CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 21121723435224916

Job options:

ID        	=	 21121723435224916
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   17-DEC-21 1MOD    1       20:23
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.845
REMARK   3  GMQE    0.88
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.84
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    GLC
REMARK   3  BIND    A.136
REMARK   3  BIND 2  A.137
REMARK   3  BIND 3  A.378
REMARK   3  BIND 4  A.456
REMARK   3  BIND 5  A.485
REMARK   3  BIND 6  A.675
REMARK   3  BIND 7  A.676
REMARK   3  BIND 8  A.677
REMARK   3  BIND 9  _.1
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    GLC
REMARK   3  BIND    B.136
REMARK   3  BIND 2  B.137
REMARK   3  BIND 3  B.378
REMARK   3  BIND 4  B.456
REMARK   3  BIND 5  B.485
REMARK   3  BIND 6  B.675
REMARK   3  BIND 7  B.676
REMARK   3  BIND 8  B.677
REMARK   3  BIND 9  _.4
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    AMP
REMARK   3  BIND    A.68
REMARK   3  BIND 2  A.69
REMARK   3  BIND 3  A.72
REMARK   3  BIND 4  A.73
REMARK   3  BIND 5  A.76
REMARK   3  BIND 6  A.310
REMARK   3  BIND 7  A.311
REMARK   3  BIND 8  B.43
REMARK   3  BIND 9  B.45
REMARK   3  BIND 10  B.46
REMARK   3  BIND 11  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 4
REMARK   3  NAME    AMP
REMARK   3  BIND    A.43
REMARK   3  BIND 2  A.45
REMARK   3  BIND 3  A.46
REMARK   3  BIND 4  B.68
REMARK   3  BIND 5  B.69
REMARK   3  BIND 6  B.72
REMARK   3  BIND 7  B.73
REMARK   3  BIND 8  B.76
REMARK   3  BIND 9  B.310
REMARK   3  BIND 10  B.311
REMARK   3  BIND 11  _.5
REMARK   3 
REMARK   3 MODEL LIGAND 5
REMARK   3  NAME    PLP
REMARK   3  BIND    A.91
REMARK   3  BIND 2  A.135
REMARK   3  BIND 3  A.136
REMARK   3  BIND 4  A.139
REMARK   3  BIND 5  A.492
REMARK   3  BIND 6  A.569
REMARK   3  BIND 7  A.649
REMARK   3  BIND 8  A.650
REMARK   3  BIND 9  A.651
REMARK   3  BIND 10  A.654
REMARK   3  BIND 11  A.677
REMARK   3  BIND 12  A.678
REMARK   3  BIND 13  A.681
REMARK   3  BIND 14  _.1
REMARK   3  BIND 15  _.3
REMARK   3 
REMARK   3 MODEL LIGAND 6
REMARK   3  NAME    PLP
REMARK   3  BIND    B.91
REMARK   3  BIND 2  B.135
REMARK   3  BIND 3  B.136
REMARK   3  BIND 4  B.139
REMARK   3  BIND 5  B.492
REMARK   3  BIND 6  B.569
REMARK   3  BIND 7  B.649
REMARK   3  BIND 8  B.650
REMARK   3  BIND 9  B.651
REMARK   3  BIND 10  B.654
REMARK   3  BIND 11  B.677
REMARK   3  BIND 12  B.678
REMARK   3  BIND 13  B.681
REMARK   3  BIND 14  _.4
REMARK   3  BIND 15  _.6
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   1fa9
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2021-12-10
REMARK   3  SMTLE   1fa9.1.B
REMARK   3  SMTLV   2021-12-15
REMARK   3  MTHD    X-RAY DIFFRACTION 2.40 A
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.92
REMARK   3  SIM     0.62
REMARK   3  SID     100.00
REMARK   3  OSTAT   homo-dimer
REMARK   3  LIGND   GLC
REMARK   3  LIGND 2 GLC
REMARK   3  LIGND 3 AMP
REMARK   3  LIGND 4 AMP
REMARK   3  LIGND 5 PLP
REMARK   3  LIGND 6 PLP
REMARK   3  ALN B TRG MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAH
REMARK   3  ALN B TRG TVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQL
REMARK   3  ALN B TRG GLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDG
REMARK   3  ALN B TRG WQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVP
REMARK   3  ALN B TRG GYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN B TRG ELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIP
REMARK   3  ALN B TRG ELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYE
REMARK   3  ALN B TRG INQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIV
REMARK   3  ALN B TRG KTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKL
REMARK   3  ALN B TRG HSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLN
REMARK   3  ALN B TRG CLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVG
REMARK   3  ALN B TRG SKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN B TRG NVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPK
REMARK   3  ALN B TRG QPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKF
REMARK   3  ALN B TRG SSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN
REMARK   3  ALN B TPL -AKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAH
REMARK   3  ALN B TPL TVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQL
REMARK   3  ALN B TPL GLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDG
REMARK   3  ALN B TPL WQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVP
REMARK   3  ALN B TPL GYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN B TPL ELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIP
REMARK   3  ALN B TPL ELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYE
REMARK   3  ALN B TPL INQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIV
REMARK   3  ALN B TPL KTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKL
REMARK   3  ALN B TPL HSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLN
REMARK   3  ALN B TPL CLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVG
REMARK   3  ALN B TPL SKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN B TPL NVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPK
REMARK   3  ALN B TPL QPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKF
REMARK   3  ALN B TPL SSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN
REMARK   3  ALN B OFF 0
ATOM      1  N   THR A   6      52.304  35.446  63.439  1.00  0.50           N  
ATOM      2  CA  THR A   6      51.351  36.607  63.680  1.00  0.50           C  
ATOM      3  C   THR A   6      50.303  36.708  62.594  1.00  0.50           C  
ATOM      4  O   THR A   6      50.094  37.742  61.965  1.00  0.50           O  
ATOM      5  CB  THR A   6      52.085  37.949  63.793  1.00  0.50           C  
ATOM      6  OG1 THR A   6      53.113  38.061  62.816  1.00  0.50           O  
ATOM      7  CG2 THR A   6      52.748  38.066  65.171  1.00  0.50           C  
ATOM      8  N   ASP A   7      49.617  35.578  62.373  1.00  0.60           N  
ATOM      9  CA  ASP A   7      49.096  35.188  61.082  1.00  0.60           C  
ATOM     10  C   ASP A   7      48.092  34.063  61.326  1.00  0.60           C  
ATOM     11  O   ASP A   7      47.066  34.303  61.957  1.00  0.60           O  
ATOM     12  CB  ASP A   7      50.275  34.766  60.143  1.00  0.60           C  
ATOM     13  CG  ASP A   7      51.417  34.151  60.943  1.00  0.60           C  
ATOM     14  OD1 ASP A   7      51.150  33.264  61.797  1.00  0.60           O  
ATOM     15  OD2 ASP A   7      52.530  34.731  60.902  1.00  0.60           O  
ATOM     16  N   GLN A   8      48.390  32.814  60.891  1.00  0.66           N  
ATOM     17  CA  GLN A   8      47.607  31.615  61.156  1.00  0.66           C  
ATOM     18  C   GLN A   8      46.256  31.537  60.440  1.00  0.66           C  
ATOM     19  O   GLN A   8      45.592  32.531  60.158  1.00  0.66           O  
ATOM     20  CB  GLN A   8      47.459  31.404  62.691  1.00  0.66           C  
ATOM     21  CG  GLN A   8      46.927  30.041  63.187  1.00  0.66           C  
ATOM     22  CD  GLN A   8      47.812  28.818  62.929  1.00  0.66           C  
ATOM     23  OE1 GLN A   8      47.277  27.715  62.860  1.00  0.66           O  
ATOM     24  NE2 GLN A   8      49.146  28.986  62.834  1.00  0.66           N  
ATOM     25  N   GLU A   9      45.760  30.315  60.148  1.00  0.62           N  
ATOM     26  CA  GLU A   9      44.465  30.140  59.513  1.00  0.62           C  
ATOM     27  C   GLU A   9      43.280  30.493  60.407  1.00  0.62           C  
ATOM     28  O   GLU A   9      42.172  30.748  59.945  1.00  0.62           O  
ATOM     29  CB  GLU A   9      44.297  28.721  58.952  1.00  0.62           C  
ATOM     30  CG  GLU A   9      45.321  28.428  57.833  1.00  0.62           C  
ATOM     31  CD  GLU A   9      44.758  27.446  56.815  1.00  0.62           C  
ATOM     32  OE1 GLU A   9      45.305  26.324  56.709  1.00  0.62           O  
ATOM     33  OE2 GLU A   9      43.782  27.850  56.125  1.00  0.62           O  
ATOM     34  N   LYS A  10      43.512  30.627  61.726  1.00  0.66           N  
ATOM     35  CA  LYS A  10      42.598  31.258  62.665  1.00  0.66           C  
ATOM     36  C   LYS A  10      42.283  32.705  62.292  1.00  0.66           C  
ATOM     37  O   LYS A  10      41.158  33.169  62.433  1.00  0.66           O  
ATOM     38  CB  LYS A  10      43.183  31.186  64.096  1.00  0.66           C  
ATOM     39  CG  LYS A  10      42.997  29.795  64.727  1.00  0.66           C  
ATOM     40  CD  LYS A  10      44.080  29.396  65.747  1.00  0.66           C  
ATOM     41  CE  LYS A  10      44.302  30.391  66.893  1.00  0.66           C  
ATOM     42  NZ  LYS A  10      45.446  29.946  67.720  1.00  0.66           N  
ATOM     43  N   ARG A  11      43.246  33.449  61.713  1.00  0.57           N  
ATOM     44  CA  ARG A  11      43.019  34.813  61.267  1.00  0.57           C  
ATOM     45  C   ARG A  11      42.151  34.893  60.010  1.00  0.57           C  
ATOM     46  O   ARG A  11      41.667  35.953  59.619  1.00  0.57           O  
ATOM     47  CB  ARG A  11      44.366  35.554  61.121  1.00  0.57           C  
ATOM     48  CG  ARG A  11      44.265  37.090  61.139  1.00  0.57           C  
ATOM     49  CD  ARG A  11      45.611  37.825  61.177  1.00  0.57           C  
ATOM     50  NE  ARG A  11      46.250  37.558  62.506  1.00  0.57           N  
ATOM     51  CZ  ARG A  11      47.181  38.340  63.065  1.00  0.57           C  
ATOM     52  NH1 ARG A  11      47.662  39.418  62.458  1.00  0.57           N  
ATOM     53  NH2 ARG A  11      47.633  38.035  64.279  1.00  0.57           N  
ATOM     54  N   ARG A  12      41.840  33.741  59.368  1.00  0.63           N  
ATOM     55  CA  ARG A  12      40.859  33.672  58.298  1.00  0.63           C  
ATOM     56  C   ARG A  12      39.432  33.853  58.804  1.00  0.63           C  
ATOM     57  O   ARG A  12      38.525  34.166  58.026  1.00  0.63           O  
ATOM     58  CB  ARG A  12      40.917  32.344  57.506  1.00  0.63           C  
ATOM     59  CG  ARG A  12      42.285  32.072  56.849  1.00  0.63           C  
ATOM     60  CD  ARG A  12      42.383  30.705  56.147  1.00  0.63           C  
ATOM     61  NE  ARG A  12      41.440  30.711  54.974  1.00  0.63           N  
ATOM     62  CZ  ARG A  12      41.746  31.208  53.768  1.00  0.63           C  
ATOM     63  NH1 ARG A  12      42.923  31.777  53.527  1.00  0.63           N  
ATOM     64  NH2 ARG A  12      40.839  31.157  52.794  1.00  0.63           N  
ATOM     65  N   GLN A  13      39.215  33.711  60.133  1.00  0.55           N  
ATOM     66  CA  GLN A  13      37.994  34.107  60.816  1.00  0.55           C  
ATOM     67  C   GLN A  13      37.720  35.594  60.691  1.00  0.55           C  
ATOM     68  O   GLN A  13      36.570  36.000  60.560  1.00  0.55           O  
ATOM     69  CB  GLN A  13      38.010  33.735  62.315  1.00  0.55           C  
ATOM     70  CG  GLN A  13      38.048  32.214  62.585  1.00  0.55           C  
ATOM     71  CD  GLN A  13      36.733  31.535  62.220  1.00  0.55           C  
ATOM     72  OE1 GLN A  13      35.687  31.814  62.812  1.00  0.55           O  
ATOM     73  NE2 GLN A  13      36.774  30.601  61.242  1.00  0.55           N  
ATOM     74  N   ILE A  14      38.778  36.440  60.679  1.00  0.58           N  
ATOM     75  CA  ILE A  14      38.671  37.851  60.344  1.00  0.58           C  
ATOM     76  C   ILE A  14      38.217  38.026  58.895  1.00  0.58           C  
ATOM     77  O   ILE A  14      38.998  37.919  57.950  1.00  0.58           O  
ATOM     78  CB  ILE A  14      39.957  38.632  60.610  1.00  0.58           C  
ATOM     79  CG1 ILE A  14      40.466  38.363  62.047  1.00  0.58           C  
ATOM     80  CG2 ILE A  14      39.696  40.136  60.389  1.00  0.58           C  
ATOM     81  CD1 ILE A  14      41.665  39.222  62.465  1.00  0.58           C  
ATOM     82  N   SER A  15      36.905  38.243  58.678  1.00  0.73           N  
ATOM     83  CA  SER A  15      36.309  38.195  57.351  1.00  0.73           C  
ATOM     84  C   SER A  15      34.939  38.835  57.372  1.00  0.73           C  
ATOM     85  O   SER A  15      34.298  38.901  58.413  1.00  0.73           O  
ATOM     86  CB  SER A  15      36.122  36.715  56.896  1.00  0.73           C  
ATOM     87  OG  SER A  15      35.672  36.565  55.544  1.00  0.73           O  
ATOM     88  N   ILE A  16      34.422  39.270  56.205  1.00  0.67           N  
ATOM     89  CA  ILE A  16      33.069  39.810  56.107  1.00  0.67           C  
ATOM     90  C   ILE A  16      32.057  38.757  55.702  1.00  0.67           C  
ATOM     91  O   ILE A  16      30.879  39.040  55.528  1.00  0.67           O  
ATOM     92  CB  ILE A  16      32.940  40.973  55.132  1.00  0.67           C  
ATOM     93  CG1 ILE A  16      33.429  40.633  53.713  1.00  0.67           C  
ATOM     94  CG2 ILE A  16      33.718  42.152  55.714  1.00  0.67           C  
ATOM     95  CD1 ILE A  16      33.259  41.796  52.732  1.00  0.67           C  
ATOM     96  N   ARG A  17      32.492  37.489  55.588  1.00  0.58           N  
ATOM     97  CA  ARG A  17      31.746  36.356  55.056  1.00  0.58           C  
ATOM     98  C   ARG A  17      30.310  36.171  55.548  1.00  0.58           C  
ATOM     99  O   ARG A  17      29.426  35.887  54.750  1.00  0.58           O  
ATOM    100  CB  ARG A  17      32.589  35.090  55.361  1.00  0.58           C  
ATOM    101  CG  ARG A  17      31.942  33.724  55.043  1.00  0.58           C  
ATOM    102  CD  ARG A  17      32.894  32.523  55.174  1.00  0.58           C  
ATOM    103  NE  ARG A  17      33.550  32.630  56.520  1.00  0.58           N  
ATOM    104  CZ  ARG A  17      34.570  31.868  56.933  1.00  0.58           C  
ATOM    105  NH1 ARG A  17      34.978  30.810  56.240  1.00  0.58           N  
ATOM    106  NH2 ARG A  17      35.201  32.189  58.061  1.00  0.58           N  
ATOM    107  N   GLY A  18      30.037  36.332  56.862  1.00  0.60           N  
ATOM    108  CA  GLY A  18      28.682  36.200  57.402  1.00  0.60           C  
ATOM    109  C   GLY A  18      27.983  37.502  57.688  1.00  0.60           C  
ATOM    110  O   GLY A  18      26.875  37.503  58.214  1.00  0.60           O  
ATOM    111  N   ILE A  19      28.612  38.652  57.392  1.00  0.69           N  
ATOM    112  CA  ILE A  19      28.043  39.967  57.686  1.00  0.69           C  
ATOM    113  C   ILE A  19      27.786  40.753  56.414  1.00  0.69           C  
ATOM    114  O   ILE A  19      27.431  41.928  56.461  1.00  0.69           O  
ATOM    115  CB  ILE A  19      28.901  40.806  58.639  1.00  0.69           C  
ATOM    116  CG1 ILE A  19      30.368  40.906  58.178  1.00  0.69           C  
ATOM    117  CG2 ILE A  19      28.802  40.187  60.047  1.00  0.69           C  
ATOM    118  CD1 ILE A  19      31.211  41.895  58.988  1.00  0.69           C  
ATOM    119  N   VAL A  20      27.930  40.111  55.241  1.00  0.61           N  
ATOM    120  CA  VAL A  20      27.711  40.735  53.946  1.00  0.61           C  
ATOM    121  C   VAL A  20      26.686  39.955  53.126  1.00  0.61           C  
ATOM    122  O   VAL A  20      26.668  38.727  53.110  1.00  0.61           O  
ATOM    123  CB  VAL A  20      29.032  40.954  53.198  1.00  0.61           C  
ATOM    124  CG1 VAL A  20      29.602  39.653  52.596  1.00  0.61           C  
ATOM    125  CG2 VAL A  20      28.882  42.048  52.122  1.00  0.61           C  
ATOM    126  N   GLY A  21      25.762  40.662  52.436  1.00  0.69           N  
ATOM    127  CA  GLY A  21      24.798  40.060  51.507  1.00  0.69           C  
ATOM    128  C   GLY A  21      23.391  39.893  52.027  1.00  0.69           C  
ATOM    129  O   GLY A  21      22.454  39.705  51.257  1.00  0.69           O  
ATOM    130  N   VAL A  22      23.171  39.983  53.349  1.00  0.67           N  
ATOM    131  CA  VAL A  22      21.833  39.943  53.927  1.00  0.67           C  
ATOM    132  C   VAL A  22      21.234  41.336  54.061  1.00  0.67           C  
ATOM    133  O   VAL A  22      21.422  42.058  55.037  1.00  0.67           O  
ATOM    134  CB  VAL A  22      21.752  39.195  55.255  1.00  0.67           C  
ATOM    135  CG1 VAL A  22      21.806  37.682  54.975  1.00  0.67           C  
ATOM    136  CG2 VAL A  22      22.899  39.592  56.204  1.00  0.67           C  
ATOM    137  N   GLU A  23      20.455  41.752  53.048  1.00  0.68           N  
ATOM    138  CA  GLU A  23      19.952  43.116  52.955  1.00  0.68           C  
ATOM    139  C   GLU A  23      18.436  43.240  52.969  1.00  0.68           C  
ATOM    140  O   GLU A  23      17.858  44.271  52.637  1.00  0.68           O  
ATOM    141  CB  GLU A  23      20.637  43.853  51.786  1.00  0.68           C  
ATOM    142  CG  GLU A  23      20.676  43.131  50.419  1.00  0.68           C  
ATOM    143  CD  GLU A  23      21.781  43.679  49.517  1.00  0.68           C  
ATOM    144  OE1 GLU A  23      22.814  44.213  50.011  1.00  0.68           O  
ATOM    145  OE2 GLU A  23      21.656  43.529  48.279  1.00  0.68           O  
ATOM    146  N   ASN A  24      17.737  42.183  53.436  1.00  0.77           N  
ATOM    147  CA  ASN A  24      16.338  42.241  53.846  1.00  0.77           C  
ATOM    148  C   ASN A  24      15.974  43.350  54.857  1.00  0.77           C  
ATOM    149  O   ASN A  24      16.812  43.843  55.610  1.00  0.77           O  
ATOM    150  CB  ASN A  24      15.819  40.852  54.332  1.00  0.77           C  
ATOM    151  CG  ASN A  24      16.151  40.511  55.788  1.00  0.77           C  
ATOM    152  OD1 ASN A  24      15.243  40.217  56.562  1.00  0.77           O  
ATOM    153  ND2 ASN A  24      17.436  40.593  56.190  1.00  0.77           N  
ATOM    154  N   VAL A  25      14.674  43.701  54.942  1.00  0.79           N  
ATOM    155  CA  VAL A  25      14.135  44.729  55.829  1.00  0.79           C  
ATOM    156  C   VAL A  25      14.447  44.533  57.311  1.00  0.79           C  
ATOM    157  O   VAL A  25      14.769  45.488  58.017  1.00  0.79           O  
ATOM    158  CB  VAL A  25      12.621  44.830  55.629  1.00  0.79           C  
ATOM    159  CG1 VAL A  25      11.936  45.718  56.689  1.00  0.79           C  
ATOM    160  CG2 VAL A  25      12.347  45.416  54.232  1.00  0.79           C  
ATOM    161  N   ALA A  26      14.387  43.292  57.837  1.00  0.78           N  
ATOM    162  CA  ALA A  26      14.662  43.020  59.236  1.00  0.78           C  
ATOM    163  C   ALA A  26      16.082  43.364  59.692  1.00  0.78           C  
ATOM    164  O   ALA A  26      16.273  44.003  60.728  1.00  0.78           O  
ATOM    165  CB  ALA A  26      14.356  41.542  59.526  1.00  0.78           C  
ATOM    166  N   GLU A  27      17.119  43.000  58.905  1.00  0.76           N  
ATOM    167  CA  GLU A  27      18.485  43.416  59.199  1.00  0.76           C  
ATOM    168  C   GLU A  27      18.740  44.898  58.965  1.00  0.76           C  
ATOM    169  O   GLU A  27      19.517  45.510  59.694  1.00  0.76           O  
ATOM    170  CB  GLU A  27      19.583  42.594  58.482  1.00  0.76           C  
ATOM    171  CG  GLU A  27      19.773  41.154  59.022  1.00  0.76           C  
ATOM    172  CD  GLU A  27      19.991  41.023  60.524  1.00  0.76           C  
ATOM    173  OE1 GLU A  27      19.323  40.117  61.094  1.00  0.76           O  
ATOM    174  OE2 GLU A  27      20.769  41.776  61.186  1.00  0.76           O  
ATOM    175  N   LEU A  28      18.080  45.544  57.977  1.00  0.83           N  
ATOM    176  CA  LEU A  28      18.177  46.990  57.803  1.00  0.83           C  
ATOM    177  C   LEU A  28      17.675  47.779  59.007  1.00  0.83           C  
ATOM    178  O   LEU A  28      18.325  48.723  59.453  1.00  0.83           O  
ATOM    179  CB  LEU A  28      17.400  47.484  56.559  1.00  0.83           C  
ATOM    180  CG  LEU A  28      17.995  47.068  55.202  1.00  0.83           C  
ATOM    181  CD1 LEU A  28      17.056  47.510  54.077  1.00  0.83           C  
ATOM    182  CD2 LEU A  28      19.384  47.673  54.959  1.00  0.83           C  
ATOM    183  N   LYS A  29      16.532  47.381  59.608  1.00  0.83           N  
ATOM    184  CA  LYS A  29      16.083  47.956  60.868  1.00  0.83           C  
ATOM    185  C   LYS A  29      17.046  47.705  62.022  1.00  0.83           C  
ATOM    186  O   LYS A  29      17.382  48.608  62.785  1.00  0.83           O  
ATOM    187  CB  LYS A  29      14.703  47.404  61.291  1.00  0.83           C  
ATOM    188  CG  LYS A  29      13.576  47.736  60.305  1.00  0.83           C  
ATOM    189  CD  LYS A  29      12.183  47.701  60.953  1.00  0.83           C  
ATOM    190  CE  LYS A  29      11.841  46.384  61.657  1.00  0.83           C  
ATOM    191  NZ  LYS A  29      10.482  46.471  62.218  1.00  0.83           N  
ATOM    192  N   LYS A  30      17.557  46.464  62.140  1.00  0.81           N  
ATOM    193  CA  LYS A  30      18.506  46.073  63.163  1.00  0.81           C  
ATOM    194  C   LYS A  30      19.818  46.849  63.099  1.00  0.81           C  
ATOM    195  O   LYS A  30      20.334  47.326  64.109  1.00  0.81           O  
ATOM    196  CB  LYS A  30      18.764  44.553  63.034  1.00  0.81           C  
ATOM    197  CG  LYS A  30      19.557  43.936  64.196  1.00  0.81           C  
ATOM    198  CD  LYS A  30      18.814  42.808  64.937  1.00  0.81           C  
ATOM    199  CE  LYS A  30      18.400  41.601  64.081  1.00  0.81           C  
ATOM    200  NZ  LYS A  30      19.567  40.951  63.481  1.00  0.81           N  
ATOM    201  N   SER A  31      20.373  47.040  61.888  1.00  0.84           N  
ATOM    202  CA  SER A  31      21.515  47.908  61.631  1.00  0.84           C  
ATOM    203  C   SER A  31      21.252  49.375  61.898  1.00  0.84           C  
ATOM    204  O   SER A  31      22.106  50.051  62.469  1.00  0.84           O  
ATOM    205  CB  SER A  31      22.083  47.734  60.204  1.00  0.84           C  
ATOM    206  OG  SER A  31      22.680  46.439  60.062  1.00  0.84           O  
ATOM    207  N   PHE A  32      20.051  49.896  61.562  1.00  0.86           N  
ATOM    208  CA  PHE A  32      19.640  51.254  61.901  1.00  0.86           C  
ATOM    209  C   PHE A  32      19.653  51.492  63.405  1.00  0.86           C  
ATOM    210  O   PHE A  32      20.172  52.499  63.887  1.00  0.86           O  
ATOM    211  CB  PHE A  32      18.225  51.543  61.316  1.00  0.86           C  
ATOM    212  CG  PHE A  32      17.760  52.964  61.539  1.00  0.86           C  
ATOM    213  CD1 PHE A  32      17.126  53.329  62.743  1.00  0.86           C  
ATOM    214  CD2 PHE A  32      17.924  53.935  60.540  1.00  0.86           C  
ATOM    215  CE1 PHE A  32      16.676  54.639  62.948  1.00  0.86           C  
ATOM    216  CE2 PHE A  32      17.467  55.244  60.738  1.00  0.86           C  
ATOM    217  CZ  PHE A  32      16.853  55.596  61.943  1.00  0.86           C  
ATOM    218  N   ASN A  33      19.120  50.538  64.194  1.00  0.84           N  
ATOM    219  CA  ASN A  33      19.207  50.581  65.642  1.00  0.84           C  
ATOM    220  C   ASN A  33      20.633  50.503  66.174  1.00  0.84           C  
ATOM    221  O   ASN A  33      21.016  51.291  67.031  1.00  0.84           O  
ATOM    222  CB  ASN A  33      18.321  49.489  66.294  1.00  0.84           C  
ATOM    223  CG  ASN A  33      16.850  49.724  65.978  1.00  0.84           C  
ATOM    224  OD1 ASN A  33      16.098  48.830  65.596  1.00  0.84           O  
ATOM    225  ND2 ASN A  33      16.401  50.990  66.143  1.00  0.84           N  
ATOM    226  N   ARG A  34      21.505  49.619  65.639  1.00  0.81           N  
ATOM    227  CA  ARG A  34      22.907  49.618  66.053  1.00  0.81           C  
ATOM    228  C   ARG A  34      23.603  50.947  65.775  1.00  0.81           C  
ATOM    229  O   ARG A  34      24.303  51.487  66.626  1.00  0.81           O  
ATOM    230  CB  ARG A  34      23.769  48.518  65.377  1.00  0.81           C  
ATOM    231  CG  ARG A  34      23.326  47.065  65.628  1.00  0.81           C  
ATOM    232  CD  ARG A  34      24.411  46.060  65.216  1.00  0.81           C  
ATOM    233  NE  ARG A  34      23.750  44.793  64.738  1.00  0.81           N  
ATOM    234  CZ  ARG A  34      23.467  44.536  63.447  1.00  0.81           C  
ATOM    235  NH1 ARG A  34      23.748  45.413  62.493  1.00  0.81           N  
ATOM    236  NH2 ARG A  34      22.926  43.364  63.117  1.00  0.81           N  
ATOM    237  N   HIS A  35      23.397  51.542  64.587  1.00  0.84           N  
ATOM    238  CA  HIS A  35      23.958  52.848  64.289  1.00  0.84           C  
ATOM    239  C   HIS A  35      23.381  54.004  65.097  1.00  0.84           C  
ATOM    240  O   HIS A  35      24.129  54.822  65.628  1.00  0.84           O  
ATOM    241  CB  HIS A  35      23.920  53.153  62.779  1.00  0.84           C  
ATOM    242  CG  HIS A  35      24.908  52.304  62.037  1.00  0.84           C  
ATOM    243  ND1 HIS A  35      26.253  52.454  62.330  1.00  0.84           N  
ATOM    244  CD2 HIS A  35      24.731  51.332  61.104  1.00  0.84           C  
ATOM    245  CE1 HIS A  35      26.866  51.563  61.565  1.00  0.84           C  
ATOM    246  NE2 HIS A  35      25.992  50.863  60.808  1.00  0.84           N  
ATOM    247  N   LEU A  36      22.049  54.106  65.278  1.00  0.86           N  
ATOM    248  CA  LEU A  36      21.481  55.158  66.109  1.00  0.86           C  
ATOM    249  C   LEU A  36      21.911  55.064  67.567  1.00  0.86           C  
ATOM    250  O   LEU A  36      22.354  56.026  68.194  1.00  0.86           O  
ATOM    251  CB  LEU A  36      19.937  55.091  66.086  1.00  0.86           C  
ATOM    252  CG  LEU A  36      19.268  56.287  66.790  1.00  0.86           C  
ATOM    253  CD1 LEU A  36      19.309  57.543  65.915  1.00  0.86           C  
ATOM    254  CD2 LEU A  36      17.829  55.947  67.161  1.00  0.86           C  
ATOM    255  N   HIS A  37      21.809  53.863  68.148  1.00  0.81           N  
ATOM    256  CA  HIS A  37      22.097  53.678  69.544  1.00  0.81           C  
ATOM    257  C   HIS A  37      23.578  53.592  69.869  1.00  0.81           C  
ATOM    258  O   HIS A  37      24.036  54.229  70.812  1.00  0.81           O  
ATOM    259  CB  HIS A  37      21.309  52.470  70.079  1.00  0.81           C  
ATOM    260  CG  HIS A  37      19.811  52.696  70.037  1.00  0.81           C  
ATOM    261  ND1 HIS A  37      19.023  52.118  69.055  1.00  0.81           N  
ATOM    262  CD2 HIS A  37      19.024  53.392  70.900  1.00  0.81           C  
ATOM    263  CE1 HIS A  37      17.790  52.471  69.338  1.00  0.81           C  
ATOM    264  NE2 HIS A  37      17.729  53.243  70.447  1.00  0.81           N  
ATOM    265  N   PHE A  38      24.388  52.831  69.109  1.00  0.82           N  
ATOM    266  CA  PHE A  38      25.784  52.603  69.459  1.00  0.82           C  
ATOM    267  C   PHE A  38      26.759  53.564  68.776  1.00  0.82           C  
ATOM    268  O   PHE A  38      27.625  54.149  69.429  1.00  0.82           O  
ATOM    269  CB  PHE A  38      26.194  51.125  69.193  1.00  0.82           C  
ATOM    270  CG  PHE A  38      25.280  50.099  69.843  1.00  0.82           C  
ATOM    271  CD1 PHE A  38      24.594  50.332  71.053  1.00  0.82           C  
ATOM    272  CD2 PHE A  38      25.132  48.840  69.230  1.00  0.82           C  
ATOM    273  CE1 PHE A  38      23.755  49.356  71.606  1.00  0.82           C  
ATOM    274  CE2 PHE A  38      24.307  47.855  69.788  1.00  0.82           C  
ATOM    275  CZ  PHE A  38      23.612  48.117  70.974  1.00  0.82           C  
ATOM    276  N   THR A  39      26.649  53.792  67.448  1.00  0.83           N  
ATOM    277  CA  THR A  39      27.502  54.723  66.690  1.00  0.83           C  
ATOM    278  C   THR A  39      27.273  56.181  67.069  1.00  0.83           C  
ATOM    279  O   THR A  39      28.201  56.989  67.227  1.00  0.83           O  
ATOM    280  CB  THR A  39      27.334  54.578  65.176  1.00  0.83           C  
ATOM    281  OG1 THR A  39      27.595  53.238  64.795  1.00  0.83           O  
ATOM    282  CG2 THR A  39      28.321  55.457  64.396  1.00  0.83           C  
ATOM    283  N   LEU A  40      25.998  56.576  67.238  1.00  0.83           N  
ATOM    284  CA  LEU A  40      25.638  57.948  67.548  1.00  0.83           C  
ATOM    285  C   LEU A  40      25.477  58.206  69.040  1.00  0.83           C  
ATOM    286  O   LEU A  40      25.570  59.356  69.475  1.00  0.83           O  
ATOM    287  CB  LEU A  40      24.332  58.332  66.822  1.00  0.83           C  
ATOM    288  CG  LEU A  40      24.477  58.790  65.355  1.00  0.83           C  
ATOM    289  CD1 LEU A  40      25.166  57.797  64.409  1.00  0.83           C  
ATOM    290  CD2 LEU A  40      23.078  59.085  64.825  1.00  0.83           C  
ATOM    291  N   VAL A  41      25.313  57.149  69.867  1.00  0.82           N  
ATOM    292  CA  VAL A  41      25.142  57.240  71.319  1.00  0.82           C  
ATOM    293  C   VAL A  41      23.892  58.033  71.686  1.00  0.82           C  
ATOM    294  O   VAL A  41      23.940  59.086  72.326  1.00  0.82           O  
ATOM    295  CB  VAL A  41      26.397  57.685  72.077  1.00  0.82           C  
ATOM    296  CG1 VAL A  41      26.266  57.431  73.592  1.00  0.82           C  
ATOM    297  CG2 VAL A  41      27.618  56.908  71.549  1.00  0.82           C  
ATOM    298  N   LYS A  42      22.738  57.553  71.196  1.00  0.80           N  
ATOM    299  CA  LYS A  42      21.447  58.212  71.236  1.00  0.80           C  
ATOM    300  C   LYS A  42      20.367  57.176  71.518  1.00  0.80           C  
ATOM    301  O   LYS A  42      20.632  55.979  71.566  1.00  0.80           O  
ATOM    302  CB  LYS A  42      21.114  58.852  69.862  1.00  0.80           C  
ATOM    303  CG  LYS A  42      22.006  60.037  69.467  1.00  0.80           C  
ATOM    304  CD  LYS A  42      21.599  61.341  70.168  1.00  0.80           C  
ATOM    305  CE  LYS A  42      22.442  62.540  69.723  1.00  0.80           C  
ATOM    306  NZ  LYS A  42      21.586  63.717  69.505  1.00  0.80           N  
ATOM    307  N   ASP A  43      19.112  57.619  71.705  1.00  0.79           N  
ATOM    308  CA  ASP A  43      17.948  56.765  71.810  1.00  0.79           C  
ATOM    309  C   ASP A  43      16.816  57.430  71.036  1.00  0.79           C  
ATOM    310  O   ASP A  43      17.010  58.475  70.425  1.00  0.79           O  
ATOM    311  CB  ASP A  43      17.599  56.411  73.286  1.00  0.79           C  
ATOM    312  CG  ASP A  43      17.093  57.572  74.129  1.00  0.79           C  
ATOM    313  OD1 ASP A  43      16.856  58.674  73.577  1.00  0.79           O  
ATOM    314  OD2 ASP A  43      16.841  57.338  75.336  1.00  0.79           O  
ATOM    315  N   ARG A  44      15.588  56.870  71.012  1.00  0.75           N  
ATOM    316  CA  ARG A  44      14.505  57.534  70.298  1.00  0.75           C  
ATOM    317  C   ARG A  44      13.970  58.769  71.011  1.00  0.75           C  
ATOM    318  O   ARG A  44      13.247  59.574  70.429  1.00  0.75           O  
ATOM    319  CB  ARG A  44      13.311  56.577  70.054  1.00  0.75           C  
ATOM    320  CG  ARG A  44      12.403  56.328  71.279  1.00  0.75           C  
ATOM    321  CD  ARG A  44      11.121  55.575  70.935  1.00  0.75           C  
ATOM    322  NE  ARG A  44      11.397  54.117  71.083  1.00  0.75           N  
ATOM    323  CZ  ARG A  44      11.036  53.381  72.138  1.00  0.75           C  
ATOM    324  NH1 ARG A  44      10.536  53.934  73.238  1.00  0.75           N  
ATOM    325  NH2 ARG A  44      11.144  52.059  72.061  1.00  0.75           N  
ATOM    326  N   ASN A  45      14.287  58.905  72.311  1.00  0.76           N  
ATOM    327  CA  ASN A  45      13.774  59.942  73.173  1.00  0.76           C  
ATOM    328  C   ASN A  45      14.504  61.252  72.910  1.00  0.76           C  
ATOM    329  O   ASN A  45      13.905  62.324  72.896  1.00  0.76           O  
ATOM    330  CB  ASN A  45      13.902  59.515  74.662  1.00  0.76           C  
ATOM    331  CG  ASN A  45      13.310  58.121  74.888  1.00  0.76           C  
ATOM    332  OD1 ASN A  45      12.153  57.825  74.576  1.00  0.76           O  
ATOM    333  ND2 ASN A  45      14.130  57.204  75.452  1.00  0.76           N  
ATOM    334  N   VAL A  46      15.833  61.179  72.682  1.00  0.76           N  
ATOM    335  CA  VAL A  46      16.665  62.354  72.459  1.00  0.76           C  
ATOM    336  C   VAL A  46      17.228  62.480  71.035  1.00  0.76           C  
ATOM    337  O   VAL A  46      17.894  63.460  70.696  1.00  0.76           O  
ATOM    338  CB  VAL A  46      17.783  62.350  73.504  1.00  0.76           C  
ATOM    339  CG1 VAL A  46      18.907  61.360  73.133  1.00  0.76           C  
ATOM    340  CG2 VAL A  46      18.318  63.775  73.746  1.00  0.76           C  
ATOM    341  N   ALA A  47      16.995  61.500  70.136  1.00  0.84           N  
ATOM    342  CA  ALA A  47      17.437  61.598  68.751  1.00  0.84           C  
ATOM    343  C   ALA A  47      16.736  62.647  67.888  1.00  0.84           C  
ATOM    344  O   ALA A  47      15.509  62.758  67.850  1.00  0.84           O  
ATOM    345  CB  ALA A  47      17.350  60.246  68.027  1.00  0.84           C  
ATOM    346  N   THR A  48      17.533  63.415  67.124  1.00  0.82           N  
ATOM    347  CA  THR A  48      17.068  64.415  66.175  1.00  0.82           C  
ATOM    348  C   THR A  48      16.774  63.812  64.807  1.00  0.82           C  
ATOM    349  O   THR A  48      17.110  62.666  64.509  1.00  0.82           O  
ATOM    350  CB  THR A  48      18.062  65.573  66.000  1.00  0.82           C  
ATOM    351  OG1 THR A  48      19.296  65.160  65.425  1.00  0.82           O  
ATOM    352  CG2 THR A  48      18.376  66.195  67.367  1.00  0.82           C  
ATOM    353  N   THR A  49      16.160  64.588  63.879  1.00  0.83           N  
ATOM    354  CA  THR A  49      16.020  64.197  62.468  1.00  0.83           C  
ATOM    355  C   THR A  49      17.377  63.936  61.830  1.00  0.83           C  
ATOM    356  O   THR A  49      17.569  63.005  61.048  1.00  0.83           O  
ATOM    357  CB  THR A  49      15.271  65.219  61.612  1.00  0.83           C  
ATOM    358  OG1 THR A  49      14.023  65.540  62.207  1.00  0.83           O  
ATOM    359  CG2 THR A  49      14.960  64.656  60.221  1.00  0.83           C  
ATOM    360  N   ARG A  50      18.392  64.740  62.207  1.00  0.80           N  
ATOM    361  CA  ARG A  50      19.767  64.541  61.805  1.00  0.80           C  
ATOM    362  C   ARG A  50      20.385  63.247  62.319  1.00  0.80           C  
ATOM    363  O   ARG A  50      21.022  62.528  61.551  1.00  0.80           O  
ATOM    364  CB  ARG A  50      20.613  65.761  62.211  1.00  0.80           C  
ATOM    365  CG  ARG A  50      22.071  65.706  61.721  1.00  0.80           C  
ATOM    366  CD  ARG A  50      22.857  66.983  62.021  1.00  0.80           C  
ATOM    367  NE  ARG A  50      22.380  68.058  61.083  1.00  0.80           N  
ATOM    368  CZ  ARG A  50      21.930  69.260  61.468  1.00  0.80           C  
ATOM    369  NH1 ARG A  50      21.636  69.560  62.728  1.00  0.80           N  
ATOM    370  NH2 ARG A  50      21.784  70.209  60.539  1.00  0.80           N  
ATOM    371  N   ASP A  51      20.153  62.871  63.596  1.00  0.85           N  
ATOM    372  CA  ASP A  51      20.565  61.583  64.134  1.00  0.85           C  
ATOM    373  C   ASP A  51      19.973  60.400  63.351  1.00  0.85           C  
ATOM    374  O   ASP A  51      20.661  59.449  62.979  1.00  0.85           O  
ATOM    375  CB  ASP A  51      20.131  61.432  65.616  1.00  0.85           C  
ATOM    376  CG  ASP A  51      20.922  62.307  66.556  1.00  0.85           C  
ATOM    377  OD1 ASP A  51      22.175  62.273  66.527  1.00  0.85           O  
ATOM    378  OD2 ASP A  51      20.268  62.938  67.431  1.00  0.85           O  
ATOM    379  N   TYR A  52      18.671  60.456  63.013  1.00  0.85           N  
ATOM    380  CA  TYR A  52      18.031  59.466  62.163  1.00  0.85           C  
ATOM    381  C   TYR A  52      18.591  59.396  60.735  1.00  0.85           C  
ATOM    382  O   TYR A  52      18.754  58.309  60.181  1.00  0.85           O  
ATOM    383  CB  TYR A  52      16.501  59.694  62.111  1.00  0.85           C  
ATOM    384  CG  TYR A  52      15.838  59.578  63.463  1.00  0.85           C  
ATOM    385  CD1 TYR A  52      16.052  58.471  64.304  1.00  0.85           C  
ATOM    386  CD2 TYR A  52      14.935  60.571  63.884  1.00  0.85           C  
ATOM    387  CE1 TYR A  52      15.393  58.372  65.537  1.00  0.85           C  
ATOM    388  CE2 TYR A  52      14.282  60.478  65.122  1.00  0.85           C  
ATOM    389  CZ  TYR A  52      14.513  59.375  65.948  1.00  0.85           C  
ATOM    390  OH  TYR A  52      13.869  59.261  67.198  1.00  0.85           O  
ATOM    391  N   TYR A  53      18.936  60.542  60.100  1.00  0.88           N  
ATOM    392  CA  TYR A  53      19.638  60.551  58.819  1.00  0.88           C  
ATOM    393  C   TYR A  53      21.000  59.852  58.895  1.00  0.88           C  
ATOM    394  O   TYR A  53      21.309  59.000  58.064  1.00  0.88           O  
ATOM    395  CB  TYR A  53      19.790  62.015  58.278  1.00  0.88           C  
ATOM    396  CG  TYR A  53      20.860  62.149  57.209  1.00  0.88           C  
ATOM    397  CD1 TYR A  53      20.722  61.500  55.971  1.00  0.88           C  
ATOM    398  CD2 TYR A  53      22.096  62.735  57.536  1.00  0.88           C  
ATOM    399  CE1 TYR A  53      21.821  61.379  55.111  1.00  0.88           C  
ATOM    400  CE2 TYR A  53      23.195  62.621  56.673  1.00  0.88           C  
ATOM    401  CZ  TYR A  53      23.058  61.916  55.474  1.00  0.88           C  
ATOM    402  OH  TYR A  53      24.164  61.709  54.634  1.00  0.88           O  
ATOM    403  N   PHE A  54      21.833  60.170  59.906  1.00  0.88           N  
ATOM    404  CA  PHE A  54      23.147  59.560  60.059  1.00  0.88           C  
ATOM    405  C   PHE A  54      23.059  58.051  60.285  1.00  0.88           C  
ATOM    406  O   PHE A  54      23.793  57.276  59.681  1.00  0.88           O  
ATOM    407  CB  PHE A  54      23.966  60.234  61.194  1.00  0.88           C  
ATOM    408  CG  PHE A  54      24.777  61.401  60.688  1.00  0.88           C  
ATOM    409  CD1 PHE A  54      26.154  61.254  60.446  1.00  0.88           C  
ATOM    410  CD2 PHE A  54      24.192  62.658  60.473  1.00  0.88           C  
ATOM    411  CE1 PHE A  54      26.924  62.338  60.000  1.00  0.88           C  
ATOM    412  CE2 PHE A  54      24.952  63.746  60.029  1.00  0.88           C  
ATOM    413  CZ  PHE A  54      26.320  63.584  59.792  1.00  0.88           C  
ATOM    414  N   ALA A  55      22.093  57.584  61.098  1.00  0.91           N  
ATOM    415  CA  ALA A  55      21.802  56.173  61.272  1.00  0.91           C  
ATOM    416  C   ALA A  55      21.385  55.428  59.994  1.00  0.91           C  
ATOM    417  O   ALA A  55      21.785  54.285  59.753  1.00  0.91           O  
ATOM    418  CB  ALA A  55      20.694  56.037  62.328  1.00  0.91           C  
ATOM    419  N   LEU A  56      20.572  56.062  59.121  1.00  0.89           N  
ATOM    420  CA  LEU A  56      20.300  55.549  57.785  1.00  0.89           C  
ATOM    421  C   LEU A  56      21.521  55.561  56.871  1.00  0.89           C  
ATOM    422  O   LEU A  56      21.819  54.567  56.206  1.00  0.89           O  
ATOM    423  CB  LEU A  56      19.123  56.321  57.136  1.00  0.89           C  
ATOM    424  CG  LEU A  56      18.705  55.877  55.713  1.00  0.89           C  
ATOM    425  CD1 LEU A  56      18.445  54.366  55.581  1.00  0.89           C  
ATOM    426  CD2 LEU A  56      17.465  56.663  55.263  1.00  0.89           C  
ATOM    427  N   ALA A  57      22.299  56.662  56.855  1.00  0.94           N  
ATOM    428  CA  ALA A  57      23.501  56.788  56.058  1.00  0.94           C  
ATOM    429  C   ALA A  57      24.559  55.749  56.401  1.00  0.94           C  
ATOM    430  O   ALA A  57      25.092  55.081  55.518  1.00  0.94           O  
ATOM    431  CB  ALA A  57      24.075  58.206  56.228  1.00  0.94           C  
ATOM    432  N   HIS A  58      24.831  55.520  57.701  1.00  0.86           N  
ATOM    433  CA  HIS A  58      25.703  54.449  58.150  1.00  0.86           C  
ATOM    434  C   HIS A  58      25.194  53.046  57.813  1.00  0.86           C  
ATOM    435  O   HIS A  58      25.962  52.219  57.337  1.00  0.86           O  
ATOM    436  CB  HIS A  58      26.041  54.576  59.651  1.00  0.86           C  
ATOM    437  CG  HIS A  58      27.048  55.657  59.942  1.00  0.86           C  
ATOM    438  ND1 HIS A  58      26.688  56.832  60.578  1.00  0.86           N  
ATOM    439  CD2 HIS A  58      28.373  55.681  59.642  1.00  0.86           C  
ATOM    440  CE1 HIS A  58      27.791  57.544  60.645  1.00  0.86           C  
ATOM    441  NE2 HIS A  58      28.844  56.896  60.093  1.00  0.86           N  
ATOM    442  N   THR A  59      23.880  52.754  57.958  1.00  0.86           N  
ATOM    443  CA  THR A  59      23.289  51.466  57.549  1.00  0.86           C  
ATOM    444  C   THR A  59      23.493  51.162  56.068  1.00  0.86           C  
ATOM    445  O   THR A  59      23.889  50.066  55.671  1.00  0.86           O  
ATOM    446  CB  THR A  59      21.778  51.407  57.812  1.00  0.86           C  
ATOM    447  OG1 THR A  59      21.498  51.517  59.200  1.00  0.86           O  
ATOM    448  CG2 THR A  59      21.151  50.089  57.315  1.00  0.86           C  
ATOM    449  N   VAL A  60      23.265  52.158  55.191  1.00  0.88           N  
ATOM    450  CA  VAL A  60      23.545  52.064  53.764  1.00  0.88           C  
ATOM    451  C   VAL A  60      25.043  51.921  53.489  1.00  0.88           C  
ATOM    452  O   VAL A  60      25.478  51.170  52.612  1.00  0.88           O  
ATOM    453  CB  VAL A  60      22.921  53.251  53.034  1.00  0.88           C  
ATOM    454  CG1 VAL A  60      23.321  53.291  51.549  1.00  0.88           C  
ATOM    455  CG2 VAL A  60      21.386  53.143  53.146  1.00  0.88           C  
ATOM    456  N   ARG A  61      25.886  52.622  54.270  1.00  0.83           N  
ATOM    457  CA  ARG A  61      27.330  52.549  54.190  1.00  0.83           C  
ATOM    458  C   ARG A  61      27.935  51.183  54.463  1.00  0.83           C  
ATOM    459  O   ARG A  61      28.864  50.784  53.769  1.00  0.83           O  
ATOM    460  CB  ARG A  61      28.005  53.573  55.120  1.00  0.83           C  
ATOM    461  CG  ARG A  61      29.449  53.891  54.702  1.00  0.83           C  
ATOM    462  CD  ARG A  61      30.161  54.815  55.682  1.00  0.83           C  
ATOM    463  NE  ARG A  61      30.865  53.988  56.711  1.00  0.83           N  
ATOM    464  CZ  ARG A  61      31.854  54.492  57.460  1.00  0.83           C  
ATOM    465  NH1 ARG A  61      32.101  55.801  57.487  1.00  0.83           N  
ATOM    466  NH2 ARG A  61      32.621  53.679  58.178  1.00  0.83           N  
ATOM    467  N   ASP A  62      27.432  50.406  55.438  1.00  0.84           N  
ATOM    468  CA  ASP A  62      27.919  49.058  55.708  1.00  0.84           C  
ATOM    469  C   ASP A  62      27.802  48.140  54.479  1.00  0.84           C  
ATOM    470  O   ASP A  62      28.739  47.448  54.077  1.00  0.84           O  
ATOM    471  CB  ASP A  62      27.115  48.447  56.884  1.00  0.84           C  
ATOM    472  CG  ASP A  62      27.374  49.150  58.209  1.00  0.84           C  
ATOM    473  OD1 ASP A  62      28.257  50.039  58.287  1.00  0.84           O  
ATOM    474  OD2 ASP A  62      26.671  48.779  59.189  1.00  0.84           O  
ATOM    475  N   HIS A  63      26.648  48.208  53.783  1.00  0.82           N  
ATOM    476  CA  HIS A  63      26.402  47.550  52.508  1.00  0.82           C  
ATOM    477  C   HIS A  63      27.309  48.007  51.375  1.00  0.82           C  
ATOM    478  O   HIS A  63      27.762  47.206  50.555  1.00  0.82           O  
ATOM    479  CB  HIS A  63      24.944  47.775  52.066  1.00  0.82           C  
ATOM    480  CG  HIS A  63      23.990  47.021  52.927  1.00  0.82           C  
ATOM    481  ND1 HIS A  63      24.087  45.646  52.949  1.00  0.82           N  
ATOM    482  CD2 HIS A  63      22.986  47.441  53.739  1.00  0.82           C  
ATOM    483  CE1 HIS A  63      23.137  45.249  53.771  1.00  0.82           C  
ATOM    484  NE2 HIS A  63      22.440  46.295  54.277  1.00  0.82           N  
ATOM    485  N   LEU A  64      27.582  49.323  51.295  1.00  0.84           N  
ATOM    486  CA  LEU A  64      28.531  49.927  50.376  1.00  0.84           C  
ATOM    487  C   LEU A  64      29.974  49.484  50.621  1.00  0.84           C  
ATOM    488  O   LEU A  64      30.687  49.075  49.704  1.00  0.84           O  
ATOM    489  CB  LEU A  64      28.393  51.463  50.546  1.00  0.84           C  
ATOM    490  CG  LEU A  64      29.309  52.364  49.703  1.00  0.84           C  
ATOM    491  CD1 LEU A  64      28.970  52.302  48.213  1.00  0.84           C  
ATOM    492  CD2 LEU A  64      29.210  53.815  50.201  1.00  0.84           C  
ATOM    493  N   VAL A  65      30.426  49.509  51.888  1.00  0.80           N  
ATOM    494  CA  VAL A  65      31.763  49.119  52.310  1.00  0.80           C  
ATOM    495  C   VAL A  65      32.039  47.634  52.145  1.00  0.80           C  
ATOM    496  O   VAL A  65      33.111  47.244  51.686  1.00  0.80           O  
ATOM    497  CB  VAL A  65      32.063  49.591  53.729  1.00  0.80           C  
ATOM    498  CG1 VAL A  65      33.414  49.049  54.230  1.00  0.80           C  
ATOM    499  CG2 VAL A  65      32.116  51.131  53.735  1.00  0.80           C  
ATOM    500  N   GLY A  66      31.073  46.744  52.459  1.00  0.81           N  
ATOM    501  CA  GLY A  66      31.244  45.307  52.229  1.00  0.81           C  
ATOM    502  C   GLY A  66      31.414  44.917  50.777  1.00  0.81           C  
ATOM    503  O   GLY A  66      32.151  43.991  50.445  1.00  0.81           O  
ATOM    504  N   ARG A  67      30.763  45.653  49.860  1.00  0.78           N  
ATOM    505  CA  ARG A  67      31.013  45.567  48.431  1.00  0.78           C  
ATOM    506  C   ARG A  67      32.376  46.125  48.019  1.00  0.78           C  
ATOM    507  O   ARG A  67      33.098  45.502  47.249  1.00  0.78           O  
