C  
ATOM   4488  CG1 ILE A 571      21.549  63.077 143.532  1.00  0.96           C  
ATOM   4489  CG2 ILE A 571      22.288  61.298 145.204  1.00  0.96           C  
ATOM   4490  CD1 ILE A 571      20.130  63.310 144.067  1.00  0.96           C  
ATOM   4491  N   HIS A 572      23.681  63.087 147.852  1.00  0.93           N  
ATOM   4492  CA  HIS A 572      24.718  62.782 148.809  1.00  0.93           C  
ATOM   4493  C   HIS A 572      24.131  61.962 149.928  1.00  0.93           C  
ATOM   4494  O   HIS A 572      22.983  62.156 150.321  1.00  0.93           O  
ATOM   4495  CB  HIS A 572      25.303  64.084 149.426  1.00  0.93           C  
ATOM   4496  CG  HIS A 572      26.735  64.005 149.890  1.00  0.93           C  
ATOM   4497  ND1 HIS A 572      27.643  64.859 149.308  1.00  0.93           N  
ATOM   4498  CD2 HIS A 572      27.358  63.247 150.835  1.00  0.93           C  
ATOM   4499  CE1 HIS A 572      28.799  64.611 149.889  1.00  0.93           C  
ATOM   4500  NE2 HIS A 572      28.682  63.637 150.823  1.00  0.93           N  
ATOM   4501  N   GLU A 573      24.924  61.060 150.529  1.00  0.94           N  
ATOM   4502  CA  GLU A 573      24.507  60.224 151.638  1.00  0.94           C  
ATOM   4503  C   GLU A 573      24.032  61.014 152.853  1.00  0.94           C  
ATOM   4504  O   GLU A 573      23.023  60.677 153.467  1.00  0.94           O  
ATOM   4505  CB  GLU A 573      25.678  59.320 152.061  1.00  0.94           C  
ATOM   4506  CG  GLU A 573      26.125  58.308 150.984  1.00  0.94           C  
ATOM   4507  CD  GLU A 573      27.440  57.650 151.394  1.00  0.94           C  
ATOM   4508  OE1 GLU A 573      27.601  57.340 152.599  1.00  0.94           O  
ATOM   4509  OE2 GLU A 573      28.309  57.472 150.505  1.00  0.94           O  
ATOM   4510  N   TYR A 574      24.713  62.136 153.187  1.00  0.89           N  
ATOM   4511  CA  TYR A 574      24.338  63.020 154.283  1.00  0.89           C  
ATOM   4512  C   TYR A 574      22.954  63.648 154.141  1.00  0.89           C  
ATOM   4513  O   TYR A 574      22.219  63.806 155.115  1.00  0.89           O  
ATOM   4514  CB  TYR A 574      25.452  64.081 154.594  1.00  0.89           C  
ATOM   4515  CG  TYR A 574      25.416  65.423 153.866  1.00  0.89           C  
ATOM   4516  CD1 TYR A 574      24.552  66.449 154.294  1.00  0.89           C  
ATOM   4517  CD2 TYR A 574      26.334  65.723 152.845  1.00  0.89           C  
ATOM   4518  CE1 TYR A 574      24.637  67.739 153.754  1.00  0.89           C  
ATOM   4519  CE2 TYR A 574      26.428  67.015 152.301  1.00  0.89           C  
ATOM   4520  CZ  TYR A 574      25.597  68.034 152.783  1.00  0.89           C  
ATOM   4521  OH  TYR A 574      25.696  69.354 152.284  1.00  0.89           O  
ATOM   4522  N   LYS A 575      22.575  64.010 152.897  1.00  0.91           N  
ATOM   4523  CA  LYS A 575      21.310  64.641 152.574  1.00  0.91           C  
ATOM   4524  C   LYS A 575      20.172  63.643 152.493  1.00  0.91           C  
ATOM   4525  O   LYS A 575      19.009  64.026 152.585  1.00  0.91           O  
ATOM   4526  CB  LYS A 575      21.417  65.396 151.229  1.00  0.91           C  
ATOM   4527  CG  LYS A 575      22.312  66.639 151.336  1.00  0.91           C  
ATOM   4528  CD  LYS A 575      22.567  67.305 149.979  1.00  0.91           C  
ATOM   4529  CE  LYS A 575      23.513  68.511 150.015  1.00  0.91           C  
ATOM   4530  NZ  LYS A 575      23.020  69.553 150.921  1.00  0.91           N  
ATOM   4531  N   ARG A 576      20.504  62.339 152.382  1.00  0.93           N  
ATOM   4532  CA  ARG A 576      19.596  61.237 152.619  1.00  0.93           C  
ATOM   4533  C   ARG A 576      18.455  61.079 151.617  1.00  0.93           C  
ATOM   4534  O   ARG A 576      17.331  60.727 151.981  1.00  0.93           O  
ATOM   4535  CB  ARG A 576      19.063  61.263 154.073  1.00  0.93           C  
ATOM   4536  CG  ARG A 576      20.039  60.790 155.168  1.00  0.93           C  
ATOM   4537  CD  ARG A 576      19.522  61.297 156.512  1.00  0.93           C  
ATOM   4538  NE  ARG A 576      19.778  60.335 157.622  1.00  0.93           N  
ATOM   4539  CZ  ARG A 576      19.145  60.467 158.790  1.00  0.93           C  
ATOM   4540  NH1 ARG A 576      18.241  61.416 159.013  1.00  0.93           N  
ATOM   4541  NH2 ARG A 576      19.405  59.662 159.809  1.00  0.93           N  
ATOM   4542  N   GLN A 577      18.730  61.192 150.294  1.00  0.96           N  
ATOM   4543  CA  GLN A 577      17.765  60.831 149.256  1.00  0.96           C  
ATOM   4544  C   GLN A 577      17.295  59.384 149.392  1.00  0.96           C  
ATOM   4545  O   GLN A 577      16.137  59.055 149.149  1.00  0.96           O  
ATOM   4546  CB  GLN A 577      18.271  61.100 147.813  1.00  0.96           C  
ATOM   4547  CG  GLN A 577      18.350  62.605 147.443  1.00  0.96           C  
ATOM   4548  CD  GLN A 577      19.649  63.290 147.874  1.00  0.96           C  
ATOM   4549  OE1 GLN A 577      20.557  62.708 148.466  1.00  0.96           O  
ATOM   4550  NE2 GLN A 577      19.766  64.589 147.511  1.00  0.96           N  
ATOM   4551  N   LEU A 578      18.181  58.506 149.891  1.00  0.98           N  
ATOM   4552  CA  LEU A 578      17.902  57.143 150.301  1.00  0.98           C  
ATOM   4553  C   LEU A 578      16.769  56.974 151.326  1.00  0.98           C  
ATOM   4554  O   LEU A 578      15.937  56.087 151.180  1.00  0.98           O  
ATOM   4555  CB  LEU A 578      19.205  56.525 150.867  1.00  0.98           C  
ATOM   4556  CG  LEU A 578      19.687  55.272 150.113  1.00  0.98           C  
ATOM   4557  CD1 LEU A 578      21.151  55.003 150.483  1.00  0.98           C  
ATOM   4558  CD2 LEU A 578      18.801  54.051 150.405  1.00  0.98           C  
ATOM   4559  N   LEU A 579      16.667  57.827 152.370  1.00  0.98           N  
ATOM   4560  CA  LEU A 579      15.624  57.759 153.398  1.00  0.98           C  
ATOM   4561  C   LEU A 579      14.219  57.991 152.825  1.00  0.98           C  
ATOM   4562  O   LEU A 579      13.267  57.261 153.106  1.00  0.98           O  
ATOM   4563  CB  LEU A 579      15.921  58.830 154.485  1.00  0.98           C  
ATOM   4564  CG  LEU A 579      15.829  58.448 155.983  1.00  0.98           C  
ATOM   4565  CD1 LEU A 579      15.638  59.734 156.803  1.00  0.98           C  
ATOM   4566  CD2 LEU A 579      14.730  57.440 156.335  1.00  0.98           C  
ATOM   4567  N   ASN A 580      14.097  58.997 151.927  1.00  0.98           N  
ATOM   4568  CA  ASN A 580      12.925  59.299 151.120  1.00  0.98           C  
ATOM   4569  C   ASN A 580      12.567  58.134 150.218  1.00  0.98           C  
ATOM   4570  O   ASN A 580      11.409  57.738 150.146  1.00  0.98           O  
ATOM   4571  CB  ASN A 580      13.237  60.568 150.283  1.00  0.98           C  
ATOM   4572  CG  ASN A 580      12.097  61.256 149.521  1.00  0.98           C  
ATOM   4573  OD1 ASN A 580      12.404  62.181 148.765  1.00  0.98           O  
ATOM   4574  ND2 ASN A 580      10.826  60.846 149.687  1.00  0.98           N  
ATOM   4575  N   CYS A 581      13.576  57.515 149.579  1.00  0.97           N  
ATOM   4576  CA  CYS A 581      13.435  56.347 148.732  1.00  0.97           C  
ATOM   4577  C   CYS A 581      12.821  55.158 149.454  1.00  0.97           C  
ATOM   4578  O   CYS A 581      11.924  54.497 148.935  1.00  0.97           O  
ATOM   4579  CB  CYS A 581      14.824  55.936 148.209  1.00  0.97           C  
ATOM   4580  SG  CYS A 581      14.729  55.221 146.623  1.00  0.97           S  
ATOM   4581  N   LEU A 582      13.242  54.899 150.713  1.00  0.96           N  
ATOM   4582  CA  LEU A 582      12.657  53.859 151.546  1.00  0.96           C  
ATOM   4583  C   LEU A 582      11.170  54.095 151.793  1.00  0.96           C  
ATOM   4584  O   LEU A 582      10.350  53.200 151.612  1.00  0.96           O  
ATOM   4585  CB  LEU A 582      13.343  53.746 152.941  1.00  0.96           C  
ATOM   4586  CG  LEU A 582      14.858  53.440 152.964  1.00  0.96           C  
ATOM   4587  CD1 LEU A 582      15.351  53.284 154.412  1.00  0.96           C  
ATOM   4588  CD2 LEU A 582      15.229  52.189 152.160  1.00  0.96           C  
ATOM   4589  N   HIS A 583      10.785  55.342 152.139  1.00  0.95           N  
ATOM   4590  CA  HIS A 583       9.399  55.742 152.353  1.00  0.95           C  
ATOM   4591  C   HIS A 583       8.500  55.616 151.130  1.00  0.95           C  
ATOM   4592  O   HIS A 583       7.349  55.198 151.245  1.00  0.95           O  
ATOM   4593  CB  HIS A 583       9.317  57.179 152.909  1.00  0.95           C  
ATOM   4594  CG  HIS A 583       7.925  57.697 153.119  1.00  0.95           C  
ATOM   4595  ND1 HIS A 583       7.491  58.756 152.354  1.00  0.95           N  
ATOM   4596  CD2 HIS A 583       6.939  57.283 153.956  1.00  0.95           C  
ATOM   4597  CE1 HIS A 583       6.249  58.973 152.733  1.00  0.95           C  
ATOM   4598  NE2 HIS A 583       5.865  58.107 153.701  1.00  0.95           N  
ATOM   4599  N   VAL A 584       9.001  55.928 149.916  1.00  0.97           N  
ATOM   4600  CA  VAL A 584       8.275  55.722 148.663  1.00  0.97           C  
ATOM   4601  C   VAL A 584       7.887  54.255 148.468  1.00  0.97           C  
ATOM   4602  O   VAL A 584       6.752  53.927 148.116  1.00  0.97           O  
ATOM   4603  CB  VAL A 584       9.114  56.181 147.468  1.00  0.97           C  
ATOM   4604  CG1 VAL A 584       8.421  55.879 146.125  1.00  0.97           C  
ATOM   4605  CG2 VAL A 584       9.349  57.700 147.548  1.00  0.97           C  
ATOM   4606  N   ILE A 585       8.822  53.324 148.759  1.00  0.96           N  
ATOM   4607  CA  ILE A 585       8.585  51.884 148.760  1.00  0.96           C  
ATOM   4608  C   ILE A 585       7.578  51.473 149.835  1.00  0.96           C  
ATOM   4609  O   ILE A 585       6.680  50.663 149.591  1.00  0.96           O  
ATOM   4610  CB  ILE A 585       9.878  51.080 148.923  1.00  0.96           C  
ATOM   4611  CG1 ILE A 585      10.921  51.443 147.841  1.00  0.96           C  
ATOM   4612  CG2 ILE A 585       9.566  49.566 148.866  1.00  0.96           C  
ATOM   4613  CD1 ILE A 585      12.338  50.984 148.203  1.00  0.96           C  
ATOM   4614  N   THR A 586       7.661  52.053 151.054  1.00  0.95           N  
ATOM   4615  CA  THR A 586       6.701  51.826 152.142  1.00  0.95           C  
ATOM   4616  C   THR A 586       5.285  52.205 151.749  1.00  0.95           C  
ATOM   4617  O   THR A 586       4.341  51.440 151.943  1.00  0.95           O  
ATOM   4618  CB  THR A 586       7.024  52.605 153.419  1.00  0.95           C  
ATOM   4619  OG1 THR A 586       8.405  52.504 153.701  1.00  0.95           O  
ATOM   4620  CG2 THR A 586       6.268  52.042 154.626  1.00  0.95           C  
ATOM   4621  N   LEU A 587       5.101  53.381 151.110  1.00  0.94           N  
ATOM   4622  CA  LEU A 587       3.819  53.817 150.578  1.00  0.94           C  
ATOM   4623  C   LEU A 587       3.281  52.917 149.477  1.00  0.94           C  
ATOM   4624  O   LEU A 587       2.102  52.565 149.483  1.00  0.94           O  
ATOM   4625  CB  LEU A 587       3.886  55.258 150.021  1.00  0.94           C  
ATOM   4626  CG  LEU A 587       4.150  56.362 151.065  1.00  0.94           C  
ATOM   4627  CD1 LEU A 587       4.141  57.730 150.367  1.00  0.94           C  
ATOM   4628  CD2 LEU A 587       3.143  56.358 152.226  1.00  0.94           C  
ATOM   4629  N   TYR A 588       4.146  52.485 148.537  1.00  0.94           N  
ATOM   4630  CA  TYR A 588       3.820  51.527 147.490  1.00  0.94           C  
ATOM   4631  C   TYR A 588       3.325  50.191 148.059  1.00  0.94           C  
ATOM   4632  O   TYR A 588       2.272  49.688 147.667  1.00  0.94           O  
ATOM   4633  CB  TYR A 588       5.085  51.340 146.587  1.00  0.94           C  
ATOM   4634  CG  TYR A 588       4.979  50.198 145.603  1.00  0.94           C  
ATOM   4635  CD1 TYR A 588       4.239  50.335 144.417  1.00  0.94           C  
ATOM   4636  CD2 TYR A 588       5.569  48.955 145.897  1.00  0.94           C  
ATOM   4637  CE1 TYR A 588       4.074  49.246 143.547  1.00  0.94           C  
ATOM   4638  CE2 TYR A 588       5.418  47.870 145.023  1.00  0.94           C  
ATOM   4639  CZ  TYR A 588       4.665  48.016 143.854  1.00  0.94           C  
ATOM   4640  OH  TYR A 588       4.482  46.911 143.003  1.00  0.94           O  
ATOM   4641  N   ASN A 589       4.035  49.614 149.051  1.00  0.92           N  
ATOM   4642  CA  ASN A 589       3.650  48.367 149.694  1.00  0.92           C  
ATOM   4643  C   ASN A 589       2.317  48.441 150.424  1.00  0.92           C  
ATOM   4644  O   ASN A 589       1.539  47.492 150.398  1.00  0.92           O  
ATOM   4645  CB  ASN A 589       4.719  47.897 150.708  1.00  0.92           C  
ATOM   4646  CG  ASN A 589       5.945  47.368 149.977  1.00  0.92           C  
ATOM   4647  OD1 ASN A 589       5.858  46.730 148.927  1.00  0.92           O  
ATOM   4648  ND2 ASN A 589       7.130  47.579 150.586  1.00  0.92           N  
ATOM   4649  N   ARG A 590       2.011  49.572 151.091  1.00  0.86           N  
ATOM   4650  CA  ARG A 590       0.730  49.795 151.742  1.00  0.86           C  
ATOM   4651  C   ARG A 590      -0.452  49.742 150.763  1.00  0.86           C  
ATOM   4652  O   ARG A 590      -1.447  49.073 151.034  1.00  0.86           O  
ATOM   4653  CB  ARG A 590       0.753  51.151 152.502  1.00  0.86           C  
ATOM   4654  CG  ARG A 590       1.644  51.145 153.768  1.00  0.86           C  
ATOM   4655  CD  ARG A 590       1.922  52.542 154.341  1.00  0.86           C  
ATOM   4656  NE  ARG A 590       2.679  52.372 155.620  1.00  0.86           N  
ATOM   4657  CZ  ARG A 590       2.751  53.276 156.596  1.00  0.86           C  
ATOM   4658  NH1 ARG A 590       2.152  54.456 156.555  1.00  0.86           N  
ATOM   4659  NH2 ARG A 590       3.420  53.028 157.715  1.00  0.86           N  
ATOM   4660  N   ILE A 591      -0.349  50.386 149.577  1.00  0.90           N  
ATOM   4661  CA  ILE A 591      -1.356  50.332 148.512  1.00  0.90           C  
ATOM   4662  C   ILE A 591      -1.543  48.924 147.961  1.00  0.90           C  
ATOM   4663  O   ILE A 591      -2.664  48.466 147.763  1.00  0.90           O  
ATOM   4664  CB  ILE A 591      -1.034  51.277 147.342  1.00  0.90           C  
ATOM   4665  CG1 ILE A 591      -0.817  52.724 147.841  1.00  0.90           C  
ATOM   4666  CG2 ILE A 591      -2.179  51.263 146.296  1.00  0.90           C  
ATOM   4667  CD1 ILE A 591      -0.123  53.624 146.811  1.00  0.90           C  
ATOM   4668  N   LYS A 592      -0.444  48.180 147.714  1.00  0.88           N  
ATOM   4669  CA  LYS A 592      -0.499  46.797 147.264  1.00  0.88           C  
ATOM   4670  C   LYS A 592      -1.139  45.842 148.269  1.00  0.88           C  
ATOM   4671  O   LYS A 592      -1.934  44.988 147.886  1.00  0.88           O  
ATOM   4672  CB  LYS A 592       0.916  46.285 146.879  1.00  0.88           C  
ATOM   4673  CG  LYS A 592       1.581  47.080 145.736  1.00  0.88           C  
ATOM   4674  CD  LYS A 592       0.932  46.922 144.346  1.00  0.88           C  
ATOM   4675  CE  LYS A 592       1.253  45.586 143.670  1.00  0.88           C  
ATOM   4676  NZ  LYS A 592       0.754  45.571 142.288  1.00  0.88           N  
ATOM   4677  N   ARG A 593      -0.822  45.963 149.578  1.00  0.82           N  
ATOM   4678  CA  ARG A 593      -1.454  45.187 150.637  1.00  0.82           C  
ATOM   4679  C   ARG A 593      -2.947  45.469 150.821  1.00  0.82           C  
ATOM   4680  O   ARG A 593      -3.736  44.534 150.940  1.00  0.82           O  
ATOM   4681  CB  ARG A 593      -0.728  45.406 151.998  1.00  0.82           C  
ATOM   4682  CG  ARG A 593       0.711  44.838 152.036  1.00  0.82           C  
ATOM   4683  CD  ARG A 593       1.502  45.219 153.295  1.00  0.82           C  
ATOM   4684  NE  ARG A 593       2.881  44.623 153.170  1.00  0.82           N  
ATOM   4685  CZ  ARG A 593       3.835  44.765 154.100  1.00  0.82           C  
ATOM   4686  NH1 ARG A 593       4.985  44.099 154.004  1.00  0.82           N  
ATOM   4687  NH2 ARG A 593       3.657  45.574 155.141  1.00  0.82           N  
ATOM   4688  N   GLU A 594      -3.385  46.747 150.829  1.00  0.79           N  
ATOM   4689  CA  GLU A 594      -4.784  47.087 151.073  1.00  0.79           C  
ATOM   4690  C   GLU A 594      -5.339  48.038 149.996  1.00  0.79           C  
ATOM   4691  O   GLU A 594      -5.444  49.242 150.242  1.00  0.79           O  
ATOM   4692  CB  GLU A 594      -4.943  47.726 152.490  1.00  0.79           C  
ATOM   4693  CG  GLU A 594      -4.668  46.760 153.681  1.00  0.79           C  
ATOM   4694  CD  GLU A 594      -4.571  47.383 155.086  1.00  0.79           C  
ATOM   4695  OE1 GLU A 594      -4.441  48.627 155.258  1.00  0.79           O  
ATOM   4696  OE2 GLU A 594      -4.567  46.587 156.056  1.00  0.79           O  
ATOM   4697  N   PRO A 595      -5.766  47.586 148.798  1.00  0.84           N  
ATOM   4698  CA  PRO A 595      -6.037  48.479 147.664  1.00  0.84           C  
ATOM   4699  C   PRO A 595      -7.292  49.312 147.801  1.00  0.84           C  
ATOM   4700  O   PRO A 595      -7.527  50.172 146.952  1.00  0.84           O  
ATOM   4701  CB  PRO A 595      -6.187  47.535 146.454  1.00  0.84           C  
ATOM   4702  CG  PRO A 595      -5.365  46.308 146.838  1.00  0.84           C  
ATOM   4703  CD  PRO A 595      -5.596  46.201 148.344  1.00  0.84           C  
ATOM   4704  N   ASN A 596      -8.122  49.059 148.824  1.00  0.73           N  
ATOM   4705  CA  ASN A 596      -9.349  49.797 149.057  1.00  0.73           C  
ATOM   4706  C   ASN A 596      -9.196  50.740 150.239  1.00  0.73           C  
ATOM   4707  O   ASN A 596     -10.146  51.404 150.644  1.00  0.73           O  
ATOM   4708  CB  ASN A 596     -10.517  48.819 149.342  1.00  0.73           C  
ATOM   4709  CG  ASN A 596     -10.819  48.013 148.085  1.00  0.73           C  
ATOM   4710  OD1 ASN A 596     -10.675  48.474 146.954  1.00  0.73           O  
ATOM   4711  ND2 ASN A 596     -11.266  46.752 148.277  1.00  0.73           N  
ATOM   4712  N   LYS A 597      -7.992  50.838 150.833  1.00  0.75           N  
ATOM   4713  CA  LYS A 597      -7.752  51.767 151.912  1.00  0.75           C  
ATOM   4714  C   LYS A 597      -7.643  53.212 151.448  1.00  0.75           C  
ATOM   4715  O   LYS A 597      -7.125  53.518 150.376  1.00  0.75           O  
ATOM   4716  CB  LYS A 597      -6.473  51.378 152.674  1.00  0.75           C  
ATOM   4717  CG  LYS A 597      -6.315  52.053 154.045  1.00  0.75           C  
ATOM   4718  CD  LYS A 597      -4.982  51.647 154.661  1.00  0.75           C  
ATOM   4719  CE  LYS A 597      -4.929  51.791 156.181  1.00  0.75           C  
ATOM   4720  NZ  LYS A 597      -3.868  50.916 156.719  1.00  0.75           N  
ATOM   4721  N   PHE A 598      -8.117  54.155 152.283  1.00  0.78           N  
ATOM   4722  CA  PHE A 598      -7.917  55.577 152.099  1.00  0.78           C  
ATOM   4723  C   PHE A 598      -6.449  55.992 152.082  1.00  0.78           C  
ATOM   4724  O   PHE A 598      -5.763  56.014 153.105  1.00  0.78           O  
ATOM   4725  CB  PHE A 598      -8.629  56.393 153.207  1.00  0.78           C  
ATOM   4726  CG  PHE A 598     -10.114  56.204 153.103  1.00  0.78           C  
ATOM   4727  CD1 PHE A 598     -10.848  56.943 152.161  1.00  0.78           C  
ATOM   4728  CD2 PHE A 598     -10.784  55.280 153.924  1.00  0.78           C  
ATOM   4729  CE1 PHE A 598     -12.231  56.760 152.035  1.00  0.78           C  
ATOM   4730  CE2 PHE A 598     -12.166  55.090 153.796  1.00  0.78           C  
ATOM   4731  CZ  PHE A 598     -12.889  55.830 152.852  1.00  0.78           C  
ATOM   4732  N   PHE A 599      -5.956  56.359 150.889  1.00  0.86           N  
ATOM   4733  CA  PHE A 599      -4.600  56.789 150.647  1.00  0.86           C  
ATOM   4734  C   PHE A 599      -4.646  58.216 150.122  1.00  0.86           C  
ATOM   4735  O   PHE A 599      -5.467  58.566 149.278  1.00  0.86           O  
ATOM   4736  CB  PHE A 599      -3.933  55.836 149.616  1.00  0.86           C  
ATOM   4737  CG  PHE A 599      -2.456  56.097 149.473  1.00  0.86           C  
ATOM   4738  CD1 PHE A 599      -1.981  56.904 148.427  1.00  0.86           C  
ATOM   4739  CD2 PHE A 599      -1.535  55.559 150.388  1.00  0.86           C  
ATOM   4740  CE1 PHE A 599      -0.614  57.172 148.294  1.00  0.86           C  
ATOM   4741  CE2 PHE A 599      -0.165  55.827 150.260  1.00  0.86           C  
ATOM   4742  CZ  PHE A 599       0.292  56.638 149.214  1.00  0.86           C  
ATOM   4743  N   VAL A 600      -3.760  59.090 150.633  1.00  0.91           N  
ATOM   4744  CA  VAL A 600      -3.692  60.480 150.217  1.00  0.91           C  
ATOM   4745  C   VAL A 600      -2.749  60.574 149.027  1.00  0.91           C  
ATOM   4746  O   VAL A 600      -1.583  60.203 149.185  1.00  0.91           O  
ATOM   4747  CB  VAL A 600      -3.191  61.400 151.326  1.00  0.91           C  
ATOM   4748  CG1 VAL A 600      -3.308  62.878 150.896  1.00  0.91           C  
ATOM   4749  CG2 VAL A 600      -4.034  61.148 152.589  1.00  0.91           C  
ATOM   4750  N   PRO A 601      -3.149  61.013 147.832  1.00  0.96           N  
ATOM   4751  CA  PRO A 601      -2.315  60.844 146.653  1.00  0.96           C  
ATOM   4752  C   PRO A 601      -1.096  61.749 146.653  1.00  0.96           C  
ATOM   4753  O   PRO A 601      -1.188  62.921 147.019  1.00  0.96           O  
ATOM   4754  CB  PRO A 601      -3.268  61.128 145.474  1.00  0.96           C  
ATOM   4755  CG  PRO A 601      -4.394  61.974 146.077  1.00  0.96           C  
ATOM   4756  CD  PRO A 601      -4.519  61.394 147.483  1.00  0.96           C  
ATOM   4757  N   ARG A 602       0.065  61.216 146.231  1.00  0.91           N  
ATOM   4758  CA  ARG A 602       1.317  61.947 146.173  1.00  0.91           C  
ATOM   4759  C   ARG A 602       1.976  61.840 144.808  1.00  0.91           C  
ATOM   4760  O   ARG A 602       1.967  60.804 144.145  1.00  0.91           O  
ATOM   4761  CB  ARG A 602       2.361  61.477 147.221  1.00  0.91           C  
ATOM   4762  CG  ARG A 602       1.974  61.752 148.689  1.00  0.91           C  
ATOM   4763  CD  ARG A 602       3.150  61.530 149.642  1.00  0.91           C  
ATOM   4764  NE  ARG A 602       2.707  61.809 151.045  1.00  0.91           N  
ATOM   4765  CZ  ARG A 602       3.562  62.171 152.009  1.00  0.91           C  
ATOM   4766  NH1 ARG A 602       4.846  62.416 151.775  1.00  0.91           N  
ATOM   4767  NH2 ARG A 602       3.123  62.267 153.263  1.00  0.91           N  
ATOM   4768  N   THR A 603       2.622  62.938 144.388  1.00  0.95           N  
ATOM   4769  CA  THR A 603       3.593  62.927 143.305  1.00  0.95           C  
ATOM   4770  C   THR A 603       4.919  63.152 143.989  1.00  0.95           C  
ATOM   4771  O   THR A 603       5.181  64.245 144.484  1.00  0.95           O  
ATOM   4772  CB  THR A 603       3.383  64.013 142.252  1.00  0.95           C  
ATOM   4773  OG1 THR A 603       2.130  63.825 141.606  1.00  0.95           O  
ATOM   4774  CG2 THR A 603       4.447  63.908 141.150  1.00  0.95           C  
ATOM   4775  N   VAL A 604       5.778  62.115 144.068  1.00  0.97           N  
ATOM   4776  CA  VAL A 604       7.059  62.200 144.760  1.00  0.97           C  
ATOM   4777  C   VAL A 604       8.145  62.510 143.761  1.00  0.97           C  
ATOM   4778  O   VAL A 604       8.342  61.827 142.758  1.00  0.97           O  
ATOM   4779  CB  VAL A 604       7.456  60.975 145.584  1.00  0.97           C  
ATOM   4780  CG1 VAL A 604       8.743  61.287 146.386  1.00  0.97           C  
ATOM   4781  CG2 VAL A 604       6.323  60.633 146.569  1.00  0.97           C  
ATOM   4782  N   MET A 605       8.873  63.599 144.007  1.00  0.94           N  
ATOM   4783  CA  MET A 605       9.858  64.121 143.107  1.00  0.94           C  
ATOM   4784  C   MET A 605      11.194  64.218 143.799  1.00  0.94           C  
ATOM   4785  O   MET A 605      11.368  64.922 144.790  1.00  0.94           O  
ATOM   4786  CB  MET A 605       9.449  65.517 142.610  1.00  0.94           C  
ATOM   4787  CG  MET A 605       8.122  65.526 141.827  1.00  0.94           C  
ATOM   4788  SD  MET A 605       7.787  67.086 140.979  1.00  0.94           S  
ATOM   4789  CE  MET A 605       9.132  66.865 139.776  1.00  0.94           C  
ATOM   4790  N   ILE A 606      12.195  63.505 143.271  1.00  0.96           N  
ATOM   4791  CA  ILE A 606      13.542  63.522 143.808  1.00  0.96           C  
ATOM   4792  C   ILE A 606      14.435  63.968 142.673  1.00  0.96           C  
ATOM   4793  O   ILE A 606      14.322  63.475 141.560  1.00  0.96           O  
ATOM   4794  CB  ILE A 606      13.968  62.165 144.364  1.00  0.96           C  
ATOM   4795  CG1 ILE A 606      12.937  61.690 145.417  1.00  0.96           C  
ATOM   4796  CG2 ILE A 606      15.373  62.287 144.999  1.00  0.96           C  
ATOM   4797  CD1 ILE A 606      13.092  60.231 145.857  1.00  0.96           C  
ATOM   4798  N   GLY A 607      15.318  64.958 142.865  1.00  0.99           N  
ATOM   4799  CA  GLY A 607      16.126  65.441 141.751  1.00  0.99           C  
ATOM   4800  C   GLY A 607      17.412  66.040 142.207  1.00  0.99           C  
ATOM   4801  O   GLY A 607      17.519  66.594 143.297  1.00  0.99           O  
ATOM   4802  N   GLY A 608      18.452  65.969 141.368  1.00  0.99           N  
ATOM   4803  CA  GLY A 608      19.761  66.417 141.800  1.00  0.99           C  
ATOM   4804  C   GLY A 608      20.863  65.760 141.045  1.00  0.99           C  
ATOM   4805  O   GLY A 608      20.728  64.666 140.510  1.00  0.99           O  
ATOM   4806  N   LYS A 609      22.021  66.428 140.991  1.00  0.93           N  
ATOM   4807  CA  LYS A 609      23.208  65.907 140.347  1.00  0.93           C  
ATOM   4808  C   LYS A 609      24.130  65.222 141.347  1.00  0.93           C  
ATOM   4809  O   LYS A 609      24.320  65.677 142.477  1.00  0.93           O  
ATOM   4810  CB  LYS A 609      23.946  67.040 139.593  1.00  0.93           C  
ATOM   4811  CG  LYS A 609      23.125  67.583 138.413  1.00  0.93           C  
ATOM   4812  CD  LYS A 609      23.786  68.773 137.699  1.00  0.93           C  
ATOM   4813  CE  LYS A 609      22.896  69.313 136.576  1.00  0.93           C  
ATOM   4814  NZ  LYS A 609      23.494  70.486 135.909  1.00  0.93           N  
ATOM   4815  N   ALA A 610      24.733  64.093 140.940  1.00  0.95           N  
ATOM   4816  CA  ALA A 610      25.705  63.353 141.717  1.00  0.95           C  
ATOM   4817  C   ALA A 610      27.096  63.664 141.183  1.00  0.95           C  
ATOM   4818  O   ALA A 610      27.283  63.866 139.989  1.00  0.95           O  
ATOM   4819  CB  ALA A 610      25.403  61.846 141.598  1.00  0.95           C  
ATOM   4820  N   ALA A 611      28.134  63.767 142.041  1.00  0.90           N  
ATOM   4821  CA  ALA A 611      29.488  63.975 141.548  1.00  0.90           C  
ATOM   4822  C   ALA A 611      30.004  62.782 140.708  1.00  0.90           C  
ATOM   4823  O   ALA A 611      29.719  61.644 141.086  1.00  0.90           O  
ATOM   4824  CB  ALA A 611      30.451  64.316 142.703  1.00  0.90           C  
ATOM   4825  N   PRO A 612      30.736  62.924 139.594  1.00  0.89           N  
ATOM   4826  CA  PRO A 612      31.001  61.814 138.678  1.00  0.89           C  
ATOM   4827  C   PRO A 612      31.758  60.642 139.260  1.00  0.89           C  
ATOM   4828  O   PRO A 612      31.508  59.519 138.822  1.00  0.89           O  
ATOM   4829  CB  PRO A 612      31.778  62.455 137.524  1.00  0.89           C  
ATOM   4830  CG  PRO A 612      31.170  63.852 137.448  1.00  0.89           C  
ATOM   4831  CD  PRO A 612      30.928  64.205 138.916  1.00  0.89           C  
ATOM   4832  N   GLY A 613      32.686  60.893 140.213  1.00  0.83           N  
ATOM   4833  CA  GLY A 613      33.439  59.861 140.926  1.00  0.83           C  
ATOM   4834  C   GLY A 613      32.726  59.279 142.125  1.00  0.83           C  
ATOM   4835  O   GLY A 613      33.216  58.357 142.771  1.00  0.83           O  
ATOM   4836  N   TYR A 614      31.539  59.803 142.479  1.00  0.89           N  
ATOM   4837  CA  TYR A 614      30.816  59.427 143.679  1.00  0.89           C  
ATOM   4838  C   TYR A 614      29.867  58.277 143.374  1.00  0.89           C  
ATOM   4839  O   TYR A 614      28.691  58.452 143.056  1.00  0.89           O  
ATOM   4840  CB  TYR A 614      30.068  60.685 144.198  1.00  0.89           C  
ATOM   4841  CG  TYR A 614      29.455  60.647 145.581  1.00  0.89           C  
ATOM   4842  CD1 TYR A 614      29.442  59.532 146.447  1.00  0.89           C  
ATOM   4843  CD2 TYR A 614      28.862  61.842 146.021  1.00  0.89           C  
ATOM   4844  CE1 TYR A 614      28.857  59.627 147.721  1.00  0.89           C  
ATOM   4845  CE2 TYR A 614      28.292  61.942 147.294  1.00  0.89           C  
ATOM   4846  CZ  TYR A 614      28.297  60.835 148.144  1.00  0.89           C  
ATOM   4847  OH  TYR A 614      27.762  60.951 149.436  1.00  0.89           O  
ATOM   4848  N   HIS A 615      30.386  57.040 143.493  1.00  0.88           N  
ATOM   4849  CA  HIS A 615      29.688  55.804 143.171  1.00  0.88           C  
ATOM   4850  C   HIS A 615      28.387  55.605 143.935  1.00  0.88           C  
ATOM   4851  O   HIS A 615      27.346  55.316 143.352  1.00  0.88           O  
ATOM   4852  CB  HIS A 615      30.630  54.609 143.469  1.00  0.88           C  
ATOM   4853  CG  HIS A 615      30.044  53.260 143.203  1.00  0.88           C  
ATOM   4854  ND1 HIS A 615      29.654  52.926 141.923  1.00  0.88           N  
ATOM   4855  CD2 HIS A 615      29.806  52.234 144.058  1.00  0.88           C  
ATOM   4856  CE1 HIS A 615      29.186  51.692 142.025  1.00  0.88           C  
ATOM   4857  NE2 HIS A 615      29.256  51.235 143.294  1.00  0.88           N  
ATOM   4858  N   MET A 616      28.391  55.825 145.264  1.00  0.92           N  
ATOM   4859  CA  MET A 616      27.223  55.637 146.105  1.00  0.92           C  
ATOM   4860  C   MET A 616      26.050  56.551 145.745  1.00  0.92           C  
ATOM   4861  O   MET A 616      24.904  56.116 145.661  1.00  0.92           O  
ATOM   4862  CB  MET A 616      27.650  55.765 147.585  1.00  0.92           C  
ATOM   4863  CG  MET A 616      26.602  55.289 148.606  1.00  0.92           C  
ATOM   4864  SD  MET A 616      26.117  53.548 148.402  1.00  0.92           S  
ATOM   4865  CE  MET A 616      24.354  53.939 148.470  1.00  0.92           C  
ATOM   4866  N   ALA A 617      26.317  57.833 145.428  1.00  0.96           N  
ATOM   4867  CA  ALA A 617      25.331  58.756 144.899  1.00  0.96           C  
ATOM   4868  C   ALA A 617      24.727  58.344 143.553  1.00  0.96           C  
ATOM   4869  O   ALA A 617      23.518  58.441 143.345  1.00  0.96           O  
ATOM   4870  CB  ALA A 617      25.977  60.144 144.774  1.00  0.96           C  
ATOM   4871  N   LYS A 618      25.546  57.832 142.608  1.00  0.92           N  
ATOM   4872  CA  LYS A 618      25.062  57.255 141.360  1.00  0.92           C  
ATOM   4873  C   LYS A 618      24.179  56.023 141.560  1.00  0.92           C  
ATOM   4874  O   LYS A 618      23.133  55.889 140.922  1.00  0.92           O  
ATOM   4875  CB  LYS A 618      26.232  56.942 140.388  1.00  0.92           C  
ATOM   4876  CG  LYS A 618      26.800  58.220 139.749  1.00  0.92           C  
ATOM   4877  CD  LYS A 618      27.923  58.003 138.713  1.00  0.92           C  
ATOM   4878  CE  LYS A 618      28.072  59.260 137.845  1.00  0.92           C  
ATOM   4879  NZ  LYS A 618      29.177  59.216 136.857  1.00  0.92           N  
ATOM   4880  N   MET A 619      24.536  55.118 142.493  1.00  0.92           N  
ATOM   4881  CA  MET A 619      23.692  54.002 142.898  1.00  0.92           C  
ATOM   4882  C   MET A 619      22.337  54.425 143.477  1.00  0.92           C  
ATOM   4883  O   MET A 619      21.309  53.825 143.166  1.00  0.92           O  
ATOM   4884  CB  MET A 619      24.428  53.072 143.898  1.00  0.92           C  
ATOM   4885  CG  MET A 619      25.677  52.380 143.307  1.00  0.92           C  
ATOM   4886  SD  MET A 619      25.407  51.465 141.759  1.00  0.92           S  
ATOM   4887  CE  MET A 619      24.291  50.195 142.410  1.00  0.92           C  
ATOM   4888  N   ILE A 620      22.285  55.502 144.294  1.00  0.96           N  
ATOM   4889  CA  ILE A 620      21.046  56.111 144.789  1.00  0.96           C  
ATOM   4890  C   ILE A 620      20.150  56.636 143.661  1.00  0.96           C  
ATOM   4891  O   ILE A 620      18.938  56.425 143.677  1.00  0.96           O  
ATOM   4892  CB  ILE A 620      21.316  57.211 145.829  1.00  0.96           C  
ATOM   4893  CG1 ILE A 620      22.009  56.611 147.075  1.00  0.96           C  
ATOM   4894  CG2 ILE A 620      20.009  57.913 146.269  1.00  0.96           C  
ATOM   4895  CD1 ILE A 620      22.677  57.648 147.990  1.00  0.96           C  
ATOM   4896  N   ILE A 621      20.711  57.288 142.617  1.00  0.96           N  
ATOM   4897  CA  ILE A 621      19.956  57.706 141.429  1.00  0.96           C  
ATOM   4898  C   ILE A 621      19.359  56.523 140.684  1.00  0.96           C  
ATOM   4899  O   ILE A 621      18.175  56.518 140.345  1.00  0.96           O  
ATOM   4900  CB  ILE A 621      20.811  58.531 140.458  1.00  0.96           C  
ATOM   4901  CG1 ILE A 621      21.208  59.866 141.131  1.00  0.96           C  
ATOM   4902  CG2 ILE A 621      20.066  58.791 139.119  1.00  0.96           C  
ATOM   4903  CD1 ILE A 621      22.148  60.733 140.285  1.00  0.96           C  
ATOM   4904  N   ARG A 622      20.149  55.449 140.461  1.00  0.90           N  
ATOM   4905  CA  ARG A 622      19.661  54.237 139.825  1.00  0.90           C  
ATOM   4906  C   ARG A 622      18.559  53.551 140.624  1.00  0.90           C  
ATOM   4907  O   ARG A 622      17.605  53.006 140.066  1.00  0.90           O  
ATOM   4908  CB  ARG A 622      20.801  53.229 139.522  1.00  0.90           C  
ATOM   4909  CG  ARG A 622      20.349  51.972 138.737  1.00  0.90           C  
ATOM   4910  CD  ARG A 622      19.767  52.270 137.348  1.00  0.90           C  
ATOM   4911  NE  ARG A 622      19.211  50.994 136.796  1.00  0.90           N  
ATOM   4912  CZ  ARG A 622      17.911  50.671 136.806  1.00  0.90           C  
ATOM   4913  NH1 ARG A 622      17.534  49.510 136.273  1.00  0.90           N  
ATOM   4914  NH2 ARG A 622      16.983  51.461 137.333  1.00  0.90           N  
ATOM   4915  N   LEU A 623      18.662  53.576 141.967  1.00  0.94           N  
ATOM   4916  CA  LEU A 623      17.625  53.102 142.859  1.00  0.94           C  
ATOM   4917  C   LEU A 623      16.314  53.878 142.743  1.00  0.94           C  
ATOM   4918  O   LEU A 623      15.248  53.281 142.610  1.00  0.94           O  
ATOM   4919  CB  LEU A 623      18.131  53.138 144.326  1.00  0.94           C  
ATOM   4920  CG  LEU A 623      17.140  52.593 145.367  1.00  0.94           C  
ATOM   4921  CD1 LEU A 623      16.765  51.140 145.085  1.00  0.94           C  
ATOM   4922  CD2 LEU A 623      17.692  52.739 146.793  1.00  0.94           C  
ATOM   4923  N   VAL A 624      16.352  55.231 142.724  1.00  0.96           N  
ATOM   4924  CA  VAL A 624      15.153  56.062 142.584  1.00  0.96           C  
ATOM   4925  C   VAL A 624      14.443  55.808 141.259  1.00  0.96           C  
ATOM   4926  O   VAL A 624      13.221  55.659 141.204  1.00  0.96           O  
ATOM   4927  CB  VAL A 624      15.450  57.563 142.712  1.00  0.96           C  
ATOM   4928  CG1 VAL A 624      14.193  58.423 142.440  1.00  0.96           C  
ATOM   4929  CG2 VAL A 624      15.977  57.889 144.118  1.00  0.96           C  
ATOM   4930  N   THR A 625      15.203  55.705 140.149  1.00  0.93           N  
ATOM   4931  CA  THR A 625      14.652  55.400 138.830  1.00  0.93           C  
ATOM   4932  C   THR A 625      14.025  54.020 138.745  1.00  0.93           C  
ATOM   4933  O   THR A 625      12.922  53.874 138.230  1.00  0.93           O  
ATOM   4934  CB  THR A 625      15.646  55.587 137.687  1.00  0.93           C  
ATOM   4935  OG1 THR A 625      16.805  54.777 137.843  1.00  0.93           O  
ATOM   4936  CG2 THR A 625      16.113  57.052 137.651  1.00  0.93           C  
ATOM   4937  N   ALA A 626      14.670  52.986 139.328  1.00  0.94           N  
ATOM   4938  CA  ALA A 626      14.169  51.624 139.376  1.00  0.94           C  
ATOM   4939  C   ALA A 626      12.815  51.491 140.073  1.00  0.94           C  
ATOM   4940  O   ALA A 626      11.901  50.814 139.605  1.00  0.94           O  
ATOM   4941  CB  ALA A 626      15.200  50.775 140.149  1.00  0.94           C  
ATOM   4942  N   ILE A 627      12.664  52.183 141.218  1.00  0.94           N  
ATOM   4943  CA  ILE A 627      11.426  52.307 141.973  1.00  0.94           C  
ATOM   4944  C   ILE A 627      10.367  53.056 141.178  1.00  0.94           C  
ATOM   4945  O   ILE A 627       9.228  52.606 141.093  1.00  0.94           O  
ATOM   4946  CB  ILE A 627      11.704  52.970 143.325  1.00  0.94           C  
ATOM   4947  CG1 ILE A 627      12.555  52.017 144.205  1.00  0.94           C  
ATOM   4948  CG2 ILE A 627      10.402  53.359 144.063  1.00  0.94           C  
ATOM   4949  CD1 ILE A 627      13.357  52.732 145.272  1.00  0.94           C  
ATOM   4950  N   GLY A 628      10.729  54.188 140.529  1.00  0.92           N  
ATOM   4951  CA  GLY A 628       9.884  54.950 139.606  1.00  0.92           C  
ATOM   4952  C   GLY A 628       9.206  54.145 138.542  1.00  0.92           C  
ATOM   4953  O   GLY A 628       7.985  54.190 138.417  1.00  0.92           O  
ATOM   4954  N   ASP A 629       9.981  53.358 137.781  1.00  0.87           N  
ATOM   4955  CA  ASP A 629       9.469  52.462 136.764  1.00  0.87           C  
ATOM   4956  C   ASP A 629       8.501  51.413 137.343  1.00  0.87           C  
ATOM   4957  O   ASP A 629       7.405  51.190 136.843  1.00  0.87           O  
ATOM   4958  CB  ASP A 629      10.665  51.778 136.044  1.00  0.87           C  
ATOM   4959  CG  ASP A 629      11.553  52.788 135.325  1.00  0.87           C  
ATOM   4960  OD1 ASP A 629      11.013  53.801 134.809  1.00  0.87           O  
ATOM   4961  OD2 ASP A 629      12.787  52.534 135.266  1.00  0.87           O  
ATOM   4962  N   VAL A 630       8.821  50.766 138.482  1.00  0.91           N  
ATOM   4963  CA  VAL A 630       7.887  49.827 139.111  1.00  0.91           C  
ATOM   4964  C   VAL A 630       6.607  50.484 139.642  1.00  0.91           C  
ATOM   4965  O   VAL A 630       5.502  49.995 139.417  1.00  0.91           O  
ATOM   4966  CB  VAL A 630       8.559  49.004 140.214  1.00  0.91           C  
ATOM   4967  CG1 VAL A 630       7.565  48.017 140.867  1.00  0.91           C  
ATOM   4968  CG2 VAL A 630       9.713  48.198 139.585  1.00  0.91           C  
ATOM   4969  N   VAL A 631       6.703  51.627 140.351  1.00  0.92           N  
ATOM   4970  CA  VAL A 631       5.554  52.336 140.908  1.00  0.92           C  
ATOM   4971  C   VAL A 631       4.656  52.966 139.849  1.00  0.92           C  
ATOM   4972  O   VAL A 631       3.432  52.849 139.903  1.00  0.92           O  
ATOM   4973  CB  VAL A 631       5.997  53.408 141.912  1.00  0.92           C  
ATOM   4974  CG1 VAL A 631       4.795  54.203 142.466  1.00  0.92           C  
ATOM   4975  CG2 VAL A 631       6.732  52.739 143.092  1.00  0.92           C  
ATOM   4976  N   ASN A 632       5.230  53.643 138.830  1.00  0.87           N  
ATOM   4977  CA  ASN A 632       4.459  54.384 137.843  1.00  0.87           C  
ATOM   4978  C   ASN A 632       3.690  53.491 136.888  1.00  0.87           C  
ATOM   4979  O   ASN A 632       2.670  53.910 136.340  1.00  0.87           O  
ATOM   4980  CB  ASN A 632       5.358  55.303 136.974  1.00  0.87           C  
ATOM   4981  CG  ASN A 632       5.890  56.470 137.793  1.00  0.87           C  
ATOM   4982  OD1 ASN A 632       5.337  56.868 138.817  1.00  0.87           O  
ATOM   4983  ND2 ASN A 632       6.977  57.100 137.295  1.00  0.87           N  
ATOM   4984  N   HIS A 633       4.157  52.252 136.657  1.00  0.84           N  
ATOM   4985  CA  HIS A 633       3.529  51.348 135.716  1.00  0.84           C  
ATOM   4986  C   HIS A 633       2.698  50.267 136.386  1.00  0.84           C  
ATOM   4987  O   HIS A 633       2.175  49.384 135.710  1.00  0.84           O  
ATOM   4988  CB  HIS A 633       4.589  50.695 134.802  1.00  0.84           C  
ATOM   4989  CG  HIS A 633       5.269  51.685 133.893  1.00  0.84           C  
ATOM   4990  ND1 HIS A 633       6.497  52.194 134.246  1.00  0.84           N  
ATOM   4991  CD2 HIS A 633       4.907  52.161 132.672  1.00  0.84           C  
ATOM   4992  CE1 HIS A 633       6.875  52.956 133.247  1.00  0.84           C  
ATOM   4993  NE2 HIS A 633       5.945  52.976 132.263  1.00  0.84           N  
ATOM   4994  N   ASP A 634       2.505  50.309 137.720  1.00  0.88           N  
ATOM   4995  CA  ASP A 634       1.647  49.361 138.398  1.00  0.88           C  
ATOM   4996  C   ASP A 634       0.144  49.729 138.293  1.00  0.88           C  
ATOM   4997  O   ASP A 634      -0.263  50.837 138.667  1.00  0.88           O  
ATOM   4998  CB  ASP A 634       2.095  49.211 139.868  1.00  0.88           C  
ATOM   4999  CG  ASP A 634       1.492  47.974 140.483  1.00  0.88           C  
ATOM   5000  OD1 ASP A 634       2.187  46.936 140.602  1.00  0.88           O  
ATOM   5001  OD2 ASP A 634       0.289  47.988 140.859  1.00  0.88           O  
ATOM   5002  N   PRO A 635      -0.739  48.846 137.812  1.00  0.89           N  
ATOM   5003  CA  PRO A 635      -2.152  49.162 137.638  1.00  0.89           C  
ATOM   5004  C   PRO A 635      -2.939  49.132 138.937  1.00  0.89           C  
ATOM   5005  O   PRO A 635      -4.075  49.597 138.935  1.00  0.89           O  
ATOM   5006  CB  PRO A 635      -2.645  48.067 136.675  1.00  0.89           C  
ATOM   5007  CG  PRO A 635      -1.726  46.875 136.955  1.00  0.89           C  
ATOM   5008  CD  PRO A 635      -0.386  47.552 137.219  1.00  0.89           C  
ATOM   5009  N   ALA A 636      -2.407  48.601 140.058  1.00  0.91           N  
ATOM   5010  CA  ALA A 636      -3.133  48.603 141.317  1.00  0.91           C  
ATOM   5011  C   ALA A 636      -2.847  49.879 142.103  1.00  0.91           C  
ATOM   5012  O   ALA A 636      -3.583  50.278 143.011  1.00  0.91           O  
ATOM   5013  CB  ALA A 636      -2.704  47.371 142.141  1.00  0.91           C  
ATOM   5014  N   VAL A 637      -1.760  50.575 141.726  1.00  0.91           N  
ATOM   5015  CA  VAL A 637      -1.396  51.859 142.285  1.00  0.91           C  
ATOM   5016  C   VAL A 637      -2.087  52.992 141.550  1.00  0.91           C  
ATOM   5017  O   VAL A 637      -2.746  53.828 142.169  1.00  0.91           O  
ATOM   5018  CB  VAL A 637       0.114  52.048 142.278  1.00  0.91           C  
ATOM   5019  CG1 VAL A 637       0.499  53.421 142.863  1.00  0.91           C  
ATOM   5020  CG2 VAL A 637       0.728  50.932 143.145  1.00  0.91           C  
ATOM   5021  N   GLY A 638      -1.999  53.037 140.201  1.00  0.87           N  
ATOM   5022  CA  GLY A 638      -2.504  54.148 139.388  1.00  0.87           C  
ATOM   5023  C   GLY A 638      -2.158  55.543 139.873  1.00  0.87           C  
ATOM   5024  O   GLY A 638      -1.005  55.886 140.111  1.00  0.87           O  
ATOM   5025  N   ASP A 639      -3.182  56.396 140.046  1.00  0.89           N  
ATOM   5026  CA  ASP A 639      -3.014  57.823 140.277  1.00  0.89           C  
ATOM   5027  C   ASP A 639      -2.889  58.168 141.757  1.00  0.89           C  
ATOM   5028  O   ASP A 639      -2.891  59.334 142.154  1.00  0.89           O  
ATOM   5029  CB  ASP A 639      -4.226  58.585 139.680  1.00  0.89           C  
ATOM   5030  CG  ASP A 639      -4.227  58.475 138.167  1.00  0.89           C  
ATOM   5031  OD1 ASP A 639      -3.123  58.275 137.594  1.00  0.89           O  
ATOM   5032  OD2 ASP A 639      -5.328  58.571 137.580  1.00  0.89           O  
ATOM   5033  N   ARG A 640      -2.759  57.143 142.620  1.00  0.88           N  
ATOM   5034  CA  ARG A 640      -2.434  57.278 144.025  1.00  0.88           C  
ATOM   5035  C   ARG A 640      -0.992  57.701 144.273  1.00  0.88           C  
ATOM   5036  O   ARG A 640      -0.711  58.521 145.143  1.00  0.88           O  
ATOM   5037  CB  ARG A 640      -2.702  55.927 144.727  1.00  0.88           C  
ATOM   5038  CG  ARG A 640      -4.202  55.567 144.731  1.00  0.88           C  
ATOM   5039  CD  ARG A 640      -4.477  54.097 145.046  1.00  0.88           C  
ATOM   5040  NE  ARG A 640      -5.958  53.906 144.973  1.00  0.88           N  
ATOM   5041  CZ  ARG A 640      -6.535  52.726 145.217  1.00  0.88           C  
ATOM   5042  NH1 ARG A 640      -7.843  52.657 145.441  1.00  0.88           N  
ATOM   5043  NH2 ARG A 640      -5.831  51.606 145.266  1.00  0.88           N  
ATOM   5044  N   LEU A 641      -0.030  57.144 143.518  1.00  0.94           N  
ATOM   5045  CA  LEU A 641       1.370  57.442 143.738  1.00  0.94           C  
ATOM   5046  C   LEU A 641       2.119  57.482 142.423  1.00  0.94           C  
ATOM   5047  O   LEU A 641       2.083  56.544 141.631  1.00  0.94           O  
ATOM   5048  CB  LEU A 641       2.002  56.389 144.687  1.00  0.94           C  
ATOM   5049  CG  LEU A 641       3.446  56.665 145.161  1.00  0.94           C  
ATOM   5050  CD1 LEU A 641       3.551  57.978 145.947  1.00  0.94           C  
ATOM   5051  CD2 LEU A 641       3.945  55.500 146.032  1.00  0.94           C  
ATOM   5052  N   ARG A 642       2.828  58.592 142.158  1.00  0.87           N  
ATOM   5053  CA  ARG A 642       3.664  58.743 140.984  1.00  0.87           C  
ATOM   5054  C   ARG A 642       5.037  59.205 141.442  1.00  0.87           C  
ATOM   5055  O   ARG A 642       5.147  60.039 142.337  1.00  0.87           O  
ATOM   5056  CB  ARG A 642       3.077  59.769 139.971  1.00  0.87           C  
ATOM   5057  CG  ARG A 642       1.701  59.389 139.362  1.00  0.87           C  
ATOM   5058  CD  ARG A 642       1.720  58.164 138.432  1.00  0.87           C  
ATOM   5059  NE  ARG A 642       0.352  57.984 137.830  1.00  0.87           N  
ATOM   5060  CZ  ARG A 642       0.043  57.045 136.928  1.00  0.87           C  
ATOM   5061  NH1 ARG A 642      -1.195  56.967 136.449  1.00  0.87           N  
ATOM   5062  NH2 ARG A 642       0.947  56.183 136.479  1.00  0.87           N  
ATOM   5063  N   VAL A 643       6.124  58.659 140.862  1.00  0.93           N  
ATOM   5064  CA  VAL A 643       7.492  59.004 141.243  1.00  0.93           C  
ATOM   5065  C   VAL A 643       8.245  59.546 140.039  1.00  0.93           C  
ATOM   5066  O   VAL A 643       8.282  58.932 138.975  1.00  0.93           O  
ATOM   5067  CB  VAL A 643       8.289  57.834 141.821  1.00  0.93           C  
ATOM   5068  CG1 VAL A 643       9.638  58.316 142.404  1.00  0.93           C  
ATOM   5069  CG2 VAL A 643       7.470  57.126 142.916  1.00  0.93           C  
ATOM   5070  N   ILE A 644       8.876  60.725 140.174  1.00  0.92           N  
ATOM   5071  CA  ILE A 644       9.658  61.351 139.116  1.00  0.92           C  
ATOM   5072  C   ILE A 644      11.072  61.576 139.625  1.00  0.92           C  
ATOM   5073  O   ILE A 644      11.278  62.145 140.697  1.00  0.92           O  
ATOM   5074  CB  ILE A 644       9.071  62.702 138.684  1.00  0.92           C  
ATOM   5075  CG1 ILE A 644       7.606  62.579 138.187  1.00  0.92           C  
ATOM   5076  CG2 ILE A 644       9.953  63.392 137.615  1.00  0.92           C  
ATOM   5077  CD1 ILE A 644       7.429  61.780 136.889  1.00  0.92           C  
ATOM   5078  N   PHE A 645      12.105  61.165 138.853  1.00  0.94           N  
ATOM   5079  CA  PHE A 645      13.452  61.656 139.083  1.00  0.94           C  
ATOM   5080  C   PHE A 645      13.613  62.919 138.245  1.00  0.94           C  
ATOM   5081  O   PHE A 645      13.489  62.882 137.025  1.00  0.94           O  
ATOM   5082  CB  PHE A 645      14.558  60.615 138.745  1.00  0.94           C  
ATOM   5083  CG  PHE A 645      15.914  61.118 139.198  1.00  0.94           C  
ATOM   5084  CD1 PHE A 645      16.292  61.043 140.550  1.00  0.94           C  
ATOM   5085  CD2 PHE A 645      16.785  61.741 138.288  1.00  0.94           C  
ATOM   5086  CE1 PHE A 645      17.511  61.579 140.987  1.00  0.94           C  
ATOM   5087  CE2 PHE A 645      18.004  62.283 138.719  1.00  0.94           C  
ATOM   5088  CZ  PHE A 645      18.367  62.198 140.069  1.00  0.94           C  
ATOM   5089  N   LEU A 646      13.845  64.086 138.874  1.00  0.93           N  
ATOM   5090  CA  LEU A 646      13.915  65.341 138.152  1.00  0.93           C  
ATOM   5091  C   LEU A 646      15.302  65.517 137.543  1.00  0.93           C  
ATOM   5092  O   LEU A 646      16.303  65.664 138.247  1.00  0.93           O  
ATOM   5093  CB  LEU A 646      13.569  66.568 139.050  1.00  0.93           C  
ATOM   5094  CG  LEU A 646      12.481  67.525 138.506  1.00  0.93           C  
ATOM   5095  CD1 LEU A 646      12.489  68.841 139.302  1.00  0.93           C  
ATOM   5096  CD2 LEU A 646      12.643  67.838 137.014  1.00  0.93           C  
ATOM   5097  N   GLU A 647      15.380  65.503 136.203  1.00  0.90           N  
ATOM   5098  CA  GLU A 647      16.626  65.523 135.464  1.00  0.90           C  
ATOM   5099  C   GLU A 647      17.196  66.911 135.265  1.00  0.90           C  
ATOM   5100  O   GLU A 647      16.496  67.871 134.948  1.00  0.90           O  
ATOM   5101  CB  GLU A 647      16.470  64.898 134.058  1.00  0.90           C  
ATOM   5102  CG  GLU A 647      15.971  63.441 134.107  1.00  0.90           C  
ATOM   5103  CD  GLU A 647      16.085  62.702 132.775  1.00  0.90           C  
ATOM   5104  OE1 GLU A 647      17.090  62.900 132.040  1.00  0.90           O  
ATOM   5105  OE2 GLU A 647      15.183  61.863 132.529  1.00  0.90           O  
ATOM   5106  N   ASN A 648      18.527  67.047 135.435  1.00  0.91           N  
ATOM   5107  CA  ASN A 648      19.274  68.258 135.159  1.00  0.91           C  
ATOM   5108  C   ASN A 648      18.850  69.422 136.038  1.00  0.91           C  
ATOM   5109  O   ASN A 648      18.698  70.556 135.576  1.00  0.91           O  
ATOM   5110  CB  ASN A 648      19.247  68.596 133.638  1.00  0.91           C  
ATOM   5111  CG  ASN A 648      20.352  69.553 133.208  1.00  0.91           C  
ATOM   5112  OD1 ASN A 648      21.451  69.600 133.770  1.00  0.91           O  
ATOM   5113  ND2 ASN A 648      20.059  70.354 132.157  1.00  0.91           N  
ATOM   5114  N   TYR A 649      18.686  69.145 137.350  1.00  0.93           N  
ATOM   5115  CA  TYR A 649      18.401  70.136 138.369  1.00  0.93           C  
ATOM   5116  C   TYR A 649      19.462  71.242 138.394  1.00  0.93           C  
ATOM   5117  O   TYR A 649      20.668  71.003 138.410  1.00  0.93           O  
ATOM   5118  CB  TYR A 649      18.222  69.451 139.755  1.00  0.93           C  
ATOM   5119  CG  TYR A 649      17.790  70.428 140.823  1.00  0.93           C  
ATOM   5120  CD1 TYR A 649      16.553  71.091 140.732  1.00  0.93           C  
ATOM   5121  CD2 TYR A 649      18.643  70.722 141.901  1.00  0.93           C  
ATOM   5122  CE1 TYR A 649      16.189  72.047 141.693  1.00  0.93           C  
ATOM   5123  CE2 TYR A 649      18.271  71.665 142.870  1.00  0.93           C  
ATOM   5124  CZ  TYR A 649      17.043  72.328 142.765  1.00  0.93           C  
ATOM   5125  OH  TYR A 649      16.657  73.238 143.771  1.00  0.93           O  
ATOM   5126  N   ARG A 650      18.989  72.489 138.311  1.00  0.90           N  
ATOM   5127  CA  ARG A 650      19.785  73.664 138.075  1.00  0.90           C  
ATOM   5128  C   ARG A 650      18.885  74.826 138.423  1.00  0.90           C  
ATOM   5129  O   ARG A 650      17.706  74.622 138.716  1.00  0.90           O  
ATOM   5130  CB  ARG A 650      20.286  73.755 136.611  1.00  0.90           C  
ATOM   5131  CG  ARG A 650      19.164  73.902 135.565  1.00  0.90           C  
ATOM   5132  CD  ARG A 650      19.631  73.626 134.135  1.00  0.90           C  
ATOM   5133  NE  ARG A 650      18.501  73.939 133.215  1.00  0.90           N  
ATOM   5134  CZ  ARG A 650      17.481  73.123 132.922  1.00  0.90           C  
ATOM   5135  NH1 ARG A 650      17.344  71.928 133.492  1.00  0.90           N  
ATOM   5136  NH2 ARG A 650      16.587  73.501 132.012  1.00  0.90           N  
ATOM   5137  N   VAL A 651      19.400  76.068 138.418  1.00  0.96           N  
ATOM   5138  CA  VAL A 651      18.683  77.243 138.895  1.00  0.96           C  
ATOM   5139  C   VAL A 651      17.388  77.527 138.140  1.00  0.96           C  
ATOM   5140  O   VAL A 651      16.347  77.706 138.768  1.00  0.96           O  
ATOM   5141  CB  VAL A 651      19.606  78.456 138.914  1.00  0.96           C  
ATOM   5142  CG1 VAL A 651      18.887  79.710 139.453  1.00  0.96           C  
ATOM   5143  CG2 VAL A 651      20.820  78.135 139.812  1.00  0.96           C  
ATOM   5144  N   SER A 652      17.382  77.464 136.791  1.00  0.95           N  
ATOM   5145  CA  SER A 652      16.176  77.678 136.001  1.00  0.95           C  
ATOM   5146  C   SER A 652      15.127  76.584 136.108  1.00  0.95           C  
ATOM   5147  O   SER A 652      13.949  76.786 135.800  1.00  0.95           O  
ATOM   5148  CB  SER A 652      16.512  77.858 134.504  1.00  0.95           C  
ATOM   5149  OG  SER A 652      17.059  76.676 133.919  1.00  0.95           O  
ATOM   5150  N   LEU A 653      15.528  75.371 136.542  1.00  0.93           N  
ATOM   5151  CA  LEU A 653      14.605  74.301 136.887  1.00  0.93           C  
ATOM   5152  C   LEU A 653      14.043  74.482 138.293  1.00  0.93           C  
ATOM   5153  O   LEU A 653      12.863  74.243 138.546  1.00  0.93           O  
ATOM   5154  CB  LEU A 653      15.229  72.887 136.737  1.00  0.93           C  
ATOM   5155  CG  LEU A 653      14.355  71.879 135.948  1.00  0.93           C  
ATOM   5156  CD1 LEU A 653      15.006  70.492 135.958  1.00  0.93           C  
ATOM   5157  CD2 LEU A 653      12.912  71.757 136.466  1.00  0.93           C  
ATOM   5158  N   ALA A 654      14.874  74.950 139.247  1.00  0.98           N  
ATOM   5159  CA  ALA A 654      14.497  75.251 140.615  1.00  0.98           C  
ATOM   5160  C   ALA A 654      13.422  76.320 140.698  1.00  0.98           C  
ATOM   5161  O   ALA A 654      12.456  76.204 141.451  1.00  0.98           O  
ATOM   5162  CB  ALA A 654      15.750  75.673 141.403  1.00  0.98           C  
ATOM   5163  N   GLU A 655      13.535  77.351 139.844  1.00  0.94           N  
ATOM   5164  CA  GLU A 655      12.522  78.365 139.630  1.00  0.94           C  
ATOM   5165  C   GLU A 655      11.178  77.796 139.186  1.00  0.94           C  
ATOM   5166  O   GLU A 655      10.123  78.299 139.551  1.00  0.94           O  
ATOM   5167  CB  GLU A 655      13.042  79.384 138.595  1.00  0.94           C  
ATOM   5168  CG  GLU A 655      14.237  80.201 139.148  1.00  0.94           C  
ATOM   5169  CD  GLU A 655      15.053  80.910 138.075  1.00  0.94           C  
ATOM   5170  OE1 GLU A 655      15.927  81.727 138.472  1.00  0.94           O  
ATOM   5171  OE2 GLU A 655      14.862  80.658 136.862  1.00  0.94           O  
ATOM   5172  N   LYS A 656      11.165  76.712 138.392  1.00  0.92           N  
ATOM   5173  CA  LYS A 656       9.933  76.032 138.035  1.00  0.92           C  
ATOM   5174  C   LYS A 656       9.350  75.094 139.108  1.00  0.92           C  
ATOM   5175  O   LYS A 656       8.154  75.145 139.389  1.00  0.92           O  
ATOM   5176  CB  LYS A 656      10.152  75.226 136.733  1.00  0.92           C  
ATOM   5177  CG  LYS A 656      10.540  76.096 135.532  1.00  0.92           C  
ATOM   5178  CD  LYS A 656      10.879  75.241 134.304  1.00  0.92           C  
ATOM   5179  CE  LYS A 656      11.064  76.073 133.036  1.00  0.92           C  
ATOM   5180  NZ  LYS A 656      12.219  76.979 133.179  1.00  0.92           N  
ATOM   5181  N   VAL A 657      10.158  74.196 139.726  1.00  0.95           N  
ATOM   5182  CA  VAL A 657       9.672  73.178 140.673  1.00  0.95           C  
ATOM   5183  C   VAL A 657       9.259  73.708 142.044  1.00  0.95           C  
ATOM   5184  O   VAL A 657       8.250  73.292 142.615  1.00  0.95           O  
ATOM   5185  CB  VAL A 657      10.638  71.985 140.788  1.00  0.95           C  
ATOM   5186  CG1 VAL A 657      11.975  72.376 141.442  1.00  0.95           C  
ATOM   5187  CG2 VAL A 657       9.984  70.776 141.497  1.00  0.95           C  
ATOM   5188  N   ILE A 658      10.011  74.665 142.627  1.00  0.96           N  
ATOM   5189  CA  ILE A 658       9.769  75.185 143.972  1.00  0.96           C  
ATOM   5190  C   ILE A 658       8.407  75.881 144.163  1.00  0.96           C  
ATOM   5191  O   ILE A 658       7.737  75.576 145.156  1.00  0.96           O  
ATOM   5192  CB  ILE A 658      10.957  76.038 144.439  1.00  0.96           C  
ATOM   5193  CG1 ILE A 658      12.226  75.154 144.557  1.00  0.96           C  
ATOM   5194  CG2 ILE A 658      10.662  76.735 145.784  1.00  0.96           C  
ATOM   5195  CD1 ILE A 658      13.525  75.955 144.704  1.00  0.96           C  
ATOM   5196  N   PRO A 659       7.875  76.752 143.293  1.00  0.98           N  
ATOM   5197  CA  PRO A 659       6.541  77.339 143.446  1.00  0.98           C  
ATOM   5198  C   PRO A 659       5.418  76.332 143.427  1.00  0.98           C  
ATOM   5199  O   PRO A 659       4.351  76.601 143.983  1.00  0.98           O  
ATOM   5200  CB  PRO A 659       6.429  78.330 142.280  1.00  0.98           C  
ATOM   5201  CG  PRO A 659       7.877  78.741 142.045  1.00  0.98           C  
ATOM   5202  CD  PRO A 659       8.616  77.424 142.225  1.00  0.98           C  
ATOM   5203  N   ALA A 660       5.628  75.166 142.802  1.00  0.95           N  
ATOM   5204  CA  ALA A 660       4.629  74.139 142.652  1.00  0.95           C  
ATOM   5205  C   ALA A 660       4.682  73.113 143.773  1.00  0.95           C  
ATOM   5206  O   ALA A 660       3.893  72.177 143.813  1.00  0.95           O  
ATOM   5207  CB  ALA A 660       4.896  73.433 141.313  1.00  0.95           C  
ATOM   5208  N   ALA A 661       5.596  73.269 144.743  1.00  0.98           N  
ATOM   5209  CA  ALA A 661       5.751  72.313 145.814  1.00  0.98           C  
ATOM   5210  C   ALA A 661       4.766  72.440 146.957  1.00  0.98           C  
ATOM   5211  O   ALA A 661       4.529  73.539 147.453  1.00  0.98           O  
ATOM   5212  CB  ALA A 661       7.162  72.476 146.391  1.00  0.98           C  
ATOM   5213  N   ASP A 662       4.193  71.313 147.421  1.00  0.97           N  
ATOM   5214  CA  ASP A 662       3.392  71.292 148.630  1.00  0.97           C  
ATOM   5215  C   ASP A 662       4.248  70.927 149.836  1.00  0.97           C  
ATOM   5216  O   ASP A 662       4.181  71.577 150.879  1.00  0.97           O  
ATOM   5217  CB  ASP A 662       2.232  70.279 148.545  1.00  0.97           C  
ATOM   5218  CG  ASP A 662       1.330  70.616 147.387  1.00  0.97           C  
ATOM   5219  OD1 ASP A 662       0.756  71.727 147.324  1.00  0.97           O  
ATOM   5220  OD2 ASP A 662       1.162  69.723 146.521  1.00  0.97           O  
ATOM   5221  N   LEU A 663       5.090  69.877 149.716  1.00  0.98           N  
ATOM   5222  CA  LEU A 663       5.947  69.398 150.788  1.00  0.98           C  
ATOM   5223  C   LEU A 663       7.408  69.448 150.383  1.00  0.98           C  
ATOM   5224  O   LEU A 663       7.798  69.107 149.269  1.00  0.98           O  
ATOM   5225  CB  LEU A 663       5.583  67.958 151.215  1.00  0.98           C  
ATOM   5226  CG  LEU A 663       6.333  67.361 152.427  1.00  0.98           C  
ATOM   5227  CD1 LEU A 663       5.934  68.017 153.756  1.00  0.98           C  
ATOM   5228  CD2 LEU A 663       6.070  65.852 152.509  1.00  0.98           C  
ATOM   5229  N   SER A 664       8.247  69.922 151.315  1.00  0.99           N  
ATOM   5230  CA  SER A 664       9.667  70.147 151.151  1.00  0.99           C  
ATOM   5231  C   SER A 664      10.461  69.221 152.040  1.00  0.99           C  
ATOM   5232  O   SER A 664      10.408  69.306 153.267  1.00  0.99           O  
ATOM   5233  CB  SER A 664       9.998  71.602 151.562  1.00  0.99           C  
ATOM   5234  OG  SER A 664      11.395  71.908 151.569  1.00  0.99           O  
ATOM   5235  N   GLU A 665      11.245  68.329 151.419  1.00  0.97           N  
ATOM   5236  CA  GLU A 665      12.038  67.335 152.105  1.00  0.97           C  
ATOM   5237  C   GLU A 665      13.418  67.841 152.487  1.00  0.97           C  
ATOM   5238  O   GLU A 665      14.301  68.089 151.657  1.00  0.97           O  
ATOM   5239  CB  GLU A 665      12.204  66.124 151.173  1.00  0.97           C  
ATOM   5240  CG  GLU A 665      10.927  65.268 151.031  1.00  0.97           C  
ATOM   5241  CD  GLU A 665      10.601  64.484 152.295  1.00  0.97           C  
ATOM   5242  OE1 GLU A 665      11.396  64.553 153.265  1.00  0.97           O  
ATOM   5243  OE2 GLU A 665       9.546  63.809 152.313  1.00  0.97           O  
ATOM   5244  N   GLN A 666      13.664  68.003 153.799  1.00  0.96           N  
ATOM   5245  CA  GLN A 666      14.891  68.566 154.329  1.00  0.96           C  
ATOM   5246  C   GLN A 666      15.416  67.661 155.422  1.00  0.96           C  
ATOM   5247  O   GLN A 666      15.578  68.040 156.577  1.00  0.96           O  
ATOM   5248  CB  GLN A 666      14.693  70.021 154.817  1.00  0.96           C  
ATOM   5249  CG  GLN A 666      14.043  70.951 153.758  1.00  0.96           C  
ATOM   5250  CD  GLN A 666      14.873  71.109 152.483  1.00  0.96           C  
ATOM   5251  OE1 GLN A 666      16.099  70.986 152.445  1.00  0.96           O  
ATOM   5252  NE2 GLN A 666      14.183  71.385 151.355  1.00  0.96           N  
ATOM   5253  N   ILE A 667      15.660  66.397 155.037  1.00  0.98           N  
ATOM   5254  CA  ILE A 667      15.790  65.251 155.920  1.00  0.98           C  
ATOM   5255  C   ILE A 667      17.210  64.783 156.223  1.00  0.98           C  
ATOM   5256  O   ILE A 667      17.429  63.633 156.615  1.00  0.98           O  
ATOM   5257  CB  ILE A 667      14.987  64.095 155.336  1.00  0.98           C  
ATOM   5258  CG1 ILE A 667      15.420  63.707 153.899  1.00  0.98           C  
ATOM   5259  CG2 ILE A 667      13.513  64.523 155.341  1.00  0.98           C  
ATOM   5260  CD1 ILE A 667      14.617  62.533 153.329  1.00  0.98           C  
ATOM   5261  N   SER A 668      18.215  65.672 156.092  1.00  0.96           N  
ATOM   5262  CA  SER A 668      19.607  65.435 156.461  1.00  0.96           C  
ATOM   5263  C   SER A 668      19.829  64.984 157.892  1.00  0.96           C  
ATOM   5264  O   SER A 668      19.063  65.281 158.804  1.00  0.96           O  
ATOM   5265  CB  SER A 668      20.487  66.694 156.259  1.00  0.96           C  
ATOM   5266  OG  SER A 668      19.970  67.821 156.965  1.00  0.96           O  
ATOM   5267  N   THR A 669      20.884  64.186 158.142  1.00  0.95           N  
ATOM   5268  CA  THR A 669      21.201  63.735 159.497  1.00  0.95           C  
ATOM   5269  C   THR A 669      21.556  64.895 160.404  1.00  0.95           C  
ATOM   5270  O   THR A 669      22.335  65.751 160.012  1.00  0.95           O  
ATOM   5271  CB  THR A 669      22.356  62.740 159.567  1.00  0.95           C  
ATOM   5272  OG1 THR A 669      22.307  61.828 158.487  1.00  0.95           O  
ATOM   5273  CG2 THR A 669      22.280  61.892 160.838  1.00  0.95           C  
ATOM   5274  N   ALA A 670      21.020  64.966 161.642  1.00  0.95           N  
ATOM   5275  CA  ALA A 670      21.319  66.066 162.544  1.00  0.95           C  
ATOM   5276  C   ALA A 670      22.811  66.288 162.792  1.00  0.95           C  
ATOM   5277  O   ALA A 670      23.526  65.407 163.268  1.00  0.95           O  
ATOM   5278  CB  ALA A 670      20.564  65.914 163.879  1.00  0.95           C  
ATOM   5279  N   GLY A 671      23.297  67.489 162.421  1.00  0.92           N  
ATOM   5280  CA  GLY A 671      24.698  67.853 162.469  1.00  0.92           C  
ATOM   5281  C   GLY A 671      25.443  67.704 161.163  1.00  0.92           C  
ATOM   5282  O   GLY A 671      26.670  67.737 161.184  1.00  0.92           O  
ATOM   5283  N   THR A 672      24.779  67.530 159.994  1.00  0.92           N  
ATOM   5284  CA  THR A 672      25.504  67.357 158.724  1.00  0.92           C  
ATOM   5285  C   THR A 672      25.262  68.438 157.682  1.00  0.92           C  
ATOM   5286  O   THR A 672      26.189  68.777 156.944  1.00  0.92           O  
ATOM   5287  CB  THR A 672      25.301  66.002 158.035  1.00  0.92           C  
ATOM   5288  OG1 THR A 672      23.983  65.797 157.547  1.00  0.92           O  
ATOM   5289  CG2 THR A 672      25.606  64.856 159.006  1.00  0.92           C  
ATOM   5290  N   GLU A 673      24.065  69.053 157.589  1.00  0.91           N  
ATOM   5291  CA  GLU A 673      23.828  70.158 156.672  1.00  0.91           C  
ATOM   5292  C   GLU A 673      24.123  71.459 157.403  1.00  0.91           C  
ATOM   5293  O   GLU A 673      23.498  71.823 158.395  1.00  0.91           O  
ATOM   5294  CB  GLU A 673      22.369  70.133 156.140  1.00  0.91           C  
ATOM   5295  CG  GLU A 673      21.947  71.157 155.047  1.00  0.91           C  
ATOM   5296  CD  GLU A 673      22.152  70.693 153.614  1.00  0.91           C  
ATOM   5297  OE1 GLU A 673      21.764  69.553 153.242  1.00  0.91           O  
ATOM   5298  OE2 GLU A 673      22.673  71.488 152.787  1.00  0.91           O  
ATOM   5299  N   ALA A 674      25.127  72.228 156.931  1.00  0.94           N  
ATOM   5300  CA  ALA A 674      25.594  73.435 157.589  1.00  0.94           C  
ATOM   5301  C   ALA A 674      24.527  74.518 157.725  1.00  0.94           C  
ATOM   5302  O   ALA A 674      24.501  75.287 158.680  1.00  0.94           O  
ATOM   5303  CB  ALA A 674      26.798  73.994 156.816  1.00  0.94           C  
ATOM   5304  N   SER A 675      23.597  74.594 156.763  1.00  0.95           N  
ATOM   5305  CA  SER A 675      22.517  75.568 156.817  1.00  0.95           C  
ATOM   5306  C   SER A 675      21.408  75.122 155.905  1.00  0.95           C  
ATOM   5307  O   SER A 675      20.268  74.918 156.321  1.00  0.95           O  
ATOM   5308  CB  SER A 675      23.003  76.988 156.406  1.00  0.95           C  
ATOM   5309  OG  SER A 675      21.999  77.995 156.523  1.00  0.95           O  
ATOM   5310  N   GLY A 676      21.735  74.923 154.618  1.00  0.97           N  
ATOM   5311  CA  GLY A 676      20.750  74.790 153.562  1.00  0.97           C  
ATOM   5312  C   GLY A 676      20.348  76.139 153.021  1.00  0.97           C  
ATOM   5313  O   GLY A 676      20.398  77.161 153.696  1.00  0.97           O  
ATOM   5314  N   THR A 677      19.938  76.187 151.745  1.00  0.96           N  
ATOM   5315  CA  THR A 677      19.251  77.364 151.211  1.00  0.96           C  
ATOM   5316  C   THR A 677      18.019  76.950 150.439  1.00  0.96           C  
ATOM   5317  O   THR A 677      17.151  77.771 150.157  1.00  0.96           O  
ATOM   5318  CB  THR A 677      20.092  78.268 150.303  1.00  0.96           C  
ATOM   5319  OG1 THR A 677      20.722  77.563 149.239  1.00  0.96           O  
ATOM   5320  CG2 THR A 677      21.201  78.949 151.115  1.00  0.96           C  
ATOM   5321  N   GLY A 678      17.856  75.652 150.081  1.00  0.98           N  
ATOM   5322  CA  GLY A 678      16.651  75.169 149.406  1.00  0.98           C  
ATOM   5323  C   GLY A 678      15.442  75.203 150.291  1.00  0.98           C  
ATOM   5324  O   GLY A 678      14.342  75.517 149.851  1.00  0.98           O  
ATOM   5325  N   ASN A 679      15.651  74.945 151.588  1.00  0.96           N  
ATOM   5326  CA  ASN A 679      14.652  74.942 152.634  1.00  0.96           C  
ATOM   5327  C   ASN A 679      13.931  76.281 152.775  1.00  0.96           C  
ATOM   5328  O   ASN A 679      12.703  76.345 152.816  1.00  0.96           O  
ATOM   5329  CB  ASN A 679      15.306  74.463 153.972  1.00  0.96           C  
ATOM   5330  CG  ASN A 679      16.598  75.188 154.376  1.00  0.96           C  
ATOM   5331  OD1 ASN A 679      17.159  76.001 153.641  1.00  0.96           O  
ATOM   5332  ND2 ASN A 679      17.120  74.828 155.568  1.00  0.96           N  
ATOM   5333  N   MET A 680      14.695  77.385 152.753  1.00  0.97           N  
ATOM   5334  CA  MET A 680      14.209  78.749 152.737  1.00  0.97           C  
ATOM   5335  C   MET A 680      13.349  79.076 151.519  1.00  0.97           C  
ATOM   5336  O   MET A 680      12.299  79.709 151.625  1.00  0.97           O  
ATOM   5337  CB  MET A 680      15.424  79.706 152.749  1.00  0.97           C  
ATOM   5338  CG  MET A 680      16.386  79.459 153.924  1.00  0.97           C  
ATOM   5339  SD  MET A 680      17.912  80.427 153.806  1.00  0.97           S  
ATOM   5340  CE  MET A 680      18.609  79.649 155.286  1.00  0.97           C  
ATOM   5341  N   LYS A 681      13.762  78.619 150.316  1.00  0.96           N  
ATOM   5342  CA  LYS A 681      13.041  78.846 149.071  1.00  0.96           C  
ATOM   5343  C   LYS A 681      11.657  78.224 149.045  1.00  0.96           C  
ATOM   5344  O   LYS A 681      10.689  78.851 148.620  1.00  0.96           O  
ATOM   5345  CB  LYS A 681      13.828  78.300 147.857  1.00  0.96           C  
ATOM   5346  CG  LYS A 681      15.217  78.917 147.671  1.00  0.96           C  
ATOM   5347  CD  LYS A 681      16.043  78.118 146.656  1.00  0.96           C  
ATOM   5348  CE  LYS A 681      17.532  78.449 146.703  1.00  0.96           C  
ATOM   5349  NZ  LYS A 681      18.264  77.542 145.796  1.00  0.96           N  
ATOM   5350  N   PHE A 682      11.520  76.976 149.529  1.00  0.97           N  
ATOM   5351  CA  PHE A 682      10.241  76.304 149.673  1.00  0.97           C  
ATOM   5352  C   PHE A 682       9.302  76.993 150.652  1.00  0.97           C  
ATOM   5353  O   PHE A 682       8.117  77.168 150.370  1.00  0.97           O  
ATOM   5354  CB  PHE A 682      10.468  74.865 150.181  1.00  0.97           C  
ATOM   5355  CG  PHE A 682      10.988  73.983 149.080  1.00  0.97           C  
ATOM   5356  CD1 PHE A 682      10.155  73.612 148.013  1.00  0.97           C  
ATOM   5357  CD2 PHE A 682      12.288  73.457 149.135  1.00  0.97           C  
ATOM   5358  CE1 PHE A 682      10.624  72.754 147.011  1.00  0.97           C  
ATOM   5359  CE2 PHE A 682      12.768  72.605 148.135  1.00  0.97           C  
ATOM   5360  CZ  PHE A 682      11.931  72.261 147.071  1.00  0.97           C  
ATOM   5361  N   MET A 683       9.834  77.437 151.810  1.00  0.96           N  
ATOM   5362  CA  MET A 683       9.097  78.144 152.847  1.00  0.96           C  
ATOM   5363  C   MET A 683       8.495  79.452 152.349  1.00  0.96           C  
ATOM   5364  O   MET A 683       7.324  79.758 152.571  1.00  0.96           O  
ATOM   5365  CB  MET A 683      10.070  78.452 154.014  1.00  0.96           C  
ATOM   5366  CG  MET A 683       9.413  78.988 155.300  1.00  0.96           C  
ATOM   5367  SD  MET A 683      10.636  79.467 156.553  1.00  0.96           S  
ATOM   5368  CE  MET A 683       9.476  79.984 157.842  1.00  0.96           C  
ATOM   5369  N   LEU A 684       9.288  80.234 151.584  1.00  0.97           N  
ATOM   5370  CA  LEU A 684       8.866  81.462 150.933  1.00  0.97           C  
ATOM   5371  C   LEU A 684       7.750  81.232 149.920  1.00  0.97           C  
ATOM   5372  O   LEU A 684       6.827  82.027 149.767  1.00  0.97           O  
ATOM   5373  CB  LEU A 684      10.080  82.122 150.212  1.00  0.97           C  
ATOM   5374  CG  LEU A 684      10.340  83.613 150.530  1.00  0.97           C  
ATOM   5375  CD1 LEU A 684      11.311  84.201 149.494  1.00  0.97           C  
ATOM   5376  CD2 LEU A 684       9.064  84.465 150.571  1.00  0.97           C  
ATOM   5377  N   ASN A 685       7.816  80.101 149.200  1.00  0.97           N  
ATOM   5378  CA  ASN A 685       6.943  79.785 148.089  1.00  0.97           C  
ATOM   5379  C   ASN A 685       5.740  78.940 148.477  1.00  0.97           C  
ATOM   5380  O   ASN A 685       5.064  78.355 147.625  1.00  0.97           O  
ATOM   5381  CB  ASN A 685       7.767  79.056 147.008  1.00  0.97           C  
ATOM   5382  CG  ASN A 685       8.461  80.131 146.191  1.00  0.97           C  
ATOM   5383  OD1 ASN A 685       7.820  80.749 145.342  1.00  0.97           O  
ATOM   5384  ND2 ASN A 685       9.748  80.394 146.475  1.00  0.97           N  
ATOM   5385  N   GLY A 686       5.407  78.871 149.775  1.00  0.98           N  
ATOM   5386  CA  GLY A 686       4.150  78.293 150.225  1.00  0.98           C  
ATOM   5387  C   GLY A 686       4.135  76.801 150.339  1.00  0.98           C  
ATOM   5388  O   GLY A 686       3.084  76.185 150.197  1.00  0.98           O  
ATOM   5389  N   ALA A 687       5.294  76.178 150.577  1.00  0.99           N  
ATOM   5390  CA  ALA A 687       5.377  74.760 150.843  1.00  0.99           C  
ATOM   5391  C   ALA A 687       5.642  74.525 152.320  1.00  0.99           C  
ATOM   5392  O   ALA A 687       6.307  75.317 152.984  1.00  0.99           O  
ATOM   5393  CB  ALA A 687       6.514  74.139 150.014  1.00  0.99           C  
ATOM   5394  N   LEU A 688       5.118  73.416 152.874  1.00  0.97           N  
ATOM   5395  CA  LEU A 688       5.428  73.007 154.231  1.00  0.97           C  
ATOM   5396  C   LEU A 688       6.665  72.131 154.238  1.00  0.97           C  
ATOM   5397  O   LEU A 688       6.990  71.464 153.260  1.00  0.97           O  
ATOM   5398  CB  LEU A 688       4.255  72.257 154.912  1.00  0.97           C  
ATOM   5399  CG  LEU A 688       2.988  73.116 155.095  1.00  0.97           C  
ATOM   5400  CD1 LEU A 688       1.891  72.324 155.818  1.00  0.97           C  
ATOM   5401  CD2 LEU A 688       3.280  74.403 155.876  1.00  0.97           C  
ATOM   5402  N   THR A 689       7.413  72.113 155.353  1.00  0.98           N  
ATOM   5403  CA  THR A 689       8.713  71.449 155.402  1.00  0.98           C  
ATOM   5404  C   THR A 689       8.681  70.289 156.360  1.00  0.98           C  
ATOM   5405  O   THR A 689       8.277  70.420 157.516  1.00  0.98           O  
ATOM   5406  CB  THR A 689       9.839  72.396 155.811  1.00  0.98           C  
ATOM   5407  OG1 THR A 689      10.006  73.399 154.817  1.00  0.98           O  
ATOM   5408  CG2 THR A 689      11.200  71.696 155.936  1.00  0.98           C  
ATOM   5409  N   ILE A 690       9.147  69.113 155.894  1.00  0.97           N  
ATOM   5410  CA  ILE A 690       9.425  67.962 156.730  1.00  0.97           C  
ATOM   5411  C   ILE A 690      10.931  67.855 156.843  1.00  0.97           C  
ATOM   5412  O   ILE A 690      11.688  68.035 155.890  1.00  0.97           O  
ATOM   5413  CB  ILE A 690       8.771  66.669 156.240  1.00  0.97           C  
ATOM   5414  CG1 ILE A 690       9.071  65.466 157.167  1.00  0.97           C  
ATOM   5415  CG2 ILE A 690       9.200  66.374 154.792  1.00  0.97           C  
ATOM   5416  CD1 ILE A 690       8.130  64.282 156.939  1.00  0.97           C  
ATOM   5417  N   GLY A 691      11.443  67.655 158.065  1.00  0.99           N  
ATOM   5418  CA  GLY A 691      12.875  67.739 158.245  1.00  0.99           C  
ATOM   5419  C   GLY A 691      13.315  67.460 159.639  1.00  0.99           C  
ATOM   5420  O   GLY A 691      12.532  67.287 160.564  1.00  0.99           O  
ATOM   5421  N   THR A 692      14.632  67.418 159.811  1.00  0.96           N  
ATOM   5422  CA  THR A 692      15.310  67.221 161.075  1.00  0.96           C  
ATOM   5423  C   THR A 692      15.684  68.569 161.660  1.00  0.96           C  
ATOM   5424  O   THR A 692      15.694  69.592 160.972  1.00  0.96           O  
ATOM   5425  CB  THR A 692      16.592  66.429 160.865  1.00  0.96           C  
ATOM   5426  OG1 THR A 692      17.286  66.978 159.750  1.00  0.96           O  
ATOM   5427  CG2 THR A 692      16.235  64.974 160.526  1.00  0.96           C  
ATOM   5428  N   MET A 693      16.025  68.622 162.965  1.00  0.93           N  
ATOM   5429  CA  MET A 693      16.630  69.806 163.563  1.00  0.93           C  
ATOM   5430  C   MET A 693      18.103  69.946 163.194  1.00  0.93           C  
ATOM   5431  O   MET A 693      18.991  69.761 164.025  1.00  0.93           O  
ATOM   5432  CB  MET A 693      16.490  69.830 165.105  1.00  0.93           C  
ATOM   5433  CG  MET A 693      15.034  69.982 165.577  1.00  0.93           C  
ATOM   5434  SD  MET A 693      14.253  71.550 165.078  1.00  0.93           S  
ATOM   5435  CE  MET A 693      14.680  72.483 166.577  1.00  0.93           C  
ATOM   5436  N   ASP A 694      18.367  70.286 161.923  1.00  0.93           N  
ATOM   5437  CA  ASP A 694      19.684  70.426 161.353  1.00  0.93           C  
ATOM   5438  C   ASP A 694      19.750  71.755 160.609  1.00  0.93           C  
ATOM   5439  O   ASP A 694      18.723  72.315 160.226  1.00  0.93           O  
ATOM   5440  CB  ASP A 694      19.906  69.224 160.401  1.00  0.93           C  
ATOM   5441  CG  ASP A 694      21.344  69.070 159.972  1.00  0.93           C  
ATOM   5442  OD1 ASP A 694      21.581  68.516 158.873  1.00  0.93           O  
ATOM   5443  OD2 ASP A 694      22.233  69.484 160.757  1.00  0.93           O  
ATOM   5444  N   GLY A 695      20.961  72.313 160.412  1.00  0.95           N  
ATOM   5445  CA  GLY A 695      21.214  73.621 159.801  1.00  0.95           C  
ATOM   5446  C   GLY A 695      20.231  74.734 160.110  1.00  0.95           C  
ATOM   5447  O   GLY A 695      19.984  75.090 161.259  1.00  0.95           O  
ATOM   5448  N   ALA A 696      19.624  75.329 159.068  1.00  0.96           N  
ATOM   5449  CA  ALA A 696      18.709  76.438 159.229  1.00  0.96           C  
ATOM   5450  C   ALA A 696      17.265  75.983 159.407  1.00  0.96           C  
ATOM   5451  O   ALA A 696      16.379  76.805 159.630  1.00  0.96           O  
ATOM   5452  CB  ALA A 696      18.794  77.355 157.995  1.00  0.96           C  
ATOM   5453  N   ASN A 697      16.988  74.654 159.405  1.00  0.95           N  
ATOM   5454  CA  ASN A 697      15.676  74.105 159.738  1.00  0.95           C  
ATOM   5455  C   ASN A 697      15.283  74.460 161.170  1.00  0.95           C  
ATOM   5456  O   ASN A 697      14.121  74.733 161.462  1.00  0.95           O  
ATOM   5457  CB  ASN A 697      15.602  72.557 159.631  1.00  0.95           C  
ATOM   5458  CG  ASN A 697      15.822  72.034 158.214  1.00  0.95           C  
ATOM   5459  OD1 ASN A 697      15.810  72.752 157.211  1.00  0.95           O  
ATOM   5460  ND2 ASN A 697      15.989  70.692 158.132  1.00  0.95           N  
ATOM   5461  N   VAL A 698      16.280  74.493 162.087  1.00  0.95           N  
ATOM   5462  CA  VAL A 698      16.130  74.909 163.479  1.00  0.95           C  
ATOM   5463  C   VAL A 698      15.610  76.331 163.583  1.00  0.95           C  
ATOM   5464  O   VAL A 698      14.607  76.605 164.236  1.00  0.95           O  
ATOM   5465  CB  VAL A 698      17.476  74.858 164.212  1.00  0.95           C  
ATOM   5466  CG1 VAL A 698      17.327  75.299 165.686  1.00  0.95           C  
ATOM   5467  CG2 VAL A 698      18.039  73.428 164.146  1.00  0.95           C  
ATOM   5468  N   GLU A 699      16.251  77.261 162.851  1.00  0.94           N  
ATOM   5469  CA  GLU A 699      15.858  78.653 162.773  1.00  0.94           C  
ATOM   5470  C   GLU A 699      14.504  78.854 162.104  1.00  0.94           C  
ATOM   5471  O   GLU A 699      13.706  79.675 162.536  1.00  0.94           O  
ATOM   5472  CB  GLU A 699      16.982  79.510 162.139  1.00  0.94           C  
ATOM   5473  CG  GLU A 699      18.224  79.527 163.064  1.00  0.94           C  
ATOM   5474  CD  GLU A 699      19.380  80.364 162.556  1.00  0.94           C  
ATOM   5475  OE1 GLU A 699      19.251  81.623 162.563  1.00  0.94           O  
ATOM   5476  OE2 GLU A 699      20.429  79.780 162.188  1.00  0.94           O  
ATOM   5477  N   MET A 700      14.165  78.091 161.047  1.00  0.95           N  
ATOM   5478  CA  MET A 700      12.837  78.087 160.443  1.00  0.95           C  
ATOM   5479  C   MET A 700      11.736  77.651 161.409  1.00  0.95           C  
ATOM   5480  O   MET A 700      10.664  78.254 161.459  1.00  0.95           O  
ATOM   5481  CB  MET A 700      12.850  77.205 159.167  1.00  0.95           C  
ATOM   5482  CG  MET A 700      13.695  77.835 158.036  1.00  0.95           C  
ATOM   5483  SD  MET A 700      14.213  76.744 156.678  1.00  0.95           S  
ATOM   5484  CE  MET A 700      12.606  76.034 156.243  1.00  0.95           C  
ATOM   5485  N   ALA A 701      11.997  76.631 162.250  1.00  0.95           N  
ATOM   5486  CA  ALA A 701      11.153  76.304 163.382  1.00  0.95           C  
ATOM   5487  C   ALA A 701      11.074  77.414 164.447  1.00  0.95           C  
ATOM   5488  O   ALA A 701       9.993  77.698 164.956  1.00  0.95           O  
ATOM   5489  CB  ALA A 701      11.598  74.959 163.990  1.00  0.95           C  
ATOM   5490  N   GLU A 702      12.189  78.108 164.790  1.00  0.90           N  
ATOM   5491  CA  GLU A 702      12.181  79.244 165.719  1.00  0.90           C  
ATOM   5492  C   GLU A 702      11.261  80.389 165.291  1.00  0.90           C  
ATOM   5493  O   GLU A 702      10.423  80.848 166.067  1.00  0.90           O  
ATOM   5494  CB  GLU A 702      13.594  79.891 165.876  1.00  0.90           C  
ATOM   5495  CG  GLU A 702      14.653  79.079 166.665  1.00  0.90           C  
ATOM   5496  CD  GLU A 702      16.038  79.699 166.522  1.00  0.90           C  
ATOM   5497  OE1 GLU A 702      16.128  80.945 166.650  1.00  0.90           O  
ATOM   5498  OE2 GLU A 702      17.036  78.982 166.265  1.00  0.90           O  
ATOM   5499  N   GLU A 703      11.380  80.854 164.031  1.00  0.91           N  
ATOM   5500  CA  GLU A 703      10.612  81.966 163.495  1.00  0.91           C  
ATOM   5501  C   GLU A 703       9.118  81.685 163.376  1.00  0.91           C  
ATOM   5502  O   GLU A 703       8.284  82.565 163.574  1.00  0.91           O  
ATOM   5503  CB  GLU A 703      11.142  82.393 162.102  1.00  0.91           C  
ATOM   5504  CG  GLU A 703      12.636  82.802 162.032  1.00  0.91           C  
ATOM   5505  CD  GLU A 703      13.013  84.019 162.869  1.00  0.91           C  
ATOM   5506  OE1 GLU A 703      12.334  85.068 162.795  1.00  0.91           O  
ATOM   5507  OE2 GLU A 703      14.064  83.912 163.564  1.00  0.91           O  
ATOM   5508  N   ALA A 704       8.726  80.450 163.009  1.00  0.92           N  
ATOM   5509  CA  ALA A 704       7.350  80.141 162.700  1.00  0.92           C  
ATOM   5510  C   ALA A 704       6.595  79.312 163.729  1.00  0.92           C  
ATOM   5511  O   ALA A 704       5.389  79.118 163.585  1.00  0.92           O  
ATOM   5512  CB  ALA A 704       7.405  79.270 161.449  1.00  0.92           C  
ATOM   5513  N   GLY A 705       7.276  78.785 164.764  1.00  0.94           N  
ATOM   5514  CA  GLY A 705       6.735  77.773 165.676  1.00  0.94           C  
ATOM   5515  C   GLY A 705       7.059  76.358 165.230  1.00  0.94           C  
ATOM   5516  O   GLY A 705       6.880  75.996 164.068  1.00  0.94           O  
ATOM   5517  N   GLU A 706       7.532  75.487 166.155  1.00  0.90           N  
ATOM   5518  CA  GLU A 706       7.968  74.121 165.866  1.00  0.90           C  
ATOM   5519  C   GLU A 706       6.815  73.222 165.410  1.00  0.90           C  
ATOM   5520  O   GLU A 706       6.993  72.297 164.620  1.00  0.90           O  
ATOM   5521  CB  GLU A 706       8.763  73.498 167.061  1.00  0.90           C  
ATOM   5522  CG  GLU A 706       9.634  72.268 166.667  1.00  0.90           C  
ATOM   5523  CD  GLU A 706      10.573  71.721 167.747  1.00  0.90           C  