ATOM    508  CB  ARG A  67      29.878  46.271  47.663  1.00  0.78           C  
ATOM    509  CG  ARG A  67      28.530  45.536  47.771  1.00  0.78           C  
ATOM    510  CD  ARG A  67      27.364  46.394  47.291  1.00  0.78           C  
ATOM    511  NE  ARG A  67      26.159  45.529  47.128  1.00  0.78           N  
ATOM    512  CZ  ARG A  67      25.295  45.183  48.091  1.00  0.78           C  
ATOM    513  NH1 ARG A  67      25.469  45.468  49.373  1.00  0.78           N  
ATOM    514  NH2 ARG A  67      24.217  44.497  47.738  1.00  0.78           N  
ATOM    515  N   TRP A  68      32.788  47.286  48.580  1.00  0.84           N  
ATOM    516  CA  TRP A  68      34.083  47.922  48.348  1.00  0.84           C  
ATOM    517  C   TRP A  68      35.261  47.024  48.711  1.00  0.84           C  
ATOM    518  O   TRP A  68      36.220  46.895  47.952  1.00  0.84           O  
ATOM    519  CB  TRP A  68      34.151  49.263  49.137  1.00  0.84           C  
ATOM    520  CG  TRP A  68      35.438  50.077  48.957  1.00  0.84           C  
ATOM    521  CD1 TRP A  68      35.772  50.945  47.954  1.00  0.84           C  
ATOM    522  CD2 TRP A  68      36.552  49.979  49.840  1.00  0.84           C  
ATOM    523  NE1 TRP A  68      37.046  51.391  48.170  1.00  0.84           N  
ATOM    524  CE2 TRP A  68      37.576  50.848  49.294  1.00  0.84           C  
ATOM    525  CE3 TRP A  68      36.803  49.261  50.995  1.00  0.84           C  
ATOM    526  CZ2 TRP A  68      38.787  50.961  49.928  1.00  0.84           C  
ATOM    527  CZ3 TRP A  68      38.060  49.347  51.598  1.00  0.84           C  
ATOM    528  CH2 TRP A  68      39.050  50.201  51.069  1.00  0.84           C  
ATOM    529  N   ILE A  69      35.176  46.321  49.859  1.00  0.81           N  
ATOM    530  CA  ILE A  69      36.148  45.321  50.285  1.00  0.81           C  
ATOM    531  C   ILE A  69      36.263  44.187  49.273  1.00  0.81           C  
ATOM    532  O   ILE A  69      37.354  43.805  48.859  1.00  0.81           O  
ATOM    533  CB  ILE A  69      35.787  44.785  51.675  1.00  0.81           C  
ATOM    534  CG1 ILE A  69      35.994  45.904  52.724  1.00  0.81           C  
ATOM    535  CG2 ILE A  69      36.626  43.536  52.039  1.00  0.81           C  
ATOM    536  CD1 ILE A  69      35.369  45.609  54.088  1.00  0.81           C  
ATOM    537  N   ARG A  70      35.133  43.648  48.775  1.00  0.76           N  
ATOM    538  CA  ARG A  70      35.151  42.635  47.735  1.00  0.76           C  
ATOM    539  C   ARG A  70      35.729  43.102  46.404  1.00  0.76           C  
ATOM    540  O   ARG A  70      36.536  42.394  45.800  1.00  0.76           O  
ATOM    541  CB  ARG A  70      33.739  42.040  47.539  1.00  0.76           C  
ATOM    542  CG  ARG A  70      33.273  41.190  48.737  1.00  0.76           C  
ATOM    543  CD  ARG A  70      34.114  39.923  48.917  1.00  0.76           C  
ATOM    544  NE  ARG A  70      33.458  39.071  49.955  1.00  0.76           N  
ATOM    545  CZ  ARG A  70      34.092  38.510  50.990  1.00  0.76           C  
ATOM    546  NH1 ARG A  70      35.292  38.917  51.398  1.00  0.76           N  
ATOM    547  NH2 ARG A  70      33.489  37.504  51.615  1.00  0.76           N  
ATOM    548  N   THR A  71      35.378  44.321  45.950  1.00  0.84           N  
ATOM    549  CA  THR A  71      35.937  44.948  44.753  1.00  0.84           C  
ATOM    550  C   THR A  71      37.441  45.126  44.826  1.00  0.84           C  
ATOM    551  O   THR A  71      38.180  44.702  43.937  1.00  0.84           O  
ATOM    552  CB  THR A  71      35.369  46.343  44.514  1.00  0.84           C  
ATOM    553  OG1 THR A  71      33.979  46.292  44.299  1.00  0.84           O  
ATOM    554  CG2 THR A  71      35.936  46.983  43.247  1.00  0.84           C  
ATOM    555  N   GLN A  72      37.958  45.726  45.919  1.00  0.81           N  
ATOM    556  CA  GLN A  72      39.381  45.980  46.071  1.00  0.81           C  
ATOM    557  C   GLN A  72      40.209  44.708  46.230  1.00  0.81           C  
ATOM    558  O   GLN A  72      41.298  44.598  45.664  1.00  0.81           O  
ATOM    559  CB  GLN A  72      39.692  47.017  47.181  1.00  0.81           C  
ATOM    560  CG  GLN A  72      39.019  48.407  46.986  1.00  0.81           C  
ATOM    561  CD  GLN A  72      39.234  49.048  45.607  1.00  0.81           C  
ATOM    562  OE1 GLN A  72      40.352  49.225  45.107  1.00  0.81           O  
ATOM    563  NE2 GLN A  72      38.105  49.438  44.964  1.00  0.81           N  
ATOM    564  N   GLN A  73      39.685  43.684  46.943  1.00  0.77           N  
ATOM    565  CA  GLN A  73      40.269  42.348  46.971  1.00  0.77           C  
ATOM    566  C   GLN A  73      40.323  41.680  45.589  1.00  0.77           C  
ATOM    567  O   GLN A  73      41.342  41.110  45.209  1.00  0.77           O  
ATOM    568  CB  GLN A  73      39.461  41.399  47.895  1.00  0.77           C  
ATOM    569  CG  GLN A  73      39.575  41.638  49.429  1.00  0.77           C  
ATOM    570  CD  GLN A  73      38.704  40.667  50.245  1.00  0.77           C  
ATOM    571  OE1 GLN A  73      38.719  40.572  51.471  1.00  0.77           O  
ATOM    572  NE2 GLN A  73      37.875  39.859  49.539  1.00  0.77           N  
ATOM    573  N   HIS A  74      39.242  41.764  44.775  1.00  0.76           N  
ATOM    574  CA  HIS A  74      39.214  41.279  43.392  1.00  0.76           C  
ATOM    575  C   HIS A  74      40.234  41.979  42.504  1.00  0.76           C  
ATOM    576  O   HIS A  74      40.952  41.355  41.725  1.00  0.76           O  
ATOM    577  CB  HIS A  74      37.799  41.469  42.787  1.00  0.76           C  
ATOM    578  CG  HIS A  74      37.625  41.152  41.321  1.00  0.76           C  
ATOM    579  ND1 HIS A  74      37.390  39.858  40.881  1.00  0.76           N  
ATOM    580  CD2 HIS A  74      37.526  42.020  40.280  1.00  0.76           C  
ATOM    581  CE1 HIS A  74      37.139  39.975  39.595  1.00  0.76           C  
ATOM    582  NE2 HIS A  74      37.213  41.259  39.175  1.00  0.76           N  
ATOM    583  N   TYR A  75      40.369  43.314  42.632  1.00  0.82           N  
ATOM    584  CA  TYR A  75      41.411  44.069  41.958  1.00  0.82           C  
ATOM    585  C   TYR A  75      42.813  43.686  42.401  1.00  0.82           C  
ATOM    586  O   TYR A  75      43.750  43.700  41.609  1.00  0.82           O  
ATOM    587  CB  TYR A  75      41.254  45.598  42.150  1.00  0.82           C  
ATOM    588  CG  TYR A  75      40.008  46.182  41.538  1.00  0.82           C  
ATOM    589  CD1 TYR A  75      39.253  45.563  40.518  1.00  0.82           C  
ATOM    590  CD2 TYR A  75      39.609  47.448  41.996  1.00  0.82           C  
ATOM    591  CE1 TYR A  75      38.106  46.186  40.004  1.00  0.82           C  
ATOM    592  CE2 TYR A  75      38.475  48.075  41.471  1.00  0.82           C  
ATOM    593  CZ  TYR A  75      37.715  47.434  40.490  1.00  0.82           C  
ATOM    594  OH  TYR A  75      36.550  48.045  39.997  1.00  0.82           O  
ATOM    595  N   TYR A  76      43.039  43.360  43.686  1.00  0.81           N  
ATOM    596  CA  TYR A  76      44.309  42.791  44.112  1.00  0.81           C  
ATOM    597  C   TYR A  76      44.567  41.411  43.504  1.00  0.81           C  
ATOM    598  O   TYR A  76      45.657  41.142  43.002  1.00  0.81           O  
ATOM    599  CB  TYR A  76      44.396  42.725  45.661  1.00  0.81           C  
ATOM    600  CG  TYR A  76      45.817  42.492  46.109  1.00  0.81           C  
ATOM    601  CD1 TYR A  76      46.676  43.584  46.306  1.00  0.81           C  
ATOM    602  CD2 TYR A  76      46.310  41.190  46.312  1.00  0.81           C  
ATOM    603  CE1 TYR A  76      48.002  43.379  46.707  1.00  0.81           C  
ATOM    604  CE2 TYR A  76      47.644  40.984  46.692  1.00  0.81           C  
ATOM    605  CZ  TYR A  76      48.488  42.080  46.892  1.00  0.81           C  
ATOM    606  OH  TYR A  76      49.822  41.881  47.289  1.00  0.81           O  
ATOM    607  N   ASP A  77      43.556  40.515  43.503  1.00  0.80           N  
ATOM    608  CA  ASP A  77      43.688  39.181  42.953  1.00  0.80           C  
ATOM    609  C   ASP A  77      43.961  39.151  41.449  1.00  0.80           C  
ATOM    610  O   ASP A  77      44.892  38.484  40.991  1.00  0.80           O  
ATOM    611  CB  ASP A  77      42.431  38.331  43.285  1.00  0.80           C  
ATOM    612  CG  ASP A  77      42.640  36.888  42.852  1.00  0.80           C  
ATOM    613  OD1 ASP A  77      43.611  36.267  43.366  1.00  0.80           O  
ATOM    614  OD2 ASP A  77      41.919  36.441  41.927  1.00  0.80           O  
ATOM    615  N   LYS A  78      43.187  39.894  40.644  1.00  0.78           N  
ATOM    616  CA  LYS A  78      43.307  39.804  39.202  1.00  0.78           C  
ATOM    617  C   LYS A  78      44.346  40.742  38.648  1.00  0.78           C  
ATOM    618  O   LYS A  78      44.770  40.602  37.506  1.00  0.78           O  
ATOM    619  CB  LYS A  78      41.941  40.115  38.545  1.00  0.78           C  
ATOM    620  CG  LYS A  78      40.806  39.181  39.002  1.00  0.78           C  
ATOM    621  CD  LYS A  78      41.141  37.689  38.818  1.00  0.78           C  
ATOM    622  CE  LYS A  78      40.052  36.734  39.305  1.00  0.78           C  
ATOM    623  NZ  LYS A  78      38.844  36.903  38.474  1.00  0.78           N  
ATOM    624  N   CYS A  79      44.785  41.710  39.470  1.00  0.83           N  
ATOM    625  CA  CYS A  79      45.776  42.714  39.133  1.00  0.83           C  
ATOM    626  C   CYS A  79      45.582  43.455  37.796  1.00  0.83           C  
ATOM    627  O   CYS A  79      46.483  43.458  36.956  1.00  0.83           O  
ATOM    628  CB  CYS A  79      47.201  42.126  39.291  1.00  0.83           C  
ATOM    629  SG  CYS A  79      48.418  43.389  39.794  1.00  0.83           S  
ATOM    630  N   PRO A  80      44.431  44.077  37.524  1.00  0.89           N  
ATOM    631  CA  PRO A  80      44.217  44.793  36.280  1.00  0.89           C  
ATOM    632  C   PRO A  80      44.944  46.121  36.266  1.00  0.89           C  
ATOM    633  O   PRO A  80      45.330  46.645  37.314  1.00  0.89           O  
ATOM    634  CB  PRO A  80      42.698  45.029  36.293  1.00  0.89           C  
ATOM    635  CG  PRO A  80      42.392  45.279  37.771  1.00  0.89           C  
ATOM    636  CD  PRO A  80      43.341  44.310  38.476  1.00  0.89           C  
ATOM    637  N   LYS A  81      45.099  46.707  35.066  1.00  0.88           N  
ATOM    638  CA  LYS A  81      45.526  48.077  34.914  1.00  0.88           C  
ATOM    639  C   LYS A  81      44.580  49.069  35.592  1.00  0.88           C  
ATOM    640  O   LYS A  81      43.359  48.991  35.460  1.00  0.88           O  
ATOM    641  CB  LYS A  81      45.677  48.407  33.410  1.00  0.88           C  
ATOM    642  CG  LYS A  81      46.234  49.809  33.155  1.00  0.88           C  
ATOM    643  CD  LYS A  81      46.622  50.076  31.698  1.00  0.88           C  
ATOM    644  CE  LYS A  81      47.342  51.419  31.604  1.00  0.88           C  
ATOM    645  NZ  LYS A  81      47.760  51.714  30.225  1.00  0.88           N  
ATOM    646  N   ARG A  82      45.139  50.027  36.356  1.00  0.87           N  
ATOM    647  CA  ARG A  82      44.363  50.902  37.205  1.00  0.87           C  
ATOM    648  C   ARG A  82      44.325  52.315  36.660  1.00  0.87           C  
ATOM    649  O   ARG A  82      45.335  52.881  36.239  1.00  0.87           O  
ATOM    650  CB  ARG A  82      44.924  50.915  38.649  1.00  0.87           C  
ATOM    651  CG  ARG A  82      44.896  49.521  39.309  1.00  0.87           C  
ATOM    652  CD  ARG A  82      45.442  49.505  40.738  1.00  0.87           C  
ATOM    653  NE  ARG A  82      45.708  48.074  41.071  1.00  0.87           N  
ATOM    654  CZ  ARG A  82      45.042  47.329  41.961  1.00  0.87           C  
ATOM    655  NH1 ARG A  82      44.071  47.805  42.732  1.00  0.87           N  
ATOM    656  NH2 ARG A  82      45.371  46.041  42.038  1.00  0.87           N  
ATOM    657  N   VAL A  83      43.122  52.918  36.653  1.00  0.95           N  
ATOM    658  CA  VAL A  83      42.894  54.238  36.094  1.00  0.95           C  
ATOM    659  C   VAL A  83      42.798  55.254  37.207  1.00  0.95           C  
ATOM    660  O   VAL A  83      41.934  55.197  38.077  1.00  0.95           O  
ATOM    661  CB  VAL A  83      41.619  54.320  35.261  1.00  0.95           C  
ATOM    662  CG1 VAL A  83      41.476  55.721  34.629  1.00  0.95           C  
ATOM    663  CG2 VAL A  83      41.649  53.249  34.154  1.00  0.95           C  
ATOM    664  N   TYR A  84      43.688  56.248  37.204  1.00  0.95           N  
ATOM    665  CA  TYR A  84      43.716  57.265  38.226  1.00  0.95           C  
ATOM    666  C   TYR A  84      43.249  58.572  37.629  1.00  0.95           C  
ATOM    667  O   TYR A  84      43.893  59.164  36.765  1.00  0.95           O  
ATOM    668  CB  TYR A  84      45.143  57.419  38.789  1.00  0.95           C  
ATOM    669  CG  TYR A  84      45.534  56.148  39.491  1.00  0.95           C  
ATOM    670  CD1 TYR A  84      45.052  55.900  40.779  1.00  0.95           C  
ATOM    671  CD2 TYR A  84      46.350  55.185  38.881  1.00  0.95           C  
ATOM    672  CE1 TYR A  84      45.395  54.729  41.466  1.00  0.95           C  
ATOM    673  CE2 TYR A  84      46.727  54.022  39.573  1.00  0.95           C  
ATOM    674  CZ  TYR A  84      46.269  53.807  40.882  1.00  0.95           C  
ATOM    675  OH  TYR A  84      46.726  52.699  41.630  1.00  0.95           O  
ATOM    676  N   TYR A  85      42.081  59.060  38.075  1.00  0.96           N  
ATOM    677  CA  TYR A  85      41.516  60.289  37.566  1.00  0.96           C  
ATOM    678  C   TYR A  85      41.936  61.449  38.448  1.00  0.96           C  
ATOM    679  O   TYR A  85      41.459  61.616  39.572  1.00  0.96           O  
ATOM    680  CB  TYR A  85      39.972  60.181  37.487  1.00  0.96           C  
ATOM    681  CG  TYR A  85      39.401  61.182  36.518  1.00  0.96           C  
ATOM    682  CD1 TYR A  85      39.318  60.851  35.156  1.00  0.96           C  
ATOM    683  CD2 TYR A  85      38.949  62.445  36.943  1.00  0.96           C  
ATOM    684  CE1 TYR A  85      38.781  61.759  34.236  1.00  0.96           C  
ATOM    685  CE2 TYR A  85      38.418  63.358  36.016  1.00  0.96           C  
ATOM    686  CZ  TYR A  85      38.327  63.009  34.663  1.00  0.96           C  
ATOM    687  OH  TYR A  85      37.773  63.879  33.702  1.00  0.96           O  
ATOM    688  N   LEU A  86      42.857  62.285  37.938  1.00  0.96           N  
ATOM    689  CA  LEU A  86      43.385  63.417  38.666  1.00  0.96           C  
ATOM    690  C   LEU A  86      42.538  64.629  38.366  1.00  0.96           C  
ATOM    691  O   LEU A  86      42.459  65.091  37.229  1.00  0.96           O  
ATOM    692  CB  LEU A  86      44.855  63.725  38.255  1.00  0.96           C  
ATOM    693  CG  LEU A  86      45.933  63.364  39.292  1.00  0.96           C  
ATOM    694  CD1 LEU A  86      45.872  64.277  40.525  1.00  0.96           C  
ATOM    695  CD2 LEU A  86      45.832  61.893  39.693  1.00  0.96           C  
ATOM    696  N   SER A  87      41.889  65.192  39.395  1.00  0.96           N  
ATOM    697  CA  SER A  87      41.050  66.357  39.214  1.00  0.96           C  
ATOM    698  C   SER A  87      41.142  67.204  40.451  1.00  0.96           C  
ATOM    699  O   SER A  87      41.230  66.712  41.571  1.00  0.96           O  
ATOM    700  CB  SER A  87      39.555  66.000  38.991  1.00  0.96           C  
ATOM    701  OG  SER A  87      38.773  67.150  38.651  1.00  0.96           O  
ATOM    702  N   LEU A  88      41.086  68.534  40.287  1.00  0.94           N  
ATOM    703  CA  LEU A  88      41.109  69.447  41.414  1.00  0.94           C  
ATOM    704  C   LEU A  88      39.684  69.752  41.845  1.00  0.94           C  
ATOM    705  O   LEU A  88      39.451  70.500  42.792  1.00  0.94           O  
ATOM    706  CB  LEU A  88      41.825  70.763  41.011  1.00  0.94           C  
ATOM    707  CG  LEU A  88      43.326  70.833  41.367  1.00  0.94           C  
ATOM    708  CD1 LEU A  88      43.527  71.051  42.872  1.00  0.94           C  
ATOM    709  CD2 LEU A  88      44.135  69.628  40.864  1.00  0.94           C  
ATOM    710  N   GLU A  89      38.698  69.135  41.172  1.00  0.91           N  
ATOM    711  CA  GLU A  89      37.296  69.361  41.412  1.00  0.91           C  
ATOM    712  C   GLU A  89      36.511  68.052  41.286  1.00  0.91           C  
ATOM    713  O   GLU A  89      36.661  67.316  40.310  1.00  0.91           O  
ATOM    714  CB  GLU A  89      36.773  70.390  40.370  1.00  0.91           C  
ATOM    715  CG  GLU A  89      35.443  71.038  40.799  1.00  0.91           C  
ATOM    716  CD  GLU A  89      34.677  71.816  39.735  1.00  0.91           C  
ATOM    717  OE1 GLU A  89      35.140  72.856  39.227  1.00  0.91           O  
ATOM    718  OE2 GLU A  89      33.511  71.393  39.494  1.00  0.91           O  
ATOM    719  N   PHE A  90      35.644  67.726  42.269  1.00  0.92           N  
ATOM    720  CA  PHE A  90      34.744  66.577  42.223  1.00  0.92           C  
ATOM    721  C   PHE A  90      33.367  66.989  42.717  1.00  0.92           C  
ATOM    722  O   PHE A  90      33.086  67.013  43.913  1.00  0.92           O  
ATOM    723  CB  PHE A  90      35.216  65.408  43.131  1.00  0.92           C  
ATOM    724  CG  PHE A  90      36.302  64.626  42.460  1.00  0.92           C  
ATOM    725  CD1 PHE A  90      37.650  64.866  42.760  1.00  0.92           C  
ATOM    726  CD2 PHE A  90      35.976  63.641  41.512  1.00  0.92           C  
ATOM    727  CE1 PHE A  90      38.657  64.141  42.112  1.00  0.92           C  
ATOM    728  CE2 PHE A  90      36.984  62.918  40.859  1.00  0.92           C  
ATOM    729  CZ  PHE A  90      38.328  63.169  41.160  1.00  0.92           C  
ATOM    730  N   TYR A  91      32.421  67.296  41.809  1.00  0.91           N  
ATOM    731  CA  TYR A  91      31.129  67.852  42.179  1.00  0.91           C  
ATOM    732  C   TYR A  91      30.123  66.741  42.417  1.00  0.91           C  
ATOM    733  O   TYR A  91      29.189  66.498  41.651  1.00  0.91           O  
ATOM    734  CB  TYR A  91      30.651  68.868  41.103  1.00  0.91           C  
ATOM    735  CG  TYR A  91      29.767  70.002  41.578  1.00  0.91           C  
ATOM    736  CD1 TYR A  91      29.597  70.384  42.926  1.00  0.91           C  
ATOM    737  CD2 TYR A  91      29.170  70.798  40.585  1.00  0.91           C  
ATOM    738  CE1 TYR A  91      28.902  71.558  43.255  1.00  0.91           C  
ATOM    739  CE2 TYR A  91      28.477  71.970  40.910  1.00  0.91           C  
ATOM    740  CZ  TYR A  91      28.373  72.363  42.244  1.00  0.91           C  
ATOM    741  OH  TYR A  91      27.791  73.605  42.549  1.00  0.91           O  
ATOM    742  N   MET A  92      30.345  65.991  43.507  1.00  0.91           N  
ATOM    743  CA  MET A  92      29.600  64.801  43.860  1.00  0.91           C  
ATOM    744  C   MET A  92      28.124  65.030  44.131  1.00  0.91           C  
ATOM    745  O   MET A  92      27.283  64.290  43.617  1.00  0.91           O  
ATOM    746  CB  MET A  92      30.254  64.111  45.081  1.00  0.91           C  
ATOM    747  CG  MET A  92      31.719  63.696  44.833  1.00  0.91           C  
ATOM    748  SD  MET A  92      31.953  62.558  43.430  1.00  0.91           S  
ATOM    749  CE  MET A  92      31.389  61.057  44.285  1.00  0.91           C  
ATOM    750  N   GLY A  93      27.782  66.091  44.894  1.00  0.94           N  
ATOM    751  CA  GLY A  93      26.435  66.302  45.412  1.00  0.94           C  
ATOM    752  C   GLY A  93      26.195  65.494  46.653  1.00  0.94           C  
ATOM    753  O   GLY A  93      27.093  65.306  47.468  1.00  0.94           O  
ATOM    754  N   ARG A  94      24.955  65.017  46.828  1.00  0.88           N  
ATOM    755  CA  ARG A  94      24.583  64.108  47.895  1.00  0.88           C  
ATOM    756  C   ARG A  94      24.842  62.646  47.538  1.00  0.88           C  
ATOM    757  O   ARG A  94      24.968  62.286  46.365  1.00  0.88           O  
ATOM    758  CB  ARG A  94      23.077  64.226  48.169  1.00  0.88           C  
ATOM    759  CG  ARG A  94      22.634  65.572  48.758  1.00  0.88           C  
ATOM    760  CD  ARG A  94      21.143  65.496  49.073  1.00  0.88           C  
ATOM    761  NE  ARG A  94      20.729  66.771  49.719  1.00  0.88           N  
ATOM    762  CZ  ARG A  94      19.464  67.203  49.742  1.00  0.88           C  
ATOM    763  NH1 ARG A  94      18.520  66.548  49.073  1.00  0.88           N  
ATOM    764  NH2 ARG A  94      19.144  68.285  50.446  1.00  0.88           N  
ATOM    765  N   THR A  95      24.884  61.748  48.536  1.00  0.95           N  
ATOM    766  CA  THR A  95      25.279  60.358  48.320  1.00  0.95           C  
ATOM    767  C   THR A  95      24.184  59.361  48.683  1.00  0.95           C  
ATOM    768  O   THR A  95      24.100  58.302  48.061  1.00  0.95           O  
ATOM    769  CB  THR A  95      26.524  60.036  49.146  1.00  0.95           C  
ATOM    770  OG1 THR A  95      27.620  60.837  48.724  1.00  0.95           O  
ATOM    771  CG2 THR A  95      26.985  58.576  49.027  1.00  0.95           C  
ATOM    772  N   LEU A  96      23.282  59.648  49.657  1.00  0.93           N  
ATOM    773  CA  LEU A  96      22.384  58.648  50.256  1.00  0.93           C  
ATOM    774  C   LEU A  96      21.481  57.879  49.284  1.00  0.93           C  
ATOM    775  O   LEU A  96      21.590  56.659  49.134  1.00  0.93           O  
ATOM    776  CB  LEU A  96      21.531  59.341  51.369  1.00  0.93           C  
ATOM    777  CG  LEU A  96      20.783  58.484  52.431  1.00  0.93           C  
ATOM    778  CD1 LEU A  96      19.260  58.678  52.344  1.00  0.93           C  
ATOM    779  CD2 LEU A  96      21.140  56.993  52.440  1.00  0.93           C  
ATOM    780  N   GLN A  97      20.608  58.573  48.526  1.00  0.90           N  
ATOM    781  CA  GLN A  97      19.731  57.928  47.560  1.00  0.90           C  
ATOM    782  C   GLN A  97      20.457  57.367  46.344  1.00  0.90           C  
ATOM    783  O   GLN A  97      20.081  56.334  45.796  1.00  0.90           O  
ATOM    784  CB  GLN A  97      18.608  58.866  47.086  1.00  0.90           C  
ATOM    785  CG  GLN A  97      17.549  59.220  48.147  1.00  0.90           C  
ATOM    786  CD  GLN A  97      16.594  58.075  48.499  1.00  0.90           C  
ATOM    787  OE1 GLN A  97      16.746  56.939  48.042  1.00  0.90           O  
ATOM    788  NE2 GLN A  97      15.564  58.383  49.317  1.00  0.90           N  
ATOM    789  N   ASN A  98      21.546  58.023  45.888  1.00  0.92           N  
ATOM    790  CA  ASN A  98      22.357  57.561  44.769  1.00  0.92           C  
ATOM    791  C   ASN A  98      23.003  56.206  45.063  1.00  0.92           C  
ATOM    792  O   ASN A  98      22.956  55.287  44.248  1.00  0.92           O  
ATOM    793  CB  ASN A  98      23.402  58.665  44.434  1.00  0.92           C  
ATOM    794  CG  ASN A  98      24.224  58.462  43.159  1.00  0.92           C  
ATOM    795  OD1 ASN A  98      25.408  58.794  43.134  1.00  0.92           O  
ATOM    796  ND2 ASN A  98      23.598  58.004  42.056  1.00  0.92           N  
ATOM    797  N   THR A  99      23.545  56.034  46.284  1.00  0.94           N  
ATOM    798  CA  THR A  99      24.002  54.746  46.798  1.00  0.94           C  
ATOM    799  C   THR A  99      22.874  53.738  46.939  1.00  0.94           C  
ATOM    800  O   THR A  99      23.000  52.588  46.529  1.00  0.94           O  
ATOM    801  CB  THR A  99      24.717  54.887  48.135  1.00  0.94           C  
ATOM    802  OG1 THR A  99      25.881  55.678  47.958  1.00  0.94           O  
ATOM    803  CG2 THR A  99      25.211  53.535  48.659  1.00  0.94           C  
ATOM    804  N   MET A 100      21.700  54.134  47.471  1.00  0.90           N  
ATOM    805  CA  MET A 100      20.534  53.260  47.545  1.00  0.90           C  
ATOM    806  C   MET A 100      20.028  52.753  46.194  1.00  0.90           C  
ATOM    807  O   MET A 100      19.670  51.585  46.080  1.00  0.90           O  
ATOM    808  CB  MET A 100      19.386  53.917  48.350  1.00  0.90           C  
ATOM    809  CG  MET A 100      19.497  53.650  49.867  1.00  0.90           C  
ATOM    810  SD  MET A 100      18.592  54.810  50.942  1.00  0.90           S  
ATOM    811  CE  MET A 100      16.932  54.598  50.254  1.00  0.90           C  
ATOM    812  N   ILE A 101      19.999  53.577  45.129  1.00  0.90           N  
ATOM    813  CA  ILE A 101      19.725  53.097  43.775  1.00  0.90           C  
ATOM    814  C   ILE A 101      20.816  52.198  43.218  1.00  0.90           C  
ATOM    815  O   ILE A 101      20.534  51.094  42.757  1.00  0.90           O  
ATOM    816  CB  ILE A 101      19.440  54.259  42.824  1.00  0.90           C  
ATOM    817  CG1 ILE A 101      18.070  54.854  43.218  1.00  0.90           C  
ATOM    818  CG2 ILE A 101      19.457  53.820  41.336  1.00  0.90           C  
ATOM    819  CD1 ILE A 101      17.592  55.978  42.301  1.00  0.90           C  
ATOM    820  N   ASN A 102      22.104  52.597  43.296  1.00  0.91           N  
ATOM    821  CA  ASN A 102      23.176  51.836  42.668  1.00  0.91           C  
ATOM    822  C   ASN A 102      23.429  50.490  43.351  1.00  0.91           C  
ATOM    823  O   ASN A 102      23.872  49.539  42.710  1.00  0.91           O  
ATOM    824  CB  ASN A 102      24.487  52.668  42.547  1.00  0.91           C  
ATOM    825  CG  ASN A 102      24.373  53.727  41.443  1.00  0.91           C  
ATOM    826  OD1 ASN A 102      23.294  54.045  40.939  1.00  0.91           O  
ATOM    827  ND2 ASN A 102      25.536  54.276  41.019  1.00  0.91           N  
ATOM    828  N   LEU A 103      23.092  50.357  44.652  1.00  0.88           N  
ATOM    829  CA  LEU A 103      23.170  49.086  45.351  1.00  0.88           C  
ATOM    830  C   LEU A 103      21.839  48.340  45.416  1.00  0.88           C  
ATOM    831  O   LEU A 103      21.786  47.231  45.938  1.00  0.88           O  
ATOM    832  CB  LEU A 103      23.639  49.286  46.815  1.00  0.88           C  
ATOM    833  CG  LEU A 103      24.963  50.050  47.018  1.00  0.88           C  
ATOM    834  CD1 LEU A 103      25.367  49.963  48.495  1.00  0.88           C  
ATOM    835  CD2 LEU A 103      26.092  49.553  46.110  1.00  0.88           C  
ATOM    836  N   GLY A 104      20.730  48.901  44.883  1.00  0.88           N  
ATOM    837  CA  GLY A 104      19.430  48.220  44.855  1.00  0.88           C  
ATOM    838  C   GLY A 104      18.629  48.259  46.133  1.00  0.88           C  
ATOM    839  O   GLY A 104      17.606  47.595  46.269  1.00  0.88           O  
ATOM    840  N   LEU A 105      19.049  49.061  47.118  1.00  0.85           N  
ATOM    841  CA  LEU A 105      18.534  48.996  48.470  1.00  0.85           C  
ATOM    842  C   LEU A 105      17.328  49.881  48.716  1.00  0.85           C  
ATOM    843  O   LEU A 105      16.726  49.831  49.787  1.00  0.85           O  
ATOM    844  CB  LEU A 105      19.620  49.495  49.452  1.00  0.85           C  
ATOM    845  CG  LEU A 105      20.881  48.619  49.524  1.00  0.85           C  
ATOM    846  CD1 LEU A 105      21.974  49.337  50.327  1.00  0.85           C  
ATOM    847  CD2 LEU A 105      20.580  47.251  50.145  1.00  0.85           C  
ATOM    848  N   GLN A 106      16.926  50.714  47.734  1.00  0.83           N  
ATOM    849  CA  GLN A 106      15.935  51.760  47.936  1.00  0.83           C  
ATOM    850  C   GLN A 106      14.581  51.264  48.430  1.00  0.83           C  
ATOM    851  O   GLN A 106      14.049  51.761  49.414  1.00  0.83           O  
ATOM    852  CB  GLN A 106      15.787  52.593  46.640  1.00  0.83           C  
ATOM    853  CG  GLN A 106      14.978  53.902  46.810  1.00  0.83           C  
ATOM    854  CD  GLN A 106      15.051  54.748  45.537  1.00  0.83           C  
ATOM    855  OE1 GLN A 106      14.635  54.320  44.461  1.00  0.83           O  
ATOM    856  NE2 GLN A 106      15.620  55.970  45.645  1.00  0.83           N  
ATOM    857  N   ASN A 107      14.041  50.192  47.819  1.00  0.78           N  
ATOM    858  CA  ASN A 107      12.778  49.594  48.220  1.00  0.78           C  
ATOM    859  C   ASN A 107      12.774  49.021  49.644  1.00  0.78           C  
ATOM    860  O   ASN A 107      11.847  49.242  50.420  1.00  0.78           O  
ATOM    861  CB  ASN A 107      12.436  48.496  47.175  1.00  0.78           C  
ATOM    862  CG  ASN A 107      11.023  47.937  47.317  1.00  0.78           C  
ATOM    863  OD1 ASN A 107      10.836  46.744  47.544  1.00  0.78           O  
ATOM    864  ND2 ASN A 107      10.002  48.805  47.153  1.00  0.78           N  
ATOM    865  N   ALA A 108      13.835  48.284  50.027  1.00  0.83           N  
ATOM    866  CA  ALA A 108      13.965  47.706  51.347  1.00  0.83           C  
ATOM    867  C   ALA A 108      14.163  48.755  52.436  1.00  0.83           C  
ATOM    868  O   ALA A 108      13.561  48.690  53.507  1.00  0.83           O  
ATOM    869  CB  ALA A 108      15.111  46.677  51.328  1.00  0.83           C  
ATOM    870  N   CYS A 109      14.996  49.784  52.172  1.00  0.84           N  
ATOM    871  CA  CYS A 109      15.183  50.902  53.083  1.00  0.84           C  
ATOM    872  C   CYS A 109      13.926  51.712  53.318  1.00  0.84           C  
ATOM    873  O   CYS A 109      13.645  52.068  54.458  1.00  0.84           O  
ATOM    874  CB  CYS A 109      16.293  51.862  52.616  1.00  0.84           C  
ATOM    875  SG  CYS A 109      17.944  51.102  52.756  1.00  0.84           S  
ATOM    876  N   ASP A 110      13.122  51.991  52.270  1.00  0.83           N  
ATOM    877  CA  ASP A 110      11.856  52.698  52.388  1.00  0.83           C  
ATOM    878  C   ASP A 110      10.892  52.039  53.374  1.00  0.83           C  
ATOM    879  O   ASP A 110      10.417  52.662  54.324  1.00  0.83           O  
ATOM    880  CB  ASP A 110      11.187  52.721  50.987  1.00  0.83           C  
ATOM    881  CG  ASP A 110      11.182  54.119  50.406  1.00  0.83           C  
ATOM    882  OD1 ASP A 110      12.286  54.692  50.230  1.00  0.83           O  
ATOM    883  OD2 ASP A 110      10.064  54.618  50.127  1.00  0.83           O  
ATOM    884  N   GLU A 111      10.664  50.719  53.216  1.00  0.81           N  
ATOM    885  CA  GLU A 111       9.868  49.918  54.128  1.00  0.81           C  
ATOM    886  C   GLU A 111      10.452  49.851  55.535  1.00  0.81           C  
ATOM    887  O   GLU A 111       9.765  50.040  56.540  1.00  0.81           O  
ATOM    888  CB  GLU A 111       9.709  48.501  53.524  1.00  0.81           C  
ATOM    889  CG  GLU A 111       9.011  47.446  54.422  1.00  0.81           C  
ATOM    890  CD  GLU A 111       7.587  47.789  54.862  1.00  0.81           C  
ATOM    891  OE1 GLU A 111       7.007  48.800  54.405  1.00  0.81           O  
ATOM    892  OE2 GLU A 111       7.077  47.004  55.706  1.00  0.81           O  
ATOM    893  N   ALA A 112      11.780  49.648  55.663  1.00  0.86           N  
ATOM    894  CA  ALA A 112      12.443  49.637  56.951  1.00  0.86           C  
ATOM    895  C   ALA A 112      12.308  50.948  57.723  1.00  0.86           C  
ATOM    896  O   ALA A 112      11.944  50.951  58.896  1.00  0.86           O  
ATOM    897  CB  ALA A 112      13.931  49.283  56.755  1.00  0.86           C  
ATOM    898  N   ILE A 113      12.529  52.098  57.061  1.00  0.83           N  
ATOM    899  CA  ILE A 113      12.346  53.426  57.630  1.00  0.83           C  
ATOM    900  C   ILE A 113      10.888  53.736  57.956  1.00  0.83           C  
ATOM    901  O   ILE A 113      10.581  54.302  59.009  1.00  0.83           O  
ATOM    902  CB  ILE A 113      12.992  54.476  56.729  1.00  0.83           C  
ATOM    903  CG1 ILE A 113      14.531  54.281  56.675  1.00  0.83           C  
ATOM    904  CG2 ILE A 113      12.662  55.919  57.160  1.00  0.83           C  
ATOM    905  CD1 ILE A 113      15.274  54.542  57.995  1.00  0.83           C  
ATOM    906  N   TYR A 114       9.934  53.316  57.098  1.00  0.83           N  
ATOM    907  CA  TYR A 114       8.505  53.431  57.357  1.00  0.83           C  
ATOM    908  C   TYR A 114       8.056  52.671  58.611  1.00  0.83           C  
ATOM    909  O   TYR A 114       7.298  53.183  59.441  1.00  0.83           O  
ATOM    910  CB  TYR A 114       7.698  52.933  56.123  1.00  0.83           C  
ATOM    911  CG  TYR A 114       6.238  53.281  56.263  1.00  0.83           C  
ATOM    912  CD1 TYR A 114       5.776  54.566  55.935  1.00  0.83           C  
ATOM    913  CD2 TYR A 114       5.342  52.359  56.830  1.00  0.83           C  
ATOM    914  CE1 TYR A 114       4.453  54.941  56.214  1.00  0.83           C  
ATOM    915  CE2 TYR A 114       4.024  52.734  57.123  1.00  0.83           C  
ATOM    916  CZ  TYR A 114       3.583  54.024  56.815  1.00  0.83           C  
ATOM    917  OH  TYR A 114       2.272  54.405  57.165  1.00  0.83           O  
ATOM    918  N   GLN A 115       8.557  51.433  58.810  1.00  0.80           N  
ATOM    919  CA  GLN A 115       8.280  50.641  59.995  1.00  0.80           C  
ATOM    920  C   GLN A 115       8.895  51.218  61.265  1.00  0.80           C  
ATOM    921  O   GLN A 115       8.435  50.921  62.364  1.00  0.80           O  
ATOM    922  CB  GLN A 115       8.805  49.193  59.854  1.00  0.80           C  
ATOM    923  CG  GLN A 115       8.032  48.304  58.850  1.00  0.80           C  
ATOM    924  CD  GLN A 115       8.530  46.860  58.934  1.00  0.80           C  
ATOM    925  OE1 GLN A 115       9.065  46.433  59.966  1.00  0.80           O  
ATOM    926  NE2 GLN A 115       8.364  46.074  57.856  1.00  0.80           N  
ATOM    927  N   LEU A 116       9.917  52.085  61.149  1.00  0.82           N  
ATOM    928  CA  LEU A 116      10.535  52.758  62.278  1.00  0.82           C  
ATOM    929  C   LEU A 116       9.856  54.095  62.563  1.00  0.82           C  
ATOM    930  O   LEU A 116      10.251  54.839  63.457  1.00  0.82           O  
ATOM    931  CB  LEU A 116      12.034  53.021  61.982  1.00  0.82           C  
ATOM    932  CG  LEU A 116      12.914  51.756  61.869  1.00  0.82           C  
ATOM    933  CD1 LEU A 116      14.238  52.101  61.177  1.00  0.82           C  
ATOM    934  CD2 LEU A 116      13.184  51.082  63.221  1.00  0.82           C  
ATOM    935  N   GLY A 117       8.771  54.437  61.830  1.00  0.81           N  
ATOM    936  CA  GLY A 117       7.950  55.603  62.145  1.00  0.81           C  
ATOM    937  C   GLY A 117       8.529  56.911  61.695  1.00  0.81           C  
ATOM    938  O   GLY A 117       8.215  57.967  62.248  1.00  0.81           O  
ATOM    939  N   LEU A 118       9.409  56.874  60.691  1.00  0.80           N  
ATOM    940  CA  LEU A 118      10.129  58.024  60.197  1.00  0.80           C  
ATOM    941  C   LEU A 118       9.716  58.305  58.766  1.00  0.80           C  
ATOM    942  O   LEU A 118       9.278  57.408  58.052  1.00  0.80           O  
ATOM    943  CB  LEU A 118      11.644  57.729  60.211  1.00  0.80           C  
ATOM    944  CG  LEU A 118      12.247  57.500  61.608  1.00  0.80           C  
ATOM    945  CD1 LEU A 118      13.652  56.904  61.491  1.00  0.80           C  
ATOM    946  CD2 LEU A 118      12.307  58.793  62.424  1.00  0.80           C  
ATOM    947  N   ASP A 119       9.850  59.566  58.304  1.00  0.78           N  
ATOM    948  CA  ASP A 119       9.699  59.885  56.897  1.00  0.78           C  
ATOM    949  C   ASP A 119      11.068  59.844  56.234  1.00  0.78           C  
ATOM    950  O   ASP A 119      11.999  60.531  56.645  1.00  0.78           O  
ATOM    951  CB  ASP A 119       9.056  61.280  56.692  1.00  0.78           C  
ATOM    952  CG  ASP A 119       9.026  61.626  55.210  1.00  0.78           C  
ATOM    953  OD1 ASP A 119       8.657  60.732  54.412  1.00  0.78           O  
ATOM    954  OD2 ASP A 119       9.497  62.731  54.860  1.00  0.78           O  
ATOM    955  N   ILE A 120      11.221  59.037  55.172  1.00  0.81           N  
ATOM    956  CA  ILE A 120      12.479  58.937  54.456  1.00  0.81           C  
ATOM    957  C   ILE A 120      12.835  60.185  53.651  1.00  0.81           C  
ATOM    958  O   ILE A 120      14.008  60.563  53.602  1.00  0.81           O  
ATOM    959  CB  ILE A 120      12.602  57.637  53.669  1.00  0.81           C  
ATOM    960  CG1 ILE A 120      14.077  57.348  53.297  1.00  0.81           C  
ATOM    961  CG2 ILE A 120      11.657  57.629  52.452  1.00  0.81           C  
ATOM    962  CD1 ILE A 120      14.325  55.903  52.851  1.00  0.81           C  
ATOM    963  N   GLU A 121      11.842  60.899  53.060  1.00  0.76           N  
ATOM    964  CA  GLU A 121      12.081  62.153  52.349  1.00  0.76           C  
ATOM    965  C   GLU A 121      12.632  63.252  53.271  1.00  0.76           C  
ATOM    966  O   GLU A 121      13.599  63.938  52.933  1.00  0.76           O  
ATOM    967  CB  GLU A 121      10.837  62.661  51.556  1.00  0.76           C  
ATOM    968  CG  GLU A 121      10.493  61.813  50.294  1.00  0.76           C  
ATOM    969  CD  GLU A 121       9.624  62.525  49.243  1.00  0.76           C  
ATOM    970  OE1 GLU A 121       8.473  62.069  49.020  1.00  0.76           O  
ATOM    971  OE2 GLU A 121      10.114  63.494  48.594  1.00  0.76           O  
ATOM    972  N   GLU A 122      12.097  63.398  54.506  1.00  0.77           N  
ATOM    973  CA  GLU A 122      12.664  64.257  55.542  1.00  0.77           C  
ATOM    974  C   GLU A 122      14.109  63.905  55.911  1.00  0.77           C  
ATOM    975  O   GLU A 122      14.969  64.782  55.999  1.00  0.77           O  
ATOM    976  CB  GLU A 122      11.789  64.249  56.834  1.00  0.77           C  
ATOM    977  CG  GLU A 122      12.108  65.398  57.837  1.00  0.77           C  
ATOM    978  CD  GLU A 122      11.514  65.232  59.246  1.00  0.77           C  
ATOM    979  OE1 GLU A 122      10.444  64.593  59.405  1.00  0.77           O  
ATOM    980  OE2 GLU A 122      12.160  65.746  60.204  1.00  0.77           O  
ATOM    981  N   LEU A 123      14.452  62.603  56.080  1.00  0.85           N  
ATOM    982  CA  LEU A 123      15.826  62.180  56.346  1.00  0.85           C  
ATOM    983  C   LEU A 123      16.791  62.509  55.213  1.00  0.85           C  
ATOM    984  O   LEU A 123      17.911  62.955  55.445  1.00  0.85           O  
ATOM    985  CB  LEU A 123      15.960  60.660  56.647  1.00  0.85           C  
ATOM    986  CG  LEU A 123      15.086  60.123  57.798  1.00  0.85           C  
ATOM    987  CD1 LEU A 123      15.367  58.634  58.053  1.00  0.85           C  
ATOM    988  CD2 LEU A 123      15.212  60.940  59.090  1.00  0.85           C  
ATOM    989  N   GLU A 124      16.369  62.315  53.951  1.00  0.85           N  
ATOM    990  CA  GLU A 124      17.155  62.595  52.761  1.00  0.85           C  
ATOM    991  C   GLU A 124      17.584  64.049  52.622  1.00  0.85           C  
ATOM    992  O   GLU A 124      18.735  64.354  52.305  1.00  0.85           O  
ATOM    993  CB  GLU A 124      16.331  62.180  51.522  1.00  0.85           C  
ATOM    994  CG  GLU A 124      17.004  62.479  50.162  1.00  0.85           C  
ATOM    995  CD  GLU A 124      16.136  62.050  48.989  1.00  0.85           C  
ATOM    996  OE1 GLU A 124      15.325  61.106  49.161  1.00  0.85           O  
ATOM    997  OE2 GLU A 124      16.345  62.615  47.885  1.00  0.85           O  
ATOM    998  N   GLU A 125      16.680  65.006  52.909  1.00  0.83           N  
ATOM    999  CA  GLU A 125      16.981  66.420  52.771  1.00  0.83           C  
ATOM   1000  C   GLU A 125      17.919  66.979  53.840  1.00  0.83           C  
ATOM   1001  O   GLU A 125      18.458  68.071  53.674  1.00  0.83           O  
ATOM   1002  CB  GLU A 125      15.697  67.279  52.674  1.00  0.83           C  
ATOM   1003  CG  GLU A 125      14.974  67.208  51.299  1.00  0.83           C  
ATOM   1004  CD  GLU A 125      15.822  67.690  50.136  1.00  0.83           C  
ATOM   1005  OE1 GLU A 125      16.488  68.755  50.193  1.00  0.83           O  
ATOM   1006  OE2 GLU A 125      15.908  66.980  49.100  1.00  0.83           O  
ATOM   1007  N   ILE A 126      18.190  66.229  54.932  1.00  0.87           N  
ATOM   1008  CA  ILE A 126      19.240  66.539  55.903  1.00  0.87           C  
ATOM   1009  C   ILE A 126      20.636  66.554  55.280  1.00  0.87           C  
ATOM   1010  O   ILE A 126      21.509  67.311  55.698  1.00  0.87           O  
ATOM   1011  CB  ILE A 126      19.236  65.547  57.075  1.00  0.87           C  
ATOM   1012  CG1 ILE A 126      17.909  65.574  57.874  1.00  0.87           C  
ATOM   1013  CG2 ILE A 126      20.436  65.770  58.027  1.00  0.87           C  
ATOM   1014  CD1 ILE A 126      17.661  66.862  58.672  1.00  0.87           C  
ATOM   1015  N   GLU A 127      20.904  65.684  54.285  1.00  0.89           N  
ATOM   1016  CA  GLU A 127      22.212  65.582  53.668  1.00  0.89           C  
ATOM   1017  C   GLU A 127      22.673  66.834  52.918  1.00  0.89           C  
ATOM   1018  O   GLU A 127      22.054  67.311  51.965  1.00  0.89           O  
ATOM   1019  CB  GLU A 127      22.284  64.339  52.749  1.00  0.89           C  
ATOM   1020  CG  GLU A 127      23.700  64.028  52.203  1.00  0.89           C  
ATOM   1021  CD  GLU A 127      23.777  62.714  51.437  1.00  0.89           C  
ATOM   1022  OE1 GLU A 127      22.752  62.226  50.902  1.00  0.89           O  
ATOM   1023  OE2 GLU A 127      24.906  62.179  51.301  1.00  0.89           O  
ATOM   1024  N   GLU A 128      23.811  67.405  53.340  1.00  0.88           N  
ATOM   1025  CA  GLU A 128      24.494  68.470  52.635  1.00  0.88           C  
ATOM   1026  C   GLU A 128      25.025  68.025  51.271  1.00  0.88           C  
ATOM   1027  O   GLU A 128      25.438  66.879  51.095  1.00  0.88           O  
ATOM   1028  CB  GLU A 128      25.676  69.000  53.487  1.00  0.88           C  
ATOM   1029  CG  GLU A 128      25.314  69.375  54.952  1.00  0.88           C  
ATOM   1030  CD  GLU A 128      24.287  70.499  55.122  1.00  0.88           C  
ATOM   1031  OE1 GLU A 128      23.892  70.712  56.303  1.00  0.88           O  
ATOM   1032  OE2 GLU A 128      23.885  71.131  54.113  1.00  0.88           O  
ATOM   1033  N   ASP A 129      25.060  68.902  50.241  1.00  0.90           N  
ATOM   1034  CA  ASP A 129      25.872  68.621  49.064  1.00  0.90           C  
ATOM   1035  C   ASP A 129      27.359  68.593  49.438  1.00  0.90           C  
ATOM   1036  O   ASP A 129      27.834  69.412  50.219  1.00  0.90           O  
ATOM   1037  CB  ASP A 129      25.685  69.659  47.921  1.00  0.90           C  
ATOM   1038  CG  ASP A 129      24.329  69.576  47.263  1.00  0.90           C  
ATOM   1039  OD1 ASP A 129      24.233  69.060  46.119  1.00  0.90           O  
ATOM   1040  OD2 ASP A 129      23.349  70.108  47.852  1.00  0.90           O  
ATOM   1041  N   ALA A 130      28.154  67.648  48.899  1.00  0.93           N  
ATOM   1042  CA  ALA A 130      29.573  67.630  49.175  1.00  0.93           C  
ATOM   1043  C   ALA A 130      30.317  68.819  48.572  1.00  0.93           C  
ATOM   1044  O   ALA A 130      30.355  68.993  47.350  1.00  0.93           O  
ATOM   1045  CB  ALA A 130      30.186  66.306  48.683  1.00  0.93           C  
ATOM   1046  N   GLY A 131      30.959  69.647  49.431  1.00  0.73           N  
ATOM   1047  CA  GLY A 131      31.691  70.861  49.066  1.00  0.73           C  
ATOM   1048  C   GLY A 131      33.015  70.596  48.402  1.00  0.73           C  
ATOM   1049  O   GLY A 131      34.056  71.128  48.767  1.00  0.73           O  
ATOM   1050  N   LEU A 132      33.017  69.713  47.400  1.00  0.84           N  
ATOM   1051  CA  LEU A 132      34.214  69.221  46.765  1.00  0.84           C  
ATOM   1052  C   LEU A 132      34.279  69.632  45.307  1.00  0.84           C  
ATOM   1053  O   LEU A 132      35.233  69.318  44.594  1.00  0.84           O  
ATOM   1054  CB  LEU A 132      34.230  67.681  46.880  1.00  0.84           C  
ATOM   1055  CG  LEU A 132      34.231  67.157  48.330  1.00  0.84           C  
ATOM   1056  CD1 LEU A 132      33.966  65.647  48.339  1.00  0.84           C  
ATOM   1057  CD2 LEU A 132      35.542  67.491  49.059  1.00  0.84           C  
ATOM   1058  N   GLY A 133      33.269  70.384  44.819  1.00  0.86           N  
ATOM   1059  CA  GLY A 133      33.255  70.845  43.442  1.00  0.86           C  
ATOM   1060  C   GLY A 133      32.596  72.175  43.253  1.00  0.86           C  
ATOM   1061  O   GLY A 133      32.139  72.798  44.207  1.00  0.86           O  
ATOM   1062  N   ASN A 134      32.549  72.654  41.995  1.00  0.75           N  
ATOM   1063  CA  ASN A 134      32.055  73.988  41.706  1.00  0.75           C  
ATOM   1064  C   ASN A 134      31.228  74.054  40.426  1.00  0.75           C  
ATOM   1065  O   ASN A 134      30.298  74.856  40.325  1.00  0.75           O  
ATOM   1066  CB  ASN A 134      33.300  74.913  41.577  1.00  0.75           C  
ATOM   1067  CG  ASN A 134      32.972  76.369  41.261  1.00  0.75           C  
ATOM   1068  OD1 ASN A 134      32.067  76.994  41.818  1.00  0.75           O  
ATOM   1069  ND2 ASN A 134      33.772  76.946  40.334  1.00  0.75           N  
ATOM   1070  N   GLY A 135      31.495  73.209  39.413  1.00  0.87           N  
ATOM   1071  CA  GLY A 135      30.766  73.336  38.164  1.00  0.87           C  
ATOM   1072  C   GLY A 135      30.864  72.153  37.241  1.00  0.87           C  
ATOM   1073  O   GLY A 135      30.663  70.998  37.604  1.00  0.87           O  
ATOM   1074  N   GLY A 136      31.117  72.426  35.944  1.00  0.90           N  
ATOM   1075  CA  GLY A 136      31.078  71.402  34.904  1.00  0.90           C  
ATOM   1076  C   GLY A 136      32.237  70.455  34.937  1.00  0.90           C  
ATOM   1077  O   GLY A 136      32.063  69.264  34.704  1.00  0.90           O  
ATOM   1078  N   LEU A 137      33.437  70.970  35.250  1.00  0.87           N  
ATOM   1079  CA  LEU A 137      34.683  70.228  35.276  1.00  0.87           C  
ATOM   1080  C   LEU A 137      34.685  69.094  36.293  1.00  0.87           C  
ATOM   1081  O   LEU A 137      35.033  67.949  35.993  1.00  0.87           O  