ATOM   5524  OE1 GLU A 706      11.178  72.493 168.527  1.00  0.90           O  
ATOM   5525  OE2 GLU A 706      10.763  70.475 167.762  1.00  0.90           O  
ATOM   5526  N   GLU A 707       5.574  73.531 165.845  1.00  0.88           N  
ATOM   5527  CA  GLU A 707       4.346  72.843 165.505  1.00  0.88           C  
ATOM   5528  C   GLU A 707       3.846  73.145 164.108  1.00  0.88           C  
ATOM   5529  O   GLU A 707       3.022  72.418 163.557  1.00  0.88           O  
ATOM   5530  CB  GLU A 707       3.229  73.204 166.524  1.00  0.88           C  
ATOM   5531  CG  GLU A 707       2.553  74.604 166.398  1.00  0.88           C  
ATOM   5532  CD  GLU A 707       3.412  75.842 166.644  1.00  0.88           C  
ATOM   5533  OE1 GLU A 707       2.860  76.945 166.394  1.00  0.88           O  
ATOM   5534  OE2 GLU A 707       4.588  75.729 167.065  1.00  0.88           O  
ATOM   5535  N   ASN A 708       4.364  74.213 163.472  1.00  0.93           N  
ATOM   5536  CA  ASN A 708       3.990  74.573 162.120  1.00  0.93           C  
ATOM   5537  C   ASN A 708       4.969  73.968 161.119  1.00  0.93           C  
ATOM   5538  O   ASN A 708       4.964  74.309 159.935  1.00  0.93           O  
ATOM   5539  CB  ASN A 708       3.880  76.111 161.956  1.00  0.93           C  
ATOM   5540  CG  ASN A 708       2.758  76.621 162.857  1.00  0.93           C  
ATOM   5541  OD1 ASN A 708       1.572  76.314 162.690  1.00  0.93           O  
ATOM   5542  ND2 ASN A 708       3.128  77.466 163.838  1.00  0.93           N  
ATOM   5543  N   PHE A 709       5.814  73.021 161.582  1.00  0.94           N  
ATOM   5544  CA  PHE A 709       6.751  72.270 160.776  1.00  0.94           C  
ATOM   5545  C   PHE A 709       6.554  70.799 161.092  1.00  0.94           C  
ATOM   5546  O   PHE A 709       6.022  70.405 162.125  1.00  0.94           O  
ATOM   5547  CB  PHE A 709       8.254  72.619 161.085  1.00  0.94           C  
ATOM   5548  CG  PHE A 709       8.677  73.897 160.421  1.00  0.94           C  
ATOM   5549  CD1 PHE A 709       8.092  75.107 160.793  1.00  0.94           C  
ATOM   5550  CD2 PHE A 709       9.600  73.907 159.369  1.00  0.94           C  
ATOM   5551  CE1 PHE A 709       8.202  76.213 159.966  1.00  0.94           C  
ATOM   5552  CE2 PHE A 709       9.759  75.037 158.576  1.00  0.94           C  
ATOM   5553  CZ  PHE A 709       8.997  76.157 158.839  1.00  0.94           C  
ATOM   5554  N   PHE A 710       7.015  69.924 160.187  1.00  0.94           N  
ATOM   5555  CA  PHE A 710       6.984  68.492 160.381  1.00  0.94           C  
ATOM   5556  C   PHE A 710       8.379  68.030 160.778  1.00  0.94           C  
ATOM   5557  O   PHE A 710       9.078  67.304 160.073  1.00  0.94           O  
ATOM   5558  CB  PHE A 710       6.438  67.809 159.103  1.00  0.94           C  
ATOM   5559  CG  PHE A 710       4.956  68.057 159.008  1.00  0.94           C  
ATOM   5560  CD1 PHE A 710       4.436  69.017 158.122  1.00  0.94           C  
ATOM   5561  CD2 PHE A 710       4.066  67.312 159.804  1.00  0.94           C  
ATOM   5562  CE1 PHE A 710       3.054  69.230 158.034  1.00  0.94           C  
ATOM   5563  CE2 PHE A 710       2.684  67.525 159.719  1.00  0.94           C  
ATOM   5564  CZ  PHE A 710       2.181  68.485 158.835  1.00  0.94           C  
ATOM   5565  N   ILE A 711       8.826  68.492 161.962  1.00  0.94           N  
ATOM   5566  CA  ILE A 711      10.065  68.076 162.597  1.00  0.94           C  
ATOM   5567  C   ILE A 711       9.989  66.635 163.084  1.00  0.94           C  
ATOM   5568  O   ILE A 711       9.006  66.207 163.689  1.00  0.94           O  
ATOM   5569  CB  ILE A 711      10.504  69.022 163.718  1.00  0.94           C  
ATOM   5570  CG1 ILE A 711      10.627  70.489 163.225  1.00  0.94           C  
ATOM   5571  CG2 ILE A 711      11.840  68.565 164.348  1.00  0.94           C  
ATOM   5572  CD1 ILE A 711      11.627  70.721 162.079  1.00  0.94           C  
ATOM   5573  N   PHE A 712      11.044  65.841 162.828  1.00  0.94           N  
ATOM   5574  CA  PHE A 712      11.121  64.468 163.276  1.00  0.94           C  
ATOM   5575  C   PHE A 712      12.546  64.094 163.619  1.00  0.94           C  
ATOM   5576  O   PHE A 712      13.493  64.820 163.318  1.00  0.94           O  
ATOM   5577  CB  PHE A 712      10.551  63.460 162.225  1.00  0.94           C  
ATOM   5578  CG  PHE A 712      11.419  63.308 160.993  1.00  0.94           C  
ATOM   5579  CD1 PHE A 712      12.343  62.249 160.903  1.00  0.94           C  
ATOM   5580  CD2 PHE A 712      11.370  64.251 159.955  1.00  0.94           C  
ATOM   5581  CE1 PHE A 712      13.228  62.161 159.822  1.00  0.94           C  
ATOM   5582  CE2 PHE A 712      12.243  64.153 158.865  1.00  0.94           C  
ATOM   5583  CZ  PHE A 712      13.181  63.116 158.802  1.00  0.94           C  
ATOM   5584  N   GLY A 713      12.701  62.899 164.219  1.00  0.96           N  
ATOM   5585  CA  GLY A 713      13.984  62.237 164.362  1.00  0.96           C  
ATOM   5586  C   GLY A 713      14.926  62.777 165.392  1.00  0.96           C  
ATOM   5587  O   GLY A 713      14.664  63.738 166.118  1.00  0.96           O  
ATOM   5588  N   MET A 714      16.076  62.096 165.495  1.00  0.91           N  
ATOM   5589  CA  MET A 714      17.113  62.427 166.447  1.00  0.91           C  
ATOM   5590  C   MET A 714      17.754  63.797 166.237  1.00  0.91           C  
ATOM   5591  O   MET A 714      17.993  64.269 165.125  1.00  0.91           O  
ATOM   5592  CB  MET A 714      18.155  61.291 166.597  1.00  0.91           C  
ATOM   5593  CG  MET A 714      18.756  60.760 165.289  1.00  0.91           C  
ATOM   5594  SD  MET A 714      19.956  59.428 165.586  1.00  0.91           S  
ATOM   5595  CE  MET A 714      20.285  59.197 163.824  1.00  0.91           C  
ATOM   5596  N   ARG A 715      18.023  64.498 167.355  1.00  0.87           N  
ATOM   5597  CA  ARG A 715      18.644  65.806 167.373  1.00  0.87           C  
ATOM   5598  C   ARG A 715      20.144  65.611 167.596  1.00  0.87           C  
ATOM   5599  O   ARG A 715      20.593  64.485 167.787  1.00  0.87           O  
ATOM   5600  CB  ARG A 715      17.951  66.704 168.441  1.00  0.87           C  
ATOM   5601  CG  ARG A 715      16.475  67.022 168.082  1.00  0.87           C  
ATOM   5602  CD  ARG A 715      15.555  67.361 169.268  1.00  0.87           C  
ATOM   5603  NE  ARG A 715      14.162  67.444 168.707  1.00  0.87           N  
ATOM   5604  CZ  ARG A 715      13.350  68.510 168.651  1.00  0.87           C  
ATOM   5605  NH1 ARG A 715      13.638  69.705 169.150  1.00  0.87           N  
ATOM   5606  NH2 ARG A 715      12.173  68.362 168.052  1.00  0.87           N  
ATOM   5607  N   VAL A 716      20.977  66.682 167.536  1.00  0.86           N  
ATOM   5608  CA  VAL A 716      22.447  66.611 167.639  1.00  0.86           C  
ATOM   5609  C   VAL A 716      22.972  65.713 168.768  1.00  0.86           C  
ATOM   5610  O   VAL A 716      23.694  64.751 168.518  1.00  0.86           O  
ATOM   5611  CB  VAL A 716      23.035  68.025 167.752  1.00  0.86           C  
ATOM   5612  CG1 VAL A 716      24.531  68.028 168.148  1.00  0.86           C  
ATOM   5613  CG2 VAL A 716      22.829  68.746 166.405  1.00  0.86           C  
ATOM   5614  N   GLU A 717      22.533  65.942 170.024  1.00  0.80           N  
ATOM   5615  CA  GLU A 717      22.898  65.170 171.200  1.00  0.80           C  
ATOM   5616  C   GLU A 717      22.566  63.693 171.105  1.00  0.80           C  
ATOM   5617  O   GLU A 717      23.331  62.830 171.525  1.00  0.80           O  
ATOM   5618  CB  GLU A 717      22.116  65.708 172.420  1.00  0.80           C  
ATOM   5619  CG  GLU A 717      22.489  67.141 172.855  1.00  0.80           C  
ATOM   5620  CD  GLU A 717      21.839  67.506 174.191  1.00  0.80           C  
ATOM   5621  OE1 GLU A 717      21.296  66.590 174.869  1.00  0.80           O  
ATOM   5622  OE2 GLU A 717      21.893  68.708 174.546  1.00  0.80           O  
ATOM   5623  N   ASP A 718      21.398  63.358 170.554  1.00  0.87           N  
ATOM   5624  CA  ASP A 718      20.933  62.006 170.346  1.00  0.87           C  
ATOM   5625  C   ASP A 718      21.751  61.244 169.302  1.00  0.87           C  
ATOM   5626  O   ASP A 718      22.053  60.064 169.487  1.00  0.87           O  
ATOM   5627  CB  ASP A 718      19.425  62.028 170.048  1.00  0.87           C  
ATOM   5628  CG  ASP A 718      18.752  62.880 171.111  1.00  0.87           C  
ATOM   5629  OD1 ASP A 718      19.054  62.718 172.323  1.00  0.87           O  
ATOM   5630  OD2 ASP A 718      17.959  63.769 170.716  1.00  0.87           O  
ATOM   5631  N   VAL A 719      22.191  61.906 168.203  1.00  0.89           N  
ATOM   5632  CA  VAL A 719      23.143  61.334 167.248  1.00  0.89           C  
ATOM   5633  C   VAL A 719      24.479  60.984 167.906  1.00  0.89           C  
ATOM   5634  O   VAL A 719      24.951  59.852 167.784  1.00  0.89           O  
ATOM   5635  CB  VAL A 719      23.415  62.249 166.045  1.00  0.89           C  
ATOM   5636  CG1 VAL A 719      24.402  61.577 165.063  1.00  0.89           C  
ATOM   5637  CG2 VAL A 719      22.111  62.572 165.290  1.00  0.89           C  
ATOM   5638  N   ASP A 720      25.063  61.914 168.693  1.00  0.84           N  
ATOM   5639  CA  ASP A 720      26.296  61.733 169.445  1.00  0.84           C  
ATOM   5640  C   ASP A 720      26.233  60.583 170.451  1.00  0.84           C  
ATOM   5641  O   ASP A 720      27.147  59.764 170.552  1.00  0.84           O  
ATOM   5642  CB  ASP A 720      26.608  63.028 170.237  1.00  0.84           C  
ATOM   5643  CG  ASP A 720      27.025  64.183 169.340  1.00  0.84           C  
ATOM   5644  OD1 ASP A 720      27.205  63.980 168.116  1.00  0.84           O  
ATOM   5645  OD2 ASP A 720      27.200  65.293 169.906  1.00  0.84           O  
ATOM   5646  N   LYS A 721      25.119  60.455 171.204  1.00  0.79           N  
ATOM   5647  CA  LYS A 721      24.832  59.330 172.087  1.00  0.79           C  
ATOM   5648  C   LYS A 721      24.819  57.987 171.355  1.00  0.79           C  
ATOM   5649  O   LYS A 721      25.341  56.985 171.844  1.00  0.79           O  
ATOM   5650  CB  LYS A 721      23.448  59.508 172.779  1.00  0.79           C  
ATOM   5651  CG  LYS A 721      23.415  60.646 173.816  1.00  0.79           C  
ATOM   5652  CD  LYS A 721      22.001  60.991 174.326  1.00  0.79           C  
ATOM   5653  CE  LYS A 721      21.947  62.337 175.064  1.00  0.79           C  
ATOM   5654  NZ  LYS A 721      20.550  62.701 175.392  1.00  0.79           N  
ATOM   5655  N   LEU A 722      24.231  57.921 170.143  1.00  0.84           N  
ATOM   5656  CA  LEU A 722      24.227  56.730 169.315  1.00  0.84           C  
ATOM   5657  C   LEU A 722      25.618  56.354 168.816  1.00  0.84           C  
ATOM   5658  O   LEU A 722      25.998  55.185 168.856  1.00  0.84           O  
ATOM   5659  CB  LEU A 722      23.171  56.869 168.185  1.00  0.84           C  
ATOM   5660  CG  LEU A 722      22.688  55.566 167.502  1.00  0.84           C  
ATOM   5661  CD1 LEU A 722      22.249  54.488 168.509  1.00  0.84           C  
ATOM   5662  CD2 LEU A 722      21.504  55.895 166.576  1.00  0.84           C  
ATOM   5663  N   ASP A 723      26.450  57.330 168.404  1.00  0.82           N  
ATOM   5664  CA  ASP A 723      27.866  57.113 168.148  1.00  0.82           C  
ATOM   5665  C   ASP A 723      28.675  56.649 169.365  1.00  0.82           C  
ATOM   5666  O   ASP A 723      29.492  55.742 169.240  1.00  0.82           O  
ATOM   5667  CB  ASP A 723      28.507  58.356 167.519  1.00  0.82           C  
ATOM   5668  CG  ASP A 723      28.093  58.426 166.098  1.00  0.82           C  
ATOM   5669  OD1 ASP A 723      28.422  57.584 165.224  1.00  0.82           O  
ATOM   5670  OD2 ASP A 723      27.321  59.369 165.825  1.00  0.82           O  
ATOM   5671  N   GLN A 724      28.453  57.190 170.584  1.00  0.75           N  
ATOM   5672  CA  GLN A 724      29.062  56.675 171.811  1.00  0.75           C  
ATOM   5673  C   GLN A 724      28.716  55.224 172.148  1.00  0.75           C  
ATOM   5674  O   GLN A 724      29.585  54.434 172.508  1.00  0.75           O  
ATOM   5675  CB  GLN A 724      28.628  57.539 173.025  1.00  0.75           C  
ATOM   5676  CG  GLN A 724      29.216  58.967 173.002  1.00  0.75           C  
ATOM   5677  CD  GLN A 724      28.586  59.849 174.080  1.00  0.75           C  
ATOM   5678  OE1 GLN A 724      27.544  59.558 174.666  1.00  0.75           O  
ATOM   5679  NE2 GLN A 724      29.248  60.996 174.361  1.00  0.75           N  
ATOM   5680  N   ARG A 725      27.430  54.832 172.041  1.00  0.73           N  
ATOM   5681  CA  ARG A 725      26.991  53.461 172.255  1.00  0.73           C  
ATOM   5682  C   ARG A 725      27.475  52.494 171.184  1.00  0.73           C  
ATOM   5683  O   ARG A 725      27.753  51.327 171.454  1.00  0.73           O  
ATOM   5684  CB  ARG A 725      25.444  53.406 172.345  1.00  0.73           C  
ATOM   5685  CG  ARG A 725      24.860  51.992 172.545  1.00  0.73           C  
ATOM   5686  CD  ARG A 725      23.339  51.982 172.669  1.00  0.73           C  
ATOM   5687  NE  ARG A 725      22.895  50.570 172.462  1.00  0.73           N  
ATOM   5688  CZ  ARG A 725      22.566  50.048 171.274  1.00  0.73           C  
ATOM   5689  NH1 ARG A 725      22.049  48.826 171.234  1.00  0.73           N  
ATOM   5690  NH2 ARG A 725      22.730  50.688 170.123  1.00  0.73           N  
ATOM   5691  N   GLY A 726      27.545  52.954 169.925  1.00  0.84           N  
ATOM   5692  CA  GLY A 726      27.781  52.103 168.777  1.00  0.84           C  
ATOM   5693  C   GLY A 726      26.513  51.934 167.989  1.00  0.84           C  
ATOM   5694  O   GLY A 726      25.457  51.549 168.497  1.00  0.84           O  
ATOM   5695  N   TYR A 727      26.595  52.219 166.680  1.00  0.85           N  
ATOM   5696  CA  TYR A 727      25.483  52.094 165.763  1.00  0.85           C  
ATOM   5697  C   TYR A 727      25.410  50.683 165.197  1.00  0.85           C  
ATOM   5698  O   TYR A 727      26.317  50.207 164.520  1.00  0.85           O  
ATOM   5699  CB  TYR A 727      25.612  53.141 164.616  1.00  0.85           C  
ATOM   5700  CG  TYR A 727      24.467  53.103 163.621  1.00  0.85           C  
ATOM   5701  CD1 TYR A 727      23.123  53.224 164.027  1.00  0.85           C  
ATOM   5702  CD2 TYR A 727      24.743  52.922 162.254  1.00  0.85           C  
ATOM   5703  CE1 TYR A 727      22.083  53.156 163.083  1.00  0.85           C  
ATOM   5704  CE2 TYR A 727      23.706  52.853 161.314  1.00  0.85           C  
ATOM   5705  CZ  TYR A 727      22.379  52.977 161.726  1.00  0.85           C  
ATOM   5706  OH  TYR A 727      21.358  52.950 160.754  1.00  0.85           O  
ATOM   5707  N   ASN A 728      24.288  49.992 165.456  1.00  0.88           N  
ATOM   5708  CA  ASN A 728      24.004  48.691 164.898  1.00  0.88           C  
ATOM   5709  C   ASN A 728      22.723  48.819 164.089  1.00  0.88           C  
ATOM   5710  O   ASN A 728      21.631  49.018 164.620  1.00  0.88           O  
ATOM   5711  CB  ASN A 728      23.868  47.654 166.045  1.00  0.88           C  
ATOM   5712  CG  ASN A 728      23.726  46.231 165.522  1.00  0.88           C  
ATOM   5713  OD1 ASN A 728      23.591  45.973 164.326  1.00  0.88           O  
ATOM   5714  ND2 ASN A 728      23.749  45.259 166.460  1.00  0.88           N  
ATOM   5715  N   ALA A 729      22.828  48.708 162.753  1.00  0.92           N  
ATOM   5716  CA  ALA A 729      21.695  48.870 161.870  1.00  0.92           C  
ATOM   5717  C   ALA A 729      20.779  47.647 161.840  1.00  0.92           C  
ATOM   5718  O   ALA A 729      19.591  47.750 161.531  1.00  0.92           O  
ATOM   5719  CB  ALA A 729      22.221  49.178 160.461  1.00  0.92           C  
ATOM   5720  N   GLN A 730      21.299  46.466 162.237  1.00  0.85           N  
ATOM   5721  CA  GLN A 730      20.560  45.217 162.360  1.00  0.85           C  
ATOM   5722  C   GLN A 730      19.407  45.306 163.362  1.00  0.85           C  
ATOM   5723  O   GLN A 730      18.312  44.802 163.117  1.00  0.85           O  
ATOM   5724  CB  GLN A 730      21.531  44.066 162.736  1.00  0.85           C  
ATOM   5725  CG  GLN A 730      20.938  42.637 162.641  1.00  0.85           C  
ATOM   5726  CD  GLN A 730      20.697  42.211 161.190  1.00  0.85           C  
ATOM   5727  OE1 GLN A 730      21.575  42.338 160.335  1.00  0.85           O  
ATOM   5728  NE2 GLN A 730      19.504  41.663 160.890  1.00  0.85           N  
ATOM   5729  N   GLU A 731      19.595  46.020 164.501  1.00  0.85           N  
ATOM   5730  CA  GLU A 731      18.555  46.241 165.502  1.00  0.85           C  
ATOM   5731  C   GLU A 731      17.305  46.920 164.949  1.00  0.85           C  
ATOM   5732  O   GLU A 731      16.187  46.537 165.273  1.00  0.85           O  
ATOM   5733  CB  GLU A 731      19.038  47.144 166.676  1.00  0.85           C  
ATOM   5734  CG  GLU A 731      20.115  46.516 167.594  1.00  0.85           C  
ATOM   5735  CD  GLU A 731      20.493  47.431 168.756  1.00  0.85           C  
ATOM   5736  OE1 GLU A 731      21.591  48.045 168.747  1.00  0.85           O  
ATOM   5737  OE2 GLU A 731      19.694  47.524 169.724  1.00  0.85           O  
ATOM   5738  N   TYR A 732      17.450  47.952 164.102  1.00  0.90           N  
ATOM   5739  CA  TYR A 732      16.330  48.634 163.467  1.00  0.90           C  
ATOM   5740  C   TYR A 732      15.632  47.797 162.403  1.00  0.90           C  
ATOM   5741  O   TYR A 732      14.408  47.807 162.312  1.00  0.90           O  
ATOM   5742  CB  TYR A 732      16.744  49.999 162.868  1.00  0.90           C  
ATOM   5743  CG  TYR A 732      17.181  50.919 163.973  1.00  0.90           C  
ATOM   5744  CD1 TYR A 732      18.540  51.036 164.310  1.00  0.90           C  
ATOM   5745  CD2 TYR A 732      16.229  51.649 164.709  1.00  0.90           C  
ATOM   5746  CE1 TYR A 732      18.943  51.872 165.362  1.00  0.90           C  
ATOM   5747  CE2 TYR A 732      16.631  52.494 165.755  1.00  0.90           C  
ATOM   5748  CZ  TYR A 732      17.990  52.612 166.069  1.00  0.90           C  
ATOM   5749  OH  TYR A 732      18.405  53.492 167.086  1.00  0.90           O  
ATOM   5750  N   TYR A 733      16.379  47.022 161.587  1.00  0.87           N  
ATOM   5751  CA  TYR A 733      15.823  46.113 160.590  1.00  0.87           C  
ATOM   5752  C   TYR A 733      14.898  45.060 161.199  1.00  0.87           C  
ATOM   5753  O   TYR A 733      13.776  44.865 160.734  1.00  0.87           O  
ATOM   5754  CB  TYR A 733      17.017  45.445 159.833  1.00  0.87           C  
ATOM   5755  CG  TYR A 733      16.664  44.323 158.874  1.00  0.87           C  
ATOM   5756  CD1 TYR A 733      16.195  44.592 157.578  1.00  0.87           C  
ATOM   5757  CD2 TYR A 733      16.866  42.983 159.252  1.00  0.87           C  
ATOM   5758  CE1 TYR A 733      15.982  43.543 156.670  1.00  0.87           C  
ATOM   5759  CE2 TYR A 733      16.619  41.931 158.359  1.00  0.87           C  
ATOM   5760  CZ  TYR A 733      16.193  42.217 157.059  1.00  0.87           C  
ATOM   5761  OH  TYR A 733      15.982  41.188 156.122  1.00  0.87           O  
ATOM   5762  N   ASP A 734      15.319  44.387 162.288  1.00  0.86           N  
ATOM   5763  CA  ASP A 734      14.518  43.332 162.874  1.00  0.86           C  
ATOM   5764  C   ASP A 734      13.419  43.816 163.815  1.00  0.86           C  
ATOM   5765  O   ASP A 734      12.452  43.095 164.058  1.00  0.86           O  
ATOM   5766  CB  ASP A 734      15.433  42.311 163.593  1.00  0.86           C  
ATOM   5767  CG  ASP A 734      16.220  41.537 162.556  1.00  0.86           C  
ATOM   5768  OD1 ASP A 734      17.468  41.483 162.658  1.00  0.86           O  
ATOM   5769  OD2 ASP A 734      15.558  40.979 161.636  1.00  0.86           O  
ATOM   5770  N   ARG A 735      13.502  45.056 164.343  1.00  0.82           N  
ATOM   5771  CA  ARG A 735      12.422  45.637 165.127  1.00  0.82           C  
ATOM   5772  C   ARG A 735      11.300  46.243 164.283  1.00  0.82           C  
ATOM   5773  O   ARG A 735      10.182  46.390 164.772  1.00  0.82           O  
ATOM   5774  CB  ARG A 735      12.965  46.734 166.083  1.00  0.82           C  
ATOM   5775  CG  ARG A 735      13.845  46.170 167.221  1.00  0.82           C  
ATOM   5776  CD  ARG A 735      14.566  47.264 168.009  1.00  0.82           C  
ATOM   5777  NE  ARG A 735      15.437  46.582 168.998  1.00  0.82           N  
ATOM   5778  CZ  ARG A 735      16.432  47.205 169.620  1.00  0.82           C  
ATOM   5779  NH1 ARG A 735      17.357  46.488 170.228  1.00  0.82           N  
ATOM   5780  NH2 ARG A 735      16.550  48.520 169.649  1.00  0.82           N  
ATOM   5781  N   ILE A 736      11.536  46.599 163.000  1.00  0.89           N  
ATOM   5782  CA  ILE A 736      10.545  47.324 162.205  1.00  0.89           C  
ATOM   5783  C   ILE A 736      10.065  46.476 161.019  1.00  0.89           C  
ATOM   5784  O   ILE A 736      10.820  46.262 160.065  1.00  0.89           O  
ATOM   5785  CB  ILE A 736      11.074  48.671 161.702  1.00  0.89           C  
ATOM   5786  CG1 ILE A 736      11.473  49.581 162.891  1.00  0.89           C  
ATOM   5787  CG2 ILE A 736      10.024  49.394 160.823  1.00  0.89           C  
ATOM   5788  CD1 ILE A 736      12.227  50.847 162.470  1.00  0.89           C  
ATOM   5789  N   PRO A 737       8.817  45.987 160.967  1.00  0.90           N  
ATOM   5790  CA  PRO A 737       8.369  45.066 159.922  1.00  0.90           C  
ATOM   5791  C   PRO A 737       8.225  45.721 158.562  1.00  0.90           C  
ATOM   5792  O   PRO A 737       8.408  45.048 157.548  1.00  0.90           O  
ATOM   5793  CB  PRO A 737       7.021  44.542 160.452  1.00  0.90           C  
ATOM   5794  CG  PRO A 737       6.509  45.658 161.368  1.00  0.90           C  
ATOM   5795  CD  PRO A 737       7.796  46.178 162.004  1.00  0.90           C  
ATOM   5796  N   GLU A 738       7.868  47.015 158.476  1.00  0.87           N  
ATOM   5797  CA  GLU A 738       7.836  47.708 157.202  1.00  0.87           C  
ATOM   5798  C   GLU A 738       9.202  47.904 156.570  1.00  0.87           C  
ATOM   5799  O   GLU A 738       9.373  47.684 155.374  1.00  0.87           O  
ATOM   5800  CB  GLU A 738       7.112  49.051 157.318  1.00  0.87           C  
ATOM   5801  CG  GLU A 738       5.608  48.852 157.593  1.00  0.87           C  
ATOM   5802  CD  GLU A 738       4.877  50.131 157.263  1.00  0.87           C  
ATOM   5803  OE1 GLU A 738       5.236  51.163 157.874  1.00  0.87           O  
ATOM   5804  OE2 GLU A 738       3.980  50.132 156.380  1.00  0.87           O  
ATOM   5805  N   LEU A 739      10.219  48.272 157.376  1.00  0.90           N  
ATOM   5806  CA  LEU A 739      11.602  48.402 156.949  1.00  0.90           C  
ATOM   5807  C   LEU A 739      12.179  47.094 156.430  1.00  0.90           C  
ATOM   5808  O   LEU A 739      12.829  47.070 155.387  1.00  0.90           O  
ATOM   5809  CB  LEU A 739      12.477  48.915 158.121  1.00  0.90           C  
ATOM   5810  CG  LEU A 739      13.943  49.256 157.773  1.00  0.90           C  
ATOM   5811  CD1 LEU A 739      14.060  50.268 156.623  1.00  0.90           C  
ATOM   5812  CD2 LEU A 739      14.653  49.804 159.019  1.00  0.90           C  
ATOM   5813  N   ARG A 740      11.896  45.960 157.110  1.00  0.84           N  
ATOM   5814  CA  ARG A 740      12.288  44.631 156.665  1.00  0.84           C  
ATOM   5815  C   ARG A 740      11.833  44.298 155.239  1.00  0.84           C  
ATOM   5816  O   ARG A 740      12.659  43.948 154.402  1.00  0.84           O  
ATOM   5817  CB  ARG A 740      11.755  43.572 157.669  1.00  0.84           C  
ATOM   5818  CG  ARG A 740      12.147  42.123 157.314  1.00  0.84           C  
ATOM   5819  CD  ARG A 740      11.652  41.035 158.273  1.00  0.84           C  
ATOM   5820  NE  ARG A 740      12.478  41.090 159.530  1.00  0.84           N  
ATOM   5821  CZ  ARG A 740      12.108  40.564 160.702  1.00  0.84           C  
ATOM   5822  NH1 ARG A 740      12.985  40.460 161.695  1.00  0.84           N  
ATOM   5823  NH2 ARG A 740      10.869  40.123 160.903  1.00  0.84           N  
ATOM   5824  N   GLN A 741      10.540  44.512 154.887  1.00  0.86           N  
ATOM   5825  CA  GLN A 741      10.027  44.303 153.530  1.00  0.86           C  
ATOM   5826  C   GLN A 741      10.717  45.176 152.493  1.00  0.86           C  
ATOM   5827  O   GLN A 741      11.093  44.707 151.419  1.00  0.86           O  
ATOM   5828  CB  GLN A 741       8.508  44.640 153.462  1.00  0.86           C  
ATOM   5829  CG  GLN A 741       7.812  44.475 152.078  1.00  0.86           C  
ATOM   5830  CD  GLN A 741       7.443  43.034 151.739  1.00  0.86           C  
ATOM   5831  OE1 GLN A 741       6.452  42.530 152.264  1.00  0.86           O  
ATOM   5832  NE2 GLN A 741       8.191  42.369 150.841  1.00  0.86           N  
ATOM   5833  N   VAL A 742      10.919  46.476 152.807  1.00  0.90           N  
ATOM   5834  CA  VAL A 742      11.582  47.424 151.923  1.00  0.90           C  
ATOM   5835  C   VAL A 742      13.005  46.984 151.604  1.00  0.90           C  
ATOM   5836  O   VAL A 742      13.397  46.897 150.443  1.00  0.90           O  
ATOM   5837  CB  VAL A 742      11.616  48.825 152.548  1.00  0.90           C  
ATOM   5838  CG1 VAL A 742      12.465  49.793 151.700  1.00  0.90           C  
ATOM   5839  CG2 VAL A 742      10.185  49.388 152.663  1.00  0.90           C  
ATOM   5840  N   ILE A 743      13.802  46.628 152.628  1.00  0.87           N  
ATOM   5841  CA  ILE A 743      15.174  46.166 152.464  1.00  0.87           C  
ATOM   5842  C   ILE A 743      15.281  44.815 151.760  1.00  0.87           C  
ATOM   5843  O   ILE A 743      16.138  44.640 150.893  1.00  0.87           O  
ATOM   5844  CB  ILE A 743      15.938  46.216 153.786  1.00  0.87           C  
ATOM   5845  CG1 ILE A 743      15.953  47.654 154.375  1.00  0.87           C  
ATOM   5846  CG2 ILE A 743      17.381  45.691 153.613  1.00  0.87           C  
ATOM   5847  CD1 ILE A 743      16.477  48.748 153.432  1.00  0.87           C  
ATOM   5848  N   GLU A 744      14.390  43.843 152.057  1.00  0.86           N  
ATOM   5849  CA  GLU A 744      14.294  42.576 151.340  1.00  0.86           C  
ATOM   5850  C   GLU A 744      13.961  42.742 149.860  1.00  0.86           C  
ATOM   5851  O   GLU A 744      14.534  42.075 149.003  1.00  0.86           O  
ATOM   5852  CB  GLU A 744      13.236  41.647 151.987  1.00  0.86           C  
ATOM   5853  CG  GLU A 744      13.643  41.085 153.376  1.00  0.86           C  
ATOM   5854  CD  GLU A 744      12.514  40.324 154.075  1.00  0.86           C  
ATOM   5855  OE1 GLU A 744      11.401  40.224 153.497  1.00  0.86           O  
ATOM   5856  OE2 GLU A 744      12.756  39.849 155.219  1.00  0.86           O  
ATOM   5857  N   GLN A 745      13.045  43.663 149.493  1.00  0.87           N  
ATOM   5858  CA  GLN A 745      12.760  43.994 148.102  1.00  0.87           C  
ATOM   5859  C   GLN A 745      13.953  44.582 147.352  1.00  0.87           C  
ATOM   5860  O   GLN A 745      14.199  44.248 146.193  1.00  0.87           O  
ATOM   5861  CB  GLN A 745      11.568  44.978 147.997  1.00  0.87           C  
ATOM   5862  CG  GLN A 745      10.204  44.310 148.279  1.00  0.87           C  
ATOM   5863  CD  GLN A 745       9.097  45.352 148.444  1.00  0.87           C  
ATOM   5864  OE1 GLN A 745       9.210  46.293 149.228  1.00  0.87           O  
ATOM   5865  NE2 GLN A 745       7.969  45.164 147.724  1.00  0.87           N  
ATOM   5866  N   LEU A 746      14.732  45.470 148.000  1.00  0.88           N  
ATOM   5867  CA  LEU A 746      15.977  45.991 147.460  1.00  0.88           C  
ATOM   5868  C   LEU A 746      17.051  44.932 147.269  1.00  0.88           C  
ATOM   5869  O   LEU A 746      17.737  44.909 146.249  1.00  0.88           O  
ATOM   5870  CB  LEU A 746      16.538  47.112 148.371  1.00  0.88           C  
ATOM   5871  CG  LEU A 746      15.617  48.339 148.505  1.00  0.88           C  
ATOM   5872  CD1 LEU A 746      16.201  49.387 149.461  1.00  0.88           C  
ATOM   5873  CD2 LEU A 746      15.225  48.937 147.158  1.00  0.88           C  
ATOM   5874  N   SER A 747      17.229  44.021 148.245  1.00  0.87           N  
ATOM   5875  CA  SER A 747      18.278  43.016 148.190  1.00  0.87           C  
ATOM   5876  C   SER A 747      17.973  41.822 147.303  1.00  0.87           C  
ATOM   5877  O   SER A 747      18.894  41.171 146.815  1.00  0.87           O  
ATOM   5878  CB  SER A 747      18.660  42.524 149.614  1.00  0.87           C  
ATOM   5879  OG  SER A 747      17.595  41.817 150.249  1.00  0.87           O  
ATOM   5880  N   SER A 748      16.685  41.509 147.044  1.00  0.89           N  
ATOM   5881  CA  SER A 748      16.315  40.338 146.257  1.00  0.89           C  
ATOM   5882  C   SER A 748      16.060  40.652 144.799  1.00  0.89           C  
ATOM   5883  O   SER A 748      15.865  39.751 143.985  1.00  0.89           O  
ATOM   5884  CB  SER A 748      15.055  39.635 146.839  1.00  0.89           C  
ATOM   5885  OG  SER A 748      13.859  40.413 146.712  1.00  0.89           O  
ATOM   5886  N   GLY A 749      16.111  41.942 144.414  1.00  0.90           N  
ATOM   5887  CA  GLY A 749      15.986  42.346 143.022  1.00  0.90           C  
ATOM   5888  C   GLY A 749      14.583  42.607 142.559  1.00  0.90           C  
ATOM   5889  O   GLY A 749      14.320  42.593 141.363  1.00  0.90           O  
ATOM   5890  N   PHE A 750      13.633  42.920 143.466  1.00  0.90           N  
ATOM   5891  CA  PHE A 750      12.254  43.272 143.121  1.00  0.90           C  
ATOM   5892  C   PHE A 750      12.211  44.494 142.198  1.00  0.90           C  
ATOM   5893  O   PHE A 750      11.458  44.553 141.231  1.00  0.90           O  
ATOM   5894  CB  PHE A 750      11.432  43.528 144.424  1.00  0.90           C  
ATOM   5895  CG  PHE A 750       9.952  43.707 144.172  1.00  0.90           C  
ATOM   5896  CD1 PHE A 750       9.165  42.604 143.805  1.00  0.90           C  
ATOM   5897  CD2 PHE A 750       9.336  44.965 144.295  1.00  0.90           C  
ATOM   5898  CE1 PHE A 750       7.797  42.753 143.545  1.00  0.90           C  
ATOM   5899  CE2 PHE A 750       7.965  45.118 144.049  1.00  0.90           C  
ATOM   5900  CZ  PHE A 750       7.194  44.011 143.668  1.00  0.90           C  
ATOM   5901  N   PHE A 751      13.098  45.475 142.444  1.00  0.89           N  
ATOM   5902  CA  PHE A 751      13.235  46.663 141.619  1.00  0.89           C  
ATOM   5903  C   PHE A 751      14.324  46.520 140.553  1.00  0.89           C  
ATOM   5904  O   PHE A 751      14.620  47.449 139.807  1.00  0.89           O  
ATOM   5905  CB  PHE A 751      13.564  47.898 142.499  1.00  0.89           C  
ATOM   5906  CG  PHE A 751      12.438  48.142 143.463  1.00  0.89           C  
ATOM   5907  CD1 PHE A 751      11.242  48.710 143.001  1.00  0.89           C  
ATOM   5908  CD2 PHE A 751      12.543  47.780 144.815  1.00  0.89           C  
ATOM   5909  CE1 PHE A 751      10.169  48.924 143.874  1.00  0.89           C  
ATOM   5910  CE2 PHE A 751      11.470  47.983 145.692  1.00  0.89           C  
ATOM   5911  CZ  PHE A 751      10.281  48.551 145.219  1.00  0.89           C  
ATOM   5912  N   SER A 752      14.940  45.336 140.404  1.00  0.87           N  
ATOM   5913  CA  SER A 752      15.980  45.100 139.409  1.00  0.87           C  
ATOM   5914  C   SER A 752      15.965  43.663 138.893  1.00  0.87           C  
ATOM   5915  O   SER A 752      16.998  43.000 138.973  1.00  0.87           O  
ATOM   5916  CB  SER A 752      17.410  45.442 139.938  1.00  0.87           C  
ATOM   5917  OG  SER A 752      17.625  44.961 141.266  1.00  0.87           O  
ATOM   5918  N   PRO A 753      14.886  43.110 138.304  1.00  0.88           N  
ATOM   5919  CA  PRO A 753      14.725  41.667 138.073  1.00  0.88           C  
ATOM   5920  C   PRO A 753      15.760  41.035 137.167  1.00  0.88           C  
ATOM   5921  O   PRO A 753      15.859  39.815 137.118  1.00  0.88           O  
ATOM   5922  CB  PRO A 753      13.330  41.536 137.423  1.00  0.88           C  
ATOM   5923  CG  PRO A 753      12.573  42.772 137.902  1.00  0.88           C  
ATOM   5924  CD  PRO A 753      13.664  43.839 137.941  1.00  0.88           C  
ATOM   5925  N   LYS A 754      16.489  41.833 136.370  1.00  0.80           N  
ATOM   5926  CA  LYS A 754      17.466  41.336 135.427  1.00  0.80           C  
ATOM   5927  C   LYS A 754      18.879  41.439 135.975  1.00  0.80           C  
ATOM   5928  O   LYS A 754      19.827  41.048 135.307  1.00  0.80           O  
ATOM   5929  CB  LYS A 754      17.403  42.142 134.101  1.00  0.80           C  
ATOM   5930  CG  LYS A 754      15.988  42.424 133.556  1.00  0.80           C  
ATOM   5931  CD  LYS A 754      15.147  41.164 133.282  1.00  0.80           C  
ATOM   5932  CE  LYS A 754      13.686  41.498 132.962  1.00  0.80           C  
ATOM   5933  NZ  LYS A 754      12.886  40.257 132.862  1.00  0.80           N  
ATOM   5934  N   GLN A 755      19.046  41.962 137.204  1.00  0.83           N  
ATOM   5935  CA  GLN A 755      20.320  42.093 137.891  1.00  0.83           C  
ATOM   5936  C   GLN A 755      20.035  42.073 139.397  1.00  0.83           C  
ATOM   5937  O   GLN A 755      20.015  43.141 140.019  1.00  0.83           O  
ATOM   5938  CB  GLN A 755      21.062  43.415 137.535  1.00  0.83           C  
ATOM   5939  CG  GLN A 755      21.711  43.442 136.132  1.00  0.83           C  
ATOM   5940  CD  GLN A 755      22.315  44.808 135.821  1.00  0.83           C  
ATOM   5941  OE1 GLN A 755      23.491  45.093 136.031  1.00  0.83           O  
ATOM   5942  NE2 GLN A 755      21.469  45.715 135.279  1.00  0.83           N  
ATOM   5943  N   PRO A 756      19.755  40.929 140.035  1.00  0.89           N  
ATOM   5944  CA  PRO A 756      19.271  40.884 141.417  1.00  0.89           C  
ATOM   5945  C   PRO A 756      20.224  41.479 142.435  1.00  0.89           C  
ATOM   5946  O   PRO A 756      19.779  42.053 143.425  1.00  0.89           O  
ATOM   5947  CB  PRO A 756      19.022  39.387 141.671  1.00  0.89           C  
ATOM   5948  CG  PRO A 756      18.657  38.851 140.286  1.00  0.89           C  
ATOM   5949  CD  PRO A 756      19.608  39.626 139.375  1.00  0.89           C  
ATOM   5950  N   ASP A 757      21.539  41.374 142.201  1.00  0.85           N  
ATOM   5951  CA  ASP A 757      22.597  41.825 143.067  1.00  0.85           C  
ATOM   5952  C   ASP A 757      23.043  43.252 142.755  1.00  0.85           C  
ATOM   5953  O   ASP A 757      24.005  43.756 143.328  1.00  0.85           O  
ATOM   5954  CB  ASP A 757      23.783  40.822 142.967  1.00  0.85           C  
ATOM   5955  CG  ASP A 757      24.282  40.587 141.542  1.00  0.85           C  
ATOM   5956  OD1 ASP A 757      25.523  40.590 141.372  1.00  0.85           O  
ATOM   5957  OD2 ASP A 757      23.443  40.368 140.630  1.00  0.85           O  
ATOM   5958  N   LEU A 758      22.310  43.985 141.893  1.00  0.88           N  
ATOM   5959  CA  LEU A 758      22.648  45.340 141.478  1.00  0.88           C  
ATOM   5960  C   LEU A 758      22.784  46.341 142.616  1.00  0.88           C  
ATOM   5961  O   LEU A 758      23.677  47.180 142.626  1.00  0.88           O  
ATOM   5962  CB  LEU A 758      21.570  45.867 140.498  1.00  0.88           C  
ATOM   5963  CG  LEU A 758      21.874  47.205 139.789  1.00  0.88           C  
ATOM   5964  CD1 LEU A 758      23.214  47.156 139.040  1.00  0.88           C  
ATOM   5965  CD2 LEU A 758      20.735  47.551 138.815  1.00  0.88           C  
ATOM   5966  N   PHE A 759      21.913  46.274 143.638  1.00  0.89           N  
ATOM   5967  CA  PHE A 759      21.928  47.226 144.737  1.00  0.89           C  
ATOM   5968  C   PHE A 759      22.685  46.694 145.954  1.00  0.89           C  
ATOM   5969  O   PHE A 759      22.475  47.138 147.082  1.00  0.89           O  
ATOM   5970  CB  PHE A 759      20.481  47.629 145.134  1.00  0.89           C  
ATOM   5971  CG  PHE A 759      19.752  48.253 143.965  1.00  0.89           C  
ATOM   5972  CD1 PHE A 759      20.293  49.352 143.268  1.00  0.89           C  
ATOM   5973  CD2 PHE A 759      18.512  47.739 143.549  1.00  0.89           C  
ATOM   5974  CE1 PHE A 759      19.623  49.907 142.171  1.00  0.89           C  
ATOM   5975  CE2 PHE A 759      17.835  48.293 142.453  1.00  0.89           C  
ATOM   5976  CZ  PHE A 759      18.395  49.374 141.761  1.00  0.89           C  
ATOM   5977  N   LYS A 760      23.613  45.732 145.765  1.00  0.81           N  
ATOM   5978  CA  LYS A 760      24.383  45.102 146.830  1.00  0.81           C  
ATOM   5979  C   LYS A 760      25.245  46.060 147.638  1.00  0.81           C  
ATOM   5980  O   LYS A 760      25.273  45.990 148.867  1.00  0.81           O  
ATOM   5981  CB  LYS A 760      25.267  44.000 146.218  1.00  0.81           C  
ATOM   5982  CG  LYS A 760      25.836  42.956 147.184  1.00  0.81           C  
ATOM   5983  CD  LYS A 760      26.595  41.896 146.368  1.00  0.81           C  
ATOM   5984  CE  LYS A 760      27.090  40.692 147.165  1.00  0.81           C  
ATOM   5985  NZ  LYS A 760      25.934  39.926 147.682  1.00  0.81           N  
ATOM   5986  N   ASP A 761      25.912  47.018 146.967  1.00  0.87           N  
ATOM   5987  CA  ASP A 761      26.683  48.094 147.564  1.00  0.87           C  
ATOM   5988  C   ASP A 761      25.848  48.953 148.512  1.00  0.87           C  
ATOM   5989  O   ASP A 761      26.271  49.297 149.617  1.00  0.87           O  
ATOM   5990  CB  ASP A 761      27.219  49.019 146.443  1.00  0.87           C  
ATOM   5991  CG  ASP A 761      28.162  48.300 145.492  1.00  0.87           C  
ATOM   5992  OD1 ASP A 761      28.558  48.962 144.502  1.00  0.87           O  
ATOM   5993  OD2 ASP A 761      28.479  47.109 145.722  1.00  0.87           O  
ATOM   5994  N   ILE A 762      24.595  49.271 148.111  1.00  0.90           N  
ATOM   5995  CA  ILE A 762      23.623  49.997 148.919  1.00  0.90           C  
ATOM   5996  C   ILE A 762      23.288  49.244 150.195  1.00  0.90           C  
ATOM   5997  O   ILE A 762      23.362  49.782 151.295  1.00  0.90           O  
ATOM   5998  CB  ILE A 762      22.319  50.281 148.155  1.00  0.90           C  
ATOM   5999  CG1 ILE A 762      22.633  50.900 146.769  1.00  0.90           C  
ATOM   6000  CG2 ILE A 762      21.407  51.194 149.012  1.00  0.90           C  
ATOM   6001  CD1 ILE A 762      21.413  51.482 146.045  1.00  0.90           C  
ATOM   6002  N   VAL A 763      22.984  47.938 150.096  1.00  0.87           N  
ATOM   6003  CA  VAL A 763      22.686  47.089 151.242  1.00  0.87           C  
ATOM   6004  C   VAL A 763      23.884  46.958 152.173  1.00  0.87           C  
ATOM   6005  O   VAL A 763      23.757  47.063 153.393  1.00  0.87           O  
ATOM   6006  CB  VAL A 763      22.190  45.718 150.784  1.00  0.87           C  
ATOM   6007  CG1 VAL A 763      21.948  44.765 151.976  1.00  0.87           C  
ATOM   6008  CG2 VAL A 763      20.875  45.905 149.998  1.00  0.87           C  
ATOM   6009  N   ASN A 764      25.099  46.784 151.610  1.00  0.81           N  
ATOM   6010  CA  ASN A 764      26.336  46.719 152.367  1.00  0.81           C  
ATOM   6011  C   ASN A 764      26.621  48.007 153.146  1.00  0.81           C  
ATOM   6012  O   ASN A 764      26.951  47.961 154.332  1.00  0.81           O  
ATOM   6013  CB  ASN A 764      27.507  46.388 151.399  1.00  0.81           C  
ATOM   6014  CG  ASN A 764      28.765  45.986 152.162  1.00  0.81           C  
ATOM   6015  OD1 ASN A 764      28.893  44.861 152.643  1.00  0.81           O  
ATOM   6016  ND2 ASN A 764      29.718  46.935 152.291  1.00  0.81           N  
ATOM   6017  N   MET A 765      26.450  49.190 152.511  1.00  0.87           N  
ATOM   6018  CA  MET A 765      26.609  50.474 153.174  1.00  0.87           C  
ATOM   6019  C   MET A 765      25.626  50.671 154.314  1.00  0.87           C  
ATOM   6020  O   MET A 765      26.031  50.971 155.434  1.00  0.87           O  
ATOM   6021  CB  MET A 765      26.458  51.641 152.157  1.00  0.87           C  
ATOM   6022  CG  MET A 765      26.785  53.050 152.713  1.00  0.87           C  
ATOM   6023  SD  MET A 765      25.462  53.850 153.682  1.00  0.87           S  
ATOM   6024  CE  MET A 765      24.667  54.713 152.306  1.00  0.87           C  
ATOM   6025  N   LEU A 766      24.318  50.426 154.083  1.00  0.91           N  
ATOM   6026  CA  LEU A 766      23.271  50.630 155.074  1.00  0.91           C  
ATOM   6027  C   LEU A 766      23.468  49.794 156.327  1.00  0.91           C  
ATOM   6028  O   LEU A 766      23.272  50.260 157.448  1.00  0.91           O  
ATOM   6029  CB  LEU A 766      21.875  50.291 154.471  1.00  0.91           C  
ATOM   6030  CG  LEU A 766      21.095  51.486 153.877  1.00  0.91           C  
ATOM   6031  CD1 LEU A 766      20.781  52.538 154.940  1.00  0.91           C  
ATOM   6032  CD2 LEU A 766      21.798  52.167 152.703  1.00  0.91           C  
ATOM   6033  N   MET A 767      23.860  48.521 156.157  1.00  0.81           N  
ATOM   6034  CA  MET A 767      24.107  47.640 157.274  1.00  0.81           C  
ATOM   6035  C   MET A 767      25.387  47.906 158.058  1.00  0.81           C  
ATOM   6036  O   MET A 767      25.353  47.888 159.287  1.00  0.81           O  
ATOM   6037  CB  MET A 767      24.095  46.169 156.799  1.00  0.81           C  
ATOM   6038  CG  MET A 767      22.705  45.678 156.340  1.00  0.81           C  
ATOM   6039  SD  MET A 767      21.363  45.848 157.560  1.00  0.81           S  
ATOM   6040  CE  MET A 767      22.213  45.098 158.972  1.00  0.81           C  
ATOM   6041  N   HIS A 768      26.541  48.133 157.390  1.00  0.82           N  
ATOM   6042  CA  HIS A 768      27.825  48.125 158.089  1.00  0.82           C  
ATOM   6043  C   HIS A 768      28.615  49.418 158.030  1.00  0.82           C  
ATOM   6044  O   HIS A 768      29.570  49.580 158.781  1.00  0.82           O  
ATOM   6045  CB  HIS A 768      28.752  47.054 157.471  1.00  0.82           C  
ATOM   6046  CG  HIS A 768      28.282  45.660 157.733  1.00  0.82           C  
ATOM   6047  ND1 HIS A 768      28.441  45.125 158.995  1.00  0.82           N  
ATOM   6048  CD2 HIS A 768      27.691  44.754 156.910  1.00  0.82           C  
ATOM   6049  CE1 HIS A 768      27.946  43.909 158.923  1.00  0.82           C  
ATOM   6050  NE2 HIS A 768      27.477  43.632 157.682  1.00  0.82           N  
ATOM   6051  N   HIS A 769      28.273  50.395 157.173  1.00  0.85           N  
ATOM   6052  CA  HIS A 769      29.168  51.522 156.950  1.00  0.85           C  
ATOM   6053  C   HIS A 769      28.411  52.822 156.832  1.00  0.85           C  
ATOM   6054  O   HIS A 769      28.926  53.814 156.330  1.00  0.85           O  
ATOM   6055  CB  HIS A 769      30.068  51.325 155.696  1.00  0.85           C  
ATOM   6056  CG  HIS A 769      31.082  50.229 155.860  1.00  0.85           C  
ATOM   6057  ND1 HIS A 769      30.920  49.011 155.224  1.00  0.85           N  
ATOM   6058  CD2 HIS A 769      32.247  50.240 156.564  1.00  0.85           C  
ATOM   6059  CE1 HIS A 769      31.985  48.305 155.557  1.00  0.85           C  
ATOM   6060  NE2 HIS A 769      32.819  49.003 156.365  1.00  0.85           N  
ATOM   6061  N   ASP A 770      27.176  52.884 157.341  1.00  0.92           N  
ATOM   6062  CA  ASP A 770      26.385  54.085 157.351  1.00  0.92           C  
ATOM   6063  C   ASP A 770      26.825  55.020 158.483  1.00  0.92           C  
ATOM   6064  O   ASP A 770      26.609  54.777 159.671  1.00  0.92           O  
ATOM   6065  CB  ASP A 770      24.891  53.677 157.440  1.00  0.92           C  
ATOM   6066  CG  ASP A 770      23.937  54.845 157.349  1.00  0.92           C  
ATOM   6067  OD1 ASP A 770      24.389  55.983 157.062  1.00  0.92           O  
ATOM   6068  OD2 ASP A 770      22.733  54.636 157.655  1.00  0.92           O  
ATOM   6069  N   ARG A 771      27.450  56.160 158.123  1.00  0.83           N  
ATOM   6070  CA  ARG A 771      27.785  57.210 159.070  1.00  0.83           C  
ATOM   6071  C   ARG A 771      26.579  58.074 159.383  1.00  0.83           C  
ATOM   6072  O   ARG A 771      26.532  58.755 160.411  1.00  0.83           O  
ATOM   6073  CB  ARG A 771      28.878  58.170 158.515  1.00  0.83           C  
ATOM   6074  CG  ARG A 771      30.304  57.582 158.544  1.00  0.83           C  
ATOM   6075  CD  ARG A 771      31.427  58.588 158.217  1.00  0.83           C  
ATOM   6076  NE  ARG A 771      31.275  58.947 156.773  1.00  0.83           N  
ATOM   6077  CZ  ARG A 771      31.650  60.083 156.168  1.00  0.83           C  
ATOM   6078  NH1 ARG A 771      32.256  61.096 156.775  1.00  0.83           N  
ATOM   6079  NH2 ARG A 771      31.402  60.209 154.870  1.00  0.83           N  
ATOM   6080  N   PHE A 772      25.576  58.066 158.495  1.00  0.92           N  
ATOM   6081  CA  PHE A 772      24.526  59.054 158.455  1.00  0.92           C  
ATOM   6082  C   PHE A 772      23.228  58.478 158.990  1.00  0.92           C  
ATOM   6083  O   PHE A 772      22.240  59.187 159.165  1.00  0.92           O  
ATOM   6084  CB  PHE A 772      24.370  59.552 156.994  1.00  0.92           C  
ATOM   6085  CG  PHE A 772      25.653  60.227 156.568  1.00  0.92           C  
ATOM   6086  CD1 PHE A 772      26.113  61.364 157.254  1.00  0.92           C  
ATOM   6087  CD2 PHE A 772      26.428  59.716 155.515  1.00  0.92           C  
ATOM   6088  CE1 PHE A 772      27.321  61.979 156.898  1.00  0.92           C  
ATOM   6089  CE2 PHE A 772      27.629  60.335 155.141  1.00  0.92           C  
ATOM   6090  CZ  PHE A 772      28.077  61.467 155.835  1.00  0.92           C  
ATOM   6091  N   LYS A 773      23.225  57.187 159.342  1.00  0.92           N  
ATOM   6092  CA  LYS A 773      22.292  56.496 160.207  1.00  0.92           C  
ATOM   6093  C   LYS A 773      20.848  56.519 159.727  1.00  0.92           C  
ATOM   6094  O   LYS A 773      19.937  56.956 160.427  1.00  0.92           O  
ATOM   6095  CB  LYS A 773      22.425  56.993 161.667  1.00  0.92           C  
ATOM   6096  CG  LYS A 773      23.838  56.900 162.267  1.00  0.92           C  
ATOM   6097  CD  LYS A 773      23.858  57.581 163.641  1.00  0.92           C  
ATOM   6098  CE  LYS A 773      25.180  57.488 164.387  1.00  0.92           C  
ATOM   6099  NZ  LYS A 773      26.202  58.300 163.711  1.00  0.92           N  
ATOM   6100  N   VAL A 774      20.606  56.058 158.489  1.00  0.97           N  
ATOM   6101  CA  VAL A 774      19.335  56.098 157.773  1.00  0.97           C  
ATOM   6102  C   VAL A 774      18.237  55.321 158.480  1.00  0.97           C  
ATOM   6103  O   VAL A 774      17.108  55.789 158.621  1.00  0.97           O  
ATOM   6104  CB  VAL A 774      19.524  55.564 156.349  1.00  0.97           C  
ATOM   6105  CG1 VAL A 774      18.195  55.343 155.592  1.00  0.97           C  
ATOM   6106  CG2 VAL A 774      20.410  56.547 155.559  1.00  0.97           C  
ATOM   6107  N   PHE A 775      18.543  54.108 158.982  1.00  0.94           N  
ATOM   6108  CA  PHE A 775      17.564  53.257 159.638  1.00  0.94           C  
ATOM   6109  C   PHE A 775      17.125  53.773 161.001  1.00  0.94           C  
ATOM   6110  O   PHE A 775      15.993  53.539 161.419  1.00  0.94           O  
ATOM   6111  CB  PHE A 775      18.087  51.803 159.810  1.00  0.94           C  
ATOM   6112  CG  PHE A 775      18.266  51.011 158.533  1.00  0.94           C  
ATOM   6113  CD1 PHE A 775      18.809  49.717 158.637  1.00  0.94           C  
ATOM   6114  CD2 PHE A 775      17.876  51.466 157.257  1.00  0.94           C  
ATOM   6115  CE1 PHE A 775      18.975  48.907 157.507  1.00  0.94           C  
ATOM   6116  CE2 PHE A 775      18.040  50.658 156.126  1.00  0.94           C  
ATOM   6117  CZ  PHE A 775      18.592  49.379 156.249  1.00  0.94           C  
ATOM   6118  N   ALA A 776      17.994  54.520 161.713  1.00  0.95           N  
ATOM   6119  CA  ALA A 776      17.685  55.109 163.001  1.00  0.95           C  
ATOM   6120  C   ALA A 776      16.558  56.134 162.950  1.00  0.95           C  
ATOM   6121  O   ALA A 776      15.749  56.221 163.868  1.00  0.95           O  
ATOM   6122  CB  ALA A 776      18.952  55.720 163.631  1.00  0.95           C  
ATOM   6123  N   ASP A 777      16.457  56.911 161.854  1.00  0.94           N  
ATOM   6124  CA  ASP A 777      15.407  57.904 161.701  1.00  0.94           C  
ATOM   6125  C   ASP A 777      14.213  57.383 160.902  1.00  0.94           C  
ATOM   6126  O   ASP A 777      13.232  58.103 160.716  1.00  0.94           O  
ATOM   6127  CB  ASP A 777      15.957  59.159 160.972  1.00  0.94           C  
ATOM   6128  CG  ASP A 777      16.632  60.099 161.951  1.00  0.94           C  
ATOM   6129  OD1 ASP A 777      16.076  60.361 163.041  1.00  0.94           O  
ATOM   6130  OD2 ASP A 777      17.717  60.619 161.575  1.00  0.94           O  
ATOM   6131  N   TYR A 778      14.224  56.119 160.415  1.00  0.94           N  
ATOM   6132  CA  TYR A 778      13.171  55.592 159.549  1.00  0.94           C  
ATOM   6133  C   TYR A 778      11.801  55.569 160.220  1.00  0.94           C  
ATOM   6134  O   TYR A 778      10.813  55.996 159.626  1.00  0.94           O  
ATOM   6135  CB  TYR A 778      13.564  54.176 159.003  1.00  0.94           C  
ATOM   6136  CG  TYR A 778      12.469  53.490 158.198  1.00  0.94           C  
ATOM   6137  CD1 TYR A 778      12.302  53.708 156.816  1.00  0.94           C  
ATOM   6138  CD2 TYR A 778      11.566  52.636 158.857  1.00  0.94           C  
ATOM   6139  CE1 TYR A 778      11.243  53.094 156.119  1.00  0.94           C  
ATOM   6140  CE2 TYR A 778      10.502  52.043 158.170  1.00  0.94           C  
ATOM   6141  CZ  TYR A 778      10.342  52.271 156.807  1.00  0.94           C  
ATOM   6142  OH  TYR A 778       9.246  51.666 156.164  1.00  0.94           O  
ATOM   6143  N   GLU A 779      11.708  55.101 161.482  1.00  0.88           N  
ATOM   6144  CA  GLU A 779      10.442  54.998 162.187  1.00  0.88           C  
ATOM   6145  C   GLU A 779       9.772  56.344 162.441  1.00  0.88           C  
ATOM   6146  O   GLU A 779       8.600  56.560 162.132  1.00  0.88           O  
ATOM   6147  CB  GLU A 779      10.652  54.243 163.518  1.00  0.88           C  
ATOM   6148  CG  GLU A 779       9.349  53.974 164.307  1.00  0.88           C  
ATOM   6149  CD  GLU A 779       9.579  53.038 165.490  1.00  0.88           C  
ATOM   6150  OE1 GLU A 779      10.486  53.334 166.304  1.00  0.88           O  
ATOM   6151  OE2 GLU A 779       8.834  52.030 165.584  1.00  0.88           O  
ATOM   6152  N   ASP A 780      10.517  57.343 162.947  1.00  0.91           N  
ATOM   6153  CA  ASP A 780      10.006  58.684 163.115  1.00  0.91           C  
ATOM   6154  C   ASP A 780       9.698  59.375 161.793  1.00  0.91           C  
ATOM   6155  O   ASP A 780       8.676  60.045 161.675  1.00  0.91           O  
ATOM   6156  CB  ASP A 780      10.971  59.537 163.999  1.00  0.91           C  
ATOM   6157  CG  ASP A 780      10.766  59.361 165.490  1.00  0.91           C  
ATOM   6158  OD1 ASP A 780       9.565  59.253 165.789  1.00  0.91           O  
ATOM   6159  OD2 ASP A 780      11.681  59.375 166.343  1.00  0.91           O  
ATOM   6160  N   TYR A 781      10.516  59.194 160.743  1.00  0.94           N  
ATOM   6161  CA  TYR A 781      10.204  59.685 159.414  1.00  0.94           C  
ATOM   6162  C   TYR A 781       8.877  59.157 158.839  1.00  0.94           C  
ATOM   6163  O   TYR A 781       8.059  59.948 158.373  1.00  0.94           O  
ATOM   6164  CB  TYR A 781      11.396  59.344 158.483  1.00  0.94           C  
ATOM   6165  CG  TYR A 781      11.227  59.867 157.087  1.00  0.94           C  
ATOM   6166  CD1 TYR A 781      10.930  61.221 156.831  1.00  0.94           C  
ATOM   6167  CD2 TYR A 781      11.371  58.982 156.011  1.00  0.94           C  
ATOM   6168  CE1 TYR A 781      10.817  61.685 155.510  1.00  0.94           C  
ATOM   6169  CE2 TYR A 781      11.273  59.444 154.701  1.00  0.94           C  
ATOM   6170  CZ  TYR A 781      11.015  60.783 154.457  1.00  0.94           C  
ATOM   6171  OH  TYR A 781      10.981  61.185 153.123  1.00  0.94           O  
ATOM   6172  N   ILE A 782       8.579  57.836 158.909  1.00  0.90           N  
ATOM   6173  CA  ILE A 782       7.307  57.288 158.428  1.00  0.90           C  
ATOM   6174  C   ILE A 782       6.097  57.804 159.206  1.00  0.90           C  
ATOM   6175  O   ILE A 782       5.108  58.226 158.611  1.00  0.90           O  
ATOM   6176  CB  ILE A 782       7.293  55.759 158.298  1.00  0.90           C  
ATOM   6177  CG1 ILE A 782       7.494  55.027 159.644  1.00  0.90           C  
ATOM   6178  CG2 ILE A 782       8.362  55.357 157.254  1.00  0.90           C  
ATOM   6179  CD1 ILE A 782       7.391  53.503 159.554  1.00  0.90           C  
ATOM   6180  N   LYS A 783       6.200  57.883 160.552  1.00  0.86           N  
ATOM   6181  CA  LYS A 783       5.207  58.458 161.449  1.00  0.86           C  
ATOM   6182  C   LYS A 783       4.951  59.939 161.179  1.00  0.86           C  
ATOM   6183  O   LYS A 783       3.824  60.434 161.199  1.00  0.86           O  
ATOM   6184  CB  LYS A 783       5.718  58.296 162.910  1.00  0.86           C  
ATOM   6185  CG  LYS A 783       5.530  56.870 163.456  1.00  0.86           C  
ATOM   6186  CD  LYS A 783       6.349  56.493 164.710  1.00  0.86           C  
ATOM   6187  CE  LYS A 783       6.234  57.416 165.931  1.00  0.86           C  
ATOM   6188  NZ  LYS A 783       7.156  58.530 165.834  1.00  0.86           N  
ATOM   6189  N   CYS A 784       6.019  60.714 160.913  1.00  0.92           N  
ATOM   6190  CA  CYS A 784       5.918  62.114 160.550  1.00  0.92           C  
ATOM   6191  C   CYS A 784       5.230  62.325 159.212  1.00  0.92           C  
ATOM   6192  O   CYS A 784       4.365  63.185 159.063  1.00  0.92           O  
ATOM   6193  CB  CYS A 784       7.309  62.784 160.542  1.00  0.92           C  
ATOM   6194  SG  CYS A 784       7.175  64.597 160.650  1.00  0.92           S  
ATOM   6195  N   GLN A 785       5.559  61.489 158.213  1.00  0.91           N  
ATOM   6196  CA  GLN A 785       4.905  61.468 156.921  1.00  0.91           C  
ATOM   6197  C   GLN A 785       3.415  61.157 156.972  1.00  0.91           C  
ATOM   6198  O   GLN A 785       2.619  61.745 156.239  1.00  0.91           O  
ATOM   6199  CB  GLN A 785       5.620  60.473 155.982  1.00  0.91           C  
ATOM   6200  CG  GLN A 785       6.989  60.990 155.485  1.00  0.91           C  
ATOM   6201  CD  GLN A 785       6.834  62.069 154.412  1.00  0.91           C  
ATOM   6202  OE1 GLN A 785       5.837  62.795 154.340  1.00  0.91           O  
ATOM   6203  NE2 GLN A 785       7.833  62.133 153.513  1.00  0.91           N  
ATOM   6204  N   GLU A 786       2.983  60.249 157.863  1.00  0.86           N  
ATOM   6205  CA  GLU A 786       1.583  59.992 158.154  1.00  0.86           C  
ATOM   6206  C   GLU A 786       0.829  61.206 158.680  1.00  0.86           C  
ATOM   6207  O   GLU A 786      -0.290  61.494 158.252  1.00  0.86           O  
ATOM   6208  CB  GLU A 786       1.495  58.824 159.146  1.00  0.86           C  
ATOM   6209  CG  GLU A 786       1.899  57.504 158.456  1.00  0.86           C  
ATOM   6210  CD  GLU A 786       2.181  56.380 159.447  1.00  0.86           C  
ATOM   6211  OE1 GLU A 786       2.229  56.602 160.675  1.00  0.86           O  
ATOM   6212  OE2 GLU A 786       2.386  55.245 158.954  1.00  0.86           O  
ATOM   6213  N   LYS A 787       1.455  61.999 159.571  1.00  0.86           N  
ATOM   6214  CA  LYS A 787       0.932  63.284 160.006  1.00  0.86           C  
ATOM   6215  C   LYS A 787       0.792  64.313 158.877  1.00  0.86           C  
ATOM   6216  O   LYS A 787      -0.208  65.028 158.813  1.00  0.86           O  
ATOM   6217  CB  LYS A 787       1.799  63.890 161.137  1.00  0.86           C  
ATOM   6218  CG  LYS A 787       1.843  63.034 162.416  1.00  0.86           C  
ATOM   6219  CD  LYS A 787       2.936  63.471 163.411  1.00  0.86           C  
ATOM   6220  CE  LYS A 787       2.843  64.920 163.910  1.00  0.86           C  
ATOM   6221  NZ  LYS A 787       1.588  65.135 164.667  1.00  0.86           N  
ATOM   6222  N   VAL A 788       1.768  64.396 157.940  1.00  0.92           N  
ATOM   6223  CA  VAL A 788       1.688  65.245 156.745  1.00  0.92           C  
ATOM   6224  C   VAL A 788       0.505  64.872 155.864  1.00  0.92           C  
ATOM   6225  O   VAL A 788      -0.284  65.714 155.433  1.00  0.92           O  
ATOM   6226  CB  VAL A 788       2.943  65.142 155.867  1.00  0.92           C  
ATOM   6227  CG1 VAL A 788       2.821  66.029 154.611  1.00  0.92           C  
ATOM   6228  CG2 VAL A 788       4.191  65.583 156.645  1.00  0.92           C  
ATOM   6229  N   SER A 789       0.322  63.559 155.618  1.00  0.90           N  
ATOM   6230  CA  SER A 789      -0.804  63.025 154.865  1.00  0.90           C  
ATOM   6231  C   SER A 789      -2.138  63.306 155.533  1.00  0.90           C  
ATOM   6232  O   SER A 789      -3.122  63.639 154.876  1.00  0.90           O  
ATOM   6233  CB  SER A 789      -0.680  61.498 154.634  1.00  0.90           C  
ATOM   6234  OG  SER A 789       0.428  61.201 153.776  1.00  0.90           O  
ATOM   6235  N   ALA A 790      -2.212  63.207 156.876  1.00  0.90           N  
ATOM   6236  CA  ALA A 790      -3.389  63.579 157.633  1.00  0.90           C  
ATOM   6237  C   ALA A 790      -3.772  65.048 157.500  1.00  0.90           C  
ATOM   6238  O   ALA A 790      -4.940  65.364 157.274  1.00  0.90           O  
ATOM   6239  CB  ALA A 790      -3.191  63.217 159.118  1.00  0.90           C  
ATOM   6240  N   LEU A 791      -2.791  65.973 157.586  1.00  0.88           N  
ATOM   6241  CA  LEU A 791      -3.030  67.399 157.434  1.00  0.88           C  
ATOM   6242  C   LEU A 791      -3.510  67.798 156.041  1.00  0.88           C  
ATOM   6243  O   LEU A 791      -4.397  68.631 155.897  1.00  0.88           O  
ATOM   6244  CB  LEU A 791      -1.795  68.244 157.835  1.00  0.88           C  
ATOM   6245  CG  LEU A 791      -2.157  69.689 158.254  1.00  0.88           C  
ATOM   6246  CD1 LEU A 791      -2.730  69.723 159.679  1.00  0.88           C  
ATOM   6247  CD2 LEU A 791      -0.946  70.625 158.175  1.00  0.88           C  
ATOM   6248  N   TYR A 792      -2.970  67.179 154.967  1.00  0.89           N  
ATOM   6249  CA  TYR A 792      -3.325  67.485 153.582  1.00  0.89           C  
ATOM   6250  C   TYR A 792      -4.777  67.140 153.227  1.00  0.89           C  
ATOM   6251  O   TYR A 792      -5.368  67.703 152.309  1.00  0.89           O  
ATOM   6252  CB  TYR A 792      -2.347  66.746 152.628  1.00  0.89           C  
ATOM   6253  CG  TYR A 792      -2.386  67.302 151.217  1.00  0.89           C  
ATOM   6254  CD1 TYR A 792      -1.718  68.498 150.892  1.00  0.89           C  
ATOM   6255  CD2 TYR A 792      -3.082  66.625 150.201  1.00  0.89           C  
ATOM   6256  CE1 TYR A 792      -1.755  69.010 149.584  1.00  0.89           C  
ATOM   6257  CE2 TYR A 792      -3.126  67.135 148.894  1.00  0.89           C  
ATOM   6258  CZ  TYR A 792      -2.464  68.328 148.587  1.00  0.89           C  
ATOM   6259  OH  TYR A 792      -2.531  68.831 147.270  1.00  0.89           O  
ATOM   6260  N   LYS A 793      -5.426  66.237 153.992  1.00  0.82           N  
ATOM   6261  CA  LYS A 793      -6.847  65.955 153.847  1.00  0.82           C  
ATOM   6262  C   LYS A 793      -7.735  67.065 154.396  1.00  0.82           C  
ATOM   6263  O   LYS A 793      -8.943  67.075 154.167  1.00  0.82           O  
ATOM   6264  CB  LYS A 793      -7.240  64.651 154.577  1.00  0.82           C  
ATOM   6265  CG  LYS A 793      -6.626  63.400 153.938  1.00  0.82           C  
ATOM   6266  CD  LYS A 793      -7.131  62.098 154.579  1.00  0.82           C  
ATOM   6267  CE  LYS A 793      -6.620  61.908 156.008  1.00  0.82           C  
ATOM   6268  NZ  LYS A 793      -7.148  60.645 156.564  1.00  0.82           N  
ATOM   6269  N   ASN A 794      -7.165  68.030 155.140  1.00  0.81           N  
ATOM   6270  CA  ASN A 794      -7.875  69.191 155.625  1.00  0.81           C  
ATOM   6271  C   ASN A 794      -7.272  70.430 154.959  1.00  0.81           C  
ATOM   6272  O   ASN A 794      -6.250  70.938 155.430  1.00  0.81           O  
ATOM   6273  CB  ASN A 794      -7.695  69.233 157.166  1.00  0.81           C  
ATOM   6274  CG  ASN A 794      -8.623  70.236 157.842  1.00  0.81           C  
ATOM   6275  OD1 ASN A 794      -9.064  71.235 157.271  1.00  0.81           O  
ATOM   6276  ND2 ASN A 794      -8.930  69.960 159.131  1.00  0.81           N  
ATOM   6277  N   PRO A 795      -7.860  70.996 153.895  1.00  0.84           N  
ATOM   6278  CA  PRO A 795      -7.210  72.082 153.174  1.00  0.84           C  
ATOM   6279  C   PRO A 795      -7.079  73.343 153.990  1.00  0.84           C  
ATOM   6280  O   PRO A 795      -6.087  74.039 153.815  1.00  0.84           O  
ATOM   6281  CB  PRO A 795      -8.077  72.287 151.921  1.00  0.84           C  
ATOM   6282  CG  PRO A 795      -8.618  70.885 151.640  1.00  0.84           C  
ATOM   6283  CD  PRO A 795      -8.843  70.314 153.042  1.00  0.84           C  
ATOM   6284  N   ARG A 796      -8.050  73.648 154.877  1.00  0.76           N  
ATOM   6285  CA  ARG A 796      -8.029  74.816 155.742  1.00  0.76           C  
ATOM   6286  C   ARG A 796      -6.885  74.796 156.740  1.00  0.76           C  
ATOM   6287  O   ARG A 796      -6.170  75.779 156.900  1.00  0.76           O  
ATOM   6288  CB  ARG A 796      -9.364  74.936 156.518  1.00  0.76           C  
ATOM   6289  CG  ARG A 796     -10.572  75.266 155.624  1.00  0.76           C  
ATOM   6290  CD  ARG A 796     -11.834  75.548 156.443  1.00  0.76           C  
ATOM   6291  NE  ARG A 796     -12.929  75.865 155.483  1.00  0.76           N  
ATOM   6292  CZ  ARG A 796     -13.761  74.965 154.939  1.00  0.76           C  
ATOM   6293  NH1 ARG A 796     -14.716  75.361 154.104  1.00  0.76           N  
ATOM   6294  NH2 ARG A 796     -13.659  73.667 155.222  1.00  0.76           N  
ATOM   6295  N   GLU A 797      -6.643  73.659 157.414  1.00  0.79           N  
ATOM   6296  CA  GLU A 797      -5.530  73.531 158.337  1.00  0.79           C  
ATOM   6297  C   GLU A 797      -4.171  73.537 157.659  1.00  0.79           C  
ATOM   6298  O   GLU A 797      -3.228  74.175 158.131  1.00  0.79           O  
ATOM   6299  CB  GLU A 797      -5.712  72.309 159.260  1.00  0.79           C  
ATOM   6300  CG  GLU A 797      -6.893  72.503 160.240  1.00  0.79           C  
ATOM   6301  CD  GLU A 797      -6.783  73.798 161.033  1.00  0.79           C  
ATOM   6302  OE1 GLU A 797      -5.972  73.878 161.982  1.00  0.79           O  
ATOM   6303  OE2 GLU A 797      -7.526  74.751 160.700  1.00  0.79           O  
ATOM   6304  N   TRP A 798      -4.042  72.876 156.488  1.00  0.87           N  
ATOM   6305  CA  TRP A 798      -2.831  72.926 155.687  1.00  0.87           C  
ATOM   6306  C   TRP A 798      -2.466  74.348 155.256  1.00  0.87           C  
ATOM   6307  O   TRP A 798      -1.352  74.818 155.473  1.00  0.87           O  
ATOM   6308  CB  TRP A 798      -3.016  72.025 154.428  1.00  0.87           C  
ATOM   6309  CG  TRP A 798      -1.812  71.944 153.500  1.00  0.87           C  
ATOM   6310  CD1 TRP A 798      -1.447  72.769 152.468  1.00  0.87           C  
ATOM   6311  CD2 TRP A 798      -0.770  70.952 153.597  1.00  0.87           C  
ATOM   6312  NE1 TRP A 798      -0.245  72.361 151.916  1.00  0.87           N  
ATOM   6313  CE2 TRP A 798       0.178  71.248 152.616  1.00  0.87           C  
ATOM   6314  CE3 TRP A 798      -0.622  69.861 154.452  1.00  0.87           C  
ATOM   6315  CZ2 TRP A 798       1.320  70.466 152.457  1.00  0.87           C  
ATOM   6316  CZ3 TRP A 798       0.515  69.054 154.282  1.00  0.87           C  
ATOM   6317  CH2 TRP A 798       1.475  69.355 153.304  1.00  0.87           C  
ATOM   6318  N   THR A 799      -3.417  75.100 154.677  1.00  0.88           N  
ATOM   6319  CA  THR A 799      -3.196  76.471 154.225  1.00  0.88           C  
ATOM   6320  C   THR A 799      -2.962  77.476 155.334  1.00  0.88           C  
ATOM   6321  O   THR A 799      -2.112  78.351 155.191  1.00  0.88           O  
ATOM   6322  CB  THR A 799      -4.280  76.987 153.315  1.00  0.88           C  
ATOM   6323  OG1 THR A 799      -5.541  76.773 153.912  1.00  0.88           O  
ATOM   6324  CG2 THR A 799      -4.265  76.180 152.012  1.00  0.88           C  
ATOM   6325  N   ARG A 800      -3.650  77.374 156.491  1.00  0.82           N  
ATOM   6326  CA  ARG A 800      -3.355  78.169 157.677  1.00  0.82           C  
ATOM   6327  C   ARG A 800      -1.919  77.962 158.158  1.00  0.82           C  
ATOM   6328  O   ARG A 800      -1.207  78.913 158.484  1.00  0.82           O  
ATOM   6329  CB  ARG A 800      -4.335  77.803 158.821  1.00  0.82           C  
ATOM   6330  CG  ARG A 800      -5.780  78.296 158.597  1.00  0.82           C  
ATOM   6331  CD  ARG A 800      -6.769  77.632 159.558  1.00  0.82           C  
ATOM   6332  NE  ARG A 800      -8.148  78.004 159.119  1.00  0.82           N  
ATOM   6333  CZ  ARG A 800      -9.236  77.616 159.789  1.00  0.82           C  
ATOM   6334  NH1 ARG A 800     -10.410  78.166 159.483  1.00  0.82           N  
ATOM   6335  NH2 ARG A 800      -9.177  76.707 160.755  1.00  0.82           N  
ATOM   6336  N   MET A 801      -1.428  76.705 158.150  1.00  0.89           N  
ATOM   6337  CA  MET A 801      -0.034  76.387 158.409  1.00  0.89           C  
ATOM   6338  C   MET A 801       0.930  76.966 157.365  1.00  0.89           C  
ATOM   6339  O   MET A 801       1.988  77.499 157.706  1.00  0.89           O  
ATOM   6340  CB  MET A 801       0.156  74.861 158.579  1.00  0.89           C  
ATOM   6341  CG  MET A 801       1.477  74.497 159.285  1.00  0.89           C  
ATOM   6342  SD  MET A 801       1.724  72.722 159.593  1.00  0.89           S  
ATOM   6343  CE  MET A 801       0.596  72.595 161.009  1.00  0.89           C  
ATOM   6344  N   VAL A 802       0.565  76.934 156.062  1.00  0.94           N  
ATOM   6345  CA  VAL A 802       1.303  77.577 154.970  1.00  0.94           C  
ATOM   6346  C   VAL A 802       1.423  79.087 155.161  1.00  0.94           C  
ATOM   6347  O   VAL A 802       2.509  79.648 155.032  1.00  0.94           O  
ATOM   6348  CB  VAL A 802       0.685  77.274 153.597  1.00  0.94           C  
ATOM   6349  CG1 VAL A 802       1.309  78.126 152.473  1.00  0.94           C  
ATOM   6350  CG2 VAL A 802       0.900  75.789 153.250  1.00  0.94           C  
ATOM   6351  N   ILE A 803       0.334  79.791 155.545  1.00  0.91           N  
ATOM   6352  CA  ILE A 803       0.351  81.225 155.847  1.00  0.91           C  
ATOM   6353  C   ILE A 803       1.291  81.552 156.995  1.00  0.91           C  
ATOM   6354  O   ILE A 803       2.073  82.499 156.924  1.00  0.91           O  
ATOM   6355  CB  ILE A 803      -1.057  81.768 156.130  1.00  0.91           C  
ATOM   6356  CG1 ILE A 803      -1.889  81.749 154.824  1.00  0.91           C  
ATOM   6357  CG2 ILE A 803      -1.023  83.197 156.736  1.00  0.91           C  
ATOM   6358  CD1 ILE A 803      -3.385  81.989 155.046  1.00  0.91           C  
ATOM   6359  N   ARG A 804       1.294  80.733 158.065  1.00  0.86           N  
ATOM   6360  CA  ARG A 804       2.239  80.868 159.157  1.00  0.86           C  
ATOM   6361  C   ARG A 804       3.689  80.698 158.725  1.00  0.86           C  
ATOM   6362  O   ARG A 804       4.554  81.419 159.202  1.00  0.86           O  
ATOM   6363  CB  ARG A 804       1.915  79.883 160.300  1.00  0.86           C  
ATOM   6364  CG  ARG A 804       0.585  80.199 161.011  1.00  0.86           C  
ATOM   6365  CD  ARG A 804       0.259  79.148 162.067  1.00  0.86           C  
ATOM   6366  NE  ARG A 804      -1.048  79.512 162.690  1.00  0.86           N  
ATOM   6367  CZ  ARG A 804      -1.650  78.713 163.580  1.00  0.86           C  
ATOM   6368  NH1 ARG A 804      -2.801  79.100 164.129  1.00  0.86           N  
ATOM   6369  NH2 ARG A 804      -1.121  77.542 163.921  1.00  0.86           N  
ATOM   6370  N   ASN A 805       3.989  79.763 157.799  1.00  0.94           N  
ATOM   6371  CA  ASN A 805       5.312  79.632 157.201  1.00  0.94           C  
ATOM   6372  C   ASN A 805       5.719  80.819 156.315  1.00  0.94           C  
ATOM   6373  O   ASN A 805       6.835  81.322 156.417  1.00  0.94           O  
ATOM   6374  CB  ASN A 805       5.421  78.332 156.356  1.00  0.94           C  
ATOM   6375  CG  ASN A 805       5.674  77.094 157.210  1.00  0.94           C  
ATOM   6376  OD1 ASN A 805       6.722  76.474 157.051  1.00  0.94           O  
ATOM   6377  ND2 ASN A 805       4.728  76.693 158.084  1.00  0.94           N  
ATOM   6378  N   ILE A 806       4.836  81.327 155.425  1.00  0.95           N  
ATOM   6379  CA  ILE A 806       5.158  82.466 154.556  1.00  0.95           C  
ATOM   6380  C   ILE A 806       5.372  83.740 155.362  1.00  0.95           C  
ATOM   6381  O   ILE A 806       6.301  84.505 155.121  1.00  0.95           O  
ATOM   6382  CB  ILE A 806       4.127  82.715 153.445  1.00  0.95           C  
ATOM   6383  CG1 ILE A 806       3.990  81.469 152.539  1.00  0.95           C  
ATOM   6384  CG2 ILE A 806       4.545  83.922 152.564  1.00  0.95           C  
ATOM   6385  CD1 ILE A 806       2.811  81.555 151.559  1.00  0.95           C  
ATOM   6386  N   ALA A 807       4.539  83.985 156.393  1.00  0.93           N  
ATOM   6387  CA  ALA A 807       4.565  85.201 157.181  1.00  0.93           C  
ATOM   6388  C   ALA A 807       5.822  85.353 158.034  1.00  0.93           C  
ATOM   6389  O   ALA A 807       6.173  86.441 158.487  1.00  0.93           O  
ATOM   6390  CB  ALA A 807       3.315  85.231 158.087  1.00  0.93           C  
ATOM   6391  N   THR A 808       6.543  84.247 158.268  1.00  0.92           N  
ATOM   6392  CA  THR A 808       7.700  84.199 159.149  1.00  0.92           C  
ATOM   6393  C   THR A 808       8.965  83.864 158.395  1.00  0.92           C  
ATOM   6394  O   THR A 808      10.018  83.624 158.980  1.00  0.92           O  
ATOM   6395  CB  THR A 808       7.520  83.184 160.259  1.00  0.92           C  
ATOM   6396  OG1 THR A 808       7.265  81.900 159.719  1.00  0.92           O  
ATOM   6397  CG2 THR A 808       6.289  83.555 161.094  1.00  0.92           C  
ATOM   6398  N   SER A 809       8.932  83.890 157.048  1.00  0.95           N  
ATOM   6399  CA  SER A 809      10.091  83.546 156.234  1.00  0.95           C  
ATOM   6400  C   SER A 809      11.028  84.727 156.044  1.00  0.95           C  
ATOM   6401  O   SER A 809      12.132  84.576 155.522  1.00  0.95           O  
ATOM   6402  CB  SER A 809       9.668  82.991 154.848  1.00  0.95           C  
ATOM   6403  OG  SER A 809       9.037  83.988 154.045  1.00  0.95           O  
ATOM   6404  N   GLY A 810      10.606  85.922 156.521  1.00  0.95           N  
ATOM   6405  CA  GLY A 810      11.288  87.216 156.446  1.00  0.95           C  
ATOM   6406  C   GLY A 810      12.762  87.213 156.723  1.00  0.95           C  
ATOM   6407  O   GLY A 810      13.569  87.661 155.905  1.00  0.95           O  
ATOM   6408  N   LYS A 811      13.150  86.598 157.859  1.00  0.91           N  
ATOM   6409  CA  LYS A 811      14.514  86.480 158.327  1.00  0.91           C  
ATOM   6410  C   LYS A 811      15.439  85.864 157.295  1.00  0.91           C  
ATOM   6411  O   LYS A 811      16.633  86.151 157.240  1.00  0.91           O  
ATOM   6412  CB  LYS A 811      14.563  85.597 159.594  1.00  0.91           C  
ATOM   6413  CG  LYS A 811      15.975  85.441 160.190  1.00  0.91           C  
ATOM   6414  CD  LYS A 811      15.951  84.500 161.378  1.00  0.91           C  
ATOM   6415  CE  LYS A 811      17.293  84.074 161.931  1.00  0.91           C  
ATOM   6416  NZ  LYS A 811      17.065  83.083 162.991  1.00  0.91           N  
ATOM   6417  N   PHE A 812      14.917  85.002 156.416  1.00  0.96           N  
ATOM   6418  CA  PHE A 812      15.708  84.254 155.471  1.00  0.96           C  
ATOM   6419  C   PHE A 812      15.894  84.989 154.154  1.00  0.96           C  
ATOM   6420  O   PHE A 812      16.444  84.438 153.208  1.00  0.96           O  
ATOM   6421  CB  PHE A 812      15.071  82.866 155.223  1.00  0.96           C  
ATOM   6422  CG  PHE A 812      14.995  82.146 156.542  1.00  0.96           C  
ATOM   6423  CD1 PHE A 812      16.170  81.718 157.184  1.00  0.96           C  
ATOM   6424  CD2 PHE A 812      13.765  81.992 157.201  1.00  0.96           C  
ATOM   6425  CE1 PHE A 812      16.121  81.176 158.475  1.00  0.96           C  
ATOM   6426  CE2 PHE A 812      13.708  81.466 158.496  1.00  0.96           C  
ATOM   6427  CZ  PHE A 812      14.890  81.070 159.134  1.00  0.96           C  
ATOM   6428  N   SER A 813      15.524  86.281 154.049  1.00  0.96           N  
ATOM   6429  CA  SER A 813      16.076  87.149 153.008  1.00  0.96           C  
ATOM   6430  C   SER A 813      17.595  87.311 153.074  1.00  0.96           C  
ATOM   6431  O   SER A 813      18.174  87.528 154.139  1.00  0.96           O  
ATOM   6432  CB  SER A 813      15.478  88.580 153.052  1.00  0.96           C  
ATOM   6433  OG  SER A 813      15.908  89.371 151.937  1.00  0.96           O  
ATOM   6434  N   SER A 814      18.291  87.275 151.911  1.00  0.97           N  
ATOM   6435  CA  SER A 814      19.726  87.552 151.847  1.00  0.97           C  
ATOM   6436  C   SER A 814      20.051  89.008 152.062  1.00  0.97           C  
ATOM   6437  O   SER A 814      21.189  89.336 152.383  1.00  0.97           O  
ATOM   6438  CB  SER A 814      20.535  86.971 150.654  1.00  0.97           C  
ATOM   6439  OG  SER A 814      19.912  87.256 149.424  1.00  0.97           O  
ATOM   6440  N   ASP A 815      19.060  89.916 152.003  1.00  0.94           N  
ATOM   6441  CA  ASP A 815      19.240  91.304 152.387  1.00  0.94           C  
ATOM   6442  C   ASP A 815      19.535  91.440 153.873  1.00  0.94           C  
ATOM   6443  O   ASP A 815      20.443  92.162 154.283  1.00  0.94           O  
ATOM   6444  CB  ASP A 815      17.983  92.116 152.046  1.00  0.94           C  
ATOM   6445  CG  ASP A 815      17.688  92.037 150.562  1.00  0.94           C  
ATOM   6446  OD1 ASP A 815      16.544  92.399 150.204  1.00  0.94           O  
ATOM   6447  OD2 ASP A 815      18.535  91.609 149.730  1.00  0.94           O  
ATOM   6448  N   ARG A 816      18.806  90.676 154.721  1.00  0.87           N  
ATOM   6449  CA  ARG A 816      19.043  90.611 156.156  1.00  0.87           C  
ATOM   6450  C   ARG A 816      20.436  90.074 156.443  1.00  0.87           C  
ATOM   6451  O   ARG A 816      21.187  90.623 157.251  1.00  0.87           O  
ATOM   6452  CB  ARG A 816      17.961  89.724 156.851  1.00  0.87           C  
ATOM   6453  CG  ARG A 816      17.988  89.645 158.405  1.00  0.87           C  
ATOM   6454  CD  ARG A 816      19.034  88.716 159.058  1.00  0.87           C  
ATOM   6455  NE  ARG A 816      18.748  87.334 158.577  1.00  0.87           N  
ATOM   6456  CZ  ARG A 816      19.635  86.386 158.256  1.00  0.87           C  
ATOM   6457  NH1 ARG A 816      20.905  86.413 158.604  1.00  0.87           N  
ATOM   6458  NH2 ARG A 816      19.199  85.341 157.558  1.00  0.87           N  
ATOM   6459  N   THR A 817      20.836  88.996 155.742  1.00  0.95           N  
ATOM   6460  CA  THR A 817      22.151  88.378 155.870  1.00  0.95           C  
ATOM   6461  C   THR A 817      23.282  89.322 155.511  1.00  0.95           C  
ATOM   6462  O   THR A 817      24.240  89.487 156.265  1.00  0.95           O  
ATOM   6463  CB  THR A 817      22.270  87.135 154.992  1.00  0.95           C  
ATOM   6464  OG1 THR A 817      21.143  86.303 155.205  1.00  0.95           O  
ATOM   6465  CG2 THR A 817      23.507  86.307 155.351  1.00  0.95           C  
ATOM   6466  N   ILE A 818      23.164  90.027 154.369  1.00  0.94           N  
ATOM   6467  CA  ILE A 818      24.122  91.020 153.904  1.00  0.94           C  
ATOM   6468  C   ILE A 818      24.229  92.223 154.822  1.00  0.94           C  
ATOM   6469  O   ILE A 818      25.329  92.709 155.078  1.00  0.94           O  
ATOM   6470  CB  ILE A 818      23.848  91.414 152.454  1.00  0.94           C  
ATOM   6471  CG1 ILE A 818      24.209  90.244 151.502  1.00  0.94           C  
ATOM   6472  CG2 ILE A 818      24.603  92.698 152.039  1.00  0.94           C  
ATOM   6473  CD1 ILE A 818      25.674  89.793 151.548  1.00  0.94           C  
ATOM   6474  N   ALA A 819      23.112  92.704 155.400  1.00  0.90           N  
ATOM   6475  CA  ALA A 819      23.123  93.755 156.402  1.00  0.90           C  
ATOM   6476  C   ALA A 819      23.947  93.405 157.645  1.00  0.90           C  
ATOM   6477  O   ALA A 819      24.704  94.224 158.165  1.00  0.90           O  
ATOM   6478  CB  ALA A 819      21.674  94.081 156.814  1.00  0.90           C  
ATOM   6479  N   GLN A 820      23.854  92.150 158.131  1.00  0.87           N  
ATOM   6480  CA  GLN A 820      24.718  91.639 159.182  1.00  0.87           C  
ATOM   6481  C   GLN A 820      26.192  91.511 158.783  1.00  0.87           C  
ATOM   6482  O   GLN A 820      27.070  91.923 159.542  1.00  0.87           O  
ATOM   6483  CB  GLN A 820      24.173  90.296 159.728  1.00  0.87           C  
ATOM   6484  CG  GLN A 820      22.786  90.459 160.399  1.00  0.87           C  
ATOM   6485  CD  GLN A 820      22.178  89.126 160.829  1.00  0.87           C  
ATOM   6486  OE1 GLN A 820      22.306  88.097 160.169  1.00  0.87           O  
ATOM   6487  NE2 GLN A 820      21.429  89.132 161.955  1.00  0.87           N  
ATOM   6488  N   TYR A 821      26.525  90.988 157.574  1.00  0.93           N  
ATOM   6489  CA  TYR A 821      27.904  90.952 157.068  1.00  0.93           C  
ATOM   6490  C   TYR A 821      28.493  92.358 156.948  1.00  0.93           C  
ATOM   6491  O   TYR A 821      29.633  92.622 157.334  1.00  0.93           O  
ATOM   6492  CB  TYR A 821      28.011  90.298 155.652  1.00  0.93           C  
ATOM   6493  CG  TYR A 821      28.188  88.796 155.660  1.00  0.93           C  
ATOM   6494  CD1 TYR A 821      29.473  88.222 155.731  1.00  0.93           C  
ATOM   6495  CD2 TYR A 821      27.091  87.943 155.463  1.00  0.93           C  
ATOM   6496  CE1 TYR A 821      29.648  86.832 155.613  1.00  0.93           C  
ATOM   6497  CE2 TYR A 821      27.263  86.556 155.342  1.00  0.93           C  
ATOM   6498  CZ  TYR A 821      28.542  86.000 155.408  1.00  0.93           C  
ATOM   6499  OH  TYR A 821      28.700  84.605 155.245  1.00  0.93           O  
ATOM   6500  N   ALA A 822      27.692  93.313 156.438  1.00  0.91           N  
ATOM   6501  CA  ALA A 822      28.052  94.704 156.316  1.00  0.91           C  
ATOM   6502  C   ALA A 822      28.373  95.370 157.644  1.00  0.91           C  
ATOM   6503  O   ALA A 822      29.412  96.012 157.785  1.00  0.91           O  
ATOM   6504  CB  ALA A 822      26.887  95.450 155.632  1.00  0.91           C  
ATOM   6505  N   ARG A 823      27.508  95.188 158.659  1.00  0.80           N  
ATOM   6506  CA  ARG A 823      27.687  95.753 159.981  1.00  0.80           C  
ATOM   6507  C   ARG A 823      28.817  95.142 160.807  1.00  0.80           C  
ATOM   6508  O   ARG A 823      29.575  95.865 161.447  1.00  0.80           O  
ATOM   6509  CB  ARG A 823      26.350  95.639 160.761  1.00  0.80           C  
ATOM   6510  CG  ARG A 823      26.310  96.426 162.089  1.00  0.80           C  
ATOM   6511  CD  ARG A 823      24.975  96.333 162.844  1.00  0.80           C  
ATOM   6512  NE  ARG A 823      24.786  94.927 163.342  1.00  0.80           N  
ATOM   6513  CZ  ARG A 823      23.622  94.437 163.784  1.00  0.80           C  
ATOM   6514  NH1 ARG A 823      23.549  93.182 164.205  1.00  0.80           N  
ATOM   6515  NH2 ARG A 823      22.514  95.165 163.807  1.00  0.80           N  
ATOM   6516  N   GLU A 824      28.953  93.799 160.841  1.00  0.86           N  
ATOM   6517  CA  GLU A 824      29.804  93.148 161.834  1.00  0.86           C  
ATOM   6518  C   GLU A 824      31.059  92.515 161.267  1.00  0.86           C  
ATOM   6519  O   GLU A 824      31.883  91.983 162.009  1.00  0.86           O  
ATOM   6520  CB  GLU A 824      29.006  92.021 162.525  1.00  0.86           C  
ATOM   6521  CG  GLU A 824      27.840  92.551 163.386  1.00  0.86           C  
ATOM   6522  CD  GLU A 824      26.853  91.465 163.787  1.00  0.86           C  
ATOM   6523  OE1 GLU A 824      27.134  90.253 163.624  1.00  0.86           O  
ATOM   6524  OE2 GLU A 824      25.737  91.864 164.203  1.00  0.86           O  
ATOM   6525  N   ILE A 825      31.265  92.554 159.939  1.00  0.93           N  
ATOM   6526  CA  ILE A 825      32.462  91.978 159.337  1.00  0.93           C  
ATOM   6527  C   ILE A 825      33.109  92.997 158.422  1.00  0.93           C  
ATOM   6528  O   ILE A 825      34.286  93.324 158.576  1.00  0.93           O  
ATOM   6529  CB  ILE A 825      32.163  90.678 158.574  1.00  0.93           C  
ATOM   6530  CG1 ILE A 825      31.723  89.577 159.571  1.00  0.93           C  
ATOM   6531  CG2 ILE A 825      33.413  90.217 157.792  1.00  0.93           C  
ATOM   6532  CD1 ILE A 825      31.313  88.245 158.931  1.00  0.93           C  
ATOM   6533  N   TRP A 826      32.373  93.517 157.422  1.00  0.90           N  
ATOM   6534  CA  TRP A 826      32.935  94.413 156.426  1.00  0.90           C  
ATOM   6535  C   TRP A 826      33.140  95.839 156.913  1.00  0.90           C  
ATOM   6536  O   TRP A 826      34.172  96.448 156.628  1.00  0.90           O  
ATOM   6537  CB  TRP A 826      32.104  94.372 155.118  1.00  0.90           C  
ATOM   6538  CG  TRP A 826      32.059  92.991 154.479  1.00  0.90           C  
ATOM   6539  CD1 TRP A 826      33.003  92.000 154.534  1.00  0.90           C  
ATOM   6540  CD2 TRP A 826      30.962  92.453 153.713  1.00  0.90           C  
ATOM   6541  NE1 TRP A 826      32.559  90.874 153.885  1.00  0.90           N  
ATOM   6542  CE2 TRP A 826      31.314  91.132 153.367  1.00  0.90           C  
ATOM   6543  CE3 TRP A 826      29.741  93.002 153.318  1.00  0.90           C  
ATOM   6544  CZ2 TRP A 826      30.457  90.330 152.625  1.00  0.90           C  
ATOM   6545  CZ3 TRP A 826      28.879  92.194 152.558  1.00  0.90           C  
ATOM   6546  CH2 TRP A 826      29.233  90.879 152.216  1.00  0.90           C  
ATOM   6547  N   GLY A 827      32.191  96.419 157.675  1.00  0.91           N  
ATOM   6548  CA  GLY A 827      32.274  97.810 158.107  1.00  0.91           C  
ATOM   6549  C   GLY A 827      31.808  98.739 157.026  1.00  0.91           C  
ATOM   6550  O   GLY A 827      32.474  99.716 156.698  1.00  0.91           O  
ATOM   6551  N   VAL A 828      30.666  98.411 156.400  1.00  0.87           N  
ATOM   6552  CA  VAL A 828      30.128  99.159 155.276  1.00  0.87           C  
ATOM   6553  C   VAL A 828      28.659  99.468 155.510  1.00  0.87           C  
ATOM   6554  O   VAL A 828      27.956  98.767 156.236  1.00  0.87           O  
ATOM   6555  CB  VAL A 828      30.291  98.453 153.924  1.00  0.87           C  
ATOM   6556  CG1 VAL A 828      31.778  98.231 153.609  1.00  0.87           C  
ATOM   6557  CG2 VAL A 828      29.597  97.082 153.913  1.00  0.87           C  
ATOM   6558  N   GLU A 829      28.164 100.558 154.895  1.00  0.75           N  
ATOM   6559  CA  GLU A 829      26.847 101.104 155.163  1.00  0.75           C  
ATOM   6560  C   GLU A 829      25.950 101.012 153.928  1.00  0.75           C  