ATOM   1082  CB  LEU A 137      35.818  71.230  35.604  1.00  0.87           C  
ATOM   1083  CG  LEU A 137      37.243  70.645  35.645  1.00  0.87           C  
ATOM   1084  CD1 LEU A 137      37.701  70.161  34.267  1.00  0.87           C  
ATOM   1085  CD2 LEU A 137      38.233  71.690  36.171  1.00  0.87           C  
ATOM   1086  N   GLY A 138      34.226  69.371  37.530  1.00  0.89           N  
ATOM   1087  CA  GLY A 138      34.147  68.360  38.566  1.00  0.89           C  
ATOM   1088  C   GLY A 138      32.904  67.541  38.509  1.00  0.89           C  
ATOM   1089  O   GLY A 138      32.861  66.433  39.038  1.00  0.89           O  
ATOM   1090  N   ARG A 139      31.826  68.035  37.872  1.00  0.86           N  
ATOM   1091  CA  ARG A 139      30.652  67.215  37.637  1.00  0.86           C  
ATOM   1092  C   ARG A 139      30.879  66.167  36.569  1.00  0.86           C  
ATOM   1093  O   ARG A 139      30.355  65.057  36.657  1.00  0.86           O  
ATOM   1094  CB  ARG A 139      29.383  68.044  37.322  1.00  0.86           C  
ATOM   1095  CG  ARG A 139      28.069  67.228  37.356  1.00  0.86           C  
ATOM   1096  CD  ARG A 139      27.836  66.504  38.694  1.00  0.86           C  
ATOM   1097  NE  ARG A 139      27.896  65.025  38.459  1.00  0.86           N  
ATOM   1098  CZ  ARG A 139      27.654  64.124  39.426  1.00  0.86           C  
ATOM   1099  NH1 ARG A 139      27.459  64.501  40.685  1.00  0.86           N  
ATOM   1100  NH2 ARG A 139      27.627  62.830  39.114  1.00  0.86           N  
ATOM   1101  N   LEU A 140      31.698  66.496  35.554  1.00  0.94           N  
ATOM   1102  CA  LEU A 140      32.179  65.577  34.542  1.00  0.94           C  
ATOM   1103  C   LEU A 140      33.011  64.470  35.178  1.00  0.94           C  
ATOM   1104  O   LEU A 140      32.761  63.286  34.961  1.00  0.94           O  
ATOM   1105  CB  LEU A 140      32.958  66.415  33.484  1.00  0.94           C  
ATOM   1106  CG  LEU A 140      33.207  65.816  32.082  1.00  0.94           C  
ATOM   1107  CD1 LEU A 140      34.580  65.144  31.980  1.00  0.94           C  
ATOM   1108  CD2 LEU A 140      32.083  64.881  31.616  1.00  0.94           C  
ATOM   1109  N   ALA A 141      33.927  64.832  36.105  1.00  0.96           N  
ATOM   1110  CA  ALA A 141      34.655  63.877  36.918  1.00  0.96           C  
ATOM   1111  C   ALA A 141      33.766  62.984  37.788  1.00  0.96           C  
ATOM   1112  O   ALA A 141      33.907  61.765  37.814  1.00  0.96           O  
ATOM   1113  CB  ALA A 141      35.627  64.658  37.821  1.00  0.96           C  
ATOM   1114  N   ALA A 142      32.775  63.570  38.485  1.00  0.96           N  
ATOM   1115  CA  ALA A 142      31.804  62.854  39.288  1.00  0.96           C  
ATOM   1116  C   ALA A 142      30.885  61.908  38.506  1.00  0.96           C  
ATOM   1117  O   ALA A 142      30.529  60.830  38.977  1.00  0.96           O  
ATOM   1118  CB  ALA A 142      30.982  63.875  40.091  1.00  0.96           C  
ATOM   1119  N   CYS A 143      30.456  62.282  37.279  1.00  0.96           N  
ATOM   1120  CA  CYS A 143      29.779  61.373  36.356  1.00  0.96           C  
ATOM   1121  C   CYS A 143      30.671  60.231  35.910  1.00  0.96           C  
ATOM   1122  O   CYS A 143      30.258  59.075  35.874  1.00  0.96           O  
ATOM   1123  CB  CYS A 143      29.267  62.103  35.088  1.00  0.96           C  
ATOM   1124  SG  CYS A 143      27.890  63.243  35.456  1.00  0.96           S  
ATOM   1125  N   PHE A 144      31.943  60.533  35.596  1.00  0.96           N  
ATOM   1126  CA  PHE A 144      32.928  59.545  35.208  1.00  0.96           C  
ATOM   1127  C   PHE A 144      33.209  58.507  36.287  1.00  0.96           C  
ATOM   1128  O   PHE A 144      33.315  57.325  35.979  1.00  0.96           O  
ATOM   1129  CB  PHE A 144      34.254  60.223  34.767  1.00  0.96           C  
ATOM   1130  CG  PHE A 144      34.229  60.838  33.382  1.00  0.96           C  
ATOM   1131  CD1 PHE A 144      33.083  60.956  32.569  1.00  0.96           C  
ATOM   1132  CD2 PHE A 144      35.454  61.288  32.867  1.00  0.96           C  
ATOM   1133  CE1 PHE A 144      33.170  61.499  31.280  1.00  0.96           C  
ATOM   1134  CE2 PHE A 144      35.552  61.827  31.579  1.00  0.96           C  
ATOM   1135  CZ  PHE A 144      34.405  61.931  30.785  1.00  0.96           C  
ATOM   1136  N   LEU A 145      33.293  58.888  37.582  1.00  0.95           N  
ATOM   1137  CA  LEU A 145      33.471  57.926  38.669  1.00  0.95           C  
ATOM   1138  C   LEU A 145      32.354  56.876  38.765  1.00  0.95           C  
ATOM   1139  O   LEU A 145      32.632  55.686  38.923  1.00  0.95           O  
ATOM   1140  CB  LEU A 145      33.624  58.603  40.059  1.00  0.95           C  
ATOM   1141  CG  LEU A 145      34.808  59.574  40.245  1.00  0.95           C  
ATOM   1142  CD1 LEU A 145      34.876  60.019  41.714  1.00  0.95           C  
ATOM   1143  CD2 LEU A 145      36.157  58.979  39.818  1.00  0.95           C  
ATOM   1144  N   ASP A 146      31.072  57.287  38.618  1.00  0.95           N  
ATOM   1145  CA  ASP A 146      29.915  56.398  38.534  1.00  0.95           C  
ATOM   1146  C   ASP A 146      29.999  55.451  37.330  1.00  0.95           C  
ATOM   1147  O   ASP A 146      29.838  54.236  37.444  1.00  0.95           O  
ATOM   1148  CB  ASP A 146      28.644  57.307  38.473  1.00  0.95           C  
ATOM   1149  CG  ASP A 146      27.318  56.598  38.225  1.00  0.95           C  
ATOM   1150  OD1 ASP A 146      26.410  56.646  39.086  1.00  0.95           O  
ATOM   1151  OD2 ASP A 146      27.130  56.086  37.090  1.00  0.95           O  
ATOM   1152  N   SER A 147      30.312  55.992  36.139  1.00  0.96           N  
ATOM   1153  CA  SER A 147      30.477  55.213  34.921  1.00  0.96           C  
ATOM   1154  C   SER A 147      31.632  54.235  34.937  1.00  0.96           C  
ATOM   1155  O   SER A 147      31.484  53.095  34.510  1.00  0.96           O  
ATOM   1156  CB  SER A 147      30.625  56.110  33.680  1.00  0.96           C  
ATOM   1157  OG  SER A 147      29.383  56.732  33.379  1.00  0.96           O  
ATOM   1158  N   MET A 148      32.819  54.613  35.456  1.00  0.93           N  
ATOM   1159  CA  MET A 148      33.935  53.693  35.619  1.00  0.93           C  
ATOM   1160  C   MET A 148      33.629  52.546  36.580  1.00  0.93           C  
ATOM   1161  O   MET A 148      33.974  51.397  36.317  1.00  0.93           O  
ATOM   1162  CB  MET A 148      35.231  54.437  36.032  1.00  0.93           C  
ATOM   1163  CG  MET A 148      35.749  55.394  34.934  1.00  0.93           C  
ATOM   1164  SD  MET A 148      37.411  56.090  35.179  1.00  0.93           S  
ATOM   1165  CE  MET A 148      37.023  57.198  36.560  1.00  0.93           C  
ATOM   1166  N   ALA A 149      32.930  52.811  37.701  1.00  0.96           N  
ATOM   1167  CA  ALA A 149      32.441  51.767  38.584  1.00  0.96           C  
ATOM   1168  C   ALA A 149      31.390  50.841  37.955  1.00  0.96           C  
ATOM   1169  O   ALA A 149      31.468  49.617  38.058  1.00  0.96           O  
ATOM   1170  CB  ALA A 149      31.917  52.427  39.869  1.00  0.96           C  
ATOM   1171  N   THR A 150      30.405  51.402  37.224  1.00  0.93           N  
ATOM   1172  CA  THR A 150      29.371  50.677  36.475  1.00  0.93           C  
ATOM   1173  C   THR A 150      29.938  49.784  35.388  1.00  0.93           C  
ATOM   1174  O   THR A 150      29.443  48.687  35.137  1.00  0.93           O  
ATOM   1175  CB  THR A 150      28.352  51.630  35.865  1.00  0.93           C  
ATOM   1176  OG1 THR A 150      27.604  52.240  36.909  1.00  0.93           O  
ATOM   1177  CG2 THR A 150      27.326  50.914  34.979  1.00  0.93           C  
ATOM   1178  N   LEU A 151      31.026  50.219  34.732  1.00  0.92           N  
ATOM   1179  CA  LEU A 151      31.684  49.469  33.674  1.00  0.92           C  
ATOM   1180  C   LEU A 151      32.795  48.573  34.205  1.00  0.92           C  
ATOM   1181  O   LEU A 151      33.569  48.017  33.430  1.00  0.92           O  
ATOM   1182  CB  LEU A 151      32.282  50.457  32.634  1.00  0.92           C  
ATOM   1183  CG  LEU A 151      31.337  50.897  31.491  1.00  0.92           C  
ATOM   1184  CD1 LEU A 151      29.872  51.101  31.901  1.00  0.92           C  
ATOM   1185  CD2 LEU A 151      31.869  52.193  30.871  1.00  0.92           C  
ATOM   1186  N   GLY A 152      32.905  48.383  35.539  1.00  0.93           N  
ATOM   1187  CA  GLY A 152      33.785  47.366  36.115  1.00  0.93           C  
ATOM   1188  C   GLY A 152      35.246  47.717  36.130  1.00  0.93           C  
ATOM   1189  O   GLY A 152      36.103  46.848  36.269  1.00  0.93           O  
ATOM   1190  N   LEU A 153      35.577  49.005  35.955  1.00  0.92           N  
ATOM   1191  CA  LEU A 153      36.945  49.442  35.800  1.00  0.92           C  
ATOM   1192  C   LEU A 153      37.614  49.692  37.133  1.00  0.92           C  
ATOM   1193  O   LEU A 153      37.036  50.306  38.029  1.00  0.92           O  
ATOM   1194  CB  LEU A 153      37.041  50.762  34.992  1.00  0.92           C  
ATOM   1195  CG  LEU A 153      36.362  50.737  33.608  1.00  0.92           C  
ATOM   1196  CD1 LEU A 153      36.701  52.007  32.817  1.00  0.92           C  
ATOM   1197  CD2 LEU A 153      36.755  49.501  32.802  1.00  0.92           C  
ATOM   1198  N   ALA A 154      38.888  49.269  37.281  1.00  0.95           N  
ATOM   1199  CA  ALA A 154      39.687  49.532  38.459  1.00  0.95           C  
ATOM   1200  C   ALA A 154      40.152  50.977  38.531  1.00  0.95           C  
ATOM   1201  O   ALA A 154      41.311  51.314  38.295  1.00  0.95           O  
ATOM   1202  CB  ALA A 154      40.874  48.555  38.527  1.00  0.95           C  
ATOM   1203  N   ALA A 155      39.207  51.877  38.833  1.00  0.97           N  
ATOM   1204  CA  ALA A 155      39.395  53.294  38.711  1.00  0.97           C  
ATOM   1205  C   ALA A 155      39.274  54.039  40.021  1.00  0.97           C  
ATOM   1206  O   ALA A 155      38.542  53.668  40.936  1.00  0.97           O  
ATOM   1207  CB  ALA A 155      38.392  53.874  37.711  1.00  0.97           C  
ATOM   1208  N   TYR A 156      40.044  55.130  40.128  1.00  0.94           N  
ATOM   1209  CA  TYR A 156      40.185  55.889  41.344  1.00  0.94           C  
ATOM   1210  C   TYR A 156      39.971  57.360  41.057  1.00  0.94           C  
ATOM   1211  O   TYR A 156      40.440  57.884  40.047  1.00  0.94           O  
ATOM   1212  CB  TYR A 156      41.610  55.747  41.948  1.00  0.94           C  
ATOM   1213  CG  TYR A 156      41.971  54.319  42.301  1.00  0.94           C  
ATOM   1214  CD1 TYR A 156      41.978  53.894  43.641  1.00  0.94           C  
ATOM   1215  CD2 TYR A 156      42.320  53.386  41.306  1.00  0.94           C  
ATOM   1216  CE1 TYR A 156      42.195  52.545  43.966  1.00  0.94           C  
ATOM   1217  CE2 TYR A 156      42.532  52.035  41.627  1.00  0.94           C  
ATOM   1218  CZ  TYR A 156      42.434  51.606  42.958  1.00  0.94           C  
ATOM   1219  OH  TYR A 156      42.552  50.237  43.305  1.00  0.94           O  
ATOM   1220  N   GLY A 157      39.278  58.084  41.957  1.00  0.97           N  
ATOM   1221  CA  GLY A 157      39.227  59.543  41.889  1.00  0.97           C  
ATOM   1222  C   GLY A 157      40.188  60.135  42.872  1.00  0.97           C  
ATOM   1223  O   GLY A 157      40.174  59.764  44.041  1.00  0.97           O  
ATOM   1224  N   TYR A 158      41.044  61.072  42.430  1.00  0.95           N  
ATOM   1225  CA  TYR A 158      42.041  61.682  43.292  1.00  0.95           C  
ATOM   1226  C   TYR A 158      41.986  63.200  43.237  1.00  0.95           C  
ATOM   1227  O   TYR A 158      42.095  63.815  42.175  1.00  0.95           O  
ATOM   1228  CB  TYR A 158      43.459  61.207  42.907  1.00  0.95           C  
ATOM   1229  CG  TYR A 158      43.813  59.945  43.642  1.00  0.95           C  
ATOM   1230  CD1 TYR A 158      43.615  58.681  43.066  1.00  0.95           C  
ATOM   1231  CD2 TYR A 158      44.410  60.027  44.910  1.00  0.95           C  
ATOM   1232  CE1 TYR A 158      44.045  57.527  43.738  1.00  0.95           C  
ATOM   1233  CE2 TYR A 158      44.862  58.874  45.564  1.00  0.95           C  
ATOM   1234  CZ  TYR A 158      44.678  57.624  44.973  1.00  0.95           C  
ATOM   1235  OH  TYR A 158      45.117  56.440  45.593  1.00  0.95           O  
ATOM   1236  N   GLY A 159      41.798  63.838  44.415  1.00  0.98           N  
ATOM   1237  CA  GLY A 159      41.616  65.281  44.526  1.00  0.98           C  
ATOM   1238  C   GLY A 159      41.958  65.809  45.896  1.00  0.98           C  
ATOM   1239  O   GLY A 159      42.626  65.160  46.697  1.00  0.98           O  
ATOM   1240  N   ILE A 160      41.479  67.024  46.218  1.00  0.95           N  
ATOM   1241  CA  ILE A 160      41.665  67.653  47.520  1.00  0.95           C  
ATOM   1242  C   ILE A 160      40.348  67.614  48.278  1.00  0.95           C  
ATOM   1243  O   ILE A 160      39.272  67.841  47.728  1.00  0.95           O  
ATOM   1244  CB  ILE A 160      42.143  69.106  47.412  1.00  0.95           C  
ATOM   1245  CG1 ILE A 160      43.550  69.180  46.779  1.00  0.95           C  
ATOM   1246  CG2 ILE A 160      42.140  69.810  48.791  1.00  0.95           C  
ATOM   1247  CD1 ILE A 160      44.046  70.616  46.551  1.00  0.95           C  
ATOM   1248  N   ARG A 161      40.395  67.326  49.594  1.00  0.89           N  
ATOM   1249  CA  ARG A 161      39.226  67.413  50.442  1.00  0.89           C  
ATOM   1250  C   ARG A 161      39.066  68.821  50.972  1.00  0.89           C  
ATOM   1251  O   ARG A 161      39.605  69.175  52.020  1.00  0.89           O  
ATOM   1252  CB  ARG A 161      39.323  66.447  51.641  1.00  0.89           C  
ATOM   1253  CG  ARG A 161      38.055  66.428  52.515  1.00  0.89           C  
ATOM   1254  CD  ARG A 161      38.116  65.298  53.535  1.00  0.89           C  
ATOM   1255  NE  ARG A 161      37.027  65.458  54.539  1.00  0.89           N  
ATOM   1256  CZ  ARG A 161      37.192  66.122  55.687  1.00  0.89           C  
ATOM   1257  NH1 ARG A 161      38.083  67.106  55.800  1.00  0.89           N  
ATOM   1258  NH2 ARG A 161      36.447  65.808  56.736  1.00  0.89           N  
ATOM   1259  N   TYR A 162      38.322  69.673  50.250  1.00  0.90           N  
ATOM   1260  CA  TYR A 162      38.091  71.041  50.666  1.00  0.90           C  
ATOM   1261  C   TYR A 162      37.249  71.165  51.936  1.00  0.90           C  
ATOM   1262  O   TYR A 162      36.111  70.703  52.011  1.00  0.90           O  
ATOM   1263  CB  TYR A 162      37.477  71.886  49.527  1.00  0.90           C  
ATOM   1264  CG  TYR A 162      38.353  71.809  48.303  1.00  0.90           C  
ATOM   1265  CD1 TYR A 162      39.577  72.498  48.249  1.00  0.90           C  
ATOM   1266  CD2 TYR A 162      37.968  71.027  47.201  1.00  0.90           C  
ATOM   1267  CE1 TYR A 162      40.377  72.440  47.097  1.00  0.90           C  
ATOM   1268  CE2 TYR A 162      38.771  70.958  46.056  1.00  0.90           C  
ATOM   1269  CZ  TYR A 162      39.965  71.683  45.998  1.00  0.90           C  
ATOM   1270  OH  TYR A 162      40.758  71.643  44.837  1.00  0.90           O  
ATOM   1271  N   GLU A 163      37.812  71.807  52.979  1.00  0.85           N  
ATOM   1272  CA  GLU A 163      37.205  72.013  54.284  1.00  0.85           C  
ATOM   1273  C   GLU A 163      35.920  72.829  54.197  1.00  0.85           C  
ATOM   1274  O   GLU A 163      34.919  72.497  54.827  1.00  0.85           O  
ATOM   1275  CB  GLU A 163      38.253  72.702  55.197  1.00  0.85           C  
ATOM   1276  CG  GLU A 163      37.973  72.774  56.727  1.00  0.85           C  
ATOM   1277  CD  GLU A 163      39.060  73.596  57.428  1.00  0.85           C  
ATOM   1278  OE1 GLU A 163      39.968  74.090  56.711  1.00  0.85           O  
ATOM   1279  OE2 GLU A 163      39.042  73.794  58.673  1.00  0.85           O  
ATOM   1280  N   TYR A 164      35.921  73.889  53.357  1.00  0.83           N  
ATOM   1281  CA  TYR A 164      34.785  74.787  53.200  1.00  0.83           C  
ATOM   1282  C   TYR A 164      34.353  75.002  51.758  1.00  0.83           C  
ATOM   1283  O   TYR A 164      33.807  76.055  51.427  1.00  0.83           O  
ATOM   1284  CB  TYR A 164      35.090  76.188  53.781  1.00  0.83           C  
ATOM   1285  CG  TYR A 164      35.294  76.093  55.253  1.00  0.83           C  
ATOM   1286  CD1 TYR A 164      36.592  76.104  55.778  1.00  0.83           C  
ATOM   1287  CD2 TYR A 164      34.197  75.982  56.123  1.00  0.83           C  
ATOM   1288  CE1 TYR A 164      36.794  75.988  57.156  1.00  0.83           C  
ATOM   1289  CE2 TYR A 164      34.400  75.864  57.506  1.00  0.83           C  
ATOM   1290  CZ  TYR A 164      35.699  75.853  58.017  1.00  0.83           C  
ATOM   1291  OH  TYR A 164      35.941  75.705  59.393  1.00  0.83           O  
ATOM   1292  N   GLY A 165      34.596  74.026  50.855  1.00  0.86           N  
ATOM   1293  CA  GLY A 165      34.270  74.117  49.426  1.00  0.86           C  
ATOM   1294  C   GLY A 165      34.685  75.381  48.722  1.00  0.86           C  
ATOM   1295  O   GLY A 165      35.755  75.919  48.976  1.00  0.86           O  
ATOM   1296  N   ILE A 166      33.884  75.882  47.765  1.00  0.70           N  
ATOM   1297  CA  ILE A 166      34.126  77.213  47.218  1.00  0.70           C  
ATOM   1298  C   ILE A 166      33.377  78.305  47.972  1.00  0.70           C  
ATOM   1299  O   ILE A 166      33.954  79.354  48.242  1.00  0.70           O  
ATOM   1300  CB  ILE A 166      33.886  77.274  45.714  1.00  0.70           C  
ATOM   1301  CG1 ILE A 166      34.475  78.576  45.125  1.00  0.70           C  
ATOM   1302  CG2 ILE A 166      32.394  77.102  45.368  1.00  0.70           C  
ATOM   1303  CD1 ILE A 166      34.799  78.480  43.635  1.00  0.70           C  
ATOM   1304  N   PHE A 167      32.097  78.049  48.348  1.00  0.80           N  
ATOM   1305  CA  PHE A 167      31.150  78.955  48.986  1.00  0.80           C  
ATOM   1306  C   PHE A 167      29.723  78.512  48.684  1.00  0.80           C  
ATOM   1307  O   PHE A 167      29.418  77.997  47.605  1.00  0.80           O  
ATOM   1308  CB  PHE A 167      31.278  80.497  48.688  1.00  0.80           C  
ATOM   1309  CG  PHE A 167      30.844  80.960  47.318  1.00  0.80           C  
ATOM   1310  CD1 PHE A 167      31.763  81.071  46.270  1.00  0.80           C  
ATOM   1311  CD2 PHE A 167      29.526  81.384  47.098  1.00  0.80           C  
ATOM   1312  CE1 PHE A 167      31.368  81.554  45.016  1.00  0.80           C  
ATOM   1313  CE2 PHE A 167      29.120  81.891  45.860  1.00  0.80           C  
ATOM   1314  CZ  PHE A 167      30.044  81.967  44.813  1.00  0.80           C  
ATOM   1315  N   ASN A 168      28.787  78.752  49.616  1.00  0.81           N  
ATOM   1316  CA  ASN A 168      27.371  78.637  49.335  1.00  0.81           C  
ATOM   1317  C   ASN A 168      26.854  80.025  49.018  1.00  0.81           C  
ATOM   1318  O   ASN A 168      27.255  81.013  49.620  1.00  0.81           O  
ATOM   1319  CB  ASN A 168      26.557  78.060  50.516  1.00  0.81           C  
ATOM   1320  CG  ASN A 168      26.708  76.551  50.708  1.00  0.81           C  
ATOM   1321  OD1 ASN A 168      26.359  76.050  51.771  1.00  0.81           O  
ATOM   1322  ND2 ASN A 168      27.146  75.796  49.677  1.00  0.81           N  
ATOM   1323  N   GLN A 169      25.979  80.163  48.018  1.00  0.84           N  
ATOM   1324  CA  GLN A 169      25.396  81.446  47.685  1.00  0.84           C  
ATOM   1325  C   GLN A 169      24.165  81.727  48.516  1.00  0.84           C  
ATOM   1326  O   GLN A 169      23.337  80.844  48.715  1.00  0.84           O  
ATOM   1327  CB  GLN A 169      24.950  81.418  46.206  1.00  0.84           C  
ATOM   1328  CG  GLN A 169      24.114  82.623  45.720  1.00  0.84           C  
ATOM   1329  CD  GLN A 169      23.624  82.397  44.297  1.00  0.84           C  
ATOM   1330  OE1 GLN A 169      22.898  81.436  44.038  1.00  0.84           O  
ATOM   1331  NE2 GLN A 169      24.032  83.265  43.352  1.00  0.84           N  
ATOM   1332  N   LYS A 170      23.989  82.985  48.953  1.00  0.83           N  
ATOM   1333  CA  LYS A 170      22.710  83.456  49.429  1.00  0.83           C  
ATOM   1334  C   LYS A 170      22.285  84.717  48.728  1.00  0.83           C  
ATOM   1335  O   LYS A 170      23.104  85.519  48.277  1.00  0.83           O  
ATOM   1336  CB  LYS A 170      22.655  83.640  50.956  1.00  0.83           C  
ATOM   1337  CG  LYS A 170      22.461  82.284  51.628  1.00  0.83           C  
ATOM   1338  CD  LYS A 170      21.826  82.377  53.016  1.00  0.83           C  
ATOM   1339  CE  LYS A 170      21.318  81.013  53.465  1.00  0.83           C  
ATOM   1340  NZ  LYS A 170      20.116  80.664  52.681  1.00  0.83           N  
ATOM   1341  N   ILE A 171      20.958  84.910  48.606  1.00  0.88           N  
ATOM   1342  CA  ILE A 171      20.393  86.116  48.030  1.00  0.88           C  
ATOM   1343  C   ILE A 171      19.646  86.882  49.104  1.00  0.88           C  
ATOM   1344  O   ILE A 171      18.598  86.497  49.617  1.00  0.88           O  
ATOM   1345  CB  ILE A 171      19.538  85.890  46.778  1.00  0.88           C  
ATOM   1346  CG1 ILE A 171      18.448  84.811  46.976  1.00  0.88           C  
ATOM   1347  CG2 ILE A 171      20.493  85.525  45.619  1.00  0.88           C  
ATOM   1348  CD1 ILE A 171      17.478  84.677  45.796  1.00  0.88           C  
ATOM   1349  N   ARG A 172      20.193  88.044  49.497  1.00  0.77           N  
ATOM   1350  CA  ARG A 172      19.560  88.892  50.489  1.00  0.77           C  
ATOM   1351  C   ARG A 172      19.561  90.318  49.987  1.00  0.77           C  
ATOM   1352  O   ARG A 172      20.589  90.851  49.580  1.00  0.77           O  
ATOM   1353  CB  ARG A 172      20.121  88.722  51.932  1.00  0.77           C  
ATOM   1354  CG  ARG A 172      21.652  88.614  52.130  1.00  0.77           C  
ATOM   1355  CD  ARG A 172      22.505  89.876  51.927  1.00  0.77           C  
ATOM   1356  NE  ARG A 172      21.990  90.942  52.852  1.00  0.77           N  
ATOM   1357  CZ  ARG A 172      22.746  91.753  53.603  1.00  0.77           C  
ATOM   1358  NH1 ARG A 172      24.072  91.674  53.627  1.00  0.77           N  
ATOM   1359  NH2 ARG A 172      22.148  92.671  54.361  1.00  0.77           N  
ATOM   1360  N   ASP A 173      18.361  90.943  49.933  1.00  0.86           N  
ATOM   1361  CA  ASP A 173      18.127  92.222  49.271  1.00  0.86           C  
ATOM   1362  C   ASP A 173      18.530  92.180  47.790  1.00  0.86           C  
ATOM   1363  O   ASP A 173      19.201  93.044  47.226  1.00  0.86           O  
ATOM   1364  CB  ASP A 173      18.758  93.377  50.085  1.00  0.86           C  
ATOM   1365  CG  ASP A 173      18.281  94.759  49.656  1.00  0.86           C  
ATOM   1366  OD1 ASP A 173      18.629  95.707  50.399  1.00  0.86           O  
ATOM   1367  OD2 ASP A 173      17.604  94.891  48.600  1.00  0.86           O  
ATOM   1368  N   GLY A 174      18.145  91.096  47.095  1.00  0.91           N  
ATOM   1369  CA  GLY A 174      18.348  90.921  45.661  1.00  0.91           C  
ATOM   1370  C   GLY A 174      19.762  90.704  45.183  1.00  0.91           C  
ATOM   1371  O   GLY A 174      19.973  90.277  44.052  1.00  0.91           O  
ATOM   1372  N   TRP A 175      20.767  91.001  46.017  1.00  0.87           N  
ATOM   1373  CA  TRP A 175      22.161  90.850  45.684  1.00  0.87           C  
ATOM   1374  C   TRP A 175      22.675  89.504  46.134  1.00  0.87           C  
ATOM   1375  O   TRP A 175      22.160  88.881  47.062  1.00  0.87           O  
ATOM   1376  CB  TRP A 175      23.051  91.906  46.383  1.00  0.87           C  
ATOM   1377  CG  TRP A 175      22.796  93.349  46.016  1.00  0.87           C  
ATOM   1378  CD1 TRP A 175      22.063  94.284  46.692  1.00  0.87           C  
ATOM   1379  CD2 TRP A 175      23.446  94.054  44.936  1.00  0.87           C  
ATOM   1380  NE1 TRP A 175      22.196  95.526  46.105  1.00  0.87           N  
ATOM   1381  CE2 TRP A 175      23.060  95.397  45.035  1.00  0.87           C  
ATOM   1382  CE3 TRP A 175      24.330  93.619  43.944  1.00  0.87           C  
ATOM   1383  CZ2 TRP A 175      23.553  96.352  44.154  1.00  0.87           C  
ATOM   1384  CZ3 TRP A 175      24.816  94.580  43.042  1.00  0.87           C  
ATOM   1385  CH2 TRP A 175      24.436  95.925  43.148  1.00  0.87           C  
ATOM   1386  N   GLN A 176      23.754  89.039  45.484  1.00  0.86           N  
ATOM   1387  CA  GLN A 176      24.496  87.891  45.950  1.00  0.86           C  
ATOM   1388  C   GLN A 176      25.349  88.192  47.178  1.00  0.86           C  
ATOM   1389  O   GLN A 176      26.094  89.171  47.212  1.00  0.86           O  
ATOM   1390  CB  GLN A 176      25.420  87.334  44.837  1.00  0.86           C  
ATOM   1391  CG  GLN A 176      26.104  86.013  45.256  1.00  0.86           C  
ATOM   1392  CD  GLN A 176      26.969  85.392  44.164  1.00  0.86           C  
ATOM   1393  OE1 GLN A 176      26.483  84.706  43.262  1.00  0.86           O  
ATOM   1394  NE2 GLN A 176      28.296  85.599  44.274  1.00  0.86           N  
ATOM   1395  N   VAL A 177      25.286  87.318  48.198  1.00  0.86           N  
ATOM   1396  CA  VAL A 177      26.294  87.249  49.239  1.00  0.86           C  
ATOM   1397  C   VAL A 177      26.839  85.824  49.284  1.00  0.86           C  
ATOM   1398  O   VAL A 177      26.112  84.837  49.176  1.00  0.86           O  
ATOM   1399  CB  VAL A 177      25.794  87.745  50.597  1.00  0.86           C  
ATOM   1400  CG1 VAL A 177      24.672  86.844  51.137  1.00  0.86           C  
ATOM   1401  CG2 VAL A 177      26.953  87.846  51.610  1.00  0.86           C  
ATOM   1402  N   GLU A 178      28.169  85.677  49.385  1.00  0.79           N  
ATOM   1403  CA  GLU A 178      28.837  84.394  49.435  1.00  0.79           C  
ATOM   1404  C   GLU A 178      29.036  83.929  50.879  1.00  0.79           C  
ATOM   1405  O   GLU A 178      29.693  84.611  51.659  1.00  0.79           O  
ATOM   1406  CB  GLU A 178      30.232  84.522  48.759  1.00  0.79           C  
ATOM   1407  CG  GLU A 178      30.191  84.899  47.251  1.00  0.79           C  
ATOM   1408  CD  GLU A 178      30.189  86.389  46.934  1.00  0.79           C  
ATOM   1409  OE1 GLU A 178      31.267  87.034  46.918  1.00  0.79           O  
ATOM   1410  OE2 GLU A 178      29.108  86.928  46.586  1.00  0.79           O  
ATOM   1411  N   GLU A 179      28.523  82.755  51.294  1.00  0.78           N  
ATOM   1412  CA  GLU A 179      28.712  82.208  52.634  1.00  0.78           C  
ATOM   1413  C   GLU A 179      29.694  81.049  52.624  1.00  0.78           C  
ATOM   1414  O   GLU A 179      29.925  80.411  51.601  1.00  0.78           O  
ATOM   1415  CB  GLU A 179      27.391  81.693  53.245  1.00  0.78           C  
ATOM   1416  CG  GLU A 179      26.313  82.792  53.362  1.00  0.78           C  
ATOM   1417  CD  GLU A 179      25.136  82.355  54.228  1.00  0.78           C  
ATOM   1418  OE1 GLU A 179      24.732  83.164  55.103  1.00  0.78           O  
ATOM   1419  OE2 GLU A 179      24.601  81.240  53.996  1.00  0.78           O  
ATOM   1420  N   ALA A 180      30.347  80.738  53.765  1.00  0.82           N  
ATOM   1421  CA  ALA A 180      31.218  79.578  53.851  1.00  0.82           C  
ATOM   1422  C   ALA A 180      30.435  78.276  53.797  1.00  0.82           C  
ATOM   1423  O   ALA A 180      29.433  78.112  54.477  1.00  0.82           O  
ATOM   1424  CB  ALA A 180      32.105  79.633  55.110  1.00  0.82           C  
ATOM   1425  N   ASP A 181      30.870  77.327  52.954  1.00  0.83           N  
ATOM   1426  CA  ASP A 181      30.203  76.056  52.784  1.00  0.83           C  
ATOM   1427  C   ASP A 181      30.716  75.084  53.845  1.00  0.83           C  
ATOM   1428  O   ASP A 181      31.603  74.269  53.604  1.00  0.83           O  
ATOM   1429  CB  ASP A 181      30.507  75.673  51.307  1.00  0.83           C  
ATOM   1430  CG  ASP A 181      29.883  74.418  50.732  1.00  0.83           C  
ATOM   1431  OD1 ASP A 181      29.355  73.571  51.482  1.00  0.83           O  
ATOM   1432  OD2 ASP A 181      29.939  74.323  49.473  1.00  0.83           O  
ATOM   1433  N   ASP A 182      30.208  75.155  55.097  1.00  0.82           N  
ATOM   1434  CA  ASP A 182      30.683  74.314  56.182  1.00  0.82           C  
ATOM   1435  C   ASP A 182      29.987  72.952  56.230  1.00  0.82           C  
ATOM   1436  O   ASP A 182      29.536  72.462  57.264  1.00  0.82           O  
ATOM   1437  CB  ASP A 182      30.746  75.058  57.547  1.00  0.82           C  
ATOM   1438  CG  ASP A 182      29.403  75.550  58.057  1.00  0.82           C  
ATOM   1439  OD1 ASP A 182      28.727  76.292  57.309  1.00  0.82           O  
ATOM   1440  OD2 ASP A 182      29.062  75.232  59.226  1.00  0.82           O  
ATOM   1441  N   TRP A 183      29.978  72.250  55.076  1.00  0.80           N  
ATOM   1442  CA  TRP A 183      29.377  70.944  54.841  1.00  0.80           C  
ATOM   1443  C   TRP A 183      29.822  69.844  55.811  1.00  0.80           C  
ATOM   1444  O   TRP A 183      29.125  68.862  56.059  1.00  0.80           O  
ATOM   1445  CB  TRP A 183      29.625  70.507  53.365  1.00  0.80           C  
ATOM   1446  CG  TRP A 183      31.054  70.154  52.974  1.00  0.80           C  
ATOM   1447  CD1 TRP A 183      32.137  70.970  52.787  1.00  0.80           C  
ATOM   1448  CD2 TRP A 183      31.522  68.813  52.719  1.00  0.80           C  
ATOM   1449  NE1 TRP A 183      33.255  70.227  52.455  1.00  0.80           N  
ATOM   1450  CE2 TRP A 183      32.884  68.903  52.412  1.00  0.80           C  
ATOM   1451  CE3 TRP A 183      30.860  67.584  52.742  1.00  0.80           C  
ATOM   1452  CZ2 TRP A 183      33.638  67.767  52.138  1.00  0.80           C  
ATOM   1453  CZ3 TRP A 183      31.613  66.437  52.444  1.00  0.80           C  
ATOM   1454  CH2 TRP A 183      32.983  66.524  52.156  1.00  0.80           C  
ATOM   1455  N   LEU A 184      31.009  70.011  56.418  1.00  0.85           N  
ATOM   1456  CA  LEU A 184      31.581  69.094  57.377  1.00  0.85           C  
ATOM   1457  C   LEU A 184      31.264  69.425  58.829  1.00  0.85           C  
ATOM   1458  O   LEU A 184      31.763  68.754  59.730  1.00  0.85           O  
ATOM   1459  CB  LEU A 184      33.118  69.126  57.228  1.00  0.85           C  
ATOM   1460  CG  LEU A 184      33.624  68.565  55.891  1.00  0.85           C  
ATOM   1461  CD1 LEU A 184      35.101  68.926  55.699  1.00  0.85           C  
ATOM   1462  CD2 LEU A 184      33.402  67.049  55.806  1.00  0.85           C  
ATOM   1463  N   ARG A 185      30.395  70.418  59.118  1.00  0.76           N  
ATOM   1464  CA  ARG A 185      30.060  70.858  60.470  1.00  0.76           C  
ATOM   1465  C   ARG A 185      29.542  69.761  61.389  1.00  0.76           C  
ATOM   1466  O   ARG A 185      29.861  69.699  62.576  1.00  0.76           O  
ATOM   1467  CB  ARG A 185      28.991  71.974  60.389  1.00  0.76           C  
ATOM   1468  CG  ARG A 185      28.499  72.494  61.753  1.00  0.76           C  
ATOM   1469  CD  ARG A 185      27.577  73.704  61.626  1.00  0.76           C  
ATOM   1470  NE  ARG A 185      27.146  74.043  63.017  1.00  0.76           N  
ATOM   1471  CZ  ARG A 185      26.310  75.049  63.296  1.00  0.76           C  
ATOM   1472  NH1 ARG A 185      25.764  75.781  62.331  1.00  0.76           N  
ATOM   1473  NH2 ARG A 185      26.028  75.320  64.568  1.00  0.76           N  
ATOM   1474  N   TYR A 186      28.732  68.844  60.844  1.00  0.84           N  
ATOM   1475  CA  TYR A 186      28.194  67.726  61.592  1.00  0.84           C  
ATOM   1476  C   TYR A 186      28.860  66.429  61.163  1.00  0.84           C  
ATOM   1477  O   TYR A 186      28.412  65.335  61.496  1.00  0.84           O  
ATOM   1478  CB  TYR A 186      26.667  67.642  61.371  1.00  0.84           C  
ATOM   1479  CG  TYR A 186      26.005  68.881  61.919  1.00  0.84           C  
ATOM   1480  CD1 TYR A 186      25.529  69.897  61.069  1.00  0.84           C  
ATOM   1481  CD2 TYR A 186      25.869  69.042  63.307  1.00  0.84           C  
ATOM   1482  CE1 TYR A 186      24.927  71.048  61.602  1.00  0.84           C  
ATOM   1483  CE2 TYR A 186      25.260  70.186  63.838  1.00  0.84           C  
ATOM   1484  CZ  TYR A 186      24.781  71.183  62.987  1.00  0.84           C  
ATOM   1485  OH  TYR A 186      24.136  72.309  63.535  1.00  0.84           O  
ATOM   1486  N   GLY A 187      29.987  66.538  60.433  1.00  0.86           N  
ATOM   1487  CA  GLY A 187      30.706  65.424  59.837  1.00  0.86           C  
ATOM   1488  C   GLY A 187      30.097  64.869  58.574  1.00  0.86           C  
ATOM   1489  O   GLY A 187      28.982  65.182  58.172  1.00  0.86           O  
ATOM   1490  N   ASN A 188      30.859  63.991  57.906  1.00  0.88           N  
ATOM   1491  CA  ASN A 188      30.471  63.335  56.678  1.00  0.88           C  
ATOM   1492  C   ASN A 188      30.474  61.838  56.973  1.00  0.88           C  
ATOM   1493  O   ASN A 188      31.524  61.312  57.340  1.00  0.88           O  
ATOM   1494  CB  ASN A 188      31.508  63.704  55.581  1.00  0.88           C  
ATOM   1495  CG  ASN A 188      31.313  62.991  54.245  1.00  0.88           C  
ATOM   1496  OD1 ASN A 188      30.310  62.321  53.992  1.00  0.88           O  
ATOM   1497  ND2 ASN A 188      32.321  63.121  53.353  1.00  0.88           N  
ATOM   1498  N   PRO A 189      29.386  61.082  56.853  1.00  0.92           N  
ATOM   1499  CA  PRO A 189      29.399  59.679  57.240  1.00  0.92           C  
ATOM   1500  C   PRO A 189      30.006  58.833  56.146  1.00  0.92           C  
ATOM   1501  O   PRO A 189      30.393  57.697  56.414  1.00  0.92           O  
ATOM   1502  CB  PRO A 189      27.912  59.353  57.458  1.00  0.92           C  
ATOM   1503  CG  PRO A 189      27.151  60.332  56.556  1.00  0.92           C  
ATOM   1504  CD  PRO A 189      28.035  61.579  56.565  1.00  0.92           C  
ATOM   1505  N   TRP A 190      30.079  59.342  54.906  1.00  0.88           N  
ATOM   1506  CA  TRP A 190      30.466  58.564  53.747  1.00  0.88           C  
ATOM   1507  C   TRP A 190      31.963  58.424  53.558  1.00  0.88           C  
ATOM   1508  O   TRP A 190      32.415  57.534  52.841  1.00  0.88           O  
ATOM   1509  CB  TRP A 190      29.875  59.206  52.471  1.00  0.88           C  
ATOM   1510  CG  TRP A 190      28.377  59.390  52.549  1.00  0.88           C  
ATOM   1511  CD1 TRP A 190      27.664  60.546  52.696  1.00  0.88           C  
ATOM   1512  CD2 TRP A 190      27.419  58.318  52.532  1.00  0.88           C  
ATOM   1513  NE1 TRP A 190      26.321  60.269  52.768  1.00  0.88           N  
ATOM   1514  CE2 TRP A 190      26.149  58.908  52.685  1.00  0.88           C  
ATOM   1515  CE3 TRP A 190      27.565  56.936  52.398  1.00  0.88           C  
ATOM   1516  CZ2 TRP A 190      25.003  58.130  52.716  1.00  0.88           C  
ATOM   1517  CZ3 TRP A 190      26.403  56.151  52.421  1.00  0.88           C  
ATOM   1518  CH2 TRP A 190      25.141  56.739  52.586  1.00  0.88           C  
ATOM   1519  N   GLU A 191      32.759  59.280  54.221  1.00  0.89           N  
ATOM   1520  CA  GLU A 191      34.203  59.274  54.114  1.00  0.89           C  
ATOM   1521  C   GLU A 191      34.861  58.507  55.254  1.00  0.89           C  
ATOM   1522  O   GLU A 191      34.283  58.259  56.317  1.00  0.89           O  
ATOM   1523  CB  GLU A 191      34.767  60.719  54.074  1.00  0.89           C  
ATOM   1524  CG  GLU A 191      34.616  61.501  55.405  1.00  0.89           C  
ATOM   1525  CD  GLU A 191      34.968  62.979  55.309  1.00  0.89           C  
ATOM   1526  OE1 GLU A 191      35.110  63.535  54.190  1.00  0.89           O  
ATOM   1527  OE2 GLU A 191      35.095  63.620  56.383  1.00  0.89           O  
ATOM   1528  N   LYS A 192      36.121  58.087  55.049  1.00  0.83           N  
ATOM   1529  CA  LYS A 192      36.942  57.538  56.102  1.00  0.83           C  
ATOM   1530  C   LYS A 192      38.359  58.084  56.042  1.00  0.83           C  
ATOM   1531  O   LYS A 192      39.110  57.825  55.104  1.00  0.83           O  
ATOM   1532  CB  LYS A 192      36.985  55.993  55.995  1.00  0.83           C  
ATOM   1533  CG  LYS A 192      37.812  55.290  57.083  1.00  0.83           C  
ATOM   1534  CD  LYS A 192      37.178  55.379  58.479  1.00  0.83           C  
ATOM   1535  CE  LYS A 192      38.166  55.011  59.586  1.00  0.83           C  
ATOM   1536  NZ  LYS A 192      37.460  54.930  60.883  1.00  0.83           N  
ATOM   1537  N   SER A 193      38.783  58.837  57.078  1.00  0.87           N  
ATOM   1538  CA  SER A 193      40.166  59.261  57.258  1.00  0.87           C  
ATOM   1539  C   SER A 193      41.151  58.129  57.515  1.00  0.87           C  
ATOM   1540  O   SER A 193      40.828  57.114  58.137  1.00  0.87           O  
ATOM   1541  CB  SER A 193      40.333  60.302  58.397  1.00  0.87           C  
ATOM   1542  OG  SER A 193      39.922  59.783  59.666  1.00  0.87           O  
ATOM   1543  N   ARG A 194      42.408  58.275  57.044  1.00  0.79           N  
ATOM   1544  CA  ARG A 194      43.462  57.305  57.307  1.00  0.79           C  
ATOM   1545  C   ARG A 194      44.637  57.896  58.098  1.00  0.79           C  
ATOM   1546  O   ARG A 194      45.685  58.159  57.508  1.00  0.79           O  
ATOM   1547  CB  ARG A 194      43.985  56.690  55.984  1.00  0.79           C  
ATOM   1548  CG  ARG A 194      42.881  56.157  55.041  1.00  0.79           C  
ATOM   1549  CD  ARG A 194      42.031  55.043  55.658  1.00  0.79           C  
ATOM   1550  NE  ARG A 194      41.138  54.526  54.588  1.00  0.79           N  
ATOM   1551  CZ  ARG A 194      40.451  53.384  54.663  1.00  0.79           C  
ATOM   1552  NH1 ARG A 194      40.307  52.701  55.789  1.00  0.79           N  
ATOM   1553  NH2 ARG A 194      39.920  52.914  53.540  1.00  0.79           N  
ATOM   1554  N   PRO A 195      44.572  58.115  59.417  1.00  0.77           N  
ATOM   1555  CA  PRO A 195      45.628  58.797  60.179  1.00  0.77           C  
ATOM   1556  C   PRO A 195      46.914  57.994  60.320  1.00  0.77           C  
ATOM   1557  O   PRO A 195      47.916  58.545  60.773  1.00  0.77           O  
ATOM   1558  CB  PRO A 195      44.968  59.043  61.548  1.00  0.77           C  
ATOM   1559  CG  PRO A 195      43.935  57.922  61.678  1.00  0.77           C  
ATOM   1560  CD  PRO A 195      43.407  57.811  60.252  1.00  0.77           C  
ATOM   1561  N   GLU A 196      46.934  56.710  59.919  1.00  0.75           N  
ATOM   1562  CA  GLU A 196      48.140  55.899  59.891  1.00  0.75           C  
ATOM   1563  C   GLU A 196      48.822  55.947  58.534  1.00  0.75           C  
ATOM   1564  O   GLU A 196      49.830  55.285  58.306  1.00  0.75           O  
ATOM   1565  CB  GLU A 196      47.817  54.415  60.183  1.00  0.75           C  
ATOM   1566  CG  GLU A 196      47.534  54.120  61.670  1.00  0.75           C  
ATOM   1567  CD  GLU A 196      47.573  52.626  61.951  1.00  0.75           C  
ATOM   1568  OE1 GLU A 196      48.274  52.255  62.931  1.00  0.75           O  
ATOM   1569  OE2 GLU A 196      46.914  51.842  61.228  1.00  0.75           O  
ATOM   1570  N   PHE A 197      48.307  56.756  57.593  1.00  0.79           N  
ATOM   1571  CA  PHE A 197      48.841  56.807  56.249  1.00  0.79           C  
ATOM   1572  C   PHE A 197      48.830  58.240  55.746  1.00  0.79           C  
ATOM   1573  O   PHE A 197      48.039  58.631  54.894  1.00  0.79           O  
ATOM   1574  CB  PHE A 197      48.042  55.849  55.320  1.00  0.79           C  
ATOM   1575  CG  PHE A 197      48.703  55.709  53.978  1.00  0.79           C  
ATOM   1576  CD1 PHE A 197      49.966  55.107  53.869  1.00  0.79           C  
ATOM   1577  CD2 PHE A 197      48.102  56.253  52.832  1.00  0.79           C  
ATOM   1578  CE1 PHE A 197      50.646  55.103  52.645  1.00  0.79           C  
ATOM   1579  CE2 PHE A 197      48.774  56.246  51.607  1.00  0.79           C  
ATOM   1580  CZ  PHE A 197      50.049  55.677  51.514  1.00  0.79           C  
ATOM   1581  N   MET A 198      49.742  59.069  56.282  1.00  0.79           N  
ATOM   1582  CA  MET A 198      49.874  60.458  55.895  1.00  0.79           C  
ATOM   1583  C   MET A 198      51.169  60.654  55.135  1.00  0.79           C  
ATOM   1584  O   MET A 198      52.233  60.206  55.560  1.00  0.79           O  
ATOM   1585  CB  MET A 198      49.867  61.403  57.118  1.00  0.79           C  
ATOM   1586  CG  MET A 198      48.568  61.319  57.938  1.00  0.79           C  
ATOM   1587  SD  MET A 198      48.389  62.647  59.167  1.00  0.79           S  
ATOM   1588  CE  MET A 198      49.586  61.987  60.362  1.00  0.79           C  
ATOM   1589  N   LEU A 199      51.106  61.317  53.965  1.00  0.88           N  
ATOM   1590  CA  LEU A 199      52.232  61.388  53.051  1.00  0.88           C  
ATOM   1591  C   LEU A 199      52.923  62.756  53.074  1.00  0.88           C  
ATOM   1592  O   LEU A 199      52.235  63.769  53.209  1.00  0.88           O  
ATOM   1593  CB  LEU A 199      51.786  61.050  51.607  1.00  0.88           C  
ATOM   1594  CG  LEU A 199      51.232  59.616  51.451  1.00  0.88           C  
ATOM   1595  CD1 LEU A 199      50.733  59.384  50.024  1.00  0.88           C  
ATOM   1596  CD2 LEU A 199      52.276  58.549  51.807  1.00  0.88           C  
ATOM   1597  N   PRO A 200      54.254  62.861  52.961  1.00  0.88           N  
ATOM   1598  CA  PRO A 200      54.943  64.136  53.159  1.00  0.88           C  
ATOM   1599  C   PRO A 200      55.138  64.910  51.864  1.00  0.88           C  
ATOM   1600  O   PRO A 200      55.909  64.518  50.989  1.00  0.88           O  
ATOM   1601  CB  PRO A 200      56.314  63.722  53.728  1.00  0.88           C  
ATOM   1602  CG  PRO A 200      56.561  62.336  53.130  1.00  0.88           C  
ATOM   1603  CD  PRO A 200      55.163  61.729  53.165  1.00  0.88           C  
ATOM   1604  N   VAL A 201      54.488  66.077  51.765  1.00  0.90           N  
ATOM   1605  CA  VAL A 201      54.559  66.974  50.630  1.00  0.90           C  
ATOM   1606  C   VAL A 201      55.536  68.095  50.937  1.00  0.90           C  
ATOM   1607  O   VAL A 201      55.371  68.860  51.884  1.00  0.90           O  
ATOM   1608  CB  VAL A 201      53.193  67.559  50.282  1.00  0.90           C  
ATOM   1609  CG1 VAL A 201      53.280  68.437  49.016  1.00  0.90           C  
ATOM   1610  CG2 VAL A 201      52.198  66.398  50.076  1.00  0.90           C  
ATOM   1611  N   HIS A 202      56.613  68.200  50.141  1.00  0.87           N  
ATOM   1612  CA  HIS A 202      57.689  69.150  50.366  1.00  0.87           C  
ATOM   1613  C   HIS A 202      57.516  70.446  49.597  1.00  0.87           C  
ATOM   1614  O   HIS A 202      57.109  70.458  48.440  1.00  0.87           O  
ATOM   1615  CB  HIS A 202      59.041  68.533  49.954  1.00  0.87           C  
ATOM   1616  CG  HIS A 202      59.395  67.345  50.792  1.00  0.87           C  
ATOM   1617  ND1 HIS A 202      60.208  67.512  51.893  1.00  0.87           N  
ATOM   1618  CD2 HIS A 202      58.990  66.052  50.700  1.00  0.87           C  
ATOM   1619  CE1 HIS A 202      60.284  66.320  52.454  1.00  0.87           C  
ATOM   1620  NE2 HIS A 202      59.562  65.399  51.771  1.00  0.87           N  
ATOM   1621  N   PHE A 203      57.856  71.581  50.227  1.00  0.88           N  
ATOM   1622  CA  PHE A 203      57.806  72.885  49.593  1.00  0.88           C  
ATOM   1623  C   PHE A 203      59.067  73.680  49.899  1.00  0.88           C  
ATOM   1624  O   PHE A 203      59.761  73.421  50.881  1.00  0.88           O  
ATOM   1625  CB  PHE A 203      56.605  73.717  50.114  1.00  0.88           C  
ATOM   1626  CG  PHE A 203      55.290  73.124  49.698  1.00  0.88           C  
ATOM   1627  CD1 PHE A 203      54.841  73.259  48.376  1.00  0.88           C  
ATOM   1628  CD2 PHE A 203      54.467  72.474  50.632  1.00  0.88           C  
ATOM   1629  CE1 PHE A 203      53.577  72.792  48.001  1.00  0.88           C  
ATOM   1630  CE2 PHE A 203      53.204  71.995  50.257  1.00  0.88           C  
ATOM   1631  CZ  PHE A 203      52.755  72.160  48.941  1.00  0.88           C  
ATOM   1632  N   TYR A 204      59.370  74.698  49.070  1.00  0.86           N  
ATOM   1633  CA  TYR A 204      60.531  75.574  49.172  1.00  0.86           C  
ATOM   1634  C   TYR A 204      61.867  74.839  49.152  1.00  0.86           C  
ATOM   1635  O   TYR A 204      62.088  73.951  48.337  1.00  0.86           O  
ATOM   1636  CB  TYR A 204      60.439  76.576  50.359  1.00  0.86           C  
ATOM   1637  CG  TYR A 204      59.118  77.294  50.357  1.00  0.86           C  
ATOM   1638  CD1 TYR A 204      58.100  76.882  51.231  1.00  0.86           C  
ATOM   1639  CD2 TYR A 204      58.872  78.369  49.485  1.00  0.86           C  
ATOM   1640  CE1 TYR A 204      56.852  77.513  51.220  1.00  0.86           C  
ATOM   1641  CE2 TYR A 204      57.619  79.004  49.471  1.00  0.86           C  
ATOM   1642  CZ  TYR A 204      56.611  78.568  50.339  1.00  0.86           C  
ATOM   1643  OH  TYR A 204      55.331  79.151  50.346  1.00  0.86           O  
ATOM   1644  N   GLY A 205      62.814  75.206  50.040  1.00  0.88           N  
ATOM   1645  CA  GLY A 205      64.150  74.625  50.043  1.00  0.88           C  
ATOM   1646  C   GLY A 205      65.027  74.947  48.867  1.00  0.88           C  
ATOM   1647  O   GLY A 205      64.932  76.004  48.245  1.00  0.88           O  
ATOM   1648  N   LYS A 206      65.964  74.041  48.565  1.00  0.83           N  
ATOM   1649  CA  LYS A 206      66.977  74.276  47.564  1.00  0.83           C  
ATOM   1650  C   LYS A 206      67.478  72.964  47.009  1.00  0.83           C  
ATOM   1651  O   LYS A 206      67.294  71.892  47.585  1.00  0.83           O  
ATOM   1652  CB  LYS A 206      68.177  75.079  48.138  1.00  0.83           C  
ATOM   1653  CG  LYS A 206      68.846  74.385  49.332  1.00  0.83           C  
ATOM   1654  CD  LYS A 206      69.862  75.255  50.082  1.00  0.83           C  
ATOM   1655  CE  LYS A 206      71.211  75.420  49.397  1.00  0.83           C  