ATOM   6561  O   GLU A 829      26.391 101.386 152.837  1.00  0.75           O  
ATOM   6562  CB  GLU A 829      26.966 102.579 155.610  1.00  0.75           C  
ATOM   6563  CG  GLU A 829      25.716 103.136 156.338  1.00  0.75           C  
ATOM   6564  CD  GLU A 829      25.940 104.561 156.845  1.00  0.75           C  
ATOM   6565  OE1 GLU A 829      25.083 105.434 156.555  1.00  0.75           O  
ATOM   6566  OE2 GLU A 829      26.965 104.778 157.540  1.00  0.75           O  
ATOM   6567  N   PRO A 830      24.718 100.502 154.011  1.00  0.80           N  
ATOM   6568  CA  PRO A 830      23.786 100.507 152.888  1.00  0.80           C  
ATOM   6569  C   PRO A 830      23.335 101.893 152.464  1.00  0.80           C  
ATOM   6570  O   PRO A 830      23.129 102.760 153.308  1.00  0.80           O  
ATOM   6571  CB  PRO A 830      22.604  99.654 153.387  1.00  0.80           C  
ATOM   6572  CG  PRO A 830      23.243  98.700 154.398  1.00  0.80           C  
ATOM   6573  CD  PRO A 830      24.274  99.599 155.077  1.00  0.80           C  
ATOM   6574  N   SER A 831      23.168 102.121 151.152  1.00  0.67           N  
ATOM   6575  CA  SER A 831      22.796 103.423 150.618  1.00  0.67           C  
ATOM   6576  C   SER A 831      21.965 103.271 149.357  1.00  0.67           C  
ATOM   6577  O   SER A 831      21.806 102.169 148.832  1.00  0.67           O  
ATOM   6578  CB  SER A 831      24.017 104.353 150.372  1.00  0.67           C  
ATOM   6579  OG  SER A 831      24.902 103.845 149.372  1.00  0.67           O  
ATOM   6580  N   ARG A 832      21.344 104.367 148.872  1.00  0.48           N  
ATOM   6581  CA  ARG A 832      20.521 104.380 147.678  1.00  0.48           C  
ATOM   6582  C   ARG A 832      20.526 105.788 147.033  1.00  0.48           C  
ATOM   6583  O   ARG A 832      20.939 106.765 147.711  1.00  0.48           O  
ATOM   6584  CB  ARG A 832      19.040 104.004 147.972  1.00  0.48           C  
ATOM   6585  CG  ARG A 832      18.826 102.495 148.180  1.00  0.48           C  
ATOM   6586  CD  ARG A 832      17.379 102.081 148.406  1.00  0.48           C  
ATOM   6587  NE  ARG A 832      17.424 100.586 148.455  1.00  0.48           N  
ATOM   6588  CZ  ARG A 832      16.434  99.798 148.885  1.00  0.48           C  
ATOM   6589  NH1 ARG A 832      16.670  98.491 148.959  1.00  0.48           N  
ATOM   6590  NH2 ARG A 832      15.251 100.288 149.233  1.00  0.48           N  
ATOM   6591  OXT ARG A 832      20.094 105.883 145.848  1.00  0.48           O  
TER    6592      ARG A 832                                                      
ATOM   6593  N   ASN B  24      25.393 110.655 106.396  1.00  0.83           N  
ATOM   6594  CA  ASN B  24      25.990 112.018 106.630  1.00  0.83           C  
ATOM   6595  C   ASN B  24      26.954 111.976 107.810  1.00  0.83           C  
ATOM   6596  O   ASN B  24      26.987 110.969 108.508  1.00  0.83           O  
ATOM   6597  CB  ASN B  24      24.854 113.084 106.772  1.00  0.83           C  
ATOM   6598  CG  ASN B  24      24.006 112.842 108.020  1.00  0.83           C  
ATOM   6599  OD1 ASN B  24      24.491 112.988 109.135  1.00  0.83           O  
ATOM   6600  ND2 ASN B  24      22.759 112.370 107.841  1.00  0.83           N  
ATOM   6601  N   VAL B  25      27.759 113.032 108.035  1.00  0.87           N  
ATOM   6602  CA  VAL B  25      28.728 113.102 109.125  1.00  0.87           C  
ATOM   6603  C   VAL B  25      28.104 113.072 110.518  1.00  0.87           C  
ATOM   6604  O   VAL B  25      28.521 112.304 111.382  1.00  0.87           O  
ATOM   6605  CB  VAL B  25      29.576 114.362 108.969  1.00  0.87           C  
ATOM   6606  CG1 VAL B  25      30.619 114.494 110.096  1.00  0.87           C  
ATOM   6607  CG2 VAL B  25      30.316 114.305 107.618  1.00  0.87           C  
ATOM   6608  N   THR B  26      27.041 113.868 110.758  1.00  0.83           N  
ATOM   6609  CA  THR B  26      26.374 114.022 112.054  1.00  0.83           C  
ATOM   6610  C   THR B  26      25.822 112.728 112.607  1.00  0.83           C  
ATOM   6611  O   THR B  26      26.066 112.368 113.761  1.00  0.83           O  
ATOM   6612  CB  THR B  26      25.218 115.011 111.927  1.00  0.83           C  
ATOM   6613  OG1 THR B  26      25.733 116.280 111.559  1.00  0.83           O  
ATOM   6614  CG2 THR B  26      24.432 115.217 113.229  1.00  0.83           C  
ATOM   6615  N   GLU B  27      25.116 111.953 111.767  1.00  0.79           N  
ATOM   6616  CA  GLU B  27      24.619 110.641 112.128  1.00  0.79           C  
ATOM   6617  C   GLU B  27      25.690 109.592 112.353  1.00  0.79           C  
ATOM   6618  O   GLU B  27      25.554 108.737 113.225  1.00  0.79           O  
ATOM   6619  CB  GLU B  27      23.518 110.167 111.153  1.00  0.79           C  
ATOM   6620  CG  GLU B  27      22.216 110.985 111.356  1.00  0.79           C  
ATOM   6621  CD  GLU B  27      21.755 110.952 112.821  1.00  0.79           C  
ATOM   6622  OE1 GLU B  27      21.541 109.833 113.360  1.00  0.79           O  
ATOM   6623  OE2 GLU B  27      21.700 112.044 113.447  1.00  0.79           O  
ATOM   6624  N   LEU B  28      26.824 109.634 111.624  1.00  0.85           N  
ATOM   6625  CA  LEU B  28      27.963 108.779 111.932  1.00  0.85           C  
ATOM   6626  C   LEU B  28      28.561 109.033 113.315  1.00  0.85           C  
ATOM   6627  O   LEU B  28      28.858 108.088 114.046  1.00  0.85           O  
ATOM   6628  CB  LEU B  28      29.063 108.913 110.858  1.00  0.85           C  
ATOM   6629  CG  LEU B  28      28.697 108.242 109.520  1.00  0.85           C  
ATOM   6630  CD1 LEU B  28      29.641 108.735 108.421  1.00  0.85           C  
ATOM   6631  CD2 LEU B  28      28.774 106.712 109.614  1.00  0.85           C  
ATOM   6632  N   LYS B  29      28.696 110.312 113.740  1.00  0.81           N  
ATOM   6633  CA  LYS B  29      29.106 110.655 115.098  1.00  0.81           C  
ATOM   6634  C   LYS B  29      28.126 110.160 116.148  1.00  0.81           C  
ATOM   6635  O   LYS B  29      28.499 109.575 117.164  1.00  0.81           O  
ATOM   6636  CB  LYS B  29      29.239 112.189 115.317  1.00  0.81           C  
ATOM   6637  CG  LYS B  29      30.157 112.880 114.305  1.00  0.81           C  
ATOM   6638  CD  LYS B  29      30.775 114.205 114.788  1.00  0.81           C  
ATOM   6639  CE  LYS B  29      29.786 115.263 115.284  1.00  0.81           C  
ATOM   6640  NZ  LYS B  29      30.510 116.520 115.562  1.00  0.81           N  
ATOM   6641  N   LYS B  30      26.818 110.352 115.885  1.00  0.81           N  
ATOM   6642  CA  LYS B  30      25.744 109.919 116.752  1.00  0.81           C  
ATOM   6643  C   LYS B  30      25.703 108.407 116.930  1.00  0.81           C  
ATOM   6644  O   LYS B  30      25.507 107.908 118.036  1.00  0.81           O  
ATOM   6645  CB  LYS B  30      24.394 110.455 116.215  1.00  0.81           C  
ATOM   6646  CG  LYS B  30      23.211 110.276 117.183  1.00  0.81           C  
ATOM   6647  CD  LYS B  30      21.921 110.955 116.683  1.00  0.81           C  
ATOM   6648  CE  LYS B  30      21.983 112.487 116.600  1.00  0.81           C  
ATOM   6649  NZ  LYS B  30      22.291 113.051 117.934  1.00  0.81           N  
ATOM   6650  N   ASN B  31      25.916 107.643 115.840  1.00  0.83           N  
ATOM   6651  CA  ASN B  31      26.049 106.196 115.838  1.00  0.83           C  
ATOM   6652  C   ASN B  31      27.302 105.712 116.596  1.00  0.83           C  
ATOM   6653  O   ASN B  31      27.220 104.813 117.432  1.00  0.83           O  
ATOM   6654  CB  ASN B  31      25.976 105.711 114.358  1.00  0.83           C  
ATOM   6655  CG  ASN B  31      25.622 104.234 114.251  1.00  0.83           C  
ATOM   6656  OD1 ASN B  31      26.390 103.384 114.667  1.00  0.83           O  
ATOM   6657  ND2 ASN B  31      24.450 103.864 113.691  1.00  0.83           N  
ATOM   6658  N   PHE B  32      28.470 106.371 116.398  1.00  0.89           N  
ATOM   6659  CA  PHE B  32      29.721 106.108 117.109  1.00  0.89           C  
ATOM   6660  C   PHE B  32      29.594 106.311 118.616  1.00  0.89           C  
ATOM   6661  O   PHE B  32      30.007 105.472 119.416  1.00  0.89           O  
ATOM   6662  CB  PHE B  32      30.824 107.054 116.533  1.00  0.89           C  
ATOM   6663  CG  PHE B  32      32.194 106.887 117.159  1.00  0.89           C  
ATOM   6664  CD1 PHE B  32      32.558 107.638 118.293  1.00  0.89           C  
ATOM   6665  CD2 PHE B  32      33.141 106.019 116.595  1.00  0.89           C  
ATOM   6666  CE1 PHE B  32      33.837 107.524 118.855  1.00  0.89           C  
ATOM   6667  CE2 PHE B  32      34.422 105.905 117.151  1.00  0.89           C  
ATOM   6668  CZ  PHE B  32      34.768 106.652 118.281  1.00  0.89           C  
ATOM   6669  N   ASN B  33      28.976 107.426 119.053  1.00  0.83           N  
ATOM   6670  CA  ASN B  33      28.697 107.675 120.458  1.00  0.83           C  
ATOM   6671  C   ASN B  33      27.726 106.656 121.052  1.00  0.83           C  
ATOM   6672  O   ASN B  33      27.910 106.195 122.178  1.00  0.83           O  
ATOM   6673  CB  ASN B  33      28.204 109.130 120.692  1.00  0.83           C  
ATOM   6674  CG  ASN B  33      29.249 110.181 120.310  1.00  0.83           C  
ATOM   6675  OD1 ASN B  33      28.925 111.275 119.849  1.00  0.83           O  
ATOM   6676  ND2 ASN B  33      30.550 109.879 120.524  1.00  0.83           N  
ATOM   6677  N   ARG B  34      26.699 106.237 120.283  1.00  0.79           N  
ATOM   6678  CA  ARG B  34      25.779 105.175 120.664  1.00  0.79           C  
ATOM   6679  C   ARG B  34      26.466 103.830 120.882  1.00  0.79           C  
ATOM   6680  O   ARG B  34      26.259 103.180 121.905  1.00  0.79           O  
ATOM   6681  CB  ARG B  34      24.684 105.008 119.572  1.00  0.79           C  
ATOM   6682  CG  ARG B  34      23.237 104.990 120.097  1.00  0.79           C  
ATOM   6683  CD  ARG B  34      22.192 104.746 118.998  1.00  0.79           C  
ATOM   6684  NE  ARG B  34      22.270 105.880 118.008  1.00  0.79           N  
ATOM   6685  CZ  ARG B  34      22.244 105.768 116.671  1.00  0.79           C  
ATOM   6686  NH1 ARG B  34      22.349 104.593 116.060  1.00  0.79           N  
ATOM   6687  NH2 ARG B  34      22.120 106.868 115.928  1.00  0.79           N  
ATOM   6688  N   HIS B  35      27.343 103.399 119.951  1.00  0.83           N  
ATOM   6689  CA  HIS B  35      28.142 102.192 120.121  1.00  0.83           C  
ATOM   6690  C   HIS B  35      29.141 102.276 121.255  1.00  0.83           C  
ATOM   6691  O   HIS B  35      29.305 101.320 122.008  1.00  0.83           O  
ATOM   6692  CB  HIS B  35      28.882 101.765 118.835  1.00  0.83           C  
ATOM   6693  CG  HIS B  35      27.994 100.988 117.919  1.00  0.83           C  
ATOM   6694  ND1 HIS B  35      27.469  99.777 118.337  1.00  0.83           N  
ATOM   6695  CD2 HIS B  35      27.537 101.300 116.682  1.00  0.83           C  
ATOM   6696  CE1 HIS B  35      26.692  99.383 117.339  1.00  0.83           C  
ATOM   6697  NE2 HIS B  35      26.702 100.268 116.317  1.00  0.83           N  
ATOM   6698  N   LEU B  36      29.825 103.421 121.451  1.00  0.86           N  
ATOM   6699  CA  LEU B  36      30.736 103.586 122.573  1.00  0.86           C  
ATOM   6700  C   LEU B  36      30.027 103.428 123.917  1.00  0.86           C  
ATOM   6701  O   LEU B  36      30.486 102.717 124.811  1.00  0.86           O  
ATOM   6702  CB  LEU B  36      31.424 104.973 122.498  1.00  0.86           C  
ATOM   6703  CG  LEU B  36      32.541 105.200 123.540  1.00  0.86           C  
ATOM   6704  CD1 LEU B  36      33.754 104.297 123.269  1.00  0.86           C  
ATOM   6705  CD2 LEU B  36      32.970 106.674 123.562  1.00  0.86           C  
ATOM   6706  N   HIS B  37      28.837 104.044 124.053  1.00  0.81           N  
ATOM   6707  CA  HIS B  37      28.027 103.917 125.247  1.00  0.81           C  
ATOM   6708  C   HIS B  37      27.433 102.524 125.441  1.00  0.81           C  
ATOM   6709  O   HIS B  37      27.735 101.848 126.417  1.00  0.81           O  
ATOM   6710  CB  HIS B  37      26.881 104.959 125.196  1.00  0.81           C  
ATOM   6711  CG  HIS B  37      26.075 105.075 126.455  1.00  0.81           C  
ATOM   6712  ND1 HIS B  37      26.605 105.726 127.548  1.00  0.81           N  
ATOM   6713  CD2 HIS B  37      24.810 104.662 126.725  1.00  0.81           C  
ATOM   6714  CE1 HIS B  37      25.658 105.702 128.461  1.00  0.81           C  
ATOM   6715  NE2 HIS B  37      24.547 105.070 128.014  1.00  0.81           N  
ATOM   6716  N   PHE B  38      26.597 102.021 124.508  1.00  0.80           N  
ATOM   6717  CA  PHE B  38      25.861 100.777 124.713  1.00  0.80           C  
ATOM   6718  C   PHE B  38      26.685  99.512 124.493  1.00  0.80           C  
ATOM   6719  O   PHE B  38      26.622  98.558 125.268  1.00  0.80           O  
ATOM   6720  CB  PHE B  38      24.598 100.726 123.808  1.00  0.80           C  
ATOM   6721  CG  PHE B  38      23.594 101.770 124.234  1.00  0.80           C  
ATOM   6722  CD1 PHE B  38      22.861 101.597 125.419  1.00  0.80           C  
ATOM   6723  CD2 PHE B  38      23.347 102.912 123.453  1.00  0.80           C  
ATOM   6724  CE1 PHE B  38      21.902 102.540 125.816  1.00  0.80           C  
ATOM   6725  CE2 PHE B  38      22.394 103.863 123.845  1.00  0.80           C  
ATOM   6726  CZ  PHE B  38      21.669 103.674 125.029  1.00  0.80           C  
ATOM   6727  N   THR B  39      27.486  99.461 123.414  1.00  0.78           N  
ATOM   6728  CA  THR B  39      28.239  98.269 123.028  1.00  0.78           C  
ATOM   6729  C   THR B  39      29.548  98.142 123.782  1.00  0.78           C  
ATOM   6730  O   THR B  39      29.945  97.046 124.184  1.00  0.78           O  
ATOM   6731  CB  THR B  39      28.515  98.225 121.527  1.00  0.78           C  
ATOM   6732  OG1 THR B  39      27.288  98.376 120.831  1.00  0.78           O  
ATOM   6733  CG2 THR B  39      29.063  96.860 121.092  1.00  0.78           C  
ATOM   6734  N   LEU B  40      30.275  99.259 124.006  1.00  0.80           N  
ATOM   6735  CA  LEU B  40      31.568  99.202 124.680  1.00  0.80           C  
ATOM   6736  C   LEU B  40      31.475  99.487 126.171  1.00  0.80           C  
ATOM   6737  O   LEU B  40      32.374  99.094 126.916  1.00  0.80           O  
ATOM   6738  CB  LEU B  40      32.614 100.178 124.068  1.00  0.80           C  
ATOM   6739  CG  LEU B  40      33.287  99.730 122.749  1.00  0.80           C  
ATOM   6740  CD1 LEU B  40      34.019  98.390 122.921  1.00  0.80           C  
ATOM   6741  CD2 LEU B  40      32.337  99.690 121.545  1.00  0.80           C  
ATOM   6742  N   VAL B  41      30.374 100.113 126.643  1.00  0.80           N  
ATOM   6743  CA  VAL B  41      30.119 100.448 128.044  1.00  0.80           C  
ATOM   6744  C   VAL B  41      31.125 101.466 128.584  1.00  0.80           C  
ATOM   6745  O   VAL B  41      31.735 101.309 129.644  1.00  0.80           O  
ATOM   6746  CB  VAL B  41      29.908  99.237 128.962  1.00  0.80           C  
ATOM   6747  CG1 VAL B  41      29.169  99.647 130.255  1.00  0.80           C  
ATOM   6748  CG2 VAL B  41      29.072  98.158 128.238  1.00  0.80           C  
ATOM   6749  N   LYS B  42      31.337 102.558 127.821  1.00  0.78           N  
ATOM   6750  CA  LYS B  42      32.349 103.555 128.117  1.00  0.78           C  
ATOM   6751  C   LYS B  42      31.850 104.959 127.818  1.00  0.78           C  
ATOM   6752  O   LYS B  42      31.026 105.180 126.933  1.00  0.78           O  
ATOM   6753  CB  LYS B  42      33.613 103.363 127.225  1.00  0.78           C  
ATOM   6754  CG  LYS B  42      34.452 102.106 127.505  1.00  0.78           C  
ATOM   6755  CD  LYS B  42      35.135 102.172 128.875  1.00  0.78           C  
ATOM   6756  CE  LYS B  42      36.054 100.988 129.186  1.00  0.78           C  
ATOM   6757  NZ  LYS B  42      37.386 101.097 128.553  1.00  0.78           N  
ATOM   6758  N   ASP B  43      32.399 105.961 128.534  1.00  0.79           N  
ATOM   6759  CA  ASP B  43      32.273 107.360 128.194  1.00  0.79           C  
ATOM   6760  C   ASP B  43      33.542 107.826 127.474  1.00  0.79           C  
ATOM   6761  O   ASP B  43      34.375 107.031 127.050  1.00  0.79           O  
ATOM   6762  CB  ASP B  43      31.958 108.204 129.458  1.00  0.79           C  
ATOM   6763  CG  ASP B  43      33.071 108.211 130.491  1.00  0.79           C  
ATOM   6764  OD1 ASP B  43      34.146 107.592 130.276  1.00  0.79           O  
ATOM   6765  OD2 ASP B  43      32.871 108.916 131.501  1.00  0.79           O  
ATOM   6766  N   ARG B  44      33.754 109.144 127.306  1.00  0.76           N  
ATOM   6767  CA  ARG B  44      34.994 109.639 126.731  1.00  0.76           C  
ATOM   6768  C   ARG B  44      36.130 109.742 127.740  1.00  0.76           C  
ATOM   6769  O   ARG B  44      37.282 109.891 127.340  1.00  0.76           O  
ATOM   6770  CB  ARG B  44      34.797 111.022 126.054  1.00  0.76           C  
ATOM   6771  CG  ARG B  44      33.888 110.991 124.802  1.00  0.76           C  
ATOM   6772  CD  ARG B  44      34.396 110.151 123.616  1.00  0.76           C  
ATOM   6773  NE  ARG B  44      35.728 110.674 123.172  1.00  0.76           N  
ATOM   6774  CZ  ARG B  44      35.929 111.610 122.236  1.00  0.76           C  
ATOM   6775  NH1 ARG B  44      34.934 112.204 121.588  1.00  0.76           N  
ATOM   6776  NH2 ARG B  44      37.168 111.976 121.925  1.00  0.76           N  
ATOM   6777  N   ASN B  45      35.841 109.656 129.055  1.00  0.68           N  
ATOM   6778  CA  ASN B  45      36.833 109.769 130.108  1.00  0.68           C  
ATOM   6779  C   ASN B  45      37.726 108.536 130.211  1.00  0.68           C  
ATOM   6780  O   ASN B  45      38.940 108.651 130.364  1.00  0.68           O  
ATOM   6781  CB  ASN B  45      36.151 109.997 131.484  1.00  0.68           C  
ATOM   6782  CG  ASN B  45      35.342 111.292 131.486  1.00  0.68           C  
ATOM   6783  OD1 ASN B  45      35.820 112.356 131.095  1.00  0.68           O  
ATOM   6784  ND2 ASN B  45      34.082 111.228 131.959  1.00  0.68           N  
ATOM   6785  N   VAL B  46      37.144 107.317 130.140  1.00  0.73           N  
ATOM   6786  CA  VAL B  46      37.902 106.078 130.344  1.00  0.73           C  
ATOM   6787  C   VAL B  46      37.872 105.120 129.147  1.00  0.73           C  
ATOM   6788  O   VAL B  46      38.214 103.934 129.246  1.00  0.73           O  
ATOM   6789  CB  VAL B  46      37.469 105.345 131.615  1.00  0.73           C  
ATOM   6790  CG1 VAL B  46      37.760 106.235 132.842  1.00  0.73           C  
ATOM   6791  CG2 VAL B  46      35.971 104.995 131.566  1.00  0.73           C  
ATOM   6792  N   ALA B  47      37.457 105.597 127.958  1.00  0.84           N  
ATOM   6793  CA  ALA B  47      37.598 104.861 126.712  1.00  0.84           C  
ATOM   6794  C   ALA B  47      39.037 104.747 126.204  1.00  0.84           C  
ATOM   6795  O   ALA B  47      39.809 105.703 126.209  1.00  0.84           O  
ATOM   6796  CB  ALA B  47      36.744 105.494 125.606  1.00  0.84           C  
ATOM   6797  N   THR B  48      39.419 103.551 125.717  1.00  0.83           N  
ATOM   6798  CA  THR B  48      40.730 103.267 125.153  1.00  0.83           C  
ATOM   6799  C   THR B  48      40.738 103.465 123.633  1.00  0.83           C  
ATOM   6800  O   THR B  48      39.666 103.534 123.025  1.00  0.83           O  
ATOM   6801  CB  THR B  48      41.275 101.876 125.525  1.00  0.83           C  
ATOM   6802  OG1 THR B  48      40.586 100.809 124.892  1.00  0.83           O  
ATOM   6803  CG2 THR B  48      41.140 101.588 127.015  1.00  0.83           C  
ATOM   6804  N   PRO B  49      41.887 103.543 122.929  1.00  0.89           N  
ATOM   6805  CA  PRO B  49      41.928 103.535 121.462  1.00  0.89           C  
ATOM   6806  C   PRO B  49      41.277 102.298 120.874  1.00  0.89           C  
ATOM   6807  O   PRO B  49      40.727 102.343 119.776  1.00  0.89           O  
ATOM   6808  CB  PRO B  49      43.424 103.628 121.109  1.00  0.89           C  
ATOM   6809  CG  PRO B  49      44.062 104.334 122.311  1.00  0.89           C  
ATOM   6810  CD  PRO B  49      43.176 103.946 123.502  1.00  0.89           C  
ATOM   6811  N   ARG B  50      41.324 101.171 121.609  1.00  0.82           N  
ATOM   6812  CA  ARG B  50      40.672  99.938 121.240  1.00  0.82           C  
ATOM   6813  C   ARG B  50      39.153 100.031 121.310  1.00  0.82           C  
ATOM   6814  O   ARG B  50      38.462  99.574 120.400  1.00  0.82           O  
ATOM   6815  CB  ARG B  50      41.260  98.770 122.068  1.00  0.82           C  
ATOM   6816  CG  ARG B  50      40.758  97.380 121.636  1.00  0.82           C  
ATOM   6817  CD  ARG B  50      41.538  96.208 122.247  1.00  0.82           C  
ATOM   6818  NE  ARG B  50      42.838  96.086 121.498  1.00  0.82           N  
ATOM   6819  CZ  ARG B  50      44.067  96.162 122.027  1.00  0.82           C  
ATOM   6820  NH1 ARG B  50      44.266  96.460 123.307  1.00  0.82           N  
ATOM   6821  NH2 ARG B  50      45.121  95.944 121.241  1.00  0.82           N  
ATOM   6822  N   ASP B  51      38.596 100.692 122.350  1.00  0.86           N  
ATOM   6823  CA  ASP B  51      37.174 100.993 122.447  1.00  0.86           C  
ATOM   6824  C   ASP B  51      36.694 101.877 121.290  1.00  0.86           C  
ATOM   6825  O   ASP B  51      35.660 101.624 120.671  1.00  0.86           O  
ATOM   6826  CB  ASP B  51      36.824 101.700 123.787  1.00  0.86           C  
ATOM   6827  CG  ASP B  51      37.176 100.848 124.990  1.00  0.86           C  
ATOM   6828  OD1 ASP B  51      36.772  99.665 125.042  1.00  0.86           O  
ATOM   6829  OD2 ASP B  51      37.859 101.368 125.917  1.00  0.86           O  
ATOM   6830  N   TYR B  52      37.478 102.919 120.935  1.00  0.89           N  
ATOM   6831  CA  TYR B  52      37.225 103.775 119.785  1.00  0.89           C  
ATOM   6832  C   TYR B  52      37.280 103.046 118.442  1.00  0.89           C  
ATOM   6833  O   TYR B  52      36.427 103.266 117.582  1.00  0.89           O  
ATOM   6834  CB  TYR B  52      38.207 104.981 119.742  1.00  0.89           C  
ATOM   6835  CG  TYR B  52      38.067 105.931 120.911  1.00  0.89           C  
ATOM   6836  CD1 TYR B  52      36.809 106.317 121.413  1.00  0.89           C  
ATOM   6837  CD2 TYR B  52      39.218 106.512 121.476  1.00  0.89           C  
ATOM   6838  CE1 TYR B  52      36.710 107.247 122.457  1.00  0.89           C  
ATOM   6839  CE2 TYR B  52      39.122 107.424 122.539  1.00  0.89           C  
ATOM   6840  CZ  TYR B  52      37.864 107.798 123.024  1.00  0.89           C  
ATOM   6841  OH  TYR B  52      37.742 108.739 124.072  1.00  0.89           O  
ATOM   6842  N   TYR B  53      38.253 102.129 118.225  1.00  0.90           N  
ATOM   6843  CA  TYR B  53      38.278 101.262 117.050  1.00  0.90           C  
ATOM   6844  C   TYR B  53      37.008 100.411 116.936  1.00  0.90           C  
ATOM   6845  O   TYR B  53      36.375 100.374 115.883  1.00  0.90           O  
ATOM   6846  CB  TYR B  53      39.558 100.348 117.059  1.00  0.90           C  
ATOM   6847  CG  TYR B  53      39.453  99.179 116.093  1.00  0.90           C  
ATOM   6848  CD1 TYR B  53      39.439  99.400 114.705  1.00  0.90           C  
ATOM   6849  CD2 TYR B  53      39.136  97.895 116.581  1.00  0.90           C  
ATOM   6850  CE1 TYR B  53      39.054  98.376 113.827  1.00  0.90           C  
ATOM   6851  CE2 TYR B  53      38.760  96.868 115.703  1.00  0.90           C  
ATOM   6852  CZ  TYR B  53      38.704  97.120 114.329  1.00  0.90           C  
ATOM   6853  OH  TYR B  53      38.262  96.124 113.443  1.00  0.90           O  
ATOM   6854  N   PHE B  54      36.584  99.737 118.024  1.00  0.89           N  
ATOM   6855  CA  PHE B  54      35.383  98.916 118.020  1.00  0.89           C  
ATOM   6856  C   PHE B  54      34.120  99.717 117.767  1.00  0.89           C  
ATOM   6857  O   PHE B  54      33.269  99.313 116.980  1.00  0.89           O  
ATOM   6858  CB  PHE B  54      35.217  98.143 119.349  1.00  0.89           C  
ATOM   6859  CG  PHE B  54      36.072  96.905 119.385  1.00  0.89           C  
ATOM   6860  CD1 PHE B  54      35.877  95.875 118.446  1.00  0.89           C  
ATOM   6861  CD2 PHE B  54      37.027  96.725 120.397  1.00  0.89           C  
ATOM   6862  CE1 PHE B  54      36.637  94.700 118.512  1.00  0.89           C  
ATOM   6863  CE2 PHE B  54      37.778  95.544 120.474  1.00  0.89           C  
ATOM   6864  CZ  PHE B  54      37.586  94.533 119.526  1.00  0.89           C  
ATOM   6865  N   ALA B  55      33.989 100.911 118.380  1.00  0.92           N  
ATOM   6866  CA  ALA B  55      32.872 101.799 118.141  1.00  0.92           C  
ATOM   6867  C   ALA B  55      32.752 102.216 116.674  1.00  0.92           C  
ATOM   6868  O   ALA B  55      31.674 102.167 116.092  1.00  0.92           O  
ATOM   6869  CB  ALA B  55      33.009 103.035 119.056  1.00  0.92           C  
ATOM   6870  N   LEU B  56      33.876 102.569 116.013  1.00  0.91           N  
ATOM   6871  CA  LEU B  56      33.908 102.825 114.581  1.00  0.91           C  
ATOM   6872  C   LEU B  56      33.632 101.592 113.724  1.00  0.91           C  
ATOM   6873  O   LEU B  56      32.881 101.655 112.752  1.00  0.91           O  
ATOM   6874  CB  LEU B  56      35.263 103.462 114.184  1.00  0.91           C  
ATOM   6875  CG  LEU B  56      35.411 103.889 112.706  1.00  0.91           C  
ATOM   6876  CD1 LEU B  56      34.341 104.898 112.257  1.00  0.91           C  
ATOM   6877  CD2 LEU B  56      36.810 104.477 112.483  1.00  0.91           C  
ATOM   6878  N   ALA B  57      34.206 100.424 114.068  1.00  0.94           N  
ATOM   6879  CA  ALA B  57      33.998  99.181 113.351  1.00  0.94           C  
ATOM   6880  C   ALA B  57      32.554  98.699 113.368  1.00  0.94           C  
ATOM   6881  O   ALA B  57      32.001  98.328 112.332  1.00  0.94           O  
ATOM   6882  CB  ALA B  57      34.933  98.097 113.917  1.00  0.94           C  
ATOM   6883  N   HIS B  58      31.875  98.756 114.533  1.00  0.86           N  
ATOM   6884  CA  HIS B  58      30.450  98.490 114.619  1.00  0.86           C  
ATOM   6885  C   HIS B  58      29.606  99.478 113.818  1.00  0.86           C  
ATOM   6886  O   HIS B  58      28.752  99.054 113.042  1.00  0.86           O  
ATOM   6887  CB  HIS B  58      29.968  98.432 116.086  1.00  0.86           C  
ATOM   6888  CG  HIS B  58      30.188  97.087 116.720  1.00  0.86           C  
ATOM   6889  ND1 HIS B  58      31.357  96.792 117.393  1.00  0.86           N  
ATOM   6890  CD2 HIS B  58      29.357  96.010 116.737  1.00  0.86           C  
ATOM   6891  CE1 HIS B  58      31.218  95.552 117.811  1.00  0.86           C  
ATOM   6892  NE2 HIS B  58      30.025  95.030 117.440  1.00  0.86           N  
ATOM   6893  N   THR B  59      29.890 100.801 113.896  1.00  0.88           N  
ATOM   6894  CA  THR B  59      29.215 101.834 113.097  1.00  0.88           C  
ATOM   6895  C   THR B  59      29.319 101.584 111.601  1.00  0.88           C  
ATOM   6896  O   THR B  59      28.334 101.628 110.871  1.00  0.88           O  
ATOM   6897  CB  THR B  59      29.801 103.232 113.337  1.00  0.88           C  
ATOM   6898  OG1 THR B  59      29.570 103.644 114.672  1.00  0.88           O  
ATOM   6899  CG2 THR B  59      29.143 104.305 112.457  1.00  0.88           C  
ATOM   6900  N   VAL B  60      30.525 101.266 111.085  1.00  0.90           N  
ATOM   6901  CA  VAL B  60      30.730 100.947 109.674  1.00  0.90           C  
ATOM   6902  C   VAL B  60      29.998  99.677 109.249  1.00  0.90           C  
ATOM   6903  O   VAL B  60      29.417  99.608 108.164  1.00  0.90           O  
ATOM   6904  CB  VAL B  60      32.216 100.880 109.313  1.00  0.90           C  
ATOM   6905  CG1 VAL B  60      32.427 100.465 107.841  1.00  0.90           C  
ATOM   6906  CG2 VAL B  60      32.839 102.273 109.525  1.00  0.90           C  
ATOM   6907  N   ARG B  61      29.982  98.632 110.102  1.00  0.84           N  
ATOM   6908  CA  ARG B  61      29.251  97.410 109.830  1.00  0.84           C  
ATOM   6909  C   ARG B  61      27.741  97.594 109.742  1.00  0.84           C  
ATOM   6910  O   ARG B  61      27.103  97.061 108.834  1.00  0.84           O  
ATOM   6911  CB  ARG B  61      29.570  96.336 110.889  1.00  0.84           C  
ATOM   6912  CG  ARG B  61      29.121  94.920 110.472  1.00  0.84           C  
ATOM   6913  CD  ARG B  61      29.219  93.907 111.610  1.00  0.84           C  
ATOM   6914  NE  ARG B  61      28.120  94.256 112.564  1.00  0.84           N  
ATOM   6915  CZ  ARG B  61      27.939  93.662 113.748  1.00  0.84           C  
ATOM   6916  NH1 ARG B  61      28.849  92.842 114.265  1.00  0.84           N  
ATOM   6917  NH2 ARG B  61      26.805  93.891 114.408  1.00  0.84           N  
ATOM   6918  N   ASP B  62      27.135  98.391 110.647  1.00  0.86           N  
ATOM   6919  CA  ASP B  62      25.713  98.690 110.659  1.00  0.86           C  
ATOM   6920  C   ASP B  62      25.237  99.290 109.332  1.00  0.86           C  
ATOM   6921  O   ASP B  62      24.215  98.897 108.766  1.00  0.86           O  
ATOM   6922  CB  ASP B  62      25.397  99.659 111.829  1.00  0.86           C  
ATOM   6923  CG  ASP B  62      25.353  98.955 113.179  1.00  0.86           C  
ATOM   6924  OD1 ASP B  62      25.544  97.711 113.244  1.00  0.86           O  
ATOM   6925  OD2 ASP B  62      25.081  99.676 114.177  1.00  0.86           O  
ATOM   6926  N   HIS B  63      26.027 100.199 108.739  1.00  0.81           N  
ATOM   6927  CA  HIS B  63      25.755 100.802 107.446  1.00  0.81           C  
ATOM   6928  C   HIS B  63      25.771  99.855 106.238  1.00  0.81           C  
ATOM   6929  O   HIS B  63      25.256 100.217 105.176  1.00  0.81           O  
ATOM   6930  CB  HIS B  63      26.731 101.973 107.175  1.00  0.81           C  
ATOM   6931  CG  HIS B  63      26.366 103.229 107.917  1.00  0.81           C  
ATOM   6932  ND1 HIS B  63      26.272 103.210 109.288  1.00  0.81           N  
ATOM   6933  CD2 HIS B  63      26.069 104.473 107.451  1.00  0.81           C  
ATOM   6934  CE1 HIS B  63      25.928 104.423 109.643  1.00  0.81           C  
ATOM   6935  NE2 HIS B  63      25.789 105.234 108.568  1.00  0.81           N  
ATOM   6936  N   LEU B  64      26.317  98.616 106.330  1.00  0.83           N  
ATOM   6937  CA  LEU B  64      26.156  97.637 105.255  1.00  0.83           C  
ATOM   6938  C   LEU B  64      25.077  96.597 105.511  1.00  0.83           C  
ATOM   6939  O   LEU B  64      24.739  95.837 104.604  1.00  0.83           O  
ATOM   6940  CB  LEU B  64      27.479  96.949 104.817  1.00  0.83           C  
ATOM   6941  CG  LEU B  64      28.336  96.208 105.866  1.00  0.83           C  
ATOM   6942  CD1 LEU B  64      27.690  94.922 106.405  1.00  0.83           C  
ATOM   6943  CD2 LEU B  64      29.682  95.848 105.221  1.00  0.83           C  
ATOM   6944  N   VAL B  65      24.438  96.568 106.703  1.00  0.83           N  
ATOM   6945  CA  VAL B  65      23.438  95.560 107.073  1.00  0.83           C  
ATOM   6946  C   VAL B  65      22.241  95.534 106.136  1.00  0.83           C  
ATOM   6947  O   VAL B  65      21.810  94.479 105.668  1.00  0.83           O  
ATOM   6948  CB  VAL B  65      22.948  95.776 108.507  1.00  0.83           C  
ATOM   6949  CG1 VAL B  65      21.707  94.930 108.854  1.00  0.83           C  
ATOM   6950  CG2 VAL B  65      24.079  95.402 109.481  1.00  0.83           C  
ATOM   6951  N   GLY B  66      21.700  96.717 105.772  1.00  0.82           N  
ATOM   6952  CA  GLY B  66      20.572  96.793 104.851  1.00  0.82           C  
ATOM   6953  C   GLY B  66      20.880  96.343 103.442  1.00  0.82           C  
ATOM   6954  O   GLY B  66      20.004  95.830 102.756  1.00  0.82           O  
ATOM   6955  N   ARG B  67      22.130  96.495 102.960  1.00  0.81           N  
ATOM   6956  CA  ARG B  67      22.533  95.941 101.675  1.00  0.81           C  
ATOM   6957  C   ARG B  67      22.875  94.465 101.751  1.00  0.81           C  
ATOM   6958  O   ARG B  67      22.558  93.735 100.821  1.00  0.81           O  
ATOM   6959  CB  ARG B  67      23.675  96.733 100.997  1.00  0.81           C  
ATOM   6960  CG  ARG B  67      23.178  98.057 100.373  1.00  0.81           C  
ATOM   6961  CD  ARG B  67      23.747  99.340 100.997  1.00  0.81           C  
ATOM   6962  NE  ARG B  67      24.982  99.724 100.236  1.00  0.81           N  
ATOM   6963  CZ  ARG B  67      25.822 100.702 100.603  1.00  0.81           C  
ATOM   6964  NH1 ARG B  67      25.808 101.232 101.822  1.00  0.81           N  
ATOM   6965  NH2 ARG B  67      26.701 101.161  99.712  1.00  0.81           N  
ATOM   6966  N   TRP B  68      23.452  93.970 102.865  1.00  0.88           N  
ATOM   6967  CA  TRP B  68      23.750  92.563 103.090  1.00  0.88           C  
ATOM   6968  C   TRP B  68      22.509  91.677 103.141  1.00  0.88           C  
ATOM   6969  O   TRP B  68      22.436  90.654 102.458  1.00  0.88           O  
ATOM   6970  CB  TRP B  68      24.610  92.398 104.381  1.00  0.88           C  
ATOM   6971  CG  TRP B  68      25.447  91.124 104.480  1.00  0.88           C  
ATOM   6972  CD1 TRP B  68      25.753  90.210 103.505  1.00  0.88           C  
ATOM   6973  CD2 TRP B  68      26.135  90.675 105.670  1.00  0.88           C  
ATOM   6974  NE1 TRP B  68      26.585  89.228 104.001  1.00  0.88           N  
ATOM   6975  CE2 TRP B  68      26.831  89.502 105.327  1.00  0.88           C  
ATOM   6976  CE3 TRP B  68      26.191  91.196 106.966  1.00  0.88           C  
ATOM   6977  CZ2 TRP B  68      27.604  88.822 106.260  1.00  0.88           C  
ATOM   6978  CZ3 TRP B  68      26.956  90.497 107.916  1.00  0.88           C  
ATOM   6979  CH2 TRP B  68      27.653  89.330 107.568  1.00  0.88           C  
ATOM   6980  N   ILE B  69      21.453  92.090 103.881  1.00  0.83           N  
ATOM   6981  CA  ILE B  69      20.172  91.383 103.887  1.00  0.83           C  
ATOM   6982  C   ILE B  69      19.526  91.382 102.501  1.00  0.83           C  
ATOM   6983  O   ILE B  69      19.107  90.343 101.995  1.00  0.83           O  
ATOM   6984  CB  ILE B  69      19.202  91.952 104.935  1.00  0.83           C  
ATOM   6985  CG1 ILE B  69      19.793  91.769 106.357  1.00  0.83           C  
ATOM   6986  CG2 ILE B  69      17.814  91.266 104.846  1.00  0.83           C  
ATOM   6987  CD1 ILE B  69      19.026  92.524 107.449  1.00  0.83           C  
ATOM   6988  N   ARG B  70      19.483  92.544 101.808  1.00  0.78           N  
ATOM   6989  CA  ARG B  70      18.906  92.656 100.471  1.00  0.78           C  
ATOM   6990  C   ARG B  70      19.627  91.847  99.398  1.00  0.78           C  
ATOM   6991  O   ARG B  70      18.990  91.193  98.577  1.00  0.78           O  
ATOM   6992  CB  ARG B  70      18.827  94.128  99.999  1.00  0.78           C  
ATOM   6993  CG  ARG B  70      17.764  94.971 100.737  1.00  0.78           C  
ATOM   6994  CD  ARG B  70      17.840  96.455 100.351  1.00  0.78           C  
ATOM   6995  NE  ARG B  70      16.855  97.218 101.188  1.00  0.78           N  
ATOM   6996  CZ  ARG B  70      16.693  98.547 101.118  1.00  0.78           C  
ATOM   6997  NH1 ARG B  70      17.353  99.286 100.231  1.00  0.78           N  
ATOM   6998  NH2 ARG B  70      15.855  99.154 101.956  1.00  0.78           N  
ATOM   6999  N   THR B  71      20.974  91.846  99.398  1.00  0.84           N  
ATOM   7000  CA  THR B  71      21.793  91.059  98.471  1.00  0.84           C  
ATOM   7001  C   THR B  71      21.510  89.577  98.590  1.00  0.84           C  
ATOM   7002  O   THR B  71      21.213  88.897  97.611  1.00  0.84           O  
ATOM   7003  CB  THR B  71      23.277  91.227  98.740  1.00  0.84           C  
ATOM   7004  OG1 THR B  71      23.579  92.591  98.683  1.00  0.84           O  
ATOM   7005  CG2 THR B  71      24.092  90.508  97.634  1.00  0.84           C  
ATOM   7006  N   GLN B  72      21.510  89.035  99.826  1.00  0.81           N  
ATOM   7007  CA  GLN B  72      21.200  87.631 100.061  1.00  0.81           C  
ATOM   7008  C   GLN B  72      19.742  87.263  99.761  1.00  0.81           C  
ATOM   7009  O   GLN B  72      19.473  86.225  99.156  1.00  0.81           O  
ATOM   7010  CB  GLN B  72      21.677  87.160 101.462  1.00  0.81           C  
ATOM   7011  CG  GLN B  72      23.194  87.405 101.705  1.00  0.81           C  
ATOM   7012  CD  GLN B  72      24.082  86.808 100.602  1.00  0.81           C  
ATOM   7013  OE1 GLN B  72      23.946  85.649 100.191  1.00  0.81           O  
ATOM   7014  NE2 GLN B  72      25.025  87.635 100.088  1.00  0.81           N  
ATOM   7015  N   GLN B  73      18.771  88.137 100.108  1.00  0.75           N  
ATOM   7016  CA  GLN B  73      17.354  88.015  99.774  1.00  0.75           C  
ATOM   7017  C   GLN B  73      17.094  87.953  98.271  1.00  0.75           C  
ATOM   7018  O   GLN B  73      16.378  87.080  97.795  1.00  0.75           O  
ATOM   7019  CB  GLN B  73      16.610  89.234 100.376  1.00  0.75           C  
ATOM   7020  CG  GLN B  73      15.060  89.207 100.318  1.00  0.75           C  
ATOM   7021  CD  GLN B  73      14.405  90.445 100.952  1.00  0.75           C  
ATOM   7022  OE1 GLN B  73      13.190  90.601 101.021  1.00  0.75           O  
ATOM   7023  NE2 GLN B  73      15.231  91.384 101.468  1.00  0.75           N  
ATOM   7024  N   HIS B  74      17.758  88.819  97.476  1.00  0.76           N  
ATOM   7025  CA  HIS B  74      17.712  88.824  96.016  1.00  0.76           C  
ATOM   7026  C   HIS B  74      18.183  87.513  95.400  1.00  0.76           C  
ATOM   7027  O   HIS B  74      17.566  86.964  94.485  1.00  0.76           O  
ATOM   7028  CB  HIS B  74      18.610  89.971  95.481  1.00  0.76           C  
ATOM   7029  CG  HIS B  74      18.722  90.081  93.987  1.00  0.76           C  
ATOM   7030  ND1 HIS B  74      17.627  90.462  93.239  1.00  0.76           N  
ATOM   7031  CD2 HIS B  74      19.804  89.909  93.180  1.00  0.76           C  
ATOM   7032  CE1 HIS B  74      18.059  90.522  91.997  1.00  0.76           C  
ATOM   7033  NE2 HIS B  74      19.369  90.195  91.904  1.00  0.76           N  
ATOM   7034  N   TYR B  75      19.281  86.935  95.929  1.00  0.82           N  
ATOM   7035  CA  TYR B  75      19.772  85.632  95.519  1.00  0.82           C  
ATOM   7036  C   TYR B  75      18.766  84.513  95.788  1.00  0.82           C  
ATOM   7037  O   TYR B  75      18.625  83.596  94.988  1.00  0.82           O  
ATOM   7038  CB  TYR B  75      21.143  85.305  96.187  1.00  0.82           C  
ATOM   7039  CG  TYR B  75      22.261  86.271  95.833  1.00  0.82           C  
ATOM   7040  CD1 TYR B  75      22.242  87.115  94.700  1.00  0.82           C  
ATOM   7041  CD2 TYR B  75      23.392  86.313  96.672  1.00  0.82           C  
ATOM   7042  CE1 TYR B  75      23.307  87.991  94.440  1.00  0.82           C  
ATOM   7043  CE2 TYR B  75      24.465  87.172  96.400  1.00  0.82           C  
ATOM   7044  CZ  TYR B  75      24.412  88.021  95.292  1.00  0.82           C  
ATOM   7045  OH  TYR B  75      25.467  88.914  95.029  1.00  0.82           O  
ATOM   7046  N   TYR B  76      18.038  84.549  96.921  1.00  0.82           N  
ATOM   7047  CA  TYR B  76      16.924  83.648  97.203  1.00  0.82           C  
ATOM   7048  C   TYR B  76      15.713  83.874  96.285  1.00  0.82           C  
ATOM   7049  O   TYR B  76      15.078  82.945  95.794  1.00  0.82           O  
ATOM   7050  CB  TYR B  76      16.539  83.807  98.708  1.00  0.82           C  
ATOM   7051  CG  TYR B  76      15.375  82.949  99.142  1.00  0.82           C  
ATOM   7052  CD1 TYR B  76      15.456  81.548  99.092  1.00  0.82           C  
ATOM   7053  CD2 TYR B  76      14.183  83.547  99.594  1.00  0.82           C  
ATOM   7054  CE1 TYR B  76      14.362  80.766  99.485  1.00  0.82           C  
ATOM   7055  CE2 TYR B  76      13.091  82.759  99.991  1.00  0.82           C  
ATOM   7056  CZ  TYR B  76      13.183  81.366  99.935  1.00  0.82           C  
ATOM   7057  OH  TYR B  76      12.090  80.572 100.333  1.00  0.82           O  
ATOM   7058  N   GLU B  77      15.331  85.135  96.031  1.00  0.76           N  
ATOM   7059  CA  GLU B  77      14.176  85.453  95.224  1.00  0.76           C  
ATOM   7060  C   GLU B  77      14.304  85.116  93.750  1.00  0.76           C  
ATOM   7061  O   GLU B  77      13.366  84.588  93.148  1.00  0.76           O  
ATOM   7062  CB  GLU B  77      13.814  86.943  95.349  1.00  0.76           C  
ATOM   7063  CG  GLU B  77      13.183  87.289  96.714  1.00  0.76           C  
ATOM   7064  CD  GLU B  77      12.643  88.715  96.755  1.00  0.76           C  
ATOM   7065  OE1 GLU B  77      12.824  89.453  95.753  1.00  0.76           O  
ATOM   7066  OE2 GLU B  77      11.995  89.036  97.779  1.00  0.76           O  
ATOM   7067  N   LYS B  78      15.445  85.428  93.122  1.00  0.77           N  
ATOM   7068  CA  LYS B  78      15.599  85.305  91.683  1.00  0.77           C  
ATOM   7069  C   LYS B  78      16.441  84.106  91.264  1.00  0.77           C  
ATOM   7070  O   LYS B  78      16.564  83.849  90.068  1.00  0.77           O  
ATOM   7071  CB  LYS B  78      16.267  86.599  91.134  1.00  0.77           C  
ATOM   7072  CG  LYS B  78      15.406  87.876  91.237  1.00  0.77           C  
ATOM   7073  CD  LYS B  78      14.169  87.853  90.319  1.00  0.77           C  
ATOM   7074  CE  LYS B  78      13.293  89.105  90.445  1.00  0.77           C  
ATOM   7075  NZ  LYS B  78      12.109  88.981  89.562  1.00  0.77           N  
ATOM   7076  N   ASP B  79      17.022  83.350  92.224  1.00  0.85           N  
ATOM   7077  CA  ASP B  79      17.929  82.217  92.031  1.00  0.85           C  
ATOM   7078  C   ASP B  79      18.867  82.220  90.806  1.00  0.85           C  
ATOM   7079  O   ASP B  79      18.776  81.337  89.930  1.00  0.85           O  
ATOM   7080  CB  ASP B  79      17.176  80.873  92.185  1.00  0.85           C  
ATOM   7081  CG  ASP B  79      17.067  80.470  93.632  1.00  0.85           C  
ATOM   7082  OD1 ASP B  79      18.136  80.393  94.274  1.00  0.85           O  
ATOM   7083  OD2 ASP B  79      15.950  80.174  94.113  1.00  0.85           O  
ATOM   7084  N   PRO B  80      19.804  83.185  90.725  1.00  0.88           N  
ATOM   7085  CA  PRO B  80      20.905  83.142  89.777  1.00  0.88           C  
ATOM   7086  C   PRO B  80      21.848  82.001  90.092  1.00  0.88           C  
ATOM   7087  O   PRO B  80      21.841  81.462  91.200  1.00  0.88           O  
ATOM   7088  CB  PRO B  80      21.600  84.502  89.973  1.00  0.88           C  
ATOM   7089  CG  PRO B  80      21.429  84.781  91.466  1.00  0.88           C  
ATOM   7090  CD  PRO B  80      20.036  84.215  91.753  1.00  0.88           C  
ATOM   7091  N   LYS B  81      22.679  81.596  89.121  1.00  0.87           N  
ATOM   7092  CA  LYS B  81      23.709  80.617  89.381  1.00  0.87           C  
ATOM   7093  C   LYS B  81      24.764  81.122  90.370  1.00  0.87           C  
ATOM   7094  O   LYS B  81      25.309  82.216  90.233  1.00  0.87           O  
ATOM   7095  CB  LYS B  81      24.333  80.128  88.058  1.00  0.87           C  
ATOM   7096  CG  LYS B  81      25.403  79.055  88.268  1.00  0.87           C  
ATOM   7097  CD  LYS B  81      25.912  78.429  86.968  1.00  0.87           C  
ATOM   7098  CE  LYS B  81      26.847  77.267  87.295  1.00  0.87           C  
ATOM   7099  NZ  LYS B  81      27.332  76.607  86.070  1.00  0.87           N  
ATOM   7100  N   ARG B  82      25.036  80.324  91.420  1.00  0.87           N  
ATOM   7101  CA  ARG B  82      25.872  80.710  92.536  1.00  0.87           C  
ATOM   7102  C   ARG B  82      27.301  80.201  92.382  1.00  0.87           C  
ATOM   7103  O   ARG B  82      27.554  79.107  91.878  1.00  0.87           O  
ATOM   7104  CB  ARG B  82      25.280  80.190  93.876  1.00  0.87           C  
ATOM   7105  CG  ARG B  82      23.965  80.879  94.317  1.00  0.87           C  
ATOM   7106  CD  ARG B  82      23.334  80.203  95.541  1.00  0.87           C  
ATOM   7107  NE  ARG B  82      22.375  81.142  96.208  1.00  0.87           N  
ATOM   7108  CZ  ARG B  82      21.052  81.104  96.028  1.00  0.87           C  
ATOM   7109  NH1 ARG B  82      20.521  80.340  95.094  1.00  0.87           N  
ATOM   7110  NH2 ARG B  82      20.247  81.829  96.798  1.00  0.87           N  
ATOM   7111  N   ILE B  83      28.277  81.010  92.836  1.00  0.95           N  
ATOM   7112  CA  ILE B  83      29.700  80.727  92.734  1.00  0.95           C  
ATOM   7113  C   ILE B  83      30.237  80.479  94.122  1.00  0.95           C  
ATOM   7114  O   ILE B  83      30.154  81.316  95.018  1.00  0.95           O  
ATOM   7115  CB  ILE B  83      30.520  81.861  92.109  1.00  0.95           C  
ATOM   7116  CG1 ILE B  83      30.015  82.237  90.695  1.00  0.95           C  
ATOM   7117  CG2 ILE B  83      32.022  81.475  92.052  1.00  0.95           C  
ATOM   7118  CD1 ILE B  83      28.909  83.303  90.694  1.00  0.95           C  
ATOM   7119  N   TYR B  84      30.825  79.302  94.346  1.00  0.96           N  
ATOM   7120  CA  TYR B  84      31.361  78.944  95.632  1.00  0.96           C  
ATOM   7121  C   TYR B  84      32.857  78.833  95.501  1.00  0.96           C  
ATOM   7122  O   TYR B  84      33.396  77.933  94.858  1.00  0.96           O  
ATOM   7123  CB  TYR B  84      30.761  77.607  96.109  1.00  0.96           C  
ATOM   7124  CG  TYR B  84      29.281  77.783  96.321  1.00  0.96           C  
ATOM   7125  CD1 TYR B  84      28.829  78.501  97.430  1.00  0.96           C  
ATOM   7126  CD2 TYR B  84      28.335  77.251  95.434  1.00  0.96           C  
ATOM   7127  CE1 TYR B  84      27.461  78.624  97.707  1.00  0.96           C  
ATOM   7128  CE2 TYR B  84      26.960  77.351  95.712  1.00  0.96           C  
ATOM   7129  CZ  TYR B  84      26.527  77.998  96.879  1.00  0.96           C  
ATOM   7130  OH  TYR B  84      25.172  77.954  97.279  1.00  0.96           O  
ATOM   7131  N   TYR B  85      33.582  79.778  96.120  1.00  0.97           N  
ATOM   7132  CA  TYR B  85      35.025  79.772  96.092  1.00  0.97           C  
ATOM   7133  C   TYR B  85      35.505  79.040  97.329  1.00  0.97           C  
ATOM   7134  O   TYR B  85      35.455  79.550  98.449  1.00  0.97           O  
ATOM   7135  CB  TYR B  85      35.585  81.214  96.010  1.00  0.97           C  
ATOM   7136  CG  TYR B  85      36.969  81.184  95.422  1.00  0.97           C  
ATOM   7137  CD1 TYR B  85      37.142  81.129  94.026  1.00  0.97           C  
ATOM   7138  CD2 TYR B  85      38.101  81.168  96.254  1.00  0.97           C  
ATOM   7139  CE1 TYR B  85      38.429  81.071  93.473  1.00  0.97           C  
ATOM   7140  CE2 TYR B  85      39.387  81.125  95.699  1.00  0.97           C  
ATOM   7141  CZ  TYR B  85      39.548  81.080  94.310  1.00  0.97           C  
ATOM   7142  OH  TYR B  85      40.839  81.069  93.752  1.00  0.97           O  
ATOM   7143  N   LEU B  86      35.945  77.786  97.142  1.00  0.97           N  
ATOM   7144  CA  LEU B  86      36.278  76.892  98.224  1.00  0.97           C  
ATOM   7145  C   LEU B  86      37.783  76.870  98.409  1.00  0.97           C  
ATOM   7146  O   LEU B  86      38.553  76.508  97.517  1.00  0.97           O  
ATOM   7147  CB  LEU B  86      35.695  75.486  97.933  1.00  0.97           C  
ATOM   7148  CG  LEU B  86      35.964  74.397  98.995  1.00  0.97           C  
ATOM   7149  CD1 LEU B  86      35.575  74.811 100.422  1.00  0.97           C  
ATOM   7150  CD2 LEU B  86      35.237  73.096  98.617  1.00  0.97           C  
ATOM   7151  N   SER B  87      38.244  77.307  99.593  1.00  0.97           N  
ATOM   7152  CA  SER B  87      39.660  77.471  99.846  1.00  0.97           C  
ATOM   7153  C   SER B  87      39.990  77.156 101.281  1.00  0.97           C  
ATOM   7154  O   SER B  87      39.161  77.218 102.183  1.00  0.97           O  
ATOM   7155  CB  SER B  87      40.149  78.915  99.542  1.00  0.97           C  
ATOM   7156  OG  SER B  87      41.570  79.024  99.657  1.00  0.97           O  
ATOM   7157  N   LEU B  88      41.264  76.823 101.525  1.00  0.96           N  
ATOM   7158  CA  LEU B  88      41.801  76.635 102.849  1.00  0.96           C  
ATOM   7159  C   LEU B  88      42.454  77.935 103.308  1.00  0.96           C  
ATOM   7160  O   LEU B  88      42.903  78.030 104.449  1.00  0.96           O  
ATOM   7161  CB  LEU B  88      42.869  75.506 102.829  1.00  0.96           C  
ATOM   7162  CG  LEU B  88      42.331  74.064 103.015  1.00  0.96           C  
ATOM   7163  CD1 LEU B  88      41.871  73.813 104.459  1.00  0.96           C  
ATOM   7164  CD2 LEU B  88      41.224  73.665 102.025  1.00  0.96           C  
ATOM   7165  N   GLU B  89      42.497  78.974 102.445  1.00  0.94           N  
ATOM   7166  CA  GLU B  89      43.141  80.236 102.748  1.00  0.94           C  
ATOM   7167  C   GLU B  89      42.377  81.453 102.228  1.00  0.94           C  
ATOM   7168  O   GLU B  89      41.975  81.535 101.070  1.00  0.94           O  
ATOM   7169  CB  GLU B  89      44.552  80.321 102.118  1.00  0.94           C  
ATOM   7170  CG  GLU B  89      45.586  79.327 102.688  1.00  0.94           C  
ATOM   7171  CD  GLU B  89      46.993  79.591 102.171  1.00  0.94           C  
ATOM   7172  OE1 GLU B  89      47.845  78.688 102.359  1.00  0.94           O  
ATOM   7173  OE2 GLU B  89      47.274  80.712 101.662  1.00  0.94           O  
ATOM   7174  N   PHE B  90      42.216  82.471 103.094  1.00  0.94           N  
ATOM   7175  CA  PHE B  90      41.654  83.766 102.755  1.00  0.94           C  
ATOM   7176  C   PHE B  90      42.492  84.839 103.432  1.00  0.94           C  
ATOM   7177  O   PHE B  90      42.286  85.202 104.587  1.00  0.94           O  
ATOM   7178  CB  PHE B  90      40.181  83.909 103.232  1.00  0.94           C  
ATOM   7179  CG  PHE B  90      39.259  83.171 102.304  1.00  0.94           C  
ATOM   7180  CD1 PHE B  90      38.837  81.863 102.589  1.00  0.94           C  
ATOM   7181  CD2 PHE B  90      38.817  83.788 101.121  1.00  0.94           C  
ATOM   7182  CE1 PHE B  90      37.996  81.181 101.701  1.00  0.94           C  
ATOM   7183  CE2 PHE B  90      37.977  83.106 100.230  1.00  0.94           C  
ATOM   7184  CZ  PHE B  90      37.569  81.799 100.519  1.00  0.94           C  
ATOM   7185  N   TYR B  91      43.476  85.410 102.714  1.00  0.92           N  
ATOM   7186  CA  TYR B  91      44.436  86.358 103.259  1.00  0.92           C  
ATOM   7187  C   TYR B  91      43.892  87.777 103.171  1.00  0.92           C  
ATOM   7188  O   TYR B  91      44.368  88.639 102.427  1.00  0.92           O  
ATOM   7189  CB  TYR B  91      45.782  86.198 102.502  1.00  0.92           C  
ATOM   7190  CG  TYR B  91      47.046  86.562 103.243  1.00  0.92           C  
ATOM   7191  CD1 TYR B  91      47.122  86.884 104.614  1.00  0.92           C  
ATOM   7192  CD2 TYR B  91      48.241  86.478 102.510  1.00  0.92           C  
ATOM   7193  CE1 TYR B  91      48.368  87.093 105.228  1.00  0.92           C  
ATOM   7194  CE2 TYR B  91      49.484  86.675 103.121  1.00  0.92           C  
ATOM   7195  CZ  TYR B  91      49.546  86.971 104.485  1.00  0.92           C  
ATOM   7196  OH  TYR B  91      50.803  87.113 105.102  1.00  0.92           O  
ATOM   7197  N   MET B  92      42.800  88.027 103.907  1.00  0.92           N  
ATOM   7198  CA  MET B  92      42.009  89.234 103.831  1.00  0.92           C  
ATOM   7199  C   MET B  92      42.755  90.489 104.252  1.00  0.92           C  
ATOM   7200  O   MET B  92      42.699  91.495 103.546  1.00  0.92           O  
ATOM   7201  CB  MET B  92      40.712  89.082 104.662  1.00  0.92           C  
ATOM   7202  CG  MET B  92      39.836  87.889 104.226  1.00  0.92           C  
ATOM   7203  SD  MET B  92      39.250  87.979 102.507  1.00  0.92           S  
ATOM   7204  CE  MET B  92      37.846  89.095 102.786  1.00  0.92           C  
ATOM   7205  N   GLY B  93      43.515  90.446 105.369  1.00  0.96           N  
ATOM   7206  CA  GLY B  93      44.106  91.632 105.988  1.00  0.96           C  
ATOM   7207  C   GLY B  93      43.106  92.364 106.844  1.00  0.96           C  
ATOM   7208  O   GLY B  93      42.146  91.779 107.335  1.00  0.96           O  
ATOM   7209  N   ARG B  94      43.320  93.667 107.079  1.00  0.90           N  
ATOM   7210  CA  ARG B  94      42.367  94.520 107.777  1.00  0.90           C  
ATOM   7211  C   ARG B  94      41.157  94.868 106.915  1.00  0.90           C  
ATOM   7212  O   ARG B  94      41.294  95.049 105.705  1.00  0.90           O  
ATOM   7213  CB  ARG B  94      43.054  95.828 108.198  1.00  0.90           C  
ATOM   7214  CG  ARG B  94      44.160  95.616 109.239  1.00  0.90           C  
ATOM   7215  CD  ARG B  94      44.810  96.946 109.567  1.00  0.90           C  
ATOM   7216  NE  ARG B  94      45.837  96.690 110.597  1.00  0.90           N  
ATOM   7217  CZ  ARG B  94      46.860  97.502 110.801  1.00  0.90           C  
ATOM   7218  NH1 ARG B  94      47.093  98.520 109.977  1.00  0.90           N  
ATOM   7219  NH2 ARG B  94      47.622  97.364 111.878  1.00  0.90           N  
ATOM   7220  N   THR B  95      39.939  94.987 107.485  1.00  0.95           N  
ATOM   7221  CA  THR B  95      38.726  95.261 106.707  1.00  0.95           C  
ATOM   7222  C   THR B  95      38.169  96.654 106.940  1.00  0.95           C  
ATOM   7223  O   THR B  95      37.430  97.133 106.077  1.00  0.95           O  
ATOM   7224  CB  THR B  95      37.620  94.166 106.794  1.00  0.95           C  
ATOM   7225  OG1 THR B  95      36.304  94.622 107.101  1.00  0.95           O  
ATOM   7226  CG2 THR B  95      37.982  93.084 107.817  1.00  0.95           C  
ATOM   7227  N   LEU B  96      38.514  97.381 108.034  1.00  0.94           N  
ATOM   7228  CA  LEU B  96      37.848  98.644 108.359  1.00  0.94           C  
ATOM   7229  C   LEU B  96      37.900  99.692 107.255  1.00  0.94           C  
ATOM   7230  O   LEU B  96      36.866 100.115 106.738  1.00  0.94           O  
ATOM   7231  CB  LEU B  96      38.426  99.254 109.671  1.00  0.94           C  
ATOM   7232  CG  LEU B  96      37.861 100.634 110.094  1.00  0.94           C  
ATOM   7233  CD1 LEU B  96      36.339 100.623 110.289  1.00  0.94           C  
ATOM   7234  CD2 LEU B  96      38.527 101.154 111.376  1.00  0.94           C  
ATOM   7235  N   GLN B  97      39.109 100.065 106.791  1.00  0.91           N  
ATOM   7236  CA  GLN B  97      39.271 101.042 105.728  1.00  0.91           C  
ATOM   7237  C   GLN B  97      38.690 100.579 104.393  1.00  0.91           C  
ATOM   7238  O   GLN B  97      38.005 101.313 103.686  1.00  0.91           O  
ATOM   7239  CB  GLN B  97      40.749 101.466 105.583  1.00  0.91           C  
ATOM   7240  CG  GLN B  97      40.882 102.847 104.898  1.00  0.91           C  
ATOM   7241  CD  GLN B  97      42.328 103.236 104.591  1.00  0.91           C  
ATOM   7242  OE1 GLN B  97      43.284 102.494 104.817  1.00  0.91           O  
ATOM   7243  NE2 GLN B  97      42.475 104.433 103.979  1.00  0.91           N  
ATOM   7244  N   ASN B  98      38.888  99.287 104.052  1.00  0.93           N  
ATOM   7245  CA  ASN B  98      38.398  98.655 102.835  1.00  0.93           C  
ATOM   7246  C   ASN B  98      36.874  98.684 102.732  1.00  0.93           C  
ATOM   7247  O   ASN B  98      36.311  99.055 101.704  1.00  0.93           O  
ATOM   7248  CB  ASN B  98      38.963  97.205 102.833  1.00  0.93           C  
ATOM   7249  CG  ASN B  98      38.826  96.392 101.547  1.00  0.93           C  
ATOM   7250  OD1 ASN B  98      38.664  95.175 101.621  1.00  0.93           O  
ATOM   7251  ND2 ASN B  98      38.986  97.002 100.358  1.00  0.93           N  
ATOM   7252  N   THR B  99      36.173  98.366 103.838  1.00  0.93           N  
ATOM   7253  CA  THR B  99      34.726  98.499 103.960  1.00  0.93           C  
ATOM   7254  C   THR B  99      34.267  99.946 103.834  1.00  0.93           C  
ATOM   7255  O   THR B  99      33.323 100.248 103.106  1.00  0.93           O  
ATOM   7256  CB  THR B  99      34.200  97.890 105.261  1.00  0.93           C  
ATOM   7257  OG1 THR B  99      34.498  96.501 105.325  1.00  0.93           O  
ATOM   7258  CG2 THR B  99      32.671  97.982 105.311  1.00  0.93           C  
ATOM   7259  N   MET B 100      34.949 100.919 104.480  1.00  0.88           N  
ATOM   7260  CA  MET B 100      34.605 102.329 104.337  1.00  0.88           C  
ATOM   7261  C   MET B 100      34.754 102.868 102.915  1.00  0.88           C  
ATOM   7262  O   MET B 100      33.867 103.561 102.417  1.00  0.88           O  
ATOM   7263  CB  MET B 100      35.419 103.227 105.299  1.00  0.88           C  
ATOM   7264  CG  MET B 100      35.090 102.984 106.782  1.00  0.88           C  
ATOM   7265  SD  MET B 100      35.821 104.180 107.940  1.00  0.88           S  
ATOM   7266  CE  MET B 100      37.565 103.907 107.531  1.00  0.88           C  
ATOM   7267  N   VAL B 101      35.852 102.537 102.206  1.00  0.89           N  
ATOM   7268  CA  VAL B 101      36.065 102.912 100.810  1.00  0.89           C  
ATOM   7269  C   VAL B 101      35.024 102.312  99.874  1.00  0.89           C  
ATOM   7270  O   VAL B 101      34.388 103.032  99.101  1.00  0.89           O  
ATOM   7271  CB  VAL B 101      37.462 102.491 100.349  1.00  0.89           C  
ATOM   7272  CG1 VAL B 101      37.687 102.697  98.835  1.00  0.89           C  
ATOM   7273  CG2 VAL B 101      38.499 103.330 101.106  1.00  0.89           C  
ATOM   7274  N   ASN B 102      34.765 100.986  99.964  1.00  0.88           N  
ATOM   7275  CA  ASN B 102      33.813 100.293  99.105  1.00  0.88           C  
ATOM   7276  C   ASN B 102      32.382 100.807  99.283  1.00  0.88           C  
ATOM   7277  O   ASN B 102      31.664 101.007  98.305  1.00  0.88           O  
ATOM   7278  CB  ASN B 102      33.898  98.744  99.275  1.00  0.88           C  
ATOM   7279  CG  ASN B 102      35.146  98.184  98.579  1.00  0.88           C  
ATOM   7280  OD1 ASN B 102      36.084  98.907  98.240  1.00  0.88           O  
ATOM   7281  ND2 ASN B 102      35.161  96.855  98.321  1.00  0.88           N  
ATOM   7282  N   LEU B 103      31.952 101.111 100.529  1.00  0.87           N  
ATOM   7283  CA  LEU B 103      30.627 101.646 100.803  1.00  0.87           C  
ATOM   7284  C   LEU B 103      30.448 103.111 100.416  1.00  0.87           C  
ATOM   7285  O   LEU B 103      29.305 103.556 100.328  1.00  0.87           O  
ATOM   7286  CB  LEU B 103      30.268 101.503 102.310  1.00  0.87           C  
ATOM   7287  CG  LEU B 103      30.109 100.049 102.808  1.00  0.87           C  
ATOM   7288  CD1 LEU B 103      29.803 100.047 104.314  1.00  0.87           C  
ATOM   7289  CD2 LEU B 103      29.033  99.258 102.048  1.00  0.87           C  
ATOM   7290  N   ALA B 104      31.557 103.858 100.184  1.00  0.85           N  
ATOM   7291  CA  ALA B 104      31.620 105.282  99.873  1.00  0.85           C  
ATOM   7292  C   ALA B 104      31.540 106.145 101.124  1.00  0.85           C  
ATOM   7293  O   ALA B 104      31.076 107.282 101.105  1.00  0.85           O  
ATOM   7294  CB  ALA B 104      30.623 105.746  98.787  1.00  0.85           C  
ATOM   7295  N   LEU B 105      32.014 105.611 102.261  1.00  0.84           N  
ATOM   7296  CA  LEU B 105      31.815 106.204 103.568  1.00  0.84           C  
ATOM   7297  C   LEU B 105      33.054 106.848 104.159  1.00  0.84           C  
ATOM   7298  O   LEU B 105      32.928 107.600 105.121  1.00  0.84           O  
ATOM   7299  CB  LEU B 105      31.311 105.101 104.542  1.00  0.84           C  
ATOM   7300  CG  LEU B 105      29.816 105.206 104.907  1.00  0.84           C  
ATOM   7301  CD1 LEU B 105      28.902 105.380 103.683  1.00  0.84           C  
ATOM   7302  CD2 LEU B 105      29.389 103.962 105.696  1.00  0.84           C  
ATOM   7303  N   GLU B 106      34.262 106.613 103.600  1.00  0.82           N  
ATOM   7304  CA  GLU B 106      35.538 107.051 104.167  1.00  0.82           C  
ATOM   7305  C   GLU B 106      35.619 108.548 104.468  1.00  0.82           C  
ATOM   7306  O   GLU B 106      35.739 108.931 105.624  1.00  0.82           O  
ATOM   7307  CB  GLU B 106      36.658 106.588 103.203  1.00  0.82           C  
ATOM   7308  CG  GLU B 106      38.121 106.820 103.662  1.00  0.82           C  
ATOM   7309  CD  GLU B 106      39.112 106.269 102.637  1.00  0.82           C  
ATOM   7310  OE1 GLU B 106      38.948 106.619 101.436  1.00  0.82           O  
ATOM   7311  OE2 GLU B 106      39.998 105.459 103.020  1.00  0.82           O  
ATOM   7312  N   ASN B 107      35.362 109.442 103.483  1.00  0.79           N  
ATOM   7313  CA  ASN B 107      35.343 110.889 103.703  1.00  0.79           C  
ATOM   7314  C   ASN B 107      34.398 111.354 104.818  1.00  0.79           C  
ATOM   7315  O   ASN B 107      34.719 112.240 105.606  1.00  0.79           O  
ATOM   7316  CB  ASN B 107      34.878 111.650 102.426  1.00  0.79           C  
ATOM   7317  CG  ASN B 107      35.868 111.495 101.280  1.00  0.79           C  
ATOM   7318  OD1 ASN B 107      37.082 111.525 101.436  1.00  0.79           O  
ATOM   7319  ND2 ASN B 107      35.333 111.365 100.044  1.00  0.79           N  
ATOM   7320  N   ALA B 108      33.187 110.770 104.914  1.00  0.85           N  
ATOM   7321  CA  ALA B 108      32.248 111.096 105.967  1.00  0.85           C  
ATOM   7322  C   ALA B 108      32.689 110.590 107.345  1.00  0.85           C  
ATOM   7323  O   ALA B 108      32.547 111.281 108.353  1.00  0.85           O  
ATOM   7324  CB  ALA B 108      30.847 110.579 105.579  1.00  0.85           C  
ATOM   7325  N   CYS B 109      33.249 109.365 107.413  1.00  0.86           N  
ATOM   7326  CA  CYS B 109      33.831 108.780 108.611  1.00  0.86           C  
ATOM   7327  C   CYS B 109      35.073 109.497 109.112  1.00  0.86           C  
ATOM   7328  O   CYS B 109      35.220 109.696 110.319  1.00  0.86           O  
ATOM   7329  CB  CYS B 109      34.156 107.281 108.417  1.00  0.86           C  
ATOM   7330  SG  CYS B 109      32.644 106.274 108.249  1.00  0.86           S  
ATOM   7331  N   ASP B 110      35.985 109.928 108.217  1.00  0.85           N  
ATOM   7332  CA  ASP B 110      37.174 110.699 108.543  1.00  0.85           C  
ATOM   7333  C   ASP B 110      36.823 111.968 109.289  1.00  0.85           C  
ATOM   7334  O   ASP B 110      37.318 112.249 110.382  1.00  0.85           O  
ATOM   7335  CB  ASP B 110      37.877 111.161 107.238  1.00  0.85           C  
ATOM   7336  CG  ASP B 110      38.635 110.041 106.555  1.00  0.85           C  
ATOM   7337  OD1 ASP B 110      39.418 110.376 105.633  1.00  0.85           O  
ATOM   7338  OD2 ASP B 110      38.447 108.871 106.945  1.00  0.85           O  
ATOM   7339  N   GLU B 111      35.872 112.721 108.712  1.00  0.81           N  
ATOM   7340  CA  GLU B 111      35.338 113.953 109.246  1.00  0.81           C  
ATOM   7341  C   GLU B 111      34.615 113.741 110.568  1.00  0.81           C  
ATOM   7342  O   GLU B 111      34.823 114.454 111.547  1.00  0.81           O  
ATOM   7343  CB  GLU B 111      34.441 114.607 108.170  1.00  0.81           C  
ATOM   7344  CG  GLU B 111      34.770 116.096 107.930  1.00  0.81           C  
ATOM   7345  CD  GLU B 111      34.123 116.985 108.968  1.00  0.81           C  
ATOM   7346  OE1 GLU B 111      32.884 117.165 108.867  1.00  0.81           O  
ATOM   7347  OE2 GLU B 111      34.824 117.501 109.872  1.00  0.81           O  
ATOM   7348  N   ALA B 112      33.807 112.666 110.676  1.00  0.89           N  
ATOM   7349  CA  ALA B 112      33.148 112.303 111.914  1.00  0.89           C  
ATOM   7350  C   ALA B 112      34.111 112.025 113.068  1.00  0.89           C  
ATOM   7351  O   ALA B 112      33.950 112.555 114.166  1.00  0.89           O  
ATOM   7352  CB  ALA B 112      32.261 111.064 111.670  1.00  0.89           C  
ATOM   7353  N   THR B 113      35.172 111.233 112.819  1.00  0.87           N  
ATOM   7354  CA  THR B 113      36.240 110.928 113.773  1.00  0.87           C  
ATOM   7355  C   THR B 113      37.058 112.156 114.140  1.00  0.87           C  
ATOM   7356  O   THR B 113      37.341 112.401 115.315  1.00  0.87           O  
ATOM   7357  CB  THR B 113      37.146 109.824 113.237  1.00  0.87           C  
ATOM   7358  OG1 THR B 113      36.398 108.623 113.113  1.00  0.87           O  
ATOM   7359  CG2 THR B 113      38.308 109.471 114.170  1.00  0.87           C  
ATOM   7360  N   TYR B 114      37.405 113.012 113.150  1.00  0.88           N  
ATOM   7361  CA  TYR B 114      38.102 114.276 113.358  1.00  0.88           C  
ATOM   7362  C   TYR B 114      37.318 115.227 114.270  1.00  0.88           C  
ATOM   7363  O   TYR B 114      37.851 115.777 115.234  1.00  0.88           O  
ATOM   7364  CB  TYR B 114      38.377 114.943 111.971  1.00  0.88           C  
ATOM   7365  CG  TYR B 114      39.019 116.307 112.084  1.00  0.88           C  
ATOM   7366  CD1 TYR B 114      40.378 116.443 112.416  1.00  0.88           C  
ATOM   7367  CD2 TYR B 114      38.236 117.465 111.918  1.00  0.88           C  
ATOM   7368  CE1 TYR B 114      40.942 117.716 112.594  1.00  0.88           C  
ATOM   7369  CE2 TYR B 114      38.795 118.737 112.106  1.00  0.88           C  
ATOM   7370  CZ  TYR B 114      40.147 118.859 112.446  1.00  0.88           C  
ATOM   7371  OH  TYR B 114      40.705 120.137 112.644  1.00  0.88           O  
ATOM   7372  N   GLN B 115      35.997 115.378 114.046  1.00  0.85           N  
ATOM   7373  CA  GLN B 115      35.141 116.243 114.839  1.00  0.85           C  
ATOM   7374  C   GLN B 115      34.856 115.706 116.236  1.00  0.85           C  
ATOM   7375  O   GLN B 115      34.242 116.382 117.062  1.00  0.85           O  
ATOM   7376  CB  GLN B 115      33.760 116.459 114.183  1.00  0.85           C  
ATOM   7377  CG  GLN B 115      33.751 117.274 112.872  1.00  0.85           C  
ATOM   7378  CD  GLN B 115      32.312 117.608 112.481  1.00  0.85           C  
ATOM   7379  OE1 GLN B 115      31.394 117.496 113.300  1.00  0.85           O  
ATOM   7380  NE2 GLN B 115      32.051 118.042 111.246  1.00  0.85           N  
ATOM   7381  N   LEU B 116      35.267 114.467 116.540  1.00  0.87           N  
ATOM   7382  CA  LEU B 116      35.196 113.911 117.873  1.00  0.87           C  
ATOM   7383  C   LEU B 116      36.538 114.037 118.576  1.00  0.87           C  
ATOM   7384  O   LEU B 116      36.674 113.636 119.735  1.00  0.87           O  
ATOM   7385  CB  LEU B 116      34.768 112.428 117.794  1.00  0.87           C  
ATOM   7386  CG  LEU B 116      33.281 112.261 117.424  1.00  0.87           C  
ATOM   7387  CD1 LEU B 116      33.023 110.844 116.906  1.00  0.87           C  
ATOM   7388  CD2 LEU B 116      32.347 112.581 118.602  1.00  0.87           C  
ATOM   7389  N   GLY B 117      37.548 114.640 117.910  1.00  0.88           N  
ATOM   7390  CA  GLY B 117      38.860 114.913 118.479  1.00  0.88           C  
ATOM   7391  C   GLY B 117      39.775 113.727 118.463  1.00  0.88           C  
ATOM   7392  O   GLY B 117      40.679 113.630 119.286  1.00  0.88           O  
ATOM   7393  N   LEU B 118      39.545 112.768 117.552  1.00  0.84           N  
ATOM   7394  CA  LEU B 118      40.296 111.530 117.514  1.00  0.84           C  
ATOM   7395  C   LEU B 118      41.079 111.406 116.222  1.00  0.84           C  
ATOM   7396  O   LEU B 118      40.693 111.937 115.183  1.00  0.84           O  
ATOM   7397  CB  LEU B 118      39.348 110.309 117.595  1.00  0.84           C  
ATOM   7398  CG  LEU B 118      38.502 110.217 118.876  1.00  0.84           C  
ATOM   7399  CD1 LEU B 118      37.551 109.016 118.778  1.00  0.84           C  
ATOM   7400  CD2 LEU B 118      39.386 110.100 120.124  1.00  0.84           C  
ATOM   7401  N   ASP B 119      42.206 110.667 116.251  1.00  0.82           N  
ATOM   7402  CA  ASP B 119      42.964 110.342 115.061  1.00  0.82           C  
ATOM   7403  C   ASP B 119      42.453 109.018 114.477  1.00  0.82           C  
ATOM   7404  O   ASP B 119      42.381 108.005 115.167  1.00  0.82           O  
ATOM   7405  CB  ASP B 119      44.475 110.271 115.403  1.00  0.82           C  
ATOM   7406  CG  ASP B 119      45.297 110.272 114.128  1.00  0.82           C  
ATOM   7407  OD1 ASP B 119      45.978 111.286 113.850  1.00  0.82           O  
ATOM   7408  OD2 ASP B 119      45.190 109.267 113.381  1.00  0.82           O  
ATOM   7409  N   MET B 120      42.052 108.989 113.185  1.00  0.81           N  
ATOM   7410  CA  MET B 120      41.640 107.763 112.508  1.00  0.81           C  
ATOM   7411  C   MET B 120      42.773 106.785 112.230  1.00  0.81           C  
ATOM   7412  O   MET B 120      42.569 105.580 112.378  1.00  0.81           O  
ATOM   7413  CB  MET B 120      40.823 108.024 111.217  1.00  0.81           C  
ATOM   7414  CG  MET B 120      40.230 106.759 110.562  1.00  0.81           C  
ATOM   7415  SD  MET B 120      39.044 107.089 109.263  1.00  0.81           S  
ATOM   7416  CE  MET B 120      37.670 107.472 110.347  1.00  0.81           C  
ATOM   7417  N   GLU B 121      44.000 107.252 111.882  1.00  0.78           N  
ATOM   7418  CA  GLU B 121      45.130 106.380 111.564  1.00  0.78           C  
ATOM   7419  C   GLU B 121      45.516 105.546 112.775  1.00  0.78           C  
ATOM   7420  O   GLU B 121      45.791 104.345 112.704  1.00  0.78           O  
ATOM   7421  CB  GLU B 121      46.371 107.164 111.047  1.00  0.78           C  
ATOM   7422  CG  GLU B 121      47.512 106.216 110.592  1.00  0.78           C  
ATOM   7423  CD  GLU B 121      48.658 106.889 109.846  1.00  0.78           C  
ATOM   7424  OE1 GLU B 121      49.399 107.710 110.434  1.00  0.78           O  
ATOM   7425  OE2 GLU B 121      48.890 106.534 108.655  1.00  0.78           O  
ATOM   7426  N   GLU B 122      45.447 106.181 113.957  1.00  0.81           N  
ATOM   7427  CA  GLU B 122      45.573 105.524 115.239  1.00  0.81           C  
ATOM   7428  C   GLU B 122      44.500 104.460 115.509  1.00  0.81           C  
ATOM   7429  O   GLU B 122      44.806 103.353 115.951  1.00  0.81           O  
ATOM   7430  CB  GLU B 122      45.583 106.594 116.354  1.00  0.81           C  
ATOM   7431  CG  GLU B 122      46.300 106.120 117.638  1.00  0.81           C  
ATOM   7432  CD  GLU B 122      46.282 107.164 118.750  1.00  0.81           C  
ATOM   7433  OE1 GLU B 122      47.381 107.646 119.124  1.00  0.81           O  
ATOM   7434  OE2 GLU B 122      45.169 107.451 119.262  1.00  0.81           O  
ATOM   7435  N   LEU B 123      43.204 104.727 115.201  1.00  0.89           N  
ATOM   7436  CA  LEU B 123      42.137 103.737 115.358  1.00  0.89           C  
ATOM   7437  C   LEU B 123      42.294 102.537 114.426  1.00  0.89           C  
ATOM   7438  O   LEU B 123      42.122 101.388 114.826  1.00  0.89           O  
ATOM   7439  CB  LEU B 123      40.695 104.297 115.138  1.00  0.89           C  
ATOM   7440  CG  LEU B 123      40.299 105.569 115.925  1.00  0.89           C  
ATOM   7441  CD1 LEU B 123      38.774 105.776 115.921  1.00  0.89           C  
ATOM   7442  CD2 LEU B 123      40.838 105.604 117.363  1.00  0.89           C  
ATOM   7443  N   GLU B 124      42.640 102.778 113.149  1.00  0.88           N  
ATOM   7444  CA  GLU B 124      42.839 101.763 112.127  1.00  0.88           C  
ATOM   7445  C   GLU B 124      43.989 100.811 112.404  1.00  0.88           C  
ATOM   7446  O   GLU B 124      43.901  99.611 112.140  1.00  0.88           O  
ATOM   7447  CB  GLU B 124      43.028 102.438 110.756  1.00  0.88           C  
ATOM   7448  CG  GLU B 124      41.701 103.029 110.233  1.00  0.88           C  
ATOM   7449  CD  GLU B 124      41.866 103.754 108.906  1.00  0.88           C  
ATOM   7450  OE1 GLU B 124      40.919 103.642 108.088  1.00  0.88           O  
ATOM   7451  OE2 GLU B 124      42.913 104.416 108.715  1.00  0.88           O  
ATOM   7452  N   GLU B 125      45.102 101.298 112.987  1.00  0.86           N  
ATOM   7453  CA  GLU B 125      46.226 100.449 113.344  1.00  0.86           C  
ATOM   7454  C   GLU B 125      45.959  99.511 114.522  1.00  0.86           C  
ATOM   7455  O   GLU B 125      46.687  98.538 114.707  1.00  0.86           O  
ATOM   7456  CB  GLU B 125      47.516 101.276 113.587  1.00  0.86           C  
ATOM   7457  CG  GLU B 125      48.208 101.785 112.293  1.00  0.86           C  
ATOM   7458  CD  GLU B 125      48.729 100.699 111.403  1.00  0.86           C  
ATOM   7459  OE1 GLU B 125      49.150  99.639 111.914  1.00  0.86           O  
ATOM   7460  OE2 GLU B 125      48.718 100.828 110.150  1.00  0.86           O  
ATOM   7461  N   ILE B 126      44.878  99.727 115.309  1.00  0.89           N  
ATOM   7462  CA  ILE B 126      44.382  98.762 116.296  1.00  0.89           C  
ATOM   7463  C   ILE B 126      43.914  97.448 115.662  1.00  0.89           C  
ATOM   7464  O   ILE B 126      44.028  96.385 116.270  1.00  0.89           O  
ATOM   7465  CB  ILE B 126      43.256  99.340 117.175  1.00  0.89           C  
ATOM   7466  CG1 ILE B 126      43.732 100.542 118.033  1.00  0.89           C  
ATOM   7467  CG2 ILE B 126      42.609  98.267 118.088  1.00  0.89           C  
ATOM   7468  CD1 ILE B 126      44.689 100.179 119.179  1.00  0.89           C  
ATOM   7469  N   GLU B 127      43.341  97.474 114.438  1.00  0.91           N  
ATOM   7470  CA  GLU B 127      42.810  96.280 113.793  1.00  0.91           C  
ATOM   7471  C   GLU B 127      43.839  95.198 113.470  1.00  0.91           C  
ATOM   7472  O   GLU B 127      44.760  95.386 112.679  1.00  0.91           O  
ATOM   7473  CB  GLU B 127      42.026  96.637 112.503  1.00  0.91           C  
ATOM   7474  CG  GLU B 127      41.223  95.450 111.902  1.00  0.91           C  
ATOM   7475  CD  GLU B 127      40.393  95.802 110.671  1.00  0.91           C  
ATOM   7476  OE1 GLU B 127      40.517  96.920 110.115  1.00  0.91           O  
ATOM   7477  OE2 GLU B 127      39.623  94.919 110.212  1.00  0.91           O  
ATOM   7478  N   GLU B 128      43.699  94.002 114.059  1.00  0.90           N  
ATOM   7479  CA  GLU B 128      44.466  92.827 113.689  1.00  0.90           C  
ATOM   7480  C   GLU B 128      44.238  92.409 112.230  1.00  0.90           C  
ATOM   7481  O   GLU B 128      43.108  92.388 111.743  1.00  0.90           O  
ATOM   7482  CB  GLU B 128      44.121  91.640 114.630  1.00  0.90           C  
ATOM   7483  CG  GLU B 128      44.310  91.931 116.146  1.00  0.90           C  
ATOM   7484  CD  GLU B 128      45.723  92.330 116.584  1.00  0.90           C  
ATOM   7485  OE1 GLU B 128      45.838  92.775 117.759  1.00  0.90           O  
ATOM   7486  OE2 GLU B 128      46.685  92.209 115.790  1.00  0.90           O  
ATOM   7487  N   ASP B 129      45.301  92.057 111.466  1.00  0.91           N  
ATOM   7488  CA  ASP B 129      45.136  91.463 110.146  1.00  0.91           C  
ATOM   7489  C   ASP B 129      44.388  90.132 110.219  1.00  0.91           C  
ATOM   7490  O   ASP B 129      44.773  89.239 110.966  1.00  0.91           O  
ATOM   7491  CB  ASP B 129      46.491  91.097 109.464  1.00  0.91           C  
ATOM   7492  CG  ASP B 129      47.296  92.268 108.975  1.00  0.91           C  
ATOM   7493  OD1 ASP B 129      47.288  92.589 107.756  1.00  0.91           O  
ATOM   7494  OD2 ASP B 129      48.037  92.846 109.806  1.00  0.91           O  
ATOM   7495  N   ALA B 130      43.344  89.902 109.390  1.00  0.93           N  
ATOM   7496  CA  ALA B 130      42.808  88.563 109.206  1.00  0.93           C  
ATOM   7497  C   ALA B 130      43.772  87.733 108.352  1.00  0.93           C  
ATOM   7498  O   ALA B 130      43.627  87.586 107.136  1.00  0.93           O  
ATOM   7499  CB  ALA B 130      41.384  88.588 108.611  1.00  0.93           C  
ATOM   7500  N   GLY B 131      44.834  87.216 109.004  1.00  0.84           N  
ATOM   7501  CA  GLY B 131      45.994  86.555 108.425  1.00  0.84           C  
ATOM   7502  C   GLY B 131      45.788  85.122 108.037  1.00  0.84           C  
ATOM   7503  O   GLY B 131      46.673  84.289 108.197  1.00  0.84           O  
ATOM   7504  N   LEU B 132      44.614  84.767 107.498  1.00  0.89           N  
ATOM   7505  CA  LEU B 132      44.226  83.390 107.251  1.00  0.89           C  
ATOM   7506  C   LEU B 132      44.734  82.872 105.911  1.00  0.89           C  
ATOM   7507  O   LEU B 132      44.043  82.138 105.210  1.00  0.89           O  
ATOM   7508  CB  LEU B 132      42.685  83.228 107.329  1.00  0.89           C  
ATOM   7509  CG  LEU B 132      42.023  83.872 108.567  1.00  0.89           C  
ATOM   7510  CD1 LEU B 132      40.514  83.593 108.562  1.00  0.89           C  
ATOM   7511  CD2 LEU B 132      42.633  83.412 109.899  1.00  0.89           C  
ATOM   7512  N   GLY B 133      45.967  83.244 105.517  1.00  0.92           N  
ATOM   7513  CA  GLY B 133      46.589  82.788 104.286  1.00  0.92           C  
ATOM   7514  C   GLY B 133      48.084  82.862 104.347  1.00  0.92           C  
ATOM   7515  O   GLY B 133      48.663  83.687 105.046  1.00  0.92           O  
ATOM   7516  N   ASN B 134      48.759  81.973 103.608  1.00  0.85           N  
ATOM   7517  CA  ASN B 134      50.201  81.886 103.552  1.00  0.85           C  
ATOM   7518  C   ASN B 134      50.835  82.944 102.674  1.00  0.85           C  
ATOM   7519  O   ASN B 134      51.880  83.503 103.018  1.00  0.85           O  
ATOM   7520  CB  ASN B 134      50.611  80.497 103.000  1.00  0.85           C  
ATOM   7521  CG  ASN B 134      50.718  79.521 104.157  1.00  0.85           C  
ATOM   7522  OD1 ASN B 134      51.687  79.611 104.920  1.00  0.85           O  
ATOM   7523  ND2 ASN B 134      49.744  78.606 104.299  1.00  0.85           N  
ATOM   7524  N   GLY B 135      50.242  83.213 101.497  1.00  0.92           N  
ATOM   7525  CA  GLY B 135      50.906  84.035 100.501  1.00  0.92           C  
ATOM   7526  C   GLY B 135      50.025  84.396  99.343  1.00  0.92           C  
ATOM   7527  O   GLY B 135      48.937  84.945  99.493  1.00  0.92           O  
ATOM   7528  N   GLY B 136      50.491  84.125  98.107  1.00  0.93           N  
ATOM   7529  CA  GLY B 136      49.804  84.561  96.890  1.00  0.93           C  
ATOM   7530  C   GLY B 136      48.501  83.855  96.634  1.00  0.93           C  
ATOM   7531  O   GLY B 136      47.554  84.466  96.150  1.00  0.93           O  
ATOM   7532  N   LEU B 137      48.431  82.563  96.999  1.00  0.91           N  
ATOM   7533  CA  LEU B 137      47.261  81.705  96.937  1.00  0.91           C  
ATOM   7534  C   LEU B 137      46.086  82.230  97.752  1.00  0.91           C  
ATOM   7535  O   LEU B 137      45.014  82.521  97.221  1.00  0.91           O  
ATOM   7536  CB  LEU B 137      47.731  80.335  97.493  1.00  0.91           C  
ATOM   7537  CG  LEU B 137      46.662  79.273  97.820  1.00  0.91           C  
ATOM   7538  CD1 LEU B 137      46.004  78.713  96.556  1.00  0.91           C  
ATOM   7539  CD2 LEU B 137      47.319  78.137  98.617  1.00  0.91           C  
ATOM   7540  N   GLY B 138      46.284  82.465  99.067  1.00  0.95           N  
ATOM   7541  CA  GLY B 138      45.254  83.043  99.917  1.00  0.95           C  
ATOM   7542  C   GLY B 138      44.923  84.477  99.613  1.00  0.95           C  
ATOM   7543  O   GLY B 138      43.807  84.940  99.847  1.00  0.95           O  
ATOM   7544  N   ARG B 139      45.891  85.256  99.090  1.00  0.90           N  
ATOM   7545  CA  ARG B 139      45.636  86.634  98.716  1.00  0.90           C  
ATOM   7546  C   ARG B 139      44.855  86.764  97.423  1.00  0.90           C  
ATOM   7547  O   ARG B 139      44.074  87.702  97.255  1.00  0.90           O  
ATOM   7548  CB  ARG B 139      46.941  87.472  98.676  1.00  0.90           C  
ATOM   7549  CG  ARG B 139      46.715  88.992  98.506  1.00  0.90           C  
ATOM   7550  CD  ARG B 139      45.833  89.614  99.603  1.00  0.90           C  
ATOM   7551  NE  ARG B 139      44.631  90.212  98.947  1.00  0.90           N  
ATOM   7552  CZ  ARG B 139      43.697  90.918  99.598  1.00  0.90           C  
ATOM   7553  NH1 ARG B 139      43.715  91.019 100.919  1.00  0.90           N  
ATOM   7554  NH2 ARG B 139      42.718  91.489  98.900  1.00  0.90           N  
ATOM   7555  N   LEU B 140      45.001  85.799  96.497  1.00  0.96           N  
ATOM   7556  CA  LEU B 140      44.192  85.700  95.300  1.00  0.96           C  
ATOM   7557  C   LEU B 140      42.722  85.511  95.634  1.00  0.96           C  
ATOM   7558  O   LEU B 140      41.862  86.220  95.117  1.00  0.96           O  
ATOM   7559  CB  LEU B 140      44.690  84.518  94.435  1.00  0.96           C  
ATOM   7560  CG  LEU B 140      44.083  84.448  93.023  1.00  0.96           C  
ATOM   7561  CD1 LEU B 140      44.569  85.615  92.150  1.00  0.96           C  
ATOM   7562  CD2 LEU B 140      44.430  83.103  92.368  1.00  0.96           C  
ATOM   7563  N   ALA B 141      42.416  84.620  96.600  1.00  0.98           N  
ATOM   7564  CA  ALA B 141      41.075  84.392  97.098  1.00  0.98           C  
ATOM   7565  C   ALA B 141      40.432  85.642  97.696  1.00  0.98           C  
ATOM   7566  O   ALA B 141      39.303  86.001  97.374  1.00  0.98           O  
ATOM   7567  CB  ALA B 141      41.144  83.278  98.159  1.00  0.98           C  
ATOM   7568  N   ALA B 142      41.182  86.387  98.526  1.00  0.98           N  
ATOM   7569  CA  ALA B 142      40.783  87.676  99.045  1.00  0.98           C  
ATOM   7570  C   ALA B 142      40.596  88.777  97.998  1.00  0.98           C  
ATOM   7571  O   ALA B 142      39.682  89.592  98.098  1.00  0.98           O  
ATOM   7572  CB  ALA B 142      41.826  88.111 100.083  1.00  0.98           C  
ATOM   7573  N   CYS B 143      41.454  88.858  96.955  1.00  0.97           N  
ATOM   7574  CA  CYS B 143      41.227  89.760  95.827  1.00  0.97           C  
ATOM   7575  C   CYS B 143      39.970  89.408  95.053  1.00  0.97           C  
ATOM   7576  O   CYS B 143      39.154  90.266  94.727  1.00  0.97           O  
ATOM   7577  CB  CYS B 143      42.430  89.782  94.848  1.00  0.97           C  
ATOM   7578  SG  CYS B 143      43.875  90.613  95.591  1.00  0.97           S  
ATOM   7579  N   PHE B 144      39.768  88.105  94.801  1.00  0.97           N  
ATOM   7580  CA  PHE B 144      38.631  87.570  94.089  1.00  0.97           C  
ATOM   7581  C   PHE B 144      37.306  87.857  94.779  1.00  0.97           C  
ATOM   7582  O   PHE B 144      36.335  88.197  94.109  1.00  0.97           O  
ATOM   7583  CB  PHE B 144      38.788  86.039  93.850  1.00  0.97           C  
ATOM   7584  CG  PHE B 144      39.741  85.650  92.733  1.00  0.97           C  
ATOM   7585  CD1 PHE B 144      40.535  86.556  91.998  1.00  0.97           C  
ATOM   7586  CD2 PHE B 144      39.791  84.291  92.378  1.00  0.97           C  
ATOM   7587  CE1 PHE B 144      41.338  86.113  90.938  1.00  0.97           C  
ATOM   7588  CE2 PHE B 144      40.591  83.840  91.321  1.00  0.97           C  
ATOM   7589  CZ  PHE B 144      41.366  84.755  90.600  1.00  0.97           C  
ATOM   7590  N   LEU B 145      37.218  87.777  96.126  1.00  0.96           N  
ATOM   7591  CA  LEU B 145      35.992  88.114  96.841  1.00  0.96           C  
ATOM   7592  C   LEU B 145      35.520  89.559  96.620  1.00  0.96           C  
ATOM   7593  O   LEU B 145      34.342  89.785  96.332  1.00  0.96           O  
ATOM   7594  CB  LEU B 145      36.113  87.867  98.373  1.00  0.96           C  
ATOM   7595  CG  LEU B 145      36.289  86.401  98.833  1.00  0.96           C  
ATOM   7596  CD1 LEU B 145      36.181  86.326 100.362  1.00  0.96           C  