ATOM   1656  NZ  LYS A 206      72.119  76.096  50.348  1.00  0.83           N  
ATOM   1657  N   VAL A 207      68.121  73.019  45.832  1.00  0.87           N  
ATOM   1658  CA  VAL A 207      68.663  71.843  45.185  1.00  0.87           C  
ATOM   1659  C   VAL A 207      70.132  71.693  45.520  1.00  0.87           C  
ATOM   1660  O   VAL A 207      70.908  72.647  45.482  1.00  0.87           O  
ATOM   1661  CB  VAL A 207      68.471  71.869  43.677  1.00  0.87           C  
ATOM   1662  CG1 VAL A 207      69.010  70.579  43.037  1.00  0.87           C  
ATOM   1663  CG2 VAL A 207      66.969  71.983  43.373  1.00  0.87           C  
ATOM   1664  N   GLU A 208      70.538  70.463  45.865  1.00  0.83           N  
ATOM   1665  CA  GLU A 208      71.913  70.097  46.099  1.00  0.83           C  
ATOM   1666  C   GLU A 208      72.254  68.975  45.136  1.00  0.83           C  
ATOM   1667  O   GLU A 208      71.624  67.920  45.114  1.00  0.83           O  
ATOM   1668  CB  GLU A 208      72.095  69.623  47.555  1.00  0.83           C  
ATOM   1669  CG  GLU A 208      73.522  69.163  47.925  1.00  0.83           C  
ATOM   1670  CD  GLU A 208      73.528  68.473  49.287  1.00  0.83           C  
ATOM   1671  OE1 GLU A 208      72.807  67.451  49.431  1.00  0.83           O  
ATOM   1672  OE2 GLU A 208      74.275  68.953  50.175  1.00  0.83           O  
ATOM   1673  N   HIS A 209      73.253  69.170  44.260  1.00  0.81           N  
ATOM   1674  CA  HIS A 209      73.641  68.139  43.311  1.00  0.81           C  
ATOM   1675  C   HIS A 209      74.779  67.312  43.898  1.00  0.81           C  
ATOM   1676  O   HIS A 209      75.941  67.703  43.833  1.00  0.81           O  
ATOM   1677  CB  HIS A 209      74.047  68.763  41.954  1.00  0.81           C  
ATOM   1678  CG  HIS A 209      72.878  69.373  41.216  1.00  0.81           C  
ATOM   1679  ND1 HIS A 209      72.282  68.650  40.199  1.00  0.81           N  
ATOM   1680  CD2 HIS A 209      72.239  70.567  41.374  1.00  0.81           C  
ATOM   1681  CE1 HIS A 209      71.302  69.417  39.758  1.00  0.81           C  
ATOM   1682  NE2 HIS A 209      71.228  70.584  40.435  1.00  0.81           N  
ATOM   1683  N   THR A 210      74.479  66.151  44.527  1.00  0.79           N  
ATOM   1684  CA  THR A 210      75.498  65.351  45.210  1.00  0.79           C  
ATOM   1685  C   THR A 210      76.139  64.312  44.313  1.00  0.79           C  
ATOM   1686  O   THR A 210      75.767  64.098  43.163  1.00  0.79           O  
ATOM   1687  CB  THR A 210      75.072  64.669  46.522  1.00  0.79           C  
ATOM   1688  OG1 THR A 210      74.304  63.483  46.344  1.00  0.79           O  
ATOM   1689  CG2 THR A 210      74.235  65.629  47.357  1.00  0.79           C  
ATOM   1690  N   ASN A 211      77.142  63.586  44.853  1.00  0.73           N  
ATOM   1691  CA  ASN A 211      77.800  62.478  44.179  1.00  0.73           C  
ATOM   1692  C   ASN A 211      76.825  61.341  43.865  1.00  0.73           C  
ATOM   1693  O   ASN A 211      76.929  60.650  42.858  1.00  0.73           O  
ATOM   1694  CB  ASN A 211      78.945  61.884  45.045  1.00  0.73           C  
ATOM   1695  CG  ASN A 211      79.959  62.886  45.607  1.00  0.73           C  
ATOM   1696  OD1 ASN A 211      80.680  62.537  46.539  1.00  0.73           O  
ATOM   1697  ND2 ASN A 211      80.043  64.130  45.088  1.00  0.73           N  
ATOM   1698  N   THR A 212      75.836  61.139  44.756  1.00  0.71           N  
ATOM   1699  CA  THR A 212      74.814  60.102  44.677  1.00  0.71           C  
ATOM   1700  C   THR A 212      73.482  60.666  44.213  1.00  0.71           C  
ATOM   1701  O   THR A 212      72.395  60.269  44.647  1.00  0.71           O  
ATOM   1702  CB  THR A 212      74.650  59.319  45.970  1.00  0.71           C  
ATOM   1703  OG1 THR A 212      74.444  60.177  47.089  1.00  0.71           O  
ATOM   1704  CG2 THR A 212      75.947  58.535  46.223  1.00  0.71           C  
ATOM   1705  N   GLY A 213      73.549  61.631  43.279  1.00  0.82           N  
ATOM   1706  CA  GLY A 213      72.416  62.179  42.550  1.00  0.82           C  
ATOM   1707  C   GLY A 213      71.877  63.442  43.145  1.00  0.82           C  
ATOM   1708  O   GLY A 213      72.216  63.852  44.253  1.00  0.82           O  
ATOM   1709  N   THR A 214      70.953  64.089  42.433  1.00  0.84           N  
ATOM   1710  CA  THR A 214      70.284  65.306  42.864  1.00  0.84           C  
ATOM   1711  C   THR A 214      69.476  65.137  44.141  1.00  0.84           C  
ATOM   1712  O   THR A 214      68.872  64.094  44.404  1.00  0.84           O  
ATOM   1713  CB  THR A 214      69.420  65.897  41.759  1.00  0.84           C  
ATOM   1714  OG1 THR A 214      70.074  65.731  40.511  1.00  0.84           O  
ATOM   1715  CG2 THR A 214      69.248  67.404  41.952  1.00  0.84           C  
ATOM   1716  N   LYS A 215      69.506  66.151  45.020  1.00  0.84           N  
ATOM   1717  CA  LYS A 215      68.798  66.176  46.279  1.00  0.84           C  
ATOM   1718  C   LYS A 215      68.029  67.473  46.384  1.00  0.84           C  
ATOM   1719  O   LYS A 215      68.442  68.518  45.889  1.00  0.84           O  
ATOM   1720  CB  LYS A 215      69.755  66.054  47.499  1.00  0.84           C  
ATOM   1721  CG  LYS A 215      70.601  64.770  47.531  1.00  0.84           C  
ATOM   1722  CD  LYS A 215      69.764  63.496  47.731  1.00  0.84           C  
ATOM   1723  CE  LYS A 215      70.490  62.208  47.330  1.00  0.84           C  
ATOM   1724  NZ  LYS A 215      70.716  62.188  45.873  1.00  0.84           N  
ATOM   1725  N   TRP A 216      66.860  67.423  47.039  1.00  0.81           N  
ATOM   1726  CA  TRP A 216      66.045  68.578  47.332  1.00  0.81           C  
ATOM   1727  C   TRP A 216      66.013  68.657  48.843  1.00  0.81           C  
ATOM   1728  O   TRP A 216      65.549  67.733  49.508  1.00  0.81           O  
ATOM   1729  CB  TRP A 216      64.633  68.391  46.718  1.00  0.81           C  
ATOM   1730  CG  TRP A 216      63.637  69.538  46.857  1.00  0.81           C  
ATOM   1731  CD1 TRP A 216      63.836  70.852  47.182  1.00  0.81           C  
ATOM   1732  CD2 TRP A 216      62.232  69.362  46.650  1.00  0.81           C  
ATOM   1733  NE1 TRP A 216      62.630  71.504  47.187  1.00  0.81           N  
ATOM   1734  CE2 TRP A 216      61.623  70.638  46.878  1.00  0.81           C  
ATOM   1735  CE3 TRP A 216      61.459  68.262  46.311  1.00  0.81           C  
ATOM   1736  CZ2 TRP A 216      60.256  70.789  46.771  1.00  0.81           C  
ATOM   1737  CZ3 TRP A 216      60.075  68.425  46.204  1.00  0.81           C  
ATOM   1738  CH2 TRP A 216      59.478  69.677  46.428  1.00  0.81           C  
ATOM   1739  N   ILE A 217      66.582  69.738  49.402  1.00  0.86           N  
ATOM   1740  CA  ILE A 217      66.870  69.863  50.823  1.00  0.86           C  
ATOM   1741  C   ILE A 217      66.348  71.193  51.331  1.00  0.86           C  
ATOM   1742  O   ILE A 217      65.893  72.025  50.547  1.00  0.86           O  
ATOM   1743  CB  ILE A 217      68.359  69.732  51.159  1.00  0.86           C  
ATOM   1744  CG1 ILE A 217      69.216  70.831  50.486  1.00  0.86           C  
ATOM   1745  CG2 ILE A 217      68.847  68.320  50.767  1.00  0.86           C  
ATOM   1746  CD1 ILE A 217      70.662  70.866  50.993  1.00  0.86           C  
ATOM   1747  N   ASP A 218      66.366  71.400  52.667  1.00  0.84           N  
ATOM   1748  CA  ASP A 218      65.934  72.608  53.363  1.00  0.84           C  
ATOM   1749  C   ASP A 218      64.453  72.941  53.150  1.00  0.84           C  
ATOM   1750  O   ASP A 218      64.030  74.095  53.085  1.00  0.84           O  
ATOM   1751  CB  ASP A 218      66.861  73.812  53.033  1.00  0.84           C  
ATOM   1752  CG  ASP A 218      68.311  73.570  53.431  1.00  0.84           C  
ATOM   1753  OD1 ASP A 218      68.613  72.519  54.050  1.00  0.84           O  
ATOM   1754  OD2 ASP A 218      69.143  74.461  53.110  1.00  0.84           O  
ATOM   1755  N   THR A 219      63.618  71.896  53.046  1.00  0.85           N  
ATOM   1756  CA  THR A 219      62.216  71.987  52.670  1.00  0.85           C  
ATOM   1757  C   THR A 219      61.268  72.186  53.836  1.00  0.85           C  
ATOM   1758  O   THR A 219      61.535  71.851  54.989  1.00  0.85           O  
ATOM   1759  CB  THR A 219      61.729  70.765  51.894  1.00  0.85           C  
ATOM   1760  OG1 THR A 219      61.996  69.562  52.604  1.00  0.85           O  
ATOM   1761  CG2 THR A 219      62.492  70.682  50.569  1.00  0.85           C  
ATOM   1762  N   GLN A 220      60.072  72.730  53.544  1.00  0.81           N  
ATOM   1763  CA  GLN A 220      58.966  72.746  54.478  1.00  0.81           C  
ATOM   1764  C   GLN A 220      58.054  71.581  54.156  1.00  0.81           C  
ATOM   1765  O   GLN A 220      57.543  71.472  53.044  1.00  0.81           O  
ATOM   1766  CB  GLN A 220      58.138  74.052  54.395  1.00  0.81           C  
ATOM   1767  CG  GLN A 220      58.966  75.304  54.770  1.00  0.81           C  
ATOM   1768  CD  GLN A 220      58.185  76.623  54.725  1.00  0.81           C  
ATOM   1769  OE1 GLN A 220      58.776  77.698  54.647  1.00  0.81           O  
ATOM   1770  NE2 GLN A 220      56.836  76.562  54.765  1.00  0.81           N  
ATOM   1771  N   VAL A 221      57.830  70.671  55.119  1.00  0.83           N  
ATOM   1772  CA  VAL A 221      56.960  69.524  54.920  1.00  0.83           C  
ATOM   1773  C   VAL A 221      55.534  69.859  55.323  1.00  0.83           C  
ATOM   1774  O   VAL A 221      55.273  70.446  56.370  1.00  0.83           O  
ATOM   1775  CB  VAL A 221      57.439  68.294  55.693  1.00  0.83           C  
ATOM   1776  CG1 VAL A 221      56.508  67.081  55.472  1.00  0.83           C  
ATOM   1777  CG2 VAL A 221      58.861  67.929  55.233  1.00  0.83           C  
ATOM   1778  N   VAL A 222      54.565  69.472  54.482  1.00  0.86           N  
ATOM   1779  CA  VAL A 222      53.145  69.496  54.769  1.00  0.86           C  
ATOM   1780  C   VAL A 222      52.685  68.058  54.659  1.00  0.86           C  
ATOM   1781  O   VAL A 222      53.123  67.322  53.781  1.00  0.86           O  
ATOM   1782  CB  VAL A 222      52.388  70.376  53.780  1.00  0.86           C  
ATOM   1783  CG1 VAL A 222      50.861  70.246  53.949  1.00  0.86           C  
ATOM   1784  CG2 VAL A 222      52.827  71.838  53.996  1.00  0.86           C  
ATOM   1785  N   LEU A 223      51.814  67.575  55.559  1.00  0.83           N  
ATOM   1786  CA  LEU A 223      51.310  66.220  55.471  1.00  0.83           C  
ATOM   1787  C   LEU A 223      50.010  66.152  54.701  1.00  0.83           C  
ATOM   1788  O   LEU A 223      49.126  66.998  54.833  1.00  0.83           O  
ATOM   1789  CB  LEU A 223      51.055  65.583  56.853  1.00  0.83           C  
ATOM   1790  CG  LEU A 223      52.297  65.412  57.745  1.00  0.83           C  
ATOM   1791  CD1 LEU A 223      51.886  64.696  59.038  1.00  0.83           C  
ATOM   1792  CD2 LEU A 223      53.433  64.643  57.055  1.00  0.83           C  
ATOM   1793  N   ALA A 224      49.858  65.100  53.885  1.00  0.92           N  
ATOM   1794  CA  ALA A 224      48.638  64.815  53.182  1.00  0.92           C  
ATOM   1795  C   ALA A 224      47.923  63.649  53.837  1.00  0.92           C  
ATOM   1796  O   ALA A 224      48.360  62.502  53.761  1.00  0.92           O  
ATOM   1797  CB  ALA A 224      48.959  64.491  51.715  1.00  0.92           C  
ATOM   1798  N   LEU A 225      46.785  63.930  54.500  1.00  0.89           N  
ATOM   1799  CA  LEU A 225      45.940  62.945  55.145  1.00  0.89           C  
ATOM   1800  C   LEU A 225      44.820  62.544  54.193  1.00  0.89           C  
ATOM   1801  O   LEU A 225      44.001  63.404  53.856  1.00  0.89           O  
ATOM   1802  CB  LEU A 225      45.326  63.572  56.428  1.00  0.89           C  
ATOM   1803  CG  LEU A 225      44.238  62.763  57.172  1.00  0.89           C  
ATOM   1804  CD1 LEU A 225      44.757  61.419  57.685  1.00  0.89           C  
ATOM   1805  CD2 LEU A 225      43.677  63.582  58.347  1.00  0.89           C  
ATOM   1806  N   PRO A 226      44.708  61.318  53.702  1.00  0.94           N  
ATOM   1807  CA  PRO A 226      43.648  60.943  52.789  1.00  0.94           C  
ATOM   1808  C   PRO A 226      42.364  60.591  53.489  1.00  0.94           C  
ATOM   1809  O   PRO A 226      42.351  60.068  54.607  1.00  0.94           O  
ATOM   1810  CB  PRO A 226      44.193  59.711  52.072  1.00  0.94           C  
ATOM   1811  CG  PRO A 226      45.108  59.052  53.097  1.00  0.94           C  
ATOM   1812  CD  PRO A 226      45.659  60.228  53.907  1.00  0.94           C  
ATOM   1813  N   TYR A 227      41.262  60.889  52.797  1.00  0.91           N  
ATOM   1814  CA  TYR A 227      39.932  60.502  53.176  1.00  0.91           C  
ATOM   1815  C   TYR A 227      39.373  59.686  52.030  1.00  0.91           C  
ATOM   1816  O   TYR A 227      39.296  60.161  50.896  1.00  0.91           O  
ATOM   1817  CB  TYR A 227      39.022  61.732  53.411  1.00  0.91           C  
ATOM   1818  CG  TYR A 227      39.326  62.418  54.724  1.00  0.91           C  
ATOM   1819  CD1 TYR A 227      38.374  62.425  55.758  1.00  0.91           C  
ATOM   1820  CD2 TYR A 227      40.527  63.122  54.921  1.00  0.91           C  
ATOM   1821  CE1 TYR A 227      38.605  63.127  56.951  1.00  0.91           C  
ATOM   1822  CE2 TYR A 227      40.781  63.780  56.131  1.00  0.91           C  
ATOM   1823  CZ  TYR A 227      39.820  63.791  57.143  1.00  0.91           C  
ATOM   1824  OH  TYR A 227      40.112  64.446  58.358  1.00  0.91           O  
ATOM   1825  N   ASP A 228      38.987  58.430  52.312  1.00  0.92           N  
ATOM   1826  CA  ASP A 228      38.478  57.513  51.315  1.00  0.92           C  
ATOM   1827  C   ASP A 228      36.957  57.500  51.328  1.00  0.92           C  
ATOM   1828  O   ASP A 228      36.332  57.237  52.354  1.00  0.92           O  
ATOM   1829  CB  ASP A 228      38.970  56.068  51.596  1.00  0.92           C  
ATOM   1830  CG  ASP A 228      40.456  55.909  51.387  1.00  0.92           C  
ATOM   1831  OD1 ASP A 228      41.007  54.885  51.885  1.00  0.92           O  
ATOM   1832  OD2 ASP A 228      41.117  56.756  50.747  1.00  0.92           O  
ATOM   1833  N   THR A 229      36.326  57.755  50.170  1.00  0.93           N  
ATOM   1834  CA  THR A 229      34.877  57.705  50.005  1.00  0.93           C  
ATOM   1835  C   THR A 229      34.569  56.649  48.954  1.00  0.93           C  
ATOM   1836  O   THR A 229      35.116  56.741  47.851  1.00  0.93           O  
ATOM   1837  CB  THR A 229      34.269  59.021  49.529  1.00  0.93           C  
ATOM   1838  OG1 THR A 229      34.468  60.043  50.495  1.00  0.93           O  
ATOM   1839  CG2 THR A 229      32.748  58.907  49.330  1.00  0.93           C  
ATOM   1840  N   PRO A 230      33.747  55.624  49.179  1.00  0.96           N  
ATOM   1841  CA  PRO A 230      33.454  54.622  48.160  1.00  0.96           C  
ATOM   1842  C   PRO A 230      32.483  55.120  47.091  1.00  0.96           C  
ATOM   1843  O   PRO A 230      31.530  55.828  47.410  1.00  0.96           O  
ATOM   1844  CB  PRO A 230      32.860  53.443  48.960  1.00  0.96           C  
ATOM   1845  CG  PRO A 230      33.182  53.720  50.431  1.00  0.96           C  
ATOM   1846  CD  PRO A 230      33.212  55.240  50.486  1.00  0.96           C  
ATOM   1847  N   VAL A 231      32.695  54.748  45.813  1.00  0.97           N  
ATOM   1848  CA  VAL A 231      31.846  55.141  44.694  1.00  0.97           C  
ATOM   1849  C   VAL A 231      31.152  53.911  44.104  1.00  0.97           C  
ATOM   1850  O   VAL A 231      31.847  53.043  43.567  1.00  0.97           O  
ATOM   1851  CB  VAL A 231      32.627  55.811  43.567  1.00  0.97           C  
ATOM   1852  CG1 VAL A 231      31.660  56.261  42.451  1.00  0.97           C  
ATOM   1853  CG2 VAL A 231      33.402  57.023  44.120  1.00  0.97           C  
ATOM   1854  N   PRO A 232      29.829  53.753  44.150  1.00  0.96           N  
ATOM   1855  CA  PRO A 232      29.185  52.501  43.755  1.00  0.96           C  
ATOM   1856  C   PRO A 232      28.750  52.459  42.304  1.00  0.96           C  
ATOM   1857  O   PRO A 232      28.012  53.326  41.846  1.00  0.96           O  
ATOM   1858  CB  PRO A 232      27.943  52.445  44.657  1.00  0.96           C  
ATOM   1859  CG  PRO A 232      27.577  53.912  44.903  1.00  0.96           C  
ATOM   1860  CD  PRO A 232      28.938  54.600  44.955  1.00  0.96           C  
ATOM   1861  N   GLY A 233      29.166  51.420  41.554  1.00  0.96           N  
ATOM   1862  CA  GLY A 233      28.597  51.103  40.250  1.00  0.96           C  
ATOM   1863  C   GLY A 233      27.169  50.629  40.305  1.00  0.96           C  
ATOM   1864  O   GLY A 233      26.697  50.116  41.316  1.00  0.96           O  
ATOM   1865  N   TYR A 234      26.429  50.771  39.194  1.00  0.90           N  
ATOM   1866  CA  TYR A 234      25.044  50.344  39.128  1.00  0.90           C  
ATOM   1867  C   TYR A 234      24.861  48.828  39.070  1.00  0.90           C  
ATOM   1868  O   TYR A 234      25.090  48.193  38.040  1.00  0.90           O  
ATOM   1869  CB  TYR A 234      24.359  51.010  37.909  1.00  0.90           C  
ATOM   1870  CG  TYR A 234      22.878  50.734  37.846  1.00  0.90           C  
ATOM   1871  CD1 TYR A 234      21.989  51.399  38.704  1.00  0.90           C  
ATOM   1872  CD2 TYR A 234      22.374  49.779  36.947  1.00  0.90           C  
ATOM   1873  CE1 TYR A 234      20.616  51.122  38.655  1.00  0.90           C  
ATOM   1874  CE2 TYR A 234      21.004  49.483  36.914  1.00  0.90           C  
ATOM   1875  CZ  TYR A 234      20.125  50.164  37.762  1.00  0.90           C  
ATOM   1876  OH  TYR A 234      18.742  49.901  37.736  1.00  0.90           O  
ATOM   1877  N   MET A 235      24.394  48.236  40.190  1.00  0.87           N  
ATOM   1878  CA  MET A 235      23.878  46.880  40.303  1.00  0.87           C  
ATOM   1879  C   MET A 235      24.859  45.753  40.006  1.00  0.87           C  
ATOM   1880  O   MET A 235      24.484  44.592  39.858  1.00  0.87           O  
ATOM   1881  CB  MET A 235      22.561  46.701  39.500  1.00  0.87           C  
ATOM   1882  CG  MET A 235      21.391  47.556  40.029  1.00  0.87           C  
ATOM   1883  SD  MET A 235      20.948  47.272  41.768  1.00  0.87           S  
ATOM   1884  CE  MET A 235      20.523  45.509  41.669  1.00  0.87           C  
ATOM   1885  N   ASN A 236      26.168  46.052  39.977  1.00  0.85           N  
ATOM   1886  CA  ASN A 236      27.198  45.079  39.668  1.00  0.85           C  
ATOM   1887  C   ASN A 236      28.028  44.721  40.892  1.00  0.85           C  
ATOM   1888  O   ASN A 236      28.956  43.921  40.817  1.00  0.85           O  
ATOM   1889  CB  ASN A 236      28.093  45.599  38.507  1.00  0.85           C  
ATOM   1890  CG  ASN A 236      28.810  46.910  38.827  1.00  0.85           C  
ATOM   1891  OD1 ASN A 236      28.638  47.525  39.882  1.00  0.85           O  
ATOM   1892  ND2 ASN A 236      29.662  47.361  37.881  1.00  0.85           N  
ATOM   1893  N   ASN A 237      27.705  45.327  42.053  1.00  0.82           N  
ATOM   1894  CA  ASN A 237      28.439  45.231  43.308  1.00  0.82           C  
ATOM   1895  C   ASN A 237      29.820  45.874  43.265  1.00  0.82           C  
ATOM   1896  O   ASN A 237      30.599  45.722  44.202  1.00  0.82           O  
ATOM   1897  CB  ASN A 237      28.583  43.781  43.860  1.00  0.82           C  
ATOM   1898  CG  ASN A 237      27.248  43.235  44.325  1.00  0.82           C  
ATOM   1899  OD1 ASN A 237      26.368  43.959  44.792  1.00  0.82           O  
ATOM   1900  ND2 ASN A 237      27.107  41.890  44.279  1.00  0.82           N  
ATOM   1901  N   THR A 238      30.151  46.645  42.216  1.00  0.89           N  
ATOM   1902  CA  THR A 238      31.499  47.163  42.043  1.00  0.89           C  
ATOM   1903  C   THR A 238      31.621  48.532  42.653  1.00  0.89           C  
ATOM   1904  O   THR A 238      31.205  49.537  42.082  1.00  0.89           O  
ATOM   1905  CB  THR A 238      31.935  47.269  40.592  1.00  0.89           C  
ATOM   1906  OG1 THR A 238      31.875  45.989  39.986  1.00  0.89           O  
ATOM   1907  CG2 THR A 238      33.391  47.736  40.476  1.00  0.89           C  
ATOM   1908  N   VAL A 239      32.213  48.622  43.854  1.00  0.93           N  
ATOM   1909  CA  VAL A 239      32.419  49.896  44.515  1.00  0.93           C  
ATOM   1910  C   VAL A 239      33.888  50.301  44.447  1.00  0.93           C  
ATOM   1911  O   VAL A 239      34.782  49.620  44.950  1.00  0.93           O  
ATOM   1912  CB  VAL A 239      31.906  49.875  45.943  1.00  0.93           C  
ATOM   1913  CG1 VAL A 239      31.928  51.289  46.537  1.00  0.93           C  
ATOM   1914  CG2 VAL A 239      30.464  49.330  45.975  1.00  0.93           C  
ATOM   1915  N   ASN A 240      34.163  51.434  43.776  1.00  0.94           N  
ATOM   1916  CA  ASN A 240      35.488  51.993  43.569  1.00  0.94           C  
ATOM   1917  C   ASN A 240      35.840  53.037  44.625  1.00  0.94           C  
ATOM   1918  O   ASN A 240      35.051  53.333  45.516  1.00  0.94           O  
ATOM   1919  CB  ASN A 240      35.596  52.610  42.153  1.00  0.94           C  
ATOM   1920  CG  ASN A 240      35.763  51.513  41.107  1.00  0.94           C  
ATOM   1921  OD1 ASN A 240      36.070  50.354  41.389  1.00  0.94           O  
ATOM   1922  ND2 ASN A 240      35.597  51.902  39.824  1.00  0.94           N  
ATOM   1923  N   THR A 241      37.060  53.614  44.569  1.00  0.94           N  
ATOM   1924  CA  THR A 241      37.569  54.513  45.610  1.00  0.94           C  
ATOM   1925  C   THR A 241      37.712  55.935  45.108  1.00  0.94           C  
ATOM   1926  O   THR A 241      38.376  56.201  44.108  1.00  0.94           O  
ATOM   1927  CB  THR A 241      38.963  54.118  46.111  1.00  0.94           C  
ATOM   1928  OG1 THR A 241      38.976  52.773  46.557  1.00  0.94           O  
ATOM   1929  CG2 THR A 241      39.416  54.972  47.306  1.00  0.94           C  
ATOM   1930  N   MET A 242      37.144  56.917  45.829  1.00  0.94           N  
ATOM   1931  CA  MET A 242      37.518  58.306  45.671  1.00  0.94           C  
ATOM   1932  C   MET A 242      38.355  58.678  46.884  1.00  0.94           C  
ATOM   1933  O   MET A 242      37.907  58.539  48.018  1.00  0.94           O  
ATOM   1934  CB  MET A 242      36.270  59.211  45.549  1.00  0.94           C  
ATOM   1935  CG  MET A 242      36.609  60.703  45.378  1.00  0.94           C  
ATOM   1936  SD  MET A 242      35.185  61.799  45.128  1.00  0.94           S  
ATOM   1937  CE  MET A 242      34.484  61.588  46.788  1.00  0.94           C  
ATOM   1938  N   ARG A 243      39.610  59.118  46.679  1.00  0.90           N  
ATOM   1939  CA  ARG A 243      40.530  59.431  47.755  1.00  0.90           C  
ATOM   1940  C   ARG A 243      40.929  60.888  47.676  1.00  0.90           C  
ATOM   1941  O   ARG A 243      41.525  61.360  46.708  1.00  0.90           O  
ATOM   1942  CB  ARG A 243      41.790  58.533  47.704  1.00  0.90           C  
ATOM   1943  CG  ARG A 243      42.903  58.939  48.696  1.00  0.90           C  
ATOM   1944  CD  ARG A 243      44.027  57.907  48.853  1.00  0.90           C  
ATOM   1945  NE  ARG A 243      43.490  56.773  49.654  1.00  0.90           N  
ATOM   1946  CZ  ARG A 243      44.247  55.898  50.320  1.00  0.90           C  
ATOM   1947  NH1 ARG A 243      45.538  55.726  50.059  1.00  0.90           N  
ATOM   1948  NH2 ARG A 243      43.679  55.162  51.271  1.00  0.90           N  
ATOM   1949  N   LEU A 244      40.584  61.662  48.717  1.00  0.95           N  
ATOM   1950  CA  LEU A 244      40.791  63.095  48.713  1.00  0.95           C  
ATOM   1951  C   LEU A 244      41.750  63.469  49.824  1.00  0.95           C  
ATOM   1952  O   LEU A 244      41.592  63.069  50.977  1.00  0.95           O  
ATOM   1953  CB  LEU A 244      39.460  63.848  48.950  1.00  0.95           C  
ATOM   1954  CG  LEU A 244      38.514  64.104  47.754  1.00  0.95           C  
ATOM   1955  CD1 LEU A 244      38.814  63.311  46.481  1.00  0.95           C  
ATOM   1956  CD2 LEU A 244      37.072  63.852  48.200  1.00  0.95           C  
ATOM   1957  N   TRP A 245      42.782  64.268  49.501  1.00  0.92           N  
ATOM   1958  CA  TRP A 245      43.814  64.644  50.448  1.00  0.92           C  
ATOM   1959  C   TRP A 245      43.450  65.883  51.256  1.00  0.92           C  
ATOM   1960  O   TRP A 245      42.915  66.866  50.748  1.00  0.92           O  
ATOM   1961  CB  TRP A 245      45.172  64.884  49.742  1.00  0.92           C  
ATOM   1962  CG  TRP A 245      45.615  63.743  48.850  1.00  0.92           C  
ATOM   1963  CD1 TRP A 245      45.516  63.645  47.490  1.00  0.92           C  
ATOM   1964  CD2 TRP A 245      46.224  62.512  49.294  1.00  0.92           C  
ATOM   1965  NE1 TRP A 245      46.005  62.434  47.054  1.00  0.92           N  
ATOM   1966  CE2 TRP A 245      46.432  61.724  48.154  1.00  0.92           C  
ATOM   1967  CE3 TRP A 245      46.598  62.064  50.562  1.00  0.92           C  
ATOM   1968  CZ2 TRP A 245      46.996  60.457  48.247  1.00  0.92           C  
ATOM   1969  CZ3 TRP A 245      47.222  60.808  50.648  1.00  0.92           C  
ATOM   1970  CH2 TRP A 245      47.392  60.007  49.514  1.00  0.92           C  
ATOM   1971  N   SER A 246      43.744  65.849  52.564  1.00  0.94           N  
ATOM   1972  CA  SER A 246      43.489  66.916  53.517  1.00  0.94           C  
ATOM   1973  C   SER A 246      44.816  67.342  54.097  1.00  0.94           C  
ATOM   1974  O   SER A 246      45.598  66.513  54.562  1.00  0.94           O  
ATOM   1975  CB  SER A 246      42.564  66.395  54.645  1.00  0.94           C  
ATOM   1976  OG  SER A 246      42.110  67.404  55.552  1.00  0.94           O  
ATOM   1977  N   ALA A 247      45.139  68.644  54.035  1.00  0.91           N  
ATOM   1978  CA  ALA A 247      46.425  69.151  54.452  1.00  0.91           C  
ATOM   1979  C   ALA A 247      46.543  69.281  55.961  1.00  0.91           C  
ATOM   1980  O   ALA A 247      45.621  69.716  56.648  1.00  0.91           O  
ATOM   1981  CB  ALA A 247      46.709  70.497  53.772  1.00  0.91           C  
ATOM   1982  N   ARG A 248      47.696  68.866  56.518  1.00  0.75           N  
ATOM   1983  CA  ARG A 248      47.959  68.886  57.941  1.00  0.75           C  
ATOM   1984  C   ARG A 248      49.416  69.238  58.147  1.00  0.75           C  
ATOM   1985  O   ARG A 248      50.254  69.052  57.269  1.00  0.75           O  
ATOM   1986  CB  ARG A 248      47.677  67.506  58.611  1.00  0.75           C  
ATOM   1987  CG  ARG A 248      46.211  67.034  58.500  1.00  0.75           C  
ATOM   1988  CD  ARG A 248      45.220  67.941  59.241  1.00  0.75           C  
ATOM   1989  NE  ARG A 248      43.870  67.706  58.632  1.00  0.75           N  
ATOM   1990  CZ  ARG A 248      42.837  67.130  59.255  1.00  0.75           C  
ATOM   1991  NH1 ARG A 248      42.996  66.424  60.369  1.00  0.75           N  
ATOM   1992  NH2 ARG A 248      41.622  67.251  58.725  1.00  0.75           N  
ATOM   1993  N   ALA A 249      49.776  69.786  59.317  1.00  0.77           N  
ATOM   1994  CA  ALA A 249      51.163  70.045  59.639  1.00  0.77           C  
ATOM   1995  C   ALA A 249      51.854  68.784  60.166  1.00  0.77           C  
ATOM   1996  O   ALA A 249      51.170  67.930  60.728  1.00  0.77           O  
ATOM   1997  CB  ALA A 249      51.252  71.173  60.674  1.00  0.77           C  
ATOM   1998  N   PRO A 250      53.170  68.594  60.025  1.00  0.72           N  
ATOM   1999  CA  PRO A 250      53.872  67.440  60.595  1.00  0.72           C  
ATOM   2000  C   PRO A 250      53.836  67.415  62.101  1.00  0.72           C  
ATOM   2001  O   PRO A 250      53.720  66.350  62.703  1.00  0.72           O  
ATOM   2002  CB  PRO A 250      55.307  67.577  60.068  1.00  0.72           C  
ATOM   2003  CG  PRO A 250      55.127  68.319  58.748  1.00  0.72           C  
ATOM   2004  CD  PRO A 250      54.000  69.302  59.050  1.00  0.72           C  
ATOM   2005  N   ASN A 251      53.930  68.599  62.711  1.00  0.67           N  
ATOM   2006  CA  ASN A 251      53.688  68.809  64.110  1.00  0.67           C  
ATOM   2007  C   ASN A 251      52.651  69.910  64.142  1.00  0.67           C  
ATOM   2008  O   ASN A 251      52.898  71.026  63.696  1.00  0.67           O  
ATOM   2009  CB  ASN A 251      54.984  69.255  64.832  1.00  0.67           C  
ATOM   2010  CG  ASN A 251      56.002  68.120  64.818  1.00  0.67           C  
ATOM   2011  OD1 ASN A 251      56.924  68.074  64.006  1.00  0.67           O  
ATOM   2012  ND2 ASN A 251      55.855  67.162  65.762  1.00  0.67           N  
ATOM   2013  N   ASP A 252      51.433  69.634  64.635  1.00  0.61           N  
ATOM   2014  CA  ASP A 252      50.347  70.594  64.562  1.00  0.61           C  
ATOM   2015  C   ASP A 252      50.209  71.387  65.848  1.00  0.61           C  
ATOM   2016  O   ASP A 252      49.361  72.275  65.971  1.00  0.61           O  
ATOM   2017  CB  ASP A 252      49.039  69.861  64.179  1.00  0.61           C  
ATOM   2018  CG  ASP A 252      48.658  68.721  65.114  1.00  0.61           C  
ATOM   2019  OD1 ASP A 252      49.237  68.611  66.227  1.00  0.61           O  
ATOM   2020  OD2 ASP A 252      47.763  67.946  64.707  1.00  0.61           O  
ATOM   2021  N   PHE A 253      51.089  71.073  66.807  1.00  0.48           N  
ATOM   2022  CA  PHE A 253      51.227  71.744  68.066  1.00  0.48           C  
ATOM   2023  C   PHE A 253      52.683  71.724  68.515  1.00  0.48           C  
ATOM   2024  O   PHE A 253      53.348  70.689  68.497  1.00  0.48           O  
ATOM   2025  CB  PHE A 253      50.346  71.026  69.117  1.00  0.48           C  
ATOM   2026  CG  PHE A 253      50.440  71.607  70.501  1.00  0.48           C  
ATOM   2027  CD1 PHE A 253      50.172  72.964  70.714  1.00  0.48           C  
ATOM   2028  CD2 PHE A 253      50.793  70.799  71.595  1.00  0.48           C  
ATOM   2029  CE1 PHE A 253      50.265  73.507  71.997  1.00  0.48           C  
ATOM   2030  CE2 PHE A 253      50.867  71.337  72.886  1.00  0.48           C  
ATOM   2031  CZ  PHE A 253      50.609  72.698  73.087  1.00  0.48           C  
ATOM   2032  N   ASN A 254      53.191  72.879  68.985  1.00  0.49           N  
ATOM   2033  CA  ASN A 254      54.467  72.985  69.660  1.00  0.49           C  
ATOM   2034  C   ASN A 254      54.239  73.344  71.125  1.00  0.49           C  
ATOM   2035  O   ASN A 254      53.742  74.410  71.487  1.00  0.49           O  
ATOM   2036  CB  ASN A 254      55.407  74.016  68.981  1.00  0.49           C  
ATOM   2037  CG  ASN A 254      56.866  73.791  69.380  1.00  0.49           C  
ATOM   2038  OD1 ASN A 254      57.179  73.334  70.486  1.00  0.49           O  
ATOM   2039  ND2 ASN A 254      57.787  74.072  68.435  1.00  0.49           N  
ATOM   2040  N   LEU A 255      54.626  72.416  72.019  1.00  0.46           N  
ATOM   2041  CA  LEU A 255      54.539  72.569  73.456  1.00  0.46           C  
ATOM   2042  C   LEU A 255      55.446  73.672  74.010  1.00  0.46           C  
ATOM   2043  O   LEU A 255      55.073  74.385  74.940  1.00  0.46           O  
ATOM   2044  CB  LEU A 255      54.835  71.208  74.140  1.00  0.46           C  
ATOM   2045  CG  LEU A 255      53.990  70.856  75.387  1.00  0.46           C  
ATOM   2046  CD1 LEU A 255      54.585  69.635  76.093  1.00  0.46           C  
ATOM   2047  CD2 LEU A 255      53.838  71.977  76.416  1.00  0.46           C  
ATOM   2048  N   ARG A 256      56.667  73.860  73.450  1.00  0.40           N  
ATOM   2049  CA  ARG A 256      57.615  74.855  73.953  1.00  0.40           C  
ATOM   2050  C   ARG A 256      57.077  76.263  73.869  1.00  0.40           C  
ATOM   2051  O   ARG A 256      57.054  76.994  74.855  1.00  0.40           O  
ATOM   2052  CB  ARG A 256      58.946  74.814  73.148  1.00  0.40           C  
ATOM   2053  CG  ARG A 256      60.130  74.071  73.803  1.00  0.40           C  
ATOM   2054  CD  ARG A 256      59.896  72.601  74.132  1.00  0.40           C  
ATOM   2055  NE  ARG A 256      59.166  72.548  75.437  1.00  0.40           N  
ATOM   2056  CZ  ARG A 256      58.399  71.519  75.803  1.00  0.40           C  
ATOM   2057  NH1 ARG A 256      58.340  70.436  75.039  1.00  0.40           N  
ATOM   2058  NH2 ARG A 256      57.695  71.580  76.925  1.00  0.40           N  
ATOM   2059  N   ASP A 257      56.554  76.616  72.692  1.00  0.40           N  
ATOM   2060  CA  ASP A 257      55.933  77.871  72.359  1.00  0.40           C  
ATOM   2061  C   ASP A 257      54.730  78.152  73.259  1.00  0.40           C  
ATOM   2062  O   ASP A 257      54.544  79.241  73.791  1.00  0.40           O  
ATOM   2063  CB  ASP A 257      55.473  77.809  70.877  1.00  0.40           C  
ATOM   2064  CG  ASP A 257      56.563  77.466  69.862  1.00  0.40           C  
ATOM   2065  OD1 ASP A 257      56.308  77.721  68.658  1.00  0.40           O  
ATOM   2066  OD2 ASP A 257      57.610  76.884  70.232  1.00  0.40           O  
ATOM   2067  N   PHE A 258      53.895  77.127  73.524  1.00  0.41           N  
ATOM   2068  CA  PHE A 258      52.777  77.223  74.447  1.00  0.41           C  
ATOM   2069  C   PHE A 258      53.181  77.530  75.893  1.00  0.41           C  
ATOM   2070  O   PHE A 258      52.513  78.284  76.600  1.00  0.41           O  
ATOM   2071  CB  PHE A 258      51.965  75.905  74.397  1.00  0.41           C  
ATOM   2072  CG  PHE A 258      50.557  76.117  74.877  1.00  0.41           C  
ATOM   2073  CD1 PHE A 258      49.530  76.405  73.964  1.00  0.41           C  
ATOM   2074  CD2 PHE A 258      50.253  76.067  76.246  1.00  0.41           C  
ATOM   2075  CE1 PHE A 258      48.222  76.627  74.406  1.00  0.41           C  
ATOM   2076  CE2 PHE A 258      48.952  76.321  76.689  1.00  0.41           C  
ATOM   2077  CZ  PHE A 258      47.931  76.579  75.771  1.00  0.41           C  
ATOM   2078  N   ASN A 259      54.293  76.941  76.378  1.00  0.43           N  
ATOM   2079  CA  ASN A 259      54.864  77.238  77.685  1.00  0.43           C  
ATOM   2080  C   ASN A 259      55.343  78.680  77.820  1.00  0.43           C  
ATOM   2081  O   ASN A 259      55.173  79.295  78.867  1.00  0.43           O  
ATOM   2082  CB  ASN A 259      56.041  76.281  78.029  1.00  0.43           C  
ATOM   2083  CG  ASN A 259      55.642  74.809  78.129  1.00  0.43           C  
ATOM   2084  OD1 ASN A 259      56.475  73.911  77.950  1.00  0.43           O  
ATOM   2085  ND2 ASN A 259      54.354  74.534  78.442  1.00  0.43           N  
ATOM   2086  N   VAL A 260      55.931  79.249  76.750  1.00  0.40           N  
ATOM   2087  CA  VAL A 260      56.413  80.628  76.710  1.00  0.40           C  
ATOM   2088  C   VAL A 260      55.276  81.640  76.585  1.00  0.40           C  
ATOM   2089  O   VAL A 260      55.392  82.797  76.983  1.00  0.40           O  
ATOM   2090  CB  VAL A 260      57.414  80.794  75.567  1.00  0.40           C  
ATOM   2091  CG1 VAL A 260      57.976  82.227  75.483  1.00  0.40           C  
ATOM   2092  CG2 VAL A 260      58.588  79.817  75.773  1.00  0.40           C  
ATOM   2093  N   GLY A 261      54.101  81.199  76.088  1.00  0.39           N  
ATOM   2094  CA  GLY A 261      52.929  82.050  75.898  1.00  0.39           C  
ATOM   2095  C   GLY A 261      52.698  82.406  74.464  1.00  0.39           C  
ATOM   2096  O   GLY A 261      51.722  83.069  74.113  1.00  0.39           O  
ATOM   2097  N   ASP A 262      53.568  81.913  73.575  1.00  0.49           N  
ATOM   2098  CA  ASP A 262      53.519  82.114  72.149  1.00  0.49           C  
ATOM   2099  C   ASP A 262      52.461  81.231  71.484  1.00  0.49           C  
ATOM   2100  O   ASP A 262      52.728  80.369  70.648  1.00  0.49           O  
ATOM   2101  CB  ASP A 262      54.908  81.867  71.530  1.00  0.49           C  
ATOM   2102  CG  ASP A 262      55.950  82.749  72.179  1.00  0.49           C  
ATOM   2103  OD1 ASP A 262      57.035  82.220  72.510  1.00  0.49           O  
ATOM   2104  OD2 ASP A 262      55.675  83.967  72.308  1.00  0.49           O  
ATOM   2105  N   TYR A 263      51.182  81.451  71.843  1.00  0.37           N  
ATOM   2106  CA  TYR A 263      50.037  80.641  71.459  1.00  0.37           C  
ATOM   2107  C   TYR A 263      49.811  80.552  69.960  1.00  0.37           C  
ATOM   2108  O   TYR A 263      49.443  79.511  69.428  1.00  0.37           O  
ATOM   2109  CB  TYR A 263      48.743  81.173  72.146  1.00  0.37           C  
ATOM   2110  CG  TYR A 263      48.847  81.119  73.651  1.00  0.37           C  
ATOM   2111  CD1 TYR A 263      48.552  82.237  74.458  1.00  0.37           C  
ATOM   2112  CD2 TYR A 263      49.252  79.931  74.278  1.00  0.37           C  
ATOM   2113  CE1 TYR A 263      48.700  82.168  75.854  1.00  0.37           C  
ATOM   2114  CE2 TYR A 263      49.419  79.866  75.665  1.00  0.37           C  
ATOM   2115  CZ  TYR A 263      49.150  80.986  76.449  1.00  0.37           C  
ATOM   2116  OH  TYR A 263      49.377  80.913  77.832  1.00  0.37           O  
ATOM   2117  N   ILE A 264      50.040  81.658  69.235  1.00  0.45           N  
ATOM   2118  CA  ILE A 264      50.002  81.706  67.786  1.00  0.45           C  
ATOM   2119  C   ILE A 264      51.120  80.878  67.156  1.00  0.45           C  
ATOM   2120  O   ILE A 264      50.893  80.121  66.219  1.00  0.45           O  
ATOM   2121  CB  ILE A 264      50.061  83.148  67.279  1.00  0.45           C  
ATOM   2122  CG1 ILE A 264      48.904  84.028  67.819  1.00  0.45           C  
ATOM   2123  CG2 ILE A 264      49.977  83.150  65.738  1.00  0.45           C  
ATOM   2124  CD1 ILE A 264      49.103  84.592  69.232  1.00  0.45           C  
ATOM   2125  N   GLN A 265      52.357  80.969  67.692  1.00  0.46           N  
ATOM   2126  CA  GLN A 265      53.519  80.206  67.250  1.00  0.46           C  
ATOM   2127  C   GLN A 265      53.338  78.711  67.429  1.00  0.46           C  
ATOM   2128  O   GLN A 265      53.600  77.918  66.529  1.00  0.46           O  
ATOM   2129  CB  GLN A 265      54.764  80.656  68.046  1.00  0.46           C  
ATOM   2130  CG  GLN A 265      55.789  81.505  67.266  1.00  0.46           C  
ATOM   2131  CD  GLN A 265      56.499  80.754  66.136  1.00  0.46           C  
ATOM   2132  OE1 GLN A 265      56.845  81.369  65.125  1.00  0.46           O  
ATOM   2133  NE2 GLN A 265      56.736  79.433  66.291  1.00  0.46           N  
ATOM   2134  N   ALA A 266      52.775  78.311  68.586  1.00  0.41           N  
ATOM   2135  CA  ALA A 266      52.512  76.940  68.956  1.00  0.41           C  
ATOM   2136  C   ALA A 266      51.663  76.181  67.949  1.00  0.41           C  
ATOM   2137  O   ALA A 266      51.768  74.967  67.818  1.00  0.41           O  
ATOM   2138  CB  ALA A 266      51.814  76.920  70.333  1.00  0.41           C  
ATOM   2139  N   VAL A 267      50.782  76.892  67.226  1.00  0.53           N  
ATOM   2140  CA  VAL A 267      49.866  76.321  66.255  1.00  0.53           C  
ATOM   2141  C   VAL A 267      50.113  76.935  64.859  1.00  0.53           C  
ATOM   2142  O   VAL A 267      49.323  76.819  63.922  1.00  0.53           O  
ATOM   2143  CB  VAL A 267      48.453  76.452  66.842  1.00  0.53           C  
ATOM   2144  CG1 VAL A 267      47.314  76.124  65.868  1.00  0.53           C  
ATOM   2145  CG2 VAL A 267      48.349  75.477  68.038  1.00  0.53           C  
ATOM   2146  N   LEU A 268      51.285  77.577  64.643  1.00  0.51           N  
ATOM   2147  CA  LEU A 268      51.621  78.294  63.410  1.00  0.51           C  
ATOM   2148  C   LEU A 268      51.637  77.435  62.155  1.00  0.51           C  
ATOM   2149  O   LEU A 268      50.964  77.730  61.161  1.00  0.51           O  
ATOM   2150  CB  LEU A 268      53.019  78.954  63.565  1.00  0.51           C  
ATOM   2151  CG  LEU A 268      53.590  79.705  62.339  1.00  0.51           C  
ATOM   2152  CD1 LEU A 268      52.700  80.878  61.903  1.00  0.51           C  
ATOM   2153  CD2 LEU A 268      55.013  80.201  62.634  1.00  0.51           C  
ATOM   2154  N   ASP A 269      52.350  76.294  62.210  1.00  0.53           N  
ATOM   2155  CA  ASP A 269      52.469  75.341  61.127  1.00  0.53           C  
ATOM   2156  C   ASP A 269      51.122  74.750  60.730  1.00  0.53           C  
ATOM   2157  O   ASP A 269      50.850  74.507  59.552  1.00  0.53           O  
ATOM   2158  CB  ASP A 269      53.440  74.202  61.521  1.00  0.53           C  
ATOM   2159  CG  ASP A 269      54.880  74.680  61.639  1.00  0.53           C  
ATOM   2160  OD1 ASP A 269      55.139  75.892  61.446  1.00  0.53           O  
ATOM   2161  OD2 ASP A 269      55.735  73.803  61.913  1.00  0.53           O  
ATOM   2162  N   ARG A 270      50.221  74.545  61.726  1.00  0.59           N  
ATOM   2163  CA  ARG A 270      48.873  74.032  61.532  1.00  0.59           C  
ATOM   2164  C   ARG A 270      48.079  74.902  60.568  1.00  0.59           C  
ATOM   2165  O   ARG A 270      47.546  74.420  59.575  1.00  0.59           O  
ATOM   2166  CB  ARG A 270      48.120  73.930  62.897  1.00  0.59           C  
ATOM   2167  CG  ARG A 270      46.772  73.172  62.850  1.00  0.59           C  
ATOM   2168  CD  ARG A 270      45.866  73.237  64.104  1.00  0.59           C  
ATOM   2169  NE  ARG A 270      46.563  72.616  65.282  1.00  0.59           N  
ATOM   2170  CZ  ARG A 270      45.942  72.101  66.352  1.00  0.59           C  
ATOM   2171  NH1 ARG A 270      44.644  72.213  66.601  1.00  0.59           N  
ATOM   2172  NH2 ARG A 270      46.653  71.432  67.250  1.00  0.59           N  
ATOM   2173  N   ASN A 271      48.072  76.237  60.771  1.00  0.71           N  
ATOM   2174  CA  ASN A 271      47.391  77.144  59.864  1.00  0.71           C  
ATOM   2175  C   ASN A 271      47.986  77.159  58.460  1.00  0.71           C  
ATOM   2176  O   ASN A 271      47.257  77.100  57.473  1.00  0.71           O  
ATOM   2177  CB  ASN A 271      47.387  78.583  60.446  1.00  0.71           C  
ATOM   2178  CG  ASN A 271      46.486  79.502  59.623  1.00  0.71           C  
ATOM   2179  OD1 ASN A 271      45.267  79.357  59.616  1.00  0.71           O  
ATOM   2180  ND2 ASN A 271      47.096  80.451  58.873  1.00  0.71           N  
ATOM   2181  N   LEU A 272      49.329  77.230  58.330  1.00  0.66           N  
ATOM   2182  CA  LEU A 272      49.976  77.351  57.033  1.00  0.66           C  
ATOM   2183  C   LEU A 272      49.710  76.163  56.126  1.00  0.66           C  
ATOM   2184  O   LEU A 272      49.374  76.324  54.951  1.00  0.66           O  
ATOM   2185  CB  LEU A 272      51.499  77.571  57.187  1.00  0.66           C  
ATOM   2186  CG  LEU A 272      52.207  78.015  55.887  1.00  0.66           C  
ATOM   2187  CD1 LEU A 272      51.826  79.448  55.477  1.00  0.66           C  
ATOM   2188  CD2 LEU A 272      53.730  77.899  56.032  1.00  0.66           C  
ATOM   2189  N   ALA A 273      49.795  74.943  56.684  1.00  0.78           N  
ATOM   2190  CA  ALA A 273      49.453  73.729  55.987  1.00  0.78           C  
ATOM   2191  C   ALA A 273      47.984  73.619  55.602  1.00  0.78           C  
ATOM   2192  O   ALA A 273      47.652  73.333  54.454  1.00  0.78           O  
ATOM   2193  CB  ALA A 273      49.813  72.557  56.909  1.00  0.78           C  
ATOM   2194  N   GLU A 274      47.057  73.902  56.537  1.00  0.79           N  
ATOM   2195  CA  GLU A 274      45.641  73.674  56.313  1.00  0.79           C  
ATOM   2196  C   GLU A 274      44.995  74.608  55.299  1.00  0.79           C  
ATOM   2197  O   GLU A 274      43.971  74.274  54.708  1.00  0.79           O  
ATOM   2198  CB  GLU A 274      44.838  73.804  57.618  1.00  0.79           C  
ATOM   2199  CG  GLU A 274      45.055  72.695  58.672  1.00  0.79           C  
ATOM   2200  CD  GLU A 274      44.279  72.992  59.955  1.00  0.79           C  
ATOM   2201  OE1 GLU A 274      43.597  74.054  60.026  1.00  0.79           O  
ATOM   2202  OE2 GLU A 274      44.360  72.156  60.889  1.00  0.79           O  
ATOM   2203  N   ASN A 275      45.603  75.779  54.999  1.00  0.79           N  
ATOM   2204  CA  ASN A 275      45.132  76.686  53.957  1.00  0.79           C  
ATOM   2205  C   ASN A 275      45.025  76.024  52.587  1.00  0.79           C  
ATOM   2206  O   ASN A 275      44.163  76.368  51.780  1.00  0.79           O  
ATOM   2207  CB  ASN A 275      46.057  77.917  53.817  1.00  0.79           C  
ATOM   2208  CG  ASN A 275      45.903  78.805  55.042  1.00  0.79           C  
ATOM   2209  OD1 ASN A 275      44.794  79.081  55.505  1.00  0.79           O  
ATOM   2210  ND2 ASN A 275      47.040  79.284  55.591  1.00  0.79           N  
ATOM   2211  N   ILE A 276      45.890  75.030  52.312  1.00  0.86           N  
ATOM   2212  CA  ILE A 276      45.905  74.261  51.080  1.00  0.86           C  
ATOM   2213  C   ILE A 276      44.596  73.519  50.826  1.00  0.86           C  
ATOM   2214  O   ILE A 276      44.051  73.539  49.727  1.00  0.86           O  
ATOM   2215  CB  ILE A 276      47.086  73.296  51.108  1.00  0.86           C  
ATOM   2216  CG1 ILE A 276      48.420  74.082  51.179  1.00  0.86           C  
ATOM   2217  CG2 ILE A 276      47.068  72.369  49.877  1.00  0.86           C  
ATOM   2218  CD1 ILE A 276      49.631  73.178  51.430  1.00  0.86           C  
ATOM   2219  N   SER A 277      44.000  72.879  51.842  1.00  0.88           N  
ATOM   2220  CA  SER A 277      42.737  72.173  51.663  1.00  0.88           C  
ATOM   2221  C   SER A 277      41.572  72.939  52.247  1.00  0.88           C  
ATOM   2222  O   SER A 277      40.519  72.374  52.520  1.00  0.88           O  
ATOM   2223  CB  SER A 277      42.761  70.735  52.239  1.00  0.88           C  
ATOM   2224  OG  SER A 277      43.119  70.699  53.620  1.00  0.88           O  
ATOM   2225  N   ARG A 278      41.722  74.255  52.464  1.00  0.80           N  
ATOM   2226  CA  ARG A 278      40.677  75.073  53.048  1.00  0.80           C  
ATOM   2227  C   ARG A 278      39.518  75.402  52.114  1.00  0.80           C  
ATOM   2228  O   ARG A 278      38.360  75.163  52.453  1.00  0.80           O  
ATOM   2229  CB  ARG A 278      41.312  76.372  53.587  1.00  0.80           C  