ATOM   7597  CD2 LEU B 145      35.275  85.434  98.207  1.00  0.96           C  
ATOM   7598  N   ASP B 146      36.436  90.556  96.685  1.00  0.95           N  
ATOM   7599  CA  ASP B 146      36.169  91.961  96.388  1.00  0.95           C  
ATOM   7600  C   ASP B 146      35.692  92.145  94.940  1.00  0.95           C  
ATOM   7601  O   ASP B 146      34.650  92.749  94.682  1.00  0.95           O  
ATOM   7602  CB  ASP B 146      37.494  92.745  96.674  1.00  0.95           C  
ATOM   7603  CG  ASP B 146      37.528  94.212  96.276  1.00  0.95           C  
ATOM   7604  OD1 ASP B 146      37.589  95.117  97.136  1.00  0.95           O  
ATOM   7605  OD2 ASP B 146      37.628  94.466  95.049  1.00  0.95           O  
ATOM   7606  N   SER B 147      36.408  91.544  93.963  1.00  0.96           N  
ATOM   7607  CA  SER B 147      36.030  91.590  92.548  1.00  0.96           C  
ATOM   7608  C   SER B 147      34.705  90.966  92.235  1.00  0.96           C  
ATOM   7609  O   SER B 147      33.907  91.538  91.502  1.00  0.96           O  
ATOM   7610  CB  SER B 147      37.012  90.908  91.598  1.00  0.96           C  
ATOM   7611  OG  SER B 147      38.164  91.717  91.635  1.00  0.96           O  
ATOM   7612  N   MET B 148      34.393  89.782  92.800  1.00  0.94           N  
ATOM   7613  CA  MET B 148      33.106  89.127  92.611  1.00  0.94           C  
ATOM   7614  C   MET B 148      31.947  89.939  93.176  1.00  0.94           C  
ATOM   7615  O   MET B 148      30.898  90.043  92.545  1.00  0.94           O  
ATOM   7616  CB  MET B 148      33.087  87.673  93.164  1.00  0.94           C  
ATOM   7617  CG  MET B 148      33.984  86.708  92.354  1.00  0.94           C  
ATOM   7618  SD  MET B 148      33.878  84.940  92.775  1.00  0.94           S  
ATOM   7619  CE  MET B 148      34.612  85.044  94.429  1.00  0.94           C  
ATOM   7620  N   ALA B 149      32.116  90.572  94.357  1.00  0.96           N  
ATOM   7621  CA  ALA B 149      31.147  91.509  94.899  1.00  0.96           C  
ATOM   7622  C   ALA B 149      30.965  92.788  94.070  1.00  0.96           C  
ATOM   7623  O   ALA B 149      29.846  93.208  93.778  1.00  0.96           O  
ATOM   7624  CB  ALA B 149      31.537  91.844  96.351  1.00  0.96           C  
ATOM   7625  N   THR B 150      32.065  93.412  93.601  1.00  0.93           N  
ATOM   7626  CA  THR B 150      32.064  94.573  92.698  1.00  0.93           C  
ATOM   7627  C   THR B 150      31.360  94.290  91.378  1.00  0.93           C  
ATOM   7628  O   THR B 150      30.640  95.130  90.842  1.00  0.93           O  
ATOM   7629  CB  THR B 150      33.476  95.088  92.432  1.00  0.93           C  
ATOM   7630  OG1 THR B 150      34.050  95.525  93.655  1.00  0.93           O  
ATOM   7631  CG2 THR B 150      33.490  96.318  91.513  1.00  0.93           C  
ATOM   7632  N   LEU B 151      31.498  93.064  90.843  1.00  0.90           N  
ATOM   7633  CA  LEU B 151      30.868  92.645  89.599  1.00  0.90           C  
ATOM   7634  C   LEU B 151      29.481  92.044  89.822  1.00  0.90           C  
ATOM   7635  O   LEU B 151      28.855  91.568  88.877  1.00  0.90           O  
ATOM   7636  CB  LEU B 151      31.746  91.566  88.900  1.00  0.90           C  
ATOM   7637  CG  LEU B 151      32.819  92.085  87.915  1.00  0.90           C  
ATOM   7638  CD1 LEU B 151      33.666  93.250  88.446  1.00  0.90           C  
ATOM   7639  CD2 LEU B 151      33.735  90.916  87.532  1.00  0.90           C  
ATOM   7640  N   GLY B 152      28.952  92.045  91.063  1.00  0.92           N  
ATOM   7641  CA  GLY B 152      27.565  91.676  91.333  1.00  0.92           C  
ATOM   7642  C   GLY B 152      27.260  90.206  91.309  1.00  0.92           C  
ATOM   7643  O   GLY B 152      26.110  89.786  91.390  1.00  0.92           O  
ATOM   7644  N   LEU B 153      28.290  89.358  91.186  1.00  0.92           N  
ATOM   7645  CA  LEU B 153      28.132  87.923  91.117  1.00  0.92           C  
ATOM   7646  C   LEU B 153      27.612  87.315  92.410  1.00  0.92           C  
ATOM   7647  O   LEU B 153      28.000  87.714  93.507  1.00  0.92           O  
ATOM   7648  CB  LEU B 153      29.459  87.226  90.732  1.00  0.92           C  
ATOM   7649  CG  LEU B 153      30.040  87.655  89.369  1.00  0.92           C  
ATOM   7650  CD1 LEU B 153      31.405  86.993  89.148  1.00  0.92           C  
ATOM   7651  CD2 LEU B 153      29.100  87.300  88.209  1.00  0.92           C  
ATOM   7652  N   ALA B 154      26.747  86.282  92.305  1.00  0.92           N  
ATOM   7653  CA  ALA B 154      26.226  85.535  93.433  1.00  0.92           C  
ATOM   7654  C   ALA B 154      27.260  84.602  94.047  1.00  0.92           C  
ATOM   7655  O   ALA B 154      27.181  83.377  93.968  1.00  0.92           O  
ATOM   7656  CB  ALA B 154      24.961  84.767  93.005  1.00  0.92           C  
ATOM   7657  N   ALA B 155      28.288  85.198  94.667  1.00  0.96           N  
ATOM   7658  CA  ALA B 155      29.489  84.519  95.066  1.00  0.96           C  
ATOM   7659  C   ALA B 155      29.696  84.480  96.564  1.00  0.96           C  
ATOM   7660  O   ALA B 155      29.513  85.458  97.288  1.00  0.96           O  
ATOM   7661  CB  ALA B 155      30.705  85.190  94.418  1.00  0.96           C  
ATOM   7662  N   TYR B 156      30.107  83.301  97.049  1.00  0.95           N  
ATOM   7663  CA  TYR B 156      30.328  83.023  98.445  1.00  0.95           C  
ATOM   7664  C   TYR B 156      31.753  82.517  98.597  1.00  0.95           C  
ATOM   7665  O   TYR B 156      32.202  81.647  97.848  1.00  0.95           O  
ATOM   7666  CB  TYR B 156      29.387  81.904  98.999  1.00  0.95           C  
ATOM   7667  CG  TYR B 156      27.897  82.145  98.803  1.00  0.95           C  
ATOM   7668  CD1 TYR B 156      27.044  82.382  99.899  1.00  0.95           C  
ATOM   7669  CD2 TYR B 156      27.312  82.058  97.526  1.00  0.95           C  
ATOM   7670  CE1 TYR B 156      25.670  82.631  99.707  1.00  0.95           C  
ATOM   7671  CE2 TYR B 156      25.947  82.311  97.332  1.00  0.95           C  
ATOM   7672  CZ  TYR B 156      25.124  82.643  98.410  1.00  0.95           C  
ATOM   7673  OH  TYR B 156      23.789  83.065  98.180  1.00  0.95           O  
ATOM   7674  N   GLY B 157      32.512  83.028  99.586  1.00  0.99           N  
ATOM   7675  CA  GLY B 157      33.785  82.411  99.953  1.00  0.99           C  
ATOM   7676  C   GLY B 157      33.558  81.409 101.042  1.00  0.99           C  
ATOM   7677  O   GLY B 157      32.822  81.682 101.984  1.00  0.99           O  
ATOM   7678  N   TYR B 158      34.184  80.228 100.951  1.00  0.96           N  
ATOM   7679  CA  TYR B 158      34.019  79.185 101.943  1.00  0.96           C  
ATOM   7680  C   TYR B 158      35.370  78.699 102.427  1.00  0.96           C  
ATOM   7681  O   TYR B 158      36.185  78.198 101.651  1.00  0.96           O  
ATOM   7682  CB  TYR B 158      33.233  77.996 101.346  1.00  0.96           C  
ATOM   7683  CG  TYR B 158      31.759  78.153 101.584  1.00  0.96           C  
ATOM   7684  CD1 TYR B 158      30.923  78.738 100.622  1.00  0.96           C  
ATOM   7685  CD2 TYR B 158      31.188  77.647 102.762  1.00  0.96           C  
ATOM   7686  CE1 TYR B 158      29.534  78.760 100.818  1.00  0.96           C  
ATOM   7687  CE2 TYR B 158      29.798  77.614 102.928  1.00  0.96           C  
ATOM   7688  CZ  TYR B 158      28.973  78.166 101.945  1.00  0.96           C  
ATOM   7689  OH  TYR B 158      27.573  78.131 102.056  1.00  0.96           O  
ATOM   7690  N   GLY B 159      35.641  78.848 103.742  1.00  0.99           N  
ATOM   7691  CA  GLY B 159      36.923  78.469 104.326  1.00  0.99           C  
ATOM   7692  C   GLY B 159      36.843  78.060 105.772  1.00  0.99           C  
ATOM   7693  O   GLY B 159      35.781  77.779 106.323  1.00  0.99           O  
ATOM   7694  N   ILE B 160      38.002  78.037 106.451  1.00  0.96           N  
ATOM   7695  CA  ILE B 160      38.106  77.713 107.868  1.00  0.96           C  
ATOM   7696  C   ILE B 160      38.355  78.978 108.662  1.00  0.96           C  
ATOM   7697  O   ILE B 160      39.209  79.802 108.338  1.00  0.96           O  
ATOM   7698  CB  ILE B 160      39.216  76.704 108.168  1.00  0.96           C  
ATOM   7699  CG1 ILE B 160      38.927  75.386 107.422  1.00  0.96           C  
ATOM   7700  CG2 ILE B 160      39.323  76.429 109.688  1.00  0.96           C  
ATOM   7701  CD1 ILE B 160      40.053  74.357 107.531  1.00  0.96           C  
ATOM   7702  N   ARG B 161      37.600  79.160 109.762  1.00  0.91           N  
ATOM   7703  CA  ARG B 161      37.839  80.209 110.728  1.00  0.91           C  
ATOM   7704  C   ARG B 161      38.950  79.790 111.668  1.00  0.91           C  
ATOM   7705  O   ARG B 161      38.705  79.322 112.779  1.00  0.91           O  
ATOM   7706  CB  ARG B 161      36.555  80.516 111.533  1.00  0.91           C  
ATOM   7707  CG  ARG B 161      36.668  81.731 112.475  1.00  0.91           C  
ATOM   7708  CD  ARG B 161      35.327  82.059 113.123  1.00  0.91           C  
ATOM   7709  NE  ARG B 161      35.533  83.080 114.192  1.00  0.91           N  
ATOM   7710  CZ  ARG B 161      35.556  82.778 115.495  1.00  0.91           C  
ATOM   7711  NH1 ARG B 161      35.825  81.548 115.924  1.00  0.91           N  
ATOM   7712  NH2 ARG B 161      35.310  83.726 116.389  1.00  0.91           N  
ATOM   7713  N   TYR B 162      40.220  79.904 111.225  1.00  0.92           N  
ATOM   7714  CA  TYR B 162      41.344  79.571 112.076  1.00  0.92           C  
ATOM   7715  C   TYR B 162      41.416  80.482 113.291  1.00  0.92           C  
ATOM   7716  O   TYR B 162      41.306  81.701 113.173  1.00  0.92           O  
ATOM   7717  CB  TYR B 162      42.729  79.602 111.376  1.00  0.92           C  
ATOM   7718  CG  TYR B 162      42.784  78.769 110.125  1.00  0.92           C  
ATOM   7719  CD1 TYR B 162      42.876  77.366 110.189  1.00  0.92           C  
ATOM   7720  CD2 TYR B 162      42.822  79.394 108.867  1.00  0.92           C  
ATOM   7721  CE1 TYR B 162      43.019  76.610 109.015  1.00  0.92           C  
ATOM   7722  CE2 TYR B 162      42.959  78.640 107.694  1.00  0.92           C  
ATOM   7723  CZ  TYR B 162      43.074  77.248 107.772  1.00  0.92           C  
ATOM   7724  OH  TYR B 162      43.266  76.483 106.606  1.00  0.92           O  
ATOM   7725  N   GLU B 163      41.607  79.904 114.490  1.00  0.85           N  
ATOM   7726  CA  GLU B 163      41.824  80.649 115.718  1.00  0.85           C  
ATOM   7727  C   GLU B 163      43.136  81.428 115.660  1.00  0.85           C  
ATOM   7728  O   GLU B 163      43.219  82.585 116.065  1.00  0.85           O  
ATOM   7729  CB  GLU B 163      41.753  79.700 116.941  1.00  0.85           C  
ATOM   7730  CG  GLU B 163      41.645  80.441 118.298  1.00  0.85           C  
ATOM   7731  CD  GLU B 163      41.506  79.524 119.506  1.00  0.85           C  
ATOM   7732  OE1 GLU B 163      41.307  78.298 119.310  1.00  0.85           O  
ATOM   7733  OE2 GLU B 163      41.594  80.041 120.645  1.00  0.85           O  
ATOM   7734  N   PHE B 164      44.171  80.795 115.070  1.00  0.88           N  
ATOM   7735  CA  PHE B 164      45.469  81.377 114.791  1.00  0.88           C  
ATOM   7736  C   PHE B 164      45.750  81.367 113.288  1.00  0.88           C  
ATOM   7737  O   PHE B 164      45.679  80.323 112.637  1.00  0.88           O  
ATOM   7738  CB  PHE B 164      46.608  80.586 115.509  1.00  0.88           C  
ATOM   7739  CG  PHE B 164      46.384  80.619 116.998  1.00  0.88           C  
ATOM   7740  CD1 PHE B 164      46.859  81.692 117.762  1.00  0.88           C  
ATOM   7741  CD2 PHE B 164      45.596  79.644 117.630  1.00  0.88           C  
ATOM   7742  CE1 PHE B 164      46.471  81.848 119.098  1.00  0.88           C  
ATOM   7743  CE2 PHE B 164      45.183  79.799 118.956  1.00  0.88           C  
ATOM   7744  CZ  PHE B 164      45.598  80.919 119.680  1.00  0.88           C  
ATOM   7745  N   GLY B 165      46.087  82.529 112.680  1.00  0.90           N  
ATOM   7746  CA  GLY B 165      46.456  82.613 111.269  1.00  0.90           C  
ATOM   7747  C   GLY B 165      47.915  82.320 111.004  1.00  0.90           C  
ATOM   7748  O   GLY B 165      48.559  81.510 111.671  1.00  0.90           O  
ATOM   7749  N   ILE B 166      48.503  82.975 109.982  1.00  0.83           N  
ATOM   7750  CA  ILE B 166      49.937  82.924 109.735  1.00  0.83           C  
ATOM   7751  C   ILE B 166      50.711  83.613 110.861  1.00  0.83           C  
ATOM   7752  O   ILE B 166      50.497  84.785 111.161  1.00  0.83           O  
ATOM   7753  CB  ILE B 166      50.330  83.465 108.349  1.00  0.83           C  
ATOM   7754  CG1 ILE B 166      51.815  83.206 107.997  1.00  0.83           C  
ATOM   7755  CG2 ILE B 166      49.986  84.964 108.193  1.00  0.83           C  
ATOM   7756  CD1 ILE B 166      52.100  81.742 107.657  1.00  0.83           C  
ATOM   7757  N   PHE B 167      51.630  82.886 111.540  1.00  0.87           N  
ATOM   7758  CA  PHE B 167      52.417  83.361 112.673  1.00  0.87           C  
ATOM   7759  C   PHE B 167      52.951  84.791 112.602  1.00  0.87           C  
ATOM   7760  O   PHE B 167      53.376  85.276 111.551  1.00  0.87           O  
ATOM   7761  CB  PHE B 167      53.560  82.371 113.051  1.00  0.87           C  
ATOM   7762  CG  PHE B 167      54.599  82.240 111.967  1.00  0.87           C  
ATOM   7763  CD1 PHE B 167      54.477  81.265 110.961  1.00  0.87           C  
ATOM   7764  CD2 PHE B 167      55.702  83.112 111.940  1.00  0.87           C  
ATOM   7765  CE1 PHE B 167      55.417  81.194 109.925  1.00  0.87           C  
ATOM   7766  CE2 PHE B 167      56.641  83.047 110.906  1.00  0.87           C  
ATOM   7767  CZ  PHE B 167      56.492  82.090 109.899  1.00  0.87           C  
ATOM   7768  N   ASN B 168      52.980  85.510 113.737  1.00  0.85           N  
ATOM   7769  CA  ASN B 168      53.701  86.755 113.842  1.00  0.85           C  
ATOM   7770  C   ASN B 168      55.192  86.460 113.868  1.00  0.85           C  
ATOM   7771  O   ASN B 168      55.697  85.663 114.652  1.00  0.85           O  
ATOM   7772  CB  ASN B 168      53.287  87.604 115.070  1.00  0.85           C  
ATOM   7773  CG  ASN B 168      51.841  88.096 115.008  1.00  0.85           C  
ATOM   7774  OD1 ASN B 168      51.166  88.175 116.031  1.00  0.85           O  
ATOM   7775  ND2 ASN B 168      51.350  88.473 113.806  1.00  0.85           N  
ATOM   7776  N   GLN B 169      55.933  87.066 112.933  1.00  0.85           N  
ATOM   7777  CA  GLN B 169      57.349  86.822 112.793  1.00  0.85           C  
ATOM   7778  C   GLN B 169      58.123  87.877 113.541  1.00  0.85           C  
ATOM   7779  O   GLN B 169      57.821  89.064 113.439  1.00  0.85           O  
ATOM   7780  CB  GLN B 169      57.738  86.894 111.301  1.00  0.85           C  
ATOM   7781  CG  GLN B 169      59.223  86.603 110.982  1.00  0.85           C  
ATOM   7782  CD  GLN B 169      59.552  87.034 109.555  1.00  0.85           C  
ATOM   7783  OE1 GLN B 169      59.119  88.094 109.099  1.00  0.85           O  
ATOM   7784  NE2 GLN B 169      60.308  86.192 108.821  1.00  0.85           N  
ATOM   7785  N   LYS B 170      59.144  87.449 114.293  1.00  0.84           N  
ATOM   7786  CA  LYS B 170      60.088  88.343 114.920  1.00  0.84           C  
ATOM   7787  C   LYS B 170      61.485  87.896 114.552  1.00  0.84           C  
ATOM   7788  O   LYS B 170      61.741  86.710 114.348  1.00  0.84           O  
ATOM   7789  CB  LYS B 170      59.990  88.275 116.462  1.00  0.84           C  
ATOM   7790  CG  LYS B 170      58.626  88.640 117.071  1.00  0.84           C  
ATOM   7791  CD  LYS B 170      58.264  90.133 116.983  1.00  0.84           C  
ATOM   7792  CE  LYS B 170      56.921  90.498 117.636  1.00  0.84           C  
ATOM   7793  NZ  LYS B 170      56.932  90.198 119.079  1.00  0.84           N  
ATOM   7794  N   ILE B 171      62.434  88.833 114.468  1.00  0.88           N  
ATOM   7795  CA  ILE B 171      63.842  88.538 114.299  1.00  0.88           C  
ATOM   7796  C   ILE B 171      64.545  88.669 115.638  1.00  0.88           C  
ATOM   7797  O   ILE B 171      64.612  89.726 116.258  1.00  0.88           O  
ATOM   7798  CB  ILE B 171      64.477  89.416 113.225  1.00  0.88           C  
ATOM   7799  CG1 ILE B 171      63.837  89.116 111.843  1.00  0.88           C  
ATOM   7800  CG2 ILE B 171      66.014  89.258 113.180  1.00  0.88           C  
ATOM   7801  CD1 ILE B 171      64.094  87.715 111.278  1.00  0.88           C  
ATOM   7802  N   SER B 172      65.103  87.554 116.141  1.00  0.87           N  
ATOM   7803  CA  SER B 172      65.844  87.531 117.393  1.00  0.87           C  
ATOM   7804  C   SER B 172      67.221  86.974 117.117  1.00  0.87           C  
ATOM   7805  O   SER B 172      67.377  85.885 116.568  1.00  0.87           O  
ATOM   7806  CB  SER B 172      65.150  86.663 118.472  1.00  0.87           C  
ATOM   7807  OG  SER B 172      65.824  86.755 119.730  1.00  0.87           O  
ATOM   7808  N   GLY B 173      68.287  87.748 117.428  1.00  0.89           N  
ATOM   7809  CA  GLY B 173      69.674  87.348 117.174  1.00  0.89           C  
ATOM   7810  C   GLY B 173      70.008  87.135 115.713  1.00  0.89           C  
ATOM   7811  O   GLY B 173      70.911  86.379 115.367  1.00  0.89           O  
ATOM   7812  N   GLY B 174      69.254  87.792 114.809  1.00  0.91           N  
ATOM   7813  CA  GLY B 174      69.364  87.604 113.369  1.00  0.91           C  
ATOM   7814  C   GLY B 174      68.583  86.436 112.810  1.00  0.91           C  
ATOM   7815  O   GLY B 174      68.632  86.193 111.607  1.00  0.91           O  
ATOM   7816  N   TRP B 175      67.824  85.692 113.635  1.00  0.87           N  
ATOM   7817  CA  TRP B 175      67.074  84.520 113.204  1.00  0.87           C  
ATOM   7818  C   TRP B 175      65.572  84.738 113.318  1.00  0.87           C  
ATOM   7819  O   TRP B 175      65.096  85.422 114.220  1.00  0.87           O  
ATOM   7820  CB  TRP B 175      67.380  83.289 114.101  1.00  0.87           C  
ATOM   7821  CG  TRP B 175      68.820  82.823 114.136  1.00  0.87           C  
ATOM   7822  CD1 TRP B 175      69.823  83.185 114.995  1.00  0.87           C  
ATOM   7823  CD2 TRP B 175      69.370  81.783 113.299  1.00  0.87           C  
ATOM   7824  NE1 TRP B 175      70.961  82.429 114.767  1.00  0.87           N  
ATOM   7825  CE2 TRP B 175      70.685  81.559 113.727  1.00  0.87           C  
ATOM   7826  CE3 TRP B 175      68.808  81.049 112.251  1.00  0.87           C  
ATOM   7827  CZ2 TRP B 175      71.487  80.594 113.126  1.00  0.87           C  
ATOM   7828  CZ3 TRP B 175      69.619  80.081 111.634  1.00  0.87           C  
ATOM   7829  CH2 TRP B 175      70.935  79.857 112.063  1.00  0.87           C  
ATOM   7830  N   GLN B 176      64.770  84.126 112.412  1.00  0.87           N  
ATOM   7831  CA  GLN B 176      63.320  84.051 112.567  1.00  0.87           C  
ATOM   7832  C   GLN B 176      62.874  83.315 113.829  1.00  0.87           C  
ATOM   7833  O   GLN B 176      63.270  82.180 114.091  1.00  0.87           O  
ATOM   7834  CB  GLN B 176      62.621  83.385 111.342  1.00  0.87           C  
ATOM   7835  CG  GLN B 176      61.104  83.102 111.542  1.00  0.87           C  
ATOM   7836  CD  GLN B 176      60.406  82.620 110.266  1.00  0.87           C  
ATOM   7837  OE1 GLN B 176      60.335  83.328 109.257  1.00  0.87           O  
ATOM   7838  NE2 GLN B 176      59.847  81.393 110.309  1.00  0.87           N  
ATOM   7839  N   MET B 177      61.982  83.959 114.598  1.00  0.84           N  
ATOM   7840  CA  MET B 177      61.262  83.395 115.711  1.00  0.84           C  
ATOM   7841  C   MET B 177      59.776  83.515 115.401  1.00  0.84           C  
ATOM   7842  O   MET B 177      59.334  84.485 114.780  1.00  0.84           O  
ATOM   7843  CB  MET B 177      61.632  84.144 117.016  1.00  0.84           C  
ATOM   7844  CG  MET B 177      61.018  83.568 118.307  1.00  0.84           C  
ATOM   7845  SD  MET B 177      61.668  84.353 119.812  1.00  0.84           S  
ATOM   7846  CE  MET B 177      60.749  85.912 119.648  1.00  0.84           C  
ATOM   7847  N   GLU B 178      58.979  82.498 115.780  1.00  0.83           N  
ATOM   7848  CA  GLU B 178      57.560  82.434 115.493  1.00  0.83           C  
ATOM   7849  C   GLU B 178      56.696  82.672 116.731  1.00  0.83           C  
ATOM   7850  O   GLU B 178      56.730  81.899 117.682  1.00  0.83           O  
ATOM   7851  CB  GLU B 178      57.177  81.035 114.934  1.00  0.83           C  
ATOM   7852  CG  GLU B 178      57.788  80.668 113.554  1.00  0.83           C  
ATOM   7853  CD  GLU B 178      59.096  79.879 113.561  1.00  0.83           C  
ATOM   7854  OE1 GLU B 178      59.346  79.018 114.434  1.00  0.83           O  
ATOM   7855  OE2 GLU B 178      59.883  80.052 112.594  1.00  0.83           O  
ATOM   7856  N   GLU B 179      55.845  83.717 116.717  1.00  0.82           N  
ATOM   7857  CA  GLU B 179      54.814  83.957 117.717  1.00  0.82           C  
ATOM   7858  C   GLU B 179      53.460  83.641 117.115  1.00  0.82           C  
ATOM   7859  O   GLU B 179      53.179  83.936 115.957  1.00  0.82           O  
ATOM   7860  CB  GLU B 179      54.772  85.425 118.185  1.00  0.82           C  
ATOM   7861  CG  GLU B 179      56.046  85.819 118.948  1.00  0.82           C  
ATOM   7862  CD  GLU B 179      56.136  87.296 119.228  1.00  0.82           C  
ATOM   7863  OE1 GLU B 179      57.168  87.722 119.809  1.00  0.82           O  
ATOM   7864  OE2 GLU B 179      55.250  88.096 118.826  1.00  0.82           O  
ATOM   7865  N   ALA B 180      52.562  82.993 117.863  1.00  0.85           N  
ATOM   7866  CA  ALA B 180      51.236  82.659 117.386  1.00  0.85           C  
ATOM   7867  C   ALA B 180      50.311  83.856 117.091  1.00  0.85           C  
ATOM   7868  O   ALA B 180      50.212  84.814 117.844  1.00  0.85           O  
ATOM   7869  CB  ALA B 180      50.574  81.740 118.426  1.00  0.85           C  
ATOM   7870  N   ASP B 181      49.545  83.825 115.993  1.00  0.86           N  
ATOM   7871  CA  ASP B 181      48.704  84.945 115.603  1.00  0.86           C  
ATOM   7872  C   ASP B 181      47.332  84.946 116.329  1.00  0.86           C  
ATOM   7873  O   ASP B 181      46.353  84.374 115.864  1.00  0.86           O  
ATOM   7874  CB  ASP B 181      48.637  84.828 114.058  1.00  0.86           C  
ATOM   7875  CG  ASP B 181      47.760  85.858 113.376  1.00  0.86           C  
ATOM   7876  OD1 ASP B 181      48.149  87.048 113.361  1.00  0.86           O  
ATOM   7877  OD2 ASP B 181      46.708  85.446 112.824  1.00  0.86           O  
ATOM   7878  N   ASP B 182      47.225  85.573 117.530  1.00  0.83           N  
ATOM   7879  CA  ASP B 182      46.056  85.533 118.421  1.00  0.83           C  
ATOM   7880  C   ASP B 182      45.026  86.601 118.022  1.00  0.83           C  
ATOM   7881  O   ASP B 182      44.579  87.426 118.815  1.00  0.83           O  
ATOM   7882  CB  ASP B 182      46.574  85.664 119.898  1.00  0.83           C  
ATOM   7883  CG  ASP B 182      45.715  85.115 121.033  1.00  0.83           C  
ATOM   7884  OD1 ASP B 182      44.482  84.995 120.926  1.00  0.83           O  
ATOM   7885  OD2 ASP B 182      46.319  84.805 122.107  1.00  0.83           O  
ATOM   7886  N   TRP B 183      44.631  86.613 116.730  1.00  0.82           N  
ATOM   7887  CA  TRP B 183      43.851  87.671 116.099  1.00  0.82           C  
ATOM   7888  C   TRP B 183      42.435  87.831 116.648  1.00  0.82           C  
ATOM   7889  O   TRP B 183      41.835  88.902 116.587  1.00  0.82           O  
ATOM   7890  CB  TRP B 183      43.825  87.515 114.543  1.00  0.82           C  
ATOM   7891  CG  TRP B 183      42.957  86.402 113.959  1.00  0.82           C  
ATOM   7892  CD1 TRP B 183      43.138  85.048 114.027  1.00  0.82           C  
ATOM   7893  CD2 TRP B 183      41.734  86.601 113.210  1.00  0.82           C  
ATOM   7894  NE1 TRP B 183      42.091  84.387 113.411  1.00  0.82           N  
ATOM   7895  CE2 TRP B 183      41.226  85.329 112.904  1.00  0.82           C  
ATOM   7896  CE3 TRP B 183      41.069  87.762 112.804  1.00  0.82           C  
ATOM   7897  CZ2 TRP B 183      40.035  85.172 112.199  1.00  0.82           C  
ATOM   7898  CZ3 TRP B 183      39.872  87.608 112.080  1.00  0.82           C  
ATOM   7899  CH2 TRP B 183      39.361  86.334 111.786  1.00  0.82           C  
ATOM   7900  N   LEU B 184      41.871  86.762 117.239  1.00  0.83           N  
ATOM   7901  CA  LEU B 184      40.541  86.772 117.813  1.00  0.83           C  
ATOM   7902  C   LEU B 184      40.547  87.068 119.305  1.00  0.83           C  
ATOM   7903  O   LEU B 184      39.498  87.034 119.948  1.00  0.83           O  
ATOM   7904  CB  LEU B 184      39.876  85.389 117.607  1.00  0.83           C  
ATOM   7905  CG  LEU B 184      39.528  85.069 116.140  1.00  0.83           C  
ATOM   7906  CD1 LEU B 184      39.000  83.635 116.019  1.00  0.83           C  
ATOM   7907  CD2 LEU B 184      38.498  86.050 115.564  1.00  0.83           C  
ATOM   7908  N   ARG B 185      41.709  87.416 119.900  1.00  0.77           N  
ATOM   7909  CA  ARG B 185      41.887  87.602 121.334  1.00  0.77           C  
ATOM   7910  C   ARG B 185      40.930  88.592 121.974  1.00  0.77           C  
ATOM   7911  O   ARG B 185      40.413  88.358 123.065  1.00  0.77           O  
ATOM   7912  CB  ARG B 185      43.340  88.064 121.599  1.00  0.77           C  
ATOM   7913  CG  ARG B 185      43.688  88.400 123.059  1.00  0.77           C  
ATOM   7914  CD  ARG B 185      45.187  88.550 123.313  1.00  0.77           C  
ATOM   7915  NE  ARG B 185      45.772  87.208 123.583  1.00  0.77           N  
ATOM   7916  CZ  ARG B 185      46.919  87.003 124.237  1.00  0.77           C  
ATOM   7917  NH1 ARG B 185      47.846  87.945 124.314  1.00  0.77           N  
ATOM   7918  NH2 ARG B 185      47.125  85.820 124.798  1.00  0.77           N  
ATOM   7919  N   TYR B 186      40.648  89.717 121.295  1.00  0.81           N  
ATOM   7920  CA  TYR B 186      39.761  90.740 121.814  1.00  0.81           C  
ATOM   7921  C   TYR B 186      38.456  90.775 121.036  1.00  0.81           C  
ATOM   7922  O   TYR B 186      37.648  91.686 121.207  1.00  0.81           O  
ATOM   7923  CB  TYR B 186      40.454  92.130 121.769  1.00  0.81           C  
ATOM   7924  CG  TYR B 186      41.706  92.133 122.620  1.00  0.81           C  
ATOM   7925  CD1 TYR B 186      42.942  92.499 122.058  1.00  0.81           C  
ATOM   7926  CD2 TYR B 186      41.668  91.758 123.978  1.00  0.81           C  
ATOM   7927  CE1 TYR B 186      44.112  92.497 122.833  1.00  0.81           C  
ATOM   7928  CE2 TYR B 186      42.838  91.751 124.754  1.00  0.81           C  
ATOM   7929  CZ  TYR B 186      44.055  92.129 124.181  1.00  0.81           C  
ATOM   7930  OH  TYR B 186      45.231  92.135 124.955  1.00  0.81           O  
ATOM   7931  N   GLY B 187      38.200  89.750 120.195  1.00  0.83           N  
ATOM   7932  CA  GLY B 187      37.014  89.666 119.353  1.00  0.83           C  
ATOM   7933  C   GLY B 187      37.157  90.285 117.986  1.00  0.83           C  
ATOM   7934  O   GLY B 187      37.991  91.146 117.725  1.00  0.83           O  
ATOM   7935  N   ASN B 188      36.292  89.842 117.060  1.00  0.87           N  
ATOM   7936  CA  ASN B 188      36.239  90.277 115.680  1.00  0.87           C  
ATOM   7937  C   ASN B 188      34.883  90.962 115.498  1.00  0.87           C  
ATOM   7938  O   ASN B 188      33.866  90.320 115.759  1.00  0.87           O  
ATOM   7939  CB  ASN B 188      36.367  89.018 114.773  1.00  0.87           C  
ATOM   7940  CG  ASN B 188      36.287  89.285 113.272  1.00  0.87           C  
ATOM   7941  OD1 ASN B 188      36.204  90.418 112.796  1.00  0.87           O  
ATOM   7942  ND2 ASN B 188      36.285  88.188 112.479  1.00  0.87           N  
ATOM   7943  N   PRO B 189      34.760  92.223 115.084  1.00  0.91           N  
ATOM   7944  CA  PRO B 189      33.458  92.873 115.002  1.00  0.91           C  
ATOM   7945  C   PRO B 189      32.797  92.578 113.672  1.00  0.91           C  
ATOM   7946  O   PRO B 189      31.582  92.743 113.554  1.00  0.91           O  
ATOM   7947  CB  PRO B 189      33.804  94.365 115.141  1.00  0.91           C  
ATOM   7948  CG  PRO B 189      35.219  94.501 114.560  1.00  0.91           C  
ATOM   7949  CD  PRO B 189      35.875  93.154 114.873  1.00  0.91           C  
ATOM   7950  N   TRP B 190      33.575  92.200 112.645  1.00  0.86           N  
ATOM   7951  CA  TRP B 190      33.106  91.984 111.292  1.00  0.86           C  
ATOM   7952  C   TRP B 190      32.327  90.698 111.117  1.00  0.86           C  
ATOM   7953  O   TRP B 190      31.355  90.658 110.366  1.00  0.86           O  
ATOM   7954  CB  TRP B 190      34.290  92.023 110.295  1.00  0.86           C  
ATOM   7955  CG  TRP B 190      35.110  93.287 110.437  1.00  0.86           C  
ATOM   7956  CD1 TRP B 190      36.352  93.445 110.989  1.00  0.86           C  
ATOM   7957  CD2 TRP B 190      34.640  94.609 110.110  1.00  0.86           C  
ATOM   7958  NE1 TRP B 190      36.690  94.779 111.035  1.00  0.86           N  
ATOM   7959  CE2 TRP B 190      35.637  95.509 110.523  1.00  0.86           C  
ATOM   7960  CE3 TRP B 190      33.457  95.055 109.513  1.00  0.86           C  
ATOM   7961  CZ2 TRP B 190      35.465  96.880 110.384  1.00  0.86           C  
ATOM   7962  CZ3 TRP B 190      33.295  96.441 109.350  1.00  0.86           C  
ATOM   7963  CH2 TRP B 190      34.276  97.340 109.793  1.00  0.86           C  
ATOM   7964  N   GLU B 191      32.739  89.612 111.794  1.00  0.89           N  
ATOM   7965  CA  GLU B 191      32.049  88.341 111.718  1.00  0.89           C  
ATOM   7966  C   GLU B 191      30.735  88.296 112.486  1.00  0.89           C  
ATOM   7967  O   GLU B 191      30.538  88.928 113.524  1.00  0.89           O  
ATOM   7968  CB  GLU B 191      32.955  87.178 112.189  1.00  0.89           C  
ATOM   7969  CG  GLU B 191      33.199  87.152 113.720  1.00  0.89           C  
ATOM   7970  CD  GLU B 191      34.288  86.185 114.160  1.00  0.89           C  
ATOM   7971  OE1 GLU B 191      35.005  85.611 113.301  1.00  0.89           O  
ATOM   7972  OE2 GLU B 191      34.459  85.995 115.392  1.00  0.89           O  
ATOM   7973  N   LYS B 192      29.780  87.502 111.986  1.00  0.82           N  
ATOM   7974  CA  LYS B 192      28.577  87.165 112.703  1.00  0.82           C  
ATOM   7975  C   LYS B 192      28.379  85.661 112.662  1.00  0.82           C  
ATOM   7976  O   LYS B 192      28.207  85.052 111.606  1.00  0.82           O  
ATOM   7977  CB  LYS B 192      27.351  87.892 112.089  1.00  0.82           C  
ATOM   7978  CG  LYS B 192      25.979  87.519 112.687  1.00  0.82           C  
ATOM   7979  CD  LYS B 192      25.810  87.885 114.173  1.00  0.82           C  
ATOM   7980  CE  LYS B 192      24.407  87.576 114.715  1.00  0.82           C  
ATOM   7981  NZ  LYS B 192      24.145  86.122 114.806  1.00  0.82           N  
ATOM   7982  N   ALA B 193      28.365  85.005 113.844  1.00  0.86           N  
ATOM   7983  CA  ALA B 193      28.007  83.606 113.975  1.00  0.86           C  
ATOM   7984  C   ALA B 193      26.606  83.296 113.460  1.00  0.86           C  
ATOM   7985  O   ALA B 193      25.674  84.091 113.628  1.00  0.86           O  
ATOM   7986  CB  ALA B 193      28.065  83.157 115.449  1.00  0.86           C  
ATOM   7987  N   ARG B 194      26.434  82.122 112.827  1.00  0.81           N  
ATOM   7988  CA  ARG B 194      25.162  81.656 112.306  1.00  0.81           C  
ATOM   7989  C   ARG B 194      24.731  80.348 112.972  1.00  0.81           C  
ATOM   7990  O   ARG B 194      24.907  79.282 112.374  1.00  0.81           O  
ATOM   7991  CB  ARG B 194      25.268  81.431 110.782  1.00  0.81           C  
ATOM   7992  CG  ARG B 194      25.786  82.641 109.983  1.00  0.81           C  
ATOM   7993  CD  ARG B 194      24.977  83.931 110.136  1.00  0.81           C  
ATOM   7994  NE  ARG B 194      23.526  83.590 109.949  1.00  0.81           N  
ATOM   7995  CZ  ARG B 194      22.867  83.740 108.798  1.00  0.81           C  
ATOM   7996  NH1 ARG B 194      23.447  84.156 107.679  1.00  0.81           N  
ATOM   7997  NH2 ARG B 194      21.577  83.423 108.772  1.00  0.81           N  
ATOM   7998  N   PRO B 195      24.189  80.346 114.200  1.00  0.79           N  
ATOM   7999  CA  PRO B 195      23.947  79.136 114.982  1.00  0.79           C  
ATOM   8000  C   PRO B 195      23.022  78.134 114.340  1.00  0.79           C  
ATOM   8001  O   PRO B 195      23.117  76.949 114.668  1.00  0.79           O  
ATOM   8002  CB  PRO B 195      23.316  79.658 116.287  1.00  0.79           C  
ATOM   8003  CG  PRO B 195      23.847  81.082 116.413  1.00  0.79           C  
ATOM   8004  CD  PRO B 195      23.834  81.545 114.961  1.00  0.79           C  
ATOM   8005  N   GLU B 196      22.100  78.601 113.479  1.00  0.80           N  
ATOM   8006  CA  GLU B 196      21.075  77.814 112.842  1.00  0.80           C  
ATOM   8007  C   GLU B 196      21.598  76.955 111.708  1.00  0.80           C  
ATOM   8008  O   GLU B 196      20.948  76.006 111.273  1.00  0.80           O  
ATOM   8009  CB  GLU B 196      19.922  78.739 112.356  1.00  0.80           C  
ATOM   8010  CG  GLU B 196      20.185  79.749 111.187  1.00  0.80           C  
ATOM   8011  CD  GLU B 196      20.895  81.070 111.496  1.00  0.80           C  
ATOM   8012  OE1 GLU B 196      20.607  82.069 110.771  1.00  0.80           O  
ATOM   8013  OE2 GLU B 196      21.727  81.147 112.428  1.00  0.80           O  
ATOM   8014  N   PHE B 197      22.818  77.238 111.218  1.00  0.83           N  
ATOM   8015  CA  PHE B 197      23.377  76.527 110.089  1.00  0.83           C  
ATOM   8016  C   PHE B 197      24.498  75.577 110.473  1.00  0.83           C  
ATOM   8017  O   PHE B 197      25.118  74.984 109.591  1.00  0.83           O  
ATOM   8018  CB  PHE B 197      23.876  77.532 109.015  1.00  0.83           C  
ATOM   8019  CG  PHE B 197      22.716  78.181 108.304  1.00  0.83           C  
ATOM   8020  CD1 PHE B 197      21.696  77.405 107.725  1.00  0.83           C  
ATOM   8021  CD2 PHE B 197      22.642  79.578 108.182  1.00  0.83           C  
ATOM   8022  CE1 PHE B 197      20.618  77.999 107.062  1.00  0.83           C  
ATOM   8023  CE2 PHE B 197      21.570  80.176 107.505  1.00  0.83           C  
ATOM   8024  CZ  PHE B 197      20.552  79.390 106.956  1.00  0.83           C  
ATOM   8025  N   THR B 198      24.745  75.354 111.780  1.00  0.86           N  
ATOM   8026  CA  THR B 198      25.701  74.373 112.311  1.00  0.86           C  
ATOM   8027  C   THR B 198      25.465  72.962 111.793  1.00  0.86           C  
ATOM   8028  O   THR B 198      24.335  72.482 111.741  1.00  0.86           O  
ATOM   8029  CB  THR B 198      25.673  74.326 113.840  1.00  0.86           C  
ATOM   8030  OG1 THR B 198      26.056  75.587 114.373  1.00  0.86           O  
ATOM   8031  CG2 THR B 198      26.644  73.298 114.449  1.00  0.86           C  
ATOM   8032  N   LEU B 199      26.541  72.265 111.369  1.00  0.91           N  
ATOM   8033  CA  LEU B 199      26.448  70.967 110.716  1.00  0.91           C  
ATOM   8034  C   LEU B 199      27.386  69.937 111.338  1.00  0.91           C  
ATOM   8035  O   LEU B 199      28.459  70.310 111.813  1.00  0.91           O  
ATOM   8036  CB  LEU B 199      26.844  71.089 109.224  1.00  0.91           C  
ATOM   8037  CG  LEU B 199      25.788  71.777 108.342  1.00  0.91           C  
ATOM   8038  CD1 LEU B 199      26.432  72.235 107.031  1.00  0.91           C  
ATOM   8039  CD2 LEU B 199      24.593  70.853 108.064  1.00  0.91           C  
ATOM   8040  N   PRO B 200      27.064  68.644 111.372  1.00  0.93           N  
ATOM   8041  CA  PRO B 200      28.014  67.605 111.744  1.00  0.93           C  
ATOM   8042  C   PRO B 200      28.979  67.243 110.616  1.00  0.93           C  
ATOM   8043  O   PRO B 200      28.604  67.175 109.446  1.00  0.93           O  
ATOM   8044  CB  PRO B 200      27.099  66.420 112.099  1.00  0.93           C  
ATOM   8045  CG  PRO B 200      25.906  66.573 111.148  1.00  0.93           C  
ATOM   8046  CD  PRO B 200      25.748  68.093 111.027  1.00  0.93           C  
ATOM   8047  N   VAL B 201      30.247  66.983 110.965  1.00  0.93           N  
ATOM   8048  CA  VAL B 201      31.269  66.430 110.098  1.00  0.93           C  
ATOM   8049  C   VAL B 201      31.722  65.117 110.723  1.00  0.93           C  
ATOM   8050  O   VAL B 201      31.852  65.007 111.939  1.00  0.93           O  
ATOM   8051  CB  VAL B 201      32.465  67.369 109.928  1.00  0.93           C  
ATOM   8052  CG1 VAL B 201      33.531  66.742 109.007  1.00  0.93           C  
ATOM   8053  CG2 VAL B 201      31.981  68.705 109.326  1.00  0.93           C  
ATOM   8054  N   HIS B 202      31.949  64.070 109.903  1.00  0.90           N  
ATOM   8055  CA  HIS B 202      32.247  62.720 110.365  1.00  0.90           C  
ATOM   8056  C   HIS B 202      33.664  62.298 110.028  1.00  0.90           C  
ATOM   8057  O   HIS B 202      34.133  62.508 108.917  1.00  0.90           O  
ATOM   8058  CB  HIS B 202      31.314  61.690 109.692  1.00  0.90           C  
ATOM   8059  CG  HIS B 202      29.884  61.901 110.064  1.00  0.90           C  
ATOM   8060  ND1 HIS B 202      29.353  61.236 111.150  1.00  0.90           N  
ATOM   8061  CD2 HIS B 202      28.965  62.745 109.528  1.00  0.90           C  
ATOM   8062  CE1 HIS B 202      28.116  61.688 111.256  1.00  0.90           C  
ATOM   8063  NE2 HIS B 202      27.834  62.605 110.300  1.00  0.90           N  
ATOM   8064  N   PHE B 203      34.373  61.670 110.979  1.00  0.91           N  
ATOM   8065  CA  PHE B 203      35.742  61.214 110.808  1.00  0.91           C  
ATOM   8066  C   PHE B 203      35.917  59.792 111.317  1.00  0.91           C  
ATOM   8067  O   PHE B 203      35.153  59.315 112.157  1.00  0.91           O  
ATOM   8068  CB  PHE B 203      36.722  62.081 111.643  1.00  0.91           C  
ATOM   8069  CG  PHE B 203      36.828  63.470 111.093  1.00  0.91           C  
ATOM   8070  CD1 PHE B 203      37.692  63.723 110.017  1.00  0.91           C  
ATOM   8071  CD2 PHE B 203      36.107  64.536 111.659  1.00  0.91           C  
ATOM   8072  CE1 PHE B 203      37.859  65.023 109.531  1.00  0.91           C  
ATOM   8073  CE2 PHE B 203      36.269  65.840 111.171  1.00  0.91           C  
ATOM   8074  CZ  PHE B 203      37.148  66.082 110.108  1.00  0.91           C  
ATOM   8075  N   TYR B 204      36.974  59.098 110.839  1.00  0.89           N  
ATOM   8076  CA  TYR B 204      37.307  57.719 111.174  1.00  0.89           C  
ATOM   8077  C   TYR B 204      36.170  56.742 110.877  1.00  0.89           C  
ATOM   8078  O   TYR B 204      35.607  56.760 109.786  1.00  0.89           O  
ATOM   8079  CB  TYR B 204      37.865  57.566 112.621  1.00  0.89           C  
ATOM   8080  CG  TYR B 204      39.076  58.435 112.859  1.00  0.89           C  
ATOM   8081  CD1 TYR B 204      38.946  59.635 113.577  1.00  0.89           C  
ATOM   8082  CD2 TYR B 204      40.359  58.035 112.437  1.00  0.89           C  
ATOM   8083  CE1 TYR B 204      40.069  60.412 113.884  1.00  0.89           C  
ATOM   8084  CE2 TYR B 204      41.489  58.817 112.733  1.00  0.89           C  
ATOM   8085  CZ  TYR B 204      41.337  59.989 113.480  1.00  0.89           C  
ATOM   8086  OH  TYR B 204      42.447  60.748 113.884  1.00  0.89           O  
ATOM   8087  N   GLY B 205      35.798  55.847 111.820  1.00  0.89           N  
ATOM   8088  CA  GLY B 205      34.819  54.793 111.561  1.00  0.89           C  
ATOM   8089  C   GLY B 205      35.212  53.767 110.526  1.00  0.89           C  
ATOM   8090  O   GLY B 205      36.359  53.683 110.101  1.00  0.89           O  
ATOM   8091  N   HIS B 206      34.249  52.928 110.117  1.00  0.85           N  
ATOM   8092  CA  HIS B 206      34.482  51.841 109.182  1.00  0.85           C  
ATOM   8093  C   HIS B 206      33.382  51.789 108.138  1.00  0.85           C  
ATOM   8094  O   HIS B 206      32.316  52.388 108.278  1.00  0.85           O  
ATOM   8095  CB  HIS B 206      34.557  50.473 109.902  1.00  0.85           C  
ATOM   8096  CG  HIS B 206      35.761  50.375 110.784  1.00  0.85           C  
ATOM   8097  ND1 HIS B 206      36.996  50.179 110.200  1.00  0.85           N  
ATOM   8098  CD2 HIS B 206      35.892  50.528 112.128  1.00  0.85           C  
ATOM   8099  CE1 HIS B 206      37.858  50.222 111.195  1.00  0.85           C  
ATOM   8100  NE2 HIS B 206      37.243  50.429 112.385  1.00  0.85           N  
ATOM   8101  N   VAL B 207      33.620  51.068 107.024  1.00  0.87           N  
ATOM   8102  CA  VAL B 207      32.628  50.897 105.971  1.00  0.87           C  
ATOM   8103  C   VAL B 207      31.960  49.549 106.124  1.00  0.87           C  
ATOM   8104  O   VAL B 207      32.620  48.519 106.243  1.00  0.87           O  
ATOM   8105  CB  VAL B 207      33.196  51.005 104.556  1.00  0.87           C  
ATOM   8106  CG1 VAL B 207      32.087  50.806 103.498  1.00  0.87           C  
ATOM   8107  CG2 VAL B 207      33.807  52.402 104.366  1.00  0.87           C  
ATOM   8108  N   GLU B 208      30.619  49.536 106.094  1.00  0.81           N  
ATOM   8109  CA  GLU B 208      29.826  48.334 106.161  1.00  0.81           C  
ATOM   8110  C   GLU B 208      29.051  48.195 104.864  1.00  0.81           C  
ATOM   8111  O   GLU B 208      28.328  49.091 104.431  1.00  0.81           O  
ATOM   8112  CB  GLU B 208      28.845  48.385 107.350  1.00  0.81           C  
ATOM   8113  CG  GLU B 208      28.163  47.031 107.647  1.00  0.81           C  
ATOM   8114  CD  GLU B 208      26.948  47.193 108.555  1.00  0.81           C  
ATOM   8115  OE1 GLU B 208      25.983  47.883 108.125  1.00  0.81           O  
ATOM   8116  OE2 GLU B 208      26.961  46.619 109.669  1.00  0.81           O  
ATOM   8117  N   HIS B 209      29.218  47.053 104.178  1.00  0.78           N  
ATOM   8118  CA  HIS B 209      28.515  46.764 102.943  1.00  0.78           C  
ATOM   8119  C   HIS B 209      27.311  45.882 103.231  1.00  0.78           C  
ATOM   8120  O   HIS B 209      27.432  44.661 103.279  1.00  0.78           O  
ATOM   8121  CB  HIS B 209      29.458  46.049 101.947  1.00  0.78           C  
ATOM   8122  CG  HIS B 209      30.579  46.934 101.476  1.00  0.78           C  
ATOM   8123  ND1 HIS B 209      30.322  47.872 100.496  1.00  0.78           N  
ATOM   8124  CD2 HIS B 209      31.890  46.988 101.842  1.00  0.78           C  
ATOM   8125  CE1 HIS B 209      31.473  48.473 100.277  1.00  0.78           C  
ATOM   8126  NE2 HIS B 209      32.455  47.978 101.066  1.00  0.78           N  
ATOM   8127  N   THR B 210      26.112  46.472 103.432  1.00  0.78           N  
ATOM   8128  CA  THR B 210      24.900  45.697 103.715  1.00  0.78           C  
ATOM   8129  C   THR B 210      24.020  45.635 102.482  1.00  0.78           C  
ATOM   8130  O   THR B 210      24.238  46.295 101.469  1.00  0.78           O  
ATOM   8131  CB  THR B 210      24.095  46.084 104.956  1.00  0.78           C  
ATOM   8132  OG1 THR B 210      23.813  47.460 104.933  1.00  0.78           O  
ATOM   8133  CG2 THR B 210      24.876  45.869 106.227  1.00  0.78           C  
ATOM   8134  N   SER B 211      22.964  44.796 102.518  1.00  0.72           N  
ATOM   8135  CA  SER B 211      21.948  44.677 101.473  1.00  0.72           C  
ATOM   8136  C   SER B 211      21.127  45.945 101.285  1.00  0.72           C  
ATOM   8137  O   SER B 211      20.361  46.066 100.336  1.00  0.72           O  
ATOM   8138  CB  SER B 211      20.966  43.507 101.766  1.00  0.72           C  
ATOM   8139  OG  SER B 211      20.393  43.617 103.074  1.00  0.72           O  
ATOM   8140  N   GLN B 212      21.302  46.941 102.175  1.00  0.55           N  
ATOM   8141  CA  GLN B 212      20.677  48.242 102.084  1.00  0.55           C  
ATOM   8142  C   GLN B 212      21.590  49.256 101.406  1.00  0.55           C  
ATOM   8143  O   GLN B 212      21.238  50.428 101.275  1.00  0.55           O  
ATOM   8144  CB  GLN B 212      20.401  48.787 103.511  1.00  0.55           C  
ATOM   8145  CG  GLN B 212      19.506  47.879 104.385  1.00  0.55           C  
ATOM   8146  CD  GLN B 212      18.081  47.794 103.835  1.00  0.55           C  
ATOM   8147  OE1 GLN B 212      17.395  48.806 103.702  1.00  0.55           O  
ATOM   8148  NE2 GLN B 212      17.609  46.563 103.539  1.00  0.55           N  
ATOM   8149  N   GLY B 213      22.797  48.839 100.972  1.00  0.72           N  
ATOM   8150  CA  GLY B 213      23.789  49.719 100.379  1.00  0.72           C  
ATOM   8151  C   GLY B 213      25.019  49.855 101.232  1.00  0.72           C  
ATOM   8152  O   GLY B 213      25.189  49.208 102.265  1.00  0.72           O  
ATOM   8153  N   ALA B 214      25.936  50.731 100.792  1.00  0.88           N  
ATOM   8154  CA  ALA B 214      27.172  51.001 101.486  1.00  0.88           C  
ATOM   8155  C   ALA B 214      26.964  52.032 102.582  1.00  0.88           C  
ATOM   8156  O   ALA B 214      26.403  53.104 102.367  1.00  0.88           O  
ATOM   8157  CB  ALA B 214      28.247  51.497 100.498  1.00  0.88           C  
ATOM   8158  N   LYS B 215      27.397  51.716 103.812  1.00  0.83           N  
ATOM   8159  CA  LYS B 215      27.254  52.607 104.940  1.00  0.83           C  
ATOM   8160  C   LYS B 215      28.598  52.899 105.566  1.00  0.83           C  
ATOM   8161  O   LYS B 215      29.495  52.065 105.620  1.00  0.83           O  
ATOM   8162  CB  LYS B 215      26.308  52.033 106.021  1.00  0.83           C  
ATOM   8163  CG  LYS B 215      24.834  51.983 105.593  1.00  0.83           C  
ATOM   8164  CD  LYS B 215      23.966  51.358 106.694  1.00  0.83           C  
ATOM   8165  CE  LYS B 215      22.487  51.285 106.325  1.00  0.83           C  
ATOM   8166  NZ  LYS B 215      21.754  50.586 107.400  1.00  0.83           N  
ATOM   8167  N   TRP B 216      28.754  54.131 106.073  1.00  0.80           N  
ATOM   8168  CA  TRP B 216      29.900  54.562 106.837  1.00  0.80           C  
ATOM   8169  C   TRP B 216      29.409  54.675 108.268  1.00  0.80           C  
ATOM   8170  O   TRP B 216      28.495  55.445 108.553  1.00  0.80           O  
ATOM   8171  CB  TRP B 216      30.407  55.924 106.282  1.00  0.80           C  
ATOM   8172  CG  TRP B 216      31.723  56.465 106.825  1.00  0.80           C  
ATOM   8173  CD1 TRP B 216      32.732  55.828 107.497  1.00  0.80           C  
ATOM   8174  CD2 TRP B 216      32.144  57.835 106.669  1.00  0.80           C  
ATOM   8175  NE1 TRP B 216      33.753  56.712 107.764  1.00  0.80           N  
ATOM   8176  CE2 TRP B 216      33.415  57.947 107.273  1.00  0.80           C  
ATOM   8177  CE3 TRP B 216      31.532  58.937 106.073  1.00  0.80           C  
ATOM   8178  CZ2 TRP B 216      34.093  59.157 107.300  1.00  0.80           C  
ATOM   8179  CZ3 TRP B 216      32.221  60.160 106.091  1.00  0.80           C  
ATOM   8180  CH2 TRP B 216      33.487  60.267 106.692  1.00  0.80           C  
ATOM   8181  N   VAL B 217      29.954  53.851 109.180  1.00  0.87           N  
ATOM   8182  CA  VAL B 217      29.453  53.706 110.539  1.00  0.87           C  
ATOM   8183  C   VAL B 217      30.596  53.809 111.532  1.00  0.87           C  
ATOM   8184  O   VAL B 217      31.766  53.867 111.155  1.00  0.87           O  
ATOM   8185  CB  VAL B 217      28.657  52.418 110.784  1.00  0.87           C  
ATOM   8186  CG1 VAL B 217      27.374  52.414 109.928  1.00  0.87           C  
ATOM   8187  CG2 VAL B 217      29.499  51.158 110.501  1.00  0.87           C  
ATOM   8188  N   ASP B 218      30.261  53.911 112.837  1.00  0.81           N  
ATOM   8189  CA  ASP B 218      31.178  54.046 113.959  1.00  0.81           C  
ATOM   8190  C   ASP B 218      32.081  55.277 113.902  1.00  0.81           C  
ATOM   8191  O   ASP B 218      33.230  55.284 114.340  1.00  0.81           O  
ATOM   8192  CB  ASP B 218      31.963  52.735 114.186  1.00  0.81           C  
ATOM   8193  CG  ASP B 218      30.972  51.597 114.344  1.00  0.81           C  
ATOM   8194  OD1 ASP B 218      29.969  51.794 115.080  1.00  0.81           O  
ATOM   8195  OD2 ASP B 218      31.197  50.541 113.705  1.00  0.81           O  
ATOM   8196  N   THR B 219      31.547  56.387 113.369  1.00  0.83           N  
ATOM   8197  CA  THR B 219      32.281  57.621 113.153  1.00  0.83           C  
ATOM   8198  C   THR B 219      32.417  58.500 114.383  1.00  0.83           C  
ATOM   8199  O   THR B 219      31.608  58.530 115.317  1.00  0.83           O  
ATOM   8200  CB  THR B 219      31.709  58.471 112.021  1.00  0.83           C  
ATOM   8201  OG1 THR B 219      30.313  58.694 112.197  1.00  0.83           O  
ATOM   8202  CG2 THR B 219      31.900  57.702 110.706  1.00  0.83           C  
ATOM   8203  N   GLN B 220      33.493  59.306 114.396  1.00  0.80           N  
ATOM   8204  CA  GLN B 220      33.624  60.410 115.314  1.00  0.80           C  
ATOM   8205  C   GLN B 220      33.009  61.632 114.673  1.00  0.80           C  
ATOM   8206  O   GLN B 220      33.211  61.900 113.494  1.00  0.80           O  
ATOM   8207  CB  GLN B 220      35.088  60.719 115.695  1.00  0.80           C  
ATOM   8208  CG  GLN B 220      35.702  59.627 116.598  1.00  0.80           C  
ATOM   8209  CD  GLN B 220      37.080  60.031 117.117  1.00  0.80           C  
ATOM   8210  OE1 GLN B 220      38.108  59.505 116.702  1.00  0.80           O  
ATOM   8211  NE2 GLN B 220      37.113  60.996 118.065  1.00  0.80           N  
ATOM   8212  N   VAL B 221      32.229  62.399 115.448  1.00  0.87           N  
ATOM   8213  CA  VAL B 221      31.514  63.554 114.943  1.00  0.87           C  
ATOM   8214  C   VAL B 221      32.188  64.796 115.482  1.00  0.87           C  
ATOM   8215  O   VAL B 221      32.490  64.893 116.670  1.00  0.87           O  
ATOM   8216  CB  VAL B 221      30.042  63.548 115.361  1.00  0.87           C  
ATOM   8217  CG1 VAL B 221      29.315  64.830 114.896  1.00  0.87           C  
ATOM   8218  CG2 VAL B 221      29.345  62.313 114.758  1.00  0.87           C  
ATOM   8219  N   VAL B 222      32.441  65.775 114.604  1.00  0.89           N  
ATOM   8220  CA  VAL B 222      32.919  67.099 114.948  1.00  0.89           C  
ATOM   8221  C   VAL B 222      31.865  68.042 114.410  1.00  0.89           C  
ATOM   8222  O   VAL B 222      31.362  67.853 113.308  1.00  0.89           O  
ATOM   8223  CB  VAL B 222      34.285  67.390 114.328  1.00  0.89           C  
ATOM   8224  CG1 VAL B 222      34.729  68.839 114.610  1.00  0.89           C  
ATOM   8225  CG2 VAL B 222      35.317  66.404 114.913  1.00  0.89           C  
ATOM   8226  N   LEU B 223      31.443  69.068 115.168  1.00  0.89           N  
ATOM   8227  CA  LEU B 223      30.461  70.018 114.680  1.00  0.89           C  
ATOM   8228  C   LEU B 223      31.149  71.187 114.005  1.00  0.89           C  
ATOM   8229  O   LEU B 223      32.202  71.652 114.433  1.00  0.89           O  
ATOM   8230  CB  LEU B 223      29.546  70.569 115.802  1.00  0.89           C  
ATOM   8231  CG  LEU B 223      28.695  69.509 116.530  1.00  0.89           C  
ATOM   8232  CD1 LEU B 223      27.866  70.179 117.636  1.00  0.89           C  
ATOM   8233  CD2 LEU B 223      27.762  68.742 115.579  1.00  0.89           C  
ATOM   8234  N   ALA B 224      30.553  71.699 112.920  1.00  0.94           N  
ATOM   8235  CA  ALA B 224      31.054  72.831 112.184  1.00  0.94           C  
ATOM   8236  C   ALA B 224      30.110  74.007 112.361  1.00  0.94           C  
ATOM   8237  O   ALA B 224      28.971  73.991 111.899  1.00  0.94           O  
ATOM   8238  CB  ALA B 224      31.168  72.473 110.689  1.00  0.94           C  
ATOM   8239  N   MET B 225      30.578  75.065 113.047  1.00  0.90           N  
ATOM   8240  CA  MET B 225      29.810  76.261 113.343  1.00  0.90           C  
ATOM   8241  C   MET B 225      30.189  77.393 112.384  1.00  0.90           C  
ATOM   8242  O   MET B 225      31.347  77.822 112.405  1.00  0.90           O  
ATOM   8243  CB  MET B 225      30.086  76.699 114.802  1.00  0.90           C  
ATOM   8244  CG  MET B 225      29.293  77.933 115.273  1.00  0.90           C  
ATOM   8245  SD  MET B 225      29.560  78.292 117.034  1.00  0.90           S  
ATOM   8246  CE  MET B 225      28.639  79.852 117.005  1.00  0.90           C  
ATOM   8247  N   PRO B 226      29.314  77.899 111.514  1.00  0.96           N  
ATOM   8248  CA  PRO B 226      29.691  78.899 110.527  1.00  0.96           C  
ATOM   8249  C   PRO B 226      29.609  80.315 111.047  1.00  0.96           C  
ATOM   8250  O   PRO B 226      28.710  80.677 111.807  1.00  0.96           O  
ATOM   8251  CB  PRO B 226      28.696  78.701 109.377  1.00  0.96           C  
ATOM   8252  CG  PRO B 226      27.455  78.085 110.028  1.00  0.96           C  
ATOM   8253  CD  PRO B 226      27.989  77.337 111.251  1.00  0.96           C  
ATOM   8254  N   TYR B 227      30.563  81.141 110.604  1.00  0.93           N  
ATOM   8255  CA  TYR B 227      30.603  82.558 110.860  1.00  0.93           C  
ATOM   8256  C   TYR B 227      30.617  83.262 109.514  1.00  0.93           C  
ATOM   8257  O   TYR B 227      31.453  82.972 108.660  1.00  0.93           O  
ATOM   8258  CB  TYR B 227      31.880  82.961 111.651  1.00  0.93           C  
ATOM   8259  CG  TYR B 227      31.857  82.502 113.095  1.00  0.93           C  
ATOM   8260  CD1 TYR B 227      31.805  83.449 114.136  1.00  0.93           C  
ATOM   8261  CD2 TYR B 227      31.972  81.140 113.439  1.00  0.93           C  
ATOM   8262  CE1 TYR B 227      31.856  83.047 115.479  1.00  0.93           C  
ATOM   8263  CE2 TYR B 227      31.995  80.733 114.781  1.00  0.93           C  
ATOM   8264  CZ  TYR B 227      31.931  81.688 115.800  1.00  0.93           C  
ATOM   8265  OH  TYR B 227      31.934  81.283 117.150  1.00  0.93           O  
ATOM   8266  N   ASP B 228      29.677  84.202 109.298  1.00  0.92           N  
ATOM   8267  CA  ASP B 228      29.569  84.965 108.071  1.00  0.92           C  
ATOM   8268  C   ASP B 228      30.228  86.337 108.253  1.00  0.92           C  
ATOM   8269  O   ASP B 228      29.943  87.066 109.201  1.00  0.92           O  
ATOM   8270  CB  ASP B 228      28.079  85.195 107.668  1.00  0.92           C  
ATOM   8271  CG  ASP B 228      27.355  83.961 107.163  1.00  0.92           C  
ATOM   8272  OD1 ASP B 228      26.095  84.020 107.041  1.00  0.92           O  
ATOM   8273  OD2 ASP B 228      27.978  82.913 106.871  1.00  0.92           O  
ATOM   8274  N   THR B 229      31.116  86.725 107.320  1.00  0.95           N  
ATOM   8275  CA  THR B 229      31.797  88.021 107.296  1.00  0.95           C  
ATOM   8276  C   THR B 229      31.363  88.737 106.026  1.00  0.95           C  
ATOM   8277  O   THR B 229      31.365  88.101 104.966  1.00  0.95           O  
ATOM   8278  CB  THR B 229      33.325  87.890 107.292  1.00  0.95           C  
ATOM   8279  OG1 THR B 229      33.766  87.423 108.559  1.00  0.95           O  
ATOM   8280  CG2 THR B 229      34.056  89.224 107.065  1.00  0.95           C  
ATOM   8281  N   PRO B 230      30.964  90.015 106.027  1.00  0.95           N  
ATOM   8282  CA  PRO B 230      30.494  90.687 104.821  1.00  0.95           C  
ATOM   8283  C   PRO B 230      31.612  91.026 103.850  1.00  0.95           C  
ATOM   8284  O   PRO B 230      32.705  91.421 104.252  1.00  0.95           O  
ATOM   8285  CB  PRO B 230      29.858  91.979 105.357  1.00  0.95           C  
ATOM   8286  CG  PRO B 230      30.664  92.293 106.619  1.00  0.95           C  
ATOM   8287  CD  PRO B 230      30.917  90.902 107.198  1.00  0.95           C  
ATOM   8288  N   VAL B 231      31.335  90.892 102.546  1.00  0.96           N  
ATOM   8289  CA  VAL B 231      32.237  91.275 101.479  1.00  0.96           C  
ATOM   8290  C   VAL B 231      31.572  92.397 100.680  1.00  0.96           C  
ATOM   8291  O   VAL B 231      30.693  92.109  99.863  1.00  0.96           O  
ATOM   8292  CB  VAL B 231      32.508  90.099 100.543  1.00  0.96           C  
ATOM   8293  CG1 VAL B 231      33.541  90.500  99.476  1.00  0.96           C  
ATOM   8294  CG2 VAL B 231      33.016  88.883 101.346  1.00  0.96           C  
ATOM   8295  N   PRO B 232      31.915  93.671 100.834  1.00  0.97           N  
ATOM   8296  CA  PRO B 232      31.190  94.741 100.157  1.00  0.97           C  
ATOM   8297  C   PRO B 232      31.749  94.988  98.771  1.00  0.97           C  
ATOM   8298  O   PRO B 232      32.963  95.076  98.596  1.00  0.97           O  
ATOM   8299  CB  PRO B 232      31.415  95.960 101.069  1.00  0.97           C  
ATOM   8300  CG  PRO B 232      32.771  95.692 101.731  1.00  0.97           C  
ATOM   8301  CD  PRO B 232      32.768  94.174 101.915  1.00  0.97           C  
ATOM   8302  N   GLY B 233      30.880  95.122  97.754  1.00  0.95           N  
ATOM   8303  CA  GLY B 233      31.291  95.559  96.430  1.00  0.95           C  
ATOM   8304  C   GLY B 233      31.651  97.019  96.390  1.00  0.95           C  
ATOM   8305  O   GLY B 233      31.151  97.835  97.162  1.00  0.95           O  
ATOM   8306  N   TYR B 234      32.540  97.409  95.464  1.00  0.88           N  
ATOM   8307  CA  TYR B 234      32.910  98.800  95.299  1.00  0.88           C  
ATOM   8308  C   TYR B 234      31.803  99.641  94.665  1.00  0.88           C  
ATOM   8309  O   TYR B 234      31.523  99.534  93.473  1.00  0.88           O  
ATOM   8310  CB  TYR B 234      34.219  98.909  94.476  1.00  0.88           C  
ATOM   8311  CG  TYR B 234      34.672 100.345  94.348  1.00  0.88           C  
ATOM   8312  CD1 TYR B 234      35.285 101.006  95.425  1.00  0.88           C  
ATOM   8313  CD2 TYR B 234      34.399 101.065  93.172  1.00  0.88           C  
ATOM   8314  CE1 TYR B 234      35.630 102.361  95.327  1.00  0.88           C  
ATOM   8315  CE2 TYR B 234      34.735 102.422  93.072  1.00  0.88           C  
ATOM   8316  CZ  TYR B 234      35.361 103.060  94.148  1.00  0.88           C  
ATOM   8317  OH  TYR B 234      35.737 104.409  94.042  1.00  0.88           O  
ATOM   8318  N   ARG B 235      31.184 100.533  95.470  1.00  0.80           N  
ATOM   8319  CA  ARG B 235      30.200 101.520  95.054  1.00  0.80           C  
ATOM   8320  C   ARG B 235      28.997 100.949  94.312  1.00  0.80           C  
ATOM   8321  O   ARG B 235      28.495 101.525  93.349  1.00  0.80           O  
ATOM   8322  CB  ARG B 235      30.827 102.705  94.266  1.00  0.80           C  
ATOM   8323  CG  ARG B 235      31.773 103.607  95.089  1.00  0.80           C  
ATOM   8324  CD  ARG B 235      32.179 104.885  94.337  1.00  0.80           C  
ATOM   8325  NE  ARG B 235      33.095 105.667  95.230  1.00  0.80           N  
ATOM   8326  CZ  ARG B 235      33.772 106.762  94.843  1.00  0.80           C  
ATOM   8327  NH1 ARG B 235      34.704 107.263  95.650  1.00  0.80           N  
ATOM   8328  NH2 ARG B 235      33.540 107.349  93.677  1.00  0.80           N  
ATOM   8329  N   ASN B 236      28.469  99.814  94.793  1.00  0.84           N  
ATOM   8330  CA  ASN B 236      27.251  99.233  94.282  1.00  0.84           C  
ATOM   8331  C   ASN B 236      26.348  98.877  95.462  1.00  0.84           C  
ATOM   8332  O   ASN B 236      26.545  99.321  96.598  1.00  0.84           O  
ATOM   8333  CB  ASN B 236      27.545  98.071  93.275  1.00  0.84           C  
ATOM   8334  CG  ASN B 236      28.192  96.838  93.903  1.00  0.84           C  
ATOM   8335  OD1 ASN B 236      28.238  96.669  95.119  1.00  0.84           O  
ATOM   8336  ND2 ASN B 236      28.656  95.903  93.045  1.00  0.84           N  
ATOM   8337  N   ASN B 237      25.298  98.075  95.217  1.00  0.73           N  
ATOM   8338  CA  ASN B 237      24.378  97.667  96.263  1.00  0.73           C  
ATOM   8339  C   ASN B 237      24.679  96.268  96.772  1.00  0.73           C  
ATOM   8340  O   ASN B 237      23.912  95.725  97.562  1.00  0.73           O  
ATOM   8341  CB  ASN B 237      22.924  97.710  95.736  1.00  0.73           C  
ATOM   8342  CG  ASN B 237      22.566  99.167  95.489  1.00  0.73           C  
ATOM   8343  OD1 ASN B 237      22.661  99.997  96.392  1.00  0.73           O  
ATOM   8344  ND2 ASN B 237      22.150  99.497  94.247  1.00  0.73           N  
ATOM   8345  N   VAL B 238      25.797  95.659  96.342  1.00  0.89           N  
ATOM   8346  CA  VAL B 238      26.094  94.258  96.582  1.00  0.89           C  
ATOM   8347  C   VAL B 238      26.988  94.081  97.785  1.00  0.89           C  
ATOM   8348  O   VAL B 238      28.092  94.614  97.882  1.00  0.89           O  
ATOM   8349  CB  VAL B 238      26.746  93.610  95.362  1.00  0.89           C  
ATOM   8350  CG1 VAL B 238      27.161  92.145  95.627  1.00  0.89           C  
ATOM   8351  CG2 VAL B 238      25.732  93.665  94.203  1.00  0.89           C  
ATOM   8352  N   VAL B 239      26.524  93.285  98.757  1.00  0.93           N  
ATOM   8353  CA  VAL B 239      27.358  92.800  99.836  1.00  0.93           C  
ATOM   8354  C   VAL B 239      27.270  91.280  99.876  1.00  0.93           C  
ATOM   8355  O   VAL B 239      26.244  90.679 100.196  1.00  0.93           O  
ATOM   8356  CB  VAL B 239      26.986  93.426 101.170  1.00  0.93           C  
ATOM   8357  CG1 VAL B 239      27.927  92.924 102.280  1.00  0.93           C  
ATOM   8358  CG2 VAL B 239      27.096  94.962 101.074  1.00  0.93           C  
ATOM   8359  N   ASN B 240      28.379  90.605  99.527  1.00  0.93           N  
ATOM   8360  CA  ASN B 240      28.474  89.160  99.472  1.00  0.93           C  
ATOM   8361  C   ASN B 240      28.950  88.602 100.806  1.00  0.93           C  
ATOM   8362  O   ASN B 240      29.203  89.332 101.760  1.00  0.93           O  
ATOM   8363  CB  ASN B 240      29.371  88.694  98.291  1.00  0.93           C  
ATOM   8364  CG  ASN B 240      28.571  88.746  96.990  1.00  0.93           C  
ATOM   8365  OD1 ASN B 240      27.342  88.797  96.973  1.00  0.93           O  
ATOM   8366  ND2 ASN B 240      29.286  88.684  95.846  1.00  0.93           N  
ATOM   8367  N   THR B 241      29.040  87.267 100.917  1.00  0.95           N  
ATOM   8368  CA  THR B 241      29.308  86.596 102.184  1.00  0.95           C  
ATOM   8369  C   THR B 241      30.559  85.758 102.085  1.00  0.95           C  
ATOM   8370  O   THR B 241      30.717  84.932 101.188  1.00  0.95           O  
ATOM   8371  CB  THR B 241      28.156  85.683 102.600  1.00  0.95           C  
ATOM   8372  OG1 THR B 241      27.030  86.474 102.946  1.00  0.95           O  
ATOM   8373  CG2 THR B 241      28.477  84.834 103.839  1.00  0.95           C  
ATOM   8374  N   MET B 242      31.484  85.920 103.047  1.00  0.95           N  
ATOM   8375  CA  MET B 242      32.535  84.954 103.288  1.00  0.95           C  
ATOM   8376  C   MET B 242      32.121  84.142 104.503  1.00  0.95           C  
ATOM   8377  O   MET B 242      31.908  84.691 105.579  1.00  0.95           O  
ATOM   8378  CB  MET B 242      33.899  85.647 103.522  1.00  0.95           C  
ATOM   8379  CG  MET B 242      35.055  84.659 103.782  1.00  0.95           C  
ATOM   8380  SD  MET B 242      36.697  85.418 103.955  1.00  0.95           S  
ATOM   8381  CE  MET B 242      36.341  86.316 105.489  1.00  0.95           C  
ATOM   8382  N   ARG B 243      31.963  82.816 104.346  1.00  0.92           N  
ATOM   8383  CA  ARG B 243      31.510  81.924 105.393  1.00  0.92           C  
ATOM   8384  C   ARG B 243      32.668  81.062 105.843  1.00  0.92           C  
ATOM   8385  O   ARG B 243      33.259  80.293 105.085  1.00  0.92           O  
ATOM   8386  CB  ARG B 243      30.329  81.043 104.910  1.00  0.92           C  
ATOM   8387  CG  ARG B 243      29.813  80.023 105.952  1.00  0.92           C  
ATOM   8388  CD  ARG B 243      28.430  79.431 105.634  1.00  0.92           C  
ATOM   8389  NE  ARG B 243      27.431  80.527 105.821  1.00  0.92           N  
ATOM   8390  CZ  ARG B 243      26.122  80.349 106.011  1.00  0.92           C  
ATOM   8391  NH1 ARG B 243      25.483  79.218 105.733  1.00  0.92           N  
ATOM   8392  NH2 ARG B 243      25.416  81.374 106.482  1.00  0.92           N  
ATOM   8393  N   LEU B 244      33.042  81.197 107.123  1.00  0.96           N  
ATOM   8394  CA  LEU B 244      34.185  80.512 107.676  1.00  0.96           C  
ATOM   8395  C   LEU B 244      33.740  79.588 108.796  1.00  0.96           C  
ATOM   8396  O   LEU B 244      33.068  79.995 109.743  1.00  0.96           O  
ATOM   8397  CB  LEU B 244      35.230  81.513 108.223  1.00  0.96           C  
ATOM   8398  CG  LEU B 244      35.833  82.510 107.212  1.00  0.96           C  
ATOM   8399  CD1 LEU B 244      36.834  83.421 107.938  1.00  0.96           C  
ATOM   8400  CD2 LEU B 244      36.540  81.810 106.042  1.00  0.96           C  
ATOM   8401  N   TRP B 245      34.097  78.294 108.710  1.00  0.92           N  
ATOM   8402  CA  TRP B 245      33.661  77.283 109.661  1.00  0.92           C  
ATOM   8403  C   TRP B 245      34.615  77.126 110.842  1.00  0.92           C  
ATOM   8404  O   TRP B 245      35.835  77.128 110.684  1.00  0.92           O  
ATOM   8405  CB  TRP B 245      33.517  75.890 108.989  1.00  0.92           C  
ATOM   8406  CG  TRP B 245      32.614  75.842 107.768  1.00  0.92           C  
ATOM   8407  CD1 TRP B 245      32.954  75.929 106.445  1.00  0.92           C  
ATOM   8408  CD2 TRP B 245      31.188  75.634 107.797  1.00  0.92           C  
ATOM   8409  NE1 TRP B 245      31.842  75.772 105.644  1.00  0.92           N  
ATOM   8410  CE2 TRP B 245      30.745  75.630 106.464  1.00  0.92           C  
ATOM   8411  CE3 TRP B 245      30.300  75.438 108.855  1.00  0.92           C  
ATOM   8412  CZ2 TRP B 245      29.398  75.482 106.157  1.00  0.92           C  
ATOM   8413  CZ3 TRP B 245      28.951  75.212 108.538  1.00  0.92           C  
ATOM   8414  CH2 TRP B 245      28.500  75.276 107.214  1.00  0.92           C  
ATOM   8415  N   SER B 246      34.065  76.965 112.062  1.00  0.93           N  
ATOM   8416  CA  SER B 246      34.822  76.740 113.291  1.00  0.93           C  
ATOM   8417  C   SER B 246      34.421  75.404 113.878  1.00  0.93           C  
ATOM   8418  O   SER B 246      33.239  75.065 113.922  1.00  0.93           O  
ATOM   8419  CB  SER B 246      34.532  77.844 114.346  1.00  0.93           C  
ATOM   8420  OG  SER B 246      35.512  77.889 115.383  1.00  0.93           O  
ATOM   8421  N   ALA B 247      35.394  74.586 114.312  1.00  0.92           N  
ATOM   8422  CA  ALA B 247      35.159  73.246 114.804  1.00  0.92           C  
ATOM   8423  C   ALA B 247      34.774  73.238 116.279  1.00  0.92           C  
ATOM   8424  O   ALA B 247      35.386  73.907 117.107  1.00  0.92           O  
ATOM   8425  CB  ALA B 247      36.413  72.371 114.589  1.00  0.92           C  
ATOM   8426  N   LYS B 248      33.732  72.471 116.647  1.00  0.84           N  
ATOM   8427  CA  LYS B 248      33.305  72.322 118.028  1.00  0.84           C  
ATOM   8428  C   LYS B 248      33.032  70.860 118.337  1.00  0.84           C  
ATOM   8429  O   LYS B 248      32.531  70.095 117.517  1.00  0.84           O  
ATOM   8430  CB  LYS B 248      32.029  73.150 118.368  1.00  0.84           C  
ATOM   8431  CG  LYS B 248      32.254  74.669 118.542  1.00  0.84           C  
ATOM   8432  CD  LYS B 248      33.011  75.086 119.828  1.00  0.84           C  
ATOM   8433  CE  LYS B 248      32.264  74.816 121.147  1.00  0.84           C  
ATOM   8434  NZ  LYS B 248      33.090  75.173 122.324  1.00  0.84           N  
ATOM   8435  N   ALA B 249      33.371  70.406 119.557  1.00  0.81           N  
ATOM   8436  CA  ALA B 249      33.007  69.076 120.008  1.00  0.81           C  
ATOM   8437  C   ALA B 249      31.492  68.900 120.274  1.00  0.81           C  
ATOM   8438  O   ALA B 249      30.894  69.750 120.944  1.00  0.81           O  
ATOM   8439  CB  ALA B 249      33.830  68.698 121.252  1.00  0.81           C  
ATOM   8440  N   PRO B 250      30.802  67.852 119.798  1.00  0.83           N  
ATOM   8441  CA  PRO B 250      29.368  67.667 120.016  1.00  0.83           C  
ATOM   8442  C   PRO B 250      29.012  67.408 121.460  1.00  0.83           C  
ATOM   8443  O   PRO B 250      29.894  67.179 122.289  1.00  0.83           O  
ATOM   8444  CB  PRO B 250      28.983  66.478 119.120  1.00  0.83           C  
ATOM   8445  CG  PRO B 250      30.274  65.677 118.951  1.00  0.83           C  
ATOM   8446  CD  PRO B 250      31.394  66.716 119.091  1.00  0.83           C  
ATOM   8447  N   ASN B 251      27.711  67.467 121.802  1.00  0.67           N  
ATOM   8448  CA  ASN B 251      27.239  67.289 123.169  1.00  0.67           C  
ATOM   8449  C   ASN B 251      27.542  65.879 123.665  1.00  0.67           C  
ATOM   8450  O   ASN B 251      28.165  65.679 124.708  1.00  0.67           O  
ATOM   8451  CB  ASN B 251      25.718  67.589 123.292  1.00  0.67           C  
ATOM   8452  CG  ASN B 251      25.409  69.048 122.969  1.00  0.67           C  
ATOM   8453  OD1 ASN B 251      26.278  69.903 122.796  1.00  0.67           O  
ATOM   8454  ND2 ASN B 251      24.103  69.371 122.840  1.00  0.67           N  
ATOM   8455  N   ASP B 252      27.226  64.887 122.820  1.00  0.68           N  
ATOM   8456  CA  ASP B 252      27.380  63.468 123.013  1.00  0.68           C  
ATOM   8457  C   ASP B 252      28.822  63.015 123.166  1.00  0.68           C  
ATOM   8458  O   ASP B 252      29.106  61.920 123.652  1.00  0.68           O  
ATOM   8459  CB  ASP B 252      26.816  62.750 121.764  1.00  0.68           C  
ATOM   8460  CG  ASP B 252      25.404  63.167 121.363  1.00  0.68           C  
ATOM   8461  OD1 ASP B 252      24.851  64.155 121.903  1.00  0.68           O  
ATOM   8462  OD2 ASP B 252      24.904  62.521 120.413  1.00  0.68           O  
ATOM   8463  N   PHE B 253      29.794  63.858 122.756  1.00  0.62           N  
ATOM   8464  CA  PHE B 253      31.210  63.594 122.930  1.00  0.62           C  
ATOM   8465  C   PHE B 253      31.565  63.455 124.403  1.00  0.62           C  
ATOM   8466  O   PHE B 253      32.169  62.466 124.779  1.00  0.62           O  
ATOM   8467  CB  PHE B 253      32.044  64.698 122.229  1.00  0.62           C  
ATOM   8468  CG  PHE B 253      33.518  64.404 122.137  1.00  0.62           C  
ATOM   8469  CD1 PHE B 253      34.398  65.153 122.922  1.00  0.62           C  
ATOM   8470  CD2 PHE B 253      34.045  63.412 121.287  1.00  0.62           C  
ATOM   8471  CE1 PHE B 253      35.775  64.922 122.887  1.00  0.62           C  
ATOM   8472  CE2 PHE B 253      35.432  63.192 121.231  1.00  0.62           C  
ATOM   8473  CZ  PHE B 253      36.296  63.948 122.034  1.00  0.62           C  
ATOM   8474  N   ASN B 254      31.057  64.339 125.292  1.00  0.52           N  
ATOM   8475  CA  ASN B 254      31.343  64.289 126.724  1.00  0.52           C  
ATOM   8476  C   ASN B 254      30.946  62.961 127.369  1.00  0.52           C  
ATOM   8477  O   ASN B 254      31.659  62.407 128.205  1.00  0.52           O  
ATOM   8478  CB  ASN B 254      30.583  65.452 127.401  1.00  0.52           C  
ATOM   8479  CG  ASN B 254      30.977  65.682 128.858  1.00  0.52           C  
ATOM   8480  OD1 ASN B 254      30.199  65.506 129.785  1.00  0.52           O  
ATOM   8481  ND2 ASN B 254      32.205  66.172 129.106  1.00  0.52           N  
ATOM   8482  N   LEU B 255      29.797  62.404 126.946  1.00  0.48           N  
ATOM   8483  CA  LEU B 255      29.367  61.078 127.325  1.00  0.48           C  
ATOM   8484  C   LEU B 255      30.279  59.964 126.825  1.00  0.48           C  
ATOM   8485  O   LEU B 255      30.582  59.013 127.541  1.00  0.48           O  
ATOM   8486  CB  LEU B 255      27.933  60.832 126.808  1.00  0.48           C  
ATOM   8487  CG  LEU B 255      27.324  59.496 127.277  1.00  0.48           C  
ATOM   8488  CD1 LEU B 255      27.332  59.390 128.806  1.00  0.48           C  
ATOM   8489  CD2 LEU B 255      25.920  59.273 126.695  1.00  0.48           C  
ATOM   8490  N   LYS B 256      30.776  60.046 125.576  1.00  0.49           N  
ATOM   8491  CA  LYS B 256      31.778  59.130 125.066  1.00  0.49           C  
ATOM   8492  C   LYS B 256      33.081  59.216 125.840  1.00  0.49           C  
ATOM   8493  O   LYS B 256      33.686  58.195 126.164  1.00  0.49           O  
ATOM   8494  CB  LYS B 256      32.057  59.384 123.559  1.00  0.49           C  
ATOM   8495  CG  LYS B 256      30.850  59.123 122.639  1.00  0.49           C  
ATOM   8496  CD  LYS B 256      31.128  59.478 121.165  1.00  0.49           C  
ATOM   8497  CE  LYS B 256      29.970  59.091 120.233  1.00  0.49           C  
ATOM   8498  NZ  LYS B 256      30.304  59.394 118.820  1.00  0.49           N  
ATOM   8499  N   ASP B 257      33.512  60.429 126.203  1.00  0.49           N  
ATOM   8500  CA  ASP B 257      34.750  60.679 126.892  1.00  0.49           C  
ATOM   8501  C   ASP B 257      34.816  60.061 128.284  1.00  0.49           C  
ATOM   8502  O   ASP B 257      35.892  59.754 128.798  1.00  0.49           O  
ATOM   8503  CB  ASP B 257      34.975  62.180 126.988  1.00  0.49           C  
ATOM   8504  CG  ASP B 257      34.894  62.906 125.675  1.00  0.49           C  
ATOM   8505  OD1 ASP B 257      34.521  64.110 125.701  1.00  0.49           O  
ATOM   8506  OD2 ASP B 257      35.159  62.257 124.638  1.00  0.49           O  
ATOM   8507  N   PHE B 258      33.655  59.755 128.900  1.00  0.44           N  
ATOM   8508  CA  PHE B 258      33.561  58.957 130.110  1.00  0.44           C  
ATOM   8509  C   PHE B 258      34.268  57.602 129.965  1.00  0.44           C  
ATOM   8510  O   PHE B 258      34.992  57.169 130.860  1.00  0.44           O  
ATOM   8511  CB  PHE B 258      32.055  58.777 130.464  1.00  0.44           C  
ATOM   8512  CG  PHE B 258      31.824  57.891 131.658  1.00  0.44           C  
ATOM   8513  CD1 PHE B 258      31.587  56.520 131.460  1.00  0.44           C  
ATOM   8514  CD2 PHE B 258      31.869  58.399 132.966  1.00  0.44           C  
ATOM   8515  CE1 PHE B 258      31.419  55.662 132.552  1.00  0.44           C  
ATOM   8516  CE2 PHE B 258      31.703  57.541 134.063  1.00  0.44           C  
ATOM   8517  CZ  PHE B 258      31.488  56.171 133.855  1.00  0.44           C  
ATOM   8518  N   ASN B 259      34.137  56.940 128.798  1.00  0.47           N  
ATOM   8519  CA  ASN B 259      34.783  55.671 128.512  1.00  0.47           C  
ATOM   8520  C   ASN B 259      36.305  55.765 128.424  1.00  0.47           C  
ATOM   8521  O   ASN B 259      37.005  54.776 128.621  1.00  0.47           O  
ATOM   8522  CB  ASN B 259      34.291  55.108 127.157  1.00  0.47           C  
ATOM   8523  CG  ASN B 259      32.803  54.793 127.214  1.00  0.47           C  
ATOM   8524  OD1 ASN B 259      32.192  54.597 128.262  1.00  0.47           O  
ATOM   8525  ND2 ASN B 259      32.178  54.709 126.018  1.00  0.47           N  
ATOM   8526  N   VAL B 260      36.859  56.954 128.120  1.00  0.41           N  
ATOM   8527  CA  VAL B 260      38.296  57.181 128.052  1.00  0.41           C  
ATOM   8528  C   VAL B 260      38.897  57.384 129.441  1.00  0.41           C  
ATOM   8529  O   VAL B 260      40.080  57.133 129.680  1.00  0.41           O  
ATOM   8530  CB  VAL B 260      38.559  58.398 127.175  1.00  0.41           C  
ATOM   8531  CG1 VAL B 260      40.059  58.739 127.106  1.00  0.41           C  
ATOM   8532  CG2 VAL B 260      38.008  58.130 125.759  1.00  0.41           C  
ATOM   8533  N   GLY B 261      38.055  57.771 130.418  1.00  0.52           N  
ATOM   8534  CA  GLY B 261      38.405  57.829 131.831  1.00  0.52           C  
ATOM   8535  C   GLY B 261      38.496  59.216 132.414  1.00  0.52           C  
ATOM   8536  O   GLY B 261      39.353  60.016 132.068  1.00  0.52           O  
ATOM   8537  N   GLY B 262      37.637  59.535 133.403  1.00  0.58           N  
ATOM   8538  CA  GLY B 262      37.705  60.792 134.143  1.00  0.58           C  
ATOM   8539  C   GLY B 262      36.936  61.928 133.514  1.00  0.58           C  
ATOM   8540  O   GLY B 262      37.279  62.429 132.452  1.00  0.58           O  
ATOM   8541  N   TYR B 263      35.893  62.434 134.207  1.00  0.46           N  
ATOM   8542  CA  TYR B 263      35.026  63.518 133.743  1.00  0.46           C  
ATOM   8543  C   TYR B 263      35.795  64.809 133.420  1.00  0.46           C  
ATOM   8544  O   TYR B 263      35.520  65.467 132.422  1.00  0.46           O  
ATOM   8545  CB  TYR B 263      33.846  63.771 134.756  1.00  0.46           C  
ATOM   8546  CG  TYR B 263      33.102  65.078 134.512  1.00  0.46           C  
ATOM   8547  CD1 TYR B 263      32.128  65.193 133.504  1.00  0.46           C  
ATOM   8548  CD2 TYR B 263      33.478  66.236 135.221  1.00  0.46           C  
ATOM   8549  CE1 TYR B 263      31.594  66.449 133.168  1.00  0.46           C  
ATOM   8550  CE2 TYR B 263      32.947  67.490 134.886  1.00  0.46           C  
ATOM   8551  CZ  TYR B 263      32.015  67.598 133.853  1.00  0.46           C  
ATOM   8552  OH  TYR B 263      31.524  68.871 133.495  1.00  0.46           O  
ATOM   8553  N   ILE B 264      36.790  65.216 134.236  1.00  0.56           N  
ATOM   8554  CA  ILE B 264      37.583  66.410 133.947  1.00  0.56           C  
ATOM   8555  C   ILE B 264      38.411  66.233 132.690  1.00  0.56           C  
ATOM   8556  O   ILE B 264      38.376  67.087 131.808  1.00  0.56           O  
ATOM   8557  CB  ILE B 264      38.456  66.850 135.126  1.00  0.56           C  
ATOM   8558  CG1 ILE B 264      37.578  67.194 136.358  1.00  0.56           C  
ATOM   8559  CG2 ILE B 264      39.351  68.051 134.727  1.00  0.56           C  
ATOM   8560  CD1 ILE B 264      36.676  68.424 136.176  1.00  0.56           C  
ATOM   8561  N   GLN B 265      39.101  65.081 132.531  1.00  0.61           N  
ATOM   8562  CA  GLN B 265      39.890  64.782 131.345  1.00  0.61           C  
ATOM   8563  C   GLN B 265      39.048  64.754 130.080  1.00  0.61           C  
ATOM   8564  O   GLN B 265      39.381  65.387 129.086  1.00  0.61           O  
ATOM   8565  CB  GLN B 265      40.652  63.442 131.499  1.00  0.61           C  
ATOM   8566  CG  GLN B 265      41.686  63.180 130.374  1.00  0.61           C  
ATOM   8567  CD  GLN B 265      42.762  64.268 130.346  1.00  0.61           C  
ATOM   8568  OE1 GLN B 265      43.379  64.590 131.366  1.00  0.61           O  
ATOM   8569  NE2 GLN B 265      42.996  64.879 129.166  1.00  0.61           N  
ATOM   8570  N   ALA B 266      37.865  64.128 130.146  1.00  0.65           N  
ATOM   8571  CA  ALA B 266      36.857  64.175 129.120  1.00  0.65           C  
ATOM   8572  C   ALA B 266      36.423  65.567 128.649  1.00  0.65           C  
ATOM   8573  O   ALA B 266      36.323  65.857 127.461  1.00  0.65           O  
ATOM   8574  CB  ALA B 266      35.644  63.453 129.729  1.00  0.65           C  
ATOM   8575  N   VAL B 267      36.188  66.523 129.561  1.00  0.64           N  
ATOM   8576  CA  VAL B 267      35.936  67.910 129.181  1.00  0.64           C  
ATOM   8577  C   VAL B 267      37.152  68.575 128.524  1.00  0.64           C  
ATOM   8578  O   VAL B 267      37.002  69.332 127.566  1.00  0.64           O  
ATOM   8579  CB  VAL B 267      35.389  68.764 130.329  1.00  0.64           C  
ATOM   8580  CG1 VAL B 267      35.065  70.197 129.857  1.00  0.64           C  
ATOM   8581  CG2 VAL B 267      34.094  68.157 130.905  1.00  0.64           C  
ATOM   8582  N   LEU B 268      38.393  68.302 128.991  1.00  0.67           N  
ATOM   8583  CA  LEU B 268      39.614  68.784 128.354  1.00  0.67           C  
ATOM   8584  C   LEU B 268      39.828  68.229 126.945  1.00  0.67           C  
ATOM   8585  O   LEU B 268      40.152  68.974 126.020  1.00  0.67           O  
ATOM   8586  CB  LEU B 268      40.871  68.489 129.219  1.00  0.67           C  
ATOM   8587  CG  LEU B 268      40.828  69.065 130.656  1.00  0.67           C  
ATOM   8588  CD1 LEU B 268      42.176  68.876 131.365  1.00  0.67           C  
ATOM   8589  CD2 LEU B 268      40.392  70.537 130.716  1.00  0.67           C  
ATOM   8590  N   ASP B 269      39.588  66.922 126.726  1.00  0.65           N  
ATOM   8591  CA  ASP B 269      39.803  66.226 125.465  1.00  0.65           C  
ATOM   8592  C   ASP B 269      38.906  66.717 124.325  1.00  0.65           C  
ATOM   8593  O   ASP B 269      39.205  66.516 123.150  1.00  0.65           O  
ATOM   8594  CB  ASP B 269      39.695  64.687 125.661  1.00  0.65           C  
ATOM   8595  CG  ASP B 269      40.912  64.147 126.403  1.00  0.65           C  
ATOM   8596  OD1 ASP B 269      41.855  64.934 126.682  1.00  0.65           O  
ATOM   8597  OD2 ASP B 269      40.938  62.925 126.687  1.00  0.65           O  
ATOM   8598  N   ARG B 270      37.845  67.503 124.621  1.00  0.70           N  
ATOM   8599  CA  ARG B 270      37.091  68.296 123.650  1.00  0.70           C  
ATOM   8600  C   ARG B 270      37.954  69.208 122.786  1.00  0.70           C  
ATOM   8601  O   ARG B 270      37.657  69.445 121.613  1.00  0.70           O  
ATOM   8602  CB  ARG B 270      36.030  69.176 124.353  1.00  0.70           C  
ATOM   8603  CG  ARG B 270      34.892  68.340 124.961  1.00  0.70           C  
ATOM   8604  CD  ARG B 270      33.896  69.132 125.816  1.00  0.70           C  
ATOM   8605  NE  ARG B 270      33.132  70.094 124.952  1.00  0.70           N  
ATOM   8606  CZ  ARG B 270      32.074  69.778 124.195  1.00  0.70           C  
ATOM   8607  NH1 ARG B 270      31.673  68.519 124.069  1.00  0.70           N  
ATOM   8608  NH2 ARG B 270      31.423  70.720 123.522  1.00  0.70           N  
ATOM   8609  N   ASN B 271      39.094  69.678 123.335  1.00  0.79           N  
ATOM   8610  CA  ASN B 271      40.111  70.441 122.637  1.00  0.79           C  
ATOM   8611  C   ASN B 271      40.656  69.725 121.401  1.00  0.79           C  
ATOM   8612  O   ASN B 271      40.985  70.374 120.415  1.00  0.79           O  
ATOM   8613  CB  ASN B 271      41.309  70.770 123.571  1.00  0.79           C  
ATOM   8614  CG  ASN B 271      40.992  71.747 124.708  1.00  0.79           C  
ATOM   8615  OD1 ASN B 271      41.855  72.001 125.552  1.00  0.79           O  
ATOM   8616  ND2 ASN B 271      39.782  72.348 124.749  1.00  0.79           N  
ATOM   8617  N   LEU B 272      40.729  68.375 121.390  1.00  0.75           N  
ATOM   8618  CA  LEU B 272      41.142  67.584 120.238  1.00  0.75           C  
ATOM   8619  C   LEU B 272      40.260  67.775 119.005  1.00  0.75           C  
ATOM   8620  O   LEU B 272      40.758  67.856 117.883  1.00  0.75           O  
ATOM   8621  CB  LEU B 272      41.168  66.074 120.587  1.00  0.75           C  
ATOM   8622  CG  LEU B 272      42.209  65.677 121.654  1.00  0.75           C  
ATOM   8623  CD1 LEU B 272      41.936  64.251 122.157  1.00  0.75           C  
ATOM   8624  CD2 LEU B 272      43.646  65.788 121.121  1.00  0.75           C  
ATOM   8625  N   ALA B 273      38.925  67.870 119.176  1.00  0.81           N  
ATOM   8626  CA  ALA B 273      38.004  68.189 118.098  1.00  0.81           C  
ATOM   8627  C   ALA B 273      38.148  69.630 117.607  1.00  0.81           C  
ATOM   8628  O   ALA B 273      38.191  69.908 116.409  1.00  0.81           O  
ATOM   8629  CB  ALA B 273      36.564  67.935 118.581  1.00  0.81           C  
ATOM   8630  N   GLU B 274      38.289  70.579 118.555  1.00  0.82           N  
ATOM   8631  CA  GLU B 274      38.428  72.005 118.303  1.00  0.82           C  
ATOM   8632  C   GLU B 274      39.781  72.348 117.670  1.00  0.82           C  
ATOM   8633  O   GLU B 274      39.949  73.364 116.998  1.00  0.82           O  