ATOM   2230  CG  ARG A 278      40.397  77.215  54.496  1.00  0.80           C  
ATOM   2231  CD  ARG A 278      41.077  77.654  55.800  1.00  0.80           C  
ATOM   2232  NE  ARG A 278      41.227  76.425  56.627  1.00  0.80           N  
ATOM   2233  CZ  ARG A 278      42.102  76.209  57.613  1.00  0.80           C  
ATOM   2234  NH1 ARG A 278      43.155  76.976  57.855  1.00  0.80           N  
ATOM   2235  NH2 ARG A 278      41.881  75.139  58.369  1.00  0.80           N  
ATOM   2236  N   VAL A 279      39.796  75.908  50.891  1.00  0.83           N  
ATOM   2237  CA  VAL A 279      38.751  76.257  49.932  1.00  0.83           C  
ATOM   2238  C   VAL A 279      39.169  75.896  48.520  1.00  0.83           C  
ATOM   2239  O   VAL A 279      40.348  75.756  48.199  1.00  0.83           O  
ATOM   2240  CB  VAL A 279      38.305  77.729  49.909  1.00  0.83           C  
ATOM   2241  CG1 VAL A 279      37.746  78.154  51.279  1.00  0.83           C  
ATOM   2242  CG2 VAL A 279      39.443  78.656  49.453  1.00  0.83           C  
ATOM   2243  N   LEU A 280      38.179  75.746  47.631  1.00  0.86           N  
ATOM   2244  CA  LEU A 280      38.342  75.469  46.223  1.00  0.86           C  
ATOM   2245  C   LEU A 280      38.456  76.771  45.448  1.00  0.86           C  
ATOM   2246  O   LEU A 280      37.679  77.699  45.653  1.00  0.86           O  
ATOM   2247  CB  LEU A 280      37.119  74.643  45.764  1.00  0.86           C  
ATOM   2248  CG  LEU A 280      36.950  74.364  44.259  1.00  0.86           C  
ATOM   2249  CD1 LEU A 280      38.138  73.640  43.616  1.00  0.86           C  
ATOM   2250  CD2 LEU A 280      35.684  73.525  44.062  1.00  0.86           C  
ATOM   2251  N   TYR A 281      39.463  76.877  44.554  1.00  0.75           N  
ATOM   2252  CA  TYR A 281      39.749  78.076  43.772  1.00  0.75           C  
ATOM   2253  C   TYR A 281      39.953  79.378  44.572  1.00  0.75           C  
ATOM   2254  O   TYR A 281      39.226  80.352  44.363  1.00  0.75           O  
ATOM   2255  CB  TYR A 281      38.724  78.288  42.619  1.00  0.75           C  
ATOM   2256  CG  TYR A 281      38.711  77.145  41.631  1.00  0.75           C  
ATOM   2257  CD1 TYR A 281      37.502  76.531  41.250  1.00  0.75           C  
ATOM   2258  CD2 TYR A 281      39.906  76.703  41.034  1.00  0.75           C  
ATOM   2259  CE1 TYR A 281      37.494  75.477  40.322  1.00  0.75           C  
ATOM   2260  CE2 TYR A 281      39.902  75.643  40.117  1.00  0.75           C  
ATOM   2261  CZ  TYR A 281      38.699  75.023  39.773  1.00  0.75           C  
ATOM   2262  OH  TYR A 281      38.710  73.936  38.880  1.00  0.75           O  
ATOM   2263  N   PRO A 282      40.917  79.466  45.497  1.00  0.50           N  
ATOM   2264  CA  PRO A 282      41.215  80.693  46.239  1.00  0.50           C  
ATOM   2265  C   PRO A 282      41.546  81.885  45.355  1.00  0.50           C  
ATOM   2266  O   PRO A 282      42.027  81.704  44.237  1.00  0.50           O  
ATOM   2267  CB  PRO A 282      42.400  80.283  47.125  1.00  0.50           C  
ATOM   2268  CG  PRO A 282      43.137  79.238  46.296  1.00  0.50           C  
ATOM   2269  CD  PRO A 282      41.983  78.470  45.660  1.00  0.50           C  
ATOM   2270  N   ASN A 283      41.266  83.120  45.824  1.00  0.54           N  
ATOM   2271  CA  ASN A 283      41.470  84.337  45.050  1.00  0.54           C  
ATOM   2272  C   ASN A 283      42.941  84.570  44.716  1.00  0.54           C  
ATOM   2273  O   ASN A 283      43.786  84.760  45.581  1.00  0.54           O  
ATOM   2274  CB  ASN A 283      40.876  85.595  45.753  1.00  0.54           C  
ATOM   2275  CG  ASN A 283      39.346  85.645  45.806  1.00  0.54           C  
ATOM   2276  OD1 ASN A 283      38.765  86.565  46.376  1.00  0.54           O  
ATOM   2277  ND2 ASN A 283      38.636  84.653  45.224  1.00  0.54           N  
ATOM   2278  N   ASP A 284      43.268  84.522  43.419  1.00  0.54           N  
ATOM   2279  CA  ASP A 284      44.601  84.475  42.875  1.00  0.54           C  
ATOM   2280  C   ASP A 284      45.078  85.812  42.325  1.00  0.54           C  
ATOM   2281  O   ASP A 284      46.174  85.936  41.772  1.00  0.54           O  
ATOM   2282  CB  ASP A 284      44.696  83.330  41.823  1.00  0.54           C  
ATOM   2283  CG  ASP A 284      43.497  83.106  40.896  1.00  0.54           C  
ATOM   2284  OD1 ASP A 284      42.361  83.583  41.155  1.00  0.54           O  
ATOM   2285  OD2 ASP A 284      43.698  82.312  39.944  1.00  0.54           O  
ATOM   2286  N   ASN A 285      44.298  86.879  42.563  1.00  0.50           N  
ATOM   2287  CA  ASN A 285      44.535  88.256  42.155  1.00  0.50           C  
ATOM   2288  C   ASN A 285      45.812  88.890  42.727  1.00  0.50           C  
ATOM   2289  O   ASN A 285      46.301  89.897  42.227  1.00  0.50           O  
ATOM   2290  CB  ASN A 285      43.318  89.120  42.585  1.00  0.50           C  
ATOM   2291  CG  ASN A 285      42.041  88.587  41.942  1.00  0.50           C  
ATOM   2292  OD1 ASN A 285      41.451  87.616  42.415  1.00  0.50           O  
ATOM   2293  ND2 ASN A 285      41.599  89.236  40.842  1.00  0.50           N  
ATOM   2294  N   PHE A 286      46.405  88.283  43.768  1.00  0.43           N  
ATOM   2295  CA  PHE A 286      47.550  88.776  44.522  1.00  0.43           C  
ATOM   2296  C   PHE A 286      48.571  87.645  44.653  1.00  0.43           C  
ATOM   2297  O   PHE A 286      48.330  86.548  44.153  1.00  0.43           O  
ATOM   2298  CB  PHE A 286      47.134  89.415  45.875  1.00  0.43           C  
ATOM   2299  CG  PHE A 286      46.182  88.557  46.662  1.00  0.43           C  
ATOM   2300  CD1 PHE A 286      46.646  87.819  47.754  1.00  0.43           C  
ATOM   2301  CD2 PHE A 286      44.811  88.520  46.353  1.00  0.43           C  
ATOM   2302  CE1 PHE A 286      45.775  87.023  48.504  1.00  0.43           C  
ATOM   2303  CE2 PHE A 286      43.933  87.729  47.100  1.00  0.43           C  
ATOM   2304  CZ  PHE A 286      44.418  86.972  48.172  1.00  0.43           C  
ATOM   2305  N   PHE A 287      49.789  87.864  45.204  1.00  0.56           N  
ATOM   2306  CA  PHE A 287      50.836  86.840  45.208  1.00  0.56           C  
ATOM   2307  C   PHE A 287      50.477  85.626  46.062  1.00  0.56           C  
ATOM   2308  O   PHE A 287      50.614  84.483  45.637  1.00  0.56           O  
ATOM   2309  CB  PHE A 287      52.185  87.476  45.676  1.00  0.56           C  
ATOM   2310  CG  PHE A 287      53.294  86.485  45.956  1.00  0.56           C  
ATOM   2311  CD1 PHE A 287      54.179  86.053  44.955  1.00  0.56           C  
ATOM   2312  CD2 PHE A 287      53.444  85.976  47.258  1.00  0.56           C  
ATOM   2313  CE1 PHE A 287      55.173  85.107  45.247  1.00  0.56           C  
ATOM   2314  CE2 PHE A 287      54.413  85.011  47.547  1.00  0.56           C  
ATOM   2315  CZ  PHE A 287      55.272  84.567  46.537  1.00  0.56           C  
ATOM   2316  N   GLU A 288      49.973  85.879  47.270  1.00  0.60           N  
ATOM   2317  CA  GLU A 288      49.725  84.948  48.345  1.00  0.60           C  
ATOM   2318  C   GLU A 288      48.705  83.879  47.966  1.00  0.60           C  
ATOM   2319  O   GLU A 288      48.916  82.680  48.159  1.00  0.60           O  
ATOM   2320  CB  GLU A 288      49.252  85.767  49.579  1.00  0.60           C  
ATOM   2321  CG  GLU A 288      50.256  86.822  50.150  1.00  0.60           C  
ATOM   2322  CD  GLU A 288      50.713  87.957  49.219  1.00  0.60           C  
ATOM   2323  OE1 GLU A 288      49.951  88.345  48.292  1.00  0.60           O  
ATOM   2324  OE2 GLU A 288      51.874  88.398  49.382  1.00  0.60           O  
ATOM   2325  N   GLY A 289      47.587  84.288  47.327  1.00  0.66           N  
ATOM   2326  CA  GLY A 289      46.569  83.364  46.835  1.00  0.66           C  
ATOM   2327  C   GLY A 289      46.948  82.658  45.560  1.00  0.66           C  
ATOM   2328  O   GLY A 289      46.551  81.524  45.303  1.00  0.66           O  
ATOM   2329  N   LYS A 290      47.775  83.313  44.727  1.00  0.75           N  
ATOM   2330  CA  LYS A 290      48.369  82.737  43.532  1.00  0.75           C  
ATOM   2331  C   LYS A 290      49.370  81.642  43.870  1.00  0.75           C  
ATOM   2332  O   LYS A 290      49.340  80.549  43.311  1.00  0.75           O  
ATOM   2333  CB  LYS A 290      49.007  83.886  42.721  1.00  0.75           C  
ATOM   2334  CG  LYS A 290      49.530  83.555  41.322  1.00  0.75           C  
ATOM   2335  CD  LYS A 290      50.170  84.758  40.599  1.00  0.75           C  
ATOM   2336  CE  LYS A 290      49.216  85.879  40.142  1.00  0.75           C  
ATOM   2337  NZ  LYS A 290      48.741  86.735  41.254  1.00  0.75           N  
ATOM   2338  N   GLU A 291      50.238  81.879  44.874  1.00  0.79           N  
ATOM   2339  CA  GLU A 291      51.100  80.864  45.448  1.00  0.79           C  
ATOM   2340  C   GLU A 291      50.310  79.736  46.084  1.00  0.79           C  
ATOM   2341  O   GLU A 291      50.647  78.563  45.955  1.00  0.79           O  
ATOM   2342  CB  GLU A 291      52.055  81.431  46.524  1.00  0.79           C  
ATOM   2343  CG  GLU A 291      53.135  80.395  46.932  1.00  0.79           C  
ATOM   2344  CD  GLU A 291      53.805  80.712  48.258  1.00  0.79           C  
ATOM   2345  OE1 GLU A 291      53.105  80.712  49.293  1.00  0.79           O  
ATOM   2346  OE2 GLU A 291      55.039  80.887  48.325  1.00  0.79           O  
ATOM   2347  N   LEU A 292      49.203  80.049  46.787  1.00  0.82           N  
ATOM   2348  CA  LEU A 292      48.330  79.041  47.357  1.00  0.82           C  
ATOM   2349  C   LEU A 292      47.740  78.070  46.341  1.00  0.82           C  
ATOM   2350  O   LEU A 292      47.749  76.870  46.592  1.00  0.82           O  
ATOM   2351  CB  LEU A 292      47.200  79.670  48.200  1.00  0.82           C  
ATOM   2352  CG  LEU A 292      46.330  78.649  48.963  1.00  0.82           C  
ATOM   2353  CD1 LEU A 292      47.149  77.761  49.910  1.00  0.82           C  
ATOM   2354  CD2 LEU A 292      45.224  79.359  49.747  1.00  0.82           C  
ATOM   2355  N   ARG A 293      47.283  78.526  45.154  1.00  0.81           N  
ATOM   2356  CA  ARG A 293      46.865  77.613  44.089  1.00  0.81           C  
ATOM   2357  C   ARG A 293      47.969  76.674  43.614  1.00  0.81           C  
ATOM   2358  O   ARG A 293      47.764  75.470  43.514  1.00  0.81           O  
ATOM   2359  CB  ARG A 293      46.321  78.362  42.853  1.00  0.81           C  
ATOM   2360  CG  ARG A 293      44.962  79.031  43.101  1.00  0.81           C  
ATOM   2361  CD  ARG A 293      44.245  79.421  41.809  1.00  0.81           C  
ATOM   2362  NE  ARG A 293      42.908  79.968  42.208  1.00  0.81           N  
ATOM   2363  CZ  ARG A 293      41.960  80.241  41.304  1.00  0.81           C  
ATOM   2364  NH1 ARG A 293      41.992  79.754  40.071  1.00  0.81           N  
ATOM   2365  NH2 ARG A 293      41.006  81.106  41.623  1.00  0.81           N  
ATOM   2366  N   LEU A 294      49.199  77.182  43.408  1.00  0.89           N  
ATOM   2367  CA  LEU A 294      50.353  76.356  43.079  1.00  0.89           C  
ATOM   2368  C   LEU A 294      50.692  75.340  44.177  1.00  0.89           C  
ATOM   2369  O   LEU A 294      51.003  74.175  43.915  1.00  0.89           O  
ATOM   2370  CB  LEU A 294      51.567  77.268  42.773  1.00  0.89           C  
ATOM   2371  CG  LEU A 294      52.790  76.563  42.147  1.00  0.89           C  
ATOM   2372  CD1 LEU A 294      52.475  75.950  40.776  1.00  0.89           C  
ATOM   2373  CD2 LEU A 294      53.957  77.553  42.018  1.00  0.89           C  
ATOM   2374  N   LYS A 295      50.581  75.742  45.468  1.00  0.88           N  
ATOM   2375  CA  LYS A 295      50.674  74.827  46.596  1.00  0.88           C  
ATOM   2376  C   LYS A 295      49.589  73.752  46.579  1.00  0.88           C  
ATOM   2377  O   LYS A 295      49.880  72.584  46.822  1.00  0.88           O  
ATOM   2378  CB  LYS A 295      50.713  75.543  47.983  1.00  0.88           C  
ATOM   2379  CG  LYS A 295      51.936  76.463  48.152  1.00  0.88           C  
ATOM   2380  CD  LYS A 295      52.385  76.737  49.601  1.00  0.88           C  
ATOM   2381  CE  LYS A 295      51.480  77.636  50.457  1.00  0.88           C  
ATOM   2382  NZ  LYS A 295      51.386  78.996  49.924  1.00  0.88           N  
ATOM   2383  N   GLN A 296      48.326  74.098  46.243  1.00  0.90           N  
ATOM   2384  CA  GLN A 296      47.247  73.136  46.067  1.00  0.90           C  
ATOM   2385  C   GLN A 296      47.492  72.134  44.962  1.00  0.90           C  
ATOM   2386  O   GLN A 296      47.346  70.934  45.173  1.00  0.90           O  
ATOM   2387  CB  GLN A 296      45.898  73.834  45.759  1.00  0.90           C  
ATOM   2388  CG  GLN A 296      45.345  74.626  46.957  1.00  0.90           C  
ATOM   2389  CD  GLN A 296      43.974  75.237  46.662  1.00  0.90           C  
ATOM   2390  OE1 GLN A 296      43.738  75.865  45.629  1.00  0.90           O  
ATOM   2391  NE2 GLN A 296      43.040  75.068  47.623  1.00  0.90           N  
ATOM   2392  N   GLU A 297      47.917  72.593  43.776  1.00  0.92           N  
ATOM   2393  CA  GLU A 297      48.206  71.756  42.629  1.00  0.92           C  
ATOM   2394  C   GLU A 297      49.336  70.779  42.876  1.00  0.92           C  
ATOM   2395  O   GLU A 297      49.218  69.586  42.597  1.00  0.92           O  
ATOM   2396  CB  GLU A 297      48.512  72.660  41.423  1.00  0.92           C  
ATOM   2397  CG  GLU A 297      47.256  73.454  40.991  1.00  0.92           C  
ATOM   2398  CD  GLU A 297      47.563  74.600  40.038  1.00  0.92           C  
ATOM   2399  OE1 GLU A 297      48.695  74.670  39.491  1.00  0.92           O  
ATOM   2400  OE2 GLU A 297      46.651  75.456  39.915  1.00  0.92           O  
ATOM   2401  N   TYR A 298      50.444  71.229  43.497  1.00  0.94           N  
ATOM   2402  CA  TYR A 298      51.497  70.330  43.924  1.00  0.94           C  
ATOM   2403  C   TYR A 298      51.051  69.328  44.990  1.00  0.94           C  
ATOM   2404  O   TYR A 298      51.411  68.154  44.948  1.00  0.94           O  
ATOM   2405  CB  TYR A 298      52.725  71.131  44.416  1.00  0.94           C  
ATOM   2406  CG  TYR A 298      53.894  70.206  44.606  1.00  0.94           C  
ATOM   2407  CD1 TYR A 298      54.424  69.501  43.512  1.00  0.94           C  
ATOM   2408  CD2 TYR A 298      54.403  69.959  45.889  1.00  0.94           C  
ATOM   2409  CE1 TYR A 298      55.447  68.567  43.705  1.00  0.94           C  
ATOM   2410  CE2 TYR A 298      55.444  69.041  46.077  1.00  0.94           C  
ATOM   2411  CZ  TYR A 298      55.973  68.354  44.982  1.00  0.94           C  
ATOM   2412  OH  TYR A 298      57.045  67.463  45.163  1.00  0.94           O  
ATOM   2413  N   PHE A 299      50.226  69.763  45.958  1.00  0.94           N  
ATOM   2414  CA  PHE A 299      49.724  68.926  47.029  1.00  0.94           C  
ATOM   2415  C   PHE A 299      48.924  67.720  46.542  1.00  0.94           C  
ATOM   2416  O   PHE A 299      49.146  66.599  47.001  1.00  0.94           O  
ATOM   2417  CB  PHE A 299      48.901  69.828  47.981  1.00  0.94           C  
ATOM   2418  CG  PHE A 299      48.371  69.108  49.179  1.00  0.94           C  
ATOM   2419  CD1 PHE A 299      49.226  68.729  50.224  1.00  0.94           C  
ATOM   2420  CD2 PHE A 299      46.999  68.832  49.273  1.00  0.94           C  
ATOM   2421  CE1 PHE A 299      48.719  68.052  51.338  1.00  0.94           C  
ATOM   2422  CE2 PHE A 299      46.486  68.164  50.387  1.00  0.94           C  
ATOM   2423  CZ  PHE A 299      47.352  67.758  51.408  1.00  0.94           C  
ATOM   2424  N   VAL A 300      48.016  67.896  45.554  1.00  0.96           N  
ATOM   2425  CA  VAL A 300      47.293  66.768  44.972  1.00  0.96           C  
ATOM   2426  C   VAL A 300      48.213  65.810  44.264  1.00  0.96           C  
ATOM   2427  O   VAL A 300      48.104  64.593  44.382  1.00  0.96           O  
ATOM   2428  CB  VAL A 300      46.252  67.140  43.918  1.00  0.96           C  
ATOM   2429  CG1 VAL A 300      45.039  66.219  44.096  1.00  0.96           C  
ATOM   2430  CG2 VAL A 300      45.853  68.607  44.022  1.00  0.96           C  
ATOM   2431  N   VAL A 301      49.145  66.380  43.488  1.00  0.96           N  
ATOM   2432  CA  VAL A 301      50.104  65.669  42.679  1.00  0.96           C  
ATOM   2433  C   VAL A 301      51.061  64.812  43.482  1.00  0.96           C  
ATOM   2434  O   VAL A 301      51.175  63.612  43.237  1.00  0.96           O  
ATOM   2435  CB  VAL A 301      50.864  66.702  41.852  1.00  0.96           C  
ATOM   2436  CG1 VAL A 301      52.223  66.176  41.366  1.00  0.96           C  
ATOM   2437  CG2 VAL A 301      49.962  67.131  40.679  1.00  0.96           C  
ATOM   2438  N   ALA A 302      51.746  65.390  44.487  1.00  0.97           N  
ATOM   2439  CA  ALA A 302      52.770  64.693  45.233  1.00  0.97           C  
ATOM   2440  C   ALA A 302      52.222  63.542  46.054  1.00  0.97           C  
ATOM   2441  O   ALA A 302      52.683  62.405  45.970  1.00  0.97           O  
ATOM   2442  CB  ALA A 302      53.471  65.712  46.146  1.00  0.97           C  
ATOM   2443  N   ALA A 303      51.138  63.806  46.805  1.00  0.96           N  
ATOM   2444  CA  ALA A 303      50.475  62.808  47.607  1.00  0.96           C  
ATOM   2445  C   ALA A 303      49.848  61.684  46.787  1.00  0.96           C  
ATOM   2446  O   ALA A 303      50.007  60.499  47.085  1.00  0.96           O  
ATOM   2447  CB  ALA A 303      49.410  63.521  48.451  1.00  0.96           C  
ATOM   2448  N   THR A 304      49.153  62.029  45.680  1.00  0.96           N  
ATOM   2449  CA  THR A 304      48.560  61.039  44.782  1.00  0.96           C  
ATOM   2450  C   THR A 304      49.588  60.149  44.126  1.00  0.96           C  
ATOM   2451  O   THR A 304      49.457  58.927  44.133  1.00  0.96           O  
ATOM   2452  CB  THR A 304      47.723  61.641  43.663  1.00  0.96           C  
ATOM   2453  OG1 THR A 304      46.658  62.407  44.207  1.00  0.96           O  
ATOM   2454  CG2 THR A 304      47.117  60.531  42.792  1.00  0.96           C  
ATOM   2455  N   LEU A 305      50.678  60.721  43.574  1.00  0.95           N  
ATOM   2456  CA  LEU A 305      51.704  59.938  42.910  1.00  0.95           C  
ATOM   2457  C   LEU A 305      52.426  58.984  43.841  1.00  0.95           C  
ATOM   2458  O   LEU A 305      52.611  57.821  43.498  1.00  0.95           O  
ATOM   2459  CB  LEU A 305      52.716  60.821  42.149  1.00  0.95           C  
ATOM   2460  CG  LEU A 305      52.130  61.510  40.899  1.00  0.95           C  
ATOM   2461  CD1 LEU A 305      53.175  62.446  40.295  1.00  0.95           C  
ATOM   2462  CD2 LEU A 305      51.669  60.514  39.829  1.00  0.95           C  
ATOM   2463  N   GLN A 306      52.769  59.406  45.075  1.00  0.91           N  
ATOM   2464  CA  GLN A 306      53.331  58.520  46.086  1.00  0.91           C  
ATOM   2465  C   GLN A 306      52.430  57.329  46.417  1.00  0.91           C  
ATOM   2466  O   GLN A 306      52.895  56.194  46.514  1.00  0.91           O  
ATOM   2467  CB  GLN A 306      53.574  59.288  47.406  1.00  0.91           C  
ATOM   2468  CG  GLN A 306      54.733  60.306  47.369  1.00  0.91           C  
ATOM   2469  CD  GLN A 306      54.823  61.033  48.710  1.00  0.91           C  
ATOM   2470  OE1 GLN A 306      54.385  62.165  48.894  1.00  0.91           O  
ATOM   2471  NE2 GLN A 306      55.402  60.340  49.717  1.00  0.91           N  
ATOM   2472  N   ASP A 307      51.107  57.554  46.561  1.00  0.91           N  
ATOM   2473  CA  ASP A 307      50.129  56.506  46.787  1.00  0.91           C  
ATOM   2474  C   ASP A 307      50.022  55.520  45.615  1.00  0.91           C  
ATOM   2475  O   ASP A 307      49.958  54.302  45.800  1.00  0.91           O  
ATOM   2476  CB  ASP A 307      48.770  57.175  47.124  1.00  0.91           C  
ATOM   2477  CG  ASP A 307      47.823  56.246  47.844  1.00  0.91           C  
ATOM   2478  OD1 ASP A 307      48.276  55.374  48.623  1.00  0.91           O  
ATOM   2479  OD2 ASP A 307      46.584  56.386  47.663  1.00  0.91           O  
ATOM   2480  N   ILE A 308      50.048  56.025  44.361  1.00  0.92           N  
ATOM   2481  CA  ILE A 308      50.086  55.197  43.160  1.00  0.92           C  
ATOM   2482  C   ILE A 308      51.349  54.349  43.080  1.00  0.92           C  
ATOM   2483  O   ILE A 308      51.269  53.147  42.830  1.00  0.92           O  
ATOM   2484  CB  ILE A 308      49.923  56.027  41.885  1.00  0.92           C  
ATOM   2485  CG1 ILE A 308      48.554  56.748  41.881  1.00  0.92           C  
ATOM   2486  CG2 ILE A 308      50.055  55.132  40.629  1.00  0.92           C  
ATOM   2487  CD1 ILE A 308      48.412  57.782  40.758  1.00  0.92           C  
ATOM   2488  N   ILE A 309      52.543  54.925  43.355  1.00  0.88           N  
ATOM   2489  CA  ILE A 309      53.809  54.191  43.386  1.00  0.88           C  
ATOM   2490  C   ILE A 309      53.791  53.096  44.452  1.00  0.88           C  
ATOM   2491  O   ILE A 309      54.184  51.956  44.207  1.00  0.88           O  
ATOM   2492  CB  ILE A 309      55.016  55.112  43.623  1.00  0.88           C  
ATOM   2493  CG1 ILE A 309      55.195  56.187  42.520  1.00  0.88           C  
ATOM   2494  CG2 ILE A 309      56.322  54.298  43.760  1.00  0.88           C  
ATOM   2495  CD1 ILE A 309      55.577  55.671  41.130  1.00  0.88           C  
ATOM   2496  N   ARG A 310      53.275  53.408  45.658  1.00  0.80           N  
ATOM   2497  CA  ARG A 310      53.142  52.477  46.766  1.00  0.80           C  
ATOM   2498  C   ARG A 310      52.252  51.280  46.457  1.00  0.80           C  
ATOM   2499  O   ARG A 310      52.599  50.131  46.722  1.00  0.80           O  
ATOM   2500  CB  ARG A 310      52.543  53.237  47.975  1.00  0.80           C  
ATOM   2501  CG  ARG A 310      52.610  52.490  49.322  1.00  0.80           C  
ATOM   2502  CD  ARG A 310      51.323  52.617  50.144  1.00  0.80           C  
ATOM   2503  NE  ARG A 310      50.426  51.501  49.707  1.00  0.80           N  
ATOM   2504  CZ  ARG A 310      49.159  51.630  49.302  1.00  0.80           C  
ATOM   2505  NH1 ARG A 310      48.543  52.792  49.148  1.00  0.80           N  
ATOM   2506  NH2 ARG A 310      48.450  50.524  49.070  1.00  0.80           N  
ATOM   2507  N   ARG A 311      51.077  51.520  45.849  1.00  0.80           N  
ATOM   2508  CA  ARG A 311      50.174  50.472  45.424  1.00  0.80           C  
ATOM   2509  C   ARG A 311      50.670  49.689  44.219  1.00  0.80           C  
ATOM   2510  O   ARG A 311      50.415  48.494  44.104  1.00  0.80           O  
ATOM   2511  CB  ARG A 311      48.780  51.086  45.193  1.00  0.80           C  
ATOM   2512  CG  ARG A 311      47.671  50.101  44.769  1.00  0.80           C  
ATOM   2513  CD  ARG A 311      46.235  50.608  45.002  1.00  0.80           C  
ATOM   2514  NE  ARG A 311      46.120  51.988  44.422  1.00  0.80           N  
ATOM   2515  CZ  ARG A 311      46.144  53.126  45.132  1.00  0.80           C  
ATOM   2516  NH1 ARG A 311      45.821  53.186  46.420  1.00  0.80           N  
ATOM   2517  NH2 ARG A 311      46.489  54.246  44.512  1.00  0.80           N  
ATOM   2518  N   PHE A 312      51.419  50.324  43.297  1.00  0.83           N  
ATOM   2519  CA  PHE A 312      52.094  49.629  42.216  1.00  0.83           C  
ATOM   2520  C   PHE A 312      53.163  48.644  42.717  1.00  0.83           C  
ATOM   2521  O   PHE A 312      53.176  47.475  42.325  1.00  0.83           O  
ATOM   2522  CB  PHE A 312      52.698  50.696  41.259  1.00  0.83           C  
ATOM   2523  CG  PHE A 312      53.494  50.066  40.158  1.00  0.83           C  
ATOM   2524  CD1 PHE A 312      52.854  49.430  39.085  1.00  0.83           C  
ATOM   2525  CD2 PHE A 312      54.894  50.019  40.258  1.00  0.83           C  
ATOM   2526  CE1 PHE A 312      53.608  48.727  38.138  1.00  0.83           C  
ATOM   2527  CE2 PHE A 312      55.646  49.323  39.308  1.00  0.83           C  
ATOM   2528  CZ  PHE A 312      54.999  48.672  38.251  1.00  0.83           C  
ATOM   2529  N   LYS A 313      54.044  49.085  43.648  1.00  0.75           N  
ATOM   2530  CA  LYS A 313      55.080  48.259  44.258  1.00  0.75           C  
ATOM   2531  C   LYS A 313      54.500  47.105  45.055  1.00  0.75           C  
ATOM   2532  O   LYS A 313      55.082  46.029  45.121  1.00  0.75           O  
ATOM   2533  CB  LYS A 313      56.036  49.067  45.183  1.00  0.75           C  
ATOM   2534  CG  LYS A 313      56.977  50.032  44.443  1.00  0.75           C  
ATOM   2535  CD  LYS A 313      57.952  50.765  45.389  1.00  0.75           C  
ATOM   2536  CE  LYS A 313      58.895  51.689  44.611  1.00  0.75           C  
ATOM   2537  NZ  LYS A 313      59.819  52.454  45.470  1.00  0.75           N  
ATOM   2538  N   ALA A 314      53.320  47.307  45.661  1.00  0.78           N  
ATOM   2539  CA  ALA A 314      52.648  46.290  46.434  1.00  0.78           C  
ATOM   2540  C   ALA A 314      51.685  45.453  45.609  1.00  0.78           C  
ATOM   2541  O   ALA A 314      50.925  44.659  46.148  1.00  0.78           O  
ATOM   2542  CB  ALA A 314      51.878  46.986  47.574  1.00  0.78           C  
ATOM   2543  N   SER A 315      51.675  45.592  44.273  1.00  0.74           N  
ATOM   2544  CA  SER A 315      50.781  44.809  43.439  1.00  0.74           C  
ATOM   2545  C   SER A 315      51.269  43.386  43.200  1.00  0.74           C  
ATOM   2546  O   SER A 315      52.431  43.060  43.405  1.00  0.74           O  
ATOM   2547  CB  SER A 315      50.450  45.531  42.111  1.00  0.74           C  
ATOM   2548  OG  SER A 315      51.503  45.465  41.149  1.00  0.74           O  
ATOM   2549  N   LYS A 316      50.376  42.474  42.759  1.00  0.63           N  
ATOM   2550  CA  LYS A 316      50.631  41.037  42.713  1.00  0.63           C  
ATOM   2551  C   LYS A 316      51.798  40.577  41.834  1.00  0.63           C  
ATOM   2552  O   LYS A 316      52.507  39.636  42.175  1.00  0.63           O  
ATOM   2553  CB  LYS A 316      49.345  40.289  42.279  1.00  0.63           C  
ATOM   2554  CG  LYS A 316      48.922  39.132  43.203  1.00  0.63           C  
ATOM   2555  CD  LYS A 316      47.779  38.347  42.540  1.00  0.63           C  
ATOM   2556  CE  LYS A 316      47.104  37.272  43.400  1.00  0.63           C  
ATOM   2557  NZ  LYS A 316      46.068  36.622  42.582  1.00  0.63           N  
ATOM   2558  N   PHE A 317      52.006  41.225  40.668  1.00  0.53           N  
ATOM   2559  CA  PHE A 317      53.157  40.976  39.807  1.00  0.53           C  
ATOM   2560  C   PHE A 317      54.139  42.135  39.955  1.00  0.53           C  
ATOM   2561  O   PHE A 317      55.173  42.221  39.298  1.00  0.53           O  
ATOM   2562  CB  PHE A 317      52.670  40.849  38.331  1.00  0.53           C  
ATOM   2563  CG  PHE A 317      53.759  40.419  37.375  1.00  0.53           C  
ATOM   2564  CD1 PHE A 317      54.155  41.258  36.318  1.00  0.53           C  
ATOM   2565  CD2 PHE A 317      54.410  39.186  37.541  1.00  0.53           C  
ATOM   2566  CE1 PHE A 317      55.195  40.882  35.457  1.00  0.53           C  
ATOM   2567  CE2 PHE A 317      55.451  38.806  36.683  1.00  0.53           C  
ATOM   2568  CZ  PHE A 317      55.846  39.657  35.643  1.00  0.53           C  
ATOM   2569  N   GLY A 318      53.811  43.086  40.844  1.00  0.58           N  
ATOM   2570  CA  GLY A 318      54.650  44.226  41.155  1.00  0.58           C  
ATOM   2571  C   GLY A 318      55.917  43.891  41.912  1.00  0.58           C  
ATOM   2572  O   GLY A 318      56.044  42.866  42.574  1.00  0.58           O  
ATOM   2573  N   SER A 319      56.895  44.813  41.885  1.00  0.56           N  
ATOM   2574  CA  SER A 319      58.186  44.652  42.539  1.00  0.56           C  
ATOM   2575  C   SER A 319      59.086  43.477  42.168  1.00  0.56           C  
ATOM   2576  O   SER A 319      58.924  42.785  41.167  1.00  0.56           O  
ATOM   2577  CB  SER A 319      58.058  44.828  44.078  1.00  0.56           C  
ATOM   2578  OG  SER A 319      59.265  45.295  44.695  1.00  0.56           O  
ATOM   2579  N   THR A 320      60.155  43.296  42.960  1.00  0.49           N  
ATOM   2580  CA  THR A 320      61.166  42.260  42.786  1.00  0.49           C  
ATOM   2581  C   THR A 320      62.061  42.444  41.570  1.00  0.49           C  
ATOM   2582  O   THR A 320      61.699  42.958  40.512  1.00  0.49           O  
ATOM   2583  CB  THR A 320      60.662  40.809  42.756  1.00  0.49           C  
ATOM   2584  OG1 THR A 320      59.413  40.658  43.407  1.00  0.49           O  
ATOM   2585  CG2 THR A 320      61.628  39.903  43.528  1.00  0.49           C  
ATOM   2586  N   ARG A 321      63.302  41.938  41.672  1.00  0.44           N  
ATOM   2587  CA  ARG A 321      64.124  41.598  40.522  1.00  0.44           C  
ATOM   2588  C   ARG A 321      63.621  40.363  39.806  1.00  0.44           C  
ATOM   2589  O   ARG A 321      64.084  39.238  39.965  1.00  0.44           O  
ATOM   2590  CB  ARG A 321      65.628  41.445  40.838  1.00  0.44           C  
ATOM   2591  CG  ARG A 321      66.532  41.256  39.591  1.00  0.44           C  
ATOM   2592  CD  ARG A 321      66.559  42.451  38.629  1.00  0.44           C  
ATOM   2593  NE  ARG A 321      67.370  42.039  37.440  1.00  0.44           N  
ATOM   2594  CZ  ARG A 321      67.804  42.896  36.505  1.00  0.44           C  
ATOM   2595  NH1 ARG A 321      67.521  44.192  36.562  1.00  0.44           N  
ATOM   2596  NH2 ARG A 321      68.526  42.426  35.490  1.00  0.44           N  
ATOM   2597  N   GLY A 322      62.629  40.627  38.964  1.00  0.54           N  
ATOM   2598  CA  GLY A 322      62.000  39.664  38.081  1.00  0.54           C  
ATOM   2599  C   GLY A 322      61.322  40.406  36.973  1.00  0.54           C  
ATOM   2600  O   GLY A 322      61.328  39.997  35.820  1.00  0.54           O  
ATOM   2601  N   ALA A 323      60.811  41.597  37.325  1.00  0.54           N  
ATOM   2602  CA  ALA A 323      60.490  42.697  36.444  1.00  0.54           C  
ATOM   2603  C   ALA A 323      61.675  43.220  35.624  1.00  0.54           C  
ATOM   2604  O   ALA A 323      61.520  43.691  34.505  1.00  0.54           O  
ATOM   2605  CB  ALA A 323      59.959  43.826  37.345  1.00  0.54           C  
ATOM   2606  N   GLY A 324      62.903  43.164  36.189  1.00  0.55           N  
ATOM   2607  CA  GLY A 324      64.085  43.806  35.629  1.00  0.55           C  
ATOM   2608  C   GLY A 324      64.280  45.100  36.353  1.00  0.55           C  
ATOM   2609  O   GLY A 324      64.990  45.142  37.360  1.00  0.55           O  
ATOM   2610  N   THR A 325      63.602  46.157  35.883  1.00  0.59           N  
ATOM   2611  CA  THR A 325      63.342  47.370  36.642  1.00  0.59           C  
ATOM   2612  C   THR A 325      61.882  47.279  36.986  1.00  0.59           C  
ATOM   2613  O   THR A 325      61.036  47.028  36.136  1.00  0.59           O  
ATOM   2614  CB  THR A 325      63.569  48.660  35.857  1.00  0.59           C  
ATOM   2615  OG1 THR A 325      64.960  48.884  35.685  1.00  0.59           O  
ATOM   2616  CG2 THR A 325      63.007  49.912  36.548  1.00  0.59           C  
ATOM   2617  N   VAL A 326      61.496  47.478  38.261  1.00  0.68           N  
ATOM   2618  CA  VAL A 326      60.117  47.266  38.693  1.00  0.68           C  
ATOM   2619  C   VAL A 326      59.108  48.143  37.975  1.00  0.68           C  
ATOM   2620  O   VAL A 326      57.958  47.773  37.774  1.00  0.68           O  
ATOM   2621  CB  VAL A 326      59.963  47.349  40.202  1.00  0.68           C  
ATOM   2622  CG1 VAL A 326      60.792  46.205  40.814  1.00  0.68           C  
ATOM   2623  CG2 VAL A 326      60.403  48.716  40.754  1.00  0.68           C  
ATOM   2624  N   PHE A 327      59.556  49.309  37.493  1.00  0.79           N  
ATOM   2625  CA  PHE A 327      58.748  50.251  36.765  1.00  0.79           C  
ATOM   2626  C   PHE A 327      58.734  50.050  35.259  1.00  0.79           C  
ATOM   2627  O   PHE A 327      58.118  50.848  34.560  1.00  0.79           O  
ATOM   2628  CB  PHE A 327      59.272  51.677  37.026  1.00  0.79           C  
ATOM   2629  CG  PHE A 327      59.189  51.974  38.488  1.00  0.79           C  
ATOM   2630  CD1 PHE A 327      60.346  52.031  39.282  1.00  0.79           C  
ATOM   2631  CD2 PHE A 327      57.937  52.205  39.079  1.00  0.79           C  
ATOM   2632  CE1 PHE A 327      60.255  52.360  40.636  1.00  0.79           C  
ATOM   2633  CE2 PHE A 327      57.844  52.553  40.430  1.00  0.79           C  
ATOM   2634  CZ  PHE A 327      59.007  52.643  41.199  1.00  0.79           C  
ATOM   2635  N   ASP A 328      59.327  48.970  34.702  1.00  0.79           N  
ATOM   2636  CA  ASP A 328      59.229  48.670  33.277  1.00  0.79           C  
ATOM   2637  C   ASP A 328      57.777  48.485  32.838  1.00  0.79           C  
ATOM   2638  O   ASP A 328      57.348  49.016  31.818  1.00  0.79           O  
ATOM   2639  CB  ASP A 328      60.055  47.404  32.913  1.00  0.79           C  
ATOM   2640  CG  ASP A 328      61.527  47.731  32.769  1.00  0.79           C  
ATOM   2641  OD1 ASP A 328      61.816  48.706  32.022  1.00  0.79           O  
ATOM   2642  OD2 ASP A 328      62.387  47.040  33.367  1.00  0.79           O  
ATOM   2643  N   ALA A 329      56.969  47.798  33.666  1.00  0.83           N  
ATOM   2644  CA  ALA A 329      55.565  47.565  33.405  1.00  0.83           C  
ATOM   2645  C   ALA A 329      54.641  48.587  34.064  1.00  0.83           C  
ATOM   2646  O   ALA A 329      53.428  48.399  34.147  1.00  0.83           O  
ATOM   2647  CB  ALA A 329      55.225  46.151  33.905  1.00  0.83           C  
ATOM   2648  N   PHE A 330      55.182  49.729  34.539  1.00  0.85           N  
ATOM   2649  CA  PHE A 330      54.391  50.792  35.145  1.00  0.85           C  
ATOM   2650  C   PHE A 330      53.299  51.380  34.241  1.00  0.85           C  
ATOM   2651  O   PHE A 330      52.153  51.403  34.692  1.00  0.85           O  
ATOM   2652  CB  PHE A 330      55.339  51.899  35.689  1.00  0.85           C  
ATOM   2653  CG  PHE A 330      54.637  52.969  36.482  1.00  0.85           C  
ATOM   2654  CD1 PHE A 330      54.329  52.760  37.833  1.00  0.85           C  
ATOM   2655  CD2 PHE A 330      54.298  54.196  35.891  1.00  0.85           C  
ATOM   2656  CE1 PHE A 330      53.702  53.757  38.589  1.00  0.85           C  
ATOM   2657  CE2 PHE A 330      53.674  55.200  36.644  1.00  0.85           C  
ATOM   2658  CZ  PHE A 330      53.378  54.982  37.995  1.00  0.85           C  
ATOM   2659  N   PRO A 331      53.486  51.787  32.983  1.00  0.94           N  
ATOM   2660  CA  PRO A 331      52.400  52.345  32.177  1.00  0.94           C  
ATOM   2661  C   PRO A 331      51.417  51.297  31.711  1.00  0.94           C  
ATOM   2662  O   PRO A 331      50.426  51.634  31.062  1.00  0.94           O  
ATOM   2663  CB  PRO A 331      53.132  52.972  30.990  1.00  0.94           C  
ATOM   2664  CG  PRO A 331      54.408  52.146  30.843  1.00  0.94           C  
ATOM   2665  CD  PRO A 331      54.781  51.898  32.298  1.00  0.94           C  
ATOM   2666  N   ASP A 332      51.676  50.017  31.994  1.00  0.88           N  
ATOM   2667  CA  ASP A 332      50.826  48.934  31.580  1.00  0.88           C  
ATOM   2668  C   ASP A 332      50.016  48.442  32.782  1.00  0.88           C  
ATOM   2669  O   ASP A 332      49.090  47.645  32.654  1.00  0.88           O  
ATOM   2670  CB  ASP A 332      51.729  47.870  30.920  1.00  0.88           C  
ATOM   2671  CG  ASP A 332      52.558  48.560  29.833  1.00  0.88           C  
ATOM   2672  OD1 ASP A 332      51.984  49.216  28.916  1.00  0.88           O  
ATOM   2673  OD2 ASP A 332      53.806  48.529  29.958  1.00  0.88           O  
ATOM   2674  N   GLN A 333      50.295  48.998  33.982  1.00  0.86           N  
ATOM   2675  CA  GLN A 333      49.509  48.802  35.189  1.00  0.86           C  
ATOM   2676  C   GLN A 333      48.896  50.096  35.710  1.00  0.86           C  
ATOM   2677  O   GLN A 333      47.975  50.075  36.525  1.00  0.86           O  
ATOM   2678  CB  GLN A 333      50.415  48.236  36.302  1.00  0.86           C  
ATOM   2679  CG  GLN A 333      50.907  46.800  36.022  1.00  0.86           C  
ATOM   2680  CD  GLN A 333      49.748  45.810  36.111  1.00  0.86           C  
ATOM   2681  OE1 GLN A 333      49.163  45.623  37.177  1.00  0.86           O  
ATOM   2682  NE2 GLN A 333      49.401  45.164  34.976  1.00  0.86           N  
ATOM   2683  N   VAL A 334      49.363  51.262  35.230  1.00  0.94           N  
ATOM   2684  CA  VAL A 334      48.911  52.568  35.680  1.00  0.94           C  
ATOM   2685  C   VAL A 334      48.515  53.430  34.488  1.00  0.94           C  
ATOM   2686  O   VAL A 334      49.234  53.532  33.498  1.00  0.94           O  
ATOM   2687  CB  VAL A 334      50.010  53.272  36.482  1.00  0.94           C  
ATOM   2688  CG1 VAL A 334      49.608  54.693  36.918  1.00  0.94           C  
ATOM   2689  CG2 VAL A 334      50.352  52.429  37.728  1.00  0.94           C  
ATOM   2690  N   ALA A 335      47.335  54.079  34.545  1.00  0.96           N  
ATOM   2691  CA  ALA A 335      46.984  55.175  33.661  1.00  0.96           C  
ATOM   2692  C   ALA A 335      46.615  56.360  34.528  1.00  0.96           C  
ATOM   2693  O   ALA A 335      45.884  56.203  35.504  1.00  0.96           O  
ATOM   2694  CB  ALA A 335      45.768  54.853  32.766  1.00  0.96           C  
ATOM   2695  N   ILE A 336      47.105  57.577  34.218  1.00  0.95           N  
ATOM   2696  CA  ILE A 336      46.737  58.767  34.976  1.00  0.95           C  
ATOM   2697  C   ILE A 336      46.140  59.809  34.046  1.00  0.95           C  
ATOM   2698  O   ILE A 336      46.794  60.331  33.145  1.00  0.95           O  
ATOM   2699  CB  ILE A 336      47.892  59.375  35.776  1.00  0.95           C  
ATOM   2700  CG1 ILE A 336      48.561  58.308  36.678  1.00  0.95           C  
ATOM   2701  CG2 ILE A 336      47.351  60.552  36.621  1.00  0.95           C  
ATOM   2702  CD1 ILE A 336      49.798  58.797  37.439  1.00  0.95           C  
ATOM   2703  N   GLN A 337      44.856  60.159  34.255  1.00  0.95           N  
ATOM   2704  CA  GLN A 337      44.183  61.151  33.439  1.00  0.95           C  
ATOM   2705  C   GLN A 337      44.264  62.517  34.086  1.00  0.95           C  
ATOM   2706  O   GLN A 337      43.793  62.734  35.202  1.00  0.95           O  
ATOM   2707  CB  GLN A 337      42.695  60.792  33.200  1.00  0.95           C  
ATOM   2708  CG  GLN A 337      41.983  61.642  32.113  1.00  0.95           C  
ATOM   2709  CD  GLN A 337      42.560  61.370  30.721  1.00  0.95           C  
ATOM   2710  OE1 GLN A 337      42.840  60.229  30.367  1.00  0.95           O  
ATOM   2711  NE2 GLN A 337      42.723  62.427  29.897  1.00  0.95           N  
ATOM   2712  N   LEU A 338      44.863  63.479  33.371  1.00  0.95           N  
ATOM   2713  CA  LEU A 338      44.987  64.861  33.775  1.00  0.95           C  
ATOM   2714  C   LEU A 338      43.746  65.611  33.328  1.00  0.95           C  
ATOM   2715  O   LEU A 338      43.595  65.987  32.164  1.00  0.95           O  
ATOM   2716  CB  LEU A 338      46.258  65.507  33.142  1.00  0.95           C  
ATOM   2717  CG  LEU A 338      47.540  65.541  34.008  1.00  0.95           C  
ATOM   2718  CD1 LEU A 338      47.674  64.368  34.988  1.00  0.95           C  
ATOM   2719  CD2 LEU A 338      48.784  65.617  33.111  1.00  0.95           C  
ATOM   2720  N   ASN A 339      42.808  65.838  34.270  1.00  0.94           N  
ATOM   2721  CA  ASN A 339      41.621  66.635  34.034  1.00  0.94           C  
ATOM   2722  C   ASN A 339      41.978  68.114  34.122  1.00  0.94           C  
ATOM   2723  O   ASN A 339      42.280  68.623  35.201  1.00  0.94           O  
ATOM   2724  CB  ASN A 339      40.539  66.261  35.085  1.00  0.94           C  
ATOM   2725  CG  ASN A 339      39.133  66.692  34.697  1.00  0.94           C  
ATOM   2726  OD1 ASN A 339      38.697  66.512  33.558  1.00  0.94           O  
ATOM   2727  ND2 ASN A 339      38.354  67.192  35.680  1.00  0.94           N  
ATOM   2728  N   ASP A 340      41.950  68.810  32.968  1.00  0.91           N  
ATOM   2729  CA  ASP A 340      42.496  70.141  32.768  1.00  0.91           C  
ATOM   2730  C   ASP A 340      43.999  70.287  33.080  1.00  0.91           C  
ATOM   2731  O   ASP A 340      44.737  69.306  33.187  1.00  0.91           O  
ATOM   2732  CB  ASP A 340      41.617  71.205  33.477  1.00  0.91           C  
ATOM   2733  CG  ASP A 340      41.419  72.394  32.560  1.00  0.91           C  
ATOM   2734  OD1 ASP A 340      42.446  72.992  32.159  1.00  0.91           O  
ATOM   2735  OD2 ASP A 340      40.253  72.680  32.196  1.00  0.91           O  
ATOM   2736  N   THR A 341      44.526  71.523  33.187  1.00  0.92           N  
ATOM   2737  CA  THR A 341      45.966  71.718  33.402  1.00  0.92           C  
ATOM   2738  C   THR A 341      46.362  71.822  34.856  1.00  0.92           C  
ATOM   2739  O   THR A 341      47.546  71.738  35.169  1.00  0.92           O  
ATOM   2740  CB  THR A 341      46.601  72.874  32.662  1.00  0.92           C  
ATOM   2741  OG1 THR A 341      45.918  74.079  32.960  1.00  0.92           O  
ATOM   2742  CG2 THR A 341      46.511  72.603  31.150  1.00  0.92           C  
ATOM   2743  N   HIS A 342      45.396  71.885  35.793  1.00  0.89           N  
ATOM   2744  CA  HIS A 342      45.662  71.961  37.228  1.00  0.89           C  
ATOM   2745  C   HIS A 342      46.533  70.826  37.799  1.00  0.89           C  
ATOM   2746  O   HIS A 342      47.309  71.083  38.716  1.00  0.89           O  
ATOM   2747  CB  HIS A 342      44.360  72.076  38.065  1.00  0.89           C  
ATOM   2748  CG  HIS A 342      43.298  72.936  37.446  1.00  0.89           C  
ATOM   2749  ND1 HIS A 342      41.995  72.470  37.337  1.00  0.89           N  
ATOM   2750  CD2 HIS A 342      43.417  74.140  36.839  1.00  0.89           C  
ATOM   2751  CE1 HIS A 342      41.360  73.402  36.648  1.00  0.89           C  
ATOM   2752  NE2 HIS A 342      42.174  74.433  36.324  1.00  0.89           N  
ATOM   2753  N   PRO A 343      46.534  69.568  37.339  1.00  0.97           N  
ATOM   2754  CA  PRO A 343      47.465  68.588  37.893  1.00  0.97           C  
ATOM   2755  C   PRO A 343      48.629  68.370  36.937  1.00  0.97           C  
ATOM   2756  O   PRO A 343      49.251  67.309  36.975  1.00  0.97           O  
ATOM   2757  CB  PRO A 343      46.583  67.336  38.024  1.00  0.97           C  
ATOM   2758  CG  PRO A 343      45.603  67.427  36.853  1.00  0.97           C  
ATOM   2759  CD  PRO A 343      45.359  68.927  36.725  1.00  0.97           C  
ATOM   2760  N   ALA A 344      49.027  69.388  36.140  1.00  0.96           N  
ATOM   2761  CA  ALA A 344      50.169  69.353  35.232  1.00  0.96           C  
ATOM   2762  C   ALA A 344      51.498  69.042  35.896  1.00  0.96           C  
ATOM   2763  O   ALA A 344      52.371  68.386  35.327  1.00  0.96           O  
ATOM   2764  CB  ALA A 344      50.315  70.708  34.521  1.00  0.96           C  
ATOM   2765  N   LEU A 345      51.659  69.475  37.161  1.00  0.94           N  
ATOM   2766  CA  LEU A 345      52.811  69.205  38.003  1.00  0.94           C  
ATOM   2767  C   LEU A 345      53.083  67.717  38.228  1.00  0.94           C  
ATOM   2768  O   LEU A 345      54.178  67.334  38.634  1.00  0.94           O  
ATOM   2769  CB  LEU A 345      52.627  69.942  39.357  1.00  0.94           C  
ATOM   2770  CG  LEU A 345      53.403  71.274  39.496  1.00  0.94           C  
ATOM   2771  CD1 LEU A 345      53.378  72.150  38.238  1.00  0.94           C  
ATOM   2772  CD2 LEU A 345      52.845  72.085  40.672  1.00  0.94           C  
ATOM   2773  N   ALA A 346      52.122  66.823  37.907  1.00  0.97           N  
ATOM   2774  CA  ALA A 346      52.310  65.389  37.941  1.00  0.97           C  
ATOM   2775  C   ALA A 346      53.419  64.884  37.027  1.00  0.97           C  
ATOM   2776  O   ALA A 346      54.168  63.978  37.384  1.00  0.97           O  
ATOM   2777  CB  ALA A 346      50.978  64.676  37.644  1.00  0.97           C  
ATOM   2778  N   ILE A 347      53.572  65.485  35.834  1.00  0.94           N  
ATOM   2779  CA  ILE A 347      54.630  65.143  34.895  1.00  0.94           C  
ATOM   2780  C   ILE A 347      56.042  65.451  35.420  1.00  0.94           C  
ATOM   2781  O   ILE A 347      56.869  64.536  35.383  1.00  0.94           O  
ATOM   2782  CB  ILE A 347      54.332  65.764  33.529  1.00  0.94           C  
ATOM   2783  CG1 ILE A 347      53.037  65.163  32.941  1.00  0.94           C  
ATOM   2784  CG2 ILE A 347      55.507  65.574  32.546  1.00  0.94           C  
ATOM   2785  CD1 ILE A 347      52.361  66.097  31.939  1.00  0.94           C  
ATOM   2786  N   PRO A 348      56.413  66.616  35.978  1.00  0.97           N  
ATOM   2787  CA  PRO A 348      57.716  66.786  36.615  1.00  0.97           C  
ATOM   2788  C   PRO A 348      57.863  65.984  37.887  1.00  0.97           C  
ATOM   2789  O   PRO A 348      58.956  65.491  38.147  1.00  0.97           O  
ATOM   2790  CB  PRO A 348      57.835  68.295  36.880  1.00  0.97           C  
ATOM   2791  CG  PRO A 348      56.920  68.917  35.829  1.00  0.97           C  
ATOM   2792  CD  PRO A 348      55.779  67.912  35.734  1.00  0.97           C  
ATOM   2793  N   GLU A 349      56.800  65.831  38.699  1.00  0.93           N  
ATOM   2794  CA  GLU A 349      56.874  65.052  39.924  1.00  0.93           C  
ATOM   2795  C   GLU A 349      57.137  63.575  39.707  1.00  0.93           C  
ATOM   2796  O   GLU A 349      58.002  62.986  40.350  1.00  0.93           O  
ATOM   2797  CB  GLU A 349      55.611  65.263  40.790  1.00  0.93           C  
ATOM   2798  CG  GLU A 349      55.559  64.482  42.137  1.00  0.93           C  
ATOM   2799  CD  GLU A 349      56.664  64.808  43.134  1.00  0.93           C  
ATOM   2800  OE1 GLU A 349      57.533  65.669  42.853  1.00  0.93           O  
ATOM   2801  OE2 GLU A 349      56.693  64.187  44.229  1.00  0.93           O  
ATOM   2802  N   LEU A 350      56.463  62.924  38.737  1.00  0.95           N  
ATOM   2803  CA  LEU A 350      56.736  61.533  38.414  1.00  0.95           C  
ATOM   2804  C   LEU A 350      58.164  61.332  37.918  1.00  0.95           C  
ATOM   2805  O   LEU A 350      58.859  60.396  38.310  1.00  0.95           O  
ATOM   2806  CB  LEU A 350      55.700  60.985  37.406  1.00  0.95           C  
ATOM   2807  CG  LEU A 350      55.778  59.463  37.164  1.00  0.95           C  
ATOM   2808  CD1 LEU A 350      55.612  58.644  38.454  1.00  0.95           C  
ATOM   2809  CD2 LEU A 350      54.732  59.017  36.134  1.00  0.95           C  
ATOM   2810  N   MET A 351      58.671  62.286  37.111  1.00  0.92           N  
ATOM   2811  CA  MET A 351      60.075  62.352  36.753  1.00  0.92           C  
ATOM   2812  C   MET A 351      61.015  62.518  37.940  1.00  0.92           C  
ATOM   2813  O   MET A 351      62.034  61.838  38.024  1.00  0.92           O  
ATOM   2814  CB  MET A 351      60.322  63.511  35.761  1.00  0.92           C  
ATOM   2815  CG  MET A 351      59.780  63.220  34.355  1.00  0.92           C  
ATOM   2816  SD  MET A 351      60.516  61.754  33.590  1.00  0.92           S  
ATOM   2817  CE  MET A 351      62.196  62.401  33.374  1.00  0.92           C  
ATOM   2818  N   ARG A 352      60.683  63.389  38.909  1.00  0.89           N  
ATOM   2819  CA  ARG A 352      61.436  63.552  40.139  1.00  0.89           C  
ATOM   2820  C   ARG A 352      61.501  62.285  40.988  1.00  0.89           C  
ATOM   2821  O   ARG A 352      62.559  61.899  41.482  1.00  0.89           O  
ATOM   2822  CB  ARG A 352      60.823  64.696  40.979  1.00  0.89           C  
ATOM   2823  CG  ARG A 352      61.742  65.166  42.119  1.00  0.89           C  
ATOM   2824  CD  ARG A 352      61.093  66.195  43.044  1.00  0.89           C  
ATOM   2825  NE  ARG A 352      59.986  65.525  43.790  1.00  0.89           N  
ATOM   2826  CZ  ARG A 352      60.123  64.737  44.859  1.00  0.89           C  
ATOM   2827  NH1 ARG A 352      61.314  64.439  45.373  1.00  0.89           N  
ATOM   2828  NH2 ARG A 352      59.037  64.230  45.431  1.00  0.89           N  
ATOM   2829  N   ILE A 353      60.371  61.565  41.149  1.00  0.92           N  
ATOM   2830  CA  ILE A 353      60.342  60.281  41.838  1.00  0.92           C  
ATOM   2831  C   ILE A 353      61.183  59.236  41.112  1.00  0.92           C  
ATOM   2832  O   ILE A 353      62.042  58.585  41.704  1.00  0.92           O  
ATOM   2833  CB  ILE A 353      58.913  59.763  42.023  1.00  0.92           C  
ATOM   2834  CG1 ILE A 353      58.040  60.769  42.812  1.00  0.92           C  
ATOM   2835  CG2 ILE A 353      58.936  58.405  42.765  1.00  0.92           C  
ATOM   2836  CD1 ILE A 353      56.536  60.502  42.668  1.00  0.92           C  
ATOM   2837  N   PHE A 354      61.012  59.089  39.784  1.00  0.91           N  
ATOM   2838  CA  PHE A 354      61.777  58.133  39.003  1.00  0.91           C  
ATOM   2839  C   PHE A 354      63.278  58.397  38.956  1.00  0.91           C  
ATOM   2840  O   PHE A 354      64.079  57.485  39.159  1.00  0.91           O  
ATOM   2841  CB  PHE A 354      61.248  58.056  37.542  1.00  0.91           C  
ATOM   2842  CG  PHE A 354      59.948  57.305  37.371  1.00  0.91           C  
ATOM   2843  CD1 PHE A 354      59.173  57.580  36.229  1.00  0.91           C  
ATOM   2844  CD2 PHE A 354      59.514  56.286  38.244  1.00  0.91           C  
ATOM   2845  CE1 PHE A 354      58.003  56.859  35.959  1.00  0.91           C  
ATOM   2846  CE2 PHE A 354      58.339  55.574  37.981  1.00  0.91           C  
ATOM   2847  CZ  PHE A 354      57.589  55.851  36.836  1.00  0.91           C  
ATOM   2848  N   VAL A 355      63.707  59.647  38.707  1.00  0.90           N  
ATOM   2849  CA  VAL A 355      65.123  59.958  38.557  1.00  0.90           C  
ATOM   2850  C   VAL A 355      65.832  60.113  39.896  1.00  0.90           C  
ATOM   2851  O   VAL A 355      66.820  59.433  40.167  1.00  0.90           O  
ATOM   2852  CB  VAL A 355      65.330  61.207  37.693  1.00  0.90           C  
ATOM   2853  CG1 VAL A 355      66.831  61.527  37.530  1.00  0.90           C  
ATOM   2854  CG2 VAL A 355      64.709  60.959  36.303  1.00  0.90           C  
ATOM   2855  N   ASP A 356      65.332  60.980  40.800  1.00  0.90           N  
ATOM   2856  CA  ASP A 356      66.036  61.295  42.032  1.00  0.90           C  
ATOM   2857  C   ASP A 356      65.890  60.208  43.100  1.00  0.90           C  
ATOM   2858  O   ASP A 356      66.844  59.850  43.793  1.00  0.90           O  
ATOM   2859  CB  ASP A 356      65.577  62.664  42.613  1.00  0.90           C  
ATOM   2860  CG  ASP A 356      65.766  63.807  41.632  1.00  0.90           C  
ATOM   2861  OD1 ASP A 356      64.969  64.784  41.702  1.00  0.90           O  
ATOM   2862  OD2 ASP A 356      66.712  63.786  40.809  1.00  0.90           O  
ATOM   2863  N   ILE A 357      64.670  59.657  43.275  1.00  0.88           N  
ATOM   2864  CA  ILE A 357      64.391  58.688  44.332  1.00  0.88           C  
ATOM   2865  C   ILE A 357      64.618  57.257  43.882  1.00  0.88           C  
ATOM   2866  O   ILE A 357      65.325  56.489  44.538  1.00  0.88           O  
ATOM   2867  CB  ILE A 357      62.984  58.868  44.901  1.00  0.88           C  
ATOM   2868  CG1 ILE A 357      62.888  60.235  45.621  1.00  0.88           C  
ATOM   2869  CG2 ILE A 357      62.629  57.719  45.876  1.00  0.88           C  
ATOM   2870  CD1 ILE A 357      61.449  60.725  45.813  1.00  0.88           C  
ATOM   2871  N   GLU A 358      64.058  56.828  42.738  1.00  0.82           N  
ATOM   2872  CA  GLU A 358      64.207  55.447  42.302  1.00  0.82           C  
ATOM   2873  C   GLU A 358      65.546  55.187  41.606  1.00  0.82           C  
ATOM   2874  O   GLU A 358      66.066  54.076  41.658  1.00  0.82           O  
ATOM   2875  CB  GLU A 358      63.008  54.994  41.443  1.00  0.82           C  
ATOM   2876  CG  GLU A 358      61.632  55.192  42.152  1.00  0.82           C  
ATOM   2877  CD  GLU A 358      61.301  54.306  43.356  1.00  0.82           C  
ATOM   2878  OE1 GLU A 358      60.303  54.625  44.060  1.00  0.82           O  
ATOM   2879  OE2 GLU A 358      61.941  53.256  43.609  1.00  0.82           O  
ATOM   2880  N   LYS A 359      66.204  56.237  41.060  1.00  0.81           N  
ATOM   2881  CA  LYS A 359      67.489  56.195  40.352  1.00  0.81           C  
ATOM   2882  C   LYS A 359      67.378  55.572  38.968  1.00  0.81           C  
ATOM   2883  O   LYS A 359      68.255  54.846  38.501  1.00  0.81           O  
ATOM   2884  CB  LYS A 359      68.712  55.597  41.126  1.00  0.81           C  
ATOM   2885  CG  LYS A 359      69.402  56.528  42.141  1.00  0.81           C  
ATOM   2886  CD  LYS A 359      68.588  56.964  43.370  1.00  0.81           C  
ATOM   2887  CE  LYS A 359      68.438  55.911  44.474  1.00  0.81           C  
ATOM   2888  NZ  LYS A 359      67.447  54.886  44.099  1.00  0.81           N  
ATOM   2889  N   LEU A 360      66.293  55.882  38.244  1.00  0.82           N  
ATOM   2890  CA  LEU A 360      66.139  55.475  36.866  1.00  0.82           C  
ATOM   2891  C   LEU A 360      66.813  56.484  35.942  1.00  0.82           C  
ATOM   2892  O   LEU A 360      66.776  57.683  36.230  1.00  0.82           O  
ATOM   2893  CB  LEU A 360      64.645  55.340  36.480  1.00  0.82           C  
ATOM   2894  CG  LEU A 360      63.862  54.329  37.342  1.00  0.82           C  
ATOM   2895  CD1 LEU A 360      62.397  54.252  36.889  1.00  0.82           C  
ATOM   2896  CD2 LEU A 360      64.500  52.935  37.320  1.00  0.82           C  
ATOM   2897  N   PRO A 361      67.450  56.092  34.832  1.00  0.85           N  
ATOM   2898  CA  PRO A 361      67.902  57.011  33.791  1.00  0.85           C  
ATOM   2899  C   PRO A 361      66.845  58.000  33.340  1.00  0.85           C  
ATOM   2900  O   PRO A 361      65.689  57.613  33.185  1.00  0.85           O  
ATOM   2901  CB  PRO A 361      68.371  56.095  32.647  1.00  0.85           C  
ATOM   2902  CG  PRO A 361      68.725  54.778  33.341  1.00  0.85           C  
ATOM   2903  CD  PRO A 361      67.695  54.697  34.463  1.00  0.85           C  
ATOM   2904  N   TRP A 362      67.212  59.274  33.087  1.00  0.83           N  
ATOM   2905  CA  TRP A 362      66.259  60.320  32.742  1.00  0.83           C  
ATOM   2906  C   TRP A 362      65.435  59.978  31.509  1.00  0.83           C  
ATOM   2907  O   TRP A 362      64.217  60.130  31.486  1.00  0.83           O  
ATOM   2908  CB  TRP A 362      67.014  61.664  32.516  1.00  0.83           C  
ATOM   2909  CG  TRP A 362      66.169  62.927  32.559  1.00  0.83           C  
ATOM   2910  CD1 TRP A 362      66.066  63.822  33.590  1.00  0.83           C  
ATOM   2911  CD2 TRP A 362      65.291  63.430  31.519  1.00  0.83           C  
ATOM   2912  NE1 TRP A 362      65.194  64.845  33.270  1.00  0.83           N  
ATOM   2913  CE2 TRP A 362      64.704  64.596  32.005  1.00  0.83           C  
ATOM   2914  CE3 TRP A 362      64.979  62.938  30.245  1.00  0.83           C  
ATOM   2915  CZ2 TRP A 362      63.775  65.313  31.254  1.00  0.83           C  
ATOM   2916  CZ3 TRP A 362      63.991  63.619  29.514  1.00  0.83           C  
ATOM   2917  CH2 TRP A 362      63.402  64.787  30.005  1.00  0.83           C  
ATOM   2918  N   SER A 363      66.088  59.448  30.456  1.00  0.84           N  
ATOM   2919  CA  SER A 363      65.423  59.020  29.234  1.00  0.84           C  
ATOM   2920  C   SER A 363      64.405  57.922  29.457  1.00  0.84           C  
ATOM   2921  O   SER A 363      63.274  58.011  28.996  1.00  0.84           O  
ATOM   2922  CB  SER A 363      66.443  58.490  28.200  1.00  0.84           C  
ATOM   2923  OG  SER A 363      67.475  59.456  27.988  1.00  0.84           O  
ATOM   2924  N   LYS A 364      64.778  56.902  30.256  1.00  0.80           N  
ATOM   2925  CA  LYS A 364      63.917  55.802  30.647  1.00  0.80           C  
ATOM   2926  C   LYS A 364      62.715  56.245  31.465  1.00  0.80           C  
ATOM   2927  O   LYS A 364      61.584  55.823  31.245  1.00  0.80           O  
ATOM   2928  CB  LYS A 364      64.747  54.793  31.480  1.00  0.80           C  
ATOM   2929  CG  LYS A 364      63.954  53.611  32.055  1.00  0.80           C  
ATOM   2930  CD  LYS A 364      63.267  52.783  30.959  1.00  0.80           C  
ATOM   2931  CE  LYS A 364      62.456  51.638  31.549  1.00  0.80           C  
ATOM   2932  NZ  LYS A 364      61.882  50.794  30.489  1.00  0.80           N  
ATOM   2933  N   ALA A 365      62.925  57.156  32.429  1.00  0.90           N  
ATOM   2934  CA  ALA A 365      61.861  57.768  33.189  1.00  0.90           C  
ATOM   2935  C   ALA A 365      60.887  58.554  32.315  1.00  0.90           C  
ATOM   2936  O   ALA A 365      59.673  58.464  32.478  1.00  0.90           O  
ATOM   2937  CB  ALA A 365      62.492  58.676  34.258  1.00  0.90           C  
ATOM   2938  N   TRP A 366      61.395  59.317  31.329  1.00  0.86           N  
ATOM   2939  CA  TRP A 366      60.589  60.053  30.374  1.00  0.86           C  
ATOM   2940  C   TRP A 366      59.722  59.171  29.478  1.00  0.86           C  
ATOM   2941  O   TRP A 366      58.550  59.473  29.243  1.00  0.86           O  
ATOM   2942  CB  TRP A 366      61.498  61.011  29.565  1.00  0.86           C  
ATOM   2943  CG  TRP A 366      60.780  61.972  28.644  1.00  0.86           C  
ATOM   2944  CD1 TRP A 366      60.826  62.041  27.281  1.00  0.86           C  
ATOM   2945  CD2 TRP A 366      59.837  62.983  29.062  1.00  0.86           C  
ATOM   2946  NE1 TRP A 366      59.972  63.021  26.814  1.00  0.86           N  
ATOM   2947  CE2 TRP A 366      59.353  63.597  27.905  1.00  0.86           C  
ATOM   2948  CE3 TRP A 366      59.391  63.366  30.329  1.00  0.86           C  
ATOM   2949  CZ2 TRP A 366      58.394  64.603  27.968  1.00  0.86           C  
ATOM   2950  CZ3 TRP A 366      58.410  64.367  30.399  1.00  0.86           C  
ATOM   2951  CH2 TRP A 366      57.922  64.977  29.239  1.00  0.86           C  
ATOM   2952  N   GLU A 367      60.251  58.023  29.002  1.00  0.85           N  
ATOM   2953  CA  GLU A 367      59.482  57.021  28.278  1.00  0.85           C  
ATOM   2954  C   GLU A 367      58.310  56.483  29.094  1.00  0.85           C  
ATOM   2955  O   GLU A 367      57.173  56.414  28.625  1.00  0.85           O  
ATOM   2956  CB  GLU A 367      60.378  55.805  27.944  1.00  0.85           C  
ATOM   2957  CG  GLU A 367      61.528  56.068  26.943  1.00  0.85           C  
ATOM   2958  CD  GLU A 367      62.568  54.944  26.970  1.00  0.85           C  
ATOM   2959  OE1 GLU A 367      62.433  53.998  27.796  1.00  0.85           O  
ATOM   2960  OE2 GLU A 367      63.532  55.044  26.172  1.00  0.85           O  
ATOM   2961  N   LEU A 368      58.558  56.134  30.374  1.00  0.90           N  
ATOM   2962  CA  LEU A 368      57.534  55.678  31.295  1.00  0.90           C  
ATOM   2963  C   LEU A 368      56.489  56.740  31.607  1.00  0.90           C  
ATOM   2964  O   LEU A 368      55.291  56.473  31.584  1.00  0.90           O  
ATOM   2965  CB  LEU A 368      58.172  55.219  32.627  1.00  0.90           C  
ATOM   2966  CG  LEU A 368      59.161  54.042  32.516  1.00  0.90           C  
ATOM   2967  CD1 LEU A 368      59.840  53.840  33.877  1.00  0.90           C  
ATOM   2968  CD2 LEU A 368      58.482  52.750  32.049  1.00  0.90           C  
ATOM   2969  N   THR A 369      56.928  57.987  31.872  1.00  0.92           N  
ATOM   2970  CA  THR A 369      56.073  59.131  32.183  1.00  0.92           C  
ATOM   2971  C   THR A 369      55.103  59.461  31.075  1.00  0.92           C  
ATOM   2972  O   THR A 369      53.904  59.580  31.320  1.00  0.92           O  
ATOM   2973  CB  THR A 369      56.914  60.363  32.510  1.00  0.92           C  
ATOM   2974  OG1 THR A 369      57.562  60.155  33.757  1.00  0.92           O  
ATOM   2975  CG2 THR A 369      56.095  61.648  32.674  1.00  0.92           C  
ATOM   2976  N   GLN A 370      55.567  59.532  29.808  1.00  0.89           N  
ATOM   2977  CA  GLN A 370      54.695  59.823  28.679  1.00  0.89           C  
ATOM   2978  C   GLN A 370      53.595  58.791  28.470  1.00  0.89           C  
ATOM   2979  O   GLN A 370      52.461  59.146  28.189  1.00  0.89           O  
ATOM   2980  CB  GLN A 370      55.485  59.982  27.360  1.00  0.89           C  
ATOM   2981  CG  GLN A 370      56.376  61.246  27.300  1.00  0.89           C  
ATOM   2982  CD  GLN A 370      57.191  61.248  26.008  1.00  0.89           C  
ATOM   2983  OE1 GLN A 370      56.952  61.987  25.055  1.00  0.89           O  
ATOM   2984  NE2 GLN A 370      58.206  60.355  25.959  1.00  0.89           N  
ATOM   2985  N   LYS A 371      53.887  57.485  28.638  1.00  0.89           N  
ATOM   2986  CA  LYS A 371      52.899  56.428  28.460  1.00  0.89           C  
ATOM   2987  C   LYS A 371      51.884  56.325  29.601  1.00  0.89           C  
ATOM   2988  O   LYS A 371      50.866  55.642  29.485  1.00  0.89           O  
ATOM   2989  CB  LYS A 371      53.591  55.046  28.340  1.00  0.89           C  
ATOM   2990  CG  LYS A 371      54.448  54.827  27.089  1.00  0.89           C  
ATOM   2991  CD  LYS A 371      55.083  53.418  27.042  1.00  0.89           C  
ATOM   2992  CE  LYS A 371      54.194  52.250  26.543  1.00  0.89           C  
ATOM   2993  NZ  LYS A 371      53.232  51.718  27.551  1.00  0.89           N  
ATOM   2994  N   THR A 372      52.177  56.958  30.748  1.00  0.94           N  
ATOM   2995  CA  THR A 372      51.312  56.980  31.921  1.00  0.94           C  
ATOM   2996  C   THR A 372      50.267  58.068  31.852  1.00  0.94           C  
ATOM   2997  O   THR A 372      49.107  57.855  32.214  1.00  0.94           O  
ATOM   2998  CB  THR A 372      52.139  57.169  33.186  1.00  0.94           C  
ATOM   2999  OG1 THR A 372      52.831  55.963  33.469  1.00  0.94           O  
ATOM   3000  CG2 THR A 372      51.298  57.492  34.427  1.00  0.94           C  
ATOM   3001  N   PHE A 373      50.653  59.280  31.416  1.00  0.95           N  
ATOM   3002  CA  PHE A 373      49.784  60.437  31.471  1.00  0.95           C  
ATOM   3003  C   PHE A 373      48.969  60.659  30.209  1.00  0.95           C  
ATOM   3004  O   PHE A 373      49.419  60.494  29.079  1.00  0.95           O  
ATOM   3005  CB  PHE A 373      50.583  61.730  31.772  1.00  0.95           C  
ATOM   3006  CG  PHE A 373      51.080  61.744  33.191  1.00  0.95           C  
ATOM   3007  CD1 PHE A 373      52.451  61.685  33.485  1.00  0.95           C  
ATOM   3008  CD2 PHE A 373      50.167  61.851  34.251  1.00  0.95           C  
ATOM   3009  CE1 PHE A 373      52.898  61.712  34.813  1.00  0.95           C  
ATOM   3010  CE2 PHE A 373      50.610  61.873  35.579  1.00  0.95           C  
ATOM   3011  CZ  PHE A 373      51.977  61.794  35.861  1.00  0.95           C  
ATOM   3012  N   ALA A 374      47.716  61.094  30.395  1.00  0.97           N  
ATOM   3013  CA  ALA A 374      46.862  61.528  29.320  1.00  0.97           C  
ATOM   3014  C   ALA A 374      46.186  62.826  29.716  1.00  0.97           C  
ATOM   3015  O   ALA A 374      45.786  62.997  30.863  1.00  0.97           O  
ATOM   3016  CB  ALA A 374      45.828  60.444  29.015  1.00  0.97           C  
ATOM   3017  N   TYR A 375      46.061  63.787  28.783  1.00  0.93           N  
ATOM   3018  CA  TYR A 375      45.630  65.148  29.070  1.00  0.93           C  
ATOM   3019  C   TYR A 375      44.260  65.460  28.477  1.00  0.93           C  
ATOM   3020  O   TYR A 375      43.998  65.263  27.293  1.00  0.93           O  
ATOM   3021  CB  TYR A 375      46.710  66.135  28.517  1.00  0.93           C  
ATOM   3022  CG  TYR A 375      46.343  67.612  28.483  1.00  0.93           C  
ATOM   3023  CD1 TYR A 375      45.678  68.258  29.544  1.00  0.93           C  
ATOM   3024  CD2 TYR A 375      46.691  68.373  27.352  1.00  0.93           C  
ATOM   3025  CE1 TYR A 375      45.292  69.603  29.430  1.00  0.93           C  
ATOM   3026  CE2 TYR A 375      46.321  69.719  27.242  1.00  0.93           C  
ATOM   3027  CZ  TYR A 375      45.599  70.325  28.271  1.00  0.93           C  
ATOM   3028  OH  TYR A 375      45.206  71.670  28.123  1.00  0.93           O  
ATOM   3029  N   THR A 376      43.355  66.021  29.303  1.00  0.93           N  
ATOM   3030  CA  THR A 376      42.037  66.468  28.857  1.00  0.93           C  
ATOM   3031  C   THR A 376      41.969  67.979  28.823  1.00  0.93           C  
ATOM   3032  O   THR A 376      42.063  68.646  29.850  1.00  0.93           O  
ATOM   3033  CB  THR A 376      40.880  66.014  29.742  1.00  0.93           C  
ATOM   3034  OG1 THR A 376      40.860  64.601  29.849  1.00  0.93           O  
ATOM   3035  CG2 THR A 376      39.529  66.423  29.133  1.00  0.93           C  
ATOM   3036  N   ASN A 377      41.756  68.569  27.632  1.00  0.86           N  
ATOM   3037  CA  ASN A 377      41.591  69.998  27.452  1.00  0.86           C  
ATOM   3038  C   ASN A 377      40.113  70.374  27.499  1.00  0.86           C  
ATOM   3039  O   ASN A 377      39.330  69.980  26.634  1.00  0.86           O  
ATOM   3040  CB  ASN A 377      42.218  70.411  26.088  1.00  0.86           C  
ATOM   3041  CG  ASN A 377      42.037  71.893  25.768  1.00  0.86           C  
ATOM   3042  OD1 ASN A 377      41.013  72.291  25.216  1.00  0.86           O  
ATOM   3043  ND2 ASN A 377      43.022  72.733  26.143  1.00  0.86           N  
ATOM   3044  N   HIS A 378      39.709  71.190  28.495  1.00  0.83           N  
ATOM   3045  CA  HIS A 378      38.339  71.679  28.576  1.00  0.83           C  
ATOM   3046  C   HIS A 378      38.198  73.120  28.114  1.00  0.83           C  
ATOM   3047  O   HIS A 378      37.099  73.584  27.821  1.00  0.83           O  
ATOM   3048  CB  HIS A 378      37.850  71.647  30.037  1.00  0.83           C  
ATOM   3049  CG  HIS A 378      37.766  70.264  30.604  1.00  0.83           C  
ATOM   3050  ND1 HIS A 378      36.568  69.577  30.544  1.00  0.83           N  
ATOM   3051  CD2 HIS A 378      38.712  69.505  31.213  1.00  0.83           C  
ATOM   3052  CE1 HIS A 378      36.808  68.417  31.116  1.00  0.83           C  
ATOM   3053  NE2 HIS A 378      38.089  68.320  31.539  1.00  0.83           N  
ATOM   3054  N   THR A 379      39.314  73.868  28.006  1.00  0.74           N  
ATOM   3055  CA  THR A 379      39.301  75.277  27.624  1.00  0.74           C  
ATOM   3056  C   THR A 379      40.016  75.464  26.297  1.00  0.74           C  
ATOM   3057  O   THR A 379      41.212  75.223  26.136  1.00  0.74           O  
ATOM   3058  CB  THR A 379      39.828  76.231  28.704  1.00  0.74           C  
ATOM   3059  OG1 THR A 379      39.846  77.586  28.270  1.00  0.74           O  
ATOM   3060  CG2 THR A 379      41.241  75.871  29.185  1.00  0.74           C  
ATOM   3061  N   VAL A 380      39.247  75.894  25.276  1.00  0.70           N  
ATOM   3062  CA  VAL A 380      39.729  76.083  23.915  1.00  0.70           C  
ATOM   3063  C   VAL A 380      40.449  77.407  23.709  1.00  0.70           C  
ATOM   3064  O   VAL A 380      41.174  77.622  22.740  1.00  0.70           O  
ATOM   3065  CB  VAL A 380      38.563  75.986  22.929  1.00  0.70           C  
ATOM   3066  CG1 VAL A 380      37.642  77.224  22.943  1.00  0.70           C  
ATOM   3067  CG2 VAL A 380      39.088  75.682  21.516  1.00  0.70           C  
ATOM   3068  N   LEU A 381      40.265  78.364  24.633  1.00  0.64           N  
ATOM   3069  CA  LEU A 381      40.732  79.719  24.456  1.00  0.64           C  
ATOM   3070  C   LEU A 381      42.221  79.832  24.766  1.00  0.64           C  
ATOM   3071  O   LEU A 381      42.601  79.599  25.915  1.00  0.64           O  
ATOM   3072  CB  LEU A 381      39.907  80.654  25.375  1.00  0.64           C  
ATOM   3073  CG  LEU A 381      40.227  82.162  25.294  1.00  0.64           C  
ATOM   3074  CD1 LEU A 381      39.911  82.757  23.917  1.00  0.64           C  
ATOM   3075  CD2 LEU A 381      39.463  82.945  26.372  1.00  0.64           C  
ATOM   3076  N   PRO A 382      43.123  80.204  23.844  1.00  0.72           N  
ATOM   3077  CA  PRO A 382      44.561  80.213  24.103  1.00  0.72           C  
ATOM   3078  C   PRO A 382      44.945  81.253  25.132  1.00  0.72           C  
ATOM   3079  O   PRO A 382      45.977  81.111  25.782  1.00  0.72           O  
ATOM   3080  CB  PRO A 382      45.194  80.473  22.727  1.00  0.72           C  
ATOM   3081  CG  PRO A 382      44.089  81.155  21.918  1.00  0.72           C  
ATOM   3082  CD  PRO A 382      42.839  80.446  22.426  1.00  0.72           C  
ATOM   3083  N   GLU A 383      44.109  82.287  25.307  1.00  0.70           N  
ATOM   3084  CA  GLU A 383      44.250  83.318  26.312  1.00  0.70           C  
ATOM   3085  C   GLU A 383      43.971  82.807  27.727  1.00  0.70           C  
ATOM   3086  O   GLU A 383      44.394  83.376  28.728  1.00  0.70           O  
ATOM   3087  CB  GLU A 383      43.228  84.429  25.976  1.00  0.70           C  
ATOM   3088  CG  GLU A 383      43.645  85.826  26.476  1.00  0.70           C  
ATOM   3089  CD  GLU A 383      44.666  86.445  25.528  1.00  0.70           C  
ATOM   3090  OE1 GLU A 383      45.883  86.363  25.826  1.00  0.70           O  
ATOM   3091  OE2 GLU A 383      44.216  86.977  24.480  1.00  0.70           O  
ATOM   3092  N   ALA A 384      43.251  81.671  27.842  1.00  0.74           N  
ATOM   3093  CA  ALA A 384      42.856  81.095  29.110  1.00  0.74           C  
ATOM   3094  C   ALA A 384      43.584  79.798  29.405  1.00  0.74           C  
ATOM   3095  O   ALA A 384      43.191  79.033  30.283  1.00  0.74           O  
ATOM   3096  CB  ALA A 384      41.340  80.835  29.110  1.00  0.74           C  
ATOM   3097  N   LEU A 385      44.690  79.516  28.690  1.00  0.80           N  
ATOM   3098  CA  LEU A 385      45.590  78.449  29.084  1.00  0.80           C  
ATOM   3099  C   LEU A 385      46.404  78.864  30.293  1.00  0.80           C  
ATOM   3100  O   LEU A 385      46.935  79.967  30.359  1.00  0.80           O  
ATOM   3101  CB  LEU A 385      46.578  78.021  27.975  1.00  0.80           C  
ATOM   3102  CG  LEU A 385      45.922  77.554  26.666  1.00  0.80           C  
ATOM   3103  CD1 LEU A 385      47.005  77.275  25.614  1.00  0.80           C  
ATOM   3104  CD2 LEU A 385      45.025  76.323  26.860  1.00  0.80           C  
ATOM   3105  N   GLU A 386      46.517  77.980  31.289  1.00  0.83           N  
ATOM   3106  CA  GLU A 386      47.239  78.240  32.509  1.00  0.83           C  
ATOM   3107  C   GLU A 386      48.729  78.504  32.371  1.00  0.83           C  
ATOM   3108  O   GLU A 386      49.472  77.798  31.678  1.00  0.83           O  
ATOM   3109  CB  GLU A 386      46.981  77.032  33.394  1.00  0.83           C  
ATOM   3110  CG  GLU A 386      47.458  77.095  34.852  1.00  0.83           C  
ATOM   3111  CD  GLU A 386      46.594  76.098  35.615  1.00  0.83           C  
ATOM   3112  OE1 GLU A 386      46.701  74.874  35.341  1.00  0.83           O  
ATOM   3113  OE2 GLU A 386      45.709  76.582  36.361  1.00  0.83           O  
ATOM   3114  N   ARG A 387      49.189  79.576  33.046  1.00  0.78           N  
ATOM   3115  CA  ARG A 387      50.548  80.048  32.982  1.00  0.78           C  
ATOM   3116  C   ARG A 387      51.064  80.331  34.379  1.00  0.78           C  
ATOM   3117  O   ARG A 387      50.513  81.162  35.097  1.00  0.78           O  
ATOM   3118  CB  ARG A 387      50.687  81.361  32.158  1.00  0.78           C  
ATOM   3119  CG  ARG A 387      50.036  81.365  30.759  1.00  0.78           C  
ATOM   3120  CD  ARG A 387      50.677  80.399  29.759  1.00  0.78           C  
ATOM   3121  NE  ARG A 387      49.817  80.258  28.540  1.00  0.78           N  
ATOM   3122  CZ  ARG A 387      49.464  81.242  27.705  1.00  0.78           C  
ATOM   3123  NH1 ARG A 387      50.052  82.425  27.700  1.00  0.78           N  
ATOM   3124  NH2 ARG A 387      48.594  80.951  26.743  1.00  0.78           N  
ATOM   3125  N   TRP A 388      52.169  79.685  34.791  1.00  0.82           N  
ATOM   3126  CA  TRP A 388      52.781  79.956  36.080  1.00  0.82           C  
ATOM   3127  C   TRP A 388      54.046  80.775  35.875  1.00  0.82           C  
ATOM   3128  O   TRP A 388      54.818  80.425  34.985  1.00  0.82           O  
ATOM   3129  CB  TRP A 388      53.120  78.647  36.842  1.00  0.82           C  
ATOM   3130  CG  TRP A 388      51.893  77.980  37.444  1.00  0.82           C  
ATOM   3131  CD1 TRP A 388      51.284  76.794  37.143  1.00  0.82           C  
ATOM   3132  CD2 TRP A 388      51.128  78.565  38.502  1.00  0.82           C  
ATOM   3133  NE1 TRP A 388      50.156  76.631  37.914  1.00  0.82           N  
ATOM   3134  CE2 TRP A 388      50.025  77.707  38.737  1.00  0.82           C  
ATOM   3135  CE3 TRP A 388      51.303  79.721  39.245  1.00  0.82           C  
ATOM   3136  CZ2 TRP A 388      49.077  78.017  39.692  1.00  0.82           C  
ATOM   3137  CZ3 TRP A 388      50.349  80.022  40.217  1.00  0.82           C  
ATOM   3138  CH2 TRP A 388      49.245  79.189  40.432  1.00  0.82           C  
ATOM   3139  N   PRO A 389      54.333  81.866  36.595  1.00  0.88           N  
ATOM   3140  CA  PRO A 389      55.652  82.495  36.611  1.00  0.88           C  
ATOM   3141  C   PRO A 389      56.765  81.532  36.970  1.00  0.88           C  
ATOM   3142  O   PRO A 389      56.600  80.778  37.932  1.00  0.88           O  
ATOM   3143  CB  PRO A 389      55.530  83.632  37.640  1.00  0.88           C  
ATOM   3144  CG  PRO A 389      54.028  83.919  37.708  1.00  0.88           C  
ATOM   3145  CD  PRO A 389      53.418  82.533  37.519  1.00  0.88           C  
ATOM   3146  N   VAL A 390      57.906  81.531  36.251  1.00  0.88           N  
ATOM   3147  CA  VAL A 390      59.018  80.637  36.569  1.00  0.88           C  
ATOM   3148  C   VAL A 390      59.560  80.909  37.955  1.00  0.88           C  
ATOM   3149  O   VAL A 390      59.898  79.992  38.689  1.00  0.88           O  
ATOM   3150  CB  VAL A 390      60.176  80.647  35.573  1.00  0.88           C  
ATOM   3151  CG1 VAL A 390      59.662  80.307  34.165  1.00  0.88           C  
ATOM   3152  CG2 VAL A 390      60.939  81.981  35.579  1.00  0.88           C  
ATOM   3153  N   ASP A 391      59.562  82.191  38.346  1.00  0.85           N  
ATOM   3154  CA  ASP A 391      60.039  82.793  39.563  1.00  0.85           C  
ATOM   3155  C   ASP A 391      59.323  82.221  40.787  1.00  0.85           C  
ATOM   3156  O   ASP A 391      59.904  81.886  41.820  1.00  0.85           O  
ATOM   3157  CB  ASP A 391      59.766  84.332  39.460  1.00  0.85           C  
ATOM   3158  CG  ASP A 391      59.893  84.890  38.039  1.00  0.85           C  
ATOM   3159  OD1 ASP A 391      60.835  85.672  37.779  1.00  0.85           O  
ATOM   3160  OD2 ASP A 391      59.016  84.543  37.198  1.00  0.85           O  
ATOM   3161  N   LEU A 392      57.989  82.059  40.665  1.00  0.85           N  
ATOM   3162  CA  LEU A 392      57.153  81.426  41.665  1.00  0.85           C  
ATOM   3163  C   LEU A 392      57.424  79.933  41.802  1.00  0.85           C  
ATOM   3164  O   LEU A 392      57.557  79.400  42.904  1.00  0.85           O  
ATOM   3165  CB  LEU A 392      55.663  81.677  41.326  1.00  0.85           C  
ATOM   3166  CG  LEU A 392      54.657  81.234  42.408  1.00  0.85           C  
ATOM   3167  CD1 LEU A 392      54.869  81.967  43.734  1.00  0.85           C  
ATOM   3168  CD2 LEU A 392      53.219  81.463  41.930  1.00  0.85           C  
ATOM   3169  N   VAL A 393      57.564  79.220  40.665  1.00  0.89           N  
ATOM   3170  CA  VAL A 393      57.935  77.811  40.635  1.00  0.89           C  
ATOM   3171  C   VAL A 393      59.334  77.575  41.186  1.00  0.89           C  
ATOM   3172  O   VAL A 393      59.548  76.643  41.951  1.00  0.89           O  
ATOM   3173  CB  VAL A 393      57.794  77.207  39.240  1.00  0.89           C  
ATOM   3174  CG1 VAL A 393      58.132  75.701  39.249  1.00  0.89           C  
ATOM   3175  CG2 VAL A 393      56.342  77.393  38.760  1.00  0.89           C  
ATOM   3176  N   GLU A 394      60.309  78.443  40.858  1.00  0.86           N  
ATOM   3177  CA  GLU A 394      61.673  78.413  41.355  1.00  0.86           C  
ATOM   3178  C   GLU A 394      61.751  78.537  42.861  1.00  0.86           C  
ATOM   3179  O   GLU A 394      62.447  77.786  43.539  1.00  0.86           O  
ATOM   3180  CB  GLU A 394      62.479  79.582  40.734  1.00  0.86           C  
ATOM   3181  CG  GLU A 394      64.012  79.471  40.922  1.00  0.86           C  
ATOM   3182  CD  GLU A 394      64.802  80.471  40.075  1.00  0.86           C  
ATOM   3183  OE1 GLU A 394      64.212  81.100  39.160  1.00  0.86           O  
ATOM   3184  OE2 GLU A 394      66.029  80.578  40.329  1.00  0.86           O  
ATOM   3185  N   LYS A 395      60.984  79.481  43.442  1.00  0.85           N  
ATOM   3186  CA  LYS A 395      60.919  79.624  44.879  1.00  0.85           C  
ATOM   3187  C   LYS A 395      60.227  78.474  45.599  1.00  0.85           C  
ATOM   3188  O   LYS A 395      60.714  77.983  46.615  1.00  0.85           O  
ATOM   3189  CB  LYS A 395      60.216  80.955  45.255  1.00  0.85           C  
ATOM   3190  CG  LYS A 395      60.402  81.376  46.724  1.00  0.85           C  
ATOM   3191  CD  LYS A 395      61.876  81.677  47.044  1.00  0.85           C  
ATOM   3192  CE  LYS A 395      62.119  82.138  48.479  1.00  0.85           C  
ATOM   3193  NZ  LYS A 395      63.558  82.442  48.646  1.00  0.85           N  
ATOM   3194  N   LEU A 396      59.059  78.033  45.095  1.00  0.91           N  
ATOM   3195  CA  LEU A 396      58.252  77.020  45.746  1.00  0.91           C  
ATOM   3196  C   LEU A 396      58.691  75.589  45.490  1.00  0.91           C  
ATOM   3197  O   LEU A 396      58.710  74.773  46.407  1.00  0.91           O  
ATOM   3198  CB  LEU A 396      56.771  77.191  45.342  1.00  0.91           C  
ATOM   3199  CG  LEU A 396      55.782  76.287  46.106  1.00  0.91           C  
ATOM   3200  CD1 LEU A 396      55.700  76.656  47.591  1.00  0.91           C  
ATOM   3201  CD2 LEU A 396      54.399  76.352  45.456  1.00  0.91           C  
ATOM   3202  N   LEU A 397      59.061  75.239  44.247  1.00  0.91           N  
ATOM   3203  CA  LEU A 397      59.422  73.888  43.861  1.00  0.91           C  
ATOM   3204  C   LEU A 397      60.730  73.896  43.051  1.00  0.91           C  
ATOM   3205  O   LEU A 397      60.698  73.548  41.866  1.00  0.91           O  
ATOM   3206  CB  LEU A 397      58.347  73.213  42.949  1.00  0.91           C  
ATOM   3207  CG  LEU A 397      56.962  72.806  43.505  1.00  0.91           C  
ATOM   3208  CD1 LEU A 397      56.979  72.389  44.977  1.00  0.91           C  
ATOM   3209  CD2 LEU A 397      55.895  73.868  43.217  1.00  0.91           C  
ATOM   3210  N   PRO A 398      61.901  74.253  43.586  1.00  0.91           N  
ATOM   3211  CA  PRO A 398      63.124  74.511  42.812  1.00  0.91           C  
ATOM   3212  C   PRO A 398      63.583  73.355  41.932  1.00  0.91           C  
ATOM   3213  O   PRO A 398      63.951  73.569  40.779  1.00  0.91           O  
ATOM   3214  CB  PRO A 398      64.164  74.876  43.892  1.00  0.91           C  
ATOM   3215  CG  PRO A 398      63.630  74.243  45.179  1.00  0.91           C  
ATOM   3216  CD  PRO A 398      62.124  74.427  45.023  1.00  0.91           C  
ATOM   3217  N   ARG A 399      63.530  72.111  42.443  1.00  0.85           N  
ATOM   3218  CA  ARG A 399      63.859  70.888  41.724  1.00  0.85           C  
ATOM   3219  C   ARG A 399      62.961  70.657  40.513  1.00  0.85           C  
ATOM   3220  O   ARG A 399      63.391  70.226  39.446  1.00  0.85           O  
ATOM   3221  CB  ARG A 399      63.713  69.712  42.723  1.00  0.85           C  
ATOM   3222  CG  ARG A 399      64.062  68.291  42.219  1.00  0.85           C  
ATOM   3223  CD  ARG A 399      65.557  67.980  42.067  1.00  0.85           C  
ATOM   3224  NE  ARG A 399      65.993  68.385  40.698  1.00  0.85           N  
ATOM   3225  CZ  ARG A 399      66.246  67.557  39.677  1.00  0.85           C  
ATOM   3226  NH1 ARG A 399      65.907  66.277  39.652  1.00  0.85           N  
ATOM   3227  NH2 ARG A 399      66.912  68.084  38.649  1.00  0.85           N  
ATOM   3228  N   HIS A 400      61.660  70.977  40.646  1.00  0.91           N  
ATOM   3229  CA  HIS A 400      60.701  70.892  39.559  1.00  0.91           C  
ATOM   3230  C   HIS A 400      60.971  71.845  38.412  1.00  0.91           C  
ATOM   3231  O   HIS A 400      60.808  71.470  37.255  1.00  0.91           O  
ATOM   3232  CB  HIS A 400      59.259  71.097  40.044  1.00  0.91           C  
ATOM   3233  CG  HIS A 400      58.839  69.997  40.964  1.00  0.91           C  
ATOM   3234  ND1 HIS A 400      58.139  68.945  40.421  1.00  0.91           N  
ATOM   3235  CD2 HIS A 400      59.048  69.792  42.294  1.00  0.91           C  
ATOM   3236  CE1 HIS A 400      57.927  68.120  41.425  1.00  0.91           C  
ATOM   3237  NE2 HIS A 400      58.456  68.585  42.580  1.00  0.91           N  
ATOM   3238  N   LEU A 401      61.417  73.094  38.673  1.00  0.90           N  
ATOM   3239  CA  LEU A 401      61.781  74.021  37.609  1.00  0.90           C  
ATOM   3240  C   LEU A 401      62.947  73.528  36.758  1.00  0.90           C  
ATOM   3241  O   LEU A 401      62.911  73.616  35.530  1.00  0.90           O  
ATOM   3242  CB  LEU A 401      62.072  75.441  38.148  1.00  0.90           C  
ATOM   3243  CG  LEU A 401      62.245  76.502  37.036  1.00  0.90           C  
ATOM   3244  CD1 LEU A 401      61.016  76.608  36.120  1.00  0.90           C  
ATOM   3245  CD2 LEU A 401      62.545  77.879  37.626  1.00  0.90           C  
ATOM   3246  N   GLU A 402      63.976  72.910  37.386  1.00  0.87           N  
ATOM   3247  CA  GLU A 402      65.053  72.241  36.666  1.00  0.87           C  
ATOM   3248  C   GLU A 402      64.533  71.134  35.751  1.00  0.87           C  
ATOM   3249  O   GLU A 402      64.908  71.033  34.585  1.00  0.87           O  
ATOM   3250  CB  GLU A 402      66.066  71.542  37.615  1.00  0.87           C  
ATOM   3251  CG  GLU A 402      66.820  72.440  38.626  1.00  0.87           C  
ATOM   3252  CD  GLU A 402      67.791  71.604  39.454  1.00  0.87           C  
ATOM   3253  OE1 GLU A 402      68.960  72.011  39.658  1.00  0.87           O  
ATOM   3254  OE2 GLU A 402      67.364  70.495  39.878  1.00  0.87           O  
ATOM   3255  N   ILE A 403      63.608  70.290  36.257  1.00  0.91           N  
ATOM   3256  CA  ILE A 403      62.966  69.242  35.475  1.00  0.91           C  
ATOM   3257  C   ILE A 403      62.120  69.785  34.328  1.00  0.91           C  
ATOM   3258  O   ILE A 403      62.212  69.291  33.208  1.00  0.91           O  
ATOM   3259  CB  ILE A 403      62.178  68.273  36.357  1.00  0.91           C  
ATOM   3260  CG1 ILE A 403      63.155  67.549  37.316  1.00  0.91           C  
ATOM   3261  CG2 ILE A 403      61.395  67.251  35.498  1.00  0.91           C  
ATOM   3262  CD1 ILE A 403      62.476  66.578  38.287  1.00  0.91           C  
ATOM   3263  N   ILE A 404      61.317  70.852  34.538  1.00  0.91           N  
ATOM   3264  CA  ILE A 404      60.562  71.516  33.473  1.00  0.91           C  
ATOM   3265  C   ILE A 404      61.476  72.088  32.395  1.00  0.91           C  
ATOM   3266  O   ILE A 404      61.223  71.927  31.201  1.00  0.91           O  
ATOM   3267  CB  ILE A 404      59.628  72.607  34.013  1.00  0.91           C  
ATOM   3268  CG1 ILE A 404      58.538  71.984  34.918  1.00  0.91           C  
ATOM   3269  CG2 ILE A 404      58.955  73.389  32.857  1.00  0.91           C  
ATOM   3270  CD1 ILE A 404      57.728  73.009  35.723  1.00  0.91           C  
ATOM   3271  N   TYR A 405      62.597  72.734  32.774  1.00  0.89           N  
ATOM   3272  CA  TYR A 405      63.604  73.177  31.825  1.00  0.89           C  
ATOM   3273  C   TYR A 405      64.282  72.052  31.052  1.00  0.89           C  
ATOM   3274  O   TYR A 405      64.431  72.158  29.838  1.00  0.89           O  
ATOM   3275  CB  TYR A 405      64.697  74.037  32.517  1.00  0.89           C  
ATOM   3276  CG  TYR A 405      64.240  75.419  32.933  1.00  0.89           C  
ATOM   3277  CD1 TYR A 405      63.228  76.132  32.260  1.00  0.89           C  
ATOM   3278  CD2 TYR A 405      64.923  76.062  33.981  1.00  0.89           C  
ATOM   3279  CE1 TYR A 405      62.918  77.448  32.623  1.00  0.89           C  
ATOM   3280  CE2 TYR A 405      64.613  77.382  34.345  1.00  0.89           C  
ATOM   3281  CZ  TYR A 405      63.609  78.076  33.662  1.00  0.89           C  
ATOM   3282  OH  TYR A 405      63.295  79.404  34.022  1.00  0.89           O  
ATOM   3283  N   GLU A 406      64.674  70.941  31.704  1.00  0.86           N  
ATOM   3284  CA  GLU A 406      65.246  69.776  31.038  1.00  0.86           C  
ATOM   3285  C   GLU A 406      64.271  69.056  30.103  1.00  0.86           C  
ATOM   3286  O   GLU A 406      64.614  68.663  28.987  1.00  0.86           O  
ATOM   3287  CB  GLU A 406      65.879  68.814  32.076  1.00  0.86           C  
ATOM   3288  CG  GLU A 406      66.743  67.681  31.469  1.00  0.86           C  
ATOM   3289  CD  GLU A 406      67.867  68.219  30.590  1.00  0.86           C  
ATOM   3290  OE1 GLU A 406      68.434  69.284  30.913  1.00  0.86           O  
ATOM   3291  OE2 GLU A 406      68.174  67.515  29.589  1.00  0.86           O  
ATOM   3292  N   ILE A 407      62.982  68.930  30.504  1.00  0.91           N  
ATOM   3293  CA  ILE A 407      61.895  68.462  29.640  1.00  0.91           C  
ATOM   3294  C   ILE A 407      61.744  69.369  28.424  1.00  0.91           C  
ATOM   3295  O   ILE A 407      61.673  68.906  27.285  1.00  0.91           O  
ATOM   3296  CB  ILE A 407      60.561  68.377  30.406  1.00  0.91           C  
ATOM   3297  CG1 ILE A 407      60.582  67.200  31.413  1.00  0.91           C  
ATOM   3298  CG2 ILE A 407      59.358  68.226  29.444  1.00  0.91           C  
ATOM   3299  CD1 ILE A 407      59.377  67.168  32.365  1.00  0.91           C  
ATOM   3300  N   ASN A 408      61.754  70.703  28.636  1.00  0.89           N  
ATOM   3301  CA  ASN A 408      61.708  71.684  27.568  1.00  0.89           C  
ATOM   3302  C   ASN A 408      62.915  71.614  26.640  1.00  0.89           C  
ATOM   3303  O   ASN A 408      62.762  71.679  25.426  1.00  0.89           O  
ATOM   3304  CB  ASN A 408      61.554  73.117  28.149  1.00  0.89           C  
ATOM   3305  CG  ASN A 408      61.165  74.107  27.056  1.00  0.89           C  
ATOM   3306  OD1 ASN A 408      60.199  73.894  26.332  1.00  0.89           O  
ATOM   3307  ND2 ASN A 408      61.911  75.221  26.926  1.00  0.89           N  
ATOM   3308  N   GLN A 409      64.144  71.453  27.171  1.00  0.83           N  
ATOM   3309  CA  GLN A 409      65.347  71.377  26.360  1.00  0.83           C  
ATOM   3310  C   GLN A 409      65.304  70.214  25.380  1.00  0.83           C  
ATOM   3311  O   GLN A 409      65.420  70.387  24.173  1.00  0.83           O  
ATOM   3312  CB  GLN A 409      66.589  71.240  27.280  1.00  0.83           C  
ATOM   3313  CG  GLN A 409      67.921  71.723  26.643  1.00  0.83           C  
ATOM   3314  CD  GLN A 409      68.079  73.246  26.521  1.00  0.83           C  
ATOM   3315  OE1 GLN A 409      68.985  73.775  25.879  1.00  0.83           O  
ATOM   3316  NE2 GLN A 409      67.200  74.019  27.201  1.00  0.83           N  
ATOM   3317  N   LYS A 410      64.970  69.008  25.882  1.00  0.83           N  
ATOM   3318  CA  LYS A 410      64.805  67.829  25.055  1.00  0.83           C  
ATOM   3319  C   LYS A 410      63.665  67.921  24.049  1.00  0.83           C  
ATOM   3320  O   LYS A 410      63.750  67.395  22.938  1.00  0.83           O  
ATOM   3321  CB  LYS A 410      64.690  66.560  25.928  1.00  0.83           C  
ATOM   3322  CG  LYS A 410      65.978  66.324  26.732  1.00  0.83           C  
ATOM   3323  CD  LYS A 410      66.245  64.833  26.966  1.00  0.83           C  
ATOM   3324  CE  LYS A 410      67.595  64.536  27.625  1.00  0.83           C  
ATOM   3325  NZ  LYS A 410      67.639  65.074  28.995  1.00  0.83           N  
ATOM   3326  N   HIS A 411      62.561  68.611  24.399  1.00  0.85           N  
ATOM   3327  CA  HIS A 411      61.526  68.951  23.438  1.00  0.85           C  
ATOM   3328  C   HIS A 411      61.990  69.878  22.313  1.00  0.85           C  
ATOM   3329  O   HIS A 411      61.813  69.570  21.136  1.00  0.85           O  
ATOM   3330  CB  HIS A 411      60.349  69.622  24.181  1.00  0.85           C  
ATOM   3331  CG  HIS A 411      59.177  69.984  23.320  1.00  0.85           C  
ATOM   3332  ND1 HIS A 411      58.659  71.256  23.413  1.00  0.85           N  
ATOM   3333  CD2 HIS A 411      58.451  69.244  22.443  1.00  0.85           C  
ATOM   3334  CE1 HIS A 411      57.630  71.277  22.594  1.00  0.85           C  
ATOM   3335  NE2 HIS A 411      57.458  70.082  21.978  1.00  0.85           N  
ATOM   3336  N   LEU A 412      62.646  71.009  22.641  1.00  0.82           N  
ATOM   3337  CA  LEU A 412      63.139  71.971  21.668  1.00  0.82           C  
ATOM   3338  C   LEU A 412      64.265  71.463  20.779  1.00  0.82           C  
ATOM   3339  O   LEU A 412      64.265  71.706  19.569  1.00  0.82           O  
ATOM   3340  CB  LEU A 412      63.569  73.299  22.336  1.00  0.82           C  
ATOM   3341  CG  LEU A 412      62.441  74.085  23.042  1.00  0.82           C  
ATOM   3342  CD1 LEU A 412      62.943  75.479  23.442  1.00  0.82           C  
ATOM   3343  CD2 LEU A 412      61.172  74.223  22.190  1.00  0.82           C  
ATOM   3344  N   ASP A 413      65.221  70.692  21.334  1.00  0.80           N  
ATOM   3345  CA  ASP A 413      66.303  70.056  20.601  1.00  0.80           C  
ATOM   3346  C   ASP A 413      65.790  69.125  19.503  1.00  0.80           C  
ATOM   3347  O   ASP A 413      66.315  69.064  18.391  1.00  0.80           O  
ATOM   3348  CB  ASP A 413      67.204  69.251  21.570  1.00  0.80           C  
ATOM   3349  CG  ASP A 413      68.016  70.157  22.485  1.00  0.80           C  
ATOM   3350  OD1 ASP A 413      68.090  71.381  22.218  1.00  0.80           O  
ATOM   3351  OD2 ASP A 413      68.599  69.593  23.447  1.00  0.80           O  
ATOM   3352  N   ARG A 414      64.693  68.383  19.755  1.00  0.70           N  
ATOM   3353  CA  ARG A 414      64.075  67.593  18.709  1.00  0.70           C  
ATOM   3354  C   ARG A 414      63.245  68.385  17.716  1.00  0.70           C  
ATOM   3355  O   ARG A 414      63.071  67.945  16.582  1.00  0.70           O  
ATOM   3356  CB  ARG A 414      63.265  66.409  19.291  1.00  0.70           C  
ATOM   3357  CG  ARG A 414      64.132  65.154  19.524  1.00  0.70           C  
ATOM   3358  CD  ARG A 414      64.718  64.580  18.225  1.00  0.70           C  
ATOM   3359  NE  ARG A 414      65.438  63.309  18.554  1.00  0.70           N  
ATOM   3360  CZ  ARG A 414      64.878  62.093  18.523  1.00  0.70           C  
ATOM   3361  NH1 ARG A 414      63.581  61.924  18.289  1.00  0.70           N  
ATOM   3362  NH2 ARG A 414      65.637  61.022  18.742  1.00  0.70           N  
ATOM   3363  N   ILE A 415      62.761  69.592  18.062  1.00  0.76           N  
ATOM   3364  CA  ILE A 415      62.166  70.491  17.080  1.00  0.76           C  
ATOM   3365  C   ILE A 415      63.211  71.025  16.105  1.00  0.76           C  
ATOM   3366  O   ILE A 415      62.986  71.020  14.900  1.00  0.76           O  
ATOM   3367  CB  ILE A 415      61.334  71.601  17.708  1.00  0.76           C  
ATOM   3368  CG1 ILE A 415      60.185  70.984  18.535  1.00  0.76           C  
ATOM   3369  CG2 ILE A 415      60.750  72.538  16.621  1.00  0.76           C  
ATOM   3370  CD1 ILE A 415      59.495  72.005  19.439  1.00  0.76           C  
ATOM   3371  N   VAL A 416      64.430  71.415  16.549  1.00  0.74           N  
ATOM   3372  CA  VAL A 416      65.489  71.828  15.617  1.00  0.74           C  
ATOM   3373  C   VAL A 416      66.076  70.669  14.828  1.00  0.74           C  
ATOM   3374  O   VAL A 416      66.705  70.857  13.794  1.00  0.74           O  
ATOM   3375  CB  VAL A 416      66.645  72.630  16.214  1.00  0.74           C  
ATOM   3376  CG1 VAL A 416      66.088  73.876  16.903  1.00  0.74           C  
ATOM   3377  CG2 VAL A 416      67.499  71.818  17.200  1.00  0.74           C  
ATOM   3378  N   ALA A 417      65.822  69.417  15.246  1.00  0.74           N  