ATOM   8634  CB  GLU B 274      38.178  72.781 119.625  1.00  0.82           C  
ATOM   8635  CG  GLU B 274      36.727  72.568 120.137  1.00  0.82           C  
ATOM   8636  CD  GLU B 274      36.433  73.065 121.550  1.00  0.82           C  
ATOM   8637  OE1 GLU B 274      35.233  73.238 121.885  1.00  0.82           O  
ATOM   8638  OE2 GLU B 274      37.365  73.265 122.359  1.00  0.82           O  
ATOM   8639  N   ASN B 275      40.782  71.446 117.789  1.00  0.85           N  
ATOM   8640  CA  ASN B 275      42.096  71.578 117.185  1.00  0.85           C  
ATOM   8641  C   ASN B 275      42.104  71.561 115.667  1.00  0.85           C  
ATOM   8642  O   ASN B 275      43.045  72.056 115.049  1.00  0.85           O  
ATOM   8643  CB  ASN B 275      43.089  70.509 117.709  1.00  0.85           C  
ATOM   8644  CG  ASN B 275      43.597  70.931 119.083  1.00  0.85           C  
ATOM   8645  OD1 ASN B 275      43.378  72.057 119.535  1.00  0.85           O  
ATOM   8646  ND2 ASN B 275      44.359  70.031 119.744  1.00  0.85           N  
ATOM   8647  N   ILE B 276      41.043  71.045 115.018  1.00  0.90           N  
ATOM   8648  CA  ILE B 276      40.895  71.088 113.571  1.00  0.90           C  
ATOM   8649  C   ILE B 276      40.867  72.524 113.038  1.00  0.90           C  
ATOM   8650  O   ILE B 276      41.586  72.857 112.101  1.00  0.90           O  
ATOM   8651  CB  ILE B 276      39.678  70.272 113.142  1.00  0.90           C  
ATOM   8652  CG1 ILE B 276      39.904  68.786 113.531  1.00  0.90           C  
ATOM   8653  CG2 ILE B 276      39.437  70.412 111.623  1.00  0.90           C  
ATOM   8654  CD1 ILE B 276      38.694  67.882 113.272  1.00  0.90           C  
ATOM   8655  N   SER B 277      40.124  73.460 113.665  1.00  0.90           N  
ATOM   8656  CA  SER B 277      40.141  74.863 113.252  1.00  0.90           C  
ATOM   8657  C   SER B 277      41.082  75.725 114.074  1.00  0.90           C  
ATOM   8658  O   SER B 277      40.981  76.947 114.062  1.00  0.90           O  
ATOM   8659  CB  SER B 277      38.739  75.541 113.224  1.00  0.90           C  
ATOM   8660  OG  SER B 277      38.088  75.547 114.493  1.00  0.90           O  
ATOM   8661  N   ARG B 278      42.036  75.145 114.826  1.00  0.83           N  
ATOM   8662  CA  ARG B 278      42.933  75.942 115.648  1.00  0.83           C  
ATOM   8663  C   ARG B 278      43.930  76.803 114.890  1.00  0.83           C  
ATOM   8664  O   ARG B 278      44.065  77.988 115.167  1.00  0.83           O  
ATOM   8665  CB  ARG B 278      43.742  75.020 116.591  1.00  0.83           C  
ATOM   8666  CG  ARG B 278      44.396  75.722 117.800  1.00  0.83           C  
ATOM   8667  CD  ARG B 278      43.370  76.144 118.860  1.00  0.83           C  
ATOM   8668  NE  ARG B 278      42.866  74.912 119.557  1.00  0.83           N  
ATOM   8669  CZ  ARG B 278      41.724  74.891 120.258  1.00  0.83           C  
ATOM   8670  NH1 ARG B 278      40.982  75.973 120.456  1.00  0.83           N  
ATOM   8671  NH2 ARG B 278      41.337  73.743 120.805  1.00  0.83           N  
ATOM   8672  N   VAL B 279      44.657  76.254 113.903  1.00  0.89           N  
ATOM   8673  CA  VAL B 279      45.781  76.980 113.323  1.00  0.89           C  
ATOM   8674  C   VAL B 279      45.976  76.674 111.851  1.00  0.89           C  
ATOM   8675  O   VAL B 279      45.893  75.532 111.399  1.00  0.89           O  
ATOM   8676  CB  VAL B 279      47.073  76.761 114.126  1.00  0.89           C  
ATOM   8677  CG1 VAL B 279      47.461  75.269 114.190  1.00  0.89           C  
ATOM   8678  CG2 VAL B 279      48.243  77.613 113.588  1.00  0.89           C  
ATOM   8679  N   LEU B 280      46.233  77.724 111.043  1.00  0.90           N  
ATOM   8680  CA  LEU B 280      46.668  77.606 109.664  1.00  0.90           C  
ATOM   8681  C   LEU B 280      48.020  76.907 109.538  1.00  0.90           C  
ATOM   8682  O   LEU B 280      48.993  77.245 110.212  1.00  0.90           O  
ATOM   8683  CB  LEU B 280      46.746  79.021 109.033  1.00  0.90           C  
ATOM   8684  CG  LEU B 280      47.353  79.131 107.615  1.00  0.90           C  
ATOM   8685  CD1 LEU B 280      46.527  78.415 106.537  1.00  0.90           C  
ATOM   8686  CD2 LEU B 280      47.505  80.610 107.249  1.00  0.90           C  
ATOM   8687  N   TYR B 281      48.133  75.908 108.636  1.00  0.87           N  
ATOM   8688  CA  TYR B 281      49.409  75.288 108.329  1.00  0.87           C  
ATOM   8689  C   TYR B 281      50.319  76.265 107.573  1.00  0.87           C  
ATOM   8690  O   TYR B 281      49.941  76.690 106.480  1.00  0.87           O  
ATOM   8691  CB  TYR B 281      49.240  73.985 107.495  1.00  0.87           C  
ATOM   8692  CG  TYR B 281      49.199  72.793 108.416  1.00  0.87           C  
ATOM   8693  CD1 TYR B 281      50.336  71.982 108.578  1.00  0.87           C  
ATOM   8694  CD2 TYR B 281      48.053  72.513 109.178  1.00  0.87           C  
ATOM   8695  CE1 TYR B 281      50.329  70.913 109.484  1.00  0.87           C  
ATOM   8696  CE2 TYR B 281      48.047  71.452 110.096  1.00  0.87           C  
ATOM   8697  CZ  TYR B 281      49.189  70.659 110.251  1.00  0.87           C  
ATOM   8698  OH  TYR B 281      49.200  69.636 111.215  1.00  0.87           O  
ATOM   8699  N   PRO B 282      51.504  76.654 108.050  1.00  0.89           N  
ATOM   8700  CA  PRO B 282      52.232  77.803 107.507  1.00  0.89           C  
ATOM   8701  C   PRO B 282      53.132  77.410 106.344  1.00  0.89           C  
ATOM   8702  O   PRO B 282      54.217  77.975 106.176  1.00  0.89           O  
ATOM   8703  CB  PRO B 282      53.085  78.231 108.712  1.00  0.89           C  
ATOM   8704  CG  PRO B 282      53.399  76.910 109.414  1.00  0.89           C  
ATOM   8705  CD  PRO B 282      52.072  76.179 109.313  1.00  0.89           C  
ATOM   8706  N   ASN B 283      52.667  76.500 105.478  1.00  0.83           N  
ATOM   8707  CA  ASN B 283      53.413  76.001 104.349  1.00  0.83           C  
ATOM   8708  C   ASN B 283      52.969  76.687 103.064  1.00  0.83           C  
ATOM   8709  O   ASN B 283      51.834  76.559 102.621  1.00  0.83           O  
ATOM   8710  CB  ASN B 283      53.214  74.474 104.221  1.00  0.83           C  
ATOM   8711  CG  ASN B 283      53.878  73.786 105.410  1.00  0.83           C  
ATOM   8712  OD1 ASN B 283      55.069  73.970 105.657  1.00  0.83           O  
ATOM   8713  ND2 ASN B 283      53.093  72.975 106.150  1.00  0.83           N  
ATOM   8714  N   ASP B 284      53.892  77.424 102.422  1.00  0.83           N  
ATOM   8715  CA  ASP B 284      53.689  78.083 101.151  1.00  0.83           C  
ATOM   8716  C   ASP B 284      54.473  77.252 100.153  1.00  0.83           C  
ATOM   8717  O   ASP B 284      55.662  77.015 100.348  1.00  0.83           O  
ATOM   8718  CB  ASP B 284      54.208  79.550 101.246  1.00  0.83           C  
ATOM   8719  CG  ASP B 284      54.066  80.343  99.955  1.00  0.83           C  
ATOM   8720  OD1 ASP B 284      54.794  80.003  98.986  1.00  0.83           O  
ATOM   8721  OD2 ASP B 284      53.267  81.311  99.920  1.00  0.83           O  
ATOM   8722  N   ASN B 285      53.803  76.737  99.098  1.00  0.76           N  
ATOM   8723  CA  ASN B 285      54.405  75.924  98.045  1.00  0.76           C  
ATOM   8724  C   ASN B 285      55.199  74.722  98.554  1.00  0.76           C  
ATOM   8725  O   ASN B 285      56.272  74.399  98.054  1.00  0.76           O  
ATOM   8726  CB  ASN B 285      55.281  76.785  97.100  1.00  0.76           C  
ATOM   8727  CG  ASN B 285      54.390  77.626  96.207  1.00  0.76           C  
ATOM   8728  OD1 ASN B 285      53.933  77.162  95.162  1.00  0.76           O  
ATOM   8729  ND2 ASN B 285      54.141  78.895  96.593  1.00  0.76           N  
ATOM   8730  N   PHE B 286      54.660  74.025  99.565  1.00  0.83           N  
ATOM   8731  CA  PHE B 286      55.281  72.850 100.126  1.00  0.83           C  
ATOM   8732  C   PHE B 286      54.176  71.952 100.654  1.00  0.83           C  
ATOM   8733  O   PHE B 286      53.244  72.417 101.309  1.00  0.83           O  
ATOM   8734  CB  PHE B 286      56.260  73.266 101.261  1.00  0.83           C  
ATOM   8735  CG  PHE B 286      56.988  72.091 101.861  1.00  0.83           C  
ATOM   8736  CD1 PHE B 286      57.953  71.395 101.115  1.00  0.83           C  
ATOM   8737  CD2 PHE B 286      56.700  71.667 103.170  1.00  0.83           C  
ATOM   8738  CE1 PHE B 286      58.616  70.289 101.665  1.00  0.83           C  
ATOM   8739  CE2 PHE B 286      57.357  70.561 103.723  1.00  0.83           C  
ATOM   8740  CZ  PHE B 286      58.314  69.870 102.968  1.00  0.83           C  
ATOM   8741  N   PHE B 287      54.256  70.638 100.384  1.00  0.84           N  
ATOM   8742  CA  PHE B 287      53.296  69.664 100.859  1.00  0.84           C  
ATOM   8743  C   PHE B 287      53.827  68.996 102.119  1.00  0.84           C  
ATOM   8744  O   PHE B 287      54.790  68.232 102.101  1.00  0.84           O  
ATOM   8745  CB  PHE B 287      52.986  68.611  99.750  1.00  0.84           C  
ATOM   8746  CG  PHE B 287      52.149  67.444 100.235  1.00  0.84           C  
ATOM   8747  CD1 PHE B 287      50.901  67.635 100.853  1.00  0.84           C  
ATOM   8748  CD2 PHE B 287      52.645  66.135 100.110  1.00  0.84           C  
ATOM   8749  CE1 PHE B 287      50.158  66.543 101.318  1.00  0.84           C  
ATOM   8750  CE2 PHE B 287      51.914  65.043 100.592  1.00  0.84           C  
ATOM   8751  CZ  PHE B 287      50.664  65.245 101.190  1.00  0.84           C  
ATOM   8752  N   GLU B 288      53.155  69.238 103.257  1.00  0.78           N  
ATOM   8753  CA  GLU B 288      53.472  68.566 104.494  1.00  0.78           C  
ATOM   8754  C   GLU B 288      52.319  67.650 104.868  1.00  0.78           C  
ATOM   8755  O   GLU B 288      51.231  68.078 105.251  1.00  0.78           O  
ATOM   8756  CB  GLU B 288      53.709  69.575 105.628  1.00  0.78           C  
ATOM   8757  CG  GLU B 288      54.312  68.937 106.898  1.00  0.78           C  
ATOM   8758  CD  GLU B 288      54.137  69.839 108.113  1.00  0.78           C  
ATOM   8759  OE1 GLU B 288      53.600  70.962 107.992  1.00  0.78           O  
ATOM   8760  OE2 GLU B 288      54.522  69.361 109.214  1.00  0.78           O  
ATOM   8761  N   GLY B 289      52.531  66.325 104.757  1.00  0.87           N  
ATOM   8762  CA  GLY B 289      51.454  65.348 104.898  1.00  0.87           C  
ATOM   8763  C   GLY B 289      51.132  64.944 106.312  1.00  0.87           C  
ATOM   8764  O   GLY B 289      51.340  63.802 106.710  1.00  0.87           O  
ATOM   8765  N   LYS B 290      50.580  65.870 107.109  1.00  0.84           N  
ATOM   8766  CA  LYS B 290      50.165  65.624 108.478  1.00  0.84           C  
ATOM   8767  C   LYS B 290      48.678  65.282 108.563  1.00  0.84           C  
ATOM   8768  O   LYS B 290      47.854  65.845 107.847  1.00  0.84           O  
ATOM   8769  CB  LYS B 290      50.441  66.879 109.347  1.00  0.84           C  
ATOM   8770  CG  LYS B 290      51.933  67.211 109.546  1.00  0.84           C  
ATOM   8771  CD  LYS B 290      52.672  66.194 110.433  1.00  0.84           C  
ATOM   8772  CE  LYS B 290      54.068  66.621 110.910  1.00  0.84           C  
ATOM   8773  NZ  LYS B 290      54.973  66.901 109.792  1.00  0.84           N  
ATOM   8774  N   GLU B 291      48.275  64.365 109.479  1.00  0.87           N  
ATOM   8775  CA  GLU B 291      46.881  63.949 109.649  1.00  0.87           C  
ATOM   8776  C   GLU B 291      45.943  65.104 109.978  1.00  0.87           C  
ATOM   8777  O   GLU B 291      44.845  65.226 109.441  1.00  0.87           O  
ATOM   8778  CB  GLU B 291      46.730  62.897 110.778  1.00  0.87           C  
ATOM   8779  CG  GLU B 291      45.317  62.268 110.836  1.00  0.87           C  
ATOM   8780  CD  GLU B 291      44.944  61.821 112.226  1.00  0.87           C  
ATOM   8781  OE1 GLU B 291      45.012  62.690 113.129  1.00  0.87           O  
ATOM   8782  OE2 GLU B 291      44.535  60.654 112.432  1.00  0.87           O  
ATOM   8783  N   LEU B 292      46.379  66.031 110.851  1.00  0.90           N  
ATOM   8784  CA  LEU B 292      45.616  67.210 111.204  1.00  0.90           C  
ATOM   8785  C   LEU B 292      45.314  68.133 110.027  1.00  0.90           C  
ATOM   8786  O   LEU B 292      44.209  68.656 109.923  1.00  0.90           O  
ATOM   8787  CB  LEU B 292      46.314  67.968 112.353  1.00  0.90           C  
ATOM   8788  CG  LEU B 292      45.527  69.169 112.922  1.00  0.90           C  
ATOM   8789  CD1 LEU B 292      44.207  68.726 113.574  1.00  0.90           C  
ATOM   8790  CD2 LEU B 292      46.373  69.930 113.949  1.00  0.90           C  
ATOM   8791  N   ARG B 293      46.250  68.319 109.072  1.00  0.86           N  
ATOM   8792  CA  ARG B 293      45.981  69.046 107.839  1.00  0.86           C  
ATOM   8793  C   ARG B 293      44.901  68.382 106.987  1.00  0.86           C  
ATOM   8794  O   ARG B 293      43.972  69.034 106.521  1.00  0.86           O  
ATOM   8795  CB  ARG B 293      47.282  69.199 107.013  1.00  0.86           C  
ATOM   8796  CG  ARG B 293      47.095  69.884 105.643  1.00  0.86           C  
ATOM   8797  CD  ARG B 293      46.494  71.293 105.711  1.00  0.86           C  
ATOM   8798  NE  ARG B 293      46.381  71.700 104.297  1.00  0.86           N  
ATOM   8799  CZ  ARG B 293      46.328  72.927 103.779  1.00  0.86           C  
ATOM   8800  NH1 ARG B 293      46.302  74.021 104.523  1.00  0.86           N  
ATOM   8801  NH2 ARG B 293      46.271  72.986 102.454  1.00  0.86           N  
ATOM   8802  N   LEU B 294      44.951  67.047 106.846  1.00  0.93           N  
ATOM   8803  CA  LEU B 294      43.935  66.264 106.166  1.00  0.93           C  
ATOM   8804  C   LEU B 294      42.555  66.379 106.818  1.00  0.93           C  
ATOM   8805  O   LEU B 294      41.523  66.507 106.153  1.00  0.93           O  
ATOM   8806  CB  LEU B 294      44.412  64.793 106.136  1.00  0.93           C  
ATOM   8807  CG  LEU B 294      43.550  63.831 105.304  1.00  0.93           C  
ATOM   8808  CD1 LEU B 294      43.499  64.259 103.833  1.00  0.93           C  
ATOM   8809  CD2 LEU B 294      44.094  62.398 105.421  1.00  0.93           C  
ATOM   8810  N   LYS B 295      42.502  66.411 108.170  1.00  0.93           N  
ATOM   8811  CA  LYS B 295      41.289  66.708 108.915  1.00  0.93           C  
ATOM   8812  C   LYS B 295      40.706  68.074 108.580  1.00  0.93           C  
ATOM   8813  O   LYS B 295      39.495  68.201 108.417  1.00  0.93           O  
ATOM   8814  CB  LYS B 295      41.492  66.625 110.452  1.00  0.93           C  
ATOM   8815  CG  LYS B 295      41.725  65.204 110.965  1.00  0.93           C  
ATOM   8816  CD  LYS B 295      42.050  65.143 112.467  1.00  0.93           C  
ATOM   8817  CE  LYS B 295      42.178  63.686 112.878  1.00  0.93           C  
ATOM   8818  NZ  LYS B 295      42.783  63.470 114.211  1.00  0.93           N  
ATOM   8819  N   GLN B 296      41.548  69.120 108.426  1.00  0.93           N  
ATOM   8820  CA  GLN B 296      41.117  70.450 108.018  1.00  0.93           C  
ATOM   8821  C   GLN B 296      40.484  70.484 106.643  1.00  0.93           C  
ATOM   8822  O   GLN B 296      39.420  71.069 106.438  1.00  0.93           O  
ATOM   8823  CB  GLN B 296      42.308  71.444 107.995  1.00  0.93           C  
ATOM   8824  CG  GLN B 296      42.881  71.682 109.400  1.00  0.93           C  
ATOM   8825  CD  GLN B 296      43.993  72.730 109.436  1.00  0.93           C  
ATOM   8826  OE1 GLN B 296      44.776  72.903 108.501  1.00  0.93           O  
ATOM   8827  NE2 GLN B 296      44.072  73.439 110.587  1.00  0.93           N  
ATOM   8828  N   GLU B 297      41.123  69.820 105.672  1.00  0.95           N  
ATOM   8829  CA  GLU B 297      40.679  69.762 104.300  1.00  0.95           C  
ATOM   8830  C   GLU B 297      39.357  69.049 104.133  1.00  0.95           C  
ATOM   8831  O   GLU B 297      38.454  69.541 103.459  1.00  0.95           O  
ATOM   8832  CB  GLU B 297      41.797  69.133 103.463  1.00  0.95           C  
ATOM   8833  CG  GLU B 297      43.012  70.085 103.432  1.00  0.95           C  
ATOM   8834  CD  GLU B 297      44.236  69.477 102.771  1.00  0.95           C  
ATOM   8835  OE1 GLU B 297      44.337  68.234 102.689  1.00  0.95           O  
ATOM   8836  OE2 GLU B 297      45.142  70.294 102.454  1.00  0.95           O  
ATOM   8837  N   TYR B 298      39.157  67.902 104.811  1.00  0.96           N  
ATOM   8838  CA  TYR B 298      37.849  67.278 104.878  1.00  0.96           C  
ATOM   8839  C   TYR B 298      36.805  68.102 105.643  1.00  0.96           C  
ATOM   8840  O   TYR B 298      35.655  68.199 105.220  1.00  0.96           O  
ATOM   8841  CB  TYR B 298      37.949  65.843 105.453  1.00  0.96           C  
ATOM   8842  CG  TYR B 298      36.621  65.142 105.311  1.00  0.96           C  
ATOM   8843  CD1 TYR B 298      36.087  64.875 104.038  1.00  0.96           C  
ATOM   8844  CD2 TYR B 298      35.844  64.864 106.447  1.00  0.96           C  
ATOM   8845  CE1 TYR B 298      34.799  64.340 103.908  1.00  0.96           C  
ATOM   8846  CE2 TYR B 298      34.567  64.306 106.315  1.00  0.96           C  
ATOM   8847  CZ  TYR B 298      34.053  64.028 105.048  1.00  0.96           C  
ATOM   8848  OH  TYR B 298      32.776  63.453 104.930  1.00  0.96           O  
ATOM   8849  N   PHE B 299      37.174  68.738 106.777  1.00  0.96           N  
ATOM   8850  CA  PHE B 299      36.267  69.535 107.594  1.00  0.96           C  
ATOM   8851  C   PHE B 299      35.604  70.671 106.820  1.00  0.96           C  
ATOM   8852  O   PHE B 299      34.380  70.815 106.830  1.00  0.96           O  
ATOM   8853  CB  PHE B 299      37.066  70.081 108.819  1.00  0.96           C  
ATOM   8854  CG  PHE B 299      36.296  71.028 109.698  1.00  0.96           C  
ATOM   8855  CD1 PHE B 299      35.305  70.557 110.574  1.00  0.96           C  
ATOM   8856  CD2 PHE B 299      36.550  72.409 109.625  1.00  0.96           C  
ATOM   8857  CE1 PHE B 299      34.554  71.457 111.341  1.00  0.96           C  
ATOM   8858  CE2 PHE B 299      35.801  73.312 110.387  1.00  0.96           C  
ATOM   8859  CZ  PHE B 299      34.792  72.834 111.232  1.00  0.96           C  
ATOM   8860  N   VAL B 300      36.394  71.469 106.075  1.00  0.98           N  
ATOM   8861  CA  VAL B 300      35.857  72.529 105.236  1.00  0.98           C  
ATOM   8862  C   VAL B 300      35.040  72.006 104.064  1.00  0.98           C  
ATOM   8863  O   VAL B 300      33.992  72.551 103.728  1.00  0.98           O  
ATOM   8864  CB  VAL B 300      36.938  73.513 104.806  1.00  0.98           C  
ATOM   8865  CG1 VAL B 300      37.965  72.888 103.845  1.00  0.98           C  
ATOM   8866  CG2 VAL B 300      36.306  74.779 104.197  1.00  0.98           C  
ATOM   8867  N   VAL B 301      35.479  70.907 103.423  1.00  0.98           N  
ATOM   8868  CA  VAL B 301      34.777  70.259 102.329  1.00  0.98           C  
ATOM   8869  C   VAL B 301      33.404  69.727 102.715  1.00  0.98           C  
ATOM   8870  O   VAL B 301      32.404  70.033 102.063  1.00  0.98           O  
ATOM   8871  CB  VAL B 301      35.679  69.145 101.801  1.00  0.98           C  
ATOM   8872  CG1 VAL B 301      34.913  67.975 101.158  1.00  0.98           C  
ATOM   8873  CG2 VAL B 301      36.680  69.769 100.809  1.00  0.98           C  
ATOM   8874  N   ALA B 302      33.307  68.957 103.816  1.00  0.98           N  
ATOM   8875  CA  ALA B 302      32.074  68.347 104.257  1.00  0.98           C  
ATOM   8876  C   ALA B 302      31.050  69.354 104.747  1.00  0.98           C  
ATOM   8877  O   ALA B 302      29.863  69.266 104.436  1.00  0.98           O  
ATOM   8878  CB  ALA B 302      32.402  67.328 105.358  1.00  0.98           C  
ATOM   8879  N   ALA B 303      31.491  70.365 105.520  1.00  0.97           N  
ATOM   8880  CA  ALA B 303      30.629  71.430 105.981  1.00  0.97           C  
ATOM   8881  C   ALA B 303      30.091  72.305 104.848  1.00  0.97           C  
ATOM   8882  O   ALA B 303      28.893  72.572 104.752  1.00  0.97           O  
ATOM   8883  CB  ALA B 303      31.414  72.269 107.002  1.00  0.97           C  
ATOM   8884  N   THR B 304      30.968  72.717 103.911  1.00  0.97           N  
ATOM   8885  CA  THR B 304      30.604  73.505 102.737  1.00  0.97           C  
ATOM   8886  C   THR B 304      29.651  72.786 101.805  1.00  0.97           C  
ATOM   8887  O   THR B 304      28.628  73.341 101.411  1.00  0.97           O  
ATOM   8888  CB  THR B 304      31.847  73.902 101.951  1.00  0.97           C  
ATOM   8889  OG1 THR B 304      32.615  74.819 102.717  1.00  0.97           O  
ATOM   8890  CG2 THR B 304      31.527  74.600 100.624  1.00  0.97           C  
ATOM   8891  N   LEU B 305      29.911  71.509 101.451  1.00  0.96           N  
ATOM   8892  CA  LEU B 305      29.044  70.768 100.544  1.00  0.96           C  
ATOM   8893  C   LEU B 305      27.646  70.530 101.081  1.00  0.96           C  
ATOM   8894  O   LEU B 305      26.661  70.710 100.366  1.00  0.96           O  
ATOM   8895  CB  LEU B 305      29.680  69.433 100.101  1.00  0.96           C  
ATOM   8896  CG  LEU B 305      30.732  69.614  98.990  1.00  0.96           C  
ATOM   8897  CD1 LEU B 305      31.459  68.294  98.747  1.00  0.96           C  
ATOM   8898  CD2 LEU B 305      30.125  70.107  97.666  1.00  0.96           C  
ATOM   8899  N   GLN B 306      27.513  70.187 102.377  1.00  0.92           N  
ATOM   8900  CA  GLN B 306      26.220  70.093 103.035  1.00  0.92           C  
ATOM   8901  C   GLN B 306      25.447  71.416 103.037  1.00  0.92           C  
ATOM   8902  O   GLN B 306      24.249  71.445 102.761  1.00  0.92           O  
ATOM   8903  CB  GLN B 306      26.403  69.630 104.497  1.00  0.92           C  
ATOM   8904  CG  GLN B 306      26.782  68.142 104.666  1.00  0.92           C  
ATOM   8905  CD  GLN B 306      26.968  67.811 106.149  1.00  0.92           C  
ATOM   8906  OE1 GLN B 306      26.024  67.461 106.857  1.00  0.92           O  
ATOM   8907  NE2 GLN B 306      28.221  67.937 106.638  1.00  0.92           N  
ATOM   8908  N   ASP B 307      26.119  72.557 103.315  1.00  0.92           N  
ATOM   8909  CA  ASP B 307      25.525  73.884 103.275  1.00  0.92           C  
ATOM   8910  C   ASP B 307      25.062  74.300 101.870  1.00  0.92           C  
ATOM   8911  O   ASP B 307      23.970  74.839 101.694  1.00  0.92           O  
ATOM   8912  CB  ASP B 307      26.530  74.894 103.896  1.00  0.92           C  
ATOM   8913  CG  ASP B 307      25.872  76.156 104.415  1.00  0.92           C  
ATOM   8914  OD1 ASP B 307      24.854  76.054 105.145  1.00  0.92           O  
ATOM   8915  OD2 ASP B 307      26.392  77.272 104.137  1.00  0.92           O  
ATOM   8916  N   ILE B 308      25.864  74.013 100.819  1.00  0.94           N  
ATOM   8917  CA  ILE B 308      25.501  74.235  99.419  1.00  0.94           C  
ATOM   8918  C   ILE B 308      24.297  73.413  98.980  1.00  0.94           C  
ATOM   8919  O   ILE B 308      23.369  73.933  98.360  1.00  0.94           O  
ATOM   8920  CB  ILE B 308      26.685  73.939  98.492  1.00  0.94           C  
ATOM   8921  CG1 ILE B 308      27.804  74.979  98.731  1.00  0.94           C  
ATOM   8922  CG2 ILE B 308      26.270  73.933  96.998  1.00  0.94           C  
ATOM   8923  CD1 ILE B 308      29.116  74.630  98.022  1.00  0.94           C  
ATOM   8924  N   ILE B 309      24.259  72.107  99.317  1.00  0.87           N  
ATOM   8925  CA  ILE B 309      23.145  71.215  99.010  1.00  0.87           C  
ATOM   8926  C   ILE B 309      21.883  71.616  99.752  1.00  0.87           C  
ATOM   8927  O   ILE B 309      20.803  71.668  99.171  1.00  0.87           O  
ATOM   8928  CB  ILE B 309      23.527  69.756  99.244  1.00  0.87           C  
ATOM   8929  CG1 ILE B 309      24.578  69.352  98.181  1.00  0.87           C  
ATOM   8930  CG2 ILE B 309      22.298  68.816  99.182  1.00  0.87           C  
ATOM   8931  CD1 ILE B 309      25.276  68.028  98.495  1.00  0.87           C  
ATOM   8932  N   ARG B 310      21.991  71.997 101.041  1.00  0.81           N  
ATOM   8933  CA  ARG B 310      20.893  72.550 101.817  1.00  0.81           C  
ATOM   8934  C   ARG B 310      20.329  73.828 101.212  1.00  0.81           C  
ATOM   8935  O   ARG B 310      19.116  73.993 101.133  1.00  0.81           O  
ATOM   8936  CB  ARG B 310      21.367  72.801 103.276  1.00  0.81           C  
ATOM   8937  CG  ARG B 310      20.375  73.561 104.187  1.00  0.81           C  
ATOM   8938  CD  ARG B 310      20.696  73.492 105.688  1.00  0.81           C  
ATOM   8939  NE  ARG B 310      22.050  74.094 105.905  1.00  0.81           N  
ATOM   8940  CZ  ARG B 310      22.746  74.011 107.046  1.00  0.81           C  
ATOM   8941  NH1 ARG B 310      22.244  73.459 108.147  1.00  0.81           N  
ATOM   8942  NH2 ARG B 310      23.958  74.546 107.100  1.00  0.81           N  
ATOM   8943  N   ARG B 311      21.193  74.744 100.733  1.00  0.82           N  
ATOM   8944  CA  ARG B 311      20.776  75.950 100.040  1.00  0.82           C  
ATOM   8945  C   ARG B 311      20.131  75.697  98.679  1.00  0.82           C  
ATOM   8946  O   ARG B 311      19.227  76.416  98.269  1.00  0.82           O  
ATOM   8947  CB  ARG B 311      21.957  76.946  99.929  1.00  0.82           C  
ATOM   8948  CG  ARG B 311      21.526  78.385  99.561  1.00  0.82           C  
ATOM   8949  CD  ARG B 311      22.667  79.405  99.444  1.00  0.82           C  
ATOM   8950  NE  ARG B 311      23.278  79.586 100.800  1.00  0.82           N  
ATOM   8951  CZ  ARG B 311      24.455  79.076 101.185  1.00  0.82           C  
ATOM   8952  NH1 ARG B 311      25.244  78.397 100.362  1.00  0.82           N  
ATOM   8953  NH2 ARG B 311      24.854  79.256 102.441  1.00  0.82           N  
ATOM   8954  N   PHE B 312      20.582  74.669  97.931  1.00  0.86           N  
ATOM   8955  CA  PHE B 312      19.935  74.213  96.707  1.00  0.86           C  
ATOM   8956  C   PHE B 312      18.537  73.638  96.972  1.00  0.86           C  
ATOM   8957  O   PHE B 312      17.574  73.944  96.280  1.00  0.86           O  
ATOM   8958  CB  PHE B 312      20.869  73.179  96.001  1.00  0.86           C  
ATOM   8959  CG  PHE B 312      20.258  72.582  94.758  1.00  0.86           C  
ATOM   8960  CD1 PHE B 312      20.137  73.339  93.581  1.00  0.86           C  
ATOM   8961  CD2 PHE B 312      19.778  71.260  94.772  1.00  0.86           C  
ATOM   8962  CE1 PHE B 312      19.531  72.791  92.441  1.00  0.86           C  
ATOM   8963  CE2 PHE B 312      19.175  70.708  93.635  1.00  0.86           C  
ATOM   8964  CZ  PHE B 312      19.047  71.477  92.472  1.00  0.86           C  
ATOM   8965  N   LYS B 313      18.385  72.821  98.027  1.00  0.77           N  
ATOM   8966  CA  LYS B 313      17.123  72.189  98.381  1.00  0.77           C  
ATOM   8967  C   LYS B 313      16.115  73.152  99.007  1.00  0.77           C  
ATOM   8968  O   LYS B 313      14.926  72.867  99.118  1.00  0.77           O  
ATOM   8969  CB  LYS B 313      17.392  71.000  99.341  1.00  0.77           C  
ATOM   8970  CG  LYS B 313      18.076  69.825  98.615  1.00  0.77           C  
ATOM   8971  CD  LYS B 313      18.198  68.535  99.448  1.00  0.77           C  
ATOM   8972  CE  LYS B 313      16.895  67.735  99.531  1.00  0.77           C  
ATOM   8973  NZ  LYS B 313      17.128  66.436 100.205  1.00  0.77           N  
ATOM   8974  N   SER B 314      16.554  74.350  99.434  1.00  0.79           N  
ATOM   8975  CA  SER B 314      15.671  75.377  99.950  1.00  0.79           C  
ATOM   8976  C   SER B 314      15.356  76.446  98.941  1.00  0.79           C  
ATOM   8977  O   SER B 314      14.670  77.405  99.273  1.00  0.79           O  
ATOM   8978  CB  SER B 314      16.232  76.060 101.229  1.00  0.79           C  
ATOM   8979  OG  SER B 314      17.457  76.766 101.008  1.00  0.79           O  
ATOM   8980  N   SER B 315      15.823  76.331  97.690  1.00  0.76           N  
ATOM   8981  CA  SER B 315      15.629  77.349  96.680  1.00  0.76           C  
ATOM   8982  C   SER B 315      14.487  77.032  95.734  1.00  0.76           C  
ATOM   8983  O   SER B 315      13.673  76.140  95.972  1.00  0.76           O  
ATOM   8984  CB  SER B 315      16.945  77.640  95.920  1.00  0.76           C  
ATOM   8985  OG  SER B 315      17.329  76.614  95.005  1.00  0.76           O  
ATOM   8986  N   LYS B 316      14.340  77.798  94.633  1.00  0.66           N  
ATOM   8987  CA  LYS B 316      13.248  77.583  93.702  1.00  0.66           C  
ATOM   8988  C   LYS B 316      13.678  76.789  92.476  1.00  0.66           C  
ATOM   8989  O   LYS B 316      14.423  77.248  91.609  1.00  0.66           O  
ATOM   8990  CB  LYS B 316      12.629  78.913  93.230  1.00  0.66           C  
ATOM   8991  CG  LYS B 316      12.179  79.819  94.384  1.00  0.66           C  
ATOM   8992  CD  LYS B 316      11.740  81.191  93.864  1.00  0.66           C  
ATOM   8993  CE  LYS B 316      11.494  82.213  94.971  1.00  0.66           C  
ATOM   8994  NZ  LYS B 316      11.243  83.523  94.349  1.00  0.66           N  
ATOM   8995  N   PHE B 317      13.172  75.552  92.356  1.00  0.53           N  
ATOM   8996  CA  PHE B 317      13.548  74.630  91.309  1.00  0.53           C  
ATOM   8997  C   PHE B 317      12.291  73.907  90.844  1.00  0.53           C  
ATOM   8998  O   PHE B 317      11.304  73.820  91.567  1.00  0.53           O  
ATOM   8999  CB  PHE B 317      14.685  73.664  91.774  1.00  0.53           C  
ATOM   9000  CG  PHE B 317      14.290  72.844  92.975  1.00  0.53           C  
ATOM   9001  CD1 PHE B 317      14.219  73.433  94.245  1.00  0.53           C  
ATOM   9002  CD2 PHE B 317      13.962  71.489  92.850  1.00  0.53           C  
ATOM   9003  CE1 PHE B 317      13.808  72.713  95.364  1.00  0.53           C  
ATOM   9004  CE2 PHE B 317      13.536  70.759  93.966  1.00  0.53           C  
ATOM   9005  CZ  PHE B 317      13.457  71.373  95.220  1.00  0.53           C  
ATOM   9006  N   GLY B 318      12.262  73.436  89.576  1.00  0.44           N  
ATOM   9007  CA  GLY B 318      11.040  72.888  88.978  1.00  0.44           C  
ATOM   9008  C   GLY B 318      10.844  71.413  89.173  1.00  0.44           C  
ATOM   9009  O   GLY B 318       9.842  70.845  88.752  1.00  0.44           O  
ATOM   9010  N   CYS B 319      11.808  70.743  89.811  1.00  0.48           N  
ATOM   9011  CA  CYS B 319      11.723  69.360  90.224  1.00  0.48           C  
ATOM   9012  C   CYS B 319      11.195  69.266  91.638  1.00  0.48           C  
ATOM   9013  O   CYS B 319      11.049  70.256  92.337  1.00  0.48           O  
ATOM   9014  CB  CYS B 319      13.105  68.665  90.225  1.00  0.48           C  
ATOM   9015  SG  CYS B 319      14.003  68.809  88.658  1.00  0.48           S  
ATOM   9016  N   ARG B 320      10.919  68.044  92.119  1.00  0.52           N  
ATOM   9017  CA  ARG B 320      10.594  67.809  93.515  1.00  0.52           C  
ATOM   9018  C   ARG B 320      11.872  67.404  94.188  1.00  0.52           C  
ATOM   9019  O   ARG B 320      12.752  66.970  93.458  1.00  0.52           O  
ATOM   9020  CB  ARG B 320       9.635  66.603  93.668  1.00  0.52           C  
ATOM   9021  CG  ARG B 320       8.243  66.767  93.033  1.00  0.52           C  
ATOM   9022  CD  ARG B 320       7.418  65.469  93.079  1.00  0.52           C  
ATOM   9023  NE  ARG B 320       6.067  65.778  92.507  1.00  0.52           N  
ATOM   9024  CZ  ARG B 320       5.069  64.895  92.353  1.00  0.52           C  
ATOM   9025  NH1 ARG B 320       3.911  65.320  91.848  1.00  0.52           N  
ATOM   9026  NH2 ARG B 320       5.190  63.614  92.685  1.00  0.52           N  
ATOM   9027  N   ASP B 321      12.008  67.441  95.528  1.00  0.52           N  
ATOM   9028  CA  ASP B 321      13.157  66.906  96.244  1.00  0.52           C  
ATOM   9029  C   ASP B 321      13.001  65.459  96.735  1.00  0.52           C  
ATOM   9030  O   ASP B 321      12.570  65.261  97.869  1.00  0.52           O  
ATOM   9031  CB  ASP B 321      13.392  67.820  97.479  1.00  0.52           C  
ATOM   9032  CG  ASP B 321      14.490  68.834  97.264  1.00  0.52           C  
ATOM   9033  OD1 ASP B 321      15.146  68.817  96.195  1.00  0.52           O  
ATOM   9034  OD2 ASP B 321      14.751  69.563  98.248  1.00  0.52           O  
ATOM   9035  N   PRO B 322      13.351  64.413  95.980  1.00  0.49           N  
ATOM   9036  CA  PRO B 322      13.503  63.122  96.648  1.00  0.49           C  
ATOM   9037  C   PRO B 322      14.768  62.416  96.218  1.00  0.49           C  
ATOM   9038  O   PRO B 322      15.574  62.075  97.079  1.00  0.49           O  
ATOM   9039  CB  PRO B 322      12.249  62.354  96.186  1.00  0.49           C  
ATOM   9040  CG  PRO B 322      12.006  62.833  94.741  1.00  0.49           C  
ATOM   9041  CD  PRO B 322      12.615  64.243  94.717  1.00  0.49           C  
ATOM   9042  N   VAL B 323      14.975  62.163  94.928  1.00  0.47           N  
ATOM   9043  CA  VAL B 323      16.032  61.341  94.413  1.00  0.47           C  
ATOM   9044  C   VAL B 323      16.735  62.147  93.377  1.00  0.47           C  
ATOM   9045  O   VAL B 323      16.155  63.109  92.890  1.00  0.47           O  
ATOM   9046  CB  VAL B 323      15.535  60.077  93.705  1.00  0.47           C  
ATOM   9047  CG1 VAL B 323      14.718  59.204  94.668  1.00  0.47           C  
ATOM   9048  CG2 VAL B 323      14.700  60.359  92.434  1.00  0.47           C  
ATOM   9049  N   ARG B 324      17.946  61.717  92.955  1.00  0.34           N  
ATOM   9050  CA  ARG B 324      18.810  62.265  91.924  1.00  0.34           C  
ATOM   9051  C   ARG B 324      18.255  63.208  90.862  1.00  0.34           C  
ATOM   9052  O   ARG B 324      18.866  64.220  90.553  1.00  0.34           O  
ATOM   9053  CB  ARG B 324      19.536  61.084  91.237  1.00  0.34           C  
ATOM   9054  CG  ARG B 324      18.691  60.125  90.378  1.00  0.34           C  
ATOM   9055  CD  ARG B 324      19.453  58.997  89.674  1.00  0.34           C  
ATOM   9056  NE  ARG B 324      18.418  58.165  88.973  1.00  0.34           N  
ATOM   9057  CZ  ARG B 324      17.750  57.133  89.522  1.00  0.34           C  
ATOM   9058  NH1 ARG B 324      17.072  56.295  88.724  1.00  0.34           N  
ATOM   9059  NH2 ARG B 324      17.926  56.762  90.791  1.00  0.34           N  
ATOM   9060  N   THR B 325      17.076  62.911  90.307  1.00  0.55           N  
ATOM   9061  CA  THR B 325      16.215  63.715  89.451  1.00  0.55           C  
ATOM   9062  C   THR B 325      15.957  65.134  89.962  1.00  0.55           C  
ATOM   9063  O   THR B 325      15.713  66.054  89.187  1.00  0.55           O  
ATOM   9064  CB  THR B 325      14.885  62.963  89.310  1.00  0.55           C  
ATOM   9065  OG1 THR B 325      15.141  61.587  89.049  1.00  0.55           O  
ATOM   9066  CG2 THR B 325      13.999  63.447  88.159  1.00  0.55           C  
ATOM   9067  N   ASN B 326      16.038  65.398  91.287  1.00  0.68           N  
ATOM   9068  CA  ASN B 326      16.038  66.755  91.810  1.00  0.68           C  
ATOM   9069  C   ASN B 326      17.334  67.537  91.565  1.00  0.68           C  
ATOM   9070  O   ASN B 326      17.333  68.762  91.493  1.00  0.68           O  
ATOM   9071  CB  ASN B 326      15.642  66.767  93.305  1.00  0.68           C  
ATOM   9072  CG  ASN B 326      16.682  66.255  94.285  1.00  0.68           C  
ATOM   9073  OD1 ASN B 326      17.233  65.176  94.119  1.00  0.68           O  
ATOM   9074  ND2 ASN B 326      16.946  67.030  95.349  1.00  0.68           N  
ATOM   9075  N   PHE B 327      18.472  66.849  91.382  1.00  0.78           N  
ATOM   9076  CA  PHE B 327      19.803  67.420  91.233  1.00  0.78           C  
ATOM   9077  C   PHE B 327      20.253  67.569  89.786  1.00  0.78           C  
ATOM   9078  O   PHE B 327      21.396  67.929  89.511  1.00  0.78           O  
ATOM   9079  CB  PHE B 327      20.886  66.544  91.918  1.00  0.78           C  
ATOM   9080  CG  PHE B 327      20.808  66.625  93.408  1.00  0.78           C  
ATOM   9081  CD1 PHE B 327      20.158  65.621  94.132  1.00  0.78           C  
ATOM   9082  CD2 PHE B 327      21.391  67.697  94.103  1.00  0.78           C  
ATOM   9083  CE1 PHE B 327      20.025  65.712  95.521  1.00  0.78           C  
ATOM   9084  CE2 PHE B 327      21.278  67.787  95.496  1.00  0.78           C  
ATOM   9085  CZ  PHE B 327      20.579  66.801  96.204  1.00  0.78           C  
ATOM   9086  N   ASP B 328      19.382  67.351  88.798  1.00  0.79           N  
ATOM   9087  CA  ASP B 328      19.658  67.624  87.410  1.00  0.79           C  
ATOM   9088  C   ASP B 328      19.976  69.079  87.116  1.00  0.79           C  
ATOM   9089  O   ASP B 328      20.878  69.367  86.336  1.00  0.79           O  
ATOM   9090  CB  ASP B 328      18.415  67.196  86.621  1.00  0.79           C  
ATOM   9091  CG  ASP B 328      18.609  65.843  86.015  1.00  0.79           C  
ATOM   9092  OD1 ASP B 328      18.589  64.761  86.644  1.00  0.79           O  
ATOM   9093  OD2 ASP B 328      18.974  65.869  84.795  1.00  0.79           O  
ATOM   9094  N   ALA B 329      19.293  70.011  87.802  1.00  0.81           N  
ATOM   9095  CA  ALA B 329      19.560  71.428  87.683  1.00  0.81           C  
ATOM   9096  C   ALA B 329      20.608  71.923  88.681  1.00  0.81           C  
ATOM   9097  O   ALA B 329      20.820  73.124  88.839  1.00  0.81           O  
ATOM   9098  CB  ALA B 329      18.245  72.195  87.936  1.00  0.81           C  
ATOM   9099  N   PHE B 330      21.313  71.020  89.398  1.00  0.86           N  
ATOM   9100  CA  PHE B 330      22.372  71.397  90.324  1.00  0.86           C  
ATOM   9101  C   PHE B 330      23.559  72.096  89.646  1.00  0.86           C  
ATOM   9102  O   PHE B 330      23.937  73.159  90.143  1.00  0.86           O  
ATOM   9103  CB  PHE B 330      22.801  70.166  91.179  1.00  0.86           C  
ATOM   9104  CG  PHE B 330      23.745  70.482  92.313  1.00  0.86           C  
ATOM   9105  CD1 PHE B 330      23.247  70.982  93.524  1.00  0.86           C  
ATOM   9106  CD2 PHE B 330      25.120  70.213  92.206  1.00  0.86           C  
ATOM   9107  CE1 PHE B 330      24.093  71.197  94.620  1.00  0.86           C  
ATOM   9108  CE2 PHE B 330      25.975  70.428  93.297  1.00  0.86           C  
ATOM   9109  CZ  PHE B 330      25.461  70.917  94.505  1.00  0.86           C  
ATOM   9110  N   PRO B 331      24.154  71.679  88.517  1.00  0.92           N  
ATOM   9111  CA  PRO B 331      25.295  72.391  87.945  1.00  0.92           C  
ATOM   9112  C   PRO B 331      24.885  73.669  87.246  1.00  0.92           C  
ATOM   9113  O   PRO B 331      25.753  74.435  86.831  1.00  0.92           O  
ATOM   9114  CB  PRO B 331      25.911  71.391  86.950  1.00  0.92           C  
ATOM   9115  CG  PRO B 331      25.365  70.029  87.384  1.00  0.92           C  
ATOM   9116  CD  PRO B 331      23.962  70.384  87.857  1.00  0.92           C  
ATOM   9117  N   ASP B 332      23.576  73.927  87.095  1.00  0.88           N  
ATOM   9118  CA  ASP B 332      23.053  75.140  86.506  1.00  0.88           C  
ATOM   9119  C   ASP B 332      22.750  76.165  87.593  1.00  0.88           C  
ATOM   9120  O   ASP B 332      22.471  77.333  87.326  1.00  0.88           O  
ATOM   9121  CB  ASP B 332      21.758  74.803  85.737  1.00  0.88           C  
ATOM   9122  CG  ASP B 332      22.083  73.699  84.748  1.00  0.88           C  
ATOM   9123  OD1 ASP B 332      22.908  73.948  83.834  1.00  0.88           O  
ATOM   9124  OD2 ASP B 332      21.549  72.579  84.943  1.00  0.88           O  
ATOM   9125  N   LYS B 333      22.839  75.758  88.876  1.00  0.85           N  
ATOM   9126  CA  LYS B 333      22.630  76.640  90.008  1.00  0.85           C  
ATOM   9127  C   LYS B 333      23.866  76.754  90.880  1.00  0.85           C  
ATOM   9128  O   LYS B 333      23.995  77.706  91.649  1.00  0.85           O  
ATOM   9129  CB  LYS B 333      21.455  76.123  90.879  1.00  0.85           C  
ATOM   9130  CG  LYS B 333      20.093  76.139  90.159  1.00  0.85           C  
ATOM   9131  CD  LYS B 333      19.679  77.542  89.682  1.00  0.85           C  
ATOM   9132  CE  LYS B 333      18.281  77.599  89.067  1.00  0.85           C  
ATOM   9133  NZ  LYS B 333      18.053  78.941  88.486  1.00  0.85           N  
ATOM   9134  N   VAL B 334      24.819  75.814  90.763  1.00  0.94           N  
ATOM   9135  CA  VAL B 334      26.003  75.740  91.603  1.00  0.94           C  
ATOM   9136  C   VAL B 334      27.266  75.601  90.759  1.00  0.94           C  
ATOM   9137  O   VAL B 334      27.381  74.724  89.907  1.00  0.94           O  
ATOM   9138  CB  VAL B 334      25.889  74.539  92.552  1.00  0.94           C  
ATOM   9139  CG1 VAL B 334      27.159  74.313  93.392  1.00  0.94           C  
ATOM   9140  CG2 VAL B 334      24.676  74.724  93.489  1.00  0.94           C  
ATOM   9141  N   ALA B 335      28.272  76.468  90.990  1.00  0.97           N  
ATOM   9142  CA  ALA B 335      29.640  76.257  90.549  1.00  0.97           C  
ATOM   9143  C   ALA B 335      30.538  76.238  91.777  1.00  0.97           C  
ATOM   9144  O   ALA B 335      30.422  77.096  92.648  1.00  0.97           O  
ATOM   9145  CB  ALA B 335      30.128  77.377  89.601  1.00  0.97           C  
ATOM   9146  N   ILE B 336      31.456  75.257  91.889  1.00  0.97           N  
ATOM   9147  CA  ILE B 336      32.415  75.199  92.990  1.00  0.97           C  
ATOM   9148  C   ILE B 336      33.820  75.262  92.421  1.00  0.97           C  
ATOM   9149  O   ILE B 336      34.258  74.391  91.671  1.00  0.97           O  
ATOM   9150  CB  ILE B 336      32.267  73.961  93.882  1.00  0.97           C  
ATOM   9151  CG1 ILE B 336      30.834  73.883  94.464  1.00  0.97           C  
ATOM   9152  CG2 ILE B 336      33.301  74.018  95.035  1.00  0.97           C  
ATOM   9153  CD1 ILE B 336      30.508  72.552  95.149  1.00  0.97           C  
ATOM   9154  N   GLN B 337      34.583  76.313  92.780  1.00  0.96           N  
ATOM   9155  CA  GLN B 337      35.959  76.460  92.349  1.00  0.96           C  
ATOM   9156  C   GLN B 337      36.894  75.953  93.428  1.00  0.96           C  
ATOM   9157  O   GLN B 337      36.899  76.435  94.562  1.00  0.96           O  
ATOM   9158  CB  GLN B 337      36.314  77.934  92.026  1.00  0.96           C  
ATOM   9159  CG  GLN B 337      37.665  78.128  91.283  1.00  0.96           C  
ATOM   9160  CD  GLN B 337      37.618  77.613  89.842  1.00  0.96           C  
ATOM   9161  OE1 GLN B 337      36.599  77.715  89.160  1.00  0.96           O  
ATOM   9162  NE2 GLN B 337      38.757  77.092  89.343  1.00  0.96           N  
ATOM   9163  N   LEU B 338      37.720  74.954  93.080  1.00  0.97           N  
ATOM   9164  CA  LEU B 338      38.745  74.402  93.935  1.00  0.97           C  
ATOM   9165  C   LEU B 338      39.977  75.274  93.831  1.00  0.97           C  
ATOM   9166  O   LEU B 338      40.638  75.366  92.794  1.00  0.97           O  
ATOM   9167  CB  LEU B 338      39.122  72.946  93.529  1.00  0.97           C  
ATOM   9168  CG  LEU B 338      38.205  71.799  94.031  1.00  0.97           C  
ATOM   9169  CD1 LEU B 338      36.871  72.247  94.652  1.00  0.97           C  
ATOM   9170  CD2 LEU B 338      37.936  70.802  92.893  1.00  0.97           C  
ATOM   9171  N   ASN B 339      40.318  75.945  94.945  1.00  0.94           N  
ATOM   9172  CA  ASN B 339      41.523  76.726  95.052  1.00  0.94           C  
ATOM   9173  C   ASN B 339      42.651  75.789  95.474  1.00  0.94           C  
ATOM   9174  O   ASN B 339      42.708  75.342  96.616  1.00  0.94           O  
ATOM   9175  CB  ASN B 339      41.279  77.885  96.063  1.00  0.94           C  
ATOM   9176  CG  ASN B 339      42.260  79.054  96.008  1.00  0.94           C  
ATOM   9177  OD1 ASN B 339      42.362  79.844  96.945  1.00  0.94           O  
ATOM   9178  ND2 ASN B 339      42.955  79.262  94.872  1.00  0.94           N  
ATOM   9179  N   ASP B 340      43.540  75.455  94.515  1.00  0.93           N  
ATOM   9180  CA  ASP B 340      44.555  74.415  94.613  1.00  0.93           C  
ATOM   9181  C   ASP B 340      44.019  72.991  94.853  1.00  0.93           C  
ATOM   9182  O   ASP B 340      42.826  72.723  94.710  1.00  0.93           O  
ATOM   9183  CB  ASP B 340      45.661  74.827  95.620  1.00  0.93           C  
ATOM   9184  CG  ASP B 340      47.030  74.441  95.096  1.00  0.93           C  
ATOM   9185  OD1 ASP B 340      47.299  73.220  95.025  1.00  0.93           O  
ATOM   9186  OD2 ASP B 340      47.797  75.350  94.698  1.00  0.93           O  
ATOM   9187  N   THR B 341      44.886  72.015  95.188  1.00  0.94           N  
ATOM   9188  CA  THR B 341      44.413  70.647  95.479  1.00  0.94           C  
ATOM   9189  C   THR B 341      43.892  70.447  96.859  1.00  0.94           C  
ATOM   9190  O   THR B 341      43.323  69.401  97.150  1.00  0.94           O  
ATOM   9191  CB  THR B 341      45.287  69.493  95.218  1.00  0.94           C  
ATOM   9192  OG1 THR B 341      46.405  69.660  95.965  1.00  0.94           O  
ATOM   9193  CG2 THR B 341      45.756  69.587  93.720  1.00  0.94           C  
ATOM   9194  N   HIS B 342      44.047  71.454  97.716  1.00  0.93           N  
ATOM   9195  CA  HIS B 342      43.658  71.399  99.105  1.00  0.93           C  
ATOM   9196  C   HIS B 342      42.177  71.076  99.346  1.00  0.93           C  
ATOM   9197  O   HIS B 342      41.897  70.404 100.332  1.00  0.93           O  
ATOM   9198  CB  HIS B 342      44.035  72.714  99.817  1.00  0.93           C  
ATOM   9199  CG  HIS B 342      45.442  73.173  99.565  1.00  0.93           C  
ATOM   9200  ND1 HIS B 342      45.764  74.481  99.885  1.00  0.93           N  
ATOM   9201  CD2 HIS B 342      46.493  72.568  98.951  1.00  0.93           C  
ATOM   9202  CE1 HIS B 342      46.997  74.648  99.435  1.00  0.93           C  
ATOM   9203  NE2 HIS B 342      47.481  73.521  98.865  1.00  0.93           N  
ATOM   9204  N   PRO B 343      41.155  71.441  98.555  1.00  0.99           N  
ATOM   9205  CA  PRO B 343      39.810  70.954  98.851  1.00  0.99           C  
ATOM   9206  C   PRO B 343      39.410  69.905  97.831  1.00  0.99           C  
ATOM   9207  O   PRO B 343      38.222  69.736  97.564  1.00  0.99           O  
ATOM   9208  CB  PRO B 343      38.971  72.229  98.731  1.00  0.99           C  
ATOM   9209  CG  PRO B 343      39.631  73.012  97.595  1.00  0.99           C  
ATOM   9210  CD  PRO B 343      41.117  72.688  97.772  1.00  0.99           C  
ATOM   9211  N   SER B 344      40.370  69.108  97.314  1.00  0.97           N  
ATOM   9212  CA  SER B 344      40.152  68.033  96.338  1.00  0.97           C  
ATOM   9213  C   SER B 344      39.153  66.985  96.807  1.00  0.97           C  
ATOM   9214  O   SER B 344      38.347  66.472  96.032  1.00  0.97           O  
ATOM   9215  CB  SER B 344      41.496  67.349  95.958  1.00  0.97           C  
ATOM   9216  OG  SER B 344      41.362  66.321  94.975  1.00  0.97           O  
ATOM   9217  N   LEU B 345      39.112  66.700  98.129  1.00  0.96           N  
ATOM   9218  CA  LEU B 345      38.138  65.820  98.760  1.00  0.96           C  
ATOM   9219  C   LEU B 345      36.667  66.186  98.542  1.00  0.96           C  
ATOM   9220  O   LEU B 345      35.785  65.364  98.782  1.00  0.96           O  
ATOM   9221  CB  LEU B 345      38.403  65.716 100.283  1.00  0.96           C  
ATOM   9222  CG  LEU B 345      39.709  64.972 100.633  1.00  0.96           C  
ATOM   9223  CD1 LEU B 345      40.066  65.186 102.109  1.00  0.96           C  
ATOM   9224  CD2 LEU B 345      39.611  63.465 100.336  1.00  0.96           C  
ATOM   9225  N   ALA B 346      36.353  67.392  98.016  1.00  0.98           N  
ATOM   9226  CA  ALA B 346      35.022  67.774  97.592  1.00  0.98           C  
ATOM   9227  C   ALA B 346      34.443  66.879  96.504  1.00  0.98           C  
ATOM   9228  O   ALA B 346      33.259  66.554  96.511  1.00  0.98           O  
ATOM   9229  CB  ALA B 346      35.039  69.234  97.099  1.00  0.98           C  
ATOM   9230  N   ILE B 347      35.275  66.436  95.545  1.00  0.96           N  
ATOM   9231  CA  ILE B 347      34.876  65.538  94.468  1.00  0.96           C  
ATOM   9232  C   ILE B 347      34.412  64.164  94.964  1.00  0.96           C  
ATOM   9233  O   ILE B 347      33.306  63.766  94.587  1.00  0.96           O  
ATOM   9234  CB  ILE B 347      35.991  65.459  93.423  1.00  0.96           C  
ATOM   9235  CG1 ILE B 347      36.154  66.849  92.760  1.00  0.96           C  
ATOM   9236  CG2 ILE B 347      35.720  64.373  92.354  1.00  0.96           C  
ATOM   9237  CD1 ILE B 347      37.487  67.014  92.032  1.00  0.96           C  
ATOM   9238  N   PRO B 348      35.088  63.405  95.842  1.00  0.98           N  
ATOM   9239  CA  PRO B 348      34.510  62.176  96.364  1.00  0.98           C  
ATOM   9240  C   PRO B 348      33.452  62.443  97.417  1.00  0.98           C  
ATOM   9241  O   PRO B 348      32.573  61.600  97.561  1.00  0.98           O  
ATOM   9242  CB  PRO B 348      35.707  61.384  96.922  1.00  0.98           C  
ATOM   9243  CG  PRO B 348      36.768  62.446  97.211  1.00  0.98           C  
ATOM   9244  CD  PRO B 348      36.532  63.463  96.091  1.00  0.98           C  
ATOM   9245  N   GLU B 349      33.489  63.561  98.173  1.00  0.95           N  
ATOM   9246  CA  GLU B 349      32.429  63.900  99.116  1.00  0.95           C  
ATOM   9247  C   GLU B 349      31.098  64.210  98.448  1.00  0.95           C  
ATOM   9248  O   GLU B 349      30.050  63.722  98.865  1.00  0.95           O  
ATOM   9249  CB  GLU B 349      32.852  65.053 100.061  1.00  0.95           C  
ATOM   9250  CG  GLU B 349      31.776  65.523 101.090  1.00  0.95           C  
ATOM   9251  CD  GLU B 349      31.251  64.459 102.052  1.00  0.95           C  
ATOM   9252  OE1 GLU B 349      31.764  63.313 102.058  1.00  0.95           O  
ATOM   9253  OE2 GLU B 349      30.283  64.747 102.804  1.00  0.95           O  
ATOM   9254  N   LEU B 350      31.087  64.972  97.331  1.00  0.94           N  
ATOM   9255  CA  LEU B 350      29.873  65.195  96.563  1.00  0.94           C  
ATOM   9256  C   LEU B 350      29.329  63.888  96.004  1.00  0.94           C  
ATOM   9257  O   LEU B 350      28.148  63.591  96.145  1.00  0.94           O  
ATOM   9258  CB  LEU B 350      30.083  66.254  95.449  1.00  0.94           C  
ATOM   9259  CG  LEU B 350      28.795  66.690  94.708  1.00  0.94           C  
ATOM   9260  CD1 LEU B 350      27.724  67.269  95.645  1.00  0.94           C  
ATOM   9261  CD2 LEU B 350      29.113  67.709  93.604  1.00  0.94           C  
ATOM   9262  N   MET B 351      30.202  63.008  95.471  1.00  0.91           N  
ATOM   9263  CA  MET B 351      29.823  61.655  95.092  1.00  0.91           C  
ATOM   9264  C   MET B 351      29.274  60.809  96.236  1.00  0.91           C  
ATOM   9265  O   MET B 351      28.286  60.104  96.059  1.00  0.91           O  
ATOM   9266  CB  MET B 351      31.009  60.895  94.451  1.00  0.91           C  
ATOM   9267  CG  MET B 351      31.378  61.419  93.053  1.00  0.91           C  
ATOM   9268  SD  MET B 351      30.039  61.257  91.841  1.00  0.91           S  
ATOM   9269  CE  MET B 351      30.096  59.456  91.612  1.00  0.91           C  
ATOM   9270  N   ARG B 352      29.864  60.875  97.445  1.00  0.88           N  
ATOM   9271  CA  ARG B 352      29.352  60.200  98.626  1.00  0.88           C  
ATOM   9272  C   ARG B 352      27.958  60.668  99.025  1.00  0.88           C  
ATOM   9273  O   ARG B 352      27.074  59.870  99.325  1.00  0.88           O  
ATOM   9274  CB  ARG B 352      30.296  60.423  99.832  1.00  0.88           C  
ATOM   9275  CG  ARG B 352      29.995  59.501 101.030  1.00  0.88           C  
ATOM   9276  CD  ARG B 352      30.827  59.816 102.277  1.00  0.88           C  
ATOM   9277  NE  ARG B 352      30.407  61.157 102.798  1.00  0.88           N  
ATOM   9278  CZ  ARG B 352      29.306  61.417 103.510  1.00  0.88           C  
ATOM   9279  NH1 ARG B 352      28.446  60.465 103.858  1.00  0.88           N  
ATOM   9280  NH2 ARG B 352      29.062  62.668 103.885  1.00  0.88           N  
ATOM   9281  N   ILE B 353      27.695  61.989  99.012  1.00  0.89           N  
ATOM   9282  CA  ILE B 353      26.363  62.523  99.274  1.00  0.89           C  
ATOM   9283  C   ILE B 353      25.379  62.114  98.193  1.00  0.89           C  
ATOM   9284  O   ILE B 353      24.274  61.657  98.476  1.00  0.89           O  
ATOM   9285  CB  ILE B 353      26.362  64.041  99.429  1.00  0.89           C  
ATOM   9286  CG1 ILE B 353      27.282  64.454 100.601  1.00  0.89           C  
ATOM   9287  CG2 ILE B 353      24.917  64.545  99.670  1.00  0.89           C  
ATOM   9288  CD1 ILE B 353      27.643  65.943 100.592  1.00  0.89           C  
ATOM   9289  N   LEU B 354      25.771  62.214  96.910  1.00  0.86           N  
ATOM   9290  CA  LEU B 354      24.917  61.811  95.811  1.00  0.86           C  
ATOM   9291  C   LEU B 354      24.575  60.327  95.821  1.00  0.86           C  
ATOM   9292  O   LEU B 354      23.406  59.956  95.766  1.00  0.86           O  
ATOM   9293  CB  LEU B 354      25.582  62.147  94.448  1.00  0.86           C  
ATOM   9294  CG  LEU B 354      25.715  63.658  94.151  1.00  0.86           C  
ATOM   9295  CD1 LEU B 354      26.602  63.901  92.919  1.00  0.86           C  
ATOM   9296  CD2 LEU B 354      24.361  64.363  94.011  1.00  0.86           C  
ATOM   9297  N   VAL B 355      25.574  59.432  95.924  1.00  0.83           N  
ATOM   9298  CA  VAL B 355      25.348  57.998  95.809  1.00  0.83           C  
ATOM   9299  C   VAL B 355      24.841  57.392  97.108  1.00  0.83           C  
ATOM   9300  O   VAL B 355      23.807  56.724  97.126  1.00  0.83           O  
ATOM   9301  CB  VAL B 355      26.611  57.276  95.328  1.00  0.83           C  
ATOM   9302  CG1 VAL B 355      26.370  55.757  95.187  1.00  0.83           C  
ATOM   9303  CG2 VAL B 355      27.033  57.852  93.958  1.00  0.83           C  
ATOM   9304  N   ASP B 356      25.518  57.626  98.248  1.00  0.84           N  
ATOM   9305  CA  ASP B 356      25.161  56.976  99.496  1.00  0.84           C  
ATOM   9306  C   ASP B 356      23.930  57.599 100.158  1.00  0.84           C  
ATOM   9307  O   ASP B 356      23.030  56.905 100.634  1.00  0.84           O  
ATOM   9308  CB  ASP B 356      26.345  56.982 100.506  1.00  0.84           C  
ATOM   9309  CG  ASP B 356      27.610  56.344  99.957  1.00  0.84           C  
ATOM   9310  OD1 ASP B 356      27.592  55.674  98.894  1.00  0.84           O  
ATOM   9311  OD2 ASP B 356      28.679  56.504 100.608  1.00  0.84           O  
ATOM   9312  N   LEU B 357      23.849  58.947 100.218  1.00  0.78           N  
ATOM   9313  CA  LEU B 357      22.759  59.620 100.910  1.00  0.78           C  
ATOM   9314  C   LEU B 357      21.540  59.870 100.035  1.00  0.78           C  
ATOM   9315  O   LEU B 357      20.436  59.469 100.409  1.00  0.78           O  
ATOM   9316  CB  LEU B 357      23.210  60.951 101.563  1.00  0.78           C  
ATOM   9317  CG  LEU B 357      24.257  60.793 102.688  1.00  0.78           C  
ATOM   9318  CD1 LEU B 357      24.731  62.174 103.163  1.00  0.78           C  
ATOM   9319  CD2 LEU B 357      23.696  60.006 103.882  1.00  0.78           C  
ATOM   9320  N   GLU B 358      21.689  60.469  98.836  1.00  0.73           N  
ATOM   9321  CA  GLU B 358      20.538  60.880  98.036  1.00  0.73           C  
ATOM   9322  C   GLU B 358      20.146  59.803  97.010  1.00  0.73           C  
ATOM   9323  O   GLU B 358      19.207  59.966  96.230  1.00  0.73           O  
ATOM   9324  CB  GLU B 358      20.797  62.231  97.303  1.00  0.73           C  
ATOM   9325  CG  GLU B 358      21.218  63.452  98.192  1.00  0.73           C  
ATOM   9326  CD  GLU B 358      20.205  64.002  99.221  1.00  0.73           C  
ATOM   9327  OE1 GLU B 358      20.346  63.628 100.412  1.00  0.73           O  
ATOM   9328  OE2 GLU B 358      19.329  64.858  98.887  1.00  0.73           O  
ATOM   9329  N   ARG B 359      20.851  58.643  97.016  1.00  0.68           N  
ATOM   9330  CA  ARG B 359      20.586  57.454  96.210  1.00  0.68           C  
ATOM   9331  C   ARG B 359      20.605  57.713  94.709  1.00  0.68           C  
ATOM   9332  O   ARG B 359      19.715  57.355  93.937  1.00  0.68           O  
ATOM   9333  CB  ARG B 359      19.342  56.645  96.678  1.00  0.68           C  
ATOM   9334  CG  ARG B 359      19.512  55.840  97.998  1.00  0.68           C  
ATOM   9335  CD  ARG B 359      19.720  56.658  99.284  1.00  0.68           C  
ATOM   9336  NE  ARG B 359      19.658  55.710 100.449  1.00  0.68           N  
ATOM   9337  CZ  ARG B 359      19.755  56.098 101.729  1.00  0.68           C  
ATOM   9338  NH1 ARG B 359      19.707  55.178 102.693  1.00  0.68           N  
ATOM   9339  NH2 ARG B 359      19.867  57.373 102.081  1.00  0.68           N  
ATOM   9340  N   MET B 360      21.670  58.362  94.240  1.00  0.74           N  
ATOM   9341  CA  MET B 360      21.906  58.609  92.850  1.00  0.74           C  
ATOM   9342  C   MET B 360      22.778  57.536  92.233  1.00  0.74           C  
ATOM   9343  O   MET B 360      23.881  57.266  92.696  1.00  0.74           O  
ATOM   9344  CB  MET B 360      22.558  59.999  92.654  1.00  0.74           C  
ATOM   9345  CG  MET B 360      22.750  60.370  91.175  1.00  0.74           C  
ATOM   9346  SD  MET B 360      23.279  62.078  90.837  1.00  0.74           S  
ATOM   9347  CE  MET B 360      22.022  63.247  91.359  1.00  0.74           C  
ATOM   9348  N   ASP B 361      22.314  56.922  91.124  1.00  0.77           N  
ATOM   9349  CA  ASP B 361      23.077  56.006  90.304  1.00  0.77           C  
ATOM   9350  C   ASP B 361      24.389  56.636  89.833  1.00  0.77           C  
ATOM   9351  O   ASP B 361      24.427  57.818  89.485  1.00  0.77           O  
ATOM   9352  CB  ASP B 361      22.270  55.591  89.064  1.00  0.77           C  
ATOM   9353  CG  ASP B 361      20.854  55.233  89.412  1.00  0.77           C  
ATOM   9354  OD1 ASP B 361      20.553  54.480  90.363  1.00  0.77           O  
ATOM   9355  OD2 ASP B 361      20.004  55.761  88.667  1.00  0.77           O  
ATOM   9356  N   TRP B 362      25.509  55.878  89.845  1.00  0.81           N  
ATOM   9357  CA  TRP B 362      26.855  56.446  89.804  1.00  0.81           C  
ATOM   9358  C   TRP B 362      27.141  57.343  88.604  1.00  0.81           C  
ATOM   9359  O   TRP B 362      27.699  58.429  88.748  1.00  0.81           O  
ATOM   9360  CB  TRP B 362      27.914  55.301  89.848  1.00  0.81           C  
ATOM   9361  CG  TRP B 362      29.369  55.756  89.807  1.00  0.81           C  
ATOM   9362  CD1 TRP B 362      30.097  56.206  88.737  1.00  0.81           C  
ATOM   9363  CD2 TRP B 362      30.231  55.893  90.954  1.00  0.81           C  
ATOM   9364  NE1 TRP B 362      31.335  56.657  89.146  1.00  0.81           N  
ATOM   9365  CE2 TRP B 362      31.445  56.416  90.498  1.00  0.81           C  
ATOM   9366  CE3 TRP B 362      30.018  55.615  92.306  1.00  0.81           C  
ATOM   9367  CZ2 TRP B 362      32.505  56.649  91.366  1.00  0.81           C  
ATOM   9368  CZ3 TRP B 362      31.083  55.853  93.190  1.00  0.81           C  
ATOM   9369  CH2 TRP B 362      32.305  56.358  92.725  1.00  0.81           C  
ATOM   9370  N   ASP B 363      26.758  56.917  87.395  1.00  0.84           N  
ATOM   9371  CA  ASP B 363      27.057  57.605  86.157  1.00  0.84           C  
ATOM   9372  C   ASP B 363      26.430  59.002  86.084  1.00  0.84           C  
ATOM   9373  O   ASP B 363      27.100  59.991  85.797  1.00  0.84           O  
ATOM   9374  CB  ASP B 363      26.605  56.688  84.999  1.00  0.84           C  
ATOM   9375  CG  ASP B 363      27.342  55.349  85.012  1.00  0.84           C  
ATOM   9376  OD1 ASP B 363      28.360  55.194  85.739  1.00  0.84           O  
ATOM   9377  OD2 ASP B 363      26.857  54.430  84.309  1.00  0.84           O  
ATOM   9378  N   LYS B 364      25.146  59.136  86.483  1.00  0.78           N  
ATOM   9379  CA  LYS B 364      24.485  60.419  86.666  1.00  0.78           C  
ATOM   9380  C   LYS B 364      25.143  61.285  87.741  1.00  0.78           C  
ATOM   9381  O   LYS B 364      25.256  62.504  87.599  1.00  0.78           O  
ATOM   9382  CB  LYS B 364      22.982  60.206  87.004  1.00  0.78           C  
ATOM   9383  CG  LYS B 364      22.157  61.492  87.139  1.00  0.78           C  
ATOM   9384  CD  LYS B 364      22.158  62.309  85.852  1.00  0.78           C  
ATOM   9385  CE  LYS B 364      21.258  63.503  85.986  1.00  0.78           C  
ATOM   9386  NZ  LYS B 364      21.109  64.106  84.662  1.00  0.78           N  
ATOM   9387  N   ALA B 365      25.613  60.679  88.852  1.00  0.86           N  
ATOM   9388  CA  ALA B 365      26.351  61.383  89.888  1.00  0.86           C  
ATOM   9389  C   ALA B 365      27.658  61.958  89.410  1.00  0.86           C  
ATOM   9390  O   ALA B 365      27.999  63.104  89.700  1.00  0.86           O  
ATOM   9391  CB  ALA B 365      26.606  60.465  91.100  1.00  0.86           C  
ATOM   9392  N   TRP B 366      28.405  61.172  88.628  1.00  0.85           N  
ATOM   9393  CA  TRP B 366      29.651  61.568  88.023  1.00  0.85           C  
ATOM   9394  C   TRP B 366      29.475  62.697  87.012  1.00  0.85           C  
ATOM   9395  O   TRP B 366      30.195  63.694  87.071  1.00  0.85           O  
ATOM   9396  CB  TRP B 366      30.346  60.309  87.449  1.00  0.85           C  
ATOM   9397  CG  TRP B 366      31.789  60.503  87.031  1.00  0.85           C  
ATOM   9398  CD1 TRP B 366      32.341  60.346  85.791  1.00  0.85           C  
ATOM   9399  CD2 TRP B 366      32.857  60.965  87.889  1.00  0.85           C  
ATOM   9400  NE1 TRP B 366      33.685  60.674  85.811  1.00  0.85           N  
ATOM   9401  CE2 TRP B 366      34.008  61.069  87.095  1.00  0.85           C  
ATOM   9402  CE3 TRP B 366      32.880  61.301  89.245  1.00  0.85           C  
ATOM   9403  CZ2 TRP B 366      35.214  61.519  87.627  1.00  0.85           C  
ATOM   9404  CZ3 TRP B 366      34.084  61.787  89.778  1.00  0.85           C  
ATOM   9405  CH2 TRP B 366      35.233  61.891  88.984  1.00  0.85           C  
ATOM   9406  N   ASP B 367      28.439  62.640  86.146  1.00  0.87           N  
ATOM   9407  CA  ASP B 367      28.055  63.744  85.281  1.00  0.87           C  
ATOM   9408  C   ASP B 367      27.728  65.028  86.040  1.00  0.87           C  
ATOM   9409  O   ASP B 367      28.098  66.131  85.635  1.00  0.87           O  
ATOM   9410  CB  ASP B 367      26.755  63.424  84.498  1.00  0.87           C  
ATOM   9411  CG  ASP B 367      26.917  62.336  83.454  1.00  0.87           C  
ATOM   9412  OD1 ASP B 367      28.068  62.018  83.077  1.00  0.87           O  
ATOM   9413  OD2 ASP B 367      25.838  61.888  82.984  1.00  0.87           O  
ATOM   9414  N   VAL B 368      26.967  64.951  87.153  1.00  0.89           N  
ATOM   9415  CA  VAL B 368      26.666  66.119  87.977  1.00  0.89           C  
ATOM   9416  C   VAL B 368      27.908  66.686  88.651  1.00  0.89           C  
ATOM   9417  O   VAL B 368      28.147  67.889  88.592  1.00  0.89           O  
ATOM   9418  CB  VAL B 368      25.569  65.833  89.004  1.00  0.89           C  
ATOM   9419  CG1 VAL B 368      25.367  67.018  89.974  1.00  0.89           C  
ATOM   9420  CG2 VAL B 368      24.238  65.546  88.274  1.00  0.89           C  
ATOM   9421  N   THR B 369      28.761  65.834  89.249  1.00  0.93           N  
ATOM   9422  CA  THR B 369      30.008  66.228  89.911  1.00  0.93           C  
ATOM   9423  C   THR B 369      30.990  66.910  88.983  1.00  0.93           C  
ATOM   9424  O   THR B 369      31.501  67.981  89.311  1.00  0.93           O  
ATOM   9425  CB  THR B 369      30.684  65.036  90.584  1.00  0.93           C  
ATOM   9426  OG1 THR B 369      29.868  64.585  91.654  1.00  0.93           O  
ATOM   9427  CG2 THR B 369      32.035  65.388  91.222  1.00  0.93           C  
ATOM   9428  N   VAL B 370      31.220  66.367  87.765  1.00  0.93           N  
ATOM   9429  CA  VAL B 370      32.126  66.958  86.783  1.00  0.93           C  
ATOM   9430  C   VAL B 370      31.702  68.357  86.363  1.00  0.93           C  
ATOM   9431  O   VAL B 370      32.525  69.255  86.248  1.00  0.93           O  
ATOM   9432  CB  VAL B 370      32.289  66.057  85.553  1.00  0.93           C  
ATOM   9433  CG1 VAL B 370      33.091  66.733  84.418  1.00  0.93           C  
ATOM   9434  CG2 VAL B 370      33.026  64.766  85.966  1.00  0.93           C  
ATOM   9435  N   ARG B 371      30.395  68.598  86.150  1.00  0.88           N  
ATOM   9436  CA  ARG B 371      29.902  69.896  85.716  1.00  0.88           C  
ATOM   9437  C   ARG B 371      29.845  70.950  86.827  1.00  0.88           C  
ATOM   9438  O   ARG B 371      29.764  72.148  86.561  1.00  0.88           O  
ATOM   9439  CB  ARG B 371      28.487  69.715  85.105  1.00  0.88           C  
ATOM   9440  CG  ARG B 371      28.469  68.925  83.779  1.00  0.88           C  
ATOM   9441  CD  ARG B 371      27.059  68.705  83.207  1.00  0.88           C  
ATOM   9442  NE  ARG B 371      26.387  67.669  84.052  1.00  0.88           N  
ATOM   9443  CZ  ARG B 371      25.065  67.542  84.209  1.00  0.88           C  
ATOM   9444  NH1 ARG B 371      24.586  66.696  85.116  1.00  0.88           N  
ATOM   9445  NH2 ARG B 371      24.202  68.260  83.504  1.00  0.88           N  
ATOM   9446  N   THR B 372      29.858  70.529  88.104  1.00  0.95           N  
ATOM   9447  CA  THR B 372      29.886  71.425  89.259  1.00  0.95           C  
ATOM   9448  C   THR B 372      31.264  71.983  89.548  1.00  0.95           C  
ATOM   9449  O   THR B 372      31.422  73.156  89.902  1.00  0.95           O  
ATOM   9450  CB  THR B 372      29.416  70.717  90.525  1.00  0.95           C  
ATOM   9451  OG1 THR B 372      28.082  70.265  90.354  1.00  0.95           O  
ATOM   9452  CG2 THR B 372      29.357  71.677  91.718  1.00  0.95           C  
ATOM   9453  N   CYS B 373      32.305  71.137  89.457  1.00  0.96           N  
ATOM   9454  CA  CYS B 373      33.623  71.461  89.969  1.00  0.96           C  
ATOM   9455  C   CYS B 373      34.563  72.006  88.913  1.00  0.96           C  
ATOM   9456  O   CYS B 373      34.613  71.561  87.771  1.00  0.96           O  
ATOM   9457  CB  CYS B 373      34.293  70.241  90.657  1.00  0.96           C  
ATOM   9458  SG  CYS B 373      33.462  69.808  92.229  1.00  0.96           S  
ATOM   9459  N   ALA B 374      35.382  72.992  89.307  1.00  0.98           N  
ATOM   9460  CA  ALA B 374      36.452  73.499  88.481  1.00  0.98           C  
ATOM   9461  C   ALA B 374      37.703  73.676  89.332  1.00  0.98           C  
ATOM   9462  O   ALA B 374      37.623  73.980  90.518  1.00  0.98           O  
ATOM   9463  CB  ALA B 374      36.030  74.817  87.817  1.00  0.98           C  
ATOM   9464  N   TYR B 375      38.905  73.439  88.764  1.00  0.96           N  
ATOM   9465  CA  TYR B 375      40.154  73.376  89.521  1.00  0.96           C  
ATOM   9466  C   TYR B 375      41.199  74.405  89.080  1.00  0.96           C  
ATOM   9467  O   TYR B 375      41.577  74.492  87.913  1.00  0.96           O  
ATOM   9468  CB  TYR B 375      40.700  71.908  89.448  1.00  0.96           C  
ATOM   9469  CG  TYR B 375      42.168  71.688  89.785  1.00  0.96           C  
ATOM   9470  CD1 TYR B 375      42.704  72.062  91.030  1.00  0.96           C  
ATOM   9471  CD2 TYR B 375      43.010  71.040  88.858  1.00  0.96           C  
ATOM   9472  CE1 TYR B 375      44.057  71.832  91.317  1.00  0.96           C  
ATOM   9473  CE2 TYR B 375      44.364  70.810  89.144  1.00  0.96           C  
ATOM   9474  CZ  TYR B 375      44.884  71.218  90.375  1.00  0.96           C  
ATOM   9475  OH  TYR B 375      46.224  70.982  90.720  1.00  0.96           O  
ATOM   9476  N   THR B 376      41.733  75.184  90.049  1.00  0.96           N  
ATOM   9477  CA  THR B 376      42.809  76.146  89.801  1.00  0.96           C  
ATOM   9478  C   THR B 376      44.138  75.637  90.330  1.00  0.96           C  
ATOM   9479  O   THR B 376      44.306  75.432  91.527  1.00  0.96           O  
ATOM   9480  CB  THR B 376      42.594  77.520  90.433  1.00  0.96           C  
ATOM   9481  OG1 THR B 376      41.333  78.060  90.077  1.00  0.96           O  
ATOM   9482  CG2 THR B 376      43.658  78.509  89.936  1.00  0.96           C  
ATOM   9483  N   ASN B 377      45.138  75.450  89.445  1.00  0.91           N  
ATOM   9484  CA  ASN B 377      46.435  74.878  89.778  1.00  0.91           C  
ATOM   9485  C   ASN B 377      47.526  75.944  89.933  1.00  0.91           C  
ATOM   9486  O   ASN B 377      47.897  76.608  88.972  1.00  0.91           O  
ATOM   9487  CB  ASN B 377      46.785  73.856  88.659  1.00  0.91           C  
ATOM   9488  CG  ASN B 377      48.039  73.025  88.908  1.00  0.91           C  
ATOM   9489  OD1 ASN B 377      47.986  71.803  89.001  1.00  0.91           O  
ATOM   9490  ND2 ASN B 377      49.209  73.683  88.988  1.00  0.91           N  
ATOM   9491  N   HIS B 378      48.135  76.102  91.126  1.00  0.90           N  
ATOM   9492  CA  HIS B 378      49.042  77.208  91.427  1.00  0.90           C  
ATOM   9493  C   HIS B 378      50.527  76.893  91.382  1.00  0.90           C  
ATOM   9494  O   HIS B 378      51.337  77.773  91.652  1.00  0.90           O  
ATOM   9495  CB  HIS B 378      48.773  77.774  92.839  1.00  0.90           C  
ATOM   9496  CG  HIS B 378      47.373  78.268  92.938  1.00  0.90           C  
ATOM   9497  ND1 HIS B 378      47.078  79.555  92.524  1.00  0.90           N  
ATOM   9498  CD2 HIS B 378      46.233  77.583  93.191  1.00  0.90           C  
ATOM   9499  CE1 HIS B 378      45.767  79.625  92.541  1.00  0.90           C  
ATOM   9500  NE2 HIS B 378      45.210  78.458  92.930  1.00  0.90           N  
ATOM   9501  N   THR B 379      50.964  75.667  91.042  1.00  0.89           N  
ATOM   9502  CA  THR B 379      52.400  75.371  91.062  1.00  0.89           C  
ATOM   9503  C   THR B 379      52.718  74.148  90.222  1.00  0.89           C  
ATOM   9504  O   THR B 379      51.862  73.302  89.982  1.00  0.89           O  
ATOM   9505  CB  THR B 379      52.943  75.207  92.487  1.00  0.89           C  
ATOM   9506  OG1 THR B 379      54.340  74.927  92.532  1.00  0.89           O  
ATOM   9507  CG2 THR B 379      52.191  74.091  93.224  1.00  0.89           C  
ATOM   9508  N   VAL B 380      53.967  74.040  89.725  1.00  0.85           N  
ATOM   9509  CA  VAL B 380      54.462  72.875  89.000  1.00  0.85           C  
ATOM   9510  C   VAL B 380      55.585  72.195  89.770  1.00  0.85           C  
ATOM   9511  O   VAL B 380      56.195  71.240  89.294  1.00  0.85           O  
ATOM   9512  CB  VAL B 380      54.985  73.215  87.600  1.00  0.85           C  
ATOM   9513  CG1 VAL B 380      53.816  73.663  86.707  1.00  0.85           C  
ATOM   9514  CG2 VAL B 380      56.083  74.296  87.644  1.00  0.85           C  
ATOM   9515  N   LEU B 381      55.896  72.664  90.997  1.00  0.82           N  
ATOM   9516  CA  LEU B 381      56.990  72.135  91.793  1.00  0.82           C  
ATOM   9517  C   LEU B 381      56.645  70.783  92.440  1.00  0.82           C  
ATOM   9518  O   LEU B 381      55.635  70.718  93.144  1.00  0.82           O  
ATOM   9519  CB  LEU B 381      57.416  73.117  92.915  1.00  0.82           C  
ATOM   9520  CG  LEU B 381      57.980  74.476  92.444  1.00  0.82           C  
ATOM   9521  CD1 LEU B 381      58.343  75.335  93.665  1.00  0.82           C  
ATOM   9522  CD2 LEU B 381      59.221  74.308  91.554  1.00  0.82           C  
ATOM   9523  N   PRO B 382      57.407  69.688  92.279  1.00  0.85           N  
ATOM   9524  CA  PRO B 382      57.063  68.367  92.811  1.00  0.85           C  
ATOM   9525  C   PRO B 382      56.862  68.307  94.311  1.00  0.85           C  
ATOM   9526  O   PRO B 382      56.051  67.510  94.779  1.00  0.85           O  
ATOM   9527  CB  PRO B 382      58.249  67.482  92.388  1.00  0.85           C  
ATOM   9528  CG  PRO B 382      58.715  68.109  91.074  1.00  0.85           C  
ATOM   9529  CD  PRO B 382      58.514  69.603  91.324  1.00  0.85           C  
ATOM   9530  N   GLU B 383      57.596  69.128  95.083  1.00  0.82           N  
ATOM   9531  CA  GLU B 383      57.516  69.193  96.525  1.00  0.82           C  
ATOM   9532  C   GLU B 383      56.281  69.929  97.015  1.00  0.82           C  
ATOM   9533  O   GLU B 383      55.920  69.859  98.189  1.00  0.82           O  
ATOM   9534  CB  GLU B 383      58.774  69.888  97.111  1.00  0.82           C  
ATOM   9535  CG  GLU B 383      59.012  71.349  96.630  1.00  0.82           C  
ATOM   9536  CD  GLU B 383      59.882  71.481  95.391  1.00  0.82           C  
ATOM   9537  OE1 GLU B 383      59.682  70.771  94.371  1.00  0.82           O  
ATOM   9538  OE2 GLU B 383      60.837  72.296  95.438  1.00  0.82           O  
ATOM   9539  N   ALA B 384      55.588  70.654  96.119  1.00  0.84           N  
ATOM   9540  CA  ALA B 384      54.416  71.420  96.458  1.00  0.84           C  
ATOM   9541  C   ALA B 384      53.131  70.702  96.081  1.00  0.84           C  
ATOM   9542  O   ALA B 384      52.039  71.179  96.380  1.00  0.84           O  
ATOM   9543  CB  ALA B 384      54.490  72.755  95.698  1.00  0.84           C  
ATOM   9544  N   LEU B 385      53.225  69.520  95.439  1.00  0.86           N  
ATOM   9545  CA  LEU B 385      52.063  68.775  94.996  1.00  0.86           C  
ATOM   9546  C   LEU B 385      51.581  67.788  96.035  1.00  0.86           C  
ATOM   9547  O   LEU B 385      52.339  66.973  96.563  1.00  0.86           O  
ATOM   9548  CB  LEU B 385      52.334  67.937  93.723  1.00  0.86           C  
ATOM   9549  CG  LEU B 385      52.790  68.721  92.479  1.00  0.86           C  
ATOM   9550  CD1 LEU B 385      52.882  67.756  91.287  1.00  0.86           C  
ATOM   9551  CD2 LEU B 385      51.852  69.890  92.143  1.00  0.86           C  
ATOM   9552  N   GLU B 386      50.273  67.801  96.332  1.00  0.89           N  
ATOM   9553  CA  GLU B 386      49.699  66.883  97.278  1.00  0.89           C  
ATOM   9554  C   GLU B 386      49.575  65.452  96.827  1.00  0.89           C  
ATOM   9555  O   GLU B 386      48.919  65.094  95.844  1.00  0.89           O  
ATOM   9556  CB  GLU B 386      48.342  67.353  97.760  1.00  0.89           C  
ATOM   9557  CG  GLU B 386      48.446  68.750  98.382  1.00  0.89           C  
ATOM   9558  CD  GLU B 386      47.168  69.085  99.139  1.00  0.89           C  
ATOM   9559  OE1 GLU B 386      46.066  69.125  98.535  1.00  0.89           O  
ATOM   9560  OE2 GLU B 386      47.298  69.372 100.343  1.00  0.89           O  
ATOM   9561  N   ARG B 387      50.233  64.590  97.608  1.00  0.84           N  
ATOM   9562  CA  ARG B 387      50.254  63.170  97.402  1.00  0.84           C  
ATOM   9563  C   ARG B 387      50.044  62.516  98.749  1.00  0.84           C  
ATOM   9564  O   ARG B 387      50.992  62.201  99.473  1.00  0.84           O  
ATOM   9565  CB  ARG B 387      51.588  62.736  96.766  1.00  0.84           C  
ATOM   9566  CG  ARG B 387      51.717  63.199  95.298  1.00  0.84           C  
ATOM   9567  CD  ARG B 387      53.156  63.418  94.839  1.00  0.84           C  
ATOM   9568  NE  ARG B 387      53.802  62.086  94.949  1.00  0.84           N  
ATOM   9569  CZ  ARG B 387      54.980  61.784  95.496  1.00  0.84           C  
ATOM   9570  NH1 ARG B 387      55.704  62.669  96.166  1.00  0.84           N  
ATOM   9571  NH2 ARG B 387      55.394  60.531  95.350  1.00  0.84           N  
ATOM   9572  N   TRP B 388      48.773  62.316  99.137  1.00  0.88           N  
ATOM   9573  CA  TRP B 388      48.405  61.807 100.445  1.00  0.88           C  
ATOM   9574  C   TRP B 388      48.563  60.282 100.530  1.00  0.88           C  
ATOM   9575  O   TRP B 388      48.046  59.588  99.654  1.00  0.88           O  
ATOM   9576  CB  TRP B 388      46.953  62.200 100.822  1.00  0.88           C  
ATOM   9577  CG  TRP B 388      46.746  63.668 101.173  1.00  0.88           C  
ATOM   9578  CD1 TRP B 388      46.122  64.646 100.449  1.00  0.88           C  
ATOM   9579  CD2 TRP B 388      47.125  64.272 102.420  1.00  0.88           C  
ATOM   9580  NE1 TRP B 388      46.159  65.839 101.129  1.00  0.88           N  
ATOM   9581  CE2 TRP B 388      46.752  65.639 102.342  1.00  0.88           C  
ATOM   9582  CE3 TRP B 388      47.715  63.756 103.569  1.00  0.88           C  
ATOM   9583  CZ2 TRP B 388      46.988  66.504 103.394  1.00  0.88           C  
ATOM   9584  CZ3 TRP B 388      47.937  64.632 104.641  1.00  0.88           C  
ATOM   9585  CH2 TRP B 388      47.595  65.992 104.546  1.00  0.88           C  
ATOM   9586  N   PRO B 389      49.271  59.696 101.507  1.00  0.92           N  
ATOM   9587  CA  PRO B 389      49.346  58.247 101.710  1.00  0.92           C  
ATOM   9588  C   PRO B 389      48.007  57.543 101.835  1.00  0.92           C  
ATOM   9589  O   PRO B 389      47.163  58.001 102.605  1.00  0.92           O  
ATOM   9590  CB  PRO B 389      50.196  58.080 102.983  1.00  0.92           C  
ATOM   9591  CG  PRO B 389      51.044  59.352 103.025  1.00  0.92           C  
ATOM   9592  CD  PRO B 389      50.078  60.410 102.498  1.00  0.92           C  
ATOM   9593  N   VAL B 390      47.794  56.413 101.124  1.00  0.90           N  
ATOM   9594  CA  VAL B 390      46.516  55.701 101.136  1.00  0.90           C  
ATOM   9595  C   VAL B 390      46.093  55.228 102.520  1.00  0.90           C  
ATOM   9596  O   VAL B 390      44.945  55.396 102.907  1.00  0.90           O  
ATOM   9597  CB  VAL B 390      46.435  54.533 100.154  1.00  0.90           C  
ATOM   9598  CG1 VAL B 390      46.589  55.063  98.717  1.00  0.90           C  
ATOM   9599  CG2 VAL B 390      47.480  53.439 100.444  1.00  0.90           C  
ATOM   9600  N   HIS B 391      47.039  54.710 103.329  1.00  0.84           N  
ATOM   9601  CA  HIS B 391      46.836  54.242 104.695  1.00  0.84           C  
ATOM   9602  C   HIS B 391      46.284  55.309 105.639  1.00  0.84           C  
ATOM   9603  O   HIS B 391      45.435  55.060 106.492  1.00  0.84           O  
ATOM   9604  CB  HIS B 391      48.206  53.774 105.254  1.00  0.84           C  
ATOM   9605  CG  HIS B 391      48.145  53.131 106.603  1.00  0.84           C  
ATOM   9606  ND1 HIS B 391      47.542  51.902 106.705  1.00  0.84           N  
ATOM   9607  CD2 HIS B 391      48.578  53.549 107.822  1.00  0.84           C  
ATOM   9608  CE1 HIS B 391      47.605  51.585 107.980  1.00  0.84           C  
ATOM   9609  NE2 HIS B 391      48.226  52.548 108.703  1.00  0.84           N  
ATOM   9610  N   LEU B 392      46.759  56.564 105.508  1.00  0.87           N  
ATOM   9611  CA  LEU B 392      46.288  57.678 106.314  1.00  0.87           C  
ATOM   9612  C   LEU B 392      44.831  58.036 106.018  1.00  0.87           C  
ATOM   9613  O   LEU B 392      44.008  58.224 106.914  1.00  0.87           O  
ATOM   9614  CB  LEU B 392      47.202  58.906 106.068  1.00  0.87           C  
ATOM   9615  CG  LEU B 392      47.145  59.984 107.170  1.00  0.87           C  
ATOM   9616  CD1 LEU B 392      47.820  59.493 108.461  1.00  0.87           C  
ATOM   9617  CD2 LEU B 392      47.817  61.281 106.695  1.00  0.87           C  
ATOM   9618  N   LEU B 393      44.483  58.079 104.714  1.00  0.90           N  
ATOM   9619  CA  LEU B 393      43.139  58.256 104.195  1.00  0.90           C  
ATOM   9620  C   LEU B 393      42.222  57.093 104.522  1.00  0.90           C  
ATOM   9621  O   LEU B 393      41.071  57.311 104.869  1.00  0.90           O  
ATOM   9622  CB  LEU B 393      43.162  58.470 102.662  1.00  0.90           C  
ATOM   9623  CG  LEU B 393      43.765  59.825 102.243  1.00  0.90           C  
ATOM   9624  CD1 LEU B 393      44.339  59.756 100.833  1.00  0.90           C  
ATOM   9625  CD2 LEU B 393      42.716  60.938 102.346  1.00  0.90           C  
ATOM   9626  N   GLU B 394      42.696  55.833 104.452  1.00  0.86           N  
ATOM   9627  CA  GLU B 394      41.924  54.649 104.803  1.00  0.86           C  
ATOM   9628  C   GLU B 394      41.478  54.668 106.252  1.00  0.86           C  
ATOM   9629  O   GLU B 394      40.307  54.488 106.566  1.00  0.86           O  
ATOM   9630  CB  GLU B 394      42.753  53.366 104.540  1.00  0.86           C  
ATOM   9631  CG  GLU B 394      41.919  52.061 104.482  1.00  0.86           C  
ATOM   9632  CD  GLU B 394      42.729  50.851 104.011  1.00  0.86           C  
ATOM   9633  OE1 GLU B 394      42.352  49.716 104.401  1.00  0.86           O  
ATOM   9634  OE2 GLU B 394      43.690  51.046 103.221  1.00  0.86           O  
ATOM   9635  N   THR B 395      42.399  54.996 107.175  1.00  0.88           N  
ATOM   9636  CA  THR B 395      42.072  55.249 108.573  1.00  0.88           C  
ATOM   9637  C   THR B 395      41.134  56.439 108.786  1.00  0.88           C  
ATOM   9638  O   THR B 395      40.158  56.343 109.525  1.00  0.88           O  
ATOM   9639  CB  THR B 395      43.345  55.501 109.384  1.00  0.88           C  
ATOM   9640  OG1 THR B 395      44.191  54.362 109.352  1.00  0.88           O  
ATOM   9641  CG2 THR B 395      43.055  55.754 110.869  1.00  0.88           C  
ATOM   9642  N   LEU B 396      41.384  57.614 108.164  1.00  0.90           N  
ATOM   9643  CA  LEU B 396      40.584  58.808 108.432  1.00  0.90           C  
ATOM   9644  C   LEU B 396      39.240  58.882 107.709  1.00  0.90           C  
ATOM   9645  O   LEU B 396      38.249  59.360 108.262  1.00  0.90           O  
ATOM   9646  CB  LEU B 396      41.383  60.100 108.116  1.00  0.90           C  
ATOM   9647  CG  LEU B 396      40.763  61.387 108.710  1.00  0.90           C  
ATOM   9648  CD1 LEU B 396      40.973  61.462 110.227  1.00  0.90           C  
ATOM   9649  CD2 LEU B 396      41.339  62.639 108.042  1.00  0.90           C  
ATOM   9650  N   LEU B 397      39.188  58.437 106.443  1.00  0.93           N  
ATOM   9651  CA  LEU B 397      38.082  58.624 105.521  1.00  0.93           C  
ATOM   9652  C   LEU B 397      37.856  57.365 104.670  1.00  0.93           C  
ATOM   9653  O   LEU B 397      38.004  57.420 103.441  1.00  0.93           O  
ATOM   9654  CB  LEU B 397      38.392  59.786 104.535  1.00  0.93           C  
ATOM   9655  CG  LEU B 397      38.578  61.185 105.150  1.00  0.93           C  
ATOM   9656  CD1 LEU B 397      38.930  62.188 104.041  1.00  0.93           C  
ATOM   9657  CD2 LEU B 397      37.316  61.649 105.889  1.00  0.93           C  
ATOM   9658  N   PRO B 398      37.508  56.201 105.226  1.00  0.93           N  
ATOM   9659  CA  PRO B 398      37.537  54.926 104.504  1.00  0.93           C  
ATOM   9660  C   PRO B 398      36.562  54.860 103.349  1.00  0.93           C  
ATOM   9661  O   PRO B 398      36.850  54.216 102.341  1.00  0.93           O  
ATOM   9662  CB  PRO B 398      37.205  53.881 105.585  1.00  0.93           C  
ATOM   9663  CG  PRO B 398      36.458  54.666 106.669  1.00  0.93           C  
ATOM   9664  CD  PRO B 398      37.165  56.018 106.639  1.00  0.93           C  
ATOM   9665  N   ARG B 399      35.385  55.504 103.455  1.00  0.87           N  
ATOM   9666  CA  ARG B 399      34.435  55.563 102.363  1.00  0.87           C  
ATOM   9667  C   ARG B 399      34.933  56.366 101.166  1.00  0.87           C  
ATOM   9668  O   ARG B 399      34.806  55.943 100.018  1.00  0.87           O  
ATOM   9669  CB  ARG B 399      33.071  56.101 102.859  1.00  0.87           C  