ATOM   3379  CA  ALA A 417      66.266  68.244  14.522  1.00  0.74           C  
ATOM   3380  C   ALA A 417      65.260  67.809  13.459  1.00  0.74           C  
ATOM   3381  O   ALA A 417      65.446  66.807  12.773  1.00  0.74           O  
ATOM   3382  CB  ALA A 417      66.485  67.107  15.534  1.00  0.74           C  
ATOM   3383  N   LEU A 418      64.189  68.600  13.273  1.00  0.73           N  
ATOM   3384  CA  LEU A 418      63.222  68.420  12.206  1.00  0.73           C  
ATOM   3385  C   LEU A 418      62.979  69.736  11.488  1.00  0.73           C  
ATOM   3386  O   LEU A 418      62.707  69.776  10.290  1.00  0.73           O  
ATOM   3387  CB  LEU A 418      61.884  67.919  12.800  1.00  0.73           C  
ATOM   3388  CG  LEU A 418      61.908  66.438  13.225  1.00  0.73           C  
ATOM   3389  CD1 LEU A 418      60.655  66.096  14.036  1.00  0.73           C  
ATOM   3390  CD2 LEU A 418      62.021  65.508  12.009  1.00  0.73           C  
ATOM   3391  N   PHE A 419      63.142  70.866  12.194  1.00  0.76           N  
ATOM   3392  CA  PHE A 419      62.911  72.196  11.677  1.00  0.76           C  
ATOM   3393  C   PHE A 419      64.125  73.100  11.928  1.00  0.76           C  
ATOM   3394  O   PHE A 419      63.965  74.135  12.575  1.00  0.76           O  
ATOM   3395  CB  PHE A 419      61.680  72.836  12.381  1.00  0.76           C  
ATOM   3396  CG  PHE A 419      60.420  72.039  12.186  1.00  0.76           C  
ATOM   3397  CD1 PHE A 419      60.062  71.028  13.093  1.00  0.76           C  
ATOM   3398  CD2 PHE A 419      59.558  72.325  11.116  1.00  0.76           C  
ATOM   3399  CE1 PHE A 419      58.884  70.293  12.920  1.00  0.76           C  
ATOM   3400  CE2 PHE A 419      58.375  71.596  10.940  1.00  0.76           C  
ATOM   3401  CZ  PHE A 419      58.041  70.574  11.838  1.00  0.76           C  
ATOM   3402  N   PRO A 420      65.352  72.829  11.455  1.00  0.75           N  
ATOM   3403  CA  PRO A 420      66.572  73.498  11.927  1.00  0.75           C  
ATOM   3404  C   PRO A 420      66.697  74.960  11.547  1.00  0.75           C  
ATOM   3405  O   PRO A 420      67.661  75.598  11.954  1.00  0.75           O  
ATOM   3406  CB  PRO A 420      67.712  72.672  11.293  1.00  0.75           C  
ATOM   3407  CG  PRO A 420      67.080  71.977  10.086  1.00  0.75           C  
ATOM   3408  CD  PRO A 420      65.668  71.694  10.582  1.00  0.75           C  
ATOM   3409  N   LYS A 421      65.777  75.515  10.741  1.00  0.74           N  
ATOM   3410  CA  LYS A 421      65.772  76.934  10.436  1.00  0.74           C  
ATOM   3411  C   LYS A 421      64.498  77.611  10.943  1.00  0.74           C  
ATOM   3412  O   LYS A 421      64.329  78.815  10.763  1.00  0.74           O  
ATOM   3413  CB  LYS A 421      65.900  77.179   8.902  1.00  0.74           C  
ATOM   3414  CG  LYS A 421      67.333  77.122   8.320  1.00  0.74           C  
ATOM   3415  CD  LYS A 421      67.997  75.736   8.204  1.00  0.74           C  
ATOM   3416  CE  LYS A 421      67.233  74.690   7.383  1.00  0.74           C  
ATOM   3417  NZ  LYS A 421      66.987  75.169   6.005  1.00  0.74           N  
ATOM   3418  N   ASP A 422      63.571  76.888  11.614  1.00  0.79           N  
ATOM   3419  CA  ASP A 422      62.322  77.479  12.077  1.00  0.79           C  
ATOM   3420  C   ASP A 422      62.483  77.967  13.513  1.00  0.79           C  
ATOM   3421  O   ASP A 422      62.151  77.314  14.505  1.00  0.79           O  
ATOM   3422  CB  ASP A 422      61.138  76.499  11.905  1.00  0.79           C  
ATOM   3423  CG  ASP A 422      59.770  77.154  12.037  1.00  0.79           C  
ATOM   3424  OD1 ASP A 422      58.775  76.472  11.672  1.00  0.79           O  
ATOM   3425  OD2 ASP A 422      59.674  78.291  12.572  1.00  0.79           O  
ATOM   3426  N   VAL A 423      63.038  79.182  13.624  1.00  0.80           N  
ATOM   3427  CA  VAL A 423      63.292  79.875  14.871  1.00  0.80           C  
ATOM   3428  C   VAL A 423      62.006  80.250  15.607  1.00  0.80           C  
ATOM   3429  O   VAL A 423      61.928  80.162  16.834  1.00  0.80           O  
ATOM   3430  CB  VAL A 423      64.192  81.086  14.634  1.00  0.80           C  
ATOM   3431  CG1 VAL A 423      64.572  81.765  15.965  1.00  0.80           C  
ATOM   3432  CG2 VAL A 423      65.476  80.619  13.916  1.00  0.80           C  
ATOM   3433  N   ASP A 424      60.937  80.664  14.881  1.00  0.83           N  
ATOM   3434  CA  ASP A 424      59.649  80.965  15.498  1.00  0.83           C  
ATOM   3435  C   ASP A 424      58.968  79.730  16.095  1.00  0.83           C  
ATOM   3436  O   ASP A 424      58.447  79.786  17.207  1.00  0.83           O  
ATOM   3437  CB  ASP A 424      58.688  81.754  14.561  1.00  0.83           C  
ATOM   3438  CG  ASP A 424      57.539  82.384  15.340  1.00  0.83           C  
ATOM   3439  OD1 ASP A 424      57.773  83.440  15.982  1.00  0.83           O  
ATOM   3440  OD2 ASP A 424      56.407  81.835  15.344  1.00  0.83           O  
ATOM   3441  N   ARG A 425      58.999  78.560  15.414  1.00  0.79           N  
ATOM   3442  CA  ARG A 425      58.406  77.327  15.926  1.00  0.79           C  
ATOM   3443  C   ARG A 425      58.954  76.891  17.273  1.00  0.79           C  
ATOM   3444  O   ARG A 425      58.203  76.439  18.133  1.00  0.79           O  
ATOM   3445  CB  ARG A 425      58.538  76.188  14.895  1.00  0.79           C  
ATOM   3446  CG  ARG A 425      57.665  74.937  15.120  1.00  0.79           C  
ATOM   3447  CD  ARG A 425      57.804  73.927  13.970  1.00  0.79           C  
ATOM   3448  NE  ARG A 425      56.755  72.858  14.130  1.00  0.79           N  
ATOM   3449  CZ  ARG A 425      55.677  72.714  13.353  1.00  0.79           C  
ATOM   3450  NH1 ARG A 425      55.314  73.589  12.424  1.00  0.79           N  
ATOM   3451  NH2 ARG A 425      54.866  71.677  13.529  1.00  0.79           N  
ATOM   3452  N   LEU A 426      60.264  77.087  17.539  1.00  0.82           N  
ATOM   3453  CA  LEU A 426      60.804  76.863  18.873  1.00  0.82           C  
ATOM   3454  C   LEU A 426      60.165  77.705  19.964  1.00  0.82           C  
ATOM   3455  O   LEU A 426      59.761  77.187  20.999  1.00  0.82           O  
ATOM   3456  CB  LEU A 426      62.319  77.185  18.960  1.00  0.82           C  
ATOM   3457  CG  LEU A 426      63.289  76.170  18.338  1.00  0.82           C  
ATOM   3458  CD1 LEU A 426      64.695  76.509  18.857  1.00  0.82           C  
ATOM   3459  CD2 LEU A 426      62.916  74.727  18.692  1.00  0.82           C  
ATOM   3460  N   ARG A 427      60.002  79.025  19.765  1.00  0.78           N  
ATOM   3461  CA  ARG A 427      59.460  79.874  20.814  1.00  0.78           C  
ATOM   3462  C   ARG A 427      57.944  79.753  20.919  1.00  0.78           C  
ATOM   3463  O   ARG A 427      57.326  80.220  21.870  1.00  0.78           O  
ATOM   3464  CB  ARG A 427      59.850  81.359  20.612  1.00  0.78           C  
ATOM   3465  CG  ARG A 427      59.221  82.001  19.365  1.00  0.78           C  
ATOM   3466  CD  ARG A 427      59.093  83.522  19.445  1.00  0.78           C  
ATOM   3467  NE  ARG A 427      57.962  83.888  18.547  1.00  0.78           N  
ATOM   3468  CZ  ARG A 427      56.668  83.844  18.885  1.00  0.78           C  
ATOM   3469  NH1 ARG A 427      56.268  83.625  20.132  1.00  0.78           N  
ATOM   3470  NH2 ARG A 427      55.780  83.985  17.907  1.00  0.78           N  
ATOM   3471  N   ARG A 428      57.305  79.142  19.907  1.00  0.81           N  
ATOM   3472  CA  ARG A 428      55.877  78.945  19.859  1.00  0.81           C  
ATOM   3473  C   ARG A 428      55.468  77.621  20.496  1.00  0.81           C  
ATOM   3474  O   ARG A 428      54.373  77.493  21.040  1.00  0.81           O  
ATOM   3475  CB  ARG A 428      55.494  79.021  18.366  1.00  0.81           C  
ATOM   3476  CG  ARG A 428      54.015  79.280  18.046  1.00  0.81           C  
ATOM   3477  CD  ARG A 428      53.816  79.732  16.590  1.00  0.81           C  
ATOM   3478  NE  ARG A 428      54.144  78.561  15.732  1.00  0.81           N  
ATOM   3479  CZ  ARG A 428      55.019  78.503  14.722  1.00  0.81           C  
ATOM   3480  NH1 ARG A 428      55.751  79.520  14.291  1.00  0.81           N  
ATOM   3481  NH2 ARG A 428      55.150  77.313  14.137  1.00  0.81           N  
ATOM   3482  N   MET A 429      56.379  76.624  20.498  1.00  0.87           N  
ATOM   3483  CA  MET A 429      56.149  75.330  21.119  1.00  0.87           C  
ATOM   3484  C   MET A 429      56.874  75.146  22.448  1.00  0.87           C  
ATOM   3485  O   MET A 429      56.680  74.140  23.125  1.00  0.87           O  
ATOM   3486  CB  MET A 429      56.637  74.204  20.172  1.00  0.87           C  
ATOM   3487  CG  MET A 429      55.828  74.086  18.866  1.00  0.87           C  
ATOM   3488  SD  MET A 429      56.355  72.719  17.781  1.00  0.87           S  
ATOM   3489  CE  MET A 429      55.741  71.369  18.819  1.00  0.87           C  
ATOM   3490  N   SER A 430      57.724  76.105  22.862  1.00  0.90           N  
ATOM   3491  CA  SER A 430      58.427  76.082  24.145  1.00  0.90           C  
ATOM   3492  C   SER A 430      57.504  76.082  25.345  1.00  0.90           C  
ATOM   3493  O   SER A 430      56.529  76.825  25.405  1.00  0.90           O  
ATOM   3494  CB  SER A 430      59.386  77.301  24.296  1.00  0.90           C  
ATOM   3495  OG  SER A 430      60.196  77.257  25.477  1.00  0.90           O  
ATOM   3496  N   LEU A 431      57.835  75.285  26.384  1.00  0.92           N  
ATOM   3497  CA  LEU A 431      57.099  75.270  27.632  1.00  0.92           C  
ATOM   3498  C   LEU A 431      57.204  76.595  28.365  1.00  0.92           C  
ATOM   3499  O   LEU A 431      56.327  76.954  29.142  1.00  0.92           O  
ATOM   3500  CB  LEU A 431      57.585  74.190  28.641  1.00  0.92           C  
ATOM   3501  CG  LEU A 431      57.677  72.734  28.142  1.00  0.92           C  
ATOM   3502  CD1 LEU A 431      57.827  71.798  29.349  1.00  0.92           C  
ATOM   3503  CD2 LEU A 431      56.476  72.309  27.298  1.00  0.92           C  
ATOM   3504  N   ILE A 432      58.301  77.340  28.145  1.00  0.90           N  
ATOM   3505  CA  ILE A 432      58.541  78.639  28.745  1.00  0.90           C  
ATOM   3506  C   ILE A 432      58.302  79.758  27.738  1.00  0.90           C  
ATOM   3507  O   ILE A 432      58.724  79.713  26.584  1.00  0.90           O  
ATOM   3508  CB  ILE A 432      59.926  78.760  29.398  1.00  0.90           C  
ATOM   3509  CG1 ILE A 432      60.227  80.203  29.879  1.00  0.90           C  
ATOM   3510  CG2 ILE A 432      61.009  78.259  28.423  1.00  0.90           C  
ATOM   3511  CD1 ILE A 432      61.538  80.369  30.646  1.00  0.90           C  
ATOM   3512  N   GLU A 433      57.596  80.814  28.190  1.00  0.83           N  
ATOM   3513  CA  GLU A 433      57.436  82.056  27.473  1.00  0.83           C  
ATOM   3514  C   GLU A 433      58.399  83.098  28.037  1.00  0.83           C  
ATOM   3515  O   GLU A 433      58.148  83.695  29.091  1.00  0.83           O  
ATOM   3516  CB  GLU A 433      56.005  82.630  27.650  1.00  0.83           C  
ATOM   3517  CG  GLU A 433      54.845  81.693  27.252  1.00  0.83           C  
ATOM   3518  CD  GLU A 433      53.481  82.307  27.525  1.00  0.83           C  
ATOM   3519  OE1 GLU A 433      53.357  83.522  27.837  1.00  0.83           O  
ATOM   3520  OE2 GLU A 433      52.493  81.544  27.453  1.00  0.83           O  
ATOM   3521  N   GLU A 434      59.526  83.363  27.352  1.00  0.76           N  
ATOM   3522  CA  GLU A 434      60.451  84.414  27.734  1.00  0.76           C  
ATOM   3523  C   GLU A 434      60.000  85.815  27.330  1.00  0.76           C  
ATOM   3524  O   GLU A 434      60.162  86.235  26.191  1.00  0.76           O  
ATOM   3525  CB  GLU A 434      61.866  84.163  27.155  1.00  0.76           C  
ATOM   3526  CG  GLU A 434      62.692  83.116  27.938  1.00  0.76           C  
ATOM   3527  CD  GLU A 434      62.595  81.673  27.463  1.00  0.76           C  
ATOM   3528  OE1 GLU A 434      61.771  81.357  26.574  1.00  0.76           O  
ATOM   3529  OE2 GLU A 434      63.375  80.877  28.058  1.00  0.76           O  
ATOM   3530  N   GLU A 435      59.461  86.581  28.302  1.00  0.70           N  
ATOM   3531  CA  GLU A 435      59.007  87.952  28.104  1.00  0.70           C  
ATOM   3532  C   GLU A 435      59.457  88.813  29.269  1.00  0.70           C  
ATOM   3533  O   GLU A 435      60.326  88.424  30.050  1.00  0.70           O  
ATOM   3534  CB  GLU A 435      57.459  87.998  28.025  1.00  0.70           C  
ATOM   3535  CG  GLU A 435      56.897  87.368  26.730  1.00  0.70           C  
ATOM   3536  CD  GLU A 435      57.184  88.195  25.476  1.00  0.70           C  
ATOM   3537  OE1 GLU A 435      57.572  89.384  25.617  1.00  0.70           O  
ATOM   3538  OE2 GLU A 435      56.964  87.641  24.369  1.00  0.70           O  
ATOM   3539  N   GLY A 436      58.837  90.006  29.465  1.00  0.67           N  
ATOM   3540  CA  GLY A 436      59.030  90.879  30.631  1.00  0.67           C  
ATOM   3541  C   GLY A 436      58.427  90.337  31.913  1.00  0.67           C  
ATOM   3542  O   GLY A 436      57.718  91.028  32.636  1.00  0.67           O  
ATOM   3543  N   SER A 437      58.711  89.055  32.166  1.00  0.79           N  
ATOM   3544  CA  SER A 437      58.255  88.138  33.188  1.00  0.79           C  
ATOM   3545  C   SER A 437      58.199  86.798  32.494  1.00  0.79           C  
ATOM   3546  O   SER A 437      57.620  86.636  31.418  1.00  0.79           O  
ATOM   3547  CB  SER A 437      56.913  88.417  33.934  1.00  0.79           C  
ATOM   3548  OG  SER A 437      55.755  88.394  33.091  1.00  0.79           O  
ATOM   3549  N   LYS A 438      58.865  85.783  33.058  1.00  0.83           N  
ATOM   3550  CA  LYS A 438      58.970  84.494  32.410  1.00  0.83           C  
ATOM   3551  C   LYS A 438      57.845  83.608  32.903  1.00  0.83           C  
ATOM   3552  O   LYS A 438      57.610  83.487  34.100  1.00  0.83           O  
ATOM   3553  CB  LYS A 438      60.314  83.807  32.735  1.00  0.83           C  
ATOM   3554  CG  LYS A 438      61.548  84.286  31.954  1.00  0.83           C  
ATOM   3555  CD  LYS A 438      62.786  83.464  32.369  1.00  0.83           C  
ATOM   3556  CE  LYS A 438      63.974  83.582  31.408  1.00  0.83           C  
ATOM   3557  NZ  LYS A 438      64.767  82.330  31.410  1.00  0.83           N  
ATOM   3558  N   ARG A 439      57.101  82.963  31.993  1.00  0.82           N  
ATOM   3559  CA  ARG A 439      55.970  82.140  32.385  1.00  0.82           C  
ATOM   3560  C   ARG A 439      56.111  80.753  31.799  1.00  0.82           C  
ATOM   3561  O   ARG A 439      56.776  80.559  30.790  1.00  0.82           O  
ATOM   3562  CB  ARG A 439      54.617  82.707  31.892  1.00  0.82           C  
ATOM   3563  CG  ARG A 439      54.034  83.909  32.679  1.00  0.82           C  
ATOM   3564  CD  ARG A 439      54.672  85.308  32.508  1.00  0.82           C  
ATOM   3565  NE  ARG A 439      55.072  85.617  31.094  1.00  0.82           N  
ATOM   3566  CZ  ARG A 439      54.355  85.454  29.978  1.00  0.82           C  
ATOM   3567  NH1 ARG A 439      53.077  85.099  29.972  1.00  0.82           N  
ATOM   3568  NH2 ARG A 439      54.952  85.528  28.794  1.00  0.82           N  
ATOM   3569  N   ILE A 440      55.469  79.748  32.417  1.00  0.91           N  
ATOM   3570  CA  ILE A 440      55.464  78.370  31.956  1.00  0.91           C  
ATOM   3571  C   ILE A 440      54.068  78.044  31.471  1.00  0.91           C  
ATOM   3572  O   ILE A 440      53.101  78.201  32.211  1.00  0.91           O  
ATOM   3573  CB  ILE A 440      55.818  77.375  33.063  1.00  0.91           C  
ATOM   3574  CG1 ILE A 440      57.136  77.775  33.757  1.00  0.91           C  
ATOM   3575  CG2 ILE A 440      55.899  75.940  32.485  1.00  0.91           C  
ATOM   3576  CD1 ILE A 440      57.437  76.952  35.012  1.00  0.91           C  
ATOM   3577  N   ASN A 441      53.910  77.570  30.221  1.00  0.91           N  
ATOM   3578  CA  ASN A 441      52.634  77.186  29.656  1.00  0.91           C  
ATOM   3579  C   ASN A 441      52.331  75.729  29.992  1.00  0.91           C  
ATOM   3580  O   ASN A 441      52.829  74.786  29.375  1.00  0.91           O  
ATOM   3581  CB  ASN A 441      52.612  77.474  28.122  1.00  0.91           C  
ATOM   3582  CG  ASN A 441      51.258  77.198  27.469  1.00  0.91           C  
ATOM   3583  OD1 ASN A 441      50.430  78.050  27.162  1.00  0.91           O  
ATOM   3584  ND2 ASN A 441      50.963  75.901  27.281  1.00  0.91           N  
ATOM   3585  N   MET A 442      51.434  75.516  30.971  1.00  0.93           N  
ATOM   3586  CA  MET A 442      51.117  74.209  31.518  1.00  0.93           C  
ATOM   3587  C   MET A 442      50.460  73.241  30.551  1.00  0.93           C  
ATOM   3588  O   MET A 442      50.718  72.042  30.583  1.00  0.93           O  
ATOM   3589  CB  MET A 442      50.301  74.331  32.820  1.00  0.93           C  
ATOM   3590  CG  MET A 442      50.946  75.280  33.850  1.00  0.93           C  
ATOM   3591  SD  MET A 442      52.745  75.068  34.098  1.00  0.93           S  
ATOM   3592  CE  MET A 442      52.674  73.695  35.278  1.00  0.93           C  
ATOM   3593  N   ALA A 443      49.628  73.728  29.610  1.00  0.94           N  
ATOM   3594  CA  ALA A 443      49.045  72.895  28.570  1.00  0.94           C  
ATOM   3595  C   ALA A 443      50.066  72.215  27.665  1.00  0.94           C  
ATOM   3596  O   ALA A 443      49.929  71.050  27.320  1.00  0.94           O  
ATOM   3597  CB  ALA A 443      48.069  73.727  27.717  1.00  0.94           C  
ATOM   3598  N   HIS A 444      51.147  72.917  27.289  1.00  0.89           N  
ATOM   3599  CA  HIS A 444      52.275  72.360  26.563  1.00  0.89           C  
ATOM   3600  C   HIS A 444      53.021  71.305  27.358  1.00  0.89           C  
ATOM   3601  O   HIS A 444      53.371  70.262  26.817  1.00  0.89           O  
ATOM   3602  CB  HIS A 444      53.303  73.436  26.168  1.00  0.89           C  
ATOM   3603  CG  HIS A 444      52.813  74.484  25.222  1.00  0.89           C  
ATOM   3604  ND1 HIS A 444      53.653  75.545  25.013  1.00  0.89           N  
ATOM   3605  CD2 HIS A 444      51.729  74.575  24.405  1.00  0.89           C  
ATOM   3606  CE1 HIS A 444      53.091  76.268  24.067  1.00  0.89           C  
ATOM   3607  NE2 HIS A 444      51.915  75.726  23.664  1.00  0.89           N  
ATOM   3608  N   LEU A 445      53.237  71.526  28.679  1.00  0.94           N  
ATOM   3609  CA  LEU A 445      53.827  70.542  29.582  1.00  0.94           C  
ATOM   3610  C   LEU A 445      52.992  69.267  29.611  1.00  0.94           C  
ATOM   3611  O   LEU A 445      53.504  68.158  29.466  1.00  0.94           O  
ATOM   3612  CB  LEU A 445      53.966  71.139  31.010  1.00  0.94           C  
ATOM   3613  CG  LEU A 445      54.488  70.188  32.113  1.00  0.94           C  
ATOM   3614  CD1 LEU A 445      55.926  69.709  31.860  1.00  0.94           C  
ATOM   3615  CD2 LEU A 445      54.389  70.880  33.481  1.00  0.94           C  
ATOM   3616  N   CYS A 446      51.657  69.418  29.695  1.00  0.95           N  
ATOM   3617  CA  CYS A 446      50.715  68.325  29.570  1.00  0.95           C  
ATOM   3618  C   CYS A 446      50.749  67.604  28.225  1.00  0.95           C  
ATOM   3619  O   CYS A 446      50.682  66.383  28.187  1.00  0.95           O  
ATOM   3620  CB  CYS A 446      49.267  68.777  29.860  1.00  0.95           C  
ATOM   3621  SG  CYS A 446      49.027  69.358  31.565  1.00  0.95           S  
ATOM   3622  N   ILE A 447      50.866  68.317  27.085  1.00  0.92           N  
ATOM   3623  CA  ILE A 447      51.015  67.728  25.750  1.00  0.92           C  
ATOM   3624  C   ILE A 447      52.327  66.973  25.550  1.00  0.92           C  
ATOM   3625  O   ILE A 447      52.340  65.862  25.015  1.00  0.92           O  
ATOM   3626  CB  ILE A 447      50.862  68.781  24.645  1.00  0.92           C  
ATOM   3627  CG1 ILE A 447      49.434  69.375  24.649  1.00  0.92           C  
ATOM   3628  CG2 ILE A 447      51.164  68.189  23.247  1.00  0.92           C  
ATOM   3629  CD1 ILE A 447      49.314  70.671  23.844  1.00  0.92           C  
ATOM   3630  N   VAL A 448      53.483  67.535  25.969  1.00  0.92           N  
ATOM   3631  CA  VAL A 448      54.766  66.846  25.847  1.00  0.92           C  
ATOM   3632  C   VAL A 448      54.868  65.640  26.767  1.00  0.92           C  
ATOM   3633  O   VAL A 448      55.411  64.607  26.393  1.00  0.92           O  
ATOM   3634  CB  VAL A 448      56.004  67.742  25.969  1.00  0.92           C  
ATOM   3635  CG1 VAL A 448      55.912  68.883  24.941  1.00  0.92           C  
ATOM   3636  CG2 VAL A 448      56.202  68.311  27.384  1.00  0.92           C  
ATOM   3637  N   GLY A 449      54.323  65.733  27.997  1.00  0.94           N  
ATOM   3638  CA  GLY A 449      54.409  64.678  29.000  1.00  0.94           C  
ATOM   3639  C   GLY A 449      53.342  63.624  28.975  1.00  0.94           C  
ATOM   3640  O   GLY A 449      53.326  62.771  29.854  1.00  0.94           O  
ATOM   3641  N   SER A 450      52.422  63.666  27.998  1.00  0.94           N  
ATOM   3642  CA  SER A 450      51.317  62.719  27.870  1.00  0.94           C  
ATOM   3643  C   SER A 450      51.391  61.998  26.548  1.00  0.94           C  
ATOM   3644  O   SER A 450      51.916  62.540  25.579  1.00  0.94           O  
ATOM   3645  CB  SER A 450      49.929  63.407  27.856  1.00  0.94           C  
ATOM   3646  OG  SER A 450      49.681  64.081  29.086  1.00  0.94           O  
ATOM   3647  N   HIS A 451      50.837  60.769  26.434  1.00  0.92           N  
ATOM   3648  CA  HIS A 451      50.765  60.062  25.159  1.00  0.92           C  
ATOM   3649  C   HIS A 451      49.490  60.375  24.406  1.00  0.92           C  
ATOM   3650  O   HIS A 451      49.366  60.080  23.220  1.00  0.92           O  
ATOM   3651  CB  HIS A 451      50.835  58.519  25.309  1.00  0.92           C  
ATOM   3652  CG  HIS A 451      49.660  57.882  25.995  1.00  0.92           C  
ATOM   3653  ND1 HIS A 451      49.548  58.020  27.354  1.00  0.92           N  
ATOM   3654  CD2 HIS A 451      48.612  57.164  25.509  1.00  0.92           C  
ATOM   3655  CE1 HIS A 451      48.444  57.391  27.686  1.00  0.92           C  
ATOM   3656  NE2 HIS A 451      47.831  56.850  26.605  1.00  0.92           N  
ATOM   3657  N   ALA A 452      48.519  61.013  25.075  1.00  0.96           N  
ATOM   3658  CA  ALA A 452      47.241  61.322  24.487  1.00  0.96           C  
ATOM   3659  C   ALA A 452      46.742  62.655  24.999  1.00  0.96           C  
ATOM   3660  O   ALA A 452      46.952  63.030  26.152  1.00  0.96           O  
ATOM   3661  CB  ALA A 452      46.211  60.229  24.819  1.00  0.96           C  
ATOM   3662  N   VAL A 453      46.081  63.416  24.116  1.00  0.94           N  
ATOM   3663  CA  VAL A 453      45.476  64.691  24.429  1.00  0.94           C  
ATOM   3664  C   VAL A 453      44.081  64.643  23.863  1.00  0.94           C  
ATOM   3665  O   VAL A 453      43.893  64.249  22.715  1.00  0.94           O  
ATOM   3666  CB  VAL A 453      46.213  65.863  23.788  1.00  0.94           C  
ATOM   3667  CG1 VAL A 453      45.507  67.203  24.092  1.00  0.94           C  
ATOM   3668  CG2 VAL A 453      47.661  65.893  24.304  1.00  0.94           C  
ATOM   3669  N   ASN A 454      43.040  65.036  24.614  1.00  0.90           N  
ATOM   3670  CA  ASN A 454      41.718  65.106  24.024  1.00  0.90           C  
ATOM   3671  C   ASN A 454      40.940  66.345  24.386  1.00  0.90           C  
ATOM   3672  O   ASN A 454      41.139  66.974  25.422  1.00  0.90           O  
ATOM   3673  CB  ASN A 454      40.858  63.838  24.295  1.00  0.90           C  
ATOM   3674  CG  ASN A 454      40.459  63.650  25.758  1.00  0.90           C  
ATOM   3675  OD1 ASN A 454      41.122  62.948  26.516  1.00  0.90           O  
ATOM   3676  ND2 ASN A 454      39.306  64.239  26.151  1.00  0.90           N  
ATOM   3677  N   GLY A 455      39.983  66.693  23.509  1.00  0.90           N  
ATOM   3678  CA  GLY A 455      38.934  67.647  23.815  1.00  0.90           C  
ATOM   3679  C   GLY A 455      37.618  66.990  24.161  1.00  0.90           C  
ATOM   3680  O   GLY A 455      37.464  65.772  24.078  1.00  0.90           O  
ATOM   3681  N   VAL A 456      36.632  67.817  24.554  1.00  0.91           N  
ATOM   3682  CA  VAL A 456      35.373  67.422  25.153  1.00  0.91           C  
ATOM   3683  C   VAL A 456      34.137  67.443  24.256  1.00  0.91           C  
ATOM   3684  O   VAL A 456      33.041  67.111  24.708  1.00  0.91           O  
ATOM   3685  CB  VAL A 456      35.085  68.356  26.317  1.00  0.91           C  
ATOM   3686  CG1 VAL A 456      36.161  68.139  27.393  1.00  0.91           C  
ATOM   3687  CG2 VAL A 456      35.060  69.835  25.876  1.00  0.91           C  
ATOM   3688  N   ALA A 457      34.270  67.817  22.973  1.00  0.92           N  
ATOM   3689  CA  ALA A 457      33.192  67.828  22.001  1.00  0.92           C  
ATOM   3690  C   ALA A 457      33.871  67.845  20.655  1.00  0.92           C  
ATOM   3691  O   ALA A 457      35.046  68.210  20.590  1.00  0.92           O  
ATOM   3692  CB  ALA A 457      32.284  69.064  22.126  1.00  0.92           C  
ATOM   3693  N   LYS A 458      33.200  67.424  19.560  1.00  0.82           N  
ATOM   3694  CA  LYS A 458      33.881  67.262  18.276  1.00  0.82           C  
ATOM   3695  C   LYS A 458      34.561  68.519  17.734  1.00  0.82           C  
ATOM   3696  O   LYS A 458      35.771  68.526  17.523  1.00  0.82           O  
ATOM   3697  CB  LYS A 458      32.917  66.749  17.182  1.00  0.82           C  
ATOM   3698  CG  LYS A 458      32.391  65.324  17.418  1.00  0.82           C  
ATOM   3699  CD  LYS A 458      31.588  64.788  16.219  1.00  0.82           C  
ATOM   3700  CE  LYS A 458      30.372  65.657  15.885  1.00  0.82           C  
ATOM   3701  NZ  LYS A 458      29.699  65.161  14.681  1.00  0.82           N  
ATOM   3702  N   ILE A 459      33.826  69.650  17.590  1.00  0.76           N  
ATOM   3703  CA  ILE A 459      34.399  70.886  17.053  1.00  0.76           C  
ATOM   3704  C   ILE A 459      35.486  71.440  17.950  1.00  0.76           C  
ATOM   3705  O   ILE A 459      36.505  71.939  17.490  1.00  0.76           O  
ATOM   3706  CB  ILE A 459      33.391  71.983  16.656  1.00  0.76           C  
ATOM   3707  CG1 ILE A 459      33.210  73.139  17.681  1.00  0.76           C  
ATOM   3708  CG2 ILE A 459      32.042  71.334  16.278  1.00  0.76           C  
ATOM   3709  CD1 ILE A 459      32.369  74.304  17.151  1.00  0.76           C  
ATOM   3710  N   HIS A 460      35.306  71.328  19.281  1.00  0.80           N  
ATOM   3711  CA  HIS A 460      36.289  71.730  20.266  1.00  0.80           C  
ATOM   3712  C   HIS A 460      37.592  70.962  20.115  1.00  0.80           C  
ATOM   3713  O   HIS A 460      38.666  71.552  20.064  1.00  0.80           O  
ATOM   3714  CB  HIS A 460      35.707  71.519  21.679  1.00  0.80           C  
ATOM   3715  CG  HIS A 460      36.705  71.667  22.783  1.00  0.80           C  
ATOM   3716  ND1 HIS A 460      37.105  72.903  23.212  1.00  0.80           N  
ATOM   3717  CD2 HIS A 460      37.404  70.707  23.423  1.00  0.80           C  
ATOM   3718  CE1 HIS A 460      38.041  72.674  24.117  1.00  0.80           C  
ATOM   3719  NE2 HIS A 460      38.258  71.353  24.283  1.00  0.80           N  
ATOM   3720  N   SER A 461      37.536  69.625  19.949  1.00  0.85           N  
ATOM   3721  CA  SER A 461      38.720  68.819  19.677  1.00  0.85           C  
ATOM   3722  C   SER A 461      39.424  69.189  18.396  1.00  0.85           C  
ATOM   3723  O   SER A 461      40.647  69.290  18.369  1.00  0.85           O  
ATOM   3724  CB  SER A 461      38.429  67.311  19.580  1.00  0.85           C  
ATOM   3725  OG  SER A 461      37.975  66.816  20.835  1.00  0.85           O  
ATOM   3726  N   ASP A 462      38.675  69.446  17.312  1.00  0.78           N  
ATOM   3727  CA  ASP A 462      39.205  69.922  16.050  1.00  0.78           C  
ATOM   3728  C   ASP A 462      39.890  71.285  16.163  1.00  0.78           C  
ATOM   3729  O   ASP A 462      40.922  71.537  15.533  1.00  0.78           O  
ATOM   3730  CB  ASP A 462      38.072  69.985  15.000  1.00  0.78           C  
ATOM   3731  CG  ASP A 462      37.568  68.595  14.641  1.00  0.78           C  
ATOM   3732  OD1 ASP A 462      36.441  68.537  14.089  1.00  0.78           O  
ATOM   3733  OD2 ASP A 462      38.306  67.607  14.879  1.00  0.78           O  
ATOM   3734  N   ILE A 463      39.345  72.217  16.976  1.00  0.76           N  
ATOM   3735  CA  ILE A 463      39.992  73.481  17.309  1.00  0.76           C  
ATOM   3736  C   ILE A 463      41.262  73.300  18.136  1.00  0.76           C  
ATOM   3737  O   ILE A 463      42.302  73.887  17.834  1.00  0.76           O  
ATOM   3738  CB  ILE A 463      39.049  74.487  17.963  1.00  0.76           C  
ATOM   3739  CG1 ILE A 463      37.812  74.776  17.079  1.00  0.76           C  
ATOM   3740  CG2 ILE A 463      39.788  75.820  18.215  1.00  0.76           C  
ATOM   3741  CD1 ILE A 463      36.667  75.438  17.857  1.00  0.76           C  
ATOM   3742  N   VAL A 464      41.229  72.427  19.161  1.00  0.80           N  
ATOM   3743  CA  VAL A 464      42.385  72.038  19.971  1.00  0.80           C  
ATOM   3744  C   VAL A 464      43.483  71.418  19.111  1.00  0.80           C  
ATOM   3745  O   VAL A 464      44.643  71.820  19.177  1.00  0.80           O  
ATOM   3746  CB  VAL A 464      41.950  71.077  21.094  1.00  0.80           C  
ATOM   3747  CG1 VAL A 464      43.111  70.405  21.862  1.00  0.80           C  
ATOM   3748  CG2 VAL A 464      41.099  71.867  22.104  1.00  0.80           C  
ATOM   3749  N   LYS A 465      43.133  70.463  18.226  1.00  0.73           N  
ATOM   3750  CA  LYS A 465      44.059  69.825  17.310  1.00  0.73           C  
ATOM   3751  C   LYS A 465      44.621  70.726  16.211  1.00  0.73           C  
ATOM   3752  O   LYS A 465      45.830  70.786  16.006  1.00  0.73           O  
ATOM   3753  CB  LYS A 465      43.354  68.591  16.678  1.00  0.73           C  
ATOM   3754  CG  LYS A 465      44.257  67.629  15.885  1.00  0.73           C  
ATOM   3755  CD  LYS A 465      43.476  66.393  15.397  1.00  0.73           C  
ATOM   3756  CE  LYS A 465      44.328  65.158  15.068  1.00  0.73           C  
ATOM   3757  NZ  LYS A 465      45.320  65.439  14.006  1.00  0.73           N  
ATOM   3758  N   THR A 466      43.774  71.465  15.463  1.00  0.73           N  
ATOM   3759  CA  THR A 466      44.219  72.085  14.210  1.00  0.73           C  
ATOM   3760  C   THR A 466      44.394  73.583  14.276  1.00  0.73           C  
ATOM   3761  O   THR A 466      44.895  74.184  13.323  1.00  0.73           O  
ATOM   3762  CB  THR A 466      43.304  71.769  13.015  1.00  0.73           C  
ATOM   3763  OG1 THR A 466      41.962  72.247  13.159  1.00  0.73           O  
ATOM   3764  CG2 THR A 466      43.262  70.249  12.781  1.00  0.73           C  
ATOM   3765  N   LYS A 467      44.007  74.226  15.393  1.00  0.77           N  
ATOM   3766  CA  LYS A 467      44.189  75.656  15.581  1.00  0.77           C  
ATOM   3767  C   LYS A 467      45.145  75.876  16.741  1.00  0.77           C  
ATOM   3768  O   LYS A 467      46.280  76.290  16.532  1.00  0.77           O  
ATOM   3769  CB  LYS A 467      42.863  76.446  15.814  1.00  0.77           C  
ATOM   3770  CG  LYS A 467      41.958  76.682  14.579  1.00  0.77           C  
ATOM   3771  CD  LYS A 467      41.279  75.400  14.081  1.00  0.77           C  
ATOM   3772  CE  LYS A 467      40.311  75.524  12.910  1.00  0.77           C  
ATOM   3773  NZ  LYS A 467      39.857  74.157  12.564  1.00  0.77           N  
ATOM   3774  N   VAL A 468      44.712  75.626  17.996  1.00  0.81           N  
ATOM   3775  CA  VAL A 468      45.472  75.985  19.196  1.00  0.81           C  
ATOM   3776  C   VAL A 468      46.807  75.277  19.352  1.00  0.81           C  
ATOM   3777  O   VAL A 468      47.823  75.896  19.660  1.00  0.81           O  
ATOM   3778  CB  VAL A 468      44.666  75.748  20.473  1.00  0.81           C  
ATOM   3779  CG1 VAL A 468      45.425  76.261  21.717  1.00  0.81           C  
ATOM   3780  CG2 VAL A 468      43.318  76.477  20.366  1.00  0.81           C  
ATOM   3781  N   PHE A 469      46.848  73.953  19.123  1.00  0.88           N  
ATOM   3782  CA  PHE A 469      48.054  73.164  19.291  1.00  0.88           C  
ATOM   3783  C   PHE A 469      48.459  72.584  17.960  1.00  0.88           C  
ATOM   3784  O   PHE A 469      48.849  71.421  17.839  1.00  0.88           O  
ATOM   3785  CB  PHE A 469      47.852  72.032  20.321  1.00  0.88           C  
ATOM   3786  CG  PHE A 469      47.450  72.607  21.650  1.00  0.88           C  
ATOM   3787  CD1 PHE A 469      46.194  72.306  22.190  1.00  0.88           C  
ATOM   3788  CD2 PHE A 469      48.309  73.458  22.365  1.00  0.88           C  
ATOM   3789  CE1 PHE A 469      45.787  72.845  23.417  1.00  0.88           C  
ATOM   3790  CE2 PHE A 469      47.913  73.999  23.596  1.00  0.88           C  
ATOM   3791  CZ  PHE A 469      46.650  73.693  24.121  1.00  0.88           C  
ATOM   3792  N   LYS A 470      48.374  73.425  16.915  1.00  0.84           N  
ATOM   3793  CA  LYS A 470      48.640  73.079  15.538  1.00  0.84           C  
ATOM   3794  C   LYS A 470      50.007  72.466  15.315  1.00  0.84           C  
ATOM   3795  O   LYS A 470      50.132  71.380  14.759  1.00  0.84           O  
ATOM   3796  CB  LYS A 470      48.560  74.375  14.697  1.00  0.84           C  
ATOM   3797  CG  LYS A 470      48.741  74.164  13.191  1.00  0.84           C  
ATOM   3798  CD  LYS A 470      48.796  75.502  12.438  1.00  0.84           C  
ATOM   3799  CE  LYS A 470      48.769  75.350  10.919  1.00  0.84           C  
ATOM   3800  NZ  LYS A 470      47.557  74.599  10.538  1.00  0.84           N  
ATOM   3801  N   ASP A 471      51.075  73.112  15.806  1.00  0.89           N  
ATOM   3802  CA  ASP A 471      52.427  72.677  15.561  1.00  0.89           C  
ATOM   3803  C   ASP A 471      52.843  71.472  16.390  1.00  0.89           C  
ATOM   3804  O   ASP A 471      53.722  70.702  15.990  1.00  0.89           O  
ATOM   3805  CB  ASP A 471      53.433  73.851  15.665  1.00  0.89           C  
ATOM   3806  CG  ASP A 471      53.074  74.939  16.654  1.00  0.89           C  
ATOM   3807  OD1 ASP A 471      52.388  74.668  17.667  1.00  0.89           O  
ATOM   3808  OD2 ASP A 471      53.485  76.090  16.343  1.00  0.89           O  
ATOM   3809  N   PHE A 472      52.165  71.242  17.525  1.00  0.90           N  
ATOM   3810  CA  PHE A 472      52.181  69.973  18.227  1.00  0.90           C  
ATOM   3811  C   PHE A 472      51.480  68.838  17.481  1.00  0.90           C  
ATOM   3812  O   PHE A 472      52.019  67.739  17.368  1.00  0.90           O  
ATOM   3813  CB  PHE A 472      51.515  70.106  19.619  1.00  0.90           C  
ATOM   3814  CG  PHE A 472      52.368  70.900  20.566  1.00  0.90           C  
ATOM   3815  CD1 PHE A 472      52.220  72.293  20.688  1.00  0.90           C  
ATOM   3816  CD2 PHE A 472      53.315  70.244  21.370  1.00  0.90           C  
ATOM   3817  CE1 PHE A 472      53.007  73.014  21.594  1.00  0.90           C  
ATOM   3818  CE2 PHE A 472      54.090  70.962  22.288  1.00  0.90           C  
ATOM   3819  CZ  PHE A 472      53.936  72.348  22.399  1.00  0.90           C  
ATOM   3820  N   SER A 473      50.265  69.048  16.924  1.00  0.89           N  
ATOM   3821  CA  SER A 473      49.553  67.959  16.254  1.00  0.89           C  
ATOM   3822  C   SER A 473      50.058  67.659  14.856  1.00  0.89           C  
ATOM   3823  O   SER A 473      49.863  66.562  14.344  1.00  0.89           O  
ATOM   3824  CB  SER A 473      48.002  68.102  16.262  1.00  0.89           C  
ATOM   3825  OG  SER A 473      47.447  68.824  15.158  1.00  0.89           O  
ATOM   3826  N   GLU A 474      50.769  68.608  14.220  1.00  0.79           N  
ATOM   3827  CA  GLU A 474      51.561  68.369  13.025  1.00  0.79           C  
ATOM   3828  C   GLU A 474      52.702  67.389  13.276  1.00  0.79           C  
ATOM   3829  O   GLU A 474      52.999  66.532  12.449  1.00  0.79           O  
ATOM   3830  CB  GLU A 474      52.168  69.697  12.508  1.00  0.79           C  
ATOM   3831  CG  GLU A 474      51.147  70.644  11.827  1.00  0.79           C  
ATOM   3832  CD  GLU A 474      51.693  72.046  11.569  1.00  0.79           C  
ATOM   3833  OE1 GLU A 474      52.864  72.338  11.946  1.00  0.79           O  
ATOM   3834  OE2 GLU A 474      50.922  72.865  11.005  1.00  0.79           O  
ATOM   3835  N   LEU A 475      53.376  67.503  14.442  1.00  0.77           N  
ATOM   3836  CA  LEU A 475      54.485  66.646  14.830  1.00  0.77           C  
ATOM   3837  C   LEU A 475      54.062  65.201  15.064  1.00  0.77           C  
ATOM   3838  O   LEU A 475      54.692  64.256  14.593  1.00  0.77           O  
ATOM   3839  CB  LEU A 475      55.121  67.248  16.118  1.00  0.77           C  
ATOM   3840  CG  LEU A 475      56.562  66.827  16.490  1.00  0.77           C  
ATOM   3841  CD1 LEU A 475      56.680  65.408  17.068  1.00  0.77           C  
ATOM   3842  CD2 LEU A 475      57.528  67.020  15.318  1.00  0.77           C  
ATOM   3843  N   GLU A 476      52.945  65.012  15.786  1.00  0.77           N  
ATOM   3844  CA  GLU A 476      52.443  63.702  16.148  1.00  0.77           C  
ATOM   3845  C   GLU A 476      50.908  63.693  16.066  1.00  0.77           C  
ATOM   3846  O   GLU A 476      50.221  63.967  17.055  1.00  0.77           O  
ATOM   3847  CB  GLU A 476      52.988  63.296  17.547  1.00  0.77           C  
ATOM   3848  CG  GLU A 476      52.923  64.424  18.610  1.00  0.77           C  
ATOM   3849  CD  GLU A 476      53.659  64.119  19.901  1.00  0.77           C  
ATOM   3850  OE1 GLU A 476      53.809  65.079  20.708  1.00  0.77           O  
ATOM   3851  OE2 GLU A 476      54.011  62.951  20.183  1.00  0.77           O  
ATOM   3852  N   PRO A 477      50.293  63.390  14.906  1.00  0.90           N  
ATOM   3853  CA  PRO A 477      48.852  63.558  14.706  1.00  0.90           C  
ATOM   3854  C   PRO A 477      47.971  62.735  15.605  1.00  0.90           C  
ATOM   3855  O   PRO A 477      46.875  63.190  15.936  1.00  0.90           O  
ATOM   3856  CB  PRO A 477      48.636  63.171  13.234  1.00  0.90           C  
ATOM   3857  CG  PRO A 477      49.931  63.625  12.566  1.00  0.90           C  
ATOM   3858  CD  PRO A 477      50.990  63.278  13.615  1.00  0.90           C  
ATOM   3859  N   ASP A 478      48.437  61.532  15.959  1.00  0.84           N  
ATOM   3860  CA  ASP A 478      47.686  60.477  16.600  1.00  0.84           C  
ATOM   3861  C   ASP A 478      47.515  60.699  18.101  1.00  0.84           C  
ATOM   3862  O   ASP A 478      46.671  60.094  18.761  1.00  0.84           O  
ATOM   3863  CB  ASP A 478      48.451  59.157  16.341  1.00  0.84           C  
ATOM   3864  CG  ASP A 478      48.634  58.887  14.851  1.00  0.84           C  
ATOM   3865  OD1 ASP A 478      47.928  59.513  14.019  1.00  0.84           O  
ATOM   3866  OD2 ASP A 478      49.535  58.071  14.540  1.00  0.84           O  
ATOM   3867  N   LYS A 479      48.308  61.627  18.677  1.00  0.87           N  
ATOM   3868  CA  LYS A 479      48.193  62.060  20.057  1.00  0.87           C  
ATOM   3869  C   LYS A 479      46.864  62.745  20.362  1.00  0.87           C  
ATOM   3870  O   LYS A 479      46.280  62.577  21.432  1.00  0.87           O  
ATOM   3871  CB  LYS A 479      49.377  63.004  20.406  1.00  0.87           C  
ATOM   3872  CG  LYS A 479      49.365  63.526  21.855  1.00  0.87           C  
ATOM   3873  CD  LYS A 479      50.651  64.262  22.273  1.00  0.87           C  
ATOM   3874  CE  LYS A 479      51.812  63.298  22.545  1.00  0.87           C  
ATOM   3875  NZ  LYS A 479      53.029  64.023  22.964  1.00  0.87           N  
ATOM   3876  N   PHE A 480      46.352  63.553  19.418  1.00  0.87           N  
ATOM   3877  CA  PHE A 480      45.216  64.421  19.657  1.00  0.87           C  
ATOM   3878  C   PHE A 480      43.897  63.793  19.232  1.00  0.87           C  
ATOM   3879  O   PHE A 480      43.671  63.478  18.065  1.00  0.87           O  
ATOM   3880  CB  PHE A 480      45.373  65.765  18.913  1.00  0.87           C  
ATOM   3881  CG  PHE A 480      46.436  66.618  19.540  1.00  0.87           C  
ATOM   3882  CD1 PHE A 480      47.799  66.385  19.285  1.00  0.87           C  
ATOM   3883  CD2 PHE A 480      46.073  67.692  20.369  1.00  0.87           C  
ATOM   3884  CE1 PHE A 480      48.781  67.203  19.854  1.00  0.87           C  
ATOM   3885  CE2 PHE A 480      47.052  68.511  20.943  1.00  0.87           C  
ATOM   3886  CZ  PHE A 480      48.405  68.264  20.686  1.00  0.87           C  
ATOM   3887  N   GLN A 481      42.975  63.629  20.198  1.00  0.87           N  
ATOM   3888  CA  GLN A 481      41.749  62.881  20.037  1.00  0.87           C  
ATOM   3889  C   GLN A 481      40.505  63.679  20.436  1.00  0.87           C  
ATOM   3890  O   GLN A 481      40.540  64.790  20.968  1.00  0.87           O  
ATOM   3891  CB  GLN A 481      41.775  61.602  20.921  1.00  0.87           C  
ATOM   3892  CG  GLN A 481      43.007  60.684  20.720  1.00  0.87           C  
ATOM   3893  CD  GLN A 481      42.865  59.417  21.569  1.00  0.87           C  
ATOM   3894  OE1 GLN A 481      41.752  59.032  21.950  1.00  0.87           O  
ATOM   3895  NE2 GLN A 481      44.002  58.754  21.873  1.00  0.87           N  
ATOM   3896  N   ASN A 482      39.320  63.089  20.204  1.00  0.88           N  
ATOM   3897  CA  ASN A 482      38.055  63.568  20.718  1.00  0.88           C  
ATOM   3898  C   ASN A 482      37.517  62.562  21.717  1.00  0.88           C  
ATOM   3899  O   ASN A 482      37.667  61.354  21.537  1.00  0.88           O  
ATOM   3900  CB  ASN A 482      37.065  63.815  19.540  1.00  0.88           C  
ATOM   3901  CG  ASN A 482      35.628  64.086  19.981  1.00  0.88           C  
ATOM   3902  OD1 ASN A 482      34.713  63.344  19.636  1.00  0.88           O  
ATOM   3903  ND2 ASN A 482      35.429  65.135  20.802  1.00  0.88           N  
ATOM   3904  N   LYS A 483      36.919  63.068  22.814  1.00  0.89           N  
ATOM   3905  CA  LYS A 483      36.068  62.302  23.696  1.00  0.89           C  
ATOM   3906  C   LYS A 483      34.923  63.212  24.109  1.00  0.89           C  
ATOM   3907  O   LYS A 483      35.036  63.965  25.076  1.00  0.89           O  
ATOM   3908  CB  LYS A 483      36.807  61.851  24.984  1.00  0.89           C  
ATOM   3909  CG  LYS A 483      37.998  60.908  24.760  1.00  0.89           C  
ATOM   3910  CD  LYS A 483      37.539  59.524  24.287  1.00  0.89           C  
ATOM   3911  CE  LYS A 483      38.664  58.661  23.722  1.00  0.89           C  
ATOM   3912  NZ  LYS A 483      39.066  59.132  22.390  1.00  0.89           N  
ATOM   3913  N   THR A 484      33.784  63.194  23.383  1.00  0.92           N  
ATOM   3914  CA  THR A 484      32.624  64.026  23.714  1.00  0.92           C  
ATOM   3915  C   THR A 484      32.076  63.748  25.099  1.00  0.92           C  
ATOM   3916  O   THR A 484      31.905  62.599  25.502  1.00  0.92           O  
ATOM   3917  CB  THR A 484      31.491  63.942  22.699  1.00  0.92           C  
ATOM   3918  OG1 THR A 484      31.973  64.382  21.440  1.00  0.92           O  
ATOM   3919  CG2 THR A 484      30.291  64.837  23.052  1.00  0.92           C  
ATOM   3920  N   ASN A 485      31.793  64.795  25.899  1.00  0.92           N  
ATOM   3921  CA  ASN A 485      31.265  64.646  27.246  1.00  0.92           C  
ATOM   3922  C   ASN A 485      29.995  63.810  27.354  1.00  0.92           C  
ATOM   3923  O   ASN A 485      29.253  63.591  26.397  1.00  0.92           O  
ATOM   3924  CB  ASN A 485      31.031  65.993  27.976  1.00  0.92           C  
ATOM   3925  CG  ASN A 485      32.299  66.793  28.245  1.00  0.92           C  
ATOM   3926  OD1 ASN A 485      32.218  68.011  28.403  1.00  0.92           O  
ATOM   3927  ND2 ASN A 485      33.477  66.138  28.326  1.00  0.92           N  
ATOM   3928  N   GLY A 486      29.763  63.261  28.556  1.00  0.96           N  
ATOM   3929  CA  GLY A 486      28.578  62.472  28.800  1.00  0.96           C  
ATOM   3930  C   GLY A 486      28.130  62.612  30.218  1.00  0.96           C  
ATOM   3931  O   GLY A 486      28.851  63.113  31.079  1.00  0.96           O  
ATOM   3932  N   ILE A 487      26.909  62.141  30.479  1.00  0.95           N  
ATOM   3933  CA  ILE A 487      26.165  62.271  31.710  1.00  0.95           C  
ATOM   3934  C   ILE A 487      25.839  60.886  32.237  1.00  0.95           C  
ATOM   3935  O   ILE A 487      25.506  59.981  31.480  1.00  0.95           O  
ATOM   3936  CB  ILE A 487      24.906  63.099  31.413  1.00  0.95           C  
ATOM   3937  CG1 ILE A 487      25.094  64.553  31.875  1.00  0.95           C  
ATOM   3938  CG2 ILE A 487      23.592  62.512  31.966  1.00  0.95           C  
ATOM   3939  CD1 ILE A 487      26.180  65.278  31.086  1.00  0.95           C  
ATOM   3940  N   THR A 488      25.932  60.640  33.563  1.00  0.96           N  
ATOM   3941  CA  THR A 488      25.459  59.362  34.103  1.00  0.96           C  
ATOM   3942  C   THR A 488      23.929  59.285  34.107  1.00  0.96           C  
ATOM   3943  O   THR A 488      23.270  60.169  34.667  1.00  0.96           O  
ATOM   3944  CB  THR A 488      26.030  58.943  35.463  1.00  0.96           C  
ATOM   3945  OG1 THR A 488      25.436  57.739  35.940  1.00  0.96           O  
ATOM   3946  CG2 THR A 488      25.783  59.998  36.542  1.00  0.96           C  
ATOM   3947  N   PRO A 489      23.294  58.265  33.531  1.00  0.97           N  
ATOM   3948  CA  PRO A 489      21.849  58.116  33.588  1.00  0.97           C  
ATOM   3949  C   PRO A 489      21.389  57.615  34.941  1.00  0.97           C  
ATOM   3950  O   PRO A 489      20.185  57.570  35.180  1.00  0.97           O  
ATOM   3951  CB  PRO A 489      21.563  57.094  32.480  1.00  0.97           C  
ATOM   3952  CG  PRO A 489      22.816  56.218  32.434  1.00  0.97           C  