ATOM   9670  CG  ARG B 399      31.945  56.021 101.803  1.00  0.87           C  
ATOM   9671  CD  ARG B 399      31.680  54.606 101.260  1.00  0.87           C  
ATOM   9672  NE  ARG B 399      30.645  54.731 100.189  1.00  0.87           N  
ATOM   9673  CZ  ARG B 399      30.752  54.241  98.948  1.00  0.87           C  
ATOM   9674  NH1 ARG B 399      31.747  53.439  98.577  1.00  0.87           N  
ATOM   9675  NH2 ARG B 399      29.818  54.552  98.055  1.00  0.87           N  
ATOM   9676  N   HIS B 400      35.571  57.526 101.401  1.00  0.92           N  
ATOM   9677  CA  HIS B 400      36.190  58.337 100.371  1.00  0.92           C  
ATOM   9678  C   HIS B 400      37.301  57.635  99.620  1.00  0.92           C  
ATOM   9679  O   HIS B 400      37.386  57.764  98.403  1.00  0.92           O  
ATOM   9680  CB  HIS B 400      36.737  59.663 100.932  1.00  0.92           C  
ATOM   9681  CG  HIS B 400      35.646  60.476 101.549  1.00  0.92           C  
ATOM   9682  ND1 HIS B 400      35.161  60.142 102.801  1.00  0.92           N  
ATOM   9683  CD2 HIS B 400      34.929  61.500 101.020  1.00  0.92           C  
ATOM   9684  CE1 HIS B 400      34.165  60.979 103.013  1.00  0.92           C  
ATOM   9685  NE2 HIS B 400      33.980  61.810 101.964  1.00  0.92           N  
ATOM   9686  N   LEU B 401      38.158  56.836 100.294  1.00  0.92           N  
ATOM   9687  CA  LEU B 401      39.183  56.049  99.616  1.00  0.92           C  
ATOM   9688  C   LEU B 401      38.600  55.049  98.618  1.00  0.92           C  
ATOM   9689  O   LEU B 401      39.071  54.919  97.489  1.00  0.92           O  
ATOM   9690  CB  LEU B 401      40.082  55.291 100.624  1.00  0.92           C  
ATOM   9691  CG  LEU B 401      41.254  54.519  99.970  1.00  0.92           C  
ATOM   9692  CD1 LEU B 401      42.253  55.444  99.269  1.00  0.92           C  
ATOM   9693  CD2 LEU B 401      42.008  53.682 101.001  1.00  0.92           C  
ATOM   9694  N   GLN B 402      37.496  54.363  98.989  1.00  0.88           N  
ATOM   9695  CA  GLN B 402      36.750  53.488  98.096  1.00  0.88           C  
ATOM   9696  C   GLN B 402      36.183  54.220  96.888  1.00  0.88           C  
ATOM   9697  O   GLN B 402      36.283  53.748  95.759  1.00  0.88           O  
ATOM   9698  CB  GLN B 402      35.548  52.831  98.823  1.00  0.88           C  
ATOM   9699  CG  GLN B 402      35.935  51.841  99.943  1.00  0.88           C  
ATOM   9700  CD  GLN B 402      34.685  51.320 100.648  1.00  0.88           C  
ATOM   9701  OE1 GLN B 402      33.574  51.821 100.450  1.00  0.88           O  
ATOM   9702  NE2 GLN B 402      34.864  50.282 101.500  1.00  0.88           N  
ATOM   9703  N   ILE B 403      35.598  55.416  97.095  1.00  0.92           N  
ATOM   9704  CA  ILE B 403      35.095  56.281  96.035  1.00  0.92           C  
ATOM   9705  C   ILE B 403      36.214  56.736  95.098  1.00  0.92           C  
ATOM   9706  O   ILE B 403      36.062  56.694  93.881  1.00  0.92           O  
ATOM   9707  CB  ILE B 403      34.306  57.453  96.625  1.00  0.92           C  
ATOM   9708  CG1 ILE B 403      33.034  56.912  97.327  1.00  0.92           C  
ATOM   9709  CG2 ILE B 403      33.909  58.488  95.545  1.00  0.92           C  
ATOM   9710  CD1 ILE B 403      32.339  57.937  98.226  1.00  0.92           C  
ATOM   9711  N   ILE B 404      37.399  57.115  95.629  1.00  0.93           N  
ATOM   9712  CA  ILE B 404      38.597  57.435  94.850  1.00  0.93           C  
ATOM   9713  C   ILE B 404      39.087  56.240  94.029  1.00  0.93           C  
ATOM   9714  O   ILE B 404      39.399  56.375  92.845  1.00  0.93           O  
ATOM   9715  CB  ILE B 404      39.721  57.996  95.738  1.00  0.93           C  
ATOM   9716  CG1 ILE B 404      39.317  59.375  96.318  1.00  0.93           C  
ATOM   9717  CG2 ILE B 404      41.041  58.139  94.943  1.00  0.93           C  
ATOM   9718  CD1 ILE B 404      40.180  59.827  97.506  1.00  0.93           C  
ATOM   9719  N   TYR B 405      39.111  55.018  94.610  1.00  0.90           N  
ATOM   9720  CA  TYR B 405      39.417  53.789  93.889  1.00  0.90           C  
ATOM   9721  C   TYR B 405      38.430  53.502  92.757  1.00  0.90           C  
ATOM   9722  O   TYR B 405      38.840  53.160  91.650  1.00  0.90           O  
ATOM   9723  CB  TYR B 405      39.445  52.546  94.835  1.00  0.90           C  
ATOM   9724  CG  TYR B 405      40.644  52.444  95.760  1.00  0.90           C  
ATOM   9725  CD1 TYR B 405      41.936  52.895  95.415  1.00  0.90           C  
ATOM   9726  CD2 TYR B 405      40.483  51.758  96.981  1.00  0.90           C  
ATOM   9727  CE1 TYR B 405      43.030  52.656  96.265  1.00  0.90           C  
ATOM   9728  CE2 TYR B 405      41.574  51.518  97.828  1.00  0.90           C  
ATOM   9729  CZ  TYR B 405      42.847  51.965  97.468  1.00  0.90           C  
ATOM   9730  OH  TYR B 405      43.942  51.713  98.321  1.00  0.90           O  
ATOM   9731  N   GLU B 406      37.116  53.676  92.989  1.00  0.87           N  
ATOM   9732  CA  GLU B 406      36.066  53.539  91.987  1.00  0.87           C  
ATOM   9733  C   GLU B 406      36.172  54.546  90.839  1.00  0.87           C  
ATOM   9734  O   GLU B 406      36.087  54.202  89.658  1.00  0.87           O  
ATOM   9735  CB  GLU B 406      34.691  53.656  92.690  1.00  0.87           C  
ATOM   9736  CG  GLU B 406      33.824  52.383  92.601  1.00  0.87           C  
ATOM   9737  CD  GLU B 406      33.056  52.335  91.297  1.00  0.87           C  
ATOM   9738  OE1 GLU B 406      33.662  52.237  90.202  1.00  0.87           O  
ATOM   9739  OE2 GLU B 406      31.803  52.422  91.359  1.00  0.87           O  
ATOM   9740  N   ILE B 407      36.458  55.833  91.153  1.00  0.92           N  
ATOM   9741  CA  ILE B 407      36.752  56.861  90.154  1.00  0.92           C  
ATOM   9742  C   ILE B 407      37.969  56.472  89.321  1.00  0.92           C  
ATOM   9743  O   ILE B 407      37.933  56.521  88.092  1.00  0.92           O  
ATOM   9744  CB  ILE B 407      36.990  58.242  90.792  1.00  0.92           C  
ATOM   9745  CG1 ILE B 407      35.697  58.782  91.453  1.00  0.92           C  
ATOM   9746  CG2 ILE B 407      37.494  59.265  89.742  1.00  0.92           C  
ATOM   9747  CD1 ILE B 407      35.937  59.961  92.407  1.00  0.92           C  
ATOM   9748  N   ASN B 408      39.059  56.006  89.972  1.00  0.89           N  
ATOM   9749  CA  ASN B 408      40.268  55.550  89.306  1.00  0.89           C  
ATOM   9750  C   ASN B 408      40.022  54.340  88.407  1.00  0.89           C  
ATOM   9751  O   ASN B 408      40.515  54.280  87.286  1.00  0.89           O  
ATOM   9752  CB  ASN B 408      41.384  55.235  90.345  1.00  0.89           C  
ATOM   9753  CG  ASN B 408      42.759  55.181  89.680  1.00  0.89           C  
ATOM   9754  OD1 ASN B 408      43.094  56.014  88.840  1.00  0.89           O  
ATOM   9755  ND2 ASN B 408      43.605  54.209  90.079  1.00  0.89           N  
ATOM   9756  N   GLN B 409      39.220  53.358  88.864  1.00  0.84           N  
ATOM   9757  CA  GLN B 409      38.877  52.166  88.108  1.00  0.84           C  
ATOM   9758  C   GLN B 409      38.154  52.476  86.798  1.00  0.84           C  
ATOM   9759  O   GLN B 409      38.544  52.033  85.720  1.00  0.84           O  
ATOM   9760  CB  GLN B 409      37.969  51.269  88.997  1.00  0.84           C  
ATOM   9761  CG  GLN B 409      37.714  49.843  88.455  1.00  0.84           C  
ATOM   9762  CD  GLN B 409      38.980  48.991  88.518  1.00  0.84           C  
ATOM   9763  OE1 GLN B 409      39.675  48.769  87.531  1.00  0.84           O  
ATOM   9764  NE2 GLN B 409      39.298  48.488  89.733  1.00  0.84           N  
ATOM   9765  N   ARG B 410      37.107  53.325  86.842  1.00  0.82           N  
ATOM   9766  CA  ARG B 410      36.377  53.762  85.661  1.00  0.82           C  
ATOM   9767  C   ARG B 410      37.228  54.602  84.720  1.00  0.82           C  
ATOM   9768  O   ARG B 410      37.169  54.466  83.496  1.00  0.82           O  
ATOM   9769  CB  ARG B 410      35.106  54.546  86.063  1.00  0.82           C  
ATOM   9770  CG  ARG B 410      34.106  53.671  86.845  1.00  0.82           C  
ATOM   9771  CD  ARG B 410      32.820  54.384  87.250  1.00  0.82           C  
ATOM   9772  NE  ARG B 410      32.167  53.512  88.268  1.00  0.82           N  
ATOM   9773  CZ  ARG B 410      31.146  52.681  88.052  1.00  0.82           C  
ATOM   9774  NH1 ARG B 410      30.666  51.989  89.077  1.00  0.82           N  
ATOM   9775  NH2 ARG B 410      30.609  52.499  86.855  1.00  0.82           N  
ATOM   9776  N   PHE B 411      38.064  55.487  85.294  1.00  0.88           N  
ATOM   9777  CA  PHE B 411      39.011  56.309  84.577  1.00  0.88           C  
ATOM   9778  C   PHE B 411      40.063  55.487  83.820  1.00  0.88           C  
ATOM   9779  O   PHE B 411      40.271  55.700  82.626  1.00  0.88           O  
ATOM   9780  CB  PHE B 411      39.645  57.285  85.607  1.00  0.88           C  
ATOM   9781  CG  PHE B 411      40.546  58.281  84.955  1.00  0.88           C  
ATOM   9782  CD1 PHE B 411      41.926  58.051  84.928  1.00  0.88           C  
ATOM   9783  CD2 PHE B 411      40.021  59.425  84.330  1.00  0.88           C  
ATOM   9784  CE1 PHE B 411      42.766  58.939  84.257  1.00  0.88           C  
ATOM   9785  CE2 PHE B 411      40.867  60.327  83.672  1.00  0.88           C  
ATOM   9786  CZ  PHE B 411      42.243  60.076  83.630  1.00  0.88           C  
ATOM   9787  N   LEU B 412      40.700  54.490  84.470  1.00  0.82           N  
ATOM   9788  CA  LEU B 412      41.651  53.586  83.839  1.00  0.82           C  
ATOM   9789  C   LEU B 412      41.050  52.660  82.788  1.00  0.82           C  
ATOM   9790  O   LEU B 412      41.638  52.466  81.723  1.00  0.82           O  
ATOM   9791  CB  LEU B 412      42.427  52.751  84.886  1.00  0.82           C  
ATOM   9792  CG  LEU B 412      43.412  53.572  85.750  1.00  0.82           C  
ATOM   9793  CD1 LEU B 412      44.071  52.680  86.813  1.00  0.82           C  
ATOM   9794  CD2 LEU B 412      44.501  54.254  84.907  1.00  0.82           C  
ATOM   9795  N   ASN B 413      39.842  52.100  83.024  1.00  0.80           N  
ATOM   9796  CA  ASN B 413      39.109  51.292  82.051  1.00  0.80           C  
ATOM   9797  C   ASN B 413      38.834  52.056  80.760  1.00  0.80           C  
ATOM   9798  O   ASN B 413      38.980  51.536  79.655  1.00  0.80           O  
ATOM   9799  CB  ASN B 413      37.745  50.839  82.640  1.00  0.80           C  
ATOM   9800  CG  ASN B 413      37.964  49.740  83.672  1.00  0.80           C  
ATOM   9801  OD1 ASN B 413      38.939  48.995  83.626  1.00  0.80           O  
ATOM   9802  ND2 ASN B 413      37.006  49.592  84.617  1.00  0.80           N  
ATOM   9803  N   ARG B 414      38.471  53.347  80.868  1.00  0.73           N  
ATOM   9804  CA  ARG B 414      38.353  54.235  79.728  1.00  0.73           C  
ATOM   9805  C   ARG B 414      39.658  54.424  78.945  1.00  0.73           C  
ATOM   9806  O   ARG B 414      39.659  54.402  77.717  1.00  0.73           O  
ATOM   9807  CB  ARG B 414      37.833  55.607  80.208  1.00  0.73           C  
ATOM   9808  CG  ARG B 414      37.346  56.527  79.072  1.00  0.73           C  
ATOM   9809  CD  ARG B 414      36.734  57.836  79.575  1.00  0.73           C  
ATOM   9810  NE  ARG B 414      37.843  58.597  80.247  1.00  0.73           N  
ATOM   9811  CZ  ARG B 414      38.286  59.808  79.884  1.00  0.73           C  
ATOM   9812  NH1 ARG B 414      39.221  60.406  80.619  1.00  0.73           N  
ATOM   9813  NH2 ARG B 414      37.824  60.434  78.808  1.00  0.73           N  
ATOM   9814  N   VAL B 415      40.815  54.589  79.626  1.00  0.78           N  
ATOM   9815  CA  VAL B 415      42.128  54.663  78.981  1.00  0.78           C  
ATOM   9816  C   VAL B 415      42.498  53.378  78.242  1.00  0.78           C  
ATOM   9817  O   VAL B 415      42.956  53.433  77.103  1.00  0.78           O  
ATOM   9818  CB  VAL B 415      43.239  55.056  79.960  1.00  0.78           C  
ATOM   9819  CG1 VAL B 415      44.618  55.113  79.264  1.00  0.78           C  
ATOM   9820  CG2 VAL B 415      42.919  56.446  80.543  1.00  0.78           C  
ATOM   9821  N   ALA B 416      42.246  52.192  78.840  1.00  0.76           N  
ATOM   9822  CA  ALA B 416      42.443  50.885  78.228  1.00  0.76           C  
ATOM   9823  C   ALA B 416      41.650  50.678  76.939  1.00  0.76           C  
ATOM   9824  O   ALA B 416      42.154  50.123  75.966  1.00  0.76           O  
ATOM   9825  CB  ALA B 416      42.050  49.788  79.241  1.00  0.76           C  
ATOM   9826  N   ALA B 417      40.389  51.155  76.894  1.00  0.76           N  
ATOM   9827  CA  ALA B 417      39.564  51.155  75.701  1.00  0.76           C  
ATOM   9828  C   ALA B 417      40.133  51.997  74.554  1.00  0.76           C  
ATOM   9829  O   ALA B 417      40.011  51.635  73.387  1.00  0.76           O  
ATOM   9830  CB  ALA B 417      38.130  51.607  76.060  1.00  0.76           C  
ATOM   9831  N   ALA B 418      40.763  53.148  74.860  1.00  0.75           N  
ATOM   9832  CA  ALA B 418      41.380  54.010  73.870  1.00  0.75           C  
ATOM   9833  C   ALA B 418      42.782  53.577  73.439  1.00  0.75           C  
ATOM   9834  O   ALA B 418      43.113  53.585  72.254  1.00  0.75           O  
ATOM   9835  CB  ALA B 418      41.437  55.444  74.432  1.00  0.75           C  
ATOM   9836  N   PHE B 419      43.649  53.183  74.394  1.00  0.73           N  
ATOM   9837  CA  PHE B 419      45.035  52.828  74.127  1.00  0.73           C  
ATOM   9838  C   PHE B 419      45.364  51.470  74.739  1.00  0.73           C  
ATOM   9839  O   PHE B 419      45.777  51.419  75.897  1.00  0.73           O  
ATOM   9840  CB  PHE B 419      46.016  53.854  74.766  1.00  0.73           C  
ATOM   9841  CG  PHE B 419      45.757  55.238  74.248  1.00  0.73           C  
ATOM   9842  CD1 PHE B 419      45.149  56.200  75.071  1.00  0.73           C  
ATOM   9843  CD2 PHE B 419      46.095  55.581  72.930  1.00  0.73           C  
ATOM   9844  CE1 PHE B 419      44.872  57.481  74.579  1.00  0.73           C  
ATOM   9845  CE2 PHE B 419      45.815  56.861  72.433  1.00  0.73           C  
ATOM   9846  CZ  PHE B 419      45.202  57.812  73.259  1.00  0.73           C  
ATOM   9847  N   PRO B 420      45.267  50.339  74.037  1.00  0.79           N  
ATOM   9848  CA  PRO B 420      45.378  49.050  74.725  1.00  0.79           C  
ATOM   9849  C   PRO B 420      46.824  48.640  74.928  1.00  0.79           C  
ATOM   9850  O   PRO B 420      47.111  47.858  75.829  1.00  0.79           O  
ATOM   9851  CB  PRO B 420      44.653  48.058  73.791  1.00  0.79           C  
ATOM   9852  CG  PRO B 420      43.687  48.933  72.989  1.00  0.79           C  
ATOM   9853  CD  PRO B 420      44.483  50.221  72.801  1.00  0.79           C  
ATOM   9854  N   GLY B 421      47.750  49.100  74.059  1.00  0.71           N  
ATOM   9855  CA  GLY B 421      49.153  48.688  74.108  1.00  0.71           C  
ATOM   9856  C   GLY B 421      50.050  49.552  74.960  1.00  0.71           C  
ATOM   9857  O   GLY B 421      51.199  49.196  75.204  1.00  0.71           O  
ATOM   9858  N   ASP B 422      49.572  50.718  75.440  1.00  0.75           N  
ATOM   9859  CA  ASP B 422      50.386  51.637  76.223  1.00  0.75           C  
ATOM   9860  C   ASP B 422      50.187  51.369  77.709  1.00  0.75           C  
ATOM   9861  O   ASP B 422      49.299  51.892  78.381  1.00  0.75           O  
ATOM   9862  CB  ASP B 422      50.111  53.112  75.823  1.00  0.75           C  
ATOM   9863  CG  ASP B 422      51.035  54.135  76.478  1.00  0.75           C  
ATOM   9864  OD1 ASP B 422      51.023  55.303  76.007  1.00  0.75           O  
ATOM   9865  OD2 ASP B 422      51.725  53.815  77.484  1.00  0.75           O  
ATOM   9866  N   VAL B 423      51.054  50.504  78.254  1.00  0.77           N  
ATOM   9867  CA  VAL B 423      51.042  50.132  79.651  1.00  0.77           C  
ATOM   9868  C   VAL B 423      51.603  51.188  80.603  1.00  0.77           C  
ATOM   9869  O   VAL B 423      51.208  51.230  81.768  1.00  0.77           O  
ATOM   9870  CB  VAL B 423      51.746  48.799  79.887  1.00  0.77           C  
ATOM   9871  CG1 VAL B 423      50.946  47.684  79.184  1.00  0.77           C  
ATOM   9872  CG2 VAL B 423      53.205  48.822  79.383  1.00  0.77           C  
ATOM   9873  N   ASP B 424      52.524  52.084  80.162  1.00  0.80           N  
ATOM   9874  CA  ASP B 424      53.063  53.135  81.022  1.00  0.80           C  
ATOM   9875  C   ASP B 424      52.015  54.216  81.262  1.00  0.80           C  
ATOM   9876  O   ASP B 424      51.818  54.661  82.391  1.00  0.80           O  
ATOM   9877  CB  ASP B 424      54.400  53.717  80.480  1.00  0.80           C  
ATOM   9878  CG  ASP B 424      55.071  54.640  81.486  1.00  0.80           C  
ATOM   9879  OD1 ASP B 424      54.977  55.883  81.361  1.00  0.80           O  
ATOM   9880  OD2 ASP B 424      55.704  54.118  82.437  1.00  0.80           O  
ATOM   9881  N   ARG B 425      51.247  54.614  80.227  1.00  0.79           N  
ATOM   9882  CA  ARG B 425      50.196  55.616  80.320  1.00  0.79           C  
ATOM   9883  C   ARG B 425      49.175  55.341  81.418  1.00  0.79           C  
ATOM   9884  O   ARG B 425      48.756  56.250  82.130  1.00  0.79           O  
ATOM   9885  CB  ARG B 425      49.500  55.752  78.950  1.00  0.79           C  
ATOM   9886  CG  ARG B 425      48.711  57.050  78.721  1.00  0.79           C  
ATOM   9887  CD  ARG B 425      48.300  57.248  77.256  1.00  0.79           C  
ATOM   9888  NE  ARG B 425      47.609  58.579  77.191  1.00  0.79           N  
ATOM   9889  CZ  ARG B 425      47.844  59.521  76.276  1.00  0.79           C  
ATOM   9890  NH1 ARG B 425      48.773  59.416  75.336  1.00  0.79           N  
ATOM   9891  NH2 ARG B 425      47.180  60.670  76.305  1.00  0.79           N  
ATOM   9892  N   LEU B 426      48.812  54.064  81.655  1.00  0.82           N  
ATOM   9893  CA  LEU B 426      47.970  53.660  82.771  1.00  0.82           C  
ATOM   9894  C   LEU B 426      48.492  54.043  84.156  1.00  0.82           C  
ATOM   9895  O   LEU B 426      47.754  54.586  84.972  1.00  0.82           O  
ATOM   9896  CB  LEU B 426      47.770  52.122  82.783  1.00  0.82           C  
ATOM   9897  CG  LEU B 426      47.150  51.529  81.502  1.00  0.82           C  
ATOM   9898  CD1 LEU B 426      47.160  49.995  81.578  1.00  0.82           C  
ATOM   9899  CD2 LEU B 426      45.721  52.041  81.267  1.00  0.82           C  
ATOM   9900  N   ARG B 427      49.786  53.826  84.476  1.00  0.75           N  
ATOM   9901  CA  ARG B 427      50.307  54.204  85.784  1.00  0.75           C  
ATOM   9902  C   ARG B 427      50.627  55.690  85.873  1.00  0.75           C  
ATOM   9903  O   ARG B 427      50.797  56.241  86.955  1.00  0.75           O  
ATOM   9904  CB  ARG B 427      51.584  53.402  86.154  1.00  0.75           C  
ATOM   9905  CG  ARG B 427      52.805  53.716  85.267  1.00  0.75           C  
ATOM   9906  CD  ARG B 427      54.141  53.235  85.823  1.00  0.75           C  
ATOM   9907  NE  ARG B 427      55.186  53.945  85.029  1.00  0.75           N  
ATOM   9908  CZ  ARG B 427      55.809  55.085  85.346  1.00  0.75           C  
ATOM   9909  NH1 ARG B 427      55.596  55.734  86.481  1.00  0.75           N  
ATOM   9910  NH2 ARG B 427      56.633  55.581  84.430  1.00  0.75           N  
ATOM   9911  N   ARG B 428      50.749  56.362  84.714  1.00  0.82           N  
ATOM   9912  CA  ARG B 428      51.070  57.768  84.599  1.00  0.82           C  
ATOM   9913  C   ARG B 428      49.845  58.646  84.819  1.00  0.82           C  
ATOM   9914  O   ARG B 428      49.933  59.748  85.357  1.00  0.82           O  
ATOM   9915  CB  ARG B 428      51.696  57.984  83.200  1.00  0.82           C  
ATOM   9916  CG  ARG B 428      52.694  59.151  83.084  1.00  0.82           C  
ATOM   9917  CD  ARG B 428      53.665  58.976  81.903  1.00  0.82           C  
ATOM   9918  NE  ARG B 428      52.860  59.082  80.641  1.00  0.82           N  
ATOM   9919  CZ  ARG B 428      52.959  58.283  79.570  1.00  0.82           C  
ATOM   9920  NH1 ARG B 428      53.756  57.226  79.498  1.00  0.82           N  
ATOM   9921  NH2 ARG B 428      52.214  58.533  78.497  1.00  0.82           N  
ATOM   9922  N   MET B 429      48.660  58.147  84.417  1.00  0.88           N  
ATOM   9923  CA  MET B 429      47.393  58.838  84.571  1.00  0.88           C  
ATOM   9924  C   MET B 429      46.536  58.332  85.728  1.00  0.88           C  
ATOM   9925  O   MET B 429      45.478  58.887  86.017  1.00  0.88           O  
ATOM   9926  CB  MET B 429      46.559  58.604  83.294  1.00  0.88           C  
ATOM   9927  CG  MET B 429      47.178  59.165  82.011  1.00  0.88           C  
ATOM   9928  SD  MET B 429      46.089  58.932  80.569  1.00  0.88           S  
ATOM   9929  CE  MET B 429      45.017  60.346  80.924  1.00  0.88           C  
ATOM   9930  N   SER B 430      46.961  57.259  86.418  1.00  0.90           N  
ATOM   9931  CA  SER B 430      46.312  56.741  87.622  1.00  0.90           C  
ATOM   9932  C   SER B 430      46.280  57.738  88.766  1.00  0.90           C  
ATOM   9933  O   SER B 430      47.262  58.415  89.049  1.00  0.90           O  
ATOM   9934  CB  SER B 430      47.057  55.481  88.155  1.00  0.90           C  
ATOM   9935  OG  SER B 430      46.457  54.881  89.312  1.00  0.90           O  
ATOM   9936  N   LEU B 431      45.166  57.787  89.528  1.00  0.93           N  
ATOM   9937  CA  LEU B 431      45.069  58.641  90.702  1.00  0.93           C  
ATOM   9938  C   LEU B 431      45.906  58.091  91.853  1.00  0.93           C  
ATOM   9939  O   LEU B 431      46.159  58.777  92.839  1.00  0.93           O  
ATOM   9940  CB  LEU B 431      43.623  58.820  91.261  1.00  0.93           C  
ATOM   9941  CG  LEU B 431      42.476  59.038  90.250  1.00  0.93           C  
ATOM   9942  CD1 LEU B 431      41.196  59.426  91.005  1.00  0.93           C  
ATOM   9943  CD2 LEU B 431      42.786  60.094  89.186  1.00  0.93           C  
ATOM   9944  N   VAL B 432      46.340  56.822  91.752  1.00  0.90           N  
ATOM   9945  CA  VAL B 432      47.123  56.128  92.757  1.00  0.90           C  
ATOM   9946  C   VAL B 432      48.537  55.905  92.239  1.00  0.90           C  
ATOM   9947  O   VAL B 432      48.763  55.292  91.194  1.00  0.90           O  
ATOM   9948  CB  VAL B 432      46.495  54.782  93.128  1.00  0.90           C  
ATOM   9949  CG1 VAL B 432      47.326  54.034  94.194  1.00  0.90           C  
ATOM   9950  CG2 VAL B 432      45.058  55.006  93.643  1.00  0.90           C  
ATOM   9951  N   GLU B 433      49.538  56.404  92.992  1.00  0.82           N  
ATOM   9952  CA  GLU B 433      50.946  56.196  92.736  1.00  0.82           C  
ATOM   9953  C   GLU B 433      51.393  54.949  93.486  1.00  0.82           C  
ATOM   9954  O   GLU B 433      51.591  54.971  94.697  1.00  0.82           O  
ATOM   9955  CB  GLU B 433      51.803  57.401  93.217  1.00  0.82           C  
ATOM   9956  CG  GLU B 433      51.526  58.724  92.460  1.00  0.82           C  
ATOM   9957  CD  GLU B 433      52.295  59.907  93.035  1.00  0.82           C  
ATOM   9958  OE1 GLU B 433      53.212  59.714  93.885  1.00  0.82           O  
ATOM   9959  OE2 GLU B 433      51.972  61.062  92.652  1.00  0.82           O  
ATOM   9960  N   GLU B 434      51.552  53.812  92.777  1.00  0.71           N  
ATOM   9961  CA  GLU B 434      51.801  52.505  93.381  1.00  0.71           C  
ATOM   9962  C   GLU B 434      53.230  52.293  93.908  1.00  0.71           C  
ATOM   9963  O   GLU B 434      53.514  51.329  94.618  1.00  0.71           O  
ATOM   9964  CB  GLU B 434      51.451  51.386  92.358  1.00  0.71           C  
ATOM   9965  CG  GLU B 434      50.551  50.244  92.910  1.00  0.71           C  
ATOM   9966  CD  GLU B 434      49.145  50.670  93.341  1.00  0.71           C  
ATOM   9967  OE1 GLU B 434      48.505  51.438  92.589  1.00  0.71           O  
ATOM   9968  OE2 GLU B 434      48.670  50.182  94.405  1.00  0.71           O  
ATOM   9969  N   GLY B 435      54.185  53.179  93.538  1.00  0.57           N  
ATOM   9970  CA  GLY B 435      55.615  53.052  93.837  1.00  0.57           C  
ATOM   9971  C   GLY B 435      56.031  53.155  95.288  1.00  0.57           C  
ATOM   9972  O   GLY B 435      56.144  54.247  95.836  1.00  0.57           O  
ATOM   9973  N   ALA B 436      56.337  51.997  95.909  1.00  0.58           N  
ATOM   9974  CA  ALA B 436      56.790  51.833  97.281  1.00  0.58           C  
ATOM   9975  C   ALA B 436      55.733  52.128  98.333  1.00  0.58           C  
ATOM   9976  O   ALA B 436      55.093  51.226  98.865  1.00  0.58           O  
ATOM   9977  CB  ALA B 436      58.084  52.627  97.566  1.00  0.58           C  
ATOM   9978  N   VAL B 437      55.517  53.410  98.657  1.00  0.70           N  
ATOM   9979  CA  VAL B 437      54.514  53.820  99.620  1.00  0.70           C  
ATOM   9980  C   VAL B 437      53.392  54.399  98.809  1.00  0.70           C  
ATOM   9981  O   VAL B 437      53.528  55.473  98.233  1.00  0.70           O  
ATOM   9982  CB  VAL B 437      55.021  54.875 100.601  1.00  0.70           C  
ATOM   9983  CG1 VAL B 437      53.903  55.329 101.568  1.00  0.70           C  
ATOM   9984  CG2 VAL B 437      56.204  54.295 101.397  1.00  0.70           C  
ATOM   9985  N   LYS B 438      52.257  53.683  98.723  1.00  0.80           N  
ATOM   9986  CA  LYS B 438      51.128  54.098  97.919  1.00  0.80           C  
ATOM   9987  C   LYS B 438      50.491  55.416  98.340  1.00  0.80           C  
ATOM   9988  O   LYS B 438      50.139  55.639  99.502  1.00  0.80           O  
ATOM   9989  CB  LYS B 438      50.047  53.003  97.862  1.00  0.80           C  
ATOM   9990  CG  LYS B 438      50.562  51.662  97.331  1.00  0.80           C  
ATOM   9991  CD  LYS B 438      49.445  50.615  97.358  1.00  0.80           C  
ATOM   9992  CE  LYS B 438      49.894  49.264  96.805  1.00  0.80           C  
ATOM   9993  NZ  LYS B 438      48.709  48.397  96.652  1.00  0.80           N  
ATOM   9994  N   ARG B 439      50.322  56.327  97.367  1.00  0.84           N  
ATOM   9995  CA  ARG B 439      49.825  57.666  97.604  1.00  0.84           C  
ATOM   9996  C   ARG B 439      48.789  58.027  96.567  1.00  0.84           C  
ATOM   9997  O   ARG B 439      48.784  57.510  95.454  1.00  0.84           O  
ATOM   9998  CB  ARG B 439      50.946  58.739  97.536  1.00  0.84           C  
ATOM   9999  CG  ARG B 439      52.096  58.489  98.525  1.00  0.84           C  
ATOM  10000  CD  ARG B 439      53.285  59.432  98.352  1.00  0.84           C  
ATOM  10001  NE  ARG B 439      53.140  60.525  99.365  1.00  0.84           N  
ATOM  10002  CZ  ARG B 439      53.811  60.601 100.520  1.00  0.84           C  
ATOM  10003  NH1 ARG B 439      54.694  59.678 100.881  1.00  0.84           N  
ATOM  10004  NH2 ARG B 439      53.575  61.634 101.323  1.00  0.84           N  
ATOM  10005  N   ILE B 440      47.880  58.951  96.917  1.00  0.93           N  
ATOM  10006  CA  ILE B 440      46.864  59.451  96.009  1.00  0.93           C  
ATOM  10007  C   ILE B 440      47.334  60.775  95.449  1.00  0.93           C  
ATOM  10008  O   ILE B 440      47.615  61.707  96.195  1.00  0.93           O  
ATOM  10009  CB  ILE B 440      45.486  59.626  96.654  1.00  0.93           C  
ATOM  10010  CG1 ILE B 440      45.055  58.289  97.293  1.00  0.93           C  
ATOM  10011  CG2 ILE B 440      44.477  60.102  95.583  1.00  0.93           C  
ATOM  10012  CD1 ILE B 440      43.664  58.281  97.922  1.00  0.93           C  
ATOM  10013  N   ASN B 441      47.417  60.898  94.110  1.00  0.93           N  
ATOM  10014  CA  ASN B 441      47.710  62.137  93.422  1.00  0.93           C  
ATOM  10015  C   ASN B 441      46.445  63.000  93.362  1.00  0.93           C  
ATOM  10016  O   ASN B 441      45.496  62.735  92.621  1.00  0.93           O  
ATOM  10017  CB  ASN B 441      48.256  61.783  92.011  1.00  0.93           C  
ATOM  10018  CG  ASN B 441      48.865  62.972  91.282  1.00  0.93           C  
ATOM  10019  OD1 ASN B 441      48.196  63.965  90.991  1.00  0.93           O  
ATOM  10020  ND2 ASN B 441      50.178  62.891  90.977  1.00  0.93           N  
ATOM  10021  N   MET B 442      46.387  64.073  94.179  1.00  0.95           N  
ATOM  10022  CA  MET B 442      45.168  64.852  94.333  1.00  0.95           C  
ATOM  10023  C   MET B 442      44.907  65.796  93.177  1.00  0.95           C  
ATOM  10024  O   MET B 442      43.767  66.195  92.936  1.00  0.95           O  
ATOM  10025  CB  MET B 442      45.192  65.684  95.631  1.00  0.95           C  
ATOM  10026  CG  MET B 442      45.462  64.858  96.899  1.00  0.95           C  
ATOM  10027  SD  MET B 442      44.403  63.390  97.140  1.00  0.95           S  
ATOM  10028  CE  MET B 442      42.961  64.217  97.867  1.00  0.95           C  
ATOM  10029  N   ALA B 443      45.959  66.139  92.406  1.00  0.96           N  
ATOM  10030  CA  ALA B 443      45.854  66.894  91.176  1.00  0.96           C  
ATOM  10031  C   ALA B 443      45.136  66.112  90.089  1.00  0.96           C  
ATOM  10032  O   ALA B 443      44.233  66.615  89.426  1.00  0.96           O  
ATOM  10033  CB  ALA B 443      47.262  67.296  90.701  1.00  0.96           C  
ATOM  10034  N   HIS B 444      45.473  64.817  89.926  1.00  0.93           N  
ATOM  10035  CA  HIS B 444      44.782  63.920  89.012  1.00  0.93           C  
ATOM  10036  C   HIS B 444      43.316  63.717  89.374  1.00  0.93           C  
ATOM  10037  O   HIS B 444      42.445  63.741  88.503  1.00  0.93           O  
ATOM  10038  CB  HIS B 444      45.493  62.552  88.921  1.00  0.93           C  
ATOM  10039  CG  HIS B 444      46.869  62.624  88.326  1.00  0.93           C  
ATOM  10040  ND1 HIS B 444      47.565  61.449  88.178  1.00  0.93           N  
ATOM  10041  CD2 HIS B 444      47.590  63.660  87.818  1.00  0.93           C  
ATOM  10042  CE1 HIS B 444      48.696  61.774  87.586  1.00  0.93           C  
ATOM  10043  NE2 HIS B 444      48.762  63.106  87.345  1.00  0.93           N  
ATOM  10044  N   LEU B 445      42.997  63.574  90.683  1.00  0.96           N  
ATOM  10045  CA  LEU B 445      41.624  63.503  91.180  1.00  0.96           C  
ATOM  10046  C   LEU B 445      40.814  64.749  90.820  1.00  0.96           C  
ATOM  10047  O   LEU B 445      39.694  64.662  90.312  1.00  0.96           O  
ATOM  10048  CB  LEU B 445      41.640  63.269  92.718  1.00  0.96           C  
ATOM  10049  CG  LEU B 445      40.272  63.217  93.443  1.00  0.96           C  
ATOM  10050  CD1 LEU B 445      39.329  62.136  92.891  1.00  0.96           C  
ATOM  10051  CD2 LEU B 445      40.492  62.981  94.945  1.00  0.96           C  
ATOM  10052  N   CYS B 446      41.410  65.947  90.987  1.00  0.97           N  
ATOM  10053  CA  CYS B 446      40.841  67.203  90.532  1.00  0.97           C  
ATOM  10054  C   CYS B 446      40.611  67.307  89.025  1.00  0.97           C  
ATOM  10055  O   CYS B 446      39.582  67.808  88.589  1.00  0.97           O  
ATOM  10056  CB  CYS B 446      41.727  68.399  90.955  1.00  0.97           C  
ATOM  10057  SG  CYS B 446      41.601  68.802  92.720  1.00  0.97           S  
ATOM  10058  N   ILE B 447      41.552  66.856  88.173  1.00  0.94           N  
ATOM  10059  CA  ILE B 447      41.413  66.909  86.714  1.00  0.94           C  
ATOM  10060  C   ILE B 447      40.282  66.028  86.190  1.00  0.94           C  
ATOM  10061  O   ILE B 447      39.502  66.420  85.316  1.00  0.94           O  
ATOM  10062  CB  ILE B 447      42.726  66.539  86.017  1.00  0.94           C  
ATOM  10063  CG1 ILE B 447      43.833  67.558  86.365  1.00  0.94           C  
ATOM  10064  CG2 ILE B 447      42.563  66.500  84.480  1.00  0.94           C  
ATOM  10065  CD1 ILE B 447      45.241  67.005  86.135  1.00  0.94           C  
ATOM  10066  N   ALA B 448      40.157  64.793  86.716  1.00  0.94           N  
ATOM  10067  CA  ALA B 448      39.091  63.883  86.340  1.00  0.94           C  
ATOM  10068  C   ALA B 448      37.710  64.347  86.804  1.00  0.94           C  
ATOM  10069  O   ALA B 448      36.743  64.258  86.055  1.00  0.94           O  
ATOM  10070  CB  ALA B 448      39.415  62.450  86.816  1.00  0.94           C  
ATOM  10071  N   GLY B 449      37.600  64.881  88.039  1.00  0.96           N  
ATOM  10072  CA  GLY B 449      36.340  65.300  88.655  1.00  0.96           C  
ATOM  10073  C   GLY B 449      35.851  66.693  88.360  1.00  0.96           C  
ATOM  10074  O   GLY B 449      34.839  67.103  88.919  1.00  0.96           O  
ATOM  10075  N   SER B 450      36.559  67.461  87.517  1.00  0.96           N  
ATOM  10076  CA  SER B 450      36.220  68.841  87.177  1.00  0.96           C  
ATOM  10077  C   SER B 450      36.051  68.999  85.681  1.00  0.96           C  
ATOM  10078  O   SER B 450      36.737  68.340  84.903  1.00  0.96           O  
ATOM  10079  CB  SER B 450      37.359  69.821  87.556  1.00  0.96           C  
ATOM  10080  OG  SER B 450      37.455  69.979  88.972  1.00  0.96           O  
ATOM  10081  N   HIS B 451      35.150  69.892  85.205  1.00  0.93           N  
ATOM  10082  CA  HIS B 451      34.988  70.150  83.776  1.00  0.93           C  
ATOM  10083  C   HIS B 451      36.033  71.097  83.225  1.00  0.93           C  
ATOM  10084  O   HIS B 451      36.299  71.109  82.025  1.00  0.93           O  
ATOM  10085  CB  HIS B 451      33.597  70.733  83.402  1.00  0.93           C  
ATOM  10086  CG  HIS B 451      33.304  72.117  83.911  1.00  0.93           C  
ATOM  10087  ND1 HIS B 451      33.032  72.286  85.245  1.00  0.93           N  
ATOM  10088  CD2 HIS B 451      33.227  73.313  83.264  1.00  0.93           C  
ATOM  10089  CE1 HIS B 451      32.790  73.570  85.401  1.00  0.93           C  
ATOM  10090  NE2 HIS B 451      32.896  74.242  84.230  1.00  0.93           N  
ATOM  10091  N   ALA B 452      36.672  71.893  84.096  1.00  0.96           N  
ATOM  10092  CA  ALA B 452      37.658  72.867  83.693  1.00  0.96           C  
ATOM  10093  C   ALA B 452      38.843  72.858  84.638  1.00  0.96           C  
ATOM  10094  O   ALA B 452      38.710  72.771  85.861  1.00  0.96           O  
ATOM  10095  CB  ALA B 452      37.053  74.283  83.642  1.00  0.96           C  
ATOM  10096  N   VAL B 453      40.053  72.936  84.059  1.00  0.96           N  
ATOM  10097  CA  VAL B 453      41.301  73.013  84.792  1.00  0.96           C  
ATOM  10098  C   VAL B 453      42.025  74.246  84.309  1.00  0.96           C  
ATOM  10099  O   VAL B 453      42.226  74.433  83.108  1.00  0.96           O  
ATOM  10100  CB  VAL B 453      42.188  71.790  84.570  1.00  0.96           C  
ATOM  10101  CG1 VAL B 453      43.536  71.949  85.307  1.00  0.96           C  
ATOM  10102  CG2 VAL B 453      41.452  70.541  85.088  1.00  0.96           C  
ATOM  10103  N   ASN B 454      42.438  75.148  85.223  1.00  0.94           N  
ATOM  10104  CA  ASN B 454      43.155  76.334  84.802  1.00  0.94           C  
ATOM  10105  C   ASN B 454      44.424  76.619  85.574  1.00  0.94           C  
ATOM  10106  O   ASN B 454      44.549  76.386  86.775  1.00  0.94           O  
ATOM  10107  CB  ASN B 454      42.255  77.597  84.712  1.00  0.94           C  
ATOM  10108  CG  ASN B 454      41.845  78.166  86.067  1.00  0.94           C  
ATOM  10109  OD1 ASN B 454      40.848  77.781  86.672  1.00  0.94           O  
ATOM  10110  ND2 ASN B 454      42.634  79.155  86.546  1.00  0.94           N  
ATOM  10111  N   GLY B 455      45.407  77.188  84.858  1.00  0.95           N  
ATOM  10112  CA  GLY B 455      46.536  77.867  85.473  1.00  0.95           C  
ATOM  10113  C   GLY B 455      46.305  79.354  85.563  1.00  0.95           C  
ATOM  10114  O   GLY B 455      45.303  79.882  85.080  1.00  0.95           O  
ATOM  10115  N   VAL B 456      47.256  80.053  86.199  1.00  0.95           N  
ATOM  10116  CA  VAL B 456      47.126  81.421  86.671  1.00  0.95           C  
ATOM  10117  C   VAL B 456      48.022  82.446  85.964  1.00  0.95           C  
ATOM  10118  O   VAL B 456      48.089  83.612  86.361  1.00  0.95           O  
ATOM  10119  CB  VAL B 456      47.464  81.446  88.156  1.00  0.95           C  
ATOM  10120  CG1 VAL B 456      46.319  80.811  88.964  1.00  0.95           C  
ATOM  10121  CG2 VAL B 456      48.783  80.700  88.433  1.00  0.95           C  
ATOM  10122  N   ALA B 457      48.720  82.047  84.888  1.00  0.95           N  
ATOM  10123  CA  ALA B 457      49.427  82.927  83.973  1.00  0.95           C  
ATOM  10124  C   ALA B 457      49.655  82.109  82.723  1.00  0.95           C  
ATOM  10125  O   ALA B 457      49.620  80.879  82.789  1.00  0.95           O  
ATOM  10126  CB  ALA B 457      50.794  83.416  84.493  1.00  0.95           C  
ATOM  10127  N   ARG B 458      49.859  82.749  81.556  1.00  0.87           N  
ATOM  10128  CA  ARG B 458      49.920  82.081  80.263  1.00  0.87           C  
ATOM  10129  C   ARG B 458      50.977  80.986  80.177  1.00  0.87           C  
ATOM  10130  O   ARG B 458      50.664  79.838  79.868  1.00  0.87           O  
ATOM  10131  CB  ARG B 458      50.178  83.148  79.169  1.00  0.87           C  
ATOM  10132  CG  ARG B 458      50.476  82.573  77.772  1.00  0.87           C  
ATOM  10133  CD  ARG B 458      50.690  83.643  76.704  1.00  0.87           C  
ATOM  10134  NE  ARG B 458      51.254  82.927  75.531  1.00  0.87           N  
ATOM  10135  CZ  ARG B 458      51.803  83.552  74.486  1.00  0.87           C  
ATOM  10136  NH1 ARG B 458      52.341  82.810  73.523  1.00  0.87           N  
ATOM  10137  NH2 ARG B 458      51.840  84.879  74.387  1.00  0.87           N  
ATOM  10138  N   ILE B 459      52.230  81.308  80.556  1.00  0.89           N  
ATOM  10139  CA  ILE B 459      53.385  80.420  80.554  1.00  0.89           C  
ATOM  10140  C   ILE B 459      53.191  79.200  81.455  1.00  0.89           C  
ATOM  10141  O   ILE B 459      53.467  78.060  81.088  1.00  0.89           O  
ATOM  10142  CB  ILE B 459      54.638  81.228  80.926  1.00  0.89           C  
ATOM  10143  CG1 ILE B 459      55.934  80.392  80.812  1.00  0.89           C  
ATOM  10144  CG2 ILE B 459      54.501  81.891  82.317  1.00  0.89           C  
ATOM  10145  CD1 ILE B 459      57.210  81.230  80.969  1.00  0.89           C  
ATOM  10146  N   HIS B 460      52.634  79.404  82.663  1.00  0.89           N  
ATOM  10147  CA  HIS B 460      52.271  78.355  83.598  1.00  0.89           C  
ATOM  10148  C   HIS B 460      51.154  77.463  83.085  1.00  0.89           C  
ATOM  10149  O   HIS B 460      51.245  76.241  83.147  1.00  0.89           O  
ATOM  10150  CB  HIS B 460      51.872  78.992  84.945  1.00  0.89           C  
ATOM  10151  CG  HIS B 460      51.357  78.070  86.005  1.00  0.89           C  
ATOM  10152  ND1 HIS B 460      52.192  77.166  86.625  1.00  0.89           N  
ATOM  10153  CD2 HIS B 460      50.130  78.035  86.575  1.00  0.89           C  
ATOM  10154  CE1 HIS B 460      51.460  76.601  87.563  1.00  0.89           C  
ATOM  10155  NE2 HIS B 460      50.203  77.098  87.576  1.00  0.89           N  
ATOM  10156  N   SER B 461      50.077  78.031  82.498  1.00  0.92           N  
ATOM  10157  CA  SER B 461      49.018  77.237  81.880  1.00  0.92           C  
ATOM  10158  C   SER B 461      49.508  76.387  80.721  1.00  0.92           C  
ATOM  10159  O   SER B 461      49.115  75.228  80.596  1.00  0.92           O  
ATOM  10160  CB  SER B 461      47.826  78.069  81.346  1.00  0.92           C  
ATOM  10161  OG  SER B 461      47.119  78.713  82.407  1.00  0.92           O  
ATOM  10162  N   GLU B 462      50.407  76.927  79.869  1.00  0.84           N  
ATOM  10163  CA  GLU B 462      51.069  76.204  78.796  1.00  0.84           C  
ATOM  10164  C   GLU B 462      51.875  75.005  79.323  1.00  0.84           C  
ATOM  10165  O   GLU B 462      51.769  73.907  78.779  1.00  0.84           O  
ATOM  10166  CB  GLU B 462      51.957  77.172  77.951  1.00  0.84           C  
ATOM  10167  CG  GLU B 462      51.169  78.226  77.103  1.00  0.84           C  
ATOM  10168  CD  GLU B 462      52.031  79.349  76.498  1.00  0.84           C  
ATOM  10169  OE1 GLU B 462      53.260  79.364  76.741  1.00  0.84           O  
ATOM  10170  OE2 GLU B 462      51.460  80.229  75.787  1.00  0.84           O  
ATOM  10171  N   ILE B 463      52.635  75.151  80.436  1.00  0.85           N  
ATOM  10172  CA  ILE B 463      53.331  74.046  81.105  1.00  0.85           C  
ATOM  10173  C   ILE B 463      52.385  73.009  81.719  1.00  0.85           C  
ATOM  10174  O   ILE B 463      52.575  71.805  81.547  1.00  0.85           O  
ATOM  10175  CB  ILE B 463      54.333  74.550  82.156  1.00  0.85           C  
ATOM  10176  CG1 ILE B 463      55.428  75.399  81.464  1.00  0.85           C  
ATOM  10177  CG2 ILE B 463      54.997  73.378  82.923  1.00  0.85           C  
ATOM  10178  CD1 ILE B 463      56.323  76.182  82.434  1.00  0.85           C  
ATOM  10179  N   LEU B 464      51.311  73.422  82.429  1.00  0.86           N  
ATOM  10180  CA  LEU B 464      50.323  72.515  83.011  1.00  0.86           C  
ATOM  10181  C   LEU B 464      49.617  71.683  81.961  1.00  0.86           C  
ATOM  10182  O   LEU B 464      49.469  70.470  82.104  1.00  0.86           O  
ATOM  10183  CB  LEU B 464      49.221  73.287  83.788  1.00  0.86           C  
ATOM  10184  CG  LEU B 464      49.685  74.023  85.058  1.00  0.86           C  
ATOM  10185  CD1 LEU B 464      48.502  74.800  85.649  1.00  0.86           C  
ATOM  10186  CD2 LEU B 464      50.296  73.065  86.084  1.00  0.86           C  
ATOM  10187  N   LYS B 465      49.203  72.337  80.859  1.00  0.76           N  
ATOM  10188  CA  LYS B 465      48.609  71.682  79.723  1.00  0.76           C  
ATOM  10189  C   LYS B 465      49.634  70.824  79.000  1.00  0.76           C  
ATOM  10190  O   LYS B 465      49.612  69.610  79.093  1.00  0.76           O  
ATOM  10191  CB  LYS B 465      47.982  72.734  78.769  1.00  0.76           C  
ATOM  10192  CG  LYS B 465      47.134  72.145  77.631  1.00  0.76           C  
ATOM  10193  CD  LYS B 465      46.470  73.246  76.787  1.00  0.76           C  
ATOM  10194  CE  LYS B 465      45.534  72.689  75.708  1.00  0.76           C  
ATOM  10195  NZ  LYS B 465      44.868  73.787  74.972  1.00  0.76           N  
ATOM  10196  N   LYS B 466      50.618  71.397  78.294  1.00  0.73           N  
ATOM  10197  CA  LYS B 466      51.408  70.637  77.347  1.00  0.73           C  
ATOM  10198  C   LYS B 466      52.510  69.780  77.956  1.00  0.73           C  
ATOM  10199  O   LYS B 466      53.027  68.901  77.268  1.00  0.73           O  
ATOM  10200  CB  LYS B 466      52.001  71.577  76.268  1.00  0.73           C  
ATOM  10201  CG  LYS B 466      50.957  72.230  75.334  1.00  0.73           C  
ATOM  10202  CD  LYS B 466      50.253  71.263  74.360  1.00  0.73           C  
ATOM  10203  CE  LYS B 466      51.160  70.731  73.240  1.00  0.73           C  
ATOM  10204  NZ  LYS B 466      50.453  69.688  72.463  1.00  0.73           N  
ATOM  10205  N   THR B 467      52.878  69.983  79.236  1.00  0.82           N  
ATOM  10206  CA  THR B 467      53.967  69.250  79.889  1.00  0.82           C  
ATOM  10207  C   THR B 467      53.503  68.411  81.071  1.00  0.82           C  
ATOM  10208  O   THR B 467      53.556  67.186  81.017  1.00  0.82           O  
ATOM  10209  CB  THR B 467      55.106  70.159  80.346  1.00  0.82           C  
ATOM  10210  OG1 THR B 467      55.657  70.832  79.226  1.00  0.82           O  
ATOM  10211  CG2 THR B 467      56.264  69.385  80.991  1.00  0.82           C  
ATOM  10212  N   ILE B 468      53.091  69.017  82.211  1.00  0.84           N  
ATOM  10213  CA  ILE B 468      52.851  68.292  83.471  1.00  0.84           C  
ATOM  10214  C   ILE B 468      51.709  67.283  83.408  1.00  0.84           C  
ATOM  10215  O   ILE B 468      51.842  66.141  83.846  1.00  0.84           O  
ATOM  10216  CB  ILE B 468      52.645  69.262  84.646  1.00  0.84           C  
ATOM  10217  CG1 ILE B 468      53.953  70.031  84.964  1.00  0.84           C  
ATOM  10218  CG2 ILE B 468      52.110  68.559  85.920  1.00  0.84           C  
ATOM  10219  CD1 ILE B 468      55.082  69.159  85.538  1.00  0.84           C  
ATOM  10220  N   PHE B 469      50.558  67.660  82.822  1.00  0.88           N  
ATOM  10221  CA  PHE B 469      49.392  66.799  82.732  1.00  0.88           C  
ATOM  10222  C   PHE B 469      49.156  66.407  81.289  1.00  0.88           C  
ATOM  10223  O   PHE B 469      48.018  66.318  80.829  1.00  0.88           O  
ATOM  10224  CB  PHE B 469      48.130  67.483  83.321  1.00  0.88           C  
ATOM  10225  CG  PHE B 469      48.349  67.813  84.773  1.00  0.88           C  
ATOM  10226  CD1 PHE B 469      48.303  69.146  85.216  1.00  0.88           C  
ATOM  10227  CD2 PHE B 469      48.607  66.794  85.710  1.00  0.88           C  
ATOM  10228  CE1 PHE B 469      48.527  69.459  86.562  1.00  0.88           C  
ATOM  10229  CE2 PHE B 469      48.841  67.105  87.058  1.00  0.88           C  
ATOM  10230  CZ  PHE B 469      48.808  68.440  87.480  1.00  0.88           C  
ATOM  10231  N   LYS B 470      50.251  66.158  80.536  1.00  0.84           N  
ATOM  10232  CA  LYS B 470      50.268  65.990  79.094  1.00  0.84           C  
ATOM  10233  C   LYS B 470      49.328  64.922  78.582  1.00  0.84           C  
ATOM  10234  O   LYS B 470      48.548  65.140  77.660  1.00  0.84           O  
ATOM  10235  CB  LYS B 470      51.699  65.628  78.604  1.00  0.84           C  
ATOM  10236  CG  LYS B 470      51.872  65.663  77.072  1.00  0.84           C  
ATOM  10237  CD  LYS B 470      53.246  65.230  76.534  1.00  0.84           C  
ATOM  10238  CE  LYS B 470      53.452  63.718  76.350  1.00  0.84           C  
ATOM  10239  NZ  LYS B 470      52.611  63.162  75.268  1.00  0.84           N  
ATOM  10240  N   ASP B 471      49.325  63.745  79.225  1.00  0.89           N  
ATOM  10241  CA  ASP B 471      48.417  62.676  78.891  1.00  0.89           C  
ATOM  10242  C   ASP B 471      46.935  63.053  79.035  1.00  0.89           C  
ATOM  10243  O   ASP B 471      46.101  62.609  78.249  1.00  0.89           O  
ATOM  10244  CB  ASP B 471      48.721  61.441  79.763  1.00  0.89           C  
ATOM  10245  CG  ASP B 471      50.112  60.924  79.479  1.00  0.89           C  
ATOM  10246  OD1 ASP B 471      50.335  60.376  78.370  1.00  0.89           O  
ATOM  10247  OD2 ASP B 471      50.997  61.025  80.363  1.00  0.89           O  
ATOM  10248  N   PHE B 472      46.574  63.872  80.048  1.00  0.90           N  
ATOM  10249  CA  PHE B 472      45.216  64.338  80.290  1.00  0.90           C  
ATOM  10250  C   PHE B 472      44.653  65.299  79.237  1.00  0.90           C  
ATOM  10251  O   PHE B 472      43.511  65.128  78.812  1.00  0.90           O  
ATOM  10252  CB  PHE B 472      45.059  65.015  81.686  1.00  0.90           C  
ATOM  10253  CG  PHE B 472      45.241  64.045  82.828  1.00  0.90           C  
ATOM  10254  CD1 PHE B 472      46.527  63.708  83.281  1.00  0.90           C  
ATOM  10255  CD2 PHE B 472      44.128  63.503  83.500  1.00  0.90           C  
ATOM  10256  CE1 PHE B 472      46.703  62.846  84.371  1.00  0.90           C  
ATOM  10257  CE2 PHE B 472      44.299  62.631  84.585  1.00  0.90           C  
ATOM  10258  CZ  PHE B 472      45.588  62.299  85.015  1.00  0.90           C  
ATOM  10259  N   TYR B 473      45.402  66.330  78.764  1.00  0.86           N  
ATOM  10260  CA  TYR B 473      44.856  67.242  77.750  1.00  0.86           C  
ATOM  10261  C   TYR B 473      44.631  66.579  76.394  1.00  0.86           C  
ATOM  10262  O   TYR B 473      43.753  66.989  75.640  1.00  0.86           O  
ATOM  10263  CB  TYR B 473      45.625  68.585  77.557  1.00  0.86           C  
ATOM  10264  CG  TYR B 473      46.837  68.451  76.686  1.00  0.86           C  
ATOM  10265  CD1 TYR B 473      46.713  68.471  75.285  1.00  0.86           C  
ATOM  10266  CD2 TYR B 473      48.065  68.131  77.243  1.00  0.86           C  
ATOM  10267  CE1 TYR B 473      47.800  68.162  74.460  1.00  0.86           C  
ATOM  10268  CE2 TYR B 473      49.181  67.939  76.420  1.00  0.86           C  
ATOM  10269  CZ  TYR B 473      49.047  67.905  75.035  1.00  0.86           C  
ATOM  10270  OH  TYR B 473      50.169  67.584  74.246  1.00  0.86           O  
ATOM  10271  N   GLU B 474      45.455  65.570  76.031  1.00  0.78           N  
ATOM  10272  CA  GLU B 474      45.334  64.817  74.793  1.00  0.78           C  
ATOM  10273  C   GLU B 474      43.966  64.151  74.684  1.00  0.78           C  
ATOM  10274  O   GLU B 474      43.344  64.133  73.625  1.00  0.78           O  
ATOM  10275  CB  GLU B 474      46.454  63.745  74.724  1.00  0.78           C  
ATOM  10276  CG  GLU B 474      47.873  64.347  74.550  1.00  0.78           C  
ATOM  10277  CD  GLU B 474      49.015  63.353  74.694  1.00  0.78           C  
ATOM  10278  OE1 GLU B 474      48.778  62.120  74.777  1.00  0.78           O  
ATOM  10279  OE2 GLU B 474      50.185  63.824  74.728  1.00  0.78           O  
ATOM  10280  N   LEU B 475      43.452  63.618  75.811  1.00  0.77           N  
ATOM  10281  CA  LEU B 475      42.090  63.121  75.923  1.00  0.77           C  
ATOM  10282  C   LEU B 475      40.984  64.184  75.887  1.00  0.77           C  
ATOM  10283  O   LEU B 475      39.968  63.984  75.225  1.00  0.77           O  
ATOM  10284  CB  LEU B 475      41.902  62.262  77.205  1.00  0.77           C  
ATOM  10285  CG  LEU B 475      42.313  60.779  77.060  1.00  0.77           C  
ATOM  10286  CD1 LEU B 475      43.819  60.593  76.850  1.00  0.77           C  
ATOM  10287  CD2 LEU B 475      41.866  59.971  78.287  1.00  0.77           C  
ATOM  10288  N   GLU B 476      41.116  65.325  76.604  1.00  0.80           N  
ATOM  10289  CA  GLU B 476      40.066  66.345  76.664  1.00  0.80           C  
ATOM  10290  C   GLU B 476      40.656  67.737  76.394  1.00  0.80           C  
ATOM  10291  O   GLU B 476      41.055  68.430  77.336  1.00  0.80           O  
ATOM  10292  CB  GLU B 476      39.355  66.378  78.051  1.00  0.80           C  
ATOM  10293  CG  GLU B 476      38.492  65.131  78.373  1.00  0.80           C  
ATOM  10294  CD  GLU B 476      37.986  65.129  79.807  1.00  0.80           C  
ATOM  10295  OE1 GLU B 476      38.639  64.525  80.701  1.00  0.80           O  
ATOM  10296  OE2 GLU B 476      36.951  65.771  80.091  1.00  0.80           O  
ATOM  10297  N   PRO B 477      40.711  68.241  75.151  1.00  0.86           N  
ATOM  10298  CA  PRO B 477      41.535  69.415  74.843  1.00  0.86           C  
ATOM  10299  C   PRO B 477      40.941  70.717  75.330  1.00  0.86           C  
ATOM  10300  O   PRO B 477      41.678  71.693  75.476  1.00  0.86           O  
ATOM  10301  CB  PRO B 477      41.632  69.415  73.306  1.00  0.86           C  
ATOM  10302  CG  PRO B 477      41.499  67.939  72.935  1.00  0.86           C  
ATOM  10303  CD  PRO B 477      40.476  67.431  73.947  1.00  0.86           C  
ATOM  10304  N   HIS B 478      39.614  70.750  75.551  1.00  0.82           N  
ATOM  10305  CA  HIS B 478      38.876  71.954  75.895  1.00  0.82           C  
ATOM  10306  C   HIS B 478      38.724  72.114  77.401  1.00  0.82           C  
ATOM  10307  O   HIS B 478      38.209  73.115  77.888  1.00  0.82           O  
ATOM  10308  CB  HIS B 478      37.462  71.890  75.266  1.00  0.82           C  
ATOM  10309  CG  HIS B 478      37.475  71.998  73.770  1.00  0.82           C  
ATOM  10310  ND1 HIS B 478      37.822  73.202  73.196  1.00  0.82           N  
ATOM  10311  CD2 HIS B 478      37.109  71.107  72.808  1.00  0.82           C  
ATOM  10312  CE1 HIS B 478      37.656  73.033  71.900  1.00  0.82           C  
ATOM  10313  NE2 HIS B 478      37.226  71.781  71.610  1.00  0.82           N  
ATOM  10314  N   LYS B 479      39.198  71.131  78.190  1.00  0.88           N  
ATOM  10315  CA  LYS B 479      39.228  71.199  79.640  1.00  0.88           C  
ATOM  10316  C   LYS B 479      40.259  72.185  80.181  1.00  0.88           C  
ATOM  10317  O   LYS B 479      40.028  72.896  81.160  1.00  0.88           O  
ATOM  10318  CB  LYS B 479      39.495  69.777  80.192  1.00  0.88           C  
ATOM  10319  CG  LYS B 479      39.606  69.692  81.724  1.00  0.88           C  
ATOM  10320  CD  LYS B 479      39.506  68.257  82.273  1.00  0.88           C  
ATOM  10321  CE  LYS B 479      38.098  67.675  82.113  1.00  0.88           C  
ATOM  10322  NZ  LYS B 479      37.983  66.337  82.721  1.00  0.88           N  
ATOM  10323  N   PHE B 480      41.449  72.237  79.552  1.00  0.90           N  
ATOM  10324  CA  PHE B 480      42.590  72.973  80.065  1.00  0.90           C  
ATOM  10325  C   PHE B 480      42.698  74.366  79.480  1.00  0.90           C  
ATOM  10326  O   PHE B 480      42.881  74.558  78.275  1.00  0.90           O  
ATOM  10327  CB  PHE B 480      43.932  72.258  79.770  1.00  0.90           C  
ATOM  10328  CG  PHE B 480      44.157  71.092  80.690  1.00  0.90           C  
ATOM  10329  CD1 PHE B 480      43.509  69.863  80.480  1.00  0.90           C  
ATOM  10330  CD2 PHE B 480      45.074  71.206  81.750  1.00  0.90           C  
ATOM  10331  CE1 PHE B 480      43.777  68.765  81.308  1.00  0.90           C  
ATOM  10332  CE2 PHE B 480      45.346  70.111  82.578  1.00  0.90           C  
ATOM  10333  CZ  PHE B 480      44.697  68.890  82.357  1.00  0.90           C  
ATOM  10334  N   GLN B 481      42.639  75.379  80.359  1.00  0.88           N  
ATOM  10335  CA  GLN B 481      42.564  76.764  79.964  1.00  0.88           C  
ATOM  10336  C   GLN B 481      43.416  77.681  80.844  1.00  0.88           C  
ATOM  10337  O   GLN B 481      44.075  77.293  81.808  1.00  0.88           O  
ATOM  10338  CB  GLN B 481      41.078  77.213  79.849  1.00  0.88           C  
ATOM  10339  CG  GLN B 481      40.164  76.809  81.034  1.00  0.88           C  
ATOM  10340  CD  GLN B 481      38.763  77.400  80.852  1.00  0.88           C  
ATOM  10341  OE1 GLN B 481      38.603  78.618  80.947  1.00  0.88           O  
ATOM  10342  NE2 GLN B 481      37.742  76.557  80.586  1.00  0.88           N  
ATOM  10343  N   ASN B 482      43.497  78.966  80.464  1.00  0.91           N  
ATOM  10344  CA  ASN B 482      44.280  79.967  81.154  1.00  0.91           C  
ATOM  10345  C   ASN B 482      43.343  80.993  81.755  1.00  0.91           C  
ATOM  10346  O   ASN B 482      42.379  81.411  81.122  1.00  0.91           O  
ATOM  10347  CB  ASN B 482      45.313  80.605  80.174  1.00  0.91           C  
ATOM  10348  CG  ASN B 482      45.990  81.850  80.741  1.00  0.91           C  
ATOM  10349  OD1 ASN B 482      45.866  82.943  80.196  1.00  0.91           O  
ATOM  10350  ND2 ASN B 482      46.652  81.694  81.903  1.00  0.91           N  
ATOM  10351  N   LYS B 483      43.619  81.399  83.010  1.00  0.92           N  
ATOM  10352  CA  LYS B 483      43.010  82.568  83.603  1.00  0.92           C  
ATOM  10353  C   LYS B 483      44.089  83.335  84.349  1.00  0.92           C  
ATOM  10354  O   LYS B 483      44.319  83.102  85.532  1.00  0.92           O  
ATOM  10355  CB  LYS B 483      41.870  82.186  84.589  1.00  0.92           C  
ATOM  10356  CG  LYS B 483      40.694  81.432  83.951  1.00  0.92           C  
ATOM  10357  CD  LYS B 483      39.849  82.361  83.075  1.00  0.92           C  
ATOM  10358  CE  LYS B 483      38.906  81.639  82.127  1.00  0.92           C  
ATOM  10359  NZ  LYS B 483      39.619  81.213  80.926  1.00  0.92           N  
ATOM  10360  N   THR B 484      44.796  84.270  83.668  1.00  0.96           N  
ATOM  10361  CA  THR B 484      45.858  85.102  84.249  1.00  0.96           C  
ATOM  10362  C   THR B 484      45.402  85.840  85.486  1.00  0.96           C  
ATOM  10363  O   THR B 484      44.398  86.546  85.457  1.00  0.96           O  
ATOM  10364  CB  THR B 484      46.437  86.113  83.258  1.00  0.96           C  
ATOM  10365  OG1 THR B 484      46.926  85.396  82.143  1.00  0.96           O  
ATOM  10366  CG2 THR B 484      47.584  86.954  83.846  1.00  0.96           C  
ATOM  10367  N   ASN B 485      46.109  85.673  86.623  1.00  0.95           N  
ATOM  10368  CA  ASN B 485      45.848  86.359  87.881  1.00  0.95           C  
ATOM  10369  C   ASN B 485      45.628  87.863  87.799  1.00  0.95           C  
ATOM  10370  O   ASN B 485      45.929  88.545  86.820  1.00  0.95           O  
ATOM  10371  CB  ASN B 485      46.932  86.086  88.958  1.00  0.95           C  
ATOM  10372  CG  ASN B 485      46.731  84.718  89.586  1.00  0.95           C  
ATOM  10373  OD1 ASN B 485      45.724  84.042  89.385  1.00  0.95           O  
ATOM  10374  ND2 ASN B 485      47.705  84.312  90.431  1.00  0.95           N  
ATOM  10375  N   GLY B 486      45.046  88.413  88.873  1.00  0.98           N  
ATOM  10376  CA  GLY B 486      44.894  89.844  89.003  1.00  0.98           C  
ATOM  10377  C   GLY B 486      44.871  90.219  90.450  1.00  0.98           C  
ATOM  10378  O   GLY B 486      44.845  89.365  91.333  1.00  0.98           O  
ATOM  10379  N   ILE B 487      44.842  91.528  90.717  1.00  0.97           N  
ATOM  10380  CA  ILE B 487      44.787  92.104  92.043  1.00  0.97           C  
ATOM  10381  C   ILE B 487      43.671  93.128  92.087  1.00  0.97           C  
ATOM  10382  O   ILE B 487      43.301  93.722  91.079  1.00  0.97           O  
ATOM  10383  CB  ILE B 487      46.090  92.794  92.427  1.00  0.97           C  
ATOM  10384  CG1 ILE B 487      46.583  93.740  91.307  1.00  0.97           C  
ATOM  10385  CG2 ILE B 487      47.141  91.706  92.733  1.00  0.97           C  
ATOM  10386  CD1 ILE B 487      47.427  94.896  91.839  1.00  0.97           C  
ATOM  10387  N   THR B 488      43.069  93.372  93.267  1.00  0.97           N  
ATOM  10388  CA  THR B 488      42.012  94.378  93.363  1.00  0.97           C  
ATOM  10389  C   THR B 488      42.576  95.803  93.400  1.00  0.97           C  
ATOM  10390  O   THR B 488      43.419  96.105  94.253  1.00  0.97           O  
ATOM  10391  CB  THR B 488      40.995  94.162  94.491  1.00  0.97           C  
ATOM  10392  OG1 THR B 488      40.114  95.269  94.641  1.00  0.97           O  
ATOM  10393  CG2 THR B 488      41.667  93.967  95.855  1.00  0.97           C  
ATOM  10394  N   PRO B 489      42.143  96.733  92.541  1.00  0.98           N  
ATOM  10395  CA  PRO B 489      42.585  98.120  92.598  1.00  0.98           C  
ATOM  10396  C   PRO B 489      41.960  98.863  93.764  1.00  0.98           C  
ATOM  10397  O   PRO B 489      42.334 100.006  94.016  1.00  0.98           O  
ATOM  10398  CB  PRO B 489      42.135  98.696  91.243  1.00  0.98           C  
ATOM  10399  CG  PRO B 489      40.901  97.874  90.865  1.00  0.98           C  
ATOM  10400  CD  PRO B 489      41.245  96.487  91.403  1.00  0.98           C  
ATOM  10401  N   ARG B 490      41.001  98.277  94.509  1.00  0.92           N  
ATOM  10402  CA  ARG B 490      40.460  98.947  95.677  1.00  0.92           C  
ATOM  10403  C   ARG B 490      41.444  98.901  96.833  1.00  0.92           C  
ATOM  10404  O   ARG B 490      41.864  99.929  97.357  1.00  0.92           O  
ATOM  10405  CB  ARG B 490      39.116  98.318  96.126  1.00  0.92           C  
ATOM  10406  CG  ARG B 490      37.884  98.801  95.332  1.00  0.92           C  
ATOM  10407  CD  ARG B 490      37.807  98.446  93.845  1.00  0.92           C  
ATOM  10408  NE  ARG B 490      37.555  96.985  93.726  1.00  0.92           N  
ATOM  10409  CZ  ARG B 490      37.342  96.375  92.554  1.00  0.92           C  
ATOM  10410  NH1 ARG B 490      37.343  97.033  91.405  1.00  0.92           N  
ATOM  10411  NH2 ARG B 490      37.135  95.068  92.548  1.00  0.92           N  
ATOM  10412  N   ARG B 491      41.909  97.701  97.227  1.00  0.93           N  
ATOM  10413  CA  ARG B 491      42.928  97.582  98.254  1.00  0.93           C  
ATOM  10414  C   ARG B 491      44.301  98.015  97.764  1.00  0.93           C  
ATOM  10415  O   ARG B 491      45.035  98.716  98.455  1.00  0.93           O  
ATOM  10416  CB  ARG B 491      42.977  96.149  98.831  1.00  0.93           C  
ATOM  10417  CG  ARG B 491      43.928  95.998 100.035  1.00  0.93           C  
ATOM  10418  CD  ARG B 491      43.888  94.620 100.694  1.00  0.93           C  
ATOM  10419  NE  ARG B 491      42.531  94.454 101.316  1.00  0.93           N  
ATOM  10420  CZ  ARG B 491      42.293  94.682 102.612  1.00  0.93           C  
ATOM  10421  NH1 ARG B 491      43.210  95.131 103.459  1.00  0.93           N  
ATOM  10422  NH2 ARG B 491      41.069  94.468 103.086  1.00  0.93           N  
ATOM  10423  N   TRP B 492      44.677  97.632  96.529  1.00  0.92           N  
ATOM  10424  CA  TRP B 492      46.046  97.782  96.066  1.00  0.92           C  
ATOM  10425  C   TRP B 492      46.271  99.023  95.219  1.00  0.92           C  
ATOM  10426  O   TRP B 492      47.300  99.151  94.561  1.00  0.92           O  
ATOM  10427  CB  TRP B 492      46.538  96.508  95.333  1.00  0.92           C  
ATOM  10428  CG  TRP B 492      46.438  95.256  96.183  1.00  0.92           C  
ATOM  10429  CD1 TRP B 492      45.575  94.204  96.058  1.00  0.92           C  
ATOM  10430  CD2 TRP B 492      47.217  94.984  97.370  1.00  0.92           C  
ATOM  10431  NE1 TRP B 492      45.762  93.282  97.075  1.00  0.92           N  
ATOM  10432  CE2 TRP B 492      46.763  93.775  97.895  1.00  0.92           C  
ATOM  10433  CE3 TRP B 492      48.236  95.715  97.991  1.00  0.92           C  
ATOM  10434  CZ2 TRP B 492      47.300  93.243  99.067  1.00  0.92           C  
ATOM  10435  CZ3 TRP B 492      48.768  95.192  99.183  1.00  0.92           C  
ATOM  10436  CH2 TRP B 492      48.304  93.983  99.716  1.00  0.92           C  
ATOM  10437  N   LEU B 493      45.346  99.996  95.263  1.00  0.96           N  
ATOM  10438  CA  LEU B 493      45.607 101.335  94.767  1.00  0.96           C  
ATOM  10439  C   LEU B 493      44.876 102.347  95.625  1.00  0.96           C  
ATOM  10440  O   LEU B 493      45.512 103.153  96.296  1.00  0.96           O  
ATOM  10441  CB  LEU B 493      45.222 101.495  93.274  1.00  0.96           C  
ATOM  10442  CG  LEU B 493      45.437 102.900  92.672  1.00  0.96           C  
ATOM  10443  CD1 LEU B 493      46.901 103.357  92.752  1.00  0.96           C  
ATOM  10444  CD2 LEU B 493      44.967 102.914  91.213  1.00  0.96           C  
ATOM  10445  N   VAL B 494      43.524 102.334  95.657  1.00  0.95           N  
ATOM  10446  CA  VAL B 494      42.738 103.363  96.343  1.00  0.95           C  
ATOM  10447  C   VAL B 494      43.016 103.454  97.839  1.00  0.95           C  
ATOM  10448  O   VAL B 494      43.254 104.536  98.369  1.00  0.95           O  
ATOM  10449  CB  VAL B 494      41.239 103.140  96.112  1.00  0.95           C  
ATOM  10450  CG1 VAL B 494      40.365 104.137  96.906  1.00  0.95           C  
ATOM  10451  CG2 VAL B 494      40.930 103.273  94.607  1.00  0.95           C  
ATOM  10452  N   LEU B 495      43.033 102.308  98.546  1.00  0.94           N  
ATOM  10453  CA  LEU B 495      43.338 102.245  99.964  1.00  0.94           C  
ATOM  10454  C   LEU B 495      44.813 102.469 100.276  1.00  0.94           C  
ATOM  10455  O   LEU B 495      45.171 103.334 101.071  1.00  0.94           O  
ATOM  10456  CB  LEU B 495      42.890 100.838 100.450  1.00  0.94           C  
ATOM  10457  CG  LEU B 495      42.803 100.560 101.967  1.00  0.94           C  
ATOM  10458  CD1 LEU B 495      41.991  99.276 102.187  1.00  0.94           C  
ATOM  10459  CD2 LEU B 495      44.163 100.390 102.659  1.00  0.94           C  
ATOM  10460  N   CYS B 496      45.734 101.706  99.644  1.00  0.95           N  
ATOM  10461  CA  CYS B 496      47.138 101.752 100.026  1.00  0.95           C  
ATOM  10462  C   CYS B 496      47.870 103.005  99.580  1.00  0.95           C  
ATOM  10463  O   CYS B 496      48.804 103.468 100.230  1.00  0.95           O  
ATOM  10464  CB  CYS B 496      47.907 100.491  99.544  1.00  0.95           C  
ATOM  10465  SG  CYS B 496      48.157 100.348  97.738  1.00  0.95           S  
ATOM  10466  N   ASN B 497      47.458 103.590  98.444  1.00  0.93           N  
ATOM  10467  CA  ASN B 497      48.164 104.688  97.826  1.00  0.93           C  
ATOM  10468  C   ASN B 497      47.185 105.792  97.444  1.00  0.93           C  
ATOM  10469  O   ASN B 497      46.946 106.021  96.252  1.00  0.93           O  
ATOM  10470  CB  ASN B 497      48.908 104.125  96.595  1.00  0.93           C  
ATOM  10471  CG  ASN B 497      50.024 105.030  96.097  1.00  0.93           C  
ATOM  10472  OD1 ASN B 497      50.133 106.224  96.383  1.00  0.93           O  
ATOM  10473  ND2 ASN B 497      50.919 104.422  95.286  1.00  0.93           N  
ATOM  10474  N   PRO B 498      46.601 106.519  98.407  1.00  0.93           N  
ATOM  10475  CA  PRO B 498      45.594 107.538  98.131  1.00  0.93           C  
ATOM  10476  C   PRO B 498      46.143 108.656  97.267  1.00  0.93           C  
ATOM  10477  O   PRO B 498      45.408 109.159  96.426  1.00  0.93           O  
ATOM  10478  CB  PRO B 498      45.140 108.015  99.524  1.00  0.93           C  
ATOM  10479  CG  PRO B 498      46.308 107.668 100.456  1.00  0.93           C  
ATOM  10480  CD  PRO B 498      46.836 106.369  99.850  1.00  0.93           C  
ATOM  10481  N   GLY B 499      47.437 109.016  97.413  1.00  0.91           N  
ATOM  10482  CA  GLY B 499      48.081 110.064  96.623  1.00  0.91           C  
ATOM  10483  C   GLY B 499      48.233 109.718  95.160  1.00  0.91           C  
ATOM  10484  O   GLY B 499      47.973 110.535  94.283  1.00  0.91           O  
ATOM  10485  N   LEU B 500      48.619 108.471  94.812  1.00  0.91           N  
ATOM  10486  CA  LEU B 500      48.628 108.041  93.417  1.00  0.91           C  
ATOM  10487  C   LEU B 500      47.227 107.935  92.839  1.00  0.91           C  
ATOM  10488  O   LEU B 500      46.973 108.342  91.706  1.00  0.91           O  
ATOM  10489  CB  LEU B 500      49.399 106.713  93.217  1.00  0.91           C  
ATOM  10490  CG  LEU B 500      49.759 106.360  91.756  1.00  0.91           C  
ATOM  10491  CD1 LEU B 500      50.726 107.387  91.147  1.00  0.91           C  
ATOM  10492  CD2 LEU B 500      50.381 104.957  91.674  1.00  0.91           C  
ATOM  10493  N   ALA B 501      46.258 107.430  93.631  1.00  0.92           N  
ATOM  10494  CA  ALA B 501      44.864 107.367  93.239  1.00  0.92           C  
ATOM  10495  C   ALA B 501      44.254 108.744  92.930  1.00  0.92           C  
ATOM  10496  O   ALA B 501      43.572 108.917  91.918  1.00  0.92           O  
ATOM  10497  CB  ALA B 501      44.066 106.630  94.337  1.00  0.92           C  
ATOM  10498  N   GLU B 502      44.549 109.763  93.768  1.00  0.85           N  
ATOM  10499  CA  GLU B 502      44.201 111.166  93.589  1.00  0.85           C  
ATOM  10500  C   GLU B 502      44.812 111.780  92.331  1.00  0.85           C  
ATOM  10501  O   GLU B 502      44.099 112.330  91.492  1.00  0.85           O  
ATOM  10502  CB  GLU B 502      44.677 111.890  94.874  1.00  0.85           C  
ATOM  10503  CG  GLU B 502      44.276 113.369  95.090  1.00  0.85           C  
ATOM  10504  CD  GLU B 502      44.619 113.830  96.514  1.00  0.85           C  
ATOM  10505  OE1 GLU B 502      44.215 114.958  96.891  1.00  0.85           O  
ATOM  10506  OE2 GLU B 502      45.261 113.042  97.258  1.00  0.85           O  
ATOM  10507  N   VAL B 503      46.130 111.578  92.098  1.00  0.86           N  
ATOM  10508  CA  VAL B 503      46.845 112.041  90.908  1.00  0.86           C  
ATOM  10509  C   VAL B 503      46.273 111.480  89.611  1.00  0.86           C  
ATOM  10510  O   VAL B 503      46.089 112.193  88.623  1.00  0.86           O  
ATOM  10511  CB  VAL B 503      48.337 111.691  91.021  1.00  0.86           C  
ATOM  10512  CG1 VAL B 503      49.091 111.735  89.674  1.00  0.86           C  
ATOM  10513  CG2 VAL B 503      48.987 112.674  92.011  1.00  0.86           C  
ATOM  10514  N   ILE B 504      45.947 110.173  89.561  1.00  0.86           N  
ATOM  10515  CA  ILE B 504      45.326 109.566  88.389  1.00  0.86           C  
ATOM  10516  C   ILE B 504      43.931 110.133  88.127  1.00  0.86           C  
ATOM  10517  O   ILE B 504      43.591 110.484  86.996  1.00  0.86           O  
ATOM  10518  CB  ILE B 504      45.319 108.041  88.497  1.00  0.86           C  
ATOM  10519  CG1 ILE B 504      46.779 107.521  88.530  1.00  0.86           C  
ATOM  10520  CG2 ILE B 504      44.566 107.399  87.310  1.00  0.86           C  
ATOM  10521  CD1 ILE B 504      46.899 106.049  88.938  1.00  0.86           C  
ATOM  10522  N   ALA B 505      43.107 110.300  89.182  1.00  0.89           N  
ATOM  10523  CA  ALA B 505      41.765 110.842  89.085  1.00  0.89           C  
ATOM  10524  C   ALA B 505      41.705 112.278  88.573  1.00  0.89           C  
ATOM  10525  O   ALA B 505      40.910 112.602  87.690  1.00  0.89           O  
ATOM  10526  CB  ALA B 505      41.094 110.752  90.467  1.00  0.89           C  
ATOM  10527  N   GLU B 506      42.598 113.156  89.068  1.00  0.82           N  
ATOM  10528  CA  GLU B 506      42.765 114.525  88.607  1.00  0.82           C  
ATOM  10529  C   GLU B 506      43.116 114.628  87.127  1.00  0.82           C  
ATOM  10530  O   GLU B 506      42.693 115.547  86.430  1.00  0.82           O  
ATOM  10531  CB  GLU B 506      43.889 115.232  89.402  1.00  0.82           C  
ATOM  10532  CG  GLU B 506      43.533 115.573  90.868  1.00  0.82           C  
ATOM  10533  CD  GLU B 506      44.646 116.386  91.529  1.00  0.82           C  
ATOM  10534  OE1 GLU B 506      44.320 117.189  92.437  1.00  0.82           O  
ATOM  10535  OE2 GLU B 506      45.819 116.243  91.095  1.00  0.82           O  
ATOM  10536  N   ARG B 507      43.927 113.691  86.600  1.00  0.80           N  
ATOM  10537  CA  ARG B 507      44.396 113.762  85.233  1.00  0.80           C  
ATOM  10538  C   ARG B 507      43.503 113.051  84.216  1.00  0.80           C  
ATOM  10539  O   ARG B 507      43.402 113.518  83.083  1.00  0.80           O  
ATOM  10540  CB  ARG B 507      45.848 113.221  85.153  1.00  0.80           C  
ATOM  10541  CG  ARG B 507      46.880 114.029  85.985  1.00  0.80           C  
ATOM  10542  CD  ARG B 507      47.111 115.471  85.514  1.00  0.80           C  
ATOM  10543  NE  ARG B 507      48.188 116.107  86.350  1.00  0.80           N  
ATOM  10544  CZ  ARG B 507      48.673 117.333  86.115  1.00  0.80           C  
ATOM  10545  NH1 ARG B 507      49.663 117.839  86.842  1.00  0.80           N  
ATOM  10546  NH2 ARG B 507      48.170 118.093  85.145  1.00  0.80           N  
ATOM  10547  N   ILE B 508      42.832 111.919  84.552  1.00  0.84           N  
ATOM  10548  CA  ILE B 508      42.029 111.185  83.562  1.00  0.84           C  
ATOM  10549  C   ILE B 508      40.602 110.855  83.988  1.00  0.84           C  
ATOM  10550  O   ILE B 508      39.905 110.141  83.259  1.00  0.84           O  
ATOM  10551  CB  ILE B 508      42.688 109.882  83.089  1.00  0.84           C  
ATOM  10552  CG1 ILE B 508      42.979 108.895  84.242  1.00  0.84           C  
ATOM  10553  CG2 ILE B 508      43.973 110.232  82.314  1.00  0.84           C  
ATOM  10554  CD1 ILE B 508      43.172 107.450  83.764  1.00  0.84           C  
ATOM  10555  N   GLY B 509      40.117 111.400  85.125  1.00  0.85           N  
ATOM  10556  CA  GLY B 509      38.792 111.120  85.689  1.00  0.85           C  
ATOM  10557  C   GLY B 509      38.744 109.889  86.563  1.00  0.85           C  
ATOM  10558  O   GLY B 509      39.721 109.156  86.675  1.00  0.85           O  
ATOM  10559  N   GLU B 510      37.603 109.623  87.241  1.00  0.79           N  
ATOM  10560  CA  GLU B 510      37.542 108.582  88.267  1.00  0.79           C  
ATOM  10561  C   GLU B 510      37.048 107.235  87.766  1.00  0.79           C  
ATOM  10562  O   GLU B 510      37.021 106.251  88.507  1.00  0.79           O  
ATOM  10563  CB  GLU B 510      36.777 109.006  89.555  1.00  0.79           C  
ATOM  10564  CG  GLU B 510      35.282 109.399  89.465  1.00  0.79           C  
ATOM  10565  CD  GLU B 510      34.732 109.596  90.882  1.00  0.79           C  
ATOM  10566  OE1 GLU B 510      34.817 110.732  91.405  1.00  0.79           O  
ATOM  10567  OE2 GLU B 510      34.250 108.612  91.500  1.00  0.79           O  
ATOM  10568  N   ASP B 511      36.750 107.116  86.460  1.00  0.80           N  
ATOM  10569  CA  ASP B 511      36.243 105.916  85.819  1.00  0.80           C  
ATOM  10570  C   ASP B 511      37.188 104.710  85.848  1.00  0.80           C  
ATOM  10571  O   ASP B 511      36.780 103.567  85.649  1.00  0.80           O  
ATOM  10572  CB  ASP B 511      35.946 106.249  84.343  1.00  0.80           C  
ATOM  10573  CG  ASP B 511      34.978 107.412  84.287  1.00  0.80           C  
ATOM  10574  OD1 ASP B 511      35.442 108.525  83.932  1.00  0.80           O  
ATOM  10575  OD2 ASP B 511      33.793 107.218  84.643  1.00  0.80           O  
ATOM  10576  N   PHE B 512      38.493 104.916  86.139  1.00  0.88           N  
ATOM  10577  CA  PHE B 512      39.486 103.853  86.132  1.00  0.88           C  
ATOM  10578  C   PHE B 512      39.285 102.770  87.198  1.00  0.88           C  
ATOM  10579  O   PHE B 512      39.838 101.680  87.113  1.00  0.88           O  
ATOM  10580  CB  PHE B 512      40.949 104.395  86.188  1.00  0.88           C  
ATOM  10581  CG  PHE B 512      41.292 105.027  87.516  1.00  0.88           C  
ATOM  10582  CD1 PHE B 512      41.080 106.396  87.728  1.00  0.88           C  
ATOM  10583  CD2 PHE B 512      41.801 104.247  88.571  1.00  0.88           C  
ATOM  10584  CE1 PHE B 512      41.344 106.976  88.975  1.00  0.88           C  
ATOM  10585  CE2 PHE B 512      42.063 104.822  89.821  1.00  0.88           C  
ATOM  10586  CZ  PHE B 512      41.833 106.188  90.024  1.00  0.88           C  
ATOM  10587  N   ILE B 513      38.516 103.035  88.269  1.00  0.87           N  
ATOM  10588  CA  ILE B 513      38.310 102.056  89.332  1.00  0.87           C  
ATOM  10589  C   ILE B 513      37.436 100.875  88.907  1.00  0.87           C  
ATOM  10590  O   ILE B 513      37.655  99.742  89.342  1.00  0.87           O  
ATOM  10591  CB  ILE B 513      37.812 102.709  90.621  1.00  0.87           C  
ATOM  10592  CG1 ILE B 513      38.833 103.779  91.089  1.00  0.87           C  
ATOM  10593  CG2 ILE B 513      37.602 101.626  91.708  1.00  0.87           C  
ATOM  10594  CD1 ILE B 513      38.337 104.673  92.229  1.00  0.87           C  
ATOM  10595  N   SER B 514      36.419 101.098  88.047  1.00  0.78           N  
ATOM  10596  CA  SER B 514      35.527 100.036  87.592  1.00  0.78           C  
ATOM  10597  C   SER B 514      35.898  99.510  86.215  1.00  0.78           C  
ATOM  10598  O   SER B 514      35.425  98.450  85.808  1.00  0.78           O  
ATOM  10599  CB  SER B 514      34.057 100.529  87.549  1.00  0.78           C  
ATOM  10600  OG  SER B 514      33.941 101.732  86.787  1.00  0.78           O  
ATOM  10601  N   ASP B 515      36.793 100.215  85.502  1.00  0.79           N  
ATOM  10602  CA  ASP B 515      37.459  99.737  84.312  1.00  0.79           C  
ATOM  10603  C   ASP B 515      38.923 100.155  84.418  1.00  0.79           C  
ATOM  10604  O   ASP B 515      39.292 101.303  84.179  1.00  0.79           O  
ATOM  10605  CB  ASP B 515      36.776 100.330  83.052  1.00  0.79           C  
ATOM  10606  CG  ASP B 515      37.457  99.881  81.776  1.00  0.79           C  
ATOM  10607  OD1 ASP B 515      37.152 100.486  80.720  1.00  0.79           O  
ATOM  10608  OD2 ASP B 515      38.308  98.960  81.843  1.00  0.79           O  
ATOM  10609  N   LEU B 516      39.833  99.224  84.762  1.00  0.89           N  
ATOM  10610  CA  LEU B 516      41.224  99.574  85.002  1.00  0.89           C  
ATOM  10611  C   LEU B 516      41.993  99.747  83.697  1.00  0.89           C  
ATOM  10612  O   LEU B 516      43.058 100.364  83.649  1.00  0.89           O  
ATOM  10613  CB  LEU B 516      41.906  98.572  85.973  1.00  0.89           C  
ATOM  10614  CG  LEU B 516      43.119  99.148  86.749  1.00  0.89           C  
ATOM  10615  CD1 LEU B 516      42.696 100.230  87.756  1.00  0.89           C  
ATOM  10616  CD2 LEU B 516      43.915  98.055  87.480  1.00  0.89           C  
ATOM  10617  N   ASP B 517      41.412  99.303  82.564  1.00  0.87           N  
ATOM  10618  CA  ASP B 517      41.973  99.445  81.236  1.00  0.87           C  
ATOM  10619  C   ASP B 517      41.947 100.899  80.763  1.00  0.87           C  
ATOM  10620  O   ASP B 517      42.616 101.276  79.794  1.00  0.87           O  
ATOM  10621  CB  ASP B 517      41.200  98.534  80.256  1.00  0.87           C  
ATOM  10622  CG  ASP B 517      41.698  97.101  80.310  1.00  0.87           C  
ATOM  10623  OD1 ASP B 517      42.530  96.778  81.193  1.00  0.87           O  
ATOM  10624  OD2 ASP B 517      41.302  96.333  79.397  1.00  0.87           O  
ATOM  10625  N   GLN B 518      41.217 101.772  81.489  1.00  0.82           N  
ATOM  10626  CA  GLN B 518      41.210 103.208  81.298  1.00  0.82           C  
ATOM  10627  C   GLN B 518      42.498 103.894  81.736  1.00  0.82           C  
ATOM  10628  O   GLN B 518      42.745 105.039  81.355  1.00  0.82           O  
ATOM  10629  CB  GLN B 518      40.016 103.873  82.025  1.00  0.82           C  
ATOM  10630  CG  GLN B 518      38.643 103.379  81.511  1.00  0.82           C  
ATOM  10631  CD  GLN B 518      38.485 103.553  79.998  1.00  0.82           C  
ATOM  10632  OE1 GLN B 518      38.729 104.623  79.444  1.00  0.82           O  
ATOM  10633  NE2 GLN B 518      38.089 102.490  79.280  1.00  0.82           N  
ATOM  10634  N   LEU B 519      43.398 103.212  82.487  1.00  0.88           N  
ATOM  10635  CA  LEU B 519      44.721 103.732  82.826  1.00  0.88           C  
ATOM  10636  C   LEU B 519      45.578 104.063  81.604  1.00  0.88           C  
ATOM  10637  O   LEU B 519      46.440 104.937  81.655  1.00  0.88           O  
ATOM  10638  CB  LEU B 519      45.516 102.774  83.751  1.00  0.88           C  
ATOM  10639  CG  LEU B 519      44.975 102.658  85.193  1.00  0.88           C  
ATOM  10640  CD1 LEU B 519      45.826 101.668  85.999  1.00  0.88           C  
ATOM  10641  CD2 LEU B 519      44.956 104.009  85.923  1.00  0.88           C  
ATOM  10642  N   ARG B 520      45.299 103.440  80.437  1.00  0.80           N  
ATOM  10643  CA  ARG B 520      45.931 103.731  79.156  1.00  0.80           C  
ATOM  10644  C   ARG B 520      45.795 105.192  78.711  1.00  0.80           C  
ATOM  10645  O   ARG B 520      46.591 105.698  77.926  1.00  0.80           O  
ATOM  10646  CB  ARG B 520      45.373 102.800  78.045  1.00  0.80           C  
ATOM  10647  CG  ARG B 520      45.740 101.315  78.261  1.00  0.80           C  
ATOM  10648  CD  ARG B 520      45.215 100.344  77.197  1.00  0.80           C  
ATOM  10649  NE  ARG B 520      43.731 100.264  77.360  1.00  0.80           N  
ATOM  10650  CZ  ARG B 520      42.932  99.541  76.566  1.00  0.80           C  
ATOM  10651  NH1 ARG B 520      41.643  99.419  76.857  1.00  0.80           N  
ATOM  10652  NH2 ARG B 520      43.401  98.946  75.477  1.00  0.80           N  
ATOM  10653  N   LYS B 521      44.811 105.941  79.252  1.00  0.79           N  
ATOM  10654  CA  LYS B 521      44.629 107.363  78.993  1.00  0.79           C  
ATOM  10655  C   LYS B 521      45.696 108.242  79.655  1.00  0.79           C  
ATOM  10656  O   LYS B 521      45.806 109.429  79.358  1.00  0.79           O  
ATOM  10657  CB  LYS B 521      43.192 107.805  79.387  1.00  0.79           C  
ATOM  10658  CG  LYS B 521      42.146 107.210  78.426  1.00  0.79           C  
ATOM  10659  CD  LYS B 521      40.789 106.832  79.048  1.00  0.79           C  
ATOM  10660  CE  LYS B 521      39.731 107.930  79.247  1.00  0.79           C  
ATOM  10661  NZ  LYS B 521      40.040 108.810  80.398  1.00  0.79           N  
ATOM  10662  N   LEU B 522      46.556 107.679  80.535  1.00  0.83           N  
ATOM  10663  CA  LEU B 522      47.713 108.374  81.085  1.00  0.83           C  
ATOM  10664  C   LEU B 522      48.829 108.585  80.059  1.00  0.83           C  
ATOM  10665  O   LEU B 522      49.720 109.411  80.253  1.00  0.83           O  
ATOM  10666  CB  LEU B 522      48.288 107.623  82.313  1.00  0.83           C  
ATOM  10667  CG  LEU B 522      47.360 107.640  83.548  1.00  0.83           C  
ATOM  10668  CD1 LEU B 522      47.810 106.600  84.584  1.00  0.83           C  
ATOM  10669  CD2 LEU B 522      47.287 109.035  84.191  1.00  0.83           C  
ATOM  10670  N   LEU B 523      48.780 107.898  78.893  1.00  0.78           N  
ATOM  10671  CA  LEU B 523      49.733 108.073  77.806  1.00  0.78           C  
ATOM  10672  C   LEU B 523      49.685 109.462  77.163  1.00  0.78           C  
ATOM  10673  O   LEU B 523      50.619 109.889  76.490  1.00  0.78           O  
ATOM  10674  CB  LEU B 523      49.519 107.012  76.699  1.00  0.78           C  
ATOM  10675  CG  LEU B 523      49.766 105.555  77.146  1.00  0.78           C  
ATOM  10676  CD1 LEU B 523      49.339 104.586  76.034  1.00  0.78           C  
ATOM  10677  CD2 LEU B 523      51.231 105.299  77.536  1.00  0.78           C  
ATOM  10678  N   SER B 524      48.622 110.247  77.414  1.00  0.76           N  
ATOM  10679  CA  SER B 524      48.494 111.631  76.972  1.00  0.76           C  
ATOM  10680  C   SER B 524      49.466 112.567  77.670  1.00  0.76           C  
ATOM  10681  O   SER B 524      49.678 113.692  77.230  1.00  0.76           O  
ATOM  10682  CB  SER B 524      47.075 112.192  77.258  1.00  0.76           C  
ATOM  10683  OG  SER B 524      46.085 111.386  76.620  1.00  0.76           O  
ATOM  10684  N   PHE B 525      50.089 112.123  78.779  1.00  0.81           N  
ATOM  10685  CA  PHE B 525      50.977 112.940  79.590  1.00  0.81           C  
ATOM  10686  C   PHE B 525      52.435 112.501  79.481  1.00  0.81           C  
ATOM  10687  O   PHE B 525      53.250 112.820  80.341  1.00  0.81           O  
ATOM  10688  CB  PHE B 525      50.566 112.880  81.087  1.00  0.81           C  
ATOM  10689  CG  PHE B 525      49.174 113.418  81.274  1.00  0.81           C  
ATOM  10690  CD1 PHE B 525      48.072 112.547  81.287  1.00  0.81           C  
ATOM  10691  CD2 PHE B 525      48.953 114.798  81.418  1.00  0.81           C  
ATOM  10692  CE1 PHE B 525      46.768 113.043  81.407  1.00  0.81           C  
ATOM  10693  CE2 PHE B 525      47.649 115.300  81.546  1.00  0.81           C  
ATOM  10694  CZ  PHE B 525      46.557 114.422  81.535  1.00  0.81           C  
ATOM  10695  N   VAL B 526      52.825 111.753  78.427  1.00  0.76           N  
ATOM  10696  CA  VAL B 526      54.161 111.167  78.295  1.00  0.76           C  
ATOM  10697  C   VAL B 526      55.306 112.166  78.267  1.00  0.76           C  
ATOM  10698  O   VAL B 526      56.339 111.936  78.896  1.00  0.76           O  
ATOM  10699  CB  VAL B 526      54.224 110.264  77.062  1.00  0.76           C  
ATOM  10700  CG1 VAL B 526      55.660 109.905  76.635  1.00  0.76           C  
ATOM  10701  CG2 VAL B 526      53.469 108.966  77.382  1.00  0.76           C  
ATOM  10702  N   ASP B 527      55.151 113.288  77.545  1.00  0.76           N  
ATOM  10703  CA  ASP B 527      56.196 114.280  77.417  1.00  0.76           C  
ATOM  10704  C   ASP B 527      55.930 115.478  78.335  1.00  0.76           C  
ATOM  10705  O   ASP B 527      56.619 116.494  78.273  1.00  0.76           O  
ATOM  10706  CB  ASP B 527      56.300 114.721  75.937  1.00  0.76           C  
ATOM  10707  CG  ASP B 527      56.525 113.512  75.033  1.00  0.76           C  
ATOM  10708  OD1 ASP B 527      57.440 112.682  75.301  1.00  0.76           O  
ATOM  10709  OD2 ASP B 527      55.744 113.370  74.062  1.00  0.76           O  
ATOM  10710  N   ASP B 528      54.928 115.394  79.241  1.00  0.77           N  
ATOM  10711  CA  ASP B 528      54.641 116.445  80.203  1.00  0.77           C  
ATOM  10712  C   ASP B 528      55.625 116.408  81.377  1.00  0.77           C  
ATOM  10713  O   ASP B 528      55.635 115.501  82.208  1.00  0.77           O  
ATOM  10714  CB  ASP B 528      53.152 116.387  80.668  1.00  0.77           C  
ATOM  10715  CG  ASP B 528      52.829 117.425  81.732  1.00  0.77           C  
ATOM  10716  OD1 ASP B 528      52.079 117.084  82.679  1.00  0.77           O  
ATOM  10717  OD2 ASP B 528      53.385 118.551  81.664  1.00  0.77           O  
ATOM  10718  N   GLU B 529      56.460 117.465  81.497  1.00  0.73           N  
ATOM  10719  CA  GLU B 529      57.376 117.629  82.611  1.00  0.73           C  
ATOM  10720  C   GLU B 529      56.657 118.034  83.899  1.00  0.73           C  
ATOM  10721  O   GLU B 529      57.246 117.960  84.980  1.00  0.73           O  
ATOM  10722  CB  GLU B 529      58.559 118.622  82.389  1.00  0.73           C  
ATOM  10723  CG  GLU B 529      59.686 118.122  81.465  1.00  0.73           C  
ATOM  10724  CD  GLU B 529      61.064 118.637  81.761  1.00  0.73           C  
ATOM  10725  OE1 GLU B 529      61.292 119.238  82.851  1.00  0.73           O  
ATOM  10726  OE2 GLU B 529      61.941 118.377  80.893  1.00  0.73           O  
ATOM  10727  N   ALA B 530      55.374 118.474  83.862  1.00  0.82           N  
ATOM  10728  CA  ALA B 530      54.623 118.670  85.089  1.00  0.82           C  
ATOM  10729  C   ALA B 530      54.217 117.342  85.739  1.00  0.82           C  
ATOM  10730  O   ALA B 530      54.582 117.073  86.884  1.00  0.82           O  
ATOM  10731  CB  ALA B 530      53.386 119.554  84.820  1.00  0.82           C  
ATOM  10732  N   PHE B 531      53.553 116.435  84.988  1.00  0.80           N  
ATOM  10733  CA  PHE B 531      53.074 115.141  85.457  1.00  0.80           C  
ATOM  10734  C   PHE B 531      54.171 114.220  85.976  1.00  0.80           C  
ATOM  10735  O   PHE B 531      54.011 113.564  87.004  1.00  0.80           O  
ATOM  10736  CB  PHE B 531      52.291 114.423  84.318  1.00  0.80           C  
ATOM  10737  CG  PHE B 531      51.619 113.152  84.776  1.00  0.80           C  
ATOM  10738  CD1 PHE B 531      50.617 113.200  85.756  1.00  0.80           C  
ATOM  10739  CD2 PHE B 531      52.004 111.905  84.256  1.00  0.80           C  
ATOM  10740  CE1 PHE B 531      50.008 112.022  86.209  1.00  0.80           C  
ATOM  10741  CE2 PHE B 531      51.392 110.726  84.703  1.00  0.80           C  
ATOM  10742  CZ  PHE B 531      50.396 110.785  85.685  1.00  0.80           C  
ATOM  10743  N   ILE B 532      55.341 114.159  85.309  1.00  0.81           N  
ATOM  10744  CA  ILE B 532      56.473 113.359  85.765  1.00  0.81           C  
ATOM  10745  C   ILE B 532      56.967 113.773  87.148  1.00  0.81           C  
ATOM  10746  O   ILE B 532      57.369 112.948  87.971  1.00  0.81           O  
ATOM  10747  CB  ILE B 532      57.644 113.350  84.777  1.00  0.81           C  
ATOM  10748  CG1 ILE B 532      58.395 114.698  84.654  1.00  0.81           C  
ATOM  10749  CG2 ILE B 532      57.153 112.777  83.431  1.00  0.81           C  
ATOM  10750  CD1 ILE B 532      59.532 114.670  83.629  1.00  0.81           C  
ATOM  10751  N   ARG B 533      56.936 115.089  87.434  1.00  0.73           N  
ATOM  10752  CA  ARG B 533      57.325 115.677  88.692  1.00  0.73           C  
ATOM  10753  C   ARG B 533      56.322 115.392  89.801  1.00  0.73           C  
ATOM  10754  O   ARG B 533      56.708 115.017  90.908  1.00  0.73           O  
ATOM  10755  CB  ARG B 533      57.564 117.183  88.449  1.00  0.73           C  
ATOM  10756  CG  ARG B 533      58.421 117.899  89.511  1.00  0.73           C  
ATOM  10757  CD  ARG B 533      59.331 118.986  88.918  1.00  0.73           C  
ATOM  10758  NE  ARG B 533      58.443 119.935  88.171  1.00  0.73           N  
ATOM  10759  CZ  ARG B 533      58.745 120.523  87.004  1.00  0.73           C  
ATOM  10760  NH1 ARG B 533      59.952 120.433  86.456  1.00  0.73           N  
ATOM  10761  NH2 ARG B 533      57.810 121.238  86.383  1.00  0.73           N  
ATOM  10762  N   ASP B 534      55.009 115.483  89.508  1.00  0.83           N  
ATOM  10763  CA  ASP B 534      53.935 115.065  90.397  1.00  0.83           C  
ATOM  10764  C   ASP B 534      54.000 113.582  90.780  1.00  0.83           C  
ATOM  10765  O   ASP B 534      53.858 113.208  91.945  1.00  0.83           O  
ATOM  10766  CB  ASP B 534      52.561 115.271  89.714  1.00  0.83           C  
ATOM  10767  CG  ASP B 534      52.272 116.714  89.360  1.00  0.83           C  
ATOM  10768  OD1 ASP B 534      52.972 117.640  89.837  1.00  0.83           O  
ATOM  10769  OD2 ASP B 534      51.298 116.889  88.579  1.00  0.83           O  
ATOM  10770  N   VAL B 535      54.264 112.694  89.796  1.00  0.87           N  
ATOM  10771  CA  VAL B 535      54.444 111.255  89.979  1.00  0.87           C  
ATOM  10772  C   VAL B 535      55.612 110.938  90.903  1.00  0.87           C  
ATOM  10773  O   VAL B 535      55.507 110.125  91.826  1.00  0.87           O  
ATOM  10774  CB  VAL B 535      54.672 110.589  88.616  1.00  0.87           C  
ATOM  10775  CG1 VAL B 535      55.218 109.147  88.716  1.00  0.87           C  
ATOM  10776  CG2 VAL B 535      53.352 110.567  87.822  1.00  0.87           C  
ATOM  10777  N   ALA B 536      56.762 111.613  90.706  1.00  0.86           N  
ATOM  10778  CA  ALA B 536      57.898 111.518  91.599  1.00  0.86           C  
ATOM  10779  C   ALA B 536      57.612 112.034  93.011  1.00  0.86           C  
ATOM  10780  O   ALA B 536      58.033 111.430  93.998  1.00  0.86           O  
ATOM  10781  CB  ALA B 536      59.112 112.250  90.997  1.00  0.86           C  
ATOM  10782  N   LYS B 537      56.867 113.151  93.151  1.00  0.82           N  
ATOM  10783  CA  LYS B 537      56.480 113.720  94.433  1.00  0.82           C  
ATOM  10784  C   LYS B 537      55.617 112.797  95.284  1.00  0.82           C  
ATOM  10785  O   LYS B 537      55.917 112.599  96.459  1.00  0.82           O  
ATOM  10786  CB  LYS B 537      55.761 115.075  94.225  1.00  0.82           C  
ATOM  10787  CG  LYS B 537      55.504 115.853  95.527  1.00  0.82           C  
ATOM  10788  CD  LYS B 537      54.918 117.249  95.263  1.00  0.82           C  
ATOM  10789  CE  LYS B 537      54.426 117.960  96.529  1.00  0.82           C  
ATOM  10790  NZ  LYS B 537      55.522 118.065  97.517  1.00  0.82           N  
ATOM  10791  N   VAL B 538      54.596 112.143  94.687  1.00  0.88           N  
ATOM  10792  CA  VAL B 538      53.761 111.135  95.342  1.00  0.88           C  
ATOM  10793  C   VAL B 538      54.578 109.944  95.822  1.00  0.88           C  
ATOM  10794  O   VAL B 538      54.425 109.445  96.939  1.00  0.88           O  
ATOM  10795  CB  VAL B 538      52.678 110.634  94.382  1.00  0.88           C  
ATOM  10796  CG1 VAL B 538      52.008 109.327  94.867  1.00  0.88           C  
ATOM  10797  CG2 VAL B 538      51.630 111.748  94.215  1.00  0.88           C  
ATOM  10798  N   LYS B 539      55.522 109.461  94.985  1.00  0.89           N  
ATOM  10799  CA  LYS B 539      56.433 108.395  95.359  1.00  0.89           C  
ATOM  10800  C   LYS B 539      57.299 108.788  96.546  1.00  0.89           C  
ATOM  10801  O   LYS B 539      57.466 108.022  97.492  1.00  0.89           O  
ATOM  10802  CB  LYS B 539      57.316 107.983  94.149  1.00  0.89           C  
ATOM  10803  CG  LYS B 539      58.306 106.827  94.408  1.00  0.89           C  
ATOM  10804  CD  LYS B 539      57.656 105.500  94.846  1.00  0.89           C  
ATOM  10805  CE  LYS B 539      56.757 104.876  93.775  1.00  0.89           C  
ATOM  10806  NZ  LYS B 539      56.205 103.604  94.266  1.00  0.89           N  
ATOM  10807  N   GLN B 540      57.813 110.029  96.550  1.00  0.85           N  
ATOM  10808  CA  GLN B 540      58.578 110.582  97.646  1.00  0.85           C  
ATOM  10809  C   GLN B 540      57.808 110.738  98.958  1.00  0.85           C  
ATOM  10810  O   GLN B 540      58.331 110.438 100.030  1.00  0.85           O  
ATOM  10811  CB  GLN B 540      59.217 111.925  97.219  1.00  0.85           C  
ATOM  10812  CG  GLN B 540      60.465 112.297  98.051  1.00  0.85           C  
ATOM  10813  CD  GLN B 540      61.542 111.214  97.947  1.00  0.85           C  
ATOM  10814  OE1 GLN B 540      61.761 110.428  98.866  1.00  0.85           O  
ATOM  10815  NE2 GLN B 540      62.212 111.139  96.775  1.00  0.85           N  
ATOM  10816  N   GLU B 541      56.529 111.171  98.919  1.00  0.84           N  
ATOM  10817  CA  GLU B 541      55.656 111.246 100.087  1.00  0.84           C  
ATOM  10818  C   GLU B 541      55.430 109.882 100.735  1.00  0.84           C  
ATOM  10819  O   GLU B 541      55.544 109.716 101.953  1.00  0.84           O  
ATOM  10820  CB  GLU B 541      54.304 111.913  99.707  1.00  0.84           C  
ATOM  10821  CG  GLU B 541      54.499 113.418  99.377  1.00  0.84           C  
ATOM  10822  CD  GLU B 541      53.303 114.148  98.766  1.00  0.84           C  
ATOM  10823  OE1 GLU B 541      52.701 113.618  97.802  1.00  0.84           O  
ATOM  10824  OE2 GLU B 541      53.078 115.316  99.190  1.00  0.84           O  
ATOM  10825  N   ASN B 542      55.187 108.841  99.914  1.00  0.89           N  
ATOM  10826  CA  ASN B 542      55.118 107.460 100.364  1.00  0.89           C  
ATOM  10827  C   ASN B 542      56.436 106.943 100.954  1.00  0.89           C  
ATOM  10828  O   ASN B 542      56.447 106.297 102.003  1.00  0.89           O  
ATOM  10829  CB  ASN B 542      54.693 106.528  99.200  1.00  0.89           C  
ATOM  10830  CG  ASN B 542      53.268 106.840  98.747  1.00  0.89           C  
ATOM  10831  OD1 ASN B 542      52.420 107.302  99.507  1.00  0.89           O  
ATOM  10832  ND2 ASN B 542      52.976 106.523  97.465  1.00  0.89           N  
ATOM  10833  N   LYS B 543      57.591 107.239 100.315  1.00  0.88           N  
ATOM  10834  CA  LYS B 543      58.914 106.880 100.816  1.00  0.88           C  
ATOM  10835  C   LYS B 543      59.259 107.516 102.152  1.00  0.88           C  
ATOM  10836  O   LYS B 543      59.734 106.836 103.060  1.00  0.88           O  
ATOM  10837  CB  LYS B 543      60.019 107.242  99.792  1.00  0.88           C  
ATOM  10838  CG  LYS B 543      59.992 106.318  98.569  1.00  0.88           C  
ATOM  10839  CD  LYS B 543      60.915 106.760  97.422  1.00  0.88           C  
ATOM  10840  CE  LYS B 543      62.403 106.684  97.762  1.00  0.88           C  
ATOM  10841  NZ  LYS B 543      63.196 106.674  96.528  1.00  0.88           N  
ATOM  10842  N   LEU B 544      58.983 108.822 102.330  1.00  0.86           N  
ATOM  10843  CA  LEU B 544      59.171 109.529 103.588  1.00  0.86           C  
ATOM  10844  C   LEU B 544      58.316 108.993 104.729  1.00  0.86           C  
ATOM  10845  O   LEU B 544      58.797 108.786 105.844  1.00  0.86           O  
ATOM  10846  CB  LEU B 544      58.865 111.038 103.391  1.00  0.86           C  
ATOM  10847  CG  LEU B 544      60.126 111.900 103.185  1.00  0.86           C  
ATOM  10848  CD1 LEU B 544      59.772 113.245 102.531  1.00  0.86           C  
ATOM  10849  CD2 LEU B 544      60.843 112.135 104.524  1.00  0.86           C  
ATOM  10850  N   LYS B 545      57.019 108.714 104.473  1.00  0.80           N  
ATOM  10851  CA  LYS B 545      56.119 108.147 105.467  1.00  0.80           C  
ATOM  10852  C   LYS B 545      56.557 106.761 105.931  1.00  0.80           C  
ATOM  10853  O   LYS B 545      56.511 106.424 107.114  1.00  0.80           O  
ATOM  10854  CB  LYS B 545      54.675 108.063 104.908  1.00  0.80           C  
ATOM  10855  CG  LYS B 545      53.595 107.805 105.975  1.00  0.80           C  
ATOM  10856  CD  LYS B 545      52.184 107.786 105.363  1.00  0.80           C  
ATOM  10857  CE  LYS B 545      51.044 107.869 106.390  1.00  0.80           C  
ATOM  10858  NZ  LYS B 545      51.041 106.680 107.258  1.00  0.80           N  
ATOM  10859  N   PHE B 546      57.003 105.917 104.982  1.00  0.86           N  
ATOM  10860  CA  PHE B 546      57.530 104.594 105.249  1.00  0.86           C  
ATOM  10861  C   PHE B 546      58.913 104.593 105.921  1.00  0.86           C  
ATOM  10862  O   PHE B 546      59.180 103.784 106.809  1.00  0.86           O  
ATOM  10863  CB  PHE B 546      57.469 103.748 103.949  1.00  0.86           C  
ATOM  10864  CG  PHE B 546      57.709 102.296 104.242  1.00  0.86           C  
ATOM  10865  CD1 PHE B 546      56.825 101.576 105.066  1.00  0.86           C  
ATOM  10866  CD2 PHE B 546      58.843 101.655 103.735  1.00  0.86           C  
ATOM  10867  CE1 PHE B 546      57.094 100.246 105.417  1.00  0.86           C  
ATOM  10868  CE2 PHE B 546      59.106 100.329 104.077  1.00  0.86           C  
ATOM  10869  CZ  PHE B 546      58.249  99.625 104.931  1.00  0.86           C  
ATOM  10870  N   ALA B 547      59.823 105.526 105.571  1.00  0.87           N  
ATOM  10871  CA  ALA B 547      61.114 105.704 106.223  1.00  0.87           C  
ATOM  10872  C   ALA B 547      61.007 105.991 107.718  1.00  0.87           C  
ATOM  10873  O   ALA B 547      61.738 105.428 108.530  1.00  0.87           O  
ATOM  10874  CB  ALA B 547      61.866 106.868 105.552  1.00  0.87           C  
ATOM  10875  N   ALA B 548      60.019 106.815 108.116  1.00  0.82           N  
ATOM  10876  CA  ALA B 548      59.669 107.070 109.499  1.00  0.82           C  
ATOM  10877  C   ALA B 548      59.279 105.821 110.298  1.00  0.82           C  
ATOM  10878  O   ALA B 548      59.557 105.723 111.492  1.00  0.82           O  
ATOM  10879  CB  ALA B 548      58.500 108.073 109.547  1.00  0.82           C  
ATOM  10880  N   TYR B 549      58.612 104.831 109.664  1.00  0.79           N  
ATOM  10881  CA  TYR B 549      58.389 103.511 110.243  1.00  0.79           C  
ATOM  10882  C   TYR B 549      59.697 102.731 110.419  1.00  0.79           C  
ATOM  10883  O   TYR B 549      59.977 102.181 111.482  1.00  0.79           O  
ATOM  10884  CB  TYR B 549      57.392 102.721 109.336  1.00  0.79           C  
ATOM  10885  CG  TYR B 549      56.905 101.421 109.936  1.00  0.79           C  
ATOM  10886  CD1 TYR B 549      57.287 100.186 109.381  1.00  0.79           C  
ATOM  10887  CD2 TYR B 549      56.036 101.424 111.041  1.00  0.79           C  
ATOM  10888  CE1 TYR B 549      56.836  98.979 109.941  1.00  0.79           C  
ATOM  10889  CE2 TYR B 549      55.593 100.218 111.607  1.00  0.79           C  
ATOM  10890  CZ  TYR B 549      56.015  98.994 111.077  1.00  0.79           C  
ATOM  10891  OH  TYR B 549      55.653  97.790 111.723  1.00  0.79           O  
ATOM  10892  N   LEU B 550      60.568 102.718 109.389  1.00  0.81           N  
ATOM  10893  CA  LEU B 550      61.830 101.993 109.401  1.00  0.81           C  
ATOM  10894  C   LEU B 550      62.804 102.440 110.478  1.00  0.81           C  
ATOM  10895  O   LEU B 550      63.403 101.608 111.153  1.00  0.81           O  
ATOM  10896  CB  LEU B 550      62.548 102.094 108.029  1.00  0.81           C  
ATOM  10897  CG  LEU B 550      61.845 101.342 106.884  1.00  0.81           C  
ATOM  10898  CD1 LEU B 550      62.526 101.633 105.536  1.00  0.81           C  
ATOM  10899  CD2 LEU B 550      61.826  99.832 107.145  1.00  0.81           C  
ATOM  10900  N   GLU B 551      62.959 103.758 110.696  1.00  0.74           N  
ATOM  10901  CA  GLU B 551      63.885 104.302 111.677  1.00  0.74           C  
ATOM  10902  C   GLU B 551      63.406 104.152 113.120  1.00  0.74           C  
ATOM  10903  O   GLU B 551      64.171 104.317 114.067  1.00  0.74           O  
ATOM  10904  CB  GLU B 551      64.210 105.777 111.334  1.00  0.74           C  
ATOM  10905  CG  GLU B 551      64.876 105.892 109.938  1.00  0.74           C  
ATOM  10906  CD  GLU B 551      65.374 107.289 109.583  1.00  0.74           C  
ATOM  10907  OE1 GLU B 551      64.743 108.293 109.988  1.00  0.74           O  
ATOM  10908  OE2 GLU B 551      66.400 107.360 108.860  1.00  0.74           O  
ATOM  10909  N   ARG B 552      62.117 103.808 113.341  1.00  0.69           N  
ATOM  10910  CA  ARG B 552      61.621 103.485 114.670  1.00  0.69           C  
ATOM  10911  C   ARG B 552      61.725 102.003 115.001  1.00  0.69           C  
ATOM  10912  O   ARG B 552      61.897 101.649 116.164  1.00  0.69           O  
ATOM  10913  CB  ARG B 552      60.145 103.925 114.827  1.00  0.69           C  
ATOM  10914  CG  ARG B 552      59.985 105.455 114.775  1.00  0.69           C  
ATOM  10915  CD  ARG B 552      58.531 105.906 114.882  1.00  0.69           C  
ATOM  10916  NE  ARG B 552      58.534 107.398 114.746  1.00  0.69           N  
ATOM  10917  CZ  ARG B 552      57.427 108.149 114.789  1.00  0.69           C  
ATOM  10918  NH1 ARG B 552      57.520 109.467 114.622  1.00  0.69           N  
ATOM  10919  NH2 ARG B 552      56.234 107.604 115.003  1.00  0.69           N  
ATOM  10920  N   GLU B 553      61.641 101.104 113.998  1.00  0.70           N  
ATOM  10921  CA  GLU B 553      61.675  99.667 114.238  1.00  0.70           C  
ATOM  10922  C   GLU B 553      63.098  99.106 114.117  1.00  0.70           C  
ATOM  10923  O   GLU B 553      63.457  98.126 114.766  1.00  0.70           O  
ATOM  10924  CB  GLU B 553      60.767  98.934 113.210  1.00  0.70           C  
ATOM  10925  CG  GLU B 553      59.266  99.352 113.217  1.00  0.70           C  
ATOM  10926  CD  GLU B 553      58.384  98.756 114.318  1.00  0.70           C  
ATOM  10927  OE1 GLU B 553      57.847  99.548 115.134  1.00  0.70           O  
ATOM  10928  OE2 GLU B 553      58.138  97.522 114.274  1.00  0.70           O  
ATOM  10929  N   TYR B 554      63.975  99.736 113.302  1.00  0.73           N  
ATOM  10930  CA  TYR B 554      65.347  99.296 113.076  1.00  0.73           C  
ATOM  10931  C   TYR B 554      66.311 100.437 113.363  1.00  0.73           C  
ATOM  10932  O   TYR B 554      66.040 101.593 113.051  1.00  0.73           O  
ATOM  10933  CB  TYR B 554      65.610  98.867 111.597  1.00  0.73           C  
ATOM  10934  CG  TYR B 554      64.599  97.849 111.139  1.00  0.73           C  
ATOM  10935  CD1 TYR B 554      63.506  98.247 110.349  1.00  0.73           C  
ATOM  10936  CD2 TYR B 554      64.687  96.509 111.549  1.00  0.73           C  
ATOM  10937  CE1 TYR B 554      62.476  97.346 110.048  1.00  0.73           C  
ATOM  10938  CE2 TYR B 554      63.651  95.609 111.261  1.00  0.73           C  
ATOM  10939  CZ  TYR B 554      62.534  96.038 110.536  1.00  0.73           C  
ATOM  10940  OH  TYR B 554      61.436  95.176 110.362  1.00  0.73           O  
ATOM  10941  N   LYS B 555      67.510 100.164 113.934  1.00  0.65           N  
ATOM  10942  CA  LYS B 555      68.499 101.218 114.115  1.00  0.65           C  
ATOM  10943  C   LYS B 555      69.288 101.462 112.836  1.00  0.65           C  
ATOM  10944  O   LYS B 555      70.365 100.914 112.603  1.00  0.65           O  
ATOM  10945  CB  LYS B 555      69.484 100.971 115.282  1.00  0.65           C  
ATOM  10946  CG  LYS B 555      70.107 102.290 115.771  1.00  0.65           C  
ATOM  10947  CD  LYS B 555      71.538 102.129 116.296  1.00  0.65           C  
ATOM  10948  CE  LYS B 555      72.067 103.438 116.887  1.00  0.65           C  
ATOM  10949  NZ  LYS B 555      73.475 103.286 117.314  1.00  0.65           N  
ATOM  10950  N   VAL B 556      68.742 102.318 111.971  1.00  0.73           N  
ATOM  10951  CA  VAL B 556      69.263 102.590 110.657  1.00  0.73           C  
ATOM  10952  C   VAL B 556      69.001 104.054 110.401  1.00  0.73           C  
ATOM  10953  O   VAL B 556      68.099 104.643 110.986  1.00  0.73           O  
ATOM  10954  CB  VAL B 556      68.607 101.687 109.602  1.00  0.73           C  
ATOM  10955  CG1 VAL B 556      67.094 101.977 109.485  1.00  0.73           C  
ATOM  10956  CG2 VAL B 556      69.307 101.799 108.230  1.00  0.73           C  
ATOM  10957  N   HIS B 557      69.813 104.685 109.543  1.00  0.74           N  
ATOM  10958  CA  HIS B 557      69.582 106.028 109.061  1.00  0.74           C  
ATOM  10959  C   HIS B 557      69.255 105.847 107.592  1.00  0.74           C  
ATOM  10960  O   HIS B 557      70.028 105.254 106.837  1.00  0.74           O  
ATOM  10961  CB  HIS B 557      70.853 106.887 109.251  1.00  0.74           C  
ATOM  10962  CG  HIS B 557      70.731 108.314 108.818  1.00  0.74           C  
ATOM  10963  ND1 HIS B 557      71.616 108.775 107.875  1.00  0.74           N  
ATOM  10964  CD2 HIS B 557      69.933 109.325 109.249  1.00  0.74           C  
ATOM  10965  CE1 HIS B 557      71.348 110.054 107.731  1.00  0.74           C  
ATOM  10966  NE2 HIS B 557      70.335 110.442 108.545  1.00  0.74           N  
ATOM  10967  N   ILE B 558      68.060 106.258 107.153  1.00  0.86           N  
ATOM  10968  CA  ILE B 558      67.577 106.004 105.814  1.00  0.86           C  
ATOM  10969  C   ILE B 558      67.853 107.221 104.958  1.00  0.86           C  
ATOM  10970  O   ILE B 558      67.368 108.324 105.190  1.00  0.86           O  
ATOM  10971  CB  ILE B 558      66.093 105.617 105.750  1.00  0.86           C  
ATOM  10972  CG1 ILE B 558      65.787 104.302 106.520  1.00  0.86           C  
ATOM  10973  CG2 ILE B 558      65.617 105.504 104.281  1.00  0.86           C  
ATOM  10974  CD1 ILE B 558      66.391 103.021 105.921  1.00  0.86           C  
ATOM  10975  N   ASN B 559      68.656 107.037 103.892  1.00  0.85           N  
ATOM  10976  CA  ASN B 559      68.914 108.062 102.903  1.00  0.85           C  
ATOM  10977  C   ASN B 559      67.622 108.413 102.144  1.00  0.85           C  
ATOM  10978  O   ASN B 559      67.060 107.527 101.500  1.00  0.85           O  
ATOM  10979  CB  ASN B 559      70.051 107.570 101.956  1.00  0.85           C  
ATOM  10980  CG  ASN B 559      70.507 108.588 100.909  1.00  0.85           C  
ATOM  10981  OD1 ASN B 559      69.840 109.563 100.562  1.00  0.85           O  
ATOM  10982  ND2 ASN B 559      71.705 108.338 100.336  1.00  0.85           N  
ATOM  10983  N   PRO B 560      67.099 109.642 102.146  1.00  0.79           N  
ATOM  10984  CA  PRO B 560      65.822 109.944 101.504  1.00  0.79           C  
ATOM  10985  C   PRO B 560      65.940 109.958  99.994  1.00  0.79           C  
ATOM  10986  O   PRO B 560      64.930 109.831  99.309  1.00  0.79           O  
ATOM  10987  CB  PRO B 560      65.453 111.335 102.052  1.00  0.79           C  
ATOM  10988  CG  PRO B 560      66.789 111.959 102.473  1.00  0.79           C  
ATOM  10989  CD  PRO B 560      67.575 110.752 102.977  1.00  0.79           C  
ATOM  10990  N   ASN B 561      67.152 110.109  99.434  1.00  0.84           N  
ATOM  10991  CA  ASN B 561      67.320 110.187  97.995  1.00  0.84           C  
ATOM  10992  C   ASN B 561      67.661 108.823  97.413  1.00  0.84           C  
ATOM  10993  O   ASN B 561      67.802 108.667  96.200  1.00  0.84           O  
ATOM  10994  CB  ASN B 561      68.467 111.167  97.641  1.00  0.84           C  
ATOM  10995  CG  ASN B 561      68.047 112.593  97.976  1.00  0.84           C  
ATOM  10996  OD1 ASN B 561      66.910 113.009  97.765  1.00  0.84           O  
ATOM  10997  ND2 ASN B 561      69.004 113.398  98.490  1.00  0.84           N  
ATOM  10998  N   SER B 562      67.784 107.779  98.258  1.00  0.93           N  
ATOM  10999  CA  SER B 562      68.055 106.429  97.796  1.00  0.93           C  
ATOM  11000  C   SER B 562      66.949 105.789  96.982  1.00  0.93           C  
ATOM  11001  O   SER B 562      65.766 106.099  97.102  1.00  0.93           O  
ATOM  11002  CB  SER B 562      68.511 105.433  98.896  1.00  0.93           C  
ATOM  11003  OG  SER B 562      67.454 105.087  99.787  1.00  0.93           O  
ATOM  11004  N   LEU B 563      67.341 104.859  96.100  1.00  0.94           N  
ATOM  11005  CA  LEU B 563      66.454 103.951  95.412  1.00  0.94           C  
ATOM  11006  C   LEU B 563      65.977 102.878  96.392  1.00  0.94           C  
ATOM  11007  O   LEU B 563      66.774 102.188  97.027  1.00  0.94           O  
ATOM  11008  CB  LEU B 563      67.235 103.353  94.211  1.00  0.94           C  
ATOM  11009  CG  LEU B 563      66.435 102.603  93.130  1.00  0.94           C  
ATOM  11010  CD1 LEU B 563      67.313 102.402  91.887  1.00  0.94           C  
ATOM  11011  CD2 LEU B 563      65.941 101.230  93.578  1.00  0.94           C  
ATOM  11012  N   PHE B 564      64.653 102.725  96.566  1.00  0.95           N  
ATOM  11013  CA  PHE B 564      64.049 101.729  97.427  1.00  0.95           C  
ATOM  11014  C   PHE B 564      63.860 100.464  96.622  1.00  0.95           C  
ATOM  11015  O   PHE B 564      62.998 100.348  95.750  1.00  0.95           O  
ATOM  11016  CB  PHE B 564      62.693 102.169  98.051  1.00  0.95           C  
ATOM  11017  CG  PHE B 564      62.841 103.028  99.291  1.00  0.95           C  
ATOM  11018  CD1 PHE B 564      63.962 103.844  99.554  1.00  0.95           C  
ATOM  11019  CD2 PHE B 564      61.784 103.030 100.220  1.00  0.95           C  
ATOM  11020  CE1 PHE B 564      64.013 104.650 100.700  1.00  0.95           C  
ATOM  11021  CE2 PHE B 564      61.833 103.827 101.371  1.00  0.95           C  
ATOM  11022  CZ  PHE B 564      62.947 104.641 101.607  1.00  0.95           C  
ATOM  11023  N   ASP B 565      64.730  99.501  96.929  1.00  0.98           N  
ATOM  11024  CA  ASP B 565      64.988  98.279  96.225  1.00  0.98           C  
ATOM  11025  C   ASP B 565      64.364  97.154  97.048  1.00  0.98           C  
ATOM  11026  O   ASP B 565      64.775  96.892  98.176  1.00  0.98           O  
ATOM  11027  CB  ASP B 565      66.541  98.256  96.159  1.00  0.98           C  
ATOM  11028  CG  ASP B 565      67.117  97.082  95.406  1.00  0.98           C  
ATOM  11029  OD1 ASP B 565      66.348  96.174  95.041  1.00  0.98           O  
ATOM  11030  OD2 ASP B 565      68.352  97.101  95.157  1.00  0.98           O  
ATOM  11031  N   ILE B 566      63.266  96.536  96.559  1.00  0.97           N  
ATOM  11032  CA  ILE B 566      62.371  95.779  97.427  1.00  0.97           C  
ATOM  11033  C   ILE B 566      62.043  94.401  96.881  1.00  0.97           C  
ATOM  11034  O   ILE B 566      61.488  94.219  95.795  1.00  0.97           O  
ATOM  11035  CB  ILE B 566      61.070  96.546  97.758  1.00  0.97           C  
ATOM  11036  CG1 ILE B 566      61.389  97.842  98.551  1.00  0.97           C  
ATOM  11037  CG2 ILE B 566      60.104  95.667  98.591  1.00  0.97           C  
ATOM  11038  CD1 ILE B 566      60.235  98.819  98.780  1.00  0.97           C  
ATOM  11039  N   GLN B 567      62.318  93.372  97.709  1.00  0.96           N  
ATOM  11040  CA  GLN B 567      61.814  92.035  97.511  1.00  0.96           C  
ATOM  11041  C   GLN B 567      60.992  91.594  98.713  1.00  0.96           C  
ATOM  11042  O   GLN B 567      61.526  91.200  99.747  1.00  0.96           O  
ATOM  11043  CB  GLN B 567      62.971  91.033  97.303  1.00  0.96           C  
ATOM  11044  CG  GLN B 567      62.432  89.702  96.741  1.00  0.96           C  
ATOM  11045  CD  GLN B 567      63.486  88.655  96.409  1.00  0.96           C  
ATOM  11046  OE1 GLN B 567      63.123  87.533  96.055  1.00  0.96           O  
ATOM  11047  NE2 GLN B 567      64.785  88.971  96.540  1.00  0.96           N  
ATOM  11048  N   VAL B 568      59.647  91.604  98.603  1.00  0.98           N  
ATOM  11049  CA  VAL B 568      58.783  91.129  99.680  1.00  0.98           C  
ATOM  11050  C   VAL B 568      57.837  90.033  99.205  1.00  0.98           C  
ATOM  11051  O   VAL B 568      56.909  90.224  98.416  1.00  0.98           O  
ATOM  11052  CB  VAL B 568      58.034  92.226 100.434  1.00  0.98           C  
ATOM  11053  CG1 VAL B 568      59.026  93.024 101.305  1.00  0.98           C  
ATOM  11054  CG2 VAL B 568      57.283  93.166  99.480  1.00  0.98           C  
ATOM  11055  N   LYS B 569      58.099  88.801  99.676  1.00  0.91           N  
ATOM  11056  CA  LYS B 569      57.382  87.601  99.308  1.00  0.91           C  
ATOM  11057  C   LYS B 569      57.806  86.526 100.295  1.00  0.91           C  
ATOM  11058  O   LYS B 569      58.767  86.715 101.031  1.00  0.91           O  
ATOM  11059  CB  LYS B 569      57.637  87.196  97.821  1.00  0.91           C  
ATOM  11060  CG  LYS B 569      59.127  87.143  97.427  1.00  0.91           C  
ATOM  11061  CD  LYS B 569      59.416  86.943  95.923  1.00  0.91           C  
ATOM  11062  CE  LYS B 569      59.025  88.105  94.996  1.00  0.91           C  
ATOM  11063  NZ  LYS B 569      58.248  87.601  93.841  1.00  0.91           N  
ATOM  11064  N   ARG B 570      57.116  85.365 100.374  1.00  0.89           N  
ATOM  11065  CA  ARG B 570      57.555  84.258 101.222  1.00  0.89           C  
ATOM  11066  C   ARG B 570      58.960  83.755 100.881  1.00  0.89           C  
ATOM  11067  O   ARG B 570      59.372  83.751  99.722  1.00  0.89           O  
ATOM  11068  CB  ARG B 570      56.552  83.076 101.173  1.00  0.89           C  
ATOM  11069  CG  ARG B 570      55.183  83.374 101.826  1.00  0.89           C  
ATOM  11070  CD  ARG B 570      55.202  83.569 103.348  1.00  0.89           C  
ATOM  11071  NE  ARG B 570      55.687  82.296 103.977  1.00  0.89           N  
ATOM  11072  CZ  ARG B 570      54.882  81.333 104.446  1.00  0.89           C  
ATOM  11073  NH1 ARG B 570      53.566  81.480 104.424  1.00  0.89           N  
ATOM  11074  NH2 ARG B 570      55.403  80.219 104.953  1.00  0.89           N  
ATOM  11075  N   ILE B 571      59.752  83.358 101.899  1.00  0.96           N  
ATOM  11076  CA  ILE B 571      61.146  82.977 101.699  1.00  0.96           C  
ATOM  11077  C   ILE B 571      61.256  81.581 101.114  1.00  0.96           C  
ATOM  11078  O   ILE B 571      60.756  80.609 101.676  1.00  0.96           O  
ATOM  11079  CB  ILE B 571      62.000  83.094 102.958  1.00  0.96           C  
ATOM  11080  CG1 ILE B 571      61.816  84.462 103.662  1.00  0.96           C  
ATOM  11081  CG2 ILE B 571      63.493  82.847 102.635  1.00  0.96           C  
ATOM  11082  CD1 ILE B 571      62.207  85.701 102.843  1.00  0.96           C  
ATOM  11083  N   HIS B 572      61.898  81.470  99.937  1.00  0.93           N  
ATOM  11084  CA  HIS B 572      61.971  80.231  99.195  1.00  0.93           C  
ATOM  11085  C   HIS B 572      63.209  80.206  98.339  1.00  0.93           C  
ATOM  11086  O   HIS B 572      63.604  81.213  97.752  1.00  0.93           O  
ATOM  11087  CB  HIS B 572      60.796  80.120  98.194  1.00  0.93           C  
ATOM  11088  CG  HIS B 572      59.596  79.419  98.713  1.00  0.93           C  
ATOM  11089  ND1 HIS B 572      59.561  78.038  98.672  1.00  0.93           N  
ATOM  11090  CD2 HIS B 572      58.410  79.918  99.142  1.00  0.93           C  
ATOM  11091  CE1 HIS B 572      58.346  77.720  99.085  1.00  0.93           C  
ATOM  11092  NE2 HIS B 572      57.615  78.824  99.376  1.00  0.93           N  
ATOM  11093  N   GLU B 573      63.796  79.012  98.149  1.00  0.94           N  
ATOM  11094  CA  GLU B 573      64.880  78.796  97.212  1.00  0.94           C  
ATOM  11095  C   GLU B 573      64.493  79.133  95.775  1.00  0.94           C  
ATOM  11096  O   GLU B 573      65.242  79.803  95.070  1.00  0.94           O  
ATOM  11097  CB  GLU B 573      65.366  77.336  97.303  1.00  0.94           C  
ATOM  11098  CG  GLU B 573      65.944  76.973  98.689  1.00  0.94           C  
ATOM  11099  CD  GLU B 573      66.226  75.477  98.781  1.00  0.94           C  
ATOM  11100  OE1 GLU B 573      67.396  75.085  98.556  1.00  0.94           O  
ATOM  11101  OE2 GLU B 573      65.277  74.717  99.096  1.00  0.94           O  
ATOM  11102  N   TYR B 574      63.274  78.747  95.325  1.00  0.89           N  
ATOM  11103  CA  TYR B 574      62.764  79.081  93.998  1.00  0.89           C  
ATOM  11104  C   TYR B 574      62.611  80.575  93.711  1.00  0.89           C  
ATOM  11105  O   TYR B 574      62.902  81.045  92.612  1.00  0.89           O  
ATOM  11106  CB  TYR B 574      61.463  78.282  93.643  1.00  0.89           C  
ATOM  11107  CG  TYR B 574      60.120  78.893  94.021  1.00  0.89           C  
ATOM  11108  CD1 TYR B 574      59.487  79.795  93.143  1.00  0.89           C  
ATOM  11109  CD2 TYR B 574      59.431  78.499  95.180  1.00  0.89           C  
ATOM  11110  CE1 TYR B 574      58.183  80.244  93.386  1.00  0.89           C  
ATOM  11111  CE2 TYR B 574      58.116  78.937  95.419  1.00  0.89           C  
ATOM  11112  CZ  TYR B 574      57.481  79.784  94.500  1.00  0.89           C  
ATOM  11113  OH  TYR B 574      56.144  80.202  94.684  1.00  0.89           O  
ATOM  11114  N   LYS B 575      62.149  81.360  94.711  1.00  0.91           N  
ATOM  11115  CA  LYS B 575      61.947  82.795  94.591  1.00  0.91           C  
ATOM  11116  C   LYS B 575      63.250  83.575  94.669  1.00  0.91           C  
ATOM  11117  O   LYS B 575      63.321  84.705  94.195  1.00  0.91           O  
ATOM  11118  CB  LYS B 575      60.978  83.308  95.685  1.00  0.91           C  
ATOM  11119  CG  LYS B 575      59.529  82.840  95.467  1.00  0.91           C  
ATOM  11120  CD  LYS B 575      58.602  83.197  96.640  1.00  0.91           C  
ATOM  11121  CE  LYS B 575      57.178  82.641  96.551  1.00  0.91           C  
ATOM  11122  NZ  LYS B 575      56.524  83.085  95.319  1.00  0.91           N  
ATOM  11123  N   ARG B 576      64.318  82.954  95.214  1.00  0.93           N  
ATOM  11124  CA  ARG B 576      65.691  83.399  95.068  1.00  0.93           C  
ATOM  11125  C   ARG B 576      66.053  84.682  95.804  1.00  0.93           C  
ATOM  11126  O   ARG B 576      66.835  85.500  95.317  1.00  0.93           O  
ATOM  11127  CB  ARG B 576      66.131  83.451  93.579  1.00  0.93           C  
ATOM  11128  CG  ARG B 576      66.268  82.070  92.907  1.00  0.93           C  
ATOM  11129  CD  ARG B 576      66.103  82.170  91.392  1.00  0.93           C  
ATOM  11130  NE  ARG B 576      67.281  81.600  90.667  1.00  0.93           N  
ATOM  11131  CZ  ARG B 576      67.552  81.957  89.411  1.00  0.93           C  
ATOM  11132  NH1 ARG B 576      66.938  82.960  88.792  1.00  0.93           N  
ATOM  11133  NH2 ARG B 576      68.448  81.297  88.690  1.00  0.93           N  
ATOM  11134  N   GLN B 577      65.620  84.831  97.080  1.00  0.96           N  
ATOM  11135  CA  GLN B 577      66.113  85.884  97.967  1.00  0.96           C  
ATOM  11136  C   GLN B 577      67.629  85.818  98.127  1.00  0.96           C  
ATOM  11137  O   GLN B 577      68.315  86.832  98.220  1.00  0.96           O  
ATOM  11138  CB  GLN B 577      65.444  85.891  99.369  1.00  0.96           C  
ATOM  11139  CG  GLN B 577      63.943  86.275  99.357  1.00  0.96           C  
ATOM  11140  CD  GLN B 577      63.009  85.094  99.092  1.00  0.96           C  
ATOM  11141  OE1 GLN B 577      63.401  83.937  98.953  1.00  0.96           O  
ATOM  11142  NE2 GLN B 577      61.692  85.396  99.075  1.00  0.96           N  
ATOM  11143  N   LEU B 578      68.189  84.596  98.071  1.00  0.97           N  
ATOM  11144  CA  LEU B 578      69.609  84.305  98.013  1.00  0.97           C  
ATOM  11145  C   LEU B 578      70.357  84.971  96.846  1.00  0.97           C  
ATOM  11146  O   LEU B 578      71.441  85.509  97.041  1.00  0.97           O  
ATOM  11147  CB  LEU B 578      69.778  82.763  97.967  1.00  0.97           C  
ATOM  11148  CG  LEU B 578      71.184  82.206  98.282  1.00  0.97           C  
ATOM  11149  CD1 LEU B 578      71.726  82.708  99.627  1.00  0.97           C  
ATOM  11150  CD2 LEU B 578      71.120  80.671  98.309  1.00  0.97           C  
ATOM  11151  N   LEU B 579      69.790  85.015  95.615  1.00  0.98           N  
ATOM  11152  CA  LEU B 579      70.377  85.676  94.444  1.00  0.98           C  
ATOM  11153  C   LEU B 579      70.503  87.201  94.626  1.00  0.98           C  
ATOM  11154  O   LEU B 579      71.541  87.807  94.354  1.00  0.98           O  
ATOM  11155  CB  LEU B 579      69.522  85.329  93.188  1.00  0.98           C  
ATOM  11156  CG  LEU B 579      70.198  85.234  91.791  1.00  0.98           C  
ATOM  11157  CD1 LEU B 579      69.272  85.811  90.706  1.00  0.98           C  
ATOM  11158  CD2 LEU B 579      71.598  85.847  91.666  1.00  0.98           C  
ATOM  11159  N   ASN B 580      69.451  87.847  95.186  1.00  0.99           N  
ATOM  11160  CA  ASN B 580      69.424  89.240  95.624  1.00  0.99           C  
ATOM  11161  C   ASN B 580      70.461  89.509  96.699  1.00  0.99           C  
ATOM  11162  O   ASN B 580      71.176  90.502  96.636  1.00  0.99           O  
ATOM  11163  CB  ASN B 580      67.999  89.561  96.153  1.00  0.99           C  
ATOM  11164  CG  ASN B 580      67.595  91.022  96.407  1.00  0.99           C  
ATOM  11165  OD1 ASN B 580      66.519  91.214  96.980  1.00  0.99           O  
ATOM  11166  ND2 ASN B 580      68.394  92.031  96.008  1.00  0.99           N  
ATOM  11167  N   CYS B 581      70.605  88.586  97.668  1.00  0.98           N  
ATOM  11168  CA  CYS B 581      71.604  88.642  98.716  1.00  0.98           C  
ATOM  11169  C   CYS B 581      73.031  88.643  98.188  1.00  0.98           C  
ATOM  11170  O   CYS B 581      73.866  89.426  98.637  1.00  0.98           O  
ATOM  11171  CB  CYS B 581      71.420  87.464  99.696  1.00  0.98           C  
ATOM  11172  SG  CYS B 581      71.750  87.981 101.357  1.00  0.98           S  
ATOM  11173  N   LEU B 582      73.336  87.816  97.160  1.00  0.97           N  
ATOM  11174  CA  LEU B 582      74.635  87.824  96.498  1.00  0.97           C  
ATOM  11175  C   LEU B 582      74.956  89.180  95.877  1.00  0.97           C  
ATOM  11176  O   LEU B 582      76.035  89.727  96.080  1.00  0.97           O  
ATOM  11177  CB  LEU B 582      74.756  86.753  95.372  1.00  0.97           C  
ATOM  11178  CG  LEU B 582      74.553  85.275  95.777  1.00  0.97           C  
ATOM  11179  CD1 LEU B 582      74.892  84.343  94.602  1.00  0.97           C  
ATOM  11180  CD2 LEU B 582      75.378  84.860  97.003  1.00  0.97           C  
ATOM  11181  N   HIS B 583      73.985  89.796  95.171  1.00  0.96           N  
ATOM  11182  CA  HIS B 583      74.113  91.138  94.614  1.00  0.96           C  
ATOM  11183  C   HIS B 583      74.357  92.242  95.639  1.00  0.96           C  
ATOM  11184  O   HIS B 583      75.178  93.127  95.405  1.00  0.96           O  
ATOM  11185  CB  HIS B 583      72.873  91.502  93.769  1.00  0.96           C  
ATOM  11186  CG  HIS B 583      72.884  92.891  93.205  1.00  0.96           C  
ATOM  11187  ND1 HIS B 583      71.920  93.778  93.624  1.00  0.96           N  
ATOM  11188  CD2 HIS B 583      73.728  93.492  92.327  1.00  0.96           C  
ATOM  11189  CE1 HIS B 583      72.185  94.904  92.999  1.00  0.96           C  
ATOM  11190  NE2 HIS B 583      73.273  94.785  92.200  1.00  0.96           N  
ATOM  11191  N   VAL B 584      73.699  92.210  96.817  1.00  0.97           N  
ATOM  11192  CA  VAL B 584      73.943  93.152  97.911  1.00  0.97           C  
ATOM  11193  C   VAL B 584      75.396  93.107  98.385  1.00  0.97           C  
ATOM  11194  O   VAL B 584      76.044  94.137  98.586  1.00  0.97           O  
ATOM  11195  CB  VAL B 584      73.016  92.859  99.092  1.00  0.97           C  
ATOM  11196  CG1 VAL B 584      73.331  93.748 100.312  1.00  0.97           C  
ATOM  11197  CG2 VAL B 584      71.557  93.116  98.673  1.00  0.97           C  
ATOM  11198  N   ILE B 585      75.963  91.889  98.518  1.00  0.96           N  
ATOM  11199  CA  ILE B 585      77.373  91.661  98.820  1.00  0.96           C  
ATOM  11200  C   ILE B 585      78.287  92.183  97.711  1.00  0.96           C  
ATOM  11201  O   ILE B 585      79.299  92.834  97.977  1.00  0.96           O  
ATOM  11202  CB  ILE B 585      77.673  90.185  99.091  1.00  0.96           C  
ATOM  11203  CG1 ILE B 585      76.806  89.617 100.238  1.00  0.96           C  
ATOM  11204  CG2 ILE B 585      79.170  90.009  99.428  1.00  0.96           C  
ATOM  11205  CD1 ILE B 585      76.728  88.085 100.217  1.00  0.96           C  
ATOM  11206  N   THR B 586      77.936  91.966  96.422  1.00  0.94           N  
ATOM  11207  CA  THR B 586      78.677  92.496  95.269  1.00  0.94           C  
ATOM  11208  C   THR B 586      78.740  94.012  95.280  1.00  0.94           C  
ATOM  11209  O   THR B 586      79.794  94.613  95.077  1.00  0.94           O  
ATOM  11210  CB  THR B 586      78.110  92.081  93.910  1.00  0.94           C  
ATOM  11211  OG1 THR B 586      77.824  90.696  93.915  1.00  0.94           O  
ATOM  11212  CG2 THR B 586      79.117  92.331  92.778  1.00  0.94           C  
ATOM  11213  N   LEU B 587      77.614  94.693  95.585  1.00  0.94           N  
ATOM  11214  CA  LEU B 587      77.578  96.137  95.752  1.00  0.94           C  
ATOM  11215  C   LEU B 587      78.449  96.641  96.897  1.00  0.94           C  
ATOM  11216  O   LEU B 587      79.183  97.614  96.739  1.00  0.94           O  
ATOM  11217  CB  LEU B 587      76.136  96.656  95.963  1.00  0.94           C  
ATOM  11218  CG  LEU B 587      75.179  96.453  94.769  1.00  0.94           C  
ATOM  11219  CD1 LEU B 587      73.799  97.033  95.113  1.00  0.94           C  
ATOM  11220  CD2 LEU B 587      75.699  97.067  93.459  1.00  0.94           C  
ATOM  11221  N   TYR B 588      78.427  95.956  98.059  1.00  0.94           N  
ATOM  11222  CA  TYR B 588      79.284  96.237  99.202  1.00  0.94           C  
ATOM  11223  C   TYR B 588      80.773  96.121  98.856  1.00  0.94           C  
ATOM  11224  O   TYR B 588      81.550  97.041  99.113  1.00  0.94           O  
ATOM  11225  CB  TYR B 588      78.877  95.266 100.358  1.00  0.94           C  
ATOM  11226  CG  TYR B 588      79.809  95.284 101.549  1.00  0.94           C  
ATOM  11227  CD1 TYR B 588      79.794  96.355 102.456  1.00  0.94           C  
ATOM  11228  CD2 TYR B 588      80.736  94.242 101.739  1.00  0.94           C  
ATOM  11229  CE1 TYR B 588      80.699  96.397 103.528  1.00  0.94           C  
ATOM  11230  CE2 TYR B 588      81.637  94.277 102.813  1.00  0.94           C  
ATOM  11231  CZ  TYR B 588      81.623  95.360 103.699  1.00  0.94           C  
ATOM  11232  OH  TYR B 588      82.554  95.418 104.752  1.00  0.94           O  
ATOM  11233  N   ASN B 589      81.193  95.023  98.193  1.00  0.92           N  
ATOM  11234  CA  ASN B 589      82.565  94.826  97.746  1.00  0.92           C  
ATOM  11235  C   ASN B 589      83.010  95.897  96.750  1.00  0.92           C  
ATOM  11236  O   ASN B 589      84.113  96.428  96.848  1.00  0.92           O  
ATOM  11237  CB  ASN B 589      82.761  93.404  97.155  1.00  0.92           C  
ATOM  11238  CG  ASN B 589      82.710  92.378  98.284  1.00  0.92           C  
ATOM  11239  OD1 ASN B 589      83.160  92.626  99.405  1.00  0.92           O  
ATOM  11240  ND2 ASN B 589      82.172  91.176  97.988  1.00  0.92           N  
ATOM  11241  N   ARG B 590      82.147  96.311  95.800  1.00  0.86           N  
ATOM  11242  CA  ARG B 590      82.422  97.423  94.905  1.00  0.86           C  
ATOM  11243  C   ARG B 590      82.707  98.759  95.593  1.00  0.86           C  
ATOM  11244  O   ARG B 590      83.639  99.455  95.191  1.00  0.86           O  
ATOM  11245  CB  ARG B 590      81.269  97.613  93.878  1.00  0.86           C  
ATOM  11246  CG  ARG B 590      81.174  96.484  92.826  1.00  0.86           C  
ATOM  11247  CD  ARG B 590      79.902  96.542  91.970  1.00  0.86           C  
ATOM  11248  NE  ARG B 590      79.989  95.455  90.946  1.00  0.86           N  
ATOM  11249  CZ  ARG B 590      79.259  95.410  89.830  1.00  0.86           C  
ATOM  11250  NH1 ARG B 590      78.356  96.306  89.491  1.00  0.86           N  
ATOM  11251  NH2 ARG B 590      79.450  94.454  88.936  1.00  0.86           N  
ATOM  11252  N   ILE B 591      81.934  99.132  96.636  1.00  0.91           N  
ATOM  11253  CA  ILE B 591      82.142 100.336  97.445  1.00  0.91           C  
ATOM  11254  C   ILE B 591      83.442 100.288  98.239  1.00  0.91           C  
ATOM  11255  O   ILE B 591      84.194 101.258  98.282  1.00  0.91           O  
ATOM  11256  CB  ILE B 591      80.961 100.588  98.391  1.00  0.91           C  
ATOM  11257  CG1 ILE B 591      79.654 100.759  97.581  1.00  0.91           C  
ATOM  11258  CG2 ILE B 591      81.194 101.845  99.266  1.00  0.91           C  
ATOM  11259  CD1 ILE B 591      78.388 100.604  98.431  1.00  0.91           C  
ATOM  11260  N   LYS B 592      83.764  99.138  98.872  1.00  0.88           N  
ATOM  11261  CA  LYS B 592      85.010  98.944  99.604  1.00  0.88           C  
ATOM  11262  C   LYS B 592      86.248  99.025  98.711  1.00  0.88           C  
ATOM  11263  O   LYS B 592      87.260  99.586  99.117  1.00  0.88           O  
ATOM  11264  CB  LYS B 592      84.988  97.624 100.427  1.00  0.88           C  
ATOM  11265  CG  LYS B 592      83.855  97.555 101.476  1.00  0.88           C  
ATOM  11266  CD  LYS B 592      83.968  98.546 102.653  1.00  0.88           C  
ATOM  11267  CE  LYS B 592      85.015  98.144 103.695  1.00  0.88           C  
ATOM  11268  NZ  LYS B 592      84.939  99.030 104.864  1.00  0.88           N  
ATOM  11269  N   ARG B 593      86.197  98.498  97.465  1.00  0.83           N  
ATOM  11270  CA  ARG B 593      87.283  98.619  96.496  1.00  0.83           C  
ATOM  11271  C   ARG B 593      87.625 100.057  96.079  1.00  0.83           C  
ATOM  11272  O   ARG B 593      88.797 100.421  96.017  1.00  0.83           O  
ATOM  11273  CB  ARG B 593      86.947  97.816  95.205  1.00  0.83           C  
ATOM  11274  CG  ARG B 593      88.092  97.747  94.162  1.00  0.83           C  
ATOM  11275  CD  ARG B 593      87.714  97.169  92.785  1.00  0.83           C  
ATOM  11276  NE  ARG B 593      86.698  98.076  92.147  1.00  0.83           N  
ATOM  11277  CZ  ARG B 593      85.381  97.855  92.118  1.00  0.83           C  
ATOM  11278  NH1 ARG B 593      84.587  98.856  91.764  1.00  0.83           N  
ATOM  11279  NH2 ARG B 593      84.831  96.708  92.464  1.00  0.83           N  
ATOM  11280  N   GLU B 594      86.620 100.913  95.780  1.00  0.81           N  
ATOM  11281  CA  GLU B 594      86.849 102.274  95.297  1.00  0.81           C  
ATOM  11282  C   GLU B 594      85.923 103.265  96.028  1.00  0.81           C  
ATOM  11283  O   GLU B 594      84.860 103.588  95.493  1.00  0.81           O  
ATOM  11284  CB  GLU B 594      86.550 102.410  93.764  1.00  0.81           C  
ATOM  11285  CG  GLU B 594      87.522 101.707  92.772  1.00  0.81           C  
ATOM  11286  CD  GLU B 594      86.999 101.673  91.332  1.00  0.81           C  
ATOM  11287  OE1 GLU B 594      87.368 102.535  90.504  1.00  0.81           O  
ATOM  11288  OE2 GLU B 594      86.154 100.776  91.028  1.00  0.81           O  
ATOM  11289  N   PRO B 595      86.243 103.821  97.206  1.00  0.87           N  
ATOM  11290  CA  PRO B 595      85.253 104.517  98.043  1.00  0.87           C  
ATOM  11291  C   PRO B 595      84.724 105.823  97.481  1.00  0.87           C  
ATOM  11292  O   PRO B 595      83.627 106.247  97.842  1.00  0.87           O  
ATOM  11293  CB  PRO B 595      85.994 104.765  99.369  1.00  0.87           C  
ATOM  11294  CG  PRO B 595      86.990 103.607  99.447  1.00  0.87           C  
ATOM  11295  CD  PRO B 595      87.416 103.421  97.991  1.00  0.87           C  
ATOM  11296  N   ASN B 596      85.507 106.507  96.629  1.00  0.77           N  
ATOM  11297  CA  ASN B 596      85.149 107.811  96.098  1.00  0.77           C  
ATOM  11298  C   ASN B 596      84.558 107.689  94.706  1.00  0.77           C  
ATOM  11299  O   ASN B 596      84.292 108.686  94.039  1.00  0.77           O  
ATOM  11300  CB  ASN B 596      86.396 108.727  96.038  1.00  0.77           C  
ATOM  11301  CG  ASN B 596      86.822 109.086  97.456  1.00  0.77           C  
ATOM  11302  OD1 ASN B 596      86.020 109.194  98.381  1.00  0.77           O  
ATOM  11303  ND2 ASN B 596      88.144 109.295  97.645  1.00  0.77           N  
ATOM  11304  N   LYS B 597      84.322 106.456  94.225  1.00  0.79           N  
ATOM  11305  CA  LYS B 597      83.631 106.235  92.977  1.00  0.79           C  
ATOM  11306  C   LYS B 597      82.146 106.571  93.058  1.00  0.79           C  
ATOM  11307  O   LYS B 597      81.501 106.429  94.096  1.00  0.79           O  
ATOM  11308  CB  LYS B 597      83.830 104.780  92.508  1.00  0.79           C  
ATOM  11309  CG  LYS B 597      83.478 104.540  91.035  1.00  0.79           C  
ATOM  11310  CD  LYS B 597      83.774 103.097  90.630  1.00  0.79           C  
ATOM  11311  CE  LYS B 597      83.528 102.821  89.153  1.00  0.79           C  
ATOM  11312  NZ  LYS B 597      83.978 101.450  88.846  1.00  0.79           N  
ATOM  11313  N   PHE B 598      81.555 107.030  91.937  1.00  0.81           N  
ATOM  11314  CA  PHE B 598      80.124 107.228  91.817  1.00  0.81           C  
ATOM  11315  C   PHE B 598      79.329 105.938  92.054  1.00  0.81           C  
ATOM  11316  O   PHE B 598      79.535 104.913  91.404  1.00  0.81           O  
ATOM  11317  CB  PHE B 598      79.790 107.841  90.423  1.00  0.81           C  
ATOM  11318  CG  PHE B 598      78.335 108.224  90.299  1.00  0.81           C  
ATOM  11319  CD1 PHE B 598      77.457 107.443  89.526  1.00  0.81           C  
ATOM  11320  CD2 PHE B 598      77.826 109.331  90.998  1.00  0.81           C  
ATOM  11321  CE1 PHE B 598      76.091 107.750  89.469  1.00  0.81           C  
ATOM  11322  CE2 PHE B 598      76.460 109.642  90.944  1.00  0.81           C  
ATOM  11323  CZ  PHE B 598      75.592 108.847  90.185  1.00  0.81           C  
ATOM  11324  N   PHE B 599      78.381 106.000  93.003  1.00  0.87           N  
ATOM  11325  CA  PHE B 599      77.523 104.903  93.382  1.00  0.87           C  
ATOM  11326  C   PHE B 599      76.128 105.479  93.529  1.00  0.87           C  
ATOM  11327  O   PHE B 599      75.933 106.533  94.131  1.00  0.87           O  
ATOM  11328  CB  PHE B 599      77.988 104.270  94.727  1.00  0.87           C  
ATOM  11329  CG  PHE B 599      77.258 102.981  95.023  1.00  0.87           C  
ATOM  11330  CD1 PHE B 599      76.160 102.961  95.901  1.00  0.87           C  
ATOM  11331  CD2 PHE B 599      77.650 101.782  94.403  1.00  0.87           C  
ATOM  11332  CE1 PHE B 599      75.460 101.774  96.148  1.00  0.87           C  
ATOM  11333  CE2 PHE B 599      76.953 100.591  94.647  1.00  0.87           C  
ATOM  11334  CZ  PHE B 599      75.854 100.591  95.514  1.00  0.87           C  
ATOM  11335  N   VAL B 600      75.115 104.802  92.962  1.00  0.92           N  
ATOM  11336  CA  VAL B 600      73.735 105.244  93.040  1.00  0.92           C  
ATOM  11337  C   VAL B 600      73.132 104.715  94.335  1.00  0.92           C  
ATOM  11338  O   VAL B 600      73.148 103.497  94.528  1.00  0.92           O  
ATOM  11339  CB  VAL B 600      72.918 104.771  91.844  1.00  0.92           C  
ATOM  11340  CG1 VAL B 600      71.458 105.263  91.936  1.00  0.92           C  
ATOM  11341  CG2 VAL B 600      73.572 105.324  90.563  1.00  0.92           C  
ATOM  11342  N   PRO B 601      72.630 105.526  95.271  1.00  0.95           N  
ATOM  11343  CA  PRO B 601      72.353 105.040  96.613  1.00  0.95           C  
ATOM  11344  C   PRO B 601      71.130 104.152  96.670  1.00  0.95           C  
ATOM  11345  O   PRO B 601      70.117 104.454  96.042  1.00  0.95           O  
ATOM  11346  CB  PRO B 601      72.181 106.319  97.459  1.00  0.95           C  
ATOM  11347  CG  PRO B 601      71.851 107.412  96.440  1.00  0.95           C  
ATOM  11348  CD  PRO B 601      72.683 106.986  95.235  1.00  0.95           C  
ATOM  11349  N   ARG B 602      71.198 103.053  97.439  1.00  0.91           N  
ATOM  11350  CA  ARG B 602      70.109 102.106  97.563  1.00  0.91           C  
ATOM  11351  C   ARG B 602      69.757 101.804  99.009  1.00  0.91           C  
ATOM  11352  O   ARG B 602      70.604 101.695  99.893  1.00  0.91           O  
ATOM  11353  CB  ARG B 602      70.399 100.755  96.863  1.00  0.91           C  
ATOM  11354  CG  ARG B 602      70.464 100.825  95.323  1.00  0.91           C  
ATOM  11355  CD  ARG B 602      70.495  99.430  94.697  1.00  0.91           C  
ATOM  11356  NE  ARG B 602      70.477  99.560  93.205  1.00  0.91           N  
ATOM  11357  CZ  ARG B 602      70.101  98.562  92.393  1.00  0.91           C  
ATOM  11358  NH1 ARG B 602      69.578  97.424  92.835  1.00  0.91           N  
ATOM  11359  NH2 ARG B 602      70.294  98.689  91.079  1.00  0.91           N  
ATOM  11360  N   THR B 603      68.452 101.608  99.256  1.00  0.95           N  
ATOM  11361  CA  THR B 603      67.948 100.975 100.467  1.00  0.95           C  
ATOM  11362  C   THR B 603      67.412  99.643 100.008  1.00  0.95           C  
ATOM  11363  O   THR B 603      66.399  99.597  99.315  1.00  0.95           O  
ATOM  11364  CB  THR B 603      66.821 101.743 101.151  1.00  0.95           C  
ATOM  11365  OG1 THR B 603      67.301 103.003 101.600  1.00  0.95           O  
ATOM  11366  CG2 THR B 603      66.336 101.006 102.407  1.00  0.95           C  
ATOM  11367  N   VAL B 604      68.086  98.526 100.354  1.00  0.97           N  
ATOM  11368  CA  VAL B 604      67.677  97.194  99.921  1.00  0.97           C  
ATOM  11369  C   VAL B 604      66.856  96.556 101.013  1.00  0.97           C  
ATOM  11370  O   VAL B 604      67.283  96.404 102.156  1.00  0.97           O  
ATOM  11371  CB  VAL B 604      68.812  96.247  99.529  1.00  0.97           C  
ATOM  11372  CG1 VAL B 604      68.216  94.933  98.969  1.00  0.97           C  
ATOM  11373  CG2 VAL B 604      69.683  96.913  98.448  1.00  0.97           C  
ATOM  11374  N   MET B 605      65.619  96.178 100.680  1.00  0.94           N  
ATOM  11375  CA  MET B 605      64.674  95.642 101.617  1.00  0.94           C  
ATOM  11376  C   MET B 605      64.231  94.274 101.166  1.00  0.94           C  
ATOM  11377  O   MET B 605      63.630  94.093 100.109  1.00  0.94           O  
ATOM  11378  CB  MET B 605      63.439  96.551 101.762  1.00  0.94           C  
ATOM  11379  CG  MET B 605      63.772  97.982 102.226  1.00  0.94           C  
ATOM  11380  SD  MET B 605      62.322  98.989 102.614  1.00  0.94           S  
ATOM  11381  CE  MET B 605      61.894  98.020 104.087  1.00  0.94           C  
ATOM  11382  N   ILE B 606      64.510  93.259 101.990  1.00  0.97           N  
ATOM  11383  CA  ILE B 606      64.094  91.897 101.726  1.00  0.97           C  
ATOM  11384  C   ILE B 606      63.206  91.511 102.883  1.00  0.97           C  
ATOM  11385  O   ILE B 606      63.558  91.697 104.039  1.00  0.97           O  
ATOM  11386  CB  ILE B 606      65.272  90.942 101.551  1.00  0.97           C  
ATOM  11387  CG1 ILE B 606      66.217  91.500 100.456  1.00  0.97           C  
ATOM  11388  CG2 ILE B 606      64.738  89.546 101.156  1.00  0.97           C  
ATOM  11389  CD1 ILE B 606      67.546  90.755 100.311  1.00  0.97           C  
ATOM  11390  N   GLY B 607      61.984  91.023 102.638  1.00  0.99           N  
ATOM  11391  CA  GLY B 607      61.071  90.715 103.733  1.00  0.99           C  
ATOM  11392  C   GLY B 607      60.214  89.546 103.398  1.00  0.99           C  
ATOM  11393  O   GLY B 607      59.882  89.299 102.243  1.00  0.99           O  
ATOM  11394  N   GLY B 608      59.806  88.777 104.414  1.00  0.99           N  
ATOM  11395  CA  GLY B 608      59.077  87.557 104.136  1.00  0.99           C  
ATOM  11396  C   GLY B 608      59.181  86.568 105.243  1.00  0.99           C  
ATOM  11397  O   GLY B 608      60.128  86.551 106.018  1.00  0.99           O  
ATOM  11398  N   LYS B 609      58.183  85.681 105.332  1.00  0.93           N  
ATOM  11399  CA  LYS B 609      58.152  84.621 106.316  1.00  0.93           C  
ATOM  11400  C   LYS B 609      58.640  83.308 105.716  1.00  0.93           C  
ATOM  11401  O   LYS B 609      58.304  82.945 104.587  1.00  0.93           O  
ATOM  11402  CB  LYS B 609      56.725  84.471 106.902  1.00  0.93           C  
ATOM  11403  CG  LYS B 609      56.254  85.728 107.654  1.00  0.93           C  
ATOM  11404  CD  LYS B 609      54.819  85.604 108.198  1.00  0.93           C  
ATOM  11405  CE  LYS B 609      54.386  86.866 108.951  1.00  0.93           C  
ATOM  11406  NZ  LYS B 609      52.984  86.786 109.409  1.00  0.93           N  
ATOM  11407  N   ALA B 610      59.459  82.553 106.467  1.00  0.95           N  
ATOM  11408  CA  ALA B 610      59.885  81.218 106.106  1.00  0.95           C  
ATOM  11409  C   ALA B 610      58.971  80.212 106.790  1.00  0.95           C  
ATOM  11410  O   ALA B 610      58.496  80.448 107.897  1.00  0.95           O  
ATOM  11411  CB  ALA B 610      61.347  81.005 106.548  1.00  0.95           C  
ATOM  11412  N   ALA B 611      58.654  79.058 106.161  1.00  0.89           N  
ATOM  11413  CA  ALA B 611      57.920  78.013 106.861  1.00  0.89           C  
ATOM  11414  C   ALA B 611      58.737  77.456 108.045  1.00  0.89           C  
ATOM  11415  O   ALA B 611      59.945  77.283 107.872  1.00  0.89           O  
ATOM  11416  CB  ALA B 611      57.483  76.884 105.905  1.00  0.89           C  
ATOM  11417  N   PRO B 612      58.212  77.168 109.242  1.00  0.88           N  
ATOM  11418  CA  PRO B 612      59.037  76.903 110.419  1.00  0.88           C  
ATOM  11419  C   PRO B 612      59.959  75.707 110.309  1.00  0.88           C  
ATOM  11420  O   PRO B 612      61.022  75.744 110.927  1.00  0.88           O  
ATOM  11421  CB  PRO B 612      58.028  76.748 111.562  1.00  0.88           C  
ATOM  11422  CG  PRO B 612      56.905  77.695 111.148  1.00  0.88           C  
ATOM  11423  CD  PRO B 612      56.847  77.509 109.634  1.00  0.88           C  
ATOM  11424  N   GLY B 613      59.561  74.657 109.553  1.00  0.83           N  
ATOM  11425  CA  GLY B 613      60.391  73.487 109.265  1.00  0.83           C  
ATOM  11426  C   GLY B 613      61.345  73.642 108.096  1.00  0.83           C  
ATOM  11427  O   GLY B 613      62.141  72.752 107.811  1.00  0.83           O  
ATOM  11428  N   TYR B 614      61.304  74.771 107.363  1.00  0.88           N  
ATOM  11429  CA  TYR B 614      62.085  74.982 106.153  1.00  0.88           C  
ATOM  11430  C   TYR B 614      63.440  75.564 106.511  1.00  0.88           C  
ATOM  11431  O   TYR B 614      63.652  76.776 106.550  1.00  0.88           O  
ATOM  11432  CB  TYR B 614      61.291  75.924 105.204  1.00  0.88           C  
ATOM  11433  CG  TYR B 614      61.734  76.076 103.758  1.00  0.88           C  
ATOM  11434  CD1 TYR B 614      62.892  75.523 103.166  1.00  0.88           C  
ATOM  11435  CD2 TYR B 614      60.887  76.852 102.951  1.00  0.88           C  
ATOM  11436  CE1 TYR B 614      63.170  75.737 101.799  1.00  0.88           C  
ATOM  11437  CE2 TYR B 614      61.157  77.057 101.596  1.00  0.88           C  
ATOM  11438  CZ  TYR B 614      62.290  76.493 101.011  1.00  0.88           C  
ATOM  11439  OH  TYR B 614      62.515  76.702  99.632  1.00  0.88           O  
ATOM  11440  N   HIS B 615      64.408  74.664 106.771  1.00  0.88           N  
ATOM  11441  CA  HIS B 615      65.741  74.995 107.243  1.00  0.88           C  
ATOM  11442  C   HIS B 615      66.490  75.948 106.328  1.00  0.88           C  
ATOM  11443  O   HIS B 615      66.984  76.984 106.759  1.00  0.88           O  
ATOM  11444  CB  HIS B 615      66.555  73.685 107.382  1.00  0.88           C  
ATOM  11445  CG  HIS B 615      67.947  73.880 107.881  1.00  0.88           C  
ATOM  11446  ND1 HIS B 615      68.146  74.387 109.147  1.00  0.88           N  
ATOM  11447  CD2 HIS B 615      69.133  73.655 107.262  1.00  0.88           C  
ATOM  11448  CE1 HIS B 615      69.460  74.457 109.278  1.00  0.88           C  
ATOM  11449  NE2 HIS B 615      70.098  74.027 108.166  1.00  0.88           N  
ATOM  11450  N   MET B 616      66.518  75.666 105.012  1.00  0.92           N  
ATOM  11451  CA  MET B 616      67.233  76.471 104.043  1.00  0.92           C  
ATOM  11452  C   MET B 616      66.718  77.908 103.923  1.00  0.92           C  
ATOM  11453  O   MET B 616      67.490  78.865 103.887  1.00  0.92           O  
ATOM  11454  CB  MET B 616      67.255  75.710 102.698  1.00  0.92           C  
ATOM  11455  CG  MET B 616      68.245  76.258 101.658  1.00  0.92           C  
ATOM  11456  SD  MET B 616      69.961  76.387 102.251  1.00  0.92           S  
ATOM  11457  CE  MET B 616      70.073  78.102 101.695  1.00  0.92           C  
ATOM  11458  N   ALA B 617      65.387  78.115 103.953  1.00  0.96           N  
ATOM  11459  CA  ALA B 617      64.785  79.432 104.038  1.00  0.96           C  
ATOM  11460  C   ALA B 617      65.141  80.209 105.307  1.00  0.96           C  
ATOM  11461  O   ALA B 617      65.439  81.402 105.258  1.00  0.96           O  
ATOM  11462  CB  ALA B 617      63.260  79.285 103.938  1.00  0.96           C  
ATOM  11463  N   LYS B 618      65.162  79.545 106.483  1.00  0.91           N  
ATOM  11464  CA  LYS B 618      65.653  80.132 107.722  1.00  0.91           C  
ATOM  11465  C   LYS B 618      67.130  80.518 107.658  1.00  0.91           C  
ATOM  11466  O   LYS B 618      67.508  81.610 108.080  1.00  0.91           O  
ATOM  11467  CB  LYS B 618      65.366  79.213 108.939  1.00  0.91           C  
ATOM  11468  CG  LYS B 618      63.869  79.178 109.285  1.00  0.91           C  
ATOM  11469  CD  LYS B 618      63.512  78.375 110.550  1.00  0.91           C  
ATOM  11470  CE  LYS B 618      62.277  78.981 111.227  1.00  0.91           C  
ATOM  11471  NZ  LYS B 618      61.761  78.183 112.361  1.00  0.91           N  
ATOM  11472  N   MET B 619      68.000  79.677 107.063  1.00  0.93           N  
ATOM  11473  CA  MET B 619      69.386  80.023 106.780  1.00  0.93           C  
ATOM  11474  C   MET B 619      69.551  81.251 105.879  1.00  0.93           C  
ATOM  11475  O   MET B 619      70.409  82.094 106.133  1.00  0.93           O  
ATOM  11476  CB  MET B 619      70.173  78.832 106.169  1.00  0.93           C  
ATOM  11477  CG  MET B 619      70.254  77.583 107.075  1.00  0.93           C  
ATOM  11478  SD  MET B 619      70.796  77.886 108.783  1.00  0.93           S  
ATOM  11479  CE  MET B 619      72.517  78.268 108.372  1.00  0.93           C  
ATOM  11480  N   ILE B 620      68.709  81.421 104.833  1.00  0.96           N  
ATOM  11481  CA  ILE B 620      68.664  82.626 103.996  1.00  0.96           C  
ATOM  11482  C   ILE B 620      68.314  83.888 104.788  1.00  0.96           C  
ATOM  11483  O   ILE B 620      68.949  84.927 104.616  1.00  0.96           O  
ATOM  11484  CB  ILE B 620      67.721  82.458 102.794  1.00  0.96           C  
ATOM  11485  CG1 ILE B 620      68.278  81.377 101.842  1.00  0.96           C  
ATOM  11486  CG2 ILE B 620      67.536  83.781 102.013  1.00  0.96           C  
ATOM  11487  CD1 ILE B 620      67.251  80.821 100.846  1.00  0.96           C  
ATOM  11488  N   ILE B 621      67.337  83.834 105.723  1.00  0.96           N  
ATOM  11489  CA  ILE B 621      67.009  84.948 106.621  1.00  0.96           C  
ATOM  11490  C   ILE B 621      68.175  85.317 107.518  1.00  0.96           C  
ATOM  11491  O   ILE B 621      68.527  86.488 107.654  1.00  0.96           O  
ATOM  11492  CB  ILE B 621      65.796  84.642 107.508  1.00  0.96           C  
ATOM  11493  CG1 ILE B 621      64.541  84.465 106.624  1.00  0.96           C  
ATOM  11494  CG2 ILE B 621      65.579  85.756 108.569  1.00  0.96           C  
ATOM  11495  CD1 ILE B 621      63.282  84.080 107.410  1.00  0.96           C  
ATOM  11496  N   ARG B 622      68.848  84.308 108.110  1.00  0.90           N  
ATOM  11497  CA  ARG B 622      70.033  84.516 108.920  1.00  0.90           C  
ATOM  11498  C   ARG B 622      71.173  85.160 108.140  1.00  0.90           C  
ATOM  11499  O   ARG B 622      71.934  85.980 108.658  1.00  0.90           O  
ATOM  11500  CB  ARG B 622      70.522  83.186 109.553  1.00  0.90           C  
ATOM  11501  CG  ARG B 622      71.742  83.334 110.488  1.00  0.90           C  
ATOM  11502  CD  ARG B 622      71.509  84.287 111.664  1.00  0.90           C  
ATOM  11503  NE  ARG B 622      72.797  84.366 112.411  1.00  0.90           N  
ATOM  11504  CZ  ARG B 622      73.705  85.335 112.262  1.00  0.90           C  
ATOM  11505  NH1 ARG B 622      74.818  85.270 112.988  1.00  0.90           N  
ATOM  11506  NH2 ARG B 622      73.547  86.343 111.411  1.00  0.90           N  
ATOM  11507  N   LEU B 623      71.318  84.784 106.857  1.00  0.95           N  
ATOM  11508  CA  LEU B 623      72.275  85.364 105.945  1.00  0.95           C  
ATOM  11509  C   LEU B 623      71.975  86.833 105.624  1.00  0.95           C  
ATOM  11510  O   LEU B 623      72.851  87.691 105.726  1.00  0.95           O  
ATOM  11511  CB  LEU B 623      72.321  84.501 104.648  1.00  0.95           C  
ATOM  11512  CG  LEU B 623      73.657  84.439 103.871  1.00  0.95           C  
ATOM  11513  CD1 LEU B 623      73.428  84.722 102.380  1.00  0.95           C  
ATOM  11514  CD2 LEU B 623      74.760  85.335 104.438  1.00  0.95           C  
ATOM  11515  N   VAL B 624      70.707  87.190 105.301  1.00  0.96           N  
ATOM  11516  CA  VAL B 624      70.316  88.571 104.988  1.00  0.96           C  
ATOM  11517  C   VAL B 624      70.569  89.505 106.165  1.00  0.96           C  
ATOM  11518  O   VAL B 624      71.104  90.605 106.009  1.00  0.96           O  
ATOM  11519  CB  VAL B 624      68.847  88.703 104.560  1.00  0.96           C  
ATOM  11520  CG1 VAL B 624      68.450  90.184 104.344  1.00  0.96           C  
ATOM  11521  CG2 VAL B 624      68.585  87.919 103.265  1.00  0.96           C  
ATOM  11522  N   THR B 625      70.232  89.065 107.395  1.00  0.93           N  
ATOM  11523  CA  THR B 625      70.496  89.818 108.618  1.00  0.93           C  
ATOM  11524  C   THR B 625      71.975  90.017 108.897  1.00  0.93           C  
ATOM  11525  O   THR B 625      72.400  91.132 109.180  1.00  0.93           O  
ATOM  11526  CB  THR B 625      69.821  89.226 109.851  1.00  0.93           C  
ATOM  11527  OG1 THR B 625      70.204  87.872 110.061  1.00  0.93           O  
ATOM  11528  CG2 THR B 625      68.296  89.244 109.656  1.00  0.93           C  
ATOM  11529  N   ALA B 626      72.810  88.967 108.730  1.00  0.94           N  
ATOM  11530  CA  ALA B 626      74.249  89.028 108.930  1.00  0.94           C  
ATOM  11531  C   ALA B 626      74.957  90.053 108.038  1.00  0.94           C  
ATOM  11532  O   ALA B 626      75.814  90.824 108.471  1.00  0.94           O  
ATOM  11533  CB  ALA B 626      74.843  87.637 108.609  1.00  0.94           C  
ATOM  11534  N   ILE B 627      74.578  90.079 106.743  1.00  0.94           N  
ATOM  11535  CA  ILE B 627      75.026  91.036 105.738  1.00  0.94           C  
ATOM  11536  C   ILE B 627      74.552  92.439 106.075  1.00  0.94           C  
ATOM  11537  O   ILE B 627      75.329  93.389 106.015  1.00  0.94           O  
ATOM  11538  CB  ILE B 627      74.552  90.611 104.343  1.00  0.94           C  
ATOM  11539  CG1 ILE B 627      75.251  89.293 103.923  1.00  0.94           C  
ATOM  11540  CG2 ILE B 627      74.808  91.706 103.277  1.00  0.94           C  
ATOM  11541  CD1 ILE B 627      74.471  88.505 102.887  1.00  0.94           C  
ATOM  11542  N   GLY B 628      73.272  92.596 106.487  1.00  0.92           N  
ATOM  11543  CA  GLY B 628      72.694  93.830 107.018  1.00  0.92           C  
ATOM  11544  C   GLY B 628      73.497  94.502 108.083  1.00  0.92           C  
ATOM  11545  O   GLY B 628      73.840  95.673 107.945  1.00  0.92           O  
ATOM  11546  N   ASP B 629      73.855  93.766 109.144  1.00  0.87           N  
ATOM  11547  CA  ASP B 629      74.710  94.262 110.202  1.00  0.87           C  
ATOM  11548  C   ASP B 629      76.092  94.704 109.683  1.00  0.87           C  
ATOM  11549  O   ASP B 629      76.552  95.816 109.918  1.00  0.87           O  
ATOM  11550  CB  ASP B 629      74.858  93.158 111.284  1.00  0.87           C  
ATOM  11551  CG  ASP B 629      73.522  92.820 111.934  1.00  0.87           C  
ATOM  11552  OD1 ASP B 629      72.744  93.764 112.228  1.00  0.87           O  
ATOM  11553  OD2 ASP B 629      73.282  91.605 112.171  1.00  0.87           O  
ATOM  11554  N   VAL B 630      76.786  93.892 108.860  1.00  0.91           N  
ATOM  11555  CA  VAL B 630      78.070  94.301 108.283  1.00  0.91           C  
ATOM  11556  C   VAL B 630      77.991  95.528 107.364  1.00  0.91           C  
ATOM  11557  O   VAL B 630      78.803  96.444 107.463  1.00  0.91           O  
ATOM  11558  CB  VAL B 630      78.769  93.148 107.558  1.00  0.91           C  
ATOM  11559  CG1 VAL B 630      80.108  93.595 106.925  1.00  0.91           C  
ATOM  11560  CG2 VAL B 630      79.057  92.032 108.581  1.00  0.91           C  
ATOM  11561  N   VAL B 631      77.002  95.605 106.451  1.00  0.92           N  
ATOM  11562  CA  VAL B 631      76.820  96.750 105.561  1.00  0.92           C  
ATOM  11563  C   VAL B 631      76.366  98.014 106.288  1.00  0.92           C  
ATOM  11564  O   VAL B 631      76.894  99.102 106.059  1.00  0.92           O  
ATOM  11565  CB  VAL B 631      75.845  96.434 104.420  1.00  0.92           C  
ATOM  11566  CG1 VAL B 631      75.669  97.646 103.479  1.00  0.92           C  
ATOM  11567  CG2 VAL B 631      76.381  95.248 103.591  1.00  0.92           C  
ATOM  11568  N   ASN B 632      75.380  97.920 107.209  1.00  0.87           N  
ATOM  11569  CA  ASN B 632      74.804  99.085 107.865  1.00  0.87           C  
ATOM  11570  C   ASN B 632      75.749  99.748 108.852  1.00  0.87           C  
ATOM  11571  O   ASN B 632      75.640 100.953 109.087  1.00  0.87           O  
ATOM  11572  CB  ASN B 632      73.491  98.750 108.627  1.00  0.87           C  
ATOM  11573  CG  ASN B 632      72.351  98.483 107.653  1.00  0.87           C  
ATOM  11574  OD1 ASN B 632      72.393  98.805 106.466  1.00  0.87           O  
ATOM  11575  ND2 ASN B 632      71.240  97.923 108.179  1.00  0.87           N  
ATOM  11576  N   HIS B 633      76.687  98.993 109.451  1.00  0.85           N  
ATOM  11577  CA  HIS B 633      77.613  99.535 110.426  1.00  0.85           C  
ATOM  11578  C   HIS B 633      78.996  99.826 109.864  1.00  0.85           C  
ATOM  11579  O   HIS B 633      79.889 100.223 110.609  1.00  0.85           O  
ATOM  11580  CB  HIS B 633      77.739  98.596 111.649  1.00  0.85           C  
ATOM  11581  CG  HIS B 633      76.457  98.465 112.430  1.00  0.85           C  
ATOM  11582  ND1 HIS B 633      75.652  97.371 112.218  1.00  0.85           N  
ATOM  11583  CD2 HIS B 633      75.927  99.241 113.414  1.00  0.85           C  
ATOM  11584  CE1 HIS B 633      74.656  97.480 113.064  1.00  0.85           C  
ATOM  11585  NE2 HIS B 633      74.770  98.601 113.816  1.00  0.85           N  
ATOM  11586  N   ASP B 634      79.225  99.698 108.543  1.00  0.88           N  
ATOM  11587  CA  ASP B 634      80.477 100.115 107.948  1.00  0.88           C  
ATOM  11588  C   ASP B 634      80.557 101.648 107.723  1.00  0.88           C  
ATOM  11589  O   ASP B 634      79.704 102.223 107.034  1.00  0.88           O  
ATOM  11590  CB  ASP B 634      80.707  99.333 106.640  1.00  0.88           C  
ATOM  11591  CG  ASP B 634      82.135  99.466 106.189  1.00  0.88           C  
ATOM  11592  OD1 ASP B 634      82.874  98.456 106.276  1.00  0.88           O  
ATOM  11593  OD2 ASP B 634      82.577 100.559 105.745  1.00  0.88           O  
ATOM  11594  N   PRO B 635      81.556 102.370 108.251  1.00  0.89           N  
ATOM  11595  CA  PRO B 635      81.660 103.816 108.074  1.00  0.89           C  
ATOM  11596  C   PRO B 635      82.080 104.233 106.673  1.00  0.89           C  
ATOM  11597  O   PRO B 635      81.843 105.383 106.313  1.00  0.89           O  
ATOM  11598  CB  PRO B 635      82.719 104.230 109.113  1.00  0.89           C  
ATOM  11599  CG  PRO B 635      83.599 102.988 109.280  1.00  0.89           C  
ATOM  11600  CD  PRO B 635      82.592 101.848 109.150  1.00  0.89           C  
ATOM  11601  N   ALA B 636      82.728 103.367 105.864  1.00  0.92           N  
ATOM  11602  CA  ALA B 636      83.108 103.705 104.504  1.00  0.92           C  
ATOM  11603  C   ALA B 636      81.900 103.719 103.582  1.00  0.92           C  
ATOM  11604  O   ALA B 636      81.750 104.572 102.703  1.00  0.92           O  
ATOM  11605  CB  ALA B 636      84.155 102.702 103.972  1.00  0.92           C  
ATOM  11606  N   VAL B 637      80.988 102.746 103.774  1.00  0.91           N  
ATOM  11607  CA  VAL B 637      79.755 102.660 103.013  1.00  0.91           C  
ATOM  11608  C   VAL B 637      78.804 103.797 103.334  1.00  0.91           C  
ATOM  11609  O   VAL B 637      78.353 104.508 102.432  1.00  0.91           O  
ATOM  11610  CB  VAL B 637      79.046 101.327 103.234  1.00  0.91           C  
ATOM  11611  CG1 VAL B 637      77.766 101.234 102.375  1.00  0.91           C  
ATOM  11612  CG2 VAL B 637      80.009 100.191 102.843  1.00  0.91           C  
ATOM  11613  N   GLY B 638      78.525 104.040 104.635  1.00  0.87           N  
ATOM  11614  CA  GLY B 638      77.510 104.987 105.096  1.00  0.87           C  
ATOM  11615  C   GLY B 638      76.192 104.953 104.352  1.00  0.87           C  
ATOM  11616  O   GLY B 638      75.504 103.940 104.281  1.00  0.87           O  
ATOM  11617  N   ASP B 639      75.817 106.096 103.758  1.00  0.89           N  
ATOM  11618  CA  ASP B 639      74.496 106.328 103.204  1.00  0.89           C  
ATOM  11619  C   ASP B 639      74.409 105.935 101.730  1.00  0.89           C  
ATOM  11620  O   ASP B 639      73.394 106.158 101.067  1.00  0.89           O  
ATOM  11621  CB  ASP B 639      74.132 107.829 103.362  1.00  0.89           C  
ATOM  11622  CG  ASP B 639      74.011 108.206 104.827  1.00  0.89           C  
ATOM  11623  OD1 ASP B 639      73.766 107.283 105.647  1.00  0.89           O  
ATOM  11624  OD2 ASP B 639      74.183 109.408 105.133  1.00  0.89           O  
ATOM  11625  N   ARG B 640      75.472 105.312 101.177  1.00  0.88           N  
ATOM  11626  CA  ARG B 640      75.470 104.686  99.866  1.00  0.88           C  
ATOM  11627  C   ARG B 640      74.600 103.433  99.796  1.00  0.88           C  
ATOM  11628  O   ARG B 640      73.883 103.210  98.822  1.00  0.88           O  
ATOM  11629  CB  ARG B 640      76.917 104.305  99.457  1.00  0.88           C  
ATOM  11630  CG  ARG B 640      77.835 105.526  99.240  1.00  0.88           C  
ATOM  11631  CD  ARG B 640      79.275 105.154  98.859  1.00  0.88           C  
ATOM  11632  NE  ARG B 640      80.038 106.427  98.623  1.00  0.88           N  
ATOM  11633  CZ  ARG B 640      80.666 107.131  99.576  1.00  0.88           C  
ATOM  11634  NH1 ARG B 640      81.348 108.222  99.226  1.00  0.88           N  
ATOM  11635  NH2 ARG B 640      80.630 106.781 100.858  1.00  0.88           N  
ATOM  11636  N   LEU B 641      74.645 102.571 100.828  1.00  0.94           N  
ATOM  11637  CA  LEU B 641      73.886 101.335 100.822  1.00  0.94           C  
ATOM  11638  C   LEU B 641      73.409 100.987 102.217  1.00  0.94           C  
ATOM  11639  O   LEU B 641      74.185 100.925 103.166  1.00  0.94           O  
ATOM  11640  CB  LEU B 641      74.756 100.183 100.250  1.00  0.94           C  
ATOM  11641  CG  LEU B 641      74.064  98.817 100.040  1.00  0.94           C  
ATOM  11642  CD1 LEU B 641      72.909  98.911  99.037  1.00  0.94           C  
ATOM  11643  CD2 LEU B 641      75.088  97.784  99.542  1.00  0.94           C  
ATOM  11644  N   ARG B 642      72.097 100.737 102.376  1.00  0.87           N  
ATOM  11645  CA  ARG B 642      71.520 100.281 103.626  1.00  0.87           C  
ATOM  11646  C   ARG B 642      70.703  99.033 103.342  1.00  0.87           C  
ATOM  11647  O   ARG B 642      70.017  98.952 102.325  1.00  0.87           O  
ATOM  11648  CB  ARG B 642      70.609 101.352 104.294  1.00  0.87           C  
ATOM  11649  CG  ARG B 642      71.314 102.671 104.703  1.00  0.87           C  
ATOM  11650  CD  ARG B 642      72.373 102.535 105.810  1.00  0.87           C  
ATOM  11651  NE  ARG B 642      72.806 103.915 106.221  1.00  0.87           N  
ATOM  11652  CZ  ARG B 642      73.702 104.180 107.179  1.00  0.87           C  
ATOM  11653  NH1 ARG B 642      74.055 105.438 107.431  1.00  0.87           N  
ATOM  11654  NH2 ARG B 642      74.237 103.218 107.922  1.00  0.87           N  
ATOM  11655  N   VAL B 643      70.768  98.016 104.222  1.00  0.93           N  
ATOM  11656  CA  VAL B 643      70.053  96.756 104.035  1.00  0.93           C  
ATOM  11657  C   VAL B 643      69.115  96.522 105.205  1.00  0.93           C  
ATOM  11658  O   VAL B 643      69.508  96.608 106.367  1.00  0.93           O  
ATOM  11659  CB  VAL B 643      70.972  95.541 103.920  1.00  0.93           C  
ATOM  11660  CG1 VAL B 643      70.178  94.290 103.479  1.00  0.93           C  
ATOM  11661  CG2 VAL B 643      72.109  95.823 102.921  1.00  0.93           C  
ATOM  11662  N   ILE B 644      67.834  96.223 104.931  1.00  0.92           N  
ATOM  11663  CA  ILE B 644      66.827  95.970 105.952  1.00  0.92           C  
ATOM  11664  C   ILE B 644      66.164  94.633 105.679  1.00  0.92           C  
ATOM  11665  O   ILE B 644      65.732  94.345 104.564  1.00  0.92           O  
ATOM  11666  CB  ILE B 644      65.772  97.084 105.993  1.00  0.92           C  
ATOM  11667  CG1 ILE B 644      66.392  98.436 106.433  1.00  0.92           C  
ATOM  11668  CG2 ILE B 644      64.564  96.722 106.890  1.00  0.92           C  
ATOM  11669  CD1 ILE B 644      66.953  98.443 107.862  1.00  0.92           C  
ATOM  11670  N   PHE B 645      66.041  93.769 106.712  1.00  0.93           N  
ATOM  11671  CA  PHE B 645      65.155  92.623 106.638  1.00  0.93           C  
ATOM  11672  C   PHE B 645      63.806  93.073 107.190  1.00  0.93           C  
ATOM  11673  O   PHE B 645      63.718  93.490 108.339  1.00  0.93           O  
ATOM  11674  CB  PHE B 645      65.691  91.387 107.413  1.00  0.93           C  
ATOM  11675  CG  PHE B 645      64.850  90.169 107.096  1.00  0.93           C  
ATOM  11676  CD1 PHE B 645      65.065  89.435 105.917  1.00  0.93           C  
ATOM  11677  CD2 PHE B 645      63.792  89.794 107.941  1.00  0.93           C  
ATOM  11678  CE1 PHE B 645      64.248  88.345 105.589  1.00  0.93           C  
ATOM  11679  CE2 PHE B 645      62.969  88.707 107.618  1.00  0.93           C  
ATOM  11680  CZ  PHE B 645      63.201  87.981 106.443  1.00  0.93           C  
ATOM  11681  N   LEU B 646      62.725  93.045 106.386  1.00  0.93           N  
ATOM  11682  CA  LEU B 646      61.446  93.595 106.805  1.00  0.93           C  
ATOM  11683  C   LEU B 646      60.632  92.542 107.557  1.00  0.93           C  
ATOM  11684  O   LEU B 646      60.112  91.587 106.977  1.00  0.93           O  
ATOM  11685  CB  LEU B 646      60.619  94.138 105.598  1.00  0.93           C  
ATOM  11686  CG  LEU B 646      59.875  95.482 105.805  1.00  0.93           C  
ATOM  11687  CD1 LEU B 646      58.646  95.550 104.884  1.00  0.93           C  
ATOM  11688  CD2 LEU B 646      59.447  95.742 107.252  1.00  0.93           C  
ATOM  11689  N   GLU B 647      60.526  92.692 108.887  1.00  0.90           N  
ATOM  11690  CA  GLU B 647      59.829  91.772 109.761  1.00  0.90           C  
ATOM  11691  C   GLU B 647      58.318  91.733 109.633  1.00  0.90           C  
ATOM  11692  O   GLU B 647      57.638  92.746 109.480  1.00  0.90           O  
ATOM  11693  CB  GLU B 647      60.163  92.047 111.238  1.00  0.90           C  
ATOM  11694  CG  GLU B 647      61.678  91.996 111.503  1.00  0.90           C  
ATOM  11695  CD  GLU B 647      61.998  92.088 112.988  1.00  0.90           C  
ATOM  11696  OE1 GLU B 647      61.440  91.277 113.773  1.00  0.90           O  
ATOM  11697  OE2 GLU B 647      62.843  92.944 113.335  1.00  0.90           O  
ATOM  11698  N   ASN B 648      57.743  90.518 109.740  1.00  0.91           N  
ATOM  11699  CA  ASN B 648      56.319  90.272 109.854  1.00  0.91           C  
ATOM  11700  C   ASN B 648      55.529  90.741 108.642  1.00  0.91           C  
ATOM  11701  O   ASN B 648      54.452  91.332 108.761  1.00  0.91           O  
ATOM  11702  CB  ASN B 648      55.767  90.825 111.200  1.00  0.91           C  
ATOM  11703  CG  ASN B 648      54.448  90.183 111.618  1.00  0.91           C  
ATOM  11704  OD1 ASN B 648      54.085  89.074 111.213  1.00  0.91           O  
ATOM  11705  ND2 ASN B 648      53.693  90.903 112.479  1.00  0.91           N  
ATOM  11706  N   TYR B 649      56.057  90.437 107.436  1.00  0.93           N  
ATOM  11707  CA  TYR B 649      55.413  90.703 106.163  1.00  0.93           C  
ATOM  11708  C   TYR B 649      54.035  90.043 106.070  1.00  0.93           C  
ATOM  11709  O   TYR B 649      53.853  88.851 106.313  1.00  0.93           O  
ATOM  11710  CB  TYR B 649      56.356  90.309 104.990  1.00  0.93           C  
ATOM  11711  CG  TYR B 649      55.775  90.686 103.648  1.00  0.93           C  
ATOM  11712  CD1 TYR B 649      55.481  92.027 103.344  1.00  0.93           C  
ATOM  11713  CD2 TYR B 649      55.473  89.691 102.701  1.00  0.93           C  
ATOM  11714  CE1 TYR B 649      54.867  92.360 102.127  1.00  0.93           C  
ATOM  11715  CE2 TYR B 649      54.875  90.027 101.478  1.00  0.93           C  
ATOM  11716  CZ  TYR B 649      54.570  91.362 101.191  1.00  0.93           C  
ATOM  11717  OH  TYR B 649      54.025  91.692  99.932  1.00  0.93           O  
ATOM  11718  N   ARG B 650      53.024  90.873 105.784  1.00  0.89           N  
ATOM  11719  CA  ARG B 650      51.626  90.542 105.878  1.00  0.89           C  
ATOM  11720  C   ARG B 650      50.903  91.633 105.123  1.00  0.89           C  
ATOM  11721  O   ARG B 650      51.531  92.603 104.701  1.00  0.89           O  
ATOM  11722  CB  ARG B 650      51.138  90.454 107.347  1.00  0.89           C  
ATOM  11723  CG  ARG B 650      51.177  91.790 108.117  1.00  0.89           C  
ATOM  11724  CD  ARG B 650      51.100  91.607 109.634  1.00  0.89           C  
ATOM  11725  NE  ARG B 650      50.990  92.960 110.254  1.00  0.89           N  
ATOM  11726  CZ  ARG B 650      52.021  93.763 110.552  1.00  0.89           C  
ATOM  11727  NH1 ARG B 650      53.274  93.476 110.202  1.00  0.89           N  
ATOM  11728  NH2 ARG B 650      51.792  94.883 111.233  1.00  0.89           N  
ATOM  11729  N   VAL B 651      49.579  91.509 104.917  1.00  0.95           N  
ATOM  11730  CA  VAL B 651      48.800  92.392 104.056  1.00  0.95           C  
ATOM  11731  C   VAL B 651      48.835  93.863 104.459  1.00  0.95           C  
ATOM  11732  O   VAL B 651      49.148  94.709 103.625  1.00  0.95           O  
ATOM  11733  CB  VAL B 651      47.368  91.877 103.943  1.00  0.95           C  
ATOM  11734  CG1 VAL B 651      46.488  92.785 103.059  1.00  0.95           C  
ATOM  11735  CG2 VAL B 651      47.408  90.458 103.339  1.00  0.95           C  
ATOM  11736  N   SER B 652      48.633  94.208 105.747  1.00  0.94           N  
ATOM  11737  CA  SER B 652      48.686  95.594 106.205  1.00  0.94           C  
ATOM  11738  C   SER B 652      50.066  96.242 106.149  1.00  0.94           C  
ATOM  11739  O   SER B 652      50.200  97.467 106.106  1.00  0.94           O  
ATOM  11740  CB  SER B 652      48.169  95.711 107.653  1.00  0.94           C  
ATOM  11741  OG  SER B 652      48.984  94.983 108.569  1.00  0.94           O  
ATOM  11742  N   LEU B 653      51.147  95.434 106.160  1.00  0.93           N  
ATOM  11743  CA  LEU B 653      52.509  95.896 105.929  1.00  0.93           C  
ATOM  11744  C   LEU B 653      52.811  96.039 104.443  1.00  0.93           C  
ATOM  11745  O   LEU B 653      53.484  96.979 104.022  1.00  0.93           O  
ATOM  11746  CB  LEU B 653      53.546  94.986 106.643  1.00  0.93           C  
ATOM  11747  CG  LEU B 653      55.012  95.489 106.673  1.00  0.93           C  
ATOM  11748  CD1 LEU B 653      55.160  96.902 107.264  1.00  0.93           C  
ATOM  11749  CD2 LEU B 653      55.873  94.522 107.495  1.00  0.93           C  
ATOM  11750  N   ALA B 654      52.263  95.143 103.593  1.00  0.97           N  
ATOM  11751  CA  ALA B 654      52.343  95.205 102.144  1.00  0.97           C  
ATOM  11752  C   ALA B 654      51.722  96.473 101.582  1.00  0.97           C  
ATOM  11753  O   ALA B 654      52.286  97.133 100.712  1.00  0.97           O  
ATOM  11754  CB  ALA B 654      51.677  93.962 101.526  1.00  0.97           C  
ATOM  11755  N   GLU B 655      50.570  96.880 102.146  1.00  0.94           N  
ATOM  11756  CA  GLU B 655      49.921  98.149 101.882  1.00  0.94           C  
ATOM  11757  C   GLU B 655      50.805  99.359 102.175  1.00  0.94           C  
ATOM  11758  O   GLU B 655      50.724 100.379 101.504  1.00  0.94           O  
ATOM  11759  CB  GLU B 655      48.612  98.242 102.697  1.00  0.94           C  
ATOM  11760  CG  GLU B 655      47.559  97.209 102.225  1.00  0.94           C  
ATOM  11761  CD  GLU B 655      46.424  96.983 103.217  1.00  0.94           C  
ATOM  11762  OE1 GLU B 655      45.467  96.258 102.828  1.00  0.94           O  
ATOM  11763  OE2 GLU B 655      46.480  97.478 104.367  1.00  0.94           O  
ATOM  11764  N   LYS B 656      51.693  99.288 103.181  1.00  0.91           N  
ATOM  11765  CA  LYS B 656      52.645 100.353 103.450  1.00  0.91           C  
ATOM  11766  C   LYS B 656      53.908 100.337 102.572  1.00  0.91           C  
ATOM  11767  O   LYS B 656      54.314 101.369 102.044  1.00  0.91           O  
ATOM  11768  CB  LYS B 656      53.076 100.293 104.935  1.00  0.91           C  
ATOM  11769  CG  LYS B 656      51.914 100.474 105.921  1.00  0.91           C  
ATOM  11770  CD  LYS B 656      52.355 100.188 107.364  1.00  0.91           C  
ATOM  11771  CE  LYS B 656      51.313 100.589 108.400  1.00  0.91           C  
ATOM  11772  NZ  LYS B 656      50.087  99.789 108.232  1.00  0.91           N  
ATOM  11773  N   VAL B 657      54.579  99.171 102.405  1.00  0.95           N  
ATOM  11774  CA  VAL B 657      55.856  99.053 101.689  1.00  0.95           C  
ATOM  11775  C   VAL B 657      55.753  99.206 100.171  1.00  0.95           C  
ATOM  11776  O   VAL B 657      56.590  99.844  99.535  1.00  0.95           O  
ATOM  11777  CB  VAL B 657      56.627  97.788 102.105  1.00  0.95           C  
ATOM  11778  CG1 VAL B 657      55.942  96.503 101.616  1.00  0.95           C  
ATOM  11779  CG2 VAL B 657      58.097  97.830 101.638  1.00  0.95           C  
ATOM  11780  N   ILE B 658      54.706  98.643  99.529  1.00  0.96           N  
ATOM  11781  CA  ILE B 658      54.534  98.672  98.076  1.00  0.96           C  
ATOM  11782  C   ILE B 658      54.380 100.081  97.478  1.00  0.96           C  
ATOM  11783  O   ILE B 658      55.069 100.366  96.492  1.00  0.96           O  
ATOM  11784  CB  ILE B 658      53.427  97.701  97.643  1.00  0.96           C  
ATOM  11785  CG1 ILE B 658      53.860  96.247  97.959  1.00  0.96           C  
ATOM  11786  CG2 ILE B 658      53.083  97.854  96.146  1.00  0.96           C  
ATOM  11787  CD1 ILE B 658      52.718  95.230  97.869  1.00  0.96           C  
ATOM  11788  N   PRO B 659      53.597 101.042  97.993  1.00  0.97           N  
ATOM  11789  CA  PRO B 659      53.553 102.412  97.477  1.00  0.97           C  
ATOM  11790  C   PRO B 659      54.876 103.142  97.551  1.00  0.97           C  
ATOM  11791  O   PRO B 659      55.103 104.062  96.763  1.00  0.97           O  
ATOM  11792  CB  PRO B 659      52.459 103.092  98.312  1.00  0.97           C  
ATOM  11793  CG  PRO B 659      51.525 101.934  98.649  1.00  0.97           C  
ATOM  11794  CD  PRO B 659      52.513 100.816  98.951  1.00  0.97           C  
ATOM  11795  N   ALA B 660      55.768 102.745  98.471  1.00  0.95           N  
ATOM  11796  CA  ALA B 660      57.045 103.379  98.699  1.00  0.95           C  
ATOM  11797  C   ALA B 660      58.170 102.748  97.886  1.00  0.95           C  
ATOM  11798  O   ALA B 660      59.318 103.169  97.959  1.00  0.95           O  
ATOM  11799  CB  ALA B 660      57.363 103.250 100.200  1.00  0.95           C  
ATOM  11800  N   ALA B 661      57.874 101.738  97.052  1.00  0.97           N  
ATOM  11801  CA  ALA B 661      58.882 101.049  96.277  1.00  0.97           C  
ATOM  11802  C   ALA B 661      59.288 101.709  94.979  1.00  0.97           C  
ATOM  11803  O   ALA B 661      58.432 102.096  94.187  1.00  0.97           O  
ATOM  11804  CB  ALA B 661      58.347  99.650  95.943  1.00  0.97           C  
ATOM  11805  N   ASP B 662      60.605 101.831  94.719  1.00  0.96           N  
ATOM  11806  CA  ASP B 662      61.100 102.262  93.425  1.00  0.96           C  
ATOM  11807  C   ASP B 662      61.355 101.063  92.519  1.00  0.96           C  
ATOM  11808  O   ASP B 662      60.950 101.046  91.357  1.00  0.96           O  
ATOM  11809  CB  ASP B 662      62.412 103.065  93.535  1.00  0.96           C  
ATOM  11810  CG  ASP B 662      62.226 104.276  94.413  1.00  0.96           C  
ATOM  11811  OD1 ASP B 662      61.408 105.173  94.109  1.00  0.96           O  
ATOM  11812  OD2 ASP B 662      62.949 104.355  95.433  1.00  0.96           O  
ATOM  11813  N   LEU B 663      62.030 100.016  93.040  1.00  0.97           N  
ATOM  11814  CA  LEU B 663      62.369  98.816  92.294  1.00  0.97           C  
ATOM  11815  C   LEU B 663      61.773  97.583  92.942  1.00  0.97           C  
ATOM  11816  O   LEU B 663      61.760  97.413  94.159  1.00  0.97           O  
ATOM  11817  CB  LEU B 663      63.898  98.640  92.153  1.00  0.97           C  
ATOM  11818  CG  LEU B 663      64.411  97.438  91.329  1.00  0.97           C  
ATOM  11819  CD1 LEU B 663      64.132  97.601  89.828  1.00  0.97           C  
ATOM  11820  CD2 LEU B 663      65.917  97.254  91.564  1.00  0.97           C  
ATOM  11821  N   SER B 664      61.227  96.704  92.094  1.00  0.99           N  
ATOM  11822  CA  SER B 664      60.514  95.499  92.452  1.00  0.99           C  
ATOM  11823  C   SER B 664      61.264  94.281  91.973  1.00  0.99           C  
ATOM  11824  O   SER B 664      61.430  94.058  90.774  1.00  0.99           O  
ATOM  11825  CB  SER B 664      59.133  95.520  91.755  1.00  0.99           C  
ATOM  11826  OG  SER B 664      58.385  94.309  91.884  1.00  0.99           O  
ATOM  11827  N   GLU B 665      61.714  93.450  92.923  1.00  0.97           N  
ATOM  11828  CA  GLU B 665      62.473  92.252  92.647  1.00  0.97           C  
ATOM  11829  C   GLU B 665      61.585  91.035  92.443  1.00  0.97           C  
ATOM  11830  O   GLU B 665      60.890  90.559  93.346  1.00  0.97           O  
ATOM  11831  CB  GLU B 665      63.406  91.971  93.840  1.00  0.97           C  
ATOM  11832  CG  GLU B 665      64.618  92.924  93.933  1.00  0.97           C  
ATOM  11833  CD  GLU B 665      65.633  92.697  92.821  1.00  0.97           C  
ATOM  11834  OE1 GLU B 665      65.495  91.695  92.077  1.00  0.97           O  
ATOM  11835  OE2 GLU B 665      66.558  93.533  92.686  1.00  0.97           O  
ATOM  11836  N   GLN B 666      61.589  90.473  91.219  1.00  0.96           N  
ATOM  11837  CA  GLN B 666      60.739  89.358  90.840  1.00  0.96           C  
ATOM  11838  C   GLN B 666      61.579  88.320  90.116  1.00  0.96           C  
ATOM  11839  O   GLN B 666      61.358  87.985  88.956  1.00  0.96           O  
ATOM  11840  CB  GLN B 666      59.547  89.814  89.958  1.00  0.96           C  
ATOM  11841  CG  GLN B 666      58.726  90.987  90.553  1.00  0.96           C  
ATOM  11842  CD  GLN B 666      58.038  90.644  91.877  1.00  0.96           C  
ATOM  11843  OE1 GLN B 666      57.567  89.530  92.130  1.00  0.96           O  
ATOM  11844  NE2 GLN B 666      57.936  91.647  92.776  1.00  0.96           N  
ATOM  11845  N   ILE B 667      62.614  87.822  90.812  1.00  0.98           N  
ATOM  11846  CA  ILE B 667      63.773  87.162  90.230  1.00  0.98           C  
ATOM  11847  C   ILE B 667      63.782  85.635  90.267  1.00  0.98           C  
ATOM  11848  O   ILE B 667      64.837  85.004  90.154  1.00  0.98           O  
ATOM  11849  CB  ILE B 667      65.032  87.694  90.903  1.00  0.98           C  
ATOM  11850  CG1 ILE B 667      65.015  87.524  92.442  1.00  0.98           C  
ATOM  11851  CG2 ILE B 667      65.143  89.182  90.539  1.00  0.98           C  
ATOM  11852  CD1 ILE B 667      66.305  88.003  93.113  1.00  0.98           C  
ATOM  11853  N   SER B 668      62.602  84.994  90.387  1.00  0.96           N  
ATOM  11854  CA  SER B 668      62.402  83.548  90.351  1.00  0.96           C  
ATOM  11855  C   SER B 668      62.993  82.824  89.157  1.00  0.96           C  
ATOM  11856  O   SER B 668      63.179  83.375  88.077  1.00  0.96           O  
ATOM  11857  CB  SER B 668      60.899  83.169  90.393  1.00  0.96           C  
ATOM  11858  OG  SER B 668      60.162  83.836  89.371  1.00  0.96           O  
ATOM  11859  N   THR B 669      63.360  81.538  89.314  1.00  0.95           N  
ATOM  11860  CA  THR B 669      63.877  80.755  88.189  1.00  0.95           C  
ATOM  11861  C   THR B 669      62.816  80.564  87.120  1.00  0.95           C  
ATOM  11862  O   THR B 669      61.691  80.201  87.434  1.00  0.95           O  
ATOM  11863  CB  THR B 669      64.411  79.371  88.555  1.00  0.95           C  
ATOM  11864  OG1 THR B 669      65.106  79.395  89.785  1.00  0.95           O  
ATOM  11865  CG2 THR B 669      65.427  78.876  87.525  1.00  0.95           C  
ATOM  11866  N   ALA B 670      63.126  80.789  85.825  1.00  0.95           N  
ATOM  11867  CA  ALA B 670      62.149  80.632  84.759  1.00  0.95           C  
ATOM  11868  C   ALA B 670      61.462  79.268  84.723  1.00  0.95           C  
ATOM  11869  O   ALA B 670      62.099  78.226  84.579  1.00  0.95           O  
ATOM  11870  CB  ALA B 670      62.776  80.948  83.388  1.00  0.95           C  
ATOM  11871  N   GLY B 671      60.125  79.277  84.892  1.00  0.91           N  
ATOM  11872  CA  GLY B 671      59.305  78.086  84.991  1.00  0.91           C  
ATOM  11873  C   GLY B 671      58.932  77.691  86.401  1.00  0.91           C  
ATOM  11874  O   GLY B 671      58.325  76.636  86.575  1.00  0.91           O  
ATOM  11875  N   THR B 672      59.270  78.474  87.457  1.00  0.91           N  
ATOM  11876  CA  THR B 672      58.954  78.078  88.840  1.00  0.91           C  
ATOM  11877  C   THR B 672      57.913  78.931  89.558  1.00  0.91           C  
ATOM  11878  O   THR B 672      57.178  78.397  90.390  1.00  0.91           O  
ATOM  11879  CB  THR B 672      60.167  77.950  89.771  1.00  0.91           C  
ATOM  11880  OG1 THR B 672      60.812  79.186  90.041  1.00  0.91           O  
ATOM  11881  CG2 THR B 672      61.220  77.022  89.149  1.00  0.91           C  
ATOM  11882  N   GLU B 673      57.753  80.242  89.267  1.00  0.91           N  
ATOM  11883  CA  GLU B 673      56.682  81.043  89.852  1.00  0.91           C  
ATOM  11884  C   GLU B 673      55.508  81.024  88.888  1.00  0.91           C  
ATOM  11885  O   GLU B 673      55.545  81.541  87.776  1.00  0.91           O  
ATOM  11886  CB  GLU B 673      57.150  82.500  90.146  1.00  0.91           C  
ATOM  11887  CG  GLU B 673      56.162  83.500  90.821  1.00  0.91           C  
ATOM  11888  CD  GLU B 673      56.270  83.659  92.330  1.00  0.91           C  
ATOM  11889  OE1 GLU B 673      57.343  84.020  92.894  1.00  0.91           O  
ATOM  11890  OE2 GLU B 673      55.221  83.484  93.006  1.00  0.91           O  
ATOM  11891  N   ALA B 674      54.387  80.399  89.301  1.00  0.94           N  
ATOM  11892  CA  ALA B 674      53.226  80.166  88.467  1.00  0.94           C  
ATOM  11893  C   ALA B 674      52.579  81.431  87.922  1.00  0.94           C  
ATOM  11894  O   ALA B 674      51.968  81.439  86.857  1.00  0.94           O  
ATOM  11895  CB  ALA B 674      52.192  79.402  89.300  1.00  0.94           C  
ATOM  11896  N   SER B 675      52.702  82.547  88.655  1.00  0.96           N  
ATOM  11897  CA  SER B 675      52.184  83.828  88.209  1.00  0.96           C  
ATOM  11898  C   SER B 675      52.837  84.931  89.002  1.00  0.96           C  
ATOM  11899  O   SER B 675      53.505  85.812  88.461  1.00  0.96           O  
ATOM  11900  CB  SER B 675      50.638  83.899  88.363  1.00  0.96           C  
ATOM  11901  OG  SER B 675      50.066  85.089  87.827  1.00  0.96           O  
ATOM  11902  N   GLY B 676      52.685  84.881  90.340  1.00  0.97           N  
ATOM  11903  CA  GLY B 676      53.003  85.995  91.216  1.00  0.97           C  
ATOM  11904  C   GLY B 676      51.847  86.961  91.277  1.00  0.97           C  
ATOM  11905  O   GLY B 676      51.112  87.149  90.316  1.00  0.97           O  
ATOM  11906  N   THR B 677      51.627  87.612  92.430  1.00  0.96           N  
ATOM  11907  CA  THR B 677      50.675  88.724  92.481  1.00  0.96           C  
ATOM  11908  C   THR B 677      51.316  89.959  93.065  1.00  0.96           C  
ATOM  11909  O   THR B 677      50.752  91.047  93.007  1.00  0.96           O  
ATOM  11910  CB  THR B 677      49.393  88.428  93.266  1.00  0.96           C  
ATOM  11911  OG1 THR B 677      49.641  88.009  94.605  1.00  0.96           O  
ATOM  11912  CG2 THR B 677      48.619  87.296  92.576  1.00  0.96           C  
ATOM  11913  N   GLY B 678      52.546  89.872  93.626  1.00  0.98           N  
ATOM  11914  CA  GLY B 678      53.244  91.040  94.165  1.00  0.98           C  
ATOM  11915  C   GLY B 678      53.738  91.949  93.083  1.00  0.98           C  
ATOM  11916  O   GLY B 678      53.722  93.167  93.210  1.00  0.98           O  
ATOM  11917  N   ASN B 679      54.133  91.347  91.956  1.00  0.96           N  
ATOM  11918  CA  ASN B 679      54.639  91.984  90.760  1.00  0.96           C  
ATOM  11919  C   ASN B 679      53.654  92.977  90.145  1.00  0.96           C  
ATOM  11920  O   ASN B 679      54.012  94.109  89.821  1.00  0.96           O  
ATOM  11921  CB  ASN B 679      55.094  90.886  89.745  1.00  0.96           C  
ATOM  11922  CG  ASN B 679      54.072  89.774  89.471  1.00  0.96           C  
ATOM  11923  OD1 ASN B 679      52.997  89.707  90.069  1.00  0.96           O  
ATOM  11924  ND2 ASN B 679      54.454  88.831  88.585  1.00  0.96           N  
ATOM  11925  N   MET B 680      52.370  92.587  90.063  1.00  0.96           N  
ATOM  11926  CA  MET B 680      51.251  93.424  89.675  1.00  0.96           C  
ATOM  11927  C   MET B 680      51.022  94.610  90.609  1.00  0.96           C  
ATOM  11928  O   MET B 680      50.809  95.740  90.171  1.00  0.96           O  
ATOM  11929  CB  MET B 680      49.964  92.567  89.663  1.00  0.96           C  
ATOM  11930  CG  MET B 680      50.071  91.301  88.794  1.00  0.96           C  
ATOM  11931  SD  MET B 680      48.628  90.215  88.944  1.00  0.96           S  
ATOM  11932  CE  MET B 680      49.362  88.940  87.889  1.00  0.96           C  
ATOM  11933  N   LYS B 681      51.095  94.388  91.941  1.00  0.96           N  
ATOM  11934  CA  LYS B 681      50.927  95.429  92.948  1.00  0.96           C  
ATOM  11935  C   LYS B 681      51.980  96.521  92.863  1.00  0.96           C  
ATOM  11936  O   LYS B 681      51.667  97.708  92.937  1.00  0.96           O  
ATOM  11937  CB  LYS B 681      50.960  94.850  94.382  1.00  0.96           C  
ATOM  11938  CG  LYS B 681      49.885  93.799  94.676  1.00  0.96           C  
ATOM  11939  CD  LYS B 681      50.185  93.061  95.987  1.00  0.96           C  
ATOM  11940  CE  LYS B 681      49.398  91.762  96.143  1.00  0.96           C  
ATOM  11941  NZ  LYS B 681      49.862  91.060  97.357  1.00  0.96           N  
ATOM  11942  N   PHE B 682      53.260  96.148  92.673  1.00  0.98           N  
ATOM  11943  CA  PHE B 682      54.346  97.086  92.447  1.00  0.98           C  
ATOM  11944  C   PHE B 682      54.192  97.896  91.166  1.00  0.98           C  
ATOM  11945  O   PHE B 682      54.399  99.110  91.163  1.00  0.98           O  
ATOM  11946  CB  PHE B 682      55.693  96.333  92.367  1.00  0.98           C  
ATOM  11947  CG  PHE B 682      56.148  95.877  93.727  1.00  0.98           C  
ATOM  11948  CD1 PHE B 682      56.543  96.812  94.697  1.00  0.98           C  
ATOM  11949  CD2 PHE B 682      56.263  94.510  94.024  1.00  0.98           C  
ATOM  11950  CE1 PHE B 682      57.025  96.385  95.941  1.00  0.98           C  
ATOM  11951  CE2 PHE B 682      56.740  94.073  95.263  1.00  0.98           C  
ATOM  11952  CZ  PHE B 682      57.118  95.019  96.220  1.00  0.98           C  
ATOM  11953  N   MET B 683      53.785  97.241  90.058  1.00  0.96           N  
ATOM  11954  CA  MET B 683      53.545  97.863  88.763  1.00  0.96           C  
ATOM  11955  C   MET B 683      52.453  98.924  88.816  1.00  0.96           C  
ATOM  11956  O   MET B 683      52.602 100.036  88.312  1.00  0.96           O  
ATOM  11957  CB  MET B 683      53.120  96.761  87.761  1.00  0.96           C  
ATOM  11958  CG  MET B 683      53.060  97.177  86.281  1.00  0.96           C  
ATOM  11959  SD  MET B 683      52.347  95.863  85.253  1.00  0.96           S  
ATOM  11960  CE  MET B 683      52.453  96.756  83.685  1.00  0.96           C  
ATOM  11961  N   LEU B 684      51.331  98.615  89.504  1.00  0.97           N  
ATOM  11962  CA  LEU B 684      50.238  99.542  89.747  1.00  0.97           C  
ATOM  11963  C   LEU B 684      50.673 100.759  90.559  1.00  0.97           C  
ATOM  11964  O   LEU B 684      50.254 101.888  90.322  1.00  0.97           O  
ATOM  11965  CB  LEU B 684      49.066  98.826  90.486  1.00  0.97           C  
ATOM  11966  CG  LEU B 684      47.659  99.017  89.869  1.00  0.97           C  
ATOM  11967  CD1 LEU B 684      46.583  98.530  90.854  1.00  0.97           C  
ATOM  11968  CD2 LEU B 684      47.356 100.467  89.465  1.00  0.97           C  
ATOM  11969  N   ASN B 685      51.559 100.546  91.547  1.00  0.96           N  
ATOM  11970  CA  ASN B 685      51.953 101.549  92.516  1.00  0.96           C  
ATOM  11971  C   ASN B 685      53.215 102.306  92.133  1.00  0.96           C  
ATOM  11972  O   ASN B 685      53.845 102.969  92.963  1.00  0.96           O  
ATOM  11973  CB  ASN B 685      52.132 100.872  93.890  1.00  0.96           C  
ATOM  11974  CG  ASN B 685      50.748 100.757  94.503  1.00  0.96           C  
ATOM  11975  OD1 ASN B 685      50.247 101.736  95.051  1.00  0.96           O  
ATOM  11976  ND2 ASN B 685      50.104  99.584  94.368  1.00  0.96           N  
ATOM  11977  N   GLY B 686      53.608 102.268  90.850  1.00  0.98           N  
ATOM  11978  CA  GLY B 686      54.632 103.157  90.322  1.00  0.98           C  
ATOM  11979  C   GLY B 686      56.043 102.730  90.573  1.00  0.98           C  
ATOM  11980  O   GLY B 686      56.934 103.570  90.650  1.00  0.98           O  
ATOM  11981  N   ALA B 687      56.287 101.423  90.726  1.00  0.99           N  
ATOM  11982  CA  ALA B 687      57.629 100.891  90.786  1.00  0.99           C  
ATOM  11983  C   ALA B 687      58.006 100.272  89.451  1.00  0.99           C  
ATOM  11984  O   ALA B 687      57.150  99.859  88.671  1.00  0.99           O  
ATOM  11985  CB  ALA B 687      57.718  99.817  91.886  1.00  0.99           C  
ATOM  11986  N   LEU B 688      59.316 100.178  89.163  1.00  0.97           N  
ATOM  11987  CA  LEU B 688      59.808  99.417  88.031  1.00  0.97           C  
ATOM  11988  C   LEU B 688      60.176  98.017  88.477  1.00  0.97           C  
ATOM  11989  O   LEU B 688      60.502  97.777  89.635  1.00  0.97           O  
ATOM  11990  CB  LEU B 688      61.024 100.085  87.344  1.00  0.97           C  
ATOM  11991  CG  LEU B 688      60.699 101.449  86.700  1.00  0.97           C  
ATOM  11992  CD1 LEU B 688      61.938 102.051  86.027  1.00  0.97           C  
ATOM  11993  CD2 LEU B 688      59.568 101.339  85.670  1.00  0.97           C  
ATOM  11994  N   THR B 689      60.124  97.034  87.563  1.00  0.97           N  
ATOM  11995  CA  THR B 689      60.323  95.631  87.920  1.00  0.97           C  
ATOM  11996  C   THR B 689      61.565  95.094  87.255  1.00  0.97           C  
ATOM  11997  O   THR B 689      61.761  95.226  86.045  1.00  0.97           O  
ATOM  11998  CB  THR B 689      59.113  94.757  87.584  1.00  0.97           C  
ATOM  11999  OG1 THR B 689      58.043  95.052  88.472  1.00  0.97           O  
ATOM  12000  CG2 THR B 689      59.387  93.250  87.700  1.00  0.97           C  
ATOM  12001  N   ILE B 690      62.432  94.443  88.056  1.00  0.97           N  
ATOM  12002  CA  ILE B 690      63.546  93.650  87.578  1.00  0.97           C  
ATOM  12003  C   ILE B 690      63.161  92.203  87.810  1.00  0.97           C  
ATOM  12004  O   ILE B 690      62.592  91.814  88.830  1.00  0.97           O  
ATOM  12005  CB  ILE B 690      64.891  94.027  88.204  1.00  0.97           C  
ATOM  12006  CG1 ILE B 690      66.073  93.232  87.599  1.00  0.97           C  
ATOM  12007  CG2 ILE B 690      64.827  93.855  89.731  1.00  0.97           C  
ATOM  12008  CD1 ILE B 690      67.443  93.814  87.964  1.00  0.97           C  
ATOM  12009  N   GLY B 691      63.361  91.348  86.800  1.00  0.99           N  
ATOM  12010  CA  GLY B 691      62.840  90.003  86.907  1.00  0.99           C  
ATOM  12011  C   GLY B 691      63.208  89.156  85.742  1.00  0.99           C  
ATOM  12012  O   GLY B 691      63.738  89.606  84.733  1.00  0.99           O  
ATOM  12013  N   THR B 692      62.913  87.867  85.865  1.00  0.96           N  
ATOM  12014  CA  THR B 692      63.098  86.876  84.827  1.00  0.96           C  
ATOM  12015  C   THR B 692      61.836  86.780  83.998  1.00  0.96           C  
ATOM  12016  O   THR B 692      60.772  87.285  84.367  1.00  0.96           O  
ATOM  12017  CB  THR B 692      63.376  85.508  85.423  1.00  0.96           C  
ATOM  12018  OG1 THR B 692      62.399  85.246  86.422  1.00  0.96           O  
ATOM  12019  CG2 THR B 692      64.757  85.526  86.096  1.00  0.96           C  
ATOM  12020  N   MET B 693      61.910  86.112  82.831  1.00  0.93           N  
ATOM  12021  CA  MET B 693      60.747  85.857  82.003  1.00  0.93           C  
ATOM  12022  C   MET B 693      59.912  84.676  82.511  1.00  0.93           C  
ATOM  12023  O   MET B 693      59.792  83.641  81.859  1.00  0.93           O  
ATOM  12024  CB  MET B 693      61.173  85.699  80.518  1.00  0.93           C  
ATOM  12025  CG  MET B 693      60.145  86.249  79.508  1.00  0.93           C  
ATOM  12026  SD  MET B 693      59.722  87.998  79.800  1.00  0.93           S  
ATOM  12027  CE  MET B 693      59.997  88.586  78.112  1.00  0.93           C  
ATOM  12028  N   ASP B 694      59.325  84.834  83.712  1.00  0.93           N  
ATOM  12029  CA  ASP B 694      58.615  83.820  84.460  1.00  0.93           C  
ATOM  12030  C   ASP B 694      57.227  84.338  84.833  1.00  0.93           C  
ATOM  12031  O   ASP B 694      56.960  85.537  84.754  1.00  0.93           O  
ATOM  12032  CB  ASP B 694      59.458  83.513  85.726  1.00  0.93           C  
ATOM  12033  CG  ASP B 694      59.037  82.255  86.447  1.00  0.93           C  
ATOM  12034  OD1 ASP B 694      59.302  82.154  87.667  1.00  0.93           O  
ATOM  12035  OD2 ASP B 694      58.470  81.358  85.778  1.00  0.93           O  
ATOM  12036  N   GLY B 695      56.296  83.438  85.220  1.00  0.96           N  
ATOM  12037  CA  GLY B 695      54.909  83.726  85.605  1.00  0.96           C  
ATOM  12038  C   GLY B 695      54.192  84.836  84.872  1.00  0.96           C  
ATOM  12039  O   GLY B 695      54.040  84.822  83.653  1.00  0.96           O  
ATOM  12040  N   ALA B 696      53.716  85.854  85.608  1.00  0.96           N  
ATOM  12041  CA  ALA B 696      53.013  86.970  85.018  1.00  0.96           C  
ATOM  12042  C   ALA B 696      53.952  88.111  84.659  1.00  0.96           C  
ATOM  12043  O   ALA B 696      53.527  89.093  84.057  1.00  0.96           O  
ATOM  12044  CB  ALA B 696      51.944  87.492  85.992  1.00  0.96           C  
ATOM  12045  N   ASN B 697      55.275  87.983  84.926  1.00  0.95           N  
ATOM  12046  CA  ASN B 697      56.277  88.945  84.479  1.00  0.95           C  
ATOM  12047  C   ASN B 697      56.311  89.006  82.954  1.00  0.95           C  
ATOM  12048  O   ASN B 697      56.492  90.067  82.361  1.00  0.95           O  
ATOM  12049  CB  ASN B 697      57.718  88.622  84.959  1.00  0.95           C  
ATOM  12050  CG  ASN B 697      57.845  88.536  86.478  1.00  0.95           C  
ATOM  12051  OD1 ASN B 697      57.026  89.017  87.264  1.00  0.95           O  
ATOM  12052  ND2 ASN B 697      58.970  87.916  86.908  1.00  0.95           N  
ATOM  12053  N   VAL B 698      56.094  87.846  82.292  1.00  0.95           N  
ATOM  12054  CA  VAL B 698      55.985  87.720  80.843  1.00  0.95           C  
ATOM  12055  C   VAL B 698      54.866  88.567  80.269  1.00  0.95           C  
ATOM  12056  O   VAL B 698      55.063  89.381  79.373  1.00  0.95           O  
ATOM  12057  CB  VAL B 698      55.683  86.276  80.426  1.00  0.95           C  
ATOM  12058  CG1 VAL B 698      55.838  86.127  78.898  1.00  0.95           C  
ATOM  12059  CG2 VAL B 698      56.622  85.304  81.158  1.00  0.95           C  
ATOM  12060  N   GLU B 699      53.656  88.431  80.838  1.00  0.93           N  
ATOM  12061  CA  GLU B 699      52.485  89.182  80.444  1.00  0.93           C  
ATOM  12062  C   GLU B 699      52.600  90.663  80.761  1.00  0.93           C  
ATOM  12063  O   GLU B 699      52.170  91.511  79.989  1.00  0.93           O  
ATOM  12064  CB  GLU B 699      51.216  88.557  81.058  1.00  0.93           C  
ATOM  12065  CG  GLU B 699      50.952  87.158  80.455  1.00  0.93           C  
ATOM  12066  CD  GLU B 699      49.705  86.523  81.020  1.00  0.93           C  
ATOM  12067  OE1 GLU B 699      48.594  87.079  80.788  1.00  0.93           O  
ATOM  12068  OE2 GLU B 699      49.835  85.468  81.691  1.00  0.93           O  
ATOM  12069  N   MET B 700      53.227  91.036  81.896  1.00  0.95           N  
ATOM  12070  CA  MET B 700      53.557  92.416  82.220  1.00  0.95           C  
ATOM  12071  C   MET B 700      54.475  93.046  81.180  1.00  0.95           C  
ATOM  12072  O   MET B 700      54.246  94.169  80.737  1.00  0.95           O  
ATOM  12073  CB  MET B 700      54.236  92.482  83.610  1.00  0.95           C  
ATOM  12074  CG  MET B 700      53.278  92.225  84.789  1.00  0.95           C  
ATOM  12075  SD  MET B 700      54.103  91.829  86.359  1.00  0.95           S  
ATOM  12076  CE  MET B 700      55.141  93.307  86.545  1.00  0.95           C  
ATOM  12077  N   ALA B 701      55.501  92.306  80.719  1.00  0.94           N  
ATOM  12078  CA  ALA B 701      56.350  92.688  79.613  1.00  0.94           C  
ATOM  12079  C   ALA B 701      55.615  92.804  78.280  1.00  0.94           C  
ATOM  12080  O   ALA B 701      55.841  93.753  77.534  1.00  0.94           O  
ATOM  12081  CB  ALA B 701      57.551  91.730  79.513  1.00  0.94           C  
ATOM  12082  N   GLU B 702      54.674  91.888  77.959  1.00  0.90           N  
ATOM  12083  CA  GLU B 702      53.803  92.026  76.797  1.00  0.90           C  
ATOM  12084  C   GLU B 702      52.966  93.317  76.826  1.00  0.90           C  
ATOM  12085  O   GLU B 702      52.934  94.061  75.848  1.00  0.90           O  
ATOM  12086  CB  GLU B 702      52.828  90.812  76.652  1.00  0.90           C  
ATOM  12087  CG  GLU B 702      53.478  89.438  76.305  1.00  0.90           C  
ATOM  12088  CD  GLU B 702      52.471  88.276  76.254  1.00  0.90           C  
ATOM  12089  OE1 GLU B 702      51.478  88.300  77.025  1.00  0.90           O  
ATOM  12090  OE2 GLU B 702      52.685  87.313  75.463  1.00  0.90           O  
ATOM  12091  N   GLU B 703      52.311  93.643  77.963  1.00  0.92           N  
ATOM  12092  CA  GLU B 703      51.489  94.839  78.104  1.00  0.92           C  
ATOM  12093  C   GLU B 703      52.237  96.175  78.078  1.00  0.92           C  
ATOM  12094  O   GLU B 703      51.773  97.126  77.451  1.00  0.92           O  
ATOM  12095  CB  GLU B 703      50.614  94.786  79.384  1.00  0.92           C  
ATOM  12096  CG  GLU B 703      49.645  93.575  79.481  1.00  0.92           C  
ATOM  12097  CD  GLU B 703      48.474  93.581  78.498  1.00  0.92           C  
ATOM  12098  OE1 GLU B 703      47.769  94.613  78.394  1.00  0.92           O  
ATOM  12099  OE2 GLU B 703      48.228  92.492  77.906  1.00  0.92           O  
ATOM  12100  N   ALA B 704      53.408  96.333  78.748  1.00  0.94           N  
ATOM  12101  CA  ALA B 704      54.069  97.636  78.749  1.00  0.94           C  
ATOM  12102  C   ALA B 704      55.156  97.780  77.695  1.00  0.94           C  
ATOM  12103  O   ALA B 704      55.680  98.876  77.506  1.00  0.94           O  
ATOM  12104  CB  ALA B 704      54.694  97.959  80.122  1.00  0.94           C  
ATOM  12105  N   GLY B 705      55.522  96.694  76.986  1.00  0.93           N  
ATOM  12106  CA  GLY B 705      56.732  96.627  76.166  1.00  0.93           C  
ATOM  12107  C   GLY B 705      57.879  96.072  76.976  1.00  0.93           C  
ATOM  12108  O   GLY B 705      58.081  96.432  78.135  1.00  0.93           O  
ATOM  12109  N   GLU B 706      58.683  95.168  76.382  1.00  0.89           N  
ATOM  12110  CA  GLU B 706      59.745  94.425  77.046  1.00  0.89           C  
ATOM  12111  C   GLU B 706      60.868  95.340  77.526  1.00  0.89           C  
ATOM  12112  O   GLU B 706      61.482  95.124  78.570  1.00  0.89           O  
ATOM  12113  CB  GLU B 706      60.264  93.271  76.137  1.00  0.89           C  
ATOM  12114  CG  GLU B 706      61.112  92.204  76.886  1.00  0.89           C  
ATOM  12115  CD  GLU B 706      61.413  90.928  76.091  1.00  0.89           C  
ATOM  12116  OE1 GLU B 706      60.480  90.326  75.507  1.00  0.89           O  
ATOM  12117  OE2 GLU B 706      62.581  90.453  76.139  1.00  0.89           O  
ATOM  12118  N   GLU B 707      61.095  96.446  76.792  1.00  0.88           N  
ATOM  12119  CA  GLU B 707      62.061  97.486  77.052  1.00  0.88           C  
ATOM  12120  C   GLU B 707      61.706  98.384  78.222  1.00  0.88           C  
ATOM  12121  O   GLU B 707      62.556  99.096  78.752  1.00  0.88           O  
ATOM  12122  CB  GLU B 707      62.212  98.385  75.794  1.00  0.88           C  
ATOM  12123  CG  GLU B 707      60.972  99.245  75.393  1.00  0.88           C  
ATOM  12124  CD  GLU B 707      59.860  98.551  74.600  1.00  0.88           C  
ATOM  12125  OE1 GLU B 707      59.071  99.305  73.976  1.00  0.88           O  
ATOM  12126  OE2 GLU B 707      59.756  97.299  74.635  1.00  0.88           O  
ATOM  12127  N   ASN B 708      60.438  98.365  78.682  1.00  0.92           N  
ATOM  12128  CA  ASN B 708      60.007  99.169  79.812  1.00  0.92           C  
ATOM  12129  C   ASN B 708      60.067  98.351  81.099  1.00  0.92           C  
ATOM  12130  O   ASN B 708      59.566  98.763  82.146  1.00  0.92           O  
ATOM  12131  CB  ASN B 708      58.595  99.767  79.580  1.00  0.92           C  
ATOM  12132  CG  ASN B 708      58.664 100.722  78.391  1.00  0.92           C  
ATOM  12133  OD1 ASN B 708      59.285 101.791  78.427  1.00  0.92           O  
ATOM  12134  ND2 ASN B 708      57.982 100.364  77.282  1.00  0.92           N  
ATOM  12135  N   PHE B 709      60.738  97.185  81.041  1.00  0.94           N  
ATOM  12136  CA  PHE B 709      61.017  96.314  82.157  1.00  0.94           C  
ATOM  12137  C   PHE B 709      62.492  95.965  82.136  1.00  0.94           C  
ATOM  12138  O   PHE B 709      63.184  96.067  81.128  1.00  0.94           O  
ATOM  12139  CB  PHE B 709      60.215  94.987  82.057  1.00  0.94           C  
ATOM  12140  CG  PHE B 709      58.812  95.206  82.519  1.00  0.94           C  
ATOM  12141  CD1 PHE B 709      58.488  95.247  83.885  1.00  0.94           C  
ATOM  12142  CD2 PHE B 709      57.803  95.406  81.579  1.00  0.94           C  
ATOM  12143  CE1 PHE B 709      57.174  95.501  84.301  1.00  0.94           C  
ATOM  12144  CE2 PHE B 709      56.518  95.720  82.004  1.00  0.94           C  
ATOM  12145  CZ  PHE B 709      56.196  95.785  83.353  1.00  0.94           C  
ATOM  12146  N   PHE B 710      63.022  95.517  83.285  1.00  0.94           N  
ATOM  12147  CA  PHE B 710      64.392  95.069  83.404  1.00  0.94           C  
ATOM  12148  C   PHE B 710      64.415  93.544  83.425  1.00  0.94           C  
ATOM  12149  O   PHE B 710      64.648  92.891  84.442  1.00  0.94           O  
ATOM  12150  CB  PHE B 710      65.043  95.699  84.660  1.00  0.94           C  
ATOM  12151  CG  PHE B 710      65.326  97.158  84.416  1.00  0.94           C  
ATOM  12152  CD1 PHE B 710      64.515  98.156  84.984  1.00  0.94           C  
ATOM  12153  CD2 PHE B 710      66.431  97.542  83.635  1.00  0.94           C  
ATOM  12154  CE1 PHE B 710      64.804  99.512  84.780  1.00  0.94           C  
ATOM  12155  CE2 PHE B 710      66.718  98.898  83.423  1.00  0.94           C  
ATOM  12156  CZ  PHE B 710      65.904  99.881  83.995  1.00  0.94           C  
ATOM  12157  N   ILE B 711      64.139  92.937  82.253  1.00  0.94           N  
ATOM  12158  CA  ILE B 711      64.150  91.496  82.050  1.00  0.94           C  
ATOM  12159  C   ILE B 711      65.576  90.987  81.869  1.00  0.94           C  
ATOM  12160  O   ILE B 711      66.380  91.574  81.148  1.00  0.94           O  
ATOM  12161  CB  ILE B 711      63.260  91.060  80.880  1.00  0.94           C  
ATOM  12162  CG1 ILE B 711      61.804  91.580  81.032  1.00  0.94           C  
ATOM  12163  CG2 ILE B 711      63.259  89.521  80.716  1.00  0.94           C  
ATOM  12164  CD1 ILE B 711      61.065  91.106  82.294  1.00  0.94           C  
ATOM  12165  N   PHE B 712      65.933  89.874  82.543  1.00  0.94           N  
ATOM  12166  CA  PHE B 712      67.267  89.305  82.482  1.00  0.94           C  
ATOM  12167  C   PHE B 712      67.232  87.791  82.602  1.00  0.94           C  
ATOM  12168  O   PHE B 712      66.202  87.202  82.929  1.00  0.94           O  
ATOM  12169  CB  PHE B 712      68.205  89.894  83.588  1.00  0.94           C  
ATOM  12170  CG  PHE B 712      67.882  89.405  84.988  1.00  0.94           C  
ATOM  12171  CD1 PHE B 712      68.587  88.314  85.534  1.00  0.94           C  
ATOM  12172  CD2 PHE B 712      66.832  89.968  85.730  1.00  0.94           C  
ATOM  12173  CE1 PHE B 712      68.227  87.775  86.774  1.00  0.94           C  
ATOM  12174  CE2 PHE B 712      66.483  89.440  86.980  1.00  0.94           C  
ATOM  12175  CZ  PHE B 712      67.172  88.338  87.498  1.00  0.94           C  
ATOM  12176  N   GLY B 713      68.402  87.153  82.390  1.00  0.97           N  
ATOM  12177  CA  GLY B 713      68.631  85.756  82.720  1.00  0.97           C  
ATOM  12178  C   GLY B 713      67.980  84.737  81.836  1.00  0.97           C  
ATOM  12179  O   GLY B 713      67.373  85.030  80.804  1.00  0.97           O  
ATOM  12180  N   MET B 714      68.138  83.467  82.241  1.00  0.92           N  
ATOM  12181  CA  MET B 714      67.655  82.313  81.517  1.00  0.92           C  
ATOM  12182  C   MET B 714      66.145  82.314  81.297  1.00  0.92           C  
ATOM  12183  O   MET B 714      65.352  82.555  82.206  1.00  0.92           O  
ATOM  12184  CB  MET B 714      68.014  81.003  82.263  1.00  0.92           C  
ATOM  12185  CG  MET B 714      69.523  80.734  82.419  1.00  0.92           C  
ATOM  12186  SD  MET B 714      69.873  79.103  83.152  1.00  0.92           S  
ATOM  12187  CE  MET B 714      69.277  79.500  84.822  1.00  0.92           C  
ATOM  12188  N   ARG B 715      65.692  82.003  80.067  1.00  0.87           N  
ATOM  12189  CA  ARG B 715      64.290  81.774  79.798  1.00  0.87           C  
ATOM  12190  C   ARG B 715      64.008  80.284  79.974  1.00  0.87           C  
ATOM  12191  O   ARG B 715      64.912  79.503  80.258  1.00  0.87           O  
ATOM  12192  CB  ARG B 715      63.884  82.325  78.405  1.00  0.87           C  
ATOM  12193  CG  ARG B 715      64.186  83.836  78.272  1.00  0.87           C  
ATOM  12194  CD  ARG B 715      63.544  84.513  77.053  1.00  0.87           C  
ATOM  12195  NE  ARG B 715      63.926  85.959  77.148  1.00  0.87           N  
ATOM  12196  CZ  ARG B 715      63.283  87.000  76.597  1.00  0.87           C  
ATOM  12197  NH1 ARG B 715      62.223  86.865  75.812  1.00  0.87           N  
ATOM  12198  NH2 ARG B 715      63.726  88.227  76.852  1.00  0.87           N  
ATOM  12199  N   VAL B 716      62.735  79.838  79.855  1.00  0.87           N  
ATOM  12200  CA  VAL B 716      62.332  78.443  80.090  1.00  0.87           C  
ATOM  12201  C   VAL B 716      63.160  77.417  79.308  1.00  0.87           C  
ATOM  12202  O   VAL B 716      63.717  76.492  79.892  1.00  0.87           O  
ATOM  12203  CB  VAL B 716      60.828  78.293  79.814  1.00  0.87           C  
ATOM  12204  CG1 VAL B 716      60.403  76.851  79.451  1.00  0.87           C  
ATOM  12205  CG2 VAL B 716      60.058  78.779  81.060  1.00  0.87           C  
ATOM  12206  N   GLU B 717      63.362  77.621  77.987  1.00  0.80           N  
ATOM  12207  CA  GLU B 717      64.218  76.789  77.161  1.00  0.80           C  
ATOM  12208  C   GLU B 717      65.664  76.719  77.627  1.00  0.80           C  
ATOM  12209  O   GLU B 717      66.288  75.662  77.591  1.00  0.80           O  
ATOM  12210  CB  GLU B 717      64.276  77.333  75.718  1.00  0.80           C  
ATOM  12211  CG  GLU B 717      62.950  77.267  74.936  1.00  0.80           C  
ATOM  12212  CD  GLU B 717      63.162  77.564  73.451  1.00  0.80           C  
ATOM  12213  OE1 GLU B 717      64.336  77.506  72.980  1.00  0.80           O  
ATOM  12214  OE2 GLU B 717      62.143  77.839  72.772  1.00  0.80           O  
ATOM  12215  N   ASP B 718      66.255  77.846  78.057  1.00  0.88           N  
ATOM  12216  CA  ASP B 718      67.622  77.910  78.543  1.00  0.88           C  
ATOM  12217  C   ASP B 718      67.826  77.111  79.829  1.00  0.88           C  
ATOM  12218  O   ASP B 718      68.811  76.386  79.962  1.00  0.88           O  
ATOM  12219  CB  ASP B 718      68.086  79.373  78.703  1.00  0.88           C  
ATOM  12220  CG  ASP B 718      67.708  80.115  77.440  1.00  0.88           C  
ATOM  12221  OD1 ASP B 718      68.296  79.827  76.369  1.00  0.88           O  
ATOM  12222  OD2 ASP B 718      66.764  80.938  77.520  1.00  0.88           O  
ATOM  12223  N   VAL B 719      66.866  77.164  80.783  1.00  0.89           N  
ATOM  12224  CA  VAL B 719      66.851  76.331  81.983  1.00  0.89           C  
ATOM  12225  C   VAL B 719      66.795  74.845  81.640  1.00  0.89           C  
ATOM  12226  O   VAL B 719      67.650  74.077  82.087  1.00  0.89           O  
ATOM  12227  CB  VAL B 719      65.669  76.677  82.894  1.00  0.89           C  
ATOM  12228  CG1 VAL B 719      65.670  75.795  84.161  1.00  0.89           C  
ATOM  12229  CG2 VAL B 719      65.731  78.159  83.314  1.00  0.89           C  
ATOM  12230  N   ASP B 720      65.859  74.430  80.760  1.00  0.82           N  
ATOM  12231  CA  ASP B 720      65.728  73.069  80.263  1.00  0.82           C  
ATOM  12232  C   ASP B 720      66.996  72.570  79.560  1.00  0.82           C  
ATOM  12233  O   ASP B 720      67.501  71.481  79.832  1.00  0.82           O  
ATOM  12234  CB  ASP B 720      64.539  72.984  79.265  1.00  0.82           C  
ATOM  12235  CG  ASP B 720      63.190  73.183  79.946  1.00  0.82           C  
ATOM  12236  OD1 ASP B 720      63.145  73.302  81.194  1.00  0.82           O  
ATOM  12237  OD2 ASP B 720      62.176  73.179  79.201  1.00  0.82           O  
ATOM  12238  N   LYS B 721      67.611  73.387  78.678  1.00  0.79           N  
ATOM  12239  CA  LYS B 721      68.884  73.116  78.020  1.00  0.79           C  
ATOM  12240  C   LYS B 721      70.052  72.943  78.986  1.00  0.79           C  
ATOM  12241  O   LYS B 721      71.034  72.269  78.672  1.00  0.79           O  
ATOM  12242  CB  LYS B 721      69.267  74.245  77.016  1.00  0.79           C  
ATOM  12243  CG  LYS B 721      68.424  74.262  75.727  1.00  0.79           C  
ATOM  12244  CD  LYS B 721      68.666  75.514  74.858  1.00  0.79           C  
ATOM  12245  CE  LYS B 721      67.678  75.621  73.685  1.00  0.79           C  
ATOM  12246  NZ  LYS B 721      67.805  76.922  72.988  1.00  0.79           N  
ATOM  12247  N   LEU B 722      70.001  73.568  80.176  1.00  0.84           N  
ATOM  12248  CA  LEU B 722      71.014  73.422  81.199  1.00  0.84           C  
ATOM  12249  C   LEU B 722      70.795  72.162  82.024  1.00  0.84           C  
ATOM  12250  O   LEU B 722      71.751  71.487  82.395  1.00  0.84           O  
ATOM  12251  CB  LEU B 722      71.076  74.708  82.062  1.00  0.84           C  
ATOM  12252  CG  LEU B 722      72.366  74.929  82.887  1.00  0.84           C  
ATOM  12253  CD1 LEU B 722      73.632  74.910  82.012  1.00  0.84           C  
ATOM  12254  CD2 LEU B 722      72.279  76.281  83.612  1.00  0.84           C  
ATOM  12255  N   ASP B 723      69.535  71.763  82.289  1.00  0.81           N  
ATOM  12256  CA  ASP B 723      69.219  70.481  82.900  1.00  0.81           C  
ATOM  12257  C   ASP B 723      69.627  69.262  82.066  1.00  0.81           C  
ATOM  12258  O   ASP B 723      70.190  68.312  82.602  1.00  0.81           O  
ATOM  12259  CB  ASP B 723      67.740  70.426  83.323  1.00  0.81           C  
ATOM  12260  CG  ASP B 723      67.608  71.240  84.559  1.00  0.81           C  
ATOM  12261  OD1 ASP B 723      68.213  70.937  85.616  1.00  0.81           O  
ATOM  12262  OD2 ASP B 723      66.901  72.265  84.510  1.00  0.81           O  
ATOM  12263  N   GLN B 724      69.434  69.258  80.728  1.00  0.74           N  
ATOM  12264  CA  GLN B 724      69.951  68.199  79.859  1.00  0.74           C  
ATOM  12265  C   GLN B 724      71.473  68.057  79.837  1.00  0.74           C  
ATOM  12266  O   GLN B 724      72.006  66.951  79.837  1.00  0.74           O  
ATOM  12267  CB  GLN B 724      69.481  68.409  78.399  1.00  0.74           C  
ATOM  12268  CG  GLN B 724      67.949  68.299  78.239  1.00  0.74           C  
ATOM  12269  CD  GLN B 724      67.520  68.591  76.802  1.00  0.74           C  
ATOM  12270  OE1 GLN B 724      68.199  69.268  76.030  1.00  0.74           O  
ATOM  12271  NE2 GLN B 724      66.336  68.059  76.418  1.00  0.74           N  
ATOM  12272  N   ARG B 725      72.215  69.180  79.806  1.00  0.72           N  
ATOM  12273  CA  ARG B 725      73.667  69.186  79.892  1.00  0.72           C  
ATOM  12274  C   ARG B 725      74.186  68.775  81.260  1.00  0.72           C  
ATOM  12275  O   ARG B 725      75.234  68.143  81.377  1.00  0.72           O  
ATOM  12276  CB  ARG B 725      74.211  70.589  79.534  1.00  0.72           C  
ATOM  12277  CG  ARG B 725      73.957  70.951  78.059  1.00  0.72           C  
ATOM  12278  CD  ARG B 725      74.305  72.401  77.732  1.00  0.72           C  
ATOM  12279  NE  ARG B 725      73.954  72.601  76.290  1.00  0.72           N  
ATOM  12280  CZ  ARG B 725      74.107  73.762  75.643  1.00  0.72           C  
ATOM  12281  NH1 ARG B 725      73.777  73.844  74.356  1.00  0.72           N  
ATOM  12282  NH2 ARG B 725      74.587  74.835  76.262  1.00  0.72           N  
ATOM  12283  N   GLY B 726      73.456  69.146  82.326  1.00  0.83           N  
ATOM  12284  CA  GLY B 726      73.878  68.961  83.700  1.00  0.83           C  
ATOM  12285  C   GLY B 726      74.388  70.259  84.260  1.00  0.83           C  
ATOM  12286  O   GLY B 726      75.308  70.884  83.740  1.00  0.83           O  
ATOM  12287  N   TYR B 727      73.794  70.718  85.374  1.00  0.85           N  
ATOM  12288  CA  TYR B 727      74.192  71.953  86.021  1.00  0.85           C  
ATOM  12289  C   TYR B 727      75.454  71.771  86.863  1.00  0.85           C  
ATOM  12290  O   TYR B 727      75.457  71.090  87.885  1.00  0.85           O  
ATOM  12291  CB  TYR B 727      73.018  72.491  86.893  1.00  0.85           C  
ATOM  12292  CG  TYR B 727      73.332  73.787  87.618  1.00  0.85           C  
ATOM  12293  CD1 TYR B 727      73.749  74.946  86.936  1.00  0.85           C  
ATOM  12294  CD2 TYR B 727      73.226  73.832  89.019  1.00  0.85           C  
ATOM  12295  CE1 TYR B 727      74.045  76.125  87.645  1.00  0.85           C  
ATOM  12296  CE2 TYR B 727      73.527  75.003  89.724  1.00  0.85           C  
ATOM  12297  CZ  TYR B 727      73.921  76.152  89.039  1.00  0.85           C  
ATOM  12298  OH  TYR B 727      74.152  77.331  89.775  1.00  0.85           O  
ATOM  12299  N   ASN B 728      76.554  72.426  86.453  1.00  0.86           N  
ATOM  12300  CA  ASN B 728      77.802  72.435  87.184  1.00  0.86           C  
ATOM  12301  C   ASN B 728      78.007  73.835  87.745  1.00  0.86           C  
ATOM  12302  O   ASN B 728      78.368  74.781  87.048  1.00  0.86           O  
ATOM  12303  CB  ASN B 728      78.938  72.045  86.205  1.00  0.86           C  
ATOM  12304  CG  ASN B 728      80.291  71.843  86.878  1.00  0.86           C  
ATOM  12305  OD1 ASN B 728      80.434  71.693  88.094  1.00  0.86           O  
ATOM  12306  ND2 ASN B 728      81.343  71.827  86.035  1.00  0.86           N  
ATOM  12307  N   ALA B 729      77.769  74.018  89.055  1.00  0.91           N  
ATOM  12308  CA  ALA B 729      77.805  75.331  89.664  1.00  0.91           C  
ATOM  12309  C   ALA B 729      79.202  75.936  89.793  1.00  0.91           C  
ATOM  12310  O   ALA B 729      79.368  77.156  89.768  1.00  0.91           O  
ATOM  12311  CB  ALA B 729      77.146  75.266  91.047  1.00  0.91           C  
ATOM  12312  N   GLN B 730      80.257  75.101  89.915  1.00  0.82           N  
ATOM  12313  CA  GLN B 730      81.627  75.560  90.122  1.00  0.82           C  
ATOM  12314  C   GLN B 730      82.206  76.376  88.970  1.00  0.82           C  
ATOM  12315  O   GLN B 730      82.973  77.310  89.179  1.00  0.82           O  
ATOM  12316  CB  GLN B 730      82.569  74.413  90.577  1.00  0.82           C  
ATOM  12317  CG  GLN B 730      83.042  73.422  89.490  1.00  0.82           C  
ATOM  12318  CD  GLN B 730      83.647  72.170  90.132  1.00  0.82           C  
ATOM  12319  OE1 GLN B 730      84.570  72.212  90.941  1.00  0.82           O  
ATOM  12320  NE2 GLN B 730      83.093  70.985  89.783  1.00  0.82           N  
ATOM  12321  N   GLU B 731      81.781  76.107  87.718  1.00  0.79           N  
ATOM  12322  CA  GLU B 731      82.198  76.845  86.536  1.00  0.79           C  
ATOM  12323  C   GLU B 731      81.905  78.339  86.602  1.00  0.79           C  
ATOM  12324  O   GLU B 731      82.740  79.164  86.251  1.00  0.79           O  
ATOM  12325  CB  GLU B 731      81.479  76.271  85.293  1.00  0.79           C  
ATOM  12326  CG  GLU B 731      82.081  74.944  84.780  1.00  0.79           C  
ATOM  12327  CD  GLU B 731      81.243  74.352  83.648  1.00  0.79           C  
ATOM  12328  OE1 GLU B 731      80.845  73.166  83.777  1.00  0.79           O  
ATOM  12329  OE2 GLU B 731      81.005  75.077  82.652  1.00  0.79           O  
ATOM  12330  N   TYR B 732      80.715  78.743  87.082  1.00  0.85           N  
ATOM  12331  CA  TYR B 732      80.356  80.139  87.284  1.00  0.85           C  
ATOM  12332  C   TYR B 732      81.198  80.814  88.365  1.00  0.85           C  
ATOM  12333  O   TYR B 732      81.627  81.955  88.215  1.00  0.85           O  
ATOM  12334  CB  TYR B 732      78.852  80.271  87.630  1.00  0.85           C  
ATOM  12335  CG  TYR B 732      78.008  79.671  86.534  1.00  0.85           C  
ATOM  12336  CD1 TYR B 732      77.548  78.345  86.631  1.00  0.85           C  
ATOM  12337  CD2 TYR B 732      77.687  80.420  85.388  1.00  0.85           C  
ATOM  12338  CE1 TYR B 732      76.780  77.779  85.604  1.00  0.85           C  
ATOM  12339  CE2 TYR B 732      76.910  79.858  84.362  1.00  0.85           C  
ATOM  12340  CZ  TYR B 732      76.448  78.541  84.479  1.00  0.85           C  
ATOM  12341  OH  TYR B 732      75.637  77.985  83.472  1.00  0.85           O  
ATOM  12342  N   TYR B 733      81.472  80.100  89.475  1.00  0.82           N  
ATOM  12343  CA  TYR B 733      82.339  80.526  90.564  1.00  0.82           C  
ATOM  12344  C   TYR B 733      83.790  80.764  90.129  1.00  0.82           C  
ATOM  12345  O   TYR B 733      84.350  81.826  90.392  1.00  0.82           O  
ATOM  12346  CB  TYR B 733      82.209  79.422  91.662  1.00  0.82           C  
ATOM  12347  CG  TYR B 733      83.195  79.477  92.799  1.00  0.82           C  
ATOM  12348  CD1 TYR B 733      82.994  80.343  93.886  1.00  0.82           C  
ATOM  12349  CD2 TYR B 733      84.302  78.609  92.811  1.00  0.82           C  
ATOM  12350  CE1 TYR B 733      83.881  80.330  94.974  1.00  0.82           C  
ATOM  12351  CE2 TYR B 733      85.186  78.593  93.898  1.00  0.82           C  
ATOM  12352  CZ  TYR B 733      84.972  79.454  94.977  1.00  0.82           C  
ATOM  12353  OH  TYR B 733      85.866  79.456  96.061  1.00  0.82           O  
ATOM  12354  N   ASP B 734      84.412  79.811  89.411  1.00  0.80           N  
ATOM  12355  CA  ASP B 734      85.766  79.951  88.910  1.00  0.80           C  
ATOM  12356  C   ASP B 734      85.883  80.942  87.751  1.00  0.80           C  
ATOM  12357  O   ASP B 734      86.864  81.672  87.623  1.00  0.80           O  
ATOM  12358  CB  ASP B 734      86.350  78.564  88.539  1.00  0.80           C  
ATOM  12359  CG  ASP B 734      86.520  77.725  89.798  1.00  0.80           C  
ATOM  12360  OD1 ASP B 734      87.003  78.278  90.819  1.00  0.80           O  
ATOM  12361  OD2 ASP B 734      86.175  76.518  89.748  1.00  0.80           O  
ATOM  12362  N   ARG B 735      84.886  80.996  86.845  1.00  0.77           N  
ATOM  12363  CA  ARG B 735      84.861  81.930  85.731  1.00  0.77           C  
ATOM  12364  C   ARG B 735      84.624  83.392  86.110  1.00  0.77           C  
ATOM  12365  O   ARG B 735      85.206  84.294  85.509  1.00  0.77           O  
ATOM  12366  CB  ARG B 735      83.825  81.471  84.671  1.00  0.77           C  
ATOM  12367  CG  ARG B 735      83.830  82.254  83.344  1.00  0.77           C  
ATOM  12368  CD  ARG B 735      82.917  81.623  82.288  1.00  0.77           C  
ATOM  12369  NE  ARG B 735      82.964  82.516  81.087  1.00  0.77           N  
ATOM  12370  CZ  ARG B 735      82.292  82.289  79.951  1.00  0.77           C  
ATOM  12371  NH1 ARG B 735      82.351  83.188  78.971  1.00  0.77           N  
ATOM  12372  NH2 ARG B 735      81.577  81.183  79.774  1.00  0.77           N  
ATOM  12373  N   ILE B 736      83.746  83.688  87.094  1.00  0.85           N  
ATOM  12374  CA  ILE B 736      83.366  85.059  87.420  1.00  0.85           C  
ATOM  12375  C   ILE B 736      84.035  85.506  88.726  1.00  0.85           C  
ATOM  12376  O   ILE B 736      83.633  85.064  89.807  1.00  0.85           O  
ATOM  12377  CB  ILE B 736      81.846  85.225  87.529  1.00  0.85           C  
ATOM  12378  CG1 ILE B 736      81.161  84.862  86.187  1.00  0.85           C  
ATOM  12379  CG2 ILE B 736      81.467  86.670  87.943  1.00  0.85           C  
ATOM  12380  CD1 ILE B 736      79.635  84.747  86.287  1.00  0.85           C  
ATOM  12381  N   PRO B 737      85.029  86.410  88.733  1.00  0.88           N  
ATOM  12382  CA  PRO B 737      85.773  86.764  89.942  1.00  0.88           C  
ATOM  12383  C   PRO B 737      84.944  87.528  90.953  1.00  0.88           C  
ATOM  12384  O   PRO B 737      85.221  87.409  92.145  1.00  0.88           O  
ATOM  12385  CB  PRO B 737      86.963  87.590  89.420  1.00  0.88           C  
ATOM  12386  CG  PRO B 737      86.484  88.148  88.077  1.00  0.88           C  
ATOM  12387  CD  PRO B 737      85.627  87.007  87.536  1.00  0.88           C  
ATOM  12388  N   GLU B 738      83.932  88.304  90.517  1.00  0.84           N  
ATOM  12389  CA  GLU B 738      82.984  88.961  91.402  1.00  0.84           C  
ATOM  12390  C   GLU B 738      82.190  87.965  92.245  1.00  0.84           C  
ATOM  12391  O   GLU B 738      82.027  88.128  93.449  1.00  0.84           O  
ATOM  12392  CB  GLU B 738      81.964  89.769  90.568  1.00  0.84           C  
ATOM  12393  CG  GLU B 738      82.559  91.000  89.847  1.00  0.84           C  
ATOM  12394  CD  GLU B 738      82.126  92.308  90.493  1.00  0.84           C  
ATOM  12395  OE1 GLU B 738      81.211  92.914  89.896  1.00  0.84           O  
ATOM  12396  OE2 GLU B 738      82.639  92.744  91.549  1.00  0.84           O  
ATOM  12397  N   LEU B 739      81.700  86.867  91.622  1.00  0.87           N  
ATOM  12398  CA  LEU B 739      80.980  85.794  92.292  1.00  0.87           C  
ATOM  12399  C   LEU B 739      81.850  85.048  93.290  1.00  0.87           C  
ATOM  12400  O   LEU B 739      81.435  84.766  94.413  1.00  0.87           O  
ATOM  12401  CB  LEU B 739      80.409  84.789  91.257  1.00  0.87           C  
ATOM  12402  CG  LEU B 739      79.499  83.671  91.819  1.00  0.87           C  
ATOM  12403  CD1 LEU B 739      78.373  84.201  92.720  1.00  0.87           C  
ATOM  12404  CD2 LEU B 739      78.889  82.878  90.655  1.00  0.87           C  
ATOM  12405  N   ARG B 740      83.111  84.753  92.917  1.00  0.81           N  
ATOM  12406  CA  ARG B 740      84.066  84.079  93.776  1.00  0.81           C  
ATOM  12407  C   ARG B 740      84.322  84.785  95.105  1.00  0.81           C  
ATOM  12408  O   ARG B 740      84.245  84.160  96.159  1.00  0.81           O  
ATOM  12409  CB  ARG B 740      85.409  83.932  93.023  1.00  0.81           C  
ATOM  12410  CG  ARG B 740      86.459  83.112  93.798  1.00  0.81           C  
ATOM  12411  CD  ARG B 740      87.827  82.968  93.121  1.00  0.81           C  
ATOM  12412  NE  ARG B 740      88.409  84.349  92.952  1.00  0.81           N  
ATOM  12413  CZ  ARG B 740      89.051  85.018  93.917  1.00  0.81           C  
ATOM  12414  NH1 ARG B 740      89.442  86.272  93.705  1.00  0.81           N  
ATOM  12415  NH2 ARG B 740      89.406  84.481  95.071  1.00  0.81           N  
ATOM  12416  N   GLN B 741      84.551  86.118  95.104  1.00  0.85           N  
ATOM  12417  CA  GLN B 741      84.760  86.899  96.318  1.00  0.85           C  
ATOM  12418  C   GLN B 741      83.564  86.882  97.260  1.00  0.85           C  
ATOM  12419  O   GLN B 741      83.711  86.730  98.473  1.00  0.85           O  
ATOM  12420  CB  GLN B 741      85.079  88.377  95.979  1.00  0.85           C  
ATOM  12421  CG  GLN B 741      86.462  88.573  95.316  1.00  0.85           C  
ATOM  12422  CD  GLN B 741      86.725  90.046  94.998  1.00  0.85           C  
ATOM  12423  OE1 GLN B 741      85.831  90.871  94.828  1.00  0.85           O  
ATOM  12424  NE2 GLN B 741      88.026  90.408  94.905  1.00  0.85           N  
ATOM  12425  N   VAL B 742      82.338  86.997  96.708  1.00  0.89           N  
ATOM  12426  CA  VAL B 742      81.095  86.889  97.458  1.00  0.89           C  
ATOM  12427  C   VAL B 742      80.966  85.536  98.158  1.00  0.89           C  
ATOM  12428  O   VAL B 742      80.735  85.461  99.362  1.00  0.89           O  
ATOM  12429  CB  VAL B 742      79.903  87.076  96.513  1.00  0.89           C  
ATOM  12430  CG1 VAL B 742      78.567  86.819  97.236  1.00  0.89           C  
ATOM  12431  CG2 VAL B 742      79.900  88.504  95.934  1.00  0.89           C  
ATOM  12432  N   ILE B 743      81.168  84.419  97.429  1.00  0.86           N  
ATOM  12433  CA  ILE B 743      81.094  83.066  97.974  1.00  0.86           C  
ATOM  12434  C   ILE B 743      82.207  82.748  98.978  1.00  0.86           C  
ATOM  12435  O   ILE B 743      81.951  82.121 100.007  1.00  0.86           O  
ATOM  12436  CB  ILE B 743      80.964  82.015  96.870  1.00  0.86           C  
ATOM  12437  CG1 ILE B 743      79.726  82.273  95.965  1.00  0.86           C  
ATOM  12438  CG2 ILE B 743      80.897  80.587  97.463  1.00  0.86           C  
ATOM  12439  CD1 ILE B 743      78.373  82.340  96.691  1.00  0.86           C  
ATOM  12440  N   GLU B 744      83.458  83.209  98.750  1.00  0.85           N  
ATOM  12441  CA  GLU B 744      84.561  83.105  99.703  1.00  0.85           C  
ATOM  12442  C   GLU B 744      84.297  83.820 101.020  1.00  0.85           C  
ATOM  12443  O   GLU B 744      84.584  83.293 102.091  1.00  0.85           O  
ATOM  12444  CB  GLU B 744      85.877  83.658  99.101  1.00  0.85           C  
ATOM  12445  CG  GLU B 744      86.467  82.732  98.011  1.00  0.85           C  
ATOM  12446  CD  GLU B 744      87.650  83.314  97.254  1.00  0.85           C  
ATOM  12447  OE1 GLU B 744      87.968  84.528  97.367  1.00  0.85           O  
ATOM  12448  OE2 GLU B 744      88.255  82.552  96.449  1.00  0.85           O  
ATOM  12449  N   GLN B 745      83.706  85.032 100.996  1.00  0.86           N  
ATOM  12450  CA  GLN B 745      83.293  85.737 102.203  1.00  0.86           C  
ATOM  12451  C   GLN B 745      82.225  84.995 103.006  1.00  0.86           C  
ATOM  12452  O   GLN B 745      82.284  84.931 104.236  1.00  0.86           O  
ATOM  12453  CB  GLN B 745      82.776  87.158 101.863  1.00  0.86           C  
ATOM  12454  CG  GLN B 745      83.890  88.161 101.479  1.00  0.86           C  
ATOM  12455  CD  GLN B 745      83.292  89.478 100.980  1.00  0.86           C  
ATOM  12456  OE1 GLN B 745      82.288  89.500 100.267  1.00  0.86           O  
ATOM  12457  NE2 GLN B 745      83.929  90.615 101.343  1.00  0.86           N  
ATOM  12458  N   LEU B 746      81.225  84.400 102.325  1.00  0.88           N  
ATOM  12459  CA  LEU B 746      80.216  83.556 102.942  1.00  0.88           C  
ATOM  12460  C   LEU B 746      80.780  82.289 103.564  1.00  0.88           C  
ATOM  12461  O   LEU B 746      80.399  81.893 104.663  1.00  0.88           O  
ATOM  12462  CB  LEU B 746      79.139  83.162 101.900  1.00  0.88           C  
ATOM  12463  CG  LEU B 746      78.349  84.352 101.327  1.00  0.88           C  
ATOM  12464  CD1 LEU B 746      77.387  83.905 100.223  1.00  0.88           C  
ATOM  12465  CD2 LEU B 746      77.633  85.146 102.409  1.00  0.88           C  
ATOM  12466  N   SER B 747      81.708  81.609 102.868  1.00  0.86           N  
ATOM  12467  CA  SER B 747      82.311  80.379 103.345  1.00  0.86           C  
ATOM  12468  C   SER B 747      83.336  80.556 104.452  1.00  0.86           C  
ATOM  12469  O   SER B 747      83.422  79.714 105.345  1.00  0.86           O  
ATOM  12470  CB  SER B 747      82.869  79.536 102.167  1.00  0.86           C  
ATOM  12471  OG  SER B 747      84.024  80.121 101.570  1.00  0.86           O  
ATOM  12472  N   SER B 748      84.138  81.642 104.418  1.00  0.89           N  
ATOM  12473  CA  SER B 748      85.175  81.913 105.402  1.00  0.89           C  
ATOM  12474  C   SER B 748      84.674  82.462 106.720  1.00  0.89           C  
ATOM  12475  O   SER B 748      85.321  82.279 107.749  1.00  0.89           O  
ATOM  12476  CB  SER B 748      86.248  82.895 104.846  1.00  0.89           C  
ATOM  12477  OG  SER B 748      85.747  84.222 104.641  1.00  0.89           O  
ATOM  12478  N   GLY B 749      83.512  83.147 106.733  1.00  0.90           N  
ATOM  12479  CA  GLY B 749      82.962  83.693 107.969  1.00  0.90           C  
ATOM  12480  C   GLY B 749      83.093  85.181 108.090  1.00  0.90           C  
ATOM  12481  O   GLY B 749      83.019  85.721 109.188  1.00  0.90           O  
ATOM  12482  N   PHE B 750      83.262  85.922 106.975  1.00  0.89           N  
ATOM  12483  CA  PHE B 750      83.356  87.381 106.964  1.00  0.89           C  
ATOM  12484  C   PHE B 750      82.108  88.034 107.569  1.00  0.89           C  
ATOM  12485  O   PHE B 750      82.177  89.001 108.324  1.00  0.89           O  
ATOM  12486  CB  PHE B 750      83.565  87.865 105.497  1.00  0.89           C  
ATOM  12487  CG  PHE B 750      83.999  89.307 105.412  1.00  0.89           C  
ATOM  12488  CD1 PHE B 750      85.349  89.651 105.595  1.00  0.89           C  
ATOM  12489  CD2 PHE B 750      83.069  90.328 105.148  1.00  0.89           C  
ATOM  12490  CE1 PHE B 750      85.763  90.989 105.535  1.00  0.89           C  
ATOM  12491  CE2 PHE B 750      83.479  91.667 105.081  1.00  0.89           C  
ATOM  12492  CZ  PHE B 750      84.827  91.998 105.278  1.00  0.89           C  
ATOM  12493  N   PHE B 751      80.922  87.459 107.288  1.00  0.89           N  
ATOM  12494  CA  PHE B 751      79.648  87.918 107.819  1.00  0.89           C  
ATOM  12495  C   PHE B 751      79.242  87.175 109.091  1.00  0.89           C  
ATOM  12496  O   PHE B 751      78.148  87.354 109.622  1.00  0.89           O  
ATOM  12497  CB  PHE B 751      78.509  87.727 106.780  1.00  0.89           C  
ATOM  12498  CG  PHE B 751      78.819  88.485 105.521  1.00  0.89           C  
ATOM  12499  CD1 PHE B 751      78.648  89.876 105.502  1.00  0.89           C  
ATOM  12500  CD2 PHE B 751      79.298  87.840 104.369  1.00  0.89           C  
ATOM  12501  CE1 PHE B 751      78.944  90.617 104.353  1.00  0.89           C  
ATOM  12502  CE2 PHE B 751      79.615  88.580 103.224  1.00  0.89           C  
ATOM  12503  CZ  PHE B 751      79.446  89.968 103.220  1.00  0.89           C  
ATOM  12504  N   SER B 752      80.118  86.332 109.656  1.00  0.88           N  
ATOM  12505  CA  SER B 752      79.808  85.575 110.860  1.00  0.88           C  
ATOM  12506  C   SER B 752      81.056  85.248 111.664  1.00  0.88           C  
ATOM  12507  O   SER B 752      81.279  84.071 111.939  1.00  0.88           O  
ATOM  12508  CB  SER B 752      79.033  84.250 110.566  1.00  0.88           C  
ATOM  12509  OG  SER B 752      79.589  83.526 109.466  1.00  0.88           O  
ATOM  12510  N   PRO B 753      81.879  86.202 112.140  1.00  0.87           N  
ATOM  12511  CA  PRO B 753      83.202  85.935 112.726  1.00  0.87           C  
ATOM  12512  C   PRO B 753      83.171  85.004 113.925  1.00  0.87           C  
ATOM  12513  O   PRO B 753      84.160  84.348 114.226  1.00  0.87           O  
ATOM  12514  CB  PRO B 753      83.731  87.333 113.124  1.00  0.87           C  
ATOM  12515  CG  PRO B 753      82.977  88.301 112.211  1.00  0.87           C  
ATOM  12516  CD  PRO B 753      81.605  87.645 112.090  1.00  0.87           C  
ATOM  12517  N   LYS B 754      82.040  84.956 114.653  1.00  0.81           N  
ATOM  12518  CA  LYS B 754      81.852  84.085 115.793  1.00  0.81           C  
ATOM  12519  C   LYS B 754      81.538  82.643 115.415  1.00  0.81           C  
ATOM  12520  O   LYS B 754      81.672  81.741 116.232  1.00  0.81           O  
ATOM  12521  CB  LYS B 754      80.639  84.579 116.624  1.00  0.81           C  
ATOM  12522  CG  LYS B 754      80.680  86.058 117.049  1.00  0.81           C  
ATOM  12523  CD  LYS B 754      81.813  86.384 118.038  1.00  0.81           C  
ATOM  12524  CE  LYS B 754      81.801  87.854 118.476  1.00  0.81           C  
ATOM  12525  NZ  LYS B 754      82.864  88.108 119.475  1.00  0.81           N  
ATOM  12526  N   GLN B 755      81.091  82.379 114.175  1.00  0.84           N  
ATOM  12527  CA  GLN B 755      80.647  81.066 113.744  1.00  0.84           C  
ATOM  12528  C   GLN B 755      81.020  80.884 112.276  1.00  0.84           C  
ATOM  12529  O   GLN B 755      80.156  81.054 111.410  1.00  0.84           O  
ATOM  12530  CB  GLN B 755      79.107  80.877 113.882  1.00  0.84           C  
ATOM  12531  CG  GLN B 755      78.577  80.830 115.333  1.00  0.84           C  
ATOM  12532  CD  GLN B 755      77.060  80.993 115.361  1.00  0.84           C  
ATOM  12533  OE1 GLN B 755      76.278  80.048 115.293  1.00  0.84           O  
ATOM  12534  NE2 GLN B 755      76.603  82.264 115.460  1.00  0.84           N  
ATOM  12535  N   PRO B 756      82.260  80.546 111.907  1.00  0.89           N  
ATOM  12536  CA  PRO B 756      82.668  80.583 110.502  1.00  0.89           C  
ATOM  12537  C   PRO B 756      82.020  79.501 109.658  1.00  0.89           C  
ATOM  12538  O   PRO B 756      81.960  79.623 108.440  1.00  0.89           O  
ATOM  12539  CB  PRO B 756      84.194  80.410 110.557  1.00  0.89           C  
ATOM  12540  CG  PRO B 756      84.575  81.012 111.909  1.00  0.89           C  
ATOM  12541  CD  PRO B 756      83.428  80.546 112.802  1.00  0.89           C  
ATOM  12542  N   ASP B 757      81.522  78.415 110.281  1.00  0.84           N  
ATOM  12543  CA  ASP B 757      80.974  77.280 109.568  1.00  0.84           C  
ATOM  12544  C   ASP B 757      79.457  77.426 109.391  1.00  0.84           C  
ATOM  12545  O   ASP B 757      78.786  76.603 108.777  1.00  0.84           O  
ATOM  12546  CB  ASP B 757      81.328  75.992 110.372  1.00  0.84           C  
ATOM  12547  CG  ASP B 757      81.438  74.755 109.496  1.00  0.84           C  
ATOM  12548  OD1 ASP B 757      81.288  74.902 108.260  1.00  0.84           O  
ATOM  12549  OD2 ASP B 757      81.740  73.665 110.029  1.00  0.84           O  
ATOM  12550  N   LEU B 758      78.874  78.539 109.879  1.00  0.89           N  
ATOM  12551  CA  LEU B 758      77.438  78.757 109.971  1.00  0.89           C  
ATOM  12552  C   LEU B 758      76.675  78.638 108.664  1.00  0.89           C  
ATOM  12553  O   LEU B 758      75.584  78.083 108.612  1.00  0.89           O  
ATOM  12554  CB  LEU B 758      77.201  80.174 110.549  1.00  0.89           C  
ATOM  12555  CG  LEU B 758      75.745  80.566 110.866  1.00  0.89           C  
ATOM  12556  CD1 LEU B 758      75.118  79.595 111.875  1.00  0.89           C  
ATOM  12557  CD2 LEU B 758      75.712  82.006 111.402  1.00  0.89           C  
ATOM  12558  N   PHE B 759      77.233  79.138 107.552  1.00  0.90           N  
ATOM  12559  CA  PHE B 759      76.542  79.140 106.277  1.00  0.90           C  
ATOM  12560  C   PHE B 759      76.980  77.981 105.389  1.00  0.90           C  
ATOM  12561  O   PHE B 759      76.816  78.021 104.170  1.00  0.90           O  
ATOM  12562  CB  PHE B 759      76.761  80.494 105.547  1.00  0.90           C  
ATOM  12563  CG  PHE B 759      76.247  81.644 106.384  1.00  0.90           C  
ATOM  12564  CD1 PHE B 759      74.925  81.660 106.868  1.00  0.90           C  
ATOM  12565  CD2 PHE B 759      77.092  82.723 106.701  1.00  0.90           C  
ATOM  12566  CE1 PHE B 759      74.464  82.718 107.662  1.00  0.90           C  
ATOM  12567  CE2 PHE B 759      76.636  83.783 107.497  1.00  0.90           C  
ATOM  12568  CZ  PHE B 759      75.321  83.778 107.980  1.00  0.90           C  
ATOM  12569  N   LYS B 760      77.545  76.891 105.961  1.00  0.82           N  
ATOM  12570  CA  LYS B 760      78.008  75.739 105.198  1.00  0.82           C  
ATOM  12571  C   LYS B 760      76.920  75.025 104.409  1.00  0.82           C  
ATOM  12572  O   LYS B 760      77.127  74.668 103.251  1.00  0.82           O  
ATOM  12573  CB  LYS B 760      78.759  74.727 106.093  1.00  0.82           C  
ATOM  12574  CG  LYS B 760      79.675  73.739 105.341  1.00  0.82           C  
ATOM  12575  CD  LYS B 760      80.811  74.358 104.489  1.00  0.82           C  
ATOM  12576  CE  LYS B 760      82.072  74.867 105.214  1.00  0.82           C  
ATOM  12577  NZ  LYS B 760      81.836  76.046 106.056  1.00  0.82           N  
ATOM  12578  N   ASP B 761      75.715  74.876 104.988  1.00  0.87           N  
ATOM  12579  CA  ASP B 761      74.527  74.339 104.348  1.00  0.87           C  
ATOM  12580  C   ASP B 761      74.159  75.088 103.067  1.00  0.87           C  
ATOM  12581  O   ASP B 761      73.900  74.495 102.020  1.00  0.87           O  
ATOM  12582  CB  ASP B 761      73.333  74.477 105.327  1.00  0.87           C  
ATOM  12583  CG  ASP B 761      73.544  73.700 106.617  1.00  0.87           C  
ATOM  12584  OD1 ASP B 761      72.678  73.866 107.510  1.00  0.87           O  
ATOM  12585  OD2 ASP B 761      74.550  72.963 106.732  1.00  0.87           O  
ATOM  12586  N   ILE B 762      74.208  76.439 103.117  1.00  0.91           N  
ATOM  12587  CA  ILE B 762      73.995  77.328 101.981  1.00  0.91           C  
ATOM  12588  C   ILE B 762      75.013  77.090 100.879  1.00  0.91           C  
ATOM  12589  O   ILE B 762      74.668  76.950  99.708  1.00  0.91           O  
ATOM  12590  CB  ILE B 762      74.072  78.811 102.375  1.00  0.91           C  
ATOM  12591  CG1 ILE B 762      73.220  79.077 103.642  1.00  0.91           C  
ATOM  12592  CG2 ILE B 762      73.638  79.689 101.173  1.00  0.91           C  
ATOM  12593  CD1 ILE B 762      72.993  80.560 103.952  1.00  0.91           C  
ATOM  12594  N   VAL B 763      76.308  76.989 101.243  1.00  0.87           N  
ATOM  12595  CA  VAL B 763      77.392  76.717 100.309  1.00  0.87           C  
ATOM  12596  C   VAL B 763      77.244  75.347  99.672  1.00  0.87           C  
ATOM  12597  O   VAL B 763      77.347  75.203  98.456  1.00  0.87           O  
ATOM  12598  CB  VAL B 763      78.761  76.846 100.987  1.00  0.87           C  
ATOM  12599  CG1 VAL B 763      79.918  76.435 100.046  1.00  0.87           C  
ATOM  12600  CG2 VAL B 763      78.952  78.309 101.434  1.00  0.87           C  
ATOM  12601  N   ASN B 764      76.941  74.302 100.468  1.00  0.82           N  
ATOM  12602  CA  ASN B 764      76.786  72.949  99.966  1.00  0.82           C  
ATOM  12603  C   ASN B 764      75.611  72.814  98.995  1.00  0.82           C  
ATOM  12604  O   ASN B 764      75.750  72.213  97.929  1.00  0.82           O  
ATOM  12605  CB  ASN B 764      76.684  71.945 101.146  1.00  0.82           C  
ATOM  12606  CG  ASN B 764      77.375  70.634 100.785  1.00  0.82           C  
ATOM  12607  OD1 ASN B 764      78.578  70.590 100.530  1.00  0.82           O  
ATOM  12608  ND2 ASN B 764      76.609  69.523 100.767  1.00  0.82           N  
ATOM  12609  N   MET B 765      74.451  73.440  99.309  1.00  0.87           N  
ATOM  12610  CA  MET B 765      73.330  73.551  98.389  1.00  0.87           C  
ATOM  12611  C   MET B 765      73.685  74.252  97.086  1.00  0.87           C  
ATOM  12612  O   MET B 765      73.464  73.697  96.014  1.00  0.87           O  
ATOM  12613  CB  MET B 765      72.147  74.306  99.062  1.00  0.87           C  
ATOM  12614  CG  MET B 765      70.842  74.375  98.229  1.00  0.87           C  
ATOM  12615  SD  MET B 765      70.767  75.692  96.966  1.00  0.87           S  
ATOM  12616  CE  MET B 765      70.263  77.034  98.071  1.00  0.87           C  
ATOM  12617  N   LEU B 766      74.316  75.446  97.134  1.00  0.91           N  
ATOM  12618  CA  LEU B 766      74.656  76.222  95.950  1.00  0.91           C  
ATOM  12619  C   LEU B 766      75.578  75.483  94.996  1.00  0.91           C  
ATOM  12620  O   LEU B 766      75.401  75.519  93.781  1.00  0.91           O  
ATOM  12621  CB  LEU B 766      75.331  77.560  96.356  1.00  0.91           C  
ATOM  12622  CG  LEU B 766      74.357  78.630  96.895  1.00  0.91           C  
ATOM  12623  CD1 LEU B 766      75.127  79.787  97.553  1.00  0.91           C  
ATOM  12624  CD2 LEU B 766      73.455  79.176  95.778  1.00  0.91           C  
ATOM  12625  N   MET B 767      76.595  74.784  95.525  1.00  0.80           N  
ATOM  12626  CA  MET B 767      77.505  74.012  94.710  1.00  0.80           C  
ATOM  12627  C   MET B 767      76.924  72.729  94.114  1.00  0.80           C  
ATOM  12628  O   MET B 767      77.130  72.467  92.931  1.00  0.80           O  
ATOM  12629  CB  MET B 767      78.795  73.696  95.506  1.00  0.80           C  
ATOM  12630  CG  MET B 767      79.532  74.962  96.003  1.00  0.80           C  
ATOM  12631  SD  MET B 767      79.970  76.181  94.731  1.00  0.80           S  
ATOM  12632  CE  MET B 767      81.234  75.202  93.890  1.00  0.80           C  
ATOM  12633  N   HIS B 768      76.198  71.896  94.896  1.00  0.81           N  
ATOM  12634  CA  HIS B 768      75.872  70.540  94.448  1.00  0.81           C  
ATOM  12635  C   HIS B 768      74.399  70.186  94.380  1.00  0.81           C  
ATOM  12636  O   HIS B 768      74.047  69.161  93.802  1.00  0.81           O  
ATOM  12637  CB  HIS B 768      76.478  69.509  95.427  1.00  0.81           C  
ATOM  12638  CG  HIS B 768      77.970  69.517  95.431  1.00  0.81           C  
ATOM  12639  ND1 HIS B 768      78.648  69.015  94.339  1.00  0.81           N  
ATOM  12640  CD2 HIS B 768      78.848  69.943  96.376  1.00  0.81           C  
ATOM  12641  CE1 HIS B 768      79.924  69.143  94.634  1.00  0.81           C  
ATOM  12642  NE2 HIS B 768      80.102  69.699  95.857  1.00  0.81           N  
ATOM  12643  N   HIS B 769      73.481  70.986  94.950  1.00  0.85           N  
ATOM  12644  CA  HIS B 769      72.087  70.565  95.035  1.00  0.85           C  
ATOM  12645  C   HIS B 769      71.130  71.657  94.623  1.00  0.85           C  
ATOM  12646  O   HIS B 769      69.919  71.524  94.788  1.00  0.85           O  
ATOM  12647  CB  HIS B 769      71.719  70.117  96.472  1.00  0.85           C  
ATOM  12648  CG  HIS B 769      72.485  68.909  96.921  1.00  0.85           C  
ATOM  12649  ND1 HIS B 769      73.599  69.038  97.729  1.00  0.85           N  
ATOM  12650  CD2 HIS B 769      72.268  67.599  96.627  1.00  0.85           C  
ATOM  12651  CE1 HIS B 769      74.039  67.809  97.907  1.00  0.85           C  
ATOM  12652  NE2 HIS B 769      73.270  66.900  97.263  1.00  0.85           N  
ATOM  12653  N   ASP B 770      71.628  72.761  94.050  1.00  0.92           N  
ATOM  12654  CA  ASP B 770      70.817  73.847  93.568  1.00  0.92           C  
ATOM  12655  C   ASP B 770      70.009  73.453  92.330  1.00  0.92           C  
ATOM  12656  O   ASP B 770      70.490  73.382  91.200  1.00  0.92           O  
ATOM  12657  CB  ASP B 770      71.720  75.089  93.360  1.00  0.92           C  
ATOM  12658  CG  ASP B 770      70.966  76.339  92.971  1.00  0.92           C  
ATOM  12659  OD1 ASP B 770      69.709  76.316  92.984  1.00  0.92           O  
ATOM  12660  OD2 ASP B 770      71.636  77.329  92.576  1.00  0.92           O  
ATOM  12661  N   ARG B 771      68.705  73.209  92.547  1.00  0.83           N  
ATOM  12662  CA  ARG B 771      67.733  72.981  91.503  1.00  0.83           C  
ATOM  12663  C   ARG B 771      67.400  74.256  90.750  1.00  0.83           C  
ATOM  12664  O   ARG B 771      66.978  74.222  89.592  1.00  0.83           O  
ATOM  12665  CB  ARG B 771      66.416  72.413  92.105  1.00  0.83           C  
ATOM  12666  CG  ARG B 771      66.192  70.931  91.743  1.00  0.83           C  
ATOM  12667  CD  ARG B 771      64.762  70.426  91.963  1.00  0.83           C  
ATOM  12668  NE  ARG B 771      64.488  70.575  93.421  1.00  0.83           N  
ATOM  12669  CZ  ARG B 771      63.287  70.847  93.942  1.00  0.83           C  
ATOM  12670  NH1 ARG B 771      62.175  70.839  93.217  1.00  0.83           N  
ATOM  12671  NH2 ARG B 771      63.197  71.157  95.228  1.00  0.83           N  
ATOM  12672  N   PHE B 772      67.569  75.412  91.411  1.00  0.92           N  
ATOM  12673  CA  PHE B 772      66.996  76.669  90.992  1.00  0.92           C  
ATOM  12674  C   PHE B 772      68.045  77.562  90.353  1.00  0.92           C  
ATOM  12675  O   PHE B 772      67.735  78.614  89.798  1.00  0.92           O  
ATOM  12676  CB  PHE B 772      66.334  77.355  92.217  1.00  0.92           C  
ATOM  12677  CG  PHE B 772      65.199  76.485  92.700  1.00  0.92           C  
ATOM  12678  CD1 PHE B 772      64.114  76.196  91.853  1.00  0.92           C  
ATOM  12679  CD2 PHE B 772      65.224  75.916  93.984  1.00  0.92           C  
ATOM  12680  CE1 PHE B 772      63.080  75.349  92.276  1.00  0.92           C  
ATOM  12681  CE2 PHE B 772      64.183  75.085  94.421  1.00  0.92           C  
ATOM  12682  CZ  PHE B 772      63.113  74.796  93.564  1.00  0.92           C  
ATOM  12683  N   LYS B 773      69.307  77.112  90.343  1.00  0.91           N  
ATOM  12684  CA  LYS B 773      70.401  77.543  89.498  1.00  0.91           C  
ATOM  12685  C   LYS B 773      70.800  79.001  89.697  1.00  0.91           C  
ATOM  12686  O   LYS B 773      70.823  79.800  88.763  1.00  0.91           O  
ATOM  12687  CB  LYS B 773      70.099  77.226  88.008  1.00  0.91           C  
ATOM  12688  CG  LYS B 773      69.773  75.753  87.683  1.00  0.91           C  
ATOM  12689  CD  LYS B 773      69.095  75.672  86.305  1.00  0.91           C  
ATOM  12690  CE  LYS B 773      68.885  74.273  85.730  1.00  0.91           C  
ATOM  12691  NZ  LYS B 773      67.823  73.560  86.453  1.00  0.91           N  
ATOM  12692  N   VAL B 774      71.104  79.399  90.946  1.00  0.97           N  
ATOM  12693  CA  VAL B 774      71.371  80.767  91.384  1.00  0.97           C  
ATOM  12694  C   VAL B 774      72.563  81.393  90.682  1.00  0.97           C  
ATOM  12695  O   VAL B 774      72.525  82.546  90.255  1.00  0.97           O  
ATOM  12696  CB  VAL B 774      71.567  80.811  92.905  1.00  0.97           C  
ATOM  12697  CG1 VAL B 774      72.055  82.187  93.411  1.00  0.97           C  
ATOM  12698  CG2 VAL B 774      70.225  80.471  93.583  1.00  0.97           C  
ATOM  12699  N   PHE B 775      73.664  80.638  90.509  1.00  0.94           N  
ATOM  12700  CA  PHE B 775      74.874  81.154  89.894  1.00  0.94           C  
ATOM  12701  C   PHE B 775      74.758  81.331  88.388  1.00  0.94           C  
ATOM  12702  O   PHE B 775      75.427  82.185  87.810  1.00  0.94           O  
ATOM  12703  CB  PHE B 775      76.087  80.227  90.163  1.00  0.94           C  
ATOM  12704  CG  PHE B 775      76.518  80.101  91.607  1.00  0.94           C  
ATOM  12705  CD1 PHE B 775      77.536  79.178  91.899  1.00  0.94           C  
ATOM  12706  CD2 PHE B 775      76.011  80.885  92.662  1.00  0.94           C  
ATOM  12707  CE1 PHE B 775      78.032  79.030  93.198  1.00  0.94           C  
ATOM  12708  CE2 PHE B 775      76.505  80.741  93.964  1.00  0.94           C  
ATOM  12709  CZ  PHE B 775      77.519  79.816  94.234  1.00  0.94           C  
ATOM  12710  N   ALA B 776      73.875  80.561  87.720  1.00  0.95           N  
ATOM  12711  CA  ALA B 776      73.636  80.658  86.293  1.00  0.95           C  
ATOM  12712  C   ALA B 776      73.069  82.008  85.868  1.00  0.95           C  
ATOM  12713  O   ALA B 776      73.434  82.535  84.824  1.00  0.95           O  
ATOM  12714  CB  ALA B 776      72.737  79.501  85.815  1.00  0.95           C  
ATOM  12715  N   ASP B 777      72.206  82.625  86.700  1.00  0.94           N  
ATOM  12716  CA  ASP B 777      71.631  83.927  86.397  1.00  0.94           C  
ATOM  12717  C   ASP B 777      72.411  85.077  87.032  1.00  0.94           C  
ATOM  12718  O   ASP B 777      72.049  86.242  86.872  1.00  0.94           O  
ATOM  12719  CB  ASP B 777      70.165  84.001  86.905  1.00  0.94           C  
ATOM  12720  CG  ASP B 777      69.226  83.289  85.952  1.00  0.94           C  
ATOM  12721  OD1 ASP B 777      69.430  83.349  84.721  1.00  0.94           O  
ATOM  12722  OD2 ASP B 777      68.245  82.687  86.463  1.00  0.94           O  
ATOM  12723  N   TYR B 778      73.516  84.809  87.762  1.00  0.94           N  
ATOM  12724  CA  TYR B 778      74.250  85.833  88.497  1.00  0.94           C  
ATOM  12725  C   TYR B 778      74.847  86.934  87.616  1.00  0.94           C  
ATOM  12726  O   TYR B 778      74.716  88.113  87.942  1.00  0.94           O  
ATOM  12727  CB  TYR B 778      75.334  85.171  89.413  1.00  0.94           C  
ATOM  12728  CG  TYR B 778      76.223  86.176  90.120  1.00  0.94           C  
ATOM  12729  CD1 TYR B 778      75.833  86.812  91.315  1.00  0.94           C  
ATOM  12730  CD2 TYR B 778      77.443  86.545  89.523  1.00  0.94           C  
ATOM  12731  CE1 TYR B 778      76.644  87.808  91.890  1.00  0.94           C  
ATOM  12732  CE2 TYR B 778      78.242  87.545  90.084  1.00  0.94           C  
ATOM  12733  CZ  TYR B 778      77.846  88.167  91.266  1.00  0.94           C  
ATOM  12734  OH  TYR B 778      78.682  89.165  91.792  1.00  0.94           O  
ATOM  12735  N   GLU B 779      75.500  86.597  86.481  1.00  0.87           N  
ATOM  12736  CA  GLU B 779      76.126  87.599  85.627  1.00  0.87           C  
ATOM  12737  C   GLU B 779      75.127  88.551  84.984  1.00  0.87           C  
ATOM  12738  O   GLU B 779      75.243  89.772  85.084  1.00  0.87           O  
ATOM  12739  CB  GLU B 779      76.988  86.930  84.531  1.00  0.87           C  
ATOM  12740  CG  GLU B 779      77.790  87.949  83.682  1.00  0.87           C  
ATOM  12741  CD  GLU B 779      78.867  87.333  82.788  1.00  0.87           C  
ATOM  12742  OE1 GLU B 779      78.776  86.131  82.439  1.00  0.87           O  
ATOM  12743  OE2 GLU B 779      79.800  88.101  82.427  1.00  0.87           O  
ATOM  12744  N   ASP B 780      74.050  88.010  84.389  1.00  0.91           N  
ATOM  12745  CA  ASP B 780      72.974  88.788  83.818  1.00  0.91           C  
ATOM  12746  C   ASP B 780      72.270  89.650  84.849  1.00  0.91           C  
ATOM  12747  O   ASP B 780      71.999  90.824  84.614  1.00  0.91           O  
ATOM  12748  CB  ASP B 780      71.958  87.837  83.155  1.00  0.91           C  
ATOM  12749  CG  ASP B 780      72.482  87.339  81.821  1.00  0.91           C  
ATOM  12750  OD1 ASP B 780      73.447  87.938  81.285  1.00  0.91           O  
ATOM  12751  OD2 ASP B 780      71.855  86.383  81.306  1.00  0.91           O  
ATOM  12752  N   TYR B 781      72.007  89.116  86.054  1.00  0.94           N  
ATOM  12753  CA  TYR B 781      71.442  89.871  87.153  1.00  0.94           C  
ATOM  12754  C   TYR B 781      72.272  91.086  87.577  1.00  0.94           C  
ATOM  12755  O   TYR B 781      71.728  92.183  87.697  1.00  0.94           O  
ATOM  12756  CB  TYR B 781      71.234  88.909  88.354  1.00  0.94           C  
ATOM  12757  CG  TYR B 781      70.523  89.539  89.521  1.00  0.94           C  
ATOM  12758  CD1 TYR B 781      69.327  90.266  89.357  1.00  0.94           C  
ATOM  12759  CD2 TYR B 781      71.051  89.380  90.810  1.00  0.94           C  
ATOM  12760  CE1 TYR B 781      68.652  90.785  90.472  1.00  0.94           C  
ATOM  12761  CE2 TYR B 781      70.377  89.891  91.921  1.00  0.94           C  
ATOM  12762  CZ  TYR B 781      69.175  90.569  91.750  1.00  0.94           C  
ATOM  12763  OH  TYR B 781      68.485  90.996  92.886  1.00  0.94           O  
ATOM  12764  N   ILE B 782      73.608  90.964  87.765  1.00  0.90           N  
ATOM  12765  CA  ILE B 782      74.447  92.103  88.141  1.00  0.90           C  
ATOM  12766  C   ILE B 782      74.506  93.179  87.064  1.00  0.90           C  
ATOM  12767  O   ILE B 782      74.358  94.363  87.359  1.00  0.90           O  
ATOM  12768  CB  ILE B 782      75.840  91.725  88.658  1.00  0.90           C  
ATOM  12769  CG1 ILE B 782      76.729  91.018  87.608  1.00  0.90           C  
ATOM  12770  CG2 ILE B 782      75.639  90.859  89.921  1.00  0.90           C  
ATOM  12771  CD1 ILE B 782      78.172  90.775  88.065  1.00  0.90           C  
ATOM  12772  N   LYS B 783      74.626  92.781  85.782  1.00  0.85           N  
ATOM  12773  CA  LYS B 783      74.597  93.666  84.630  1.00  0.85           C  
ATOM  12774  C   LYS B 783      73.256  94.366  84.432  1.00  0.85           C  
ATOM  12775  O   LYS B 783      73.168  95.547  84.091  1.00  0.85           O  
ATOM  12776  CB  LYS B 783      74.979  92.870  83.361  1.00  0.85           C  
ATOM  12777  CG  LYS B 783      76.427  92.352  83.421  1.00  0.85           C  
ATOM  12778  CD  LYS B 783      76.850  91.576  82.166  1.00  0.85           C  
ATOM  12779  CE  LYS B 783      77.176  92.483