ATOM   3953  CD  PRO A 489      23.929  57.222  32.713  1.00  0.97           C  
ATOM   3954  N   ARG A 490      22.288  57.216  35.864  1.00  0.91           N  
ATOM   3955  CA  ARG A 490      21.850  56.827  37.195  1.00  0.91           C  
ATOM   3956  C   ARG A 490      21.422  58.027  38.009  1.00  0.91           C  
ATOM   3957  O   ARG A 490      20.291  58.119  38.474  1.00  0.91           O  
ATOM   3958  CB  ARG A 490      22.963  56.087  37.972  1.00  0.91           C  
ATOM   3959  CG  ARG A 490      23.026  54.577  37.676  1.00  0.91           C  
ATOM   3960  CD  ARG A 490      23.395  54.175  36.249  1.00  0.91           C  
ATOM   3961  NE  ARG A 490      24.807  54.601  36.046  1.00  0.91           N  
ATOM   3962  CZ  ARG A 490      25.503  54.337  34.937  1.00  0.91           C  
ATOM   3963  NH1 ARG A 490      24.975  53.719  33.891  1.00  0.91           N  
ATOM   3964  NH2 ARG A 490      26.774  54.709  34.883  1.00  0.91           N  
ATOM   3965  N   ARG A 491      22.308  59.025  38.147  1.00  0.91           N  
ATOM   3966  CA  ARG A 491      21.980  60.263  38.816  1.00  0.91           C  
ATOM   3967  C   ARG A 491      21.031  61.145  38.027  1.00  0.91           C  
ATOM   3968  O   ARG A 491      20.089  61.716  38.568  1.00  0.91           O  
ATOM   3969  CB  ARG A 491      23.277  61.017  39.160  1.00  0.91           C  
ATOM   3970  CG  ARG A 491      23.038  62.364  39.857  1.00  0.91           C  
ATOM   3971  CD  ARG A 491      24.286  62.890  40.565  1.00  0.91           C  
ATOM   3972  NE  ARG A 491      23.886  63.250  41.944  1.00  0.91           N  
ATOM   3973  CZ  ARG A 491      24.292  62.708  43.093  1.00  0.91           C  
ATOM   3974  NH1 ARG A 491      25.230  61.777  43.210  1.00  0.91           N  
ATOM   3975  NH2 ARG A 491      23.676  63.152  44.181  1.00  0.91           N  
ATOM   3976  N   TRP A 492      21.239  61.262  36.703  1.00  0.92           N  
ATOM   3977  CA  TRP A 492      20.513  62.237  35.911  1.00  0.92           C  
ATOM   3978  C   TRP A 492      19.329  61.659  35.164  1.00  0.92           C  
ATOM   3979  O   TRP A 492      18.758  62.314  34.296  1.00  0.92           O  
ATOM   3980  CB  TRP A 492      21.465  62.982  34.950  1.00  0.92           C  
ATOM   3981  CG  TRP A 492      22.620  63.645  35.669  1.00  0.92           C  
ATOM   3982  CD1 TRP A 492      23.936  63.278  35.710  1.00  0.92           C  
ATOM   3983  CD2 TRP A 492      22.502  64.771  36.569  1.00  0.92           C  
ATOM   3984  NE1 TRP A 492      24.657  64.095  36.567  1.00  0.92           N  
ATOM   3985  CE2 TRP A 492      23.761  65.004  37.106  1.00  0.92           C  
ATOM   3986  CE3 TRP A 492      21.391  65.540  36.932  1.00  0.92           C  
ATOM   3987  CZ2 TRP A 492      23.977  66.016  38.041  1.00  0.92           C  
ATOM   3988  CZ3 TRP A 492      21.602  66.563  37.874  1.00  0.92           C  
ATOM   3989  CH2 TRP A 492      22.869  66.794  38.422  1.00  0.92           C  
ATOM   3990  N   LEU A 493      18.895  60.441  35.528  1.00  0.95           N  
ATOM   3991  CA  LEU A 493      17.610  59.934  35.096  1.00  0.95           C  
ATOM   3992  C   LEU A 493      16.982  59.151  36.231  1.00  0.95           C  
ATOM   3993  O   LEU A 493      15.984  59.583  36.792  1.00  0.95           O  
ATOM   3994  CB  LEU A 493      17.731  59.057  33.823  1.00  0.95           C  
ATOM   3995  CG  LEU A 493      16.514  59.023  32.869  1.00  0.95           C  
ATOM   3996  CD1 LEU A 493      16.425  57.649  32.205  1.00  0.95           C  
ATOM   3997  CD2 LEU A 493      15.158  59.399  33.477  1.00  0.95           C  
ATOM   3998  N   LEU A 494      17.551  57.995  36.641  1.00  0.92           N  
ATOM   3999  CA  LEU A 494      16.906  57.102  37.600  1.00  0.92           C  
ATOM   4000  C   LEU A 494      16.649  57.728  38.966  1.00  0.92           C  
ATOM   4001  O   LEU A 494      15.584  57.567  39.555  1.00  0.92           O  
ATOM   4002  CB  LEU A 494      17.729  55.801  37.822  1.00  0.92           C  
ATOM   4003  CG  LEU A 494      18.138  55.022  36.553  1.00  0.92           C  
ATOM   4004  CD1 LEU A 494      18.815  53.702  36.948  1.00  0.92           C  
ATOM   4005  CD2 LEU A 494      16.951  54.740  35.627  1.00  0.92           C  
ATOM   4006  N   LEU A 495      17.641  58.468  39.487  1.00  0.92           N  
ATOM   4007  CA  LEU A 495      17.564  59.130  40.769  1.00  0.92           C  
ATOM   4008  C   LEU A 495      16.715  60.383  40.784  1.00  0.92           C  
ATOM   4009  O   LEU A 495      15.776  60.506  41.568  1.00  0.92           O  
ATOM   4010  CB  LEU A 495      19.014  59.491  41.162  1.00  0.92           C  
ATOM   4011  CG  LEU A 495      19.204  60.136  42.538  1.00  0.92           C  
ATOM   4012  CD1 LEU A 495      18.846  59.164  43.656  1.00  0.92           C  
ATOM   4013  CD2 LEU A 495      20.646  60.633  42.697  1.00  0.92           C  
ATOM   4014  N   CYS A 496      17.008  61.350  39.894  1.00  0.94           N  
ATOM   4015  CA  CYS A 496      16.291  62.609  39.868  1.00  0.94           C  
ATOM   4016  C   CYS A 496      14.876  62.479  39.335  1.00  0.94           C  
ATOM   4017  O   CYS A 496      13.947  63.142  39.796  1.00  0.94           O  
ATOM   4018  CB  CYS A 496      17.094  63.701  39.112  1.00  0.94           C  
ATOM   4019  SG  CYS A 496      17.321  63.430  37.322  1.00  0.94           S  
ATOM   4020  N   ASN A 497      14.677  61.587  38.350  1.00  0.92           N  
ATOM   4021  CA  ASN A 497      13.422  61.440  37.656  1.00  0.92           C  
ATOM   4022  C   ASN A 497      12.974  59.981  37.586  1.00  0.92           C  
ATOM   4023  O   ASN A 497      12.944  59.386  36.501  1.00  0.92           O  
ATOM   4024  CB  ASN A 497      13.583  62.036  36.244  1.00  0.92           C  
ATOM   4025  CG  ASN A 497      12.236  62.414  35.654  1.00  0.92           C  
ATOM   4026  OD1 ASN A 497      11.184  61.884  36.027  1.00  0.92           O  
ATOM   4027  ND2 ASN A 497      12.268  63.368  34.697  1.00  0.92           N  
ATOM   4028  N   PRO A 498      12.572  59.361  38.697  1.00  0.92           N  
ATOM   4029  CA  PRO A 498      12.122  57.974  38.709  1.00  0.92           C  
ATOM   4030  C   PRO A 498      10.897  57.756  37.848  1.00  0.92           C  
ATOM   4031  O   PRO A 498      10.737  56.668  37.307  1.00  0.92           O  
ATOM   4032  CB  PRO A 498      11.866  57.678  40.196  1.00  0.92           C  
ATOM   4033  CG  PRO A 498      11.610  59.049  40.830  1.00  0.92           C  
ATOM   4034  CD  PRO A 498      12.551  59.952  40.041  1.00  0.92           C  
ATOM   4035  N   GLY A 499      10.034  58.780  37.682  1.00  0.90           N  
ATOM   4036  CA  GLY A 499       8.822  58.667  36.883  1.00  0.90           C  
ATOM   4037  C   GLY A 499       9.079  58.572  35.404  1.00  0.90           C  
ATOM   4038  O   GLY A 499       8.457  57.773  34.714  1.00  0.90           O  
ATOM   4039  N   LEU A 500      10.026  59.360  34.855  1.00  0.90           N  
ATOM   4040  CA  LEU A 500      10.427  59.229  33.460  1.00  0.90           C  
ATOM   4041  C   LEU A 500      11.166  57.919  33.229  1.00  0.90           C  
ATOM   4042  O   LEU A 500      10.928  57.206  32.256  1.00  0.90           O  
ATOM   4043  CB  LEU A 500      11.297  60.436  33.030  1.00  0.90           C  
ATOM   4044  CG  LEU A 500      11.236  60.900  31.555  1.00  0.90           C  
ATOM   4045  CD1 LEU A 500      12.498  61.710  31.237  1.00  0.90           C  
ATOM   4046  CD2 LEU A 500      11.078  59.782  30.524  1.00  0.90           C  
ATOM   4047  N   ALA A 501      12.054  57.533  34.168  1.00  0.92           N  
ATOM   4048  CA  ALA A 501      12.764  56.272  34.104  1.00  0.92           C  
ATOM   4049  C   ALA A 501      11.856  55.044  34.085  1.00  0.92           C  
ATOM   4050  O   ALA A 501      12.000  54.166  33.237  1.00  0.92           O  
ATOM   4051  CB  ALA A 501      13.691  56.164  35.325  1.00  0.92           C  
ATOM   4052  N   GLU A 502      10.851  54.998  34.978  1.00  0.84           N  
ATOM   4053  CA  GLU A 502       9.827  53.971  35.010  1.00  0.84           C  
ATOM   4054  C   GLU A 502       8.988  53.927  33.743  1.00  0.84           C  
ATOM   4055  O   GLU A 502       8.752  52.865  33.174  1.00  0.84           O  
ATOM   4056  CB  GLU A 502       8.927  54.214  36.237  1.00  0.84           C  
ATOM   4057  CG  GLU A 502       7.810  53.170  36.464  1.00  0.84           C  
ATOM   4058  CD  GLU A 502       7.217  53.320  37.863  1.00  0.84           C  
ATOM   4059  OE1 GLU A 502       6.692  54.424  38.165  1.00  0.84           O  
ATOM   4060  OE2 GLU A 502       7.309  52.340  38.646  1.00  0.84           O  
ATOM   4061  N   LEU A 503       8.591  55.102  33.209  1.00  0.85           N  
ATOM   4062  CA  LEU A 503       7.871  55.205  31.951  1.00  0.85           C  
ATOM   4063  C   LEU A 503       8.654  54.642  30.757  1.00  0.85           C  
ATOM   4064  O   LEU A 503       8.125  53.897  29.935  1.00  0.85           O  
ATOM   4065  CB  LEU A 503       7.514  56.696  31.685  1.00  0.85           C  
ATOM   4066  CG  LEU A 503       6.170  57.013  30.988  1.00  0.85           C  
ATOM   4067  CD1 LEU A 503       6.349  58.179  30.009  1.00  0.85           C  
ATOM   4068  CD2 LEU A 503       5.499  55.833  30.280  1.00  0.85           C  
ATOM   4069  N   ILE A 504       9.964  54.946  30.637  1.00  0.87           N  
ATOM   4070  CA  ILE A 504      10.823  54.355  29.614  1.00  0.87           C  
ATOM   4071  C   ILE A 504      10.993  52.846  29.781  1.00  0.87           C  
ATOM   4072  O   ILE A 504      10.846  52.078  28.829  1.00  0.87           O  
ATOM   4073  CB  ILE A 504      12.189  55.039  29.617  1.00  0.87           C  
ATOM   4074  CG1 ILE A 504      12.024  56.514  29.181  1.00  0.87           C  
ATOM   4075  CG2 ILE A 504      13.202  54.302  28.711  1.00  0.87           C  
ATOM   4076  CD1 ILE A 504      13.333  57.313  29.179  1.00  0.87           C  
ATOM   4077  N   ALA A 505      11.261  52.381  31.018  1.00  0.89           N  
ATOM   4078  CA  ALA A 505      11.451  50.983  31.365  1.00  0.89           C  
ATOM   4079  C   ALA A 505      10.232  50.121  31.082  1.00  0.89           C  
ATOM   4080  O   ALA A 505      10.331  49.011  30.564  1.00  0.89           O  
ATOM   4081  CB  ALA A 505      11.843  50.859  32.849  1.00  0.89           C  
ATOM   4082  N   GLU A 506       9.030  50.654  31.357  1.00  0.83           N  
ATOM   4083  CA  GLU A 506       7.771  49.984  31.115  1.00  0.83           C  
ATOM   4084  C   GLU A 506       7.492  49.742  29.633  1.00  0.83           C  
ATOM   4085  O   GLU A 506       6.738  48.847  29.259  1.00  0.83           O  
ATOM   4086  CB  GLU A 506       6.632  50.821  31.739  1.00  0.83           C  
ATOM   4087  CG  GLU A 506       5.317  50.041  31.929  1.00  0.83           C  
ATOM   4088  CD  GLU A 506       4.167  50.992  32.181  1.00  0.83           C  
ATOM   4089  OE1 GLU A 506       3.508  51.323  31.163  1.00  0.83           O  
ATOM   4090  OE2 GLU A 506       3.936  51.406  33.337  1.00  0.83           O  
ATOM   4091  N   LYS A 507       8.121  50.524  28.731  1.00  0.84           N  
ATOM   4092  CA  LYS A 507       7.894  50.374  27.310  1.00  0.84           C  
ATOM   4093  C   LYS A 507       9.058  49.717  26.566  1.00  0.84           C  
ATOM   4094  O   LYS A 507       8.825  49.032  25.572  1.00  0.84           O  
ATOM   4095  CB  LYS A 507       7.580  51.760  26.694  1.00  0.84           C  
ATOM   4096  CG  LYS A 507       6.401  52.524  27.348  1.00  0.84           C  
ATOM   4097  CD  LYS A 507       5.065  51.754  27.397  1.00  0.84           C  
ATOM   4098  CE  LYS A 507       3.830  52.552  27.882  1.00  0.84           C  
ATOM   4099  NZ  LYS A 507       3.886  53.027  29.280  1.00  0.84           N  
ATOM   4100  N   ILE A 508      10.334  49.864  27.011  1.00  0.86           N  
ATOM   4101  CA  ILE A 508      11.473  49.252  26.305  1.00  0.86           C  
ATOM   4102  C   ILE A 508      12.359  48.342  27.147  1.00  0.86           C  
ATOM   4103  O   ILE A 508      13.408  47.893  26.684  1.00  0.86           O  
ATOM   4104  CB  ILE A 508      12.371  50.259  25.571  1.00  0.86           C  
ATOM   4105  CG1 ILE A 508      13.121  51.233  26.508  1.00  0.86           C  
ATOM   4106  CG2 ILE A 508      11.506  51.011  24.539  1.00  0.86           C  
ATOM   4107  CD1 ILE A 508      14.214  52.038  25.792  1.00  0.86           C  
ATOM   4108  N   GLY A 509      11.959  48.004  28.390  1.00  0.87           N  
ATOM   4109  CA  GLY A 509      12.788  47.232  29.319  1.00  0.87           C  
ATOM   4110  C   GLY A 509      13.903  48.041  29.935  1.00  0.87           C  
ATOM   4111  O   GLY A 509      14.034  49.231  29.679  1.00  0.87           O  
ATOM   4112  N   GLU A 510      14.731  47.436  30.810  1.00  0.81           N  
ATOM   4113  CA  GLU A 510      15.664  48.198  31.634  1.00  0.81           C  
ATOM   4114  C   GLU A 510      17.101  48.268  31.140  1.00  0.81           C  
ATOM   4115  O   GLU A 510      17.931  48.943  31.743  1.00  0.81           O  
ATOM   4116  CB  GLU A 510      15.667  47.665  33.083  1.00  0.81           C  
ATOM   4117  CG  GLU A 510      14.366  48.009  33.844  1.00  0.81           C  
ATOM   4118  CD  GLU A 510      14.338  47.441  35.261  1.00  0.81           C  
ATOM   4119  OE1 GLU A 510      13.209  47.344  35.804  1.00  0.81           O  
ATOM   4120  OE2 GLU A 510      15.422  47.107  35.803  1.00  0.81           O  
ATOM   4121  N   ASP A 511      17.447  47.658  29.991  1.00  0.81           N  
ATOM   4122  CA  ASP A 511      18.808  47.644  29.457  1.00  0.81           C  
ATOM   4123  C   ASP A 511      19.402  49.029  29.199  1.00  0.81           C  
ATOM   4124  O   ASP A 511      20.608  49.255  29.318  1.00  0.81           O  
ATOM   4125  CB  ASP A 511      18.867  46.853  28.137  1.00  0.81           C  
ATOM   4126  CG  ASP A 511      18.325  45.459  28.350  1.00  0.81           C  
ATOM   4127  OD1 ASP A 511      17.331  45.135  27.653  1.00  0.81           O  
ATOM   4128  OD2 ASP A 511      18.878  44.732  29.208  1.00  0.81           O  
ATOM   4129  N   TYR A 512      18.536  50.019  28.890  1.00  0.86           N  
ATOM   4130  CA  TYR A 512      18.906  51.399  28.630  1.00  0.86           C  
ATOM   4131  C   TYR A 512      19.735  52.070  29.738  1.00  0.86           C  
ATOM   4132  O   TYR A 512      20.494  53.003  29.495  1.00  0.86           O  
ATOM   4133  CB  TYR A 512      17.659  52.254  28.239  1.00  0.86           C  
ATOM   4134  CG  TYR A 512      16.822  52.635  29.431  1.00  0.86           C  
ATOM   4135  CD1 TYR A 512      15.899  51.735  29.972  1.00  0.86           C  
ATOM   4136  CD2 TYR A 512      17.031  53.864  30.075  1.00  0.86           C  
ATOM   4137  CE1 TYR A 512      15.233  52.026  31.170  1.00  0.86           C  
ATOM   4138  CE2 TYR A 512      16.388  54.147  31.286  1.00  0.86           C  
ATOM   4139  CZ  TYR A 512      15.500  53.221  31.839  1.00  0.86           C  
ATOM   4140  OH  TYR A 512      14.908  53.467  33.088  1.00  0.86           O  
ATOM   4141  N   VAL A 513      19.629  51.600  30.997  1.00  0.89           N  
ATOM   4142  CA  VAL A 513      20.334  52.178  32.131  1.00  0.89           C  
ATOM   4143  C   VAL A 513      21.848  51.983  32.108  1.00  0.89           C  
ATOM   4144  O   VAL A 513      22.575  52.739  32.754  1.00  0.89           O  
ATOM   4145  CB  VAL A 513      19.795  51.673  33.466  1.00  0.89           C  
ATOM   4146  CG1 VAL A 513      18.269  51.860  33.502  1.00  0.89           C  
ATOM   4147  CG2 VAL A 513      20.166  50.199  33.708  1.00  0.89           C  
ATOM   4148  N   LYS A 514      22.364  50.974  31.364  1.00  0.81           N  
ATOM   4149  CA  LYS A 514      23.798  50.799  31.151  1.00  0.81           C  
ATOM   4150  C   LYS A 514      24.165  50.893  29.674  1.00  0.81           C  
ATOM   4151  O   LYS A 514      25.334  50.793  29.291  1.00  0.81           O  
ATOM   4152  CB  LYS A 514      24.302  49.431  31.682  1.00  0.81           C  
ATOM   4153  CG  LYS A 514      24.042  49.214  33.182  1.00  0.81           C  
ATOM   4154  CD  LYS A 514      25.003  48.236  33.894  1.00  0.81           C  
ATOM   4155  CE  LYS A 514      25.047  46.780  33.393  1.00  0.81           C  
ATOM   4156  NZ  LYS A 514      25.848  46.670  32.160  1.00  0.81           N  
ATOM   4157  N   ASP A 515      23.160  51.122  28.811  1.00  0.83           N  
ATOM   4158  CA  ASP A 515      23.356  51.249  27.384  1.00  0.83           C  
ATOM   4159  C   ASP A 515      22.313  52.214  26.843  1.00  0.83           C  
ATOM   4160  O   ASP A 515      21.279  51.859  26.287  1.00  0.83           O  
ATOM   4161  CB  ASP A 515      23.315  49.878  26.668  1.00  0.83           C  
ATOM   4162  CG  ASP A 515      24.102  49.972  25.374  1.00  0.83           C  
ATOM   4163  OD1 ASP A 515      23.519  49.696  24.301  1.00  0.83           O  
ATOM   4164  OD2 ASP A 515      25.313  50.341  25.467  1.00  0.83           O  
ATOM   4165  N   LEU A 516      22.554  53.520  27.051  1.00  0.88           N  
ATOM   4166  CA  LEU A 516      21.547  54.557  26.897  1.00  0.88           C  
ATOM   4167  C   LEU A 516      21.158  54.823  25.448  1.00  0.88           C  
ATOM   4168  O   LEU A 516      20.101  55.369  25.151  1.00  0.88           O  
ATOM   4169  CB  LEU A 516      22.058  55.839  27.597  1.00  0.88           C  
ATOM   4170  CG  LEU A 516      20.987  56.871  28.006  1.00  0.88           C  
ATOM   4171  CD1 LEU A 516      20.132  56.353  29.168  1.00  0.88           C  
ATOM   4172  CD2 LEU A 516      21.629  58.218  28.375  1.00  0.88           C  
ATOM   4173  N   SER A 517      21.970  54.358  24.483  1.00  0.86           N  
ATOM   4174  CA  SER A 517      21.699  54.376  23.052  1.00  0.86           C  
ATOM   4175  C   SER A 517      20.463  53.587  22.664  1.00  0.86           C  
ATOM   4176  O   SER A 517      19.789  53.913  21.690  1.00  0.86           O  
ATOM   4177  CB  SER A 517      22.919  53.837  22.273  1.00  0.86           C  
ATOM   4178  OG  SER A 517      23.475  52.716  22.954  1.00  0.86           O  
ATOM   4179  N   GLN A 518      20.088  52.583  23.485  1.00  0.81           N  
ATOM   4180  CA  GLN A 518      18.845  51.828  23.441  1.00  0.81           C  
ATOM   4181  C   GLN A 518      17.575  52.695  23.478  1.00  0.81           C  
ATOM   4182  O   GLN A 518      16.490  52.252  23.102  1.00  0.81           O  
ATOM   4183  CB  GLN A 518      18.865  50.865  24.662  1.00  0.81           C  
ATOM   4184  CG  GLN A 518      17.793  49.750  24.746  1.00  0.81           C  
ATOM   4185  CD  GLN A 518      18.216  48.492  23.990  1.00  0.81           C  
ATOM   4186  OE1 GLN A 518      18.392  48.480  22.772  1.00  0.81           O  
ATOM   4187  NE2 GLN A 518      18.313  47.337  24.689  1.00  0.81           N  
ATOM   4188  N   LEU A 519      17.678  53.986  23.876  1.00  0.87           N  
ATOM   4189  CA  LEU A 519      16.573  54.931  23.878  1.00  0.87           C  
ATOM   4190  C   LEU A 519      15.979  55.239  22.504  1.00  0.87           C  
ATOM   4191  O   LEU A 519      14.851  55.720  22.418  1.00  0.87           O  
ATOM   4192  CB  LEU A 519      16.975  56.275  24.539  1.00  0.87           C  
ATOM   4193  CG  LEU A 519      17.145  56.224  26.070  1.00  0.87           C  
ATOM   4194  CD1 LEU A 519      17.592  57.592  26.602  1.00  0.87           C  
ATOM   4195  CD2 LEU A 519      15.852  55.812  26.776  1.00  0.87           C  
ATOM   4196  N   THR A 520      16.662  54.894  21.391  1.00  0.84           N  
ATOM   4197  CA  THR A 520      16.123  55.003  20.027  1.00  0.84           C  
ATOM   4198  C   THR A 520      14.917  54.101  19.789  1.00  0.84           C  
ATOM   4199  O   THR A 520      14.098  54.308  18.898  1.00  0.84           O  
ATOM   4200  CB  THR A 520      17.145  54.697  18.937  1.00  0.84           C  
ATOM   4201  OG1 THR A 520      17.722  53.406  19.100  1.00  0.84           O  
ATOM   4202  CG2 THR A 520      18.285  55.722  19.011  1.00  0.84           C  
ATOM   4203  N   LYS A 521      14.714  53.089  20.653  1.00  0.80           N  
ATOM   4204  CA  LYS A 521      13.533  52.247  20.636  1.00  0.80           C  
ATOM   4205  C   LYS A 521      12.280  52.978  21.102  1.00  0.80           C  
ATOM   4206  O   LYS A 521      11.157  52.535  20.867  1.00  0.80           O  
ATOM   4207  CB  LYS A 521      13.776  50.962  21.457  1.00  0.80           C  
ATOM   4208  CG  LYS A 521      14.900  50.124  20.832  1.00  0.80           C  
ATOM   4209  CD  LYS A 521      15.124  48.783  21.541  1.00  0.80           C  
ATOM   4210  CE  LYS A 521      16.131  47.912  20.786  1.00  0.80           C  
ATOM   4211  NZ  LYS A 521      16.561  46.778  21.628  1.00  0.80           N  
ATOM   4212  N   LEU A 522      12.427  54.174  21.710  1.00  0.83           N  
ATOM   4213  CA  LEU A 522      11.302  55.038  21.999  1.00  0.83           C  
ATOM   4214  C   LEU A 522      10.712  55.697  20.749  1.00  0.83           C  
ATOM   4215  O   LEU A 522       9.562  56.133  20.758  1.00  0.83           O  
ATOM   4216  CB  LEU A 522      11.663  56.132  23.025  1.00  0.83           C  
ATOM   4217  CG  LEU A 522      11.967  55.635  24.452  1.00  0.83           C  
ATOM   4218  CD1 LEU A 522      12.373  56.834  25.318  1.00  0.83           C  
ATOM   4219  CD2 LEU A 522      10.780  54.899  25.095  1.00  0.83           C  
ATOM   4220  N   HIS A 523      11.427  55.722  19.598  1.00  0.80           N  
ATOM   4221  CA  HIS A 523      10.880  56.237  18.346  1.00  0.80           C  
ATOM   4222  C   HIS A 523       9.757  55.363  17.791  1.00  0.80           C  
ATOM   4223  O   HIS A 523       8.921  55.819  17.015  1.00  0.80           O  
ATOM   4224  CB  HIS A 523      11.964  56.419  17.256  1.00  0.80           C  
ATOM   4225  CG  HIS A 523      12.950  57.515  17.561  1.00  0.80           C  
ATOM   4226  ND1 HIS A 523      14.261  57.198  17.850  1.00  0.80           N  
ATOM   4227  CD2 HIS A 523      12.796  58.867  17.534  1.00  0.80           C  
ATOM   4228  CE1 HIS A 523      14.880  58.351  17.992  1.00  0.80           C  
ATOM   4229  NE2 HIS A 523      14.040  59.397  17.810  1.00  0.80           N  
ATOM   4230  N   SER A 524       9.634  54.107  18.263  1.00  0.78           N  
ATOM   4231  CA  SER A 524       8.532  53.212  17.921  1.00  0.78           C  
ATOM   4232  C   SER A 524       7.220  53.638  18.555  1.00  0.78           C  
ATOM   4233  O   SER A 524       6.157  53.139  18.204  1.00  0.78           O  
ATOM   4234  CB  SER A 524       8.818  51.741  18.314  1.00  0.78           C  
ATOM   4235  OG  SER A 524       9.974  51.275  17.616  1.00  0.78           O  
ATOM   4236  N   PHE A 525       7.258  54.616  19.480  1.00  0.81           N  
ATOM   4237  CA  PHE A 525       6.090  55.145  20.157  1.00  0.81           C  
ATOM   4238  C   PHE A 525       5.807  56.563  19.685  1.00  0.81           C  
ATOM   4239  O   PHE A 525       4.998  57.286  20.253  1.00  0.81           O  
ATOM   4240  CB  PHE A 525       6.297  55.159  21.695  1.00  0.81           C  
ATOM   4241  CG  PHE A 525       6.525  53.763  22.212  1.00  0.81           C  
ATOM   4242  CD1 PHE A 525       7.810  53.199  22.177  1.00  0.81           C  
ATOM   4243  CD2 PHE A 525       5.463  52.995  22.716  1.00  0.81           C  
ATOM   4244  CE1 PHE A 525       8.033  51.882  22.590  1.00  0.81           C  
ATOM   4245  CE2 PHE A 525       5.680  51.676  23.141  1.00  0.81           C  
ATOM   4246  CZ  PHE A 525       6.963  51.115  23.065  1.00  0.81           C  
ATOM   4247  N   LEU A 526       6.458  57.018  18.596  1.00  0.77           N  
ATOM   4248  CA  LEU A 526       6.365  58.392  18.126  1.00  0.77           C  
ATOM   4249  C   LEU A 526       5.013  58.759  17.526  1.00  0.77           C  
ATOM   4250  O   LEU A 526       4.581  59.912  17.558  1.00  0.77           O  
ATOM   4251  CB  LEU A 526       7.519  58.644  17.130  1.00  0.77           C  
ATOM   4252  CG  LEU A 526       7.833  60.115  16.793  1.00  0.77           C  
ATOM   4253  CD1 LEU A 526       8.093  60.966  18.046  1.00  0.77           C  
ATOM   4254  CD2 LEU A 526       9.049  60.171  15.856  1.00  0.77           C  
ATOM   4255  N   GLY A 527       4.291  57.754  16.987  1.00  0.75           N  
ATOM   4256  CA  GLY A 527       2.898  57.891  16.572  1.00  0.75           C  
ATOM   4257  C   GLY A 527       1.892  57.601  17.655  1.00  0.75           C  
ATOM   4258  O   GLY A 527       0.693  57.704  17.419  1.00  0.75           O  
ATOM   4259  N   ASP A 528       2.342  57.212  18.862  1.00  0.78           N  
ATOM   4260  CA  ASP A 528       1.465  56.836  19.949  1.00  0.78           C  
ATOM   4261  C   ASP A 528       1.147  58.050  20.814  1.00  0.78           C  
ATOM   4262  O   ASP A 528       1.999  58.644  21.472  1.00  0.78           O  
ATOM   4263  CB  ASP A 528       2.120  55.702  20.779  1.00  0.78           C  
ATOM   4264  CG  ASP A 528       1.235  55.157  21.888  1.00  0.78           C  
ATOM   4265  OD1 ASP A 528       1.730  54.275  22.629  1.00  0.78           O  
ATOM   4266  OD2 ASP A 528       0.083  55.638  22.043  1.00  0.78           O  
ATOM   4267  N   ASP A 529      -0.136  58.436  20.841  1.00  0.71           N  
ATOM   4268  CA  ASP A 529      -0.597  59.557  21.622  1.00  0.71           C  
ATOM   4269  C   ASP A 529      -0.910  59.139  23.063  1.00  0.71           C  
ATOM   4270  O   ASP A 529      -0.896  59.941  23.997  1.00  0.71           O  
ATOM   4271  CB  ASP A 529      -1.831  60.131  20.889  1.00  0.71           C  
ATOM   4272  CG  ASP A 529      -2.114  61.561  21.305  1.00  0.71           C  
ATOM   4273  OD1 ASP A 529      -3.274  61.850  21.687  1.00  0.71           O  
ATOM   4274  OD2 ASP A 529      -1.173  62.386  21.193  1.00  0.71           O  
ATOM   4275  N   VAL A 530      -1.132  57.829  23.309  1.00  0.78           N  
ATOM   4276  CA  VAL A 530      -1.406  57.294  24.635  1.00  0.78           C  
ATOM   4277  C   VAL A 530      -0.153  57.343  25.497  1.00  0.78           C  
ATOM   4278  O   VAL A 530      -0.173  57.775  26.650  1.00  0.78           O  
ATOM   4279  CB  VAL A 530      -1.964  55.874  24.593  1.00  0.78           C  
ATOM   4280  CG1 VAL A 530      -2.534  55.491  25.974  1.00  0.78           C  
ATOM   4281  CG2 VAL A 530      -3.074  55.793  23.525  1.00  0.78           C  
ATOM   4282  N   PHE A 531       0.998  56.963  24.911  1.00  0.77           N  
ATOM   4283  CA  PHE A 531       2.318  57.130  25.494  1.00  0.77           C  
ATOM   4284  C   PHE A 531       2.695  58.600  25.721  1.00  0.77           C  
ATOM   4285  O   PHE A 531       3.205  58.988  26.772  1.00  0.77           O  
ATOM   4286  CB  PHE A 531       3.342  56.397  24.584  1.00  0.77           C  
ATOM   4287  CG  PHE A 531       4.761  56.562  25.050  1.00  0.77           C  
ATOM   4288  CD1 PHE A 531       5.207  55.974  26.242  1.00  0.77           C  
ATOM   4289  CD2 PHE A 531       5.633  57.392  24.336  1.00  0.77           C  
ATOM   4290  CE1 PHE A 531       6.503  56.216  26.718  1.00  0.77           C  
ATOM   4291  CE2 PHE A 531       6.924  57.630  24.810  1.00  0.77           C  
ATOM   4292  CZ  PHE A 531       7.370  57.039  25.995  1.00  0.77           C  
ATOM   4293  N   LEU A 532       2.419  59.495  24.754  1.00  0.82           N  
ATOM   4294  CA  LEU A 532       2.662  60.926  24.907  1.00  0.82           C  
ATOM   4295  C   LEU A 532       1.840  61.557  26.028  1.00  0.82           C  
ATOM   4296  O   LEU A 532       2.336  62.392  26.789  1.00  0.82           O  
ATOM   4297  CB  LEU A 532       2.473  61.674  23.571  1.00  0.82           C  
ATOM   4298  CG  LEU A 532       3.766  61.828  22.740  1.00  0.82           C  
ATOM   4299  CD1 LEU A 532       4.594  60.545  22.590  1.00  0.82           C  
ATOM   4300  CD2 LEU A 532       3.408  62.373  21.357  1.00  0.82           C  
ATOM   4301  N   ARG A 533       0.585  61.096  26.211  1.00  0.76           N  
ATOM   4302  CA  ARG A 533      -0.254  61.377  27.362  1.00  0.76           C  
ATOM   4303  C   ARG A 533       0.410  60.995  28.676  1.00  0.76           C  
ATOM   4304  O   ARG A 533       0.304  61.740  29.650  1.00  0.76           O  
ATOM   4305  CB  ARG A 533      -1.629  60.660  27.181  1.00  0.76           C  
ATOM   4306  CG  ARG A 533      -2.596  60.568  28.388  1.00  0.76           C  
ATOM   4307  CD  ARG A 533      -2.265  59.476  29.433  1.00  0.76           C  
ATOM   4308  NE  ARG A 533      -3.296  59.479  30.528  1.00  0.76           N  
ATOM   4309  CZ  ARG A 533      -3.435  60.445  31.449  1.00  0.76           C  
ATOM   4310  NH1 ARG A 533      -2.716  61.562  31.418  1.00  0.76           N  
ATOM   4311  NH2 ARG A 533      -4.321  60.283  32.431  1.00  0.76           N  
ATOM   4312  N   GLU A 534       1.090  59.828  28.770  1.00  0.81           N  
ATOM   4313  CA  GLU A 534       1.863  59.443  29.944  1.00  0.81           C  
ATOM   4314  C   GLU A 534       3.079  60.340  30.157  1.00  0.81           C  
ATOM   4315  O   GLU A 534       3.352  60.802  31.264  1.00  0.81           O  
ATOM   4316  CB  GLU A 534       2.383  57.987  29.846  1.00  0.81           C  
ATOM   4317  CG  GLU A 534       1.314  56.878  29.699  1.00  0.81           C  
ATOM   4318  CD  GLU A 534       1.995  55.543  29.434  1.00  0.81           C  
ATOM   4319  OE1 GLU A 534       1.880  54.608  30.256  1.00  0.81           O  
ATOM   4320  OE2 GLU A 534       2.701  55.418  28.405  1.00  0.81           O  
ATOM   4321  N   LEU A 535       3.820  60.633  29.071  1.00  0.88           N  
ATOM   4322  CA  LEU A 535       5.047  61.412  29.058  1.00  0.88           C  
ATOM   4323  C   LEU A 535       4.866  62.844  29.552  1.00  0.88           C  
ATOM   4324  O   LEU A 535       5.609  63.339  30.402  1.00  0.88           O  
ATOM   4325  CB  LEU A 535       5.588  61.386  27.606  1.00  0.88           C  
ATOM   4326  CG  LEU A 535       7.026  61.890  27.388  1.00  0.88           C  
ATOM   4327  CD1 LEU A 535       8.054  60.991  28.091  1.00  0.88           C  
ATOM   4328  CD2 LEU A 535       7.323  61.948  25.881  1.00  0.88           C  
ATOM   4329  N   ALA A 536       3.803  63.524  29.080  1.00  0.88           N  
ATOM   4330  CA  ALA A 536       3.381  64.817  29.579  1.00  0.88           C  
ATOM   4331  C   ALA A 536       2.916  64.783  31.034  1.00  0.88           C  
ATOM   4332  O   ALA A 536       3.172  65.699  31.815  1.00  0.88           O  
ATOM   4333  CB  ALA A 536       2.271  65.378  28.677  1.00  0.88           C  
ATOM   4334  N   LYS A 537       2.233  63.692  31.444  1.00  0.83           N  
ATOM   4335  CA  LYS A 537       1.789  63.475  32.813  1.00  0.83           C  
ATOM   4336  C   LYS A 537       2.948  63.401  33.789  1.00  0.83           C  
ATOM   4337  O   LYS A 537       2.929  64.060  34.820  1.00  0.83           O  
ATOM   4338  CB  LYS A 537       0.933  62.182  32.912  1.00  0.83           C  
ATOM   4339  CG  LYS A 537      -0.343  62.295  33.762  1.00  0.83           C  
ATOM   4340  CD  LYS A 537      -0.159  62.074  35.272  1.00  0.83           C  
ATOM   4341  CE  LYS A 537       0.111  60.616  35.664  1.00  0.83           C  
ATOM   4342  NZ  LYS A 537       0.031  60.451  37.127  1.00  0.83           N  
ATOM   4343  N   VAL A 538       4.021  62.658  33.442  1.00  0.89           N  
ATOM   4344  CA  VAL A 538       5.259  62.570  34.212  1.00  0.89           C  
ATOM   4345  C   VAL A 538       5.923  63.923  34.405  1.00  0.89           C  
ATOM   4346  O   VAL A 538       6.341  64.279  35.507  1.00  0.89           O  
ATOM   4347  CB  VAL A 538       6.238  61.617  33.529  1.00  0.89           C  
ATOM   4348  CG1 VAL A 538       7.668  61.735  34.096  1.00  0.89           C  
ATOM   4349  CG2 VAL A 538       5.732  60.175  33.710  1.00  0.89           C  
ATOM   4350  N   LYS A 539       5.985  64.746  33.339  1.00  0.89           N  
ATOM   4351  CA  LYS A 539       6.481  66.106  33.430  1.00  0.89           C  
ATOM   4352  C   LYS A 539       5.662  66.969  34.380  1.00  0.89           C  
ATOM   4353  O   LYS A 539       6.208  67.681  35.217  1.00  0.89           O  
ATOM   4354  CB  LYS A 539       6.493  66.749  32.023  1.00  0.89           C  
ATOM   4355  CG  LYS A 539       7.073  68.174  31.954  1.00  0.89           C  
ATOM   4356  CD  LYS A 539       8.530  68.308  32.432  1.00  0.89           C  
ATOM   4357  CE  LYS A 539       9.511  67.482  31.597  1.00  0.89           C  
ATOM   4358  NZ  LYS A 539      10.886  67.728  32.052  1.00  0.89           N  
ATOM   4359  N   GLN A 540       4.321  66.876  34.322  1.00  0.85           N  
ATOM   4360  CA  GLN A 540       3.436  67.555  35.252  1.00  0.85           C  
ATOM   4361  C   GLN A 540       3.582  67.116  36.714  1.00  0.85           C  
ATOM   4362  O   GLN A 540       3.598  67.954  37.610  1.00  0.85           O  
ATOM   4363  CB  GLN A 540       1.971  67.483  34.761  1.00  0.85           C  
ATOM   4364  CG  GLN A 540       1.007  68.469  35.469  1.00  0.85           C  
ATOM   4365  CD  GLN A 540       1.465  69.931  35.396  1.00  0.85           C  
ATOM   4366  OE1 GLN A 540       1.964  70.505  36.361  1.00  0.85           O  
ATOM   4367  NE2 GLN A 540       1.303  70.572  34.218  1.00  0.85           N  
ATOM   4368  N   GLU A 541       3.775  65.809  37.006  1.00  0.85           N  
ATOM   4369  CA  GLU A 541       4.090  65.322  38.352  1.00  0.85           C  
ATOM   4370  C   GLU A 541       5.363  65.945  38.916  1.00  0.85           C  
ATOM   4371  O   GLU A 541       5.448  66.392  40.061  1.00  0.85           O  
ATOM   4372  CB  GLU A 541       4.339  63.789  38.353  1.00  0.85           C  
ATOM   4373  CG  GLU A 541       3.137  62.929  37.899  1.00  0.85           C  
ATOM   4374  CD  GLU A 541       1.952  62.952  38.852  1.00  0.85           C  
ATOM   4375  OE1 GLU A 541       0.849  62.569  38.368  1.00  0.85           O  
ATOM   4376  OE2 GLU A 541       2.132  63.244  40.051  1.00  0.85           O  
ATOM   4377  N   ASN A 542       6.411  66.021  38.071  1.00  0.89           N  
ATOM   4378  CA  ASN A 542       7.671  66.651  38.415  1.00  0.89           C  
ATOM   4379  C   ASN A 542       7.504  68.152  38.671  1.00  0.89           C  
ATOM   4380  O   ASN A 542       8.041  68.703  39.632  1.00  0.89           O  
ATOM   4381  CB  ASN A 542       8.721  66.438  37.291  1.00  0.89           C  
ATOM   4382  CG  ASN A 542       9.090  64.983  36.979  1.00  0.89           C  
ATOM   4383  OD1 ASN A 542       9.816  64.735  36.017  1.00  0.89           O  
ATOM   4384  ND2 ASN A 542       8.630  63.996  37.778  1.00  0.89           N  
ATOM   4385  N   LYS A 543       6.714  68.836  37.819  1.00  0.88           N  
ATOM   4386  CA  LYS A 543       6.340  70.231  37.968  1.00  0.88           C  
ATOM   4387  C   LYS A 543       5.507  70.553  39.198  1.00  0.88           C  
ATOM   4388  O   LYS A 543       5.764  71.557  39.855  1.00  0.88           O  
ATOM   4389  CB  LYS A 543       5.627  70.755  36.700  1.00  0.88           C  
ATOM   4390  CG  LYS A 543       6.597  70.846  35.517  1.00  0.88           C  
ATOM   4391  CD  LYS A 543       5.945  71.092  34.148  1.00  0.88           C  
ATOM   4392  CE  LYS A 543       5.357  72.489  33.976  1.00  0.88           C  
ATOM   4393  NZ  LYS A 543       5.053  72.738  32.557  1.00  0.88           N  
ATOM   4394  N   LEU A 544       4.521  69.715  39.588  1.00  0.87           N  
ATOM   4395  CA  LEU A 544       3.788  69.878  40.842  1.00  0.87           C  
ATOM   4396  C   LEU A 544       4.699  69.847  42.064  1.00  0.87           C  
ATOM   4397  O   LEU A 544       4.642  70.729  42.920  1.00  0.87           O  
ATOM   4398  CB  LEU A 544       2.711  68.774  41.041  1.00  0.87           C  
ATOM   4399  CG  LEU A 544       1.270  69.214  40.713  1.00  0.87           C  
ATOM   4400  CD1 LEU A 544       0.981  69.138  39.214  1.00  0.87           C  
ATOM   4401  CD2 LEU A 544       0.258  68.354  41.485  1.00  0.87           C  
ATOM   4402  N   LYS A 545       5.617  68.859  42.138  1.00  0.81           N  
ATOM   4403  CA  LYS A 545       6.596  68.757  43.209  1.00  0.81           C  
ATOM   4404  C   LYS A 545       7.530  69.962  43.263  1.00  0.81           C  
ATOM   4405  O   LYS A 545       7.797  70.524  44.326  1.00  0.81           O  
ATOM   4406  CB  LYS A 545       7.424  67.452  43.047  1.00  0.81           C  
ATOM   4407  CG  LYS A 545       8.406  67.170  44.201  1.00  0.81           C  
ATOM   4408  CD  LYS A 545       9.377  66.011  43.905  1.00  0.81           C  
ATOM   4409  CE  LYS A 545      10.440  65.852  45.004  1.00  0.81           C  
ATOM   4410  NZ  LYS A 545      11.388  64.754  44.699  1.00  0.81           N  
ATOM   4411  N   PHE A 546       8.036  70.424  42.102  1.00  0.86           N  
ATOM   4412  CA  PHE A 546       8.874  71.607  42.048  1.00  0.86           C  
ATOM   4413  C   PHE A 546       8.127  72.910  42.356  1.00  0.86           C  
ATOM   4414  O   PHE A 546       8.670  73.794  43.014  1.00  0.86           O  
ATOM   4415  CB  PHE A 546       9.693  71.648  40.734  1.00  0.86           C  
ATOM   4416  CG  PHE A 546      10.921  72.505  40.904  1.00  0.86           C  
ATOM   4417  CD1 PHE A 546      11.956  72.088  41.760  1.00  0.86           C  
ATOM   4418  CD2 PHE A 546      11.033  73.747  40.261  1.00  0.86           C  
ATOM   4419  CE1 PHE A 546      13.059  72.915  42.005  1.00  0.86           C  
ATOM   4420  CE2 PHE A 546      12.137  74.576  40.504  1.00  0.86           C  
ATOM   4421  CZ  PHE A 546      13.144  74.164  41.383  1.00  0.86           C  
ATOM   4422  N   SER A 547       6.837  73.047  41.971  1.00  0.83           N  
ATOM   4423  CA  SER A 547       5.982  74.163  42.382  1.00  0.83           C  
ATOM   4424  C   SER A 547       5.872  74.273  43.885  1.00  0.83           C  
ATOM   4425  O   SER A 547       6.000  75.359  44.438  1.00  0.83           O  
ATOM   4426  CB  SER A 547       4.524  74.058  41.863  1.00  0.83           C  
ATOM   4427  OG  SER A 547       4.477  74.237  40.452  1.00  0.83           O  
ATOM   4428  N   GLN A 548       5.705  73.138  44.601  1.00  0.77           N  
ATOM   4429  CA  GLN A 548       5.711  73.120  46.057  1.00  0.77           C  
ATOM   4430  C   GLN A 548       7.022  73.609  46.649  1.00  0.77           C  
ATOM   4431  O   GLN A 548       7.031  74.402  47.585  1.00  0.77           O  
ATOM   4432  CB  GLN A 548       5.458  71.703  46.629  1.00  0.77           C  
ATOM   4433  CG  GLN A 548       4.077  71.108  46.274  1.00  0.77           C  
ATOM   4434  CD  GLN A 548       3.930  69.655  46.732  1.00  0.77           C  
ATOM   4435  OE1 GLN A 548       3.264  68.842  46.095  1.00  0.77           O  
ATOM   4436  NE2 GLN A 548       4.570  69.300  47.871  1.00  0.77           N  
ATOM   4437  N   PHE A 549       8.170  73.182  46.080  1.00  0.81           N  
ATOM   4438  CA  PHE A 549       9.483  73.664  46.482  1.00  0.81           C  
ATOM   4439  C   PHE A 549       9.601  75.177  46.294  1.00  0.81           C  
ATOM   4440  O   PHE A 549      10.005  75.909  47.192  1.00  0.81           O  
ATOM   4441  CB  PHE A 549      10.562  72.899  45.657  1.00  0.81           C  
ATOM   4442  CG  PHE A 549      11.969  73.315  45.988  1.00  0.81           C  
ATOM   4443  CD1 PHE A 549      12.632  72.783  47.104  1.00  0.81           C  
ATOM   4444  CD2 PHE A 549      12.625  74.272  45.194  1.00  0.81           C  
ATOM   4445  CE1 PHE A 549      13.924  73.213  47.433  1.00  0.81           C  
ATOM   4446  CE2 PHE A 549      13.914  74.707  45.521  1.00  0.81           C  
ATOM   4447  CZ  PHE A 549      14.562  74.179  46.644  1.00  0.81           C  
ATOM   4448  N   LEU A 550       9.169  75.692  45.131  1.00  0.79           N  
ATOM   4449  CA  LEU A 550       9.137  77.110  44.851  1.00  0.79           C  
ATOM   4450  C   LEU A 550       8.206  77.924  45.752  1.00  0.79           C  
ATOM   4451  O   LEU A 550       8.608  78.968  46.268  1.00  0.79           O  
ATOM   4452  CB  LEU A 550       8.770  77.333  43.370  1.00  0.79           C  
ATOM   4453  CG  LEU A 550       9.839  76.873  42.357  1.00  0.79           C  
ATOM   4454  CD1 LEU A 550       9.241  76.839  40.943  1.00  0.79           C  
ATOM   4455  CD2 LEU A 550      11.070  77.785  42.389  1.00  0.79           C  
ATOM   4456  N   GLU A 551       6.959  77.464  46.013  1.00  0.74           N  
ATOM   4457  CA  GLU A 551       6.051  78.125  46.946  1.00  0.74           C  
ATOM   4458  C   GLU A 551       6.594  78.146  48.375  1.00  0.74           C  
ATOM   4459  O   GLU A 551       6.622  79.196  49.019  1.00  0.74           O  
ATOM   4460  CB  GLU A 551       4.598  77.553  46.891  1.00  0.74           C  
ATOM   4461  CG  GLU A 551       3.899  77.892  45.546  1.00  0.74           C  
ATOM   4462  CD  GLU A 551       2.400  77.654  45.435  1.00  0.74           C  
ATOM   4463  OE1 GLU A 551       1.647  77.502  46.427  1.00  0.74           O  
ATOM   4464  OE2 GLU A 551       1.922  77.723  44.268  1.00  0.74           O  
ATOM   4465  N   THR A 552       7.120  77.013  48.889  1.00  0.75           N  
ATOM   4466  CA  THR A 552       7.734  76.940  50.218  1.00  0.75           C  
ATOM   4467  C   THR A 552       8.989  77.773  50.367  1.00  0.75           C  
ATOM   4468  O   THR A 552       9.086  78.606  51.272  1.00  0.75           O  
ATOM   4469  CB  THR A 552       8.092  75.506  50.597  1.00  0.75           C  
ATOM   4470  OG1 THR A 552       6.906  74.730  50.673  1.00  0.75           O  
ATOM   4471  CG2 THR A 552       8.767  75.400  51.974  1.00  0.75           C  
ATOM   4472  N   GLU A 553       9.981  77.629  49.467  1.00  0.74           N  
ATOM   4473  CA  GLU A 553      11.238  78.349  49.587  1.00  0.74           C  
ATOM   4474  C   GLU A 553      11.132  79.830  49.263  1.00  0.74           C  
ATOM   4475  O   GLU A 553      11.634  80.672  50.010  1.00  0.74           O  
ATOM   4476  CB  GLU A 553      12.383  77.646  48.810  1.00  0.74           C  
ATOM   4477  CG  GLU A 553      13.447  76.986  49.730  1.00  0.74           C  
ATOM   4478  CD  GLU A 553      12.885  75.906  50.657  1.00  0.74           C  
ATOM   4479  OE1 GLU A 553      12.256  76.282  51.681  1.00  0.74           O  
ATOM   4480  OE2 GLU A 553      13.112  74.705  50.362  1.00  0.74           O  
ATOM   4481  N   TYR A 554      10.420  80.219  48.188  1.00  0.73           N  
ATOM   4482  CA  TYR A 554      10.467  81.595  47.716  1.00  0.73           C  
ATOM   4483  C   TYR A 554       9.234  82.411  48.046  1.00  0.73           C  
ATOM   4484  O   TYR A 554       9.283  83.634  47.957  1.00  0.73           O  
ATOM   4485  CB  TYR A 554      10.661  81.618  46.175  1.00  0.73           C  
ATOM   4486  CG  TYR A 554      12.024  81.071  45.842  1.00  0.73           C  
ATOM   4487  CD1 TYR A 554      12.217  79.702  45.586  1.00  0.73           C  
ATOM   4488  CD2 TYR A 554      13.146  81.915  45.881  1.00  0.73           C  
ATOM   4489  CE1 TYR A 554      13.507  79.173  45.452  1.00  0.73           C  
ATOM   4490  CE2 TYR A 554      14.440  81.388  45.751  1.00  0.73           C  
ATOM   4491  CZ  TYR A 554      14.616  80.012  45.568  1.00  0.73           C  
ATOM   4492  OH  TYR A 554      15.902  79.445  45.577  1.00  0.73           O  
ATOM   4493  N   LYS A 555       8.115  81.782  48.472  1.00  0.69           N  
ATOM   4494  CA  LYS A 555       6.859  82.467  48.791  1.00  0.69           C  
ATOM   4495  C   LYS A 555       6.263  83.193  47.580  1.00  0.69           C  
ATOM   4496  O   LYS A 555       5.703  84.284  47.667  1.00  0.69           O  
ATOM   4497  CB  LYS A 555       6.955  83.398  50.040  1.00  0.69           C  
ATOM   4498  CG  LYS A 555       6.757  82.711  51.408  1.00  0.69           C  
ATOM   4499  CD  LYS A 555       7.756  81.597  51.772  1.00  0.69           C  
ATOM   4500  CE  LYS A 555       9.213  82.052  51.898  1.00  0.69           C  
ATOM   4501  NZ  LYS A 555      10.062  80.898  52.252  1.00  0.69           N  
ATOM   4502  N   VAL A 556       6.348  82.558  46.400  1.00  0.74           N  
ATOM   4503  CA  VAL A 556       5.862  83.107  45.148  1.00  0.74           C  
ATOM   4504  C   VAL A 556       4.838  82.149  44.597  1.00  0.74           C  
ATOM   4505  O   VAL A 556       5.112  80.965  44.440  1.00  0.74           O  
ATOM   4506  CB  VAL A 556       6.990  83.274  44.129  1.00  0.74           C  
ATOM   4507  CG1 VAL A 556       6.452  83.594  42.721  1.00  0.74           C  
ATOM   4508  CG2 VAL A 556       7.919  84.410  44.589  1.00  0.74           C  
ATOM   4509  N   LYS A 557       3.610  82.626  44.281  1.00  0.71           N  
ATOM   4510  CA  LYS A 557       2.588  81.764  43.721  1.00  0.71           C  
ATOM   4511  C   LYS A 557       2.916  81.303  42.312  1.00  0.71           C  
ATOM   4512  O   LYS A 557       2.919  82.100  41.364  1.00  0.71           O  
ATOM   4513  CB  LYS A 557       1.174  82.416  43.745  1.00  0.71           C  
ATOM   4514  CG  LYS A 557       0.019  81.453  43.392  1.00  0.71           C  
ATOM   4515  CD  LYS A 557      -0.093  80.323  44.432  1.00  0.71           C  
ATOM   4516  CE  LYS A 557      -0.982  79.140  44.042  1.00  0.71           C  
ATOM   4517  NZ  LYS A 557      -0.623  77.984  44.885  1.00  0.71           N  
ATOM   4518  N   ILE A 558       3.194  79.996  42.161  1.00  0.82           N  
ATOM   4519  CA  ILE A 558       3.559  79.378  40.904  1.00  0.82           C  
ATOM   4520  C   ILE A 558       2.310  78.868  40.204  1.00  0.82           C  
ATOM   4521  O   ILE A 558       1.322  78.468  40.816  1.00  0.82           O  
ATOM   4522  CB  ILE A 558       4.597  78.271  41.105  1.00  0.82           C  
ATOM   4523  CG1 ILE A 558       5.853  78.801  41.838  1.00  0.82           C  
ATOM   4524  CG2 ILE A 558       5.024  77.588  39.785  1.00  0.82           C  
ATOM   4525  CD1 ILE A 558       6.625  79.921  41.125  1.00  0.82           C  
ATOM   4526  N   ASN A 559       2.300  78.909  38.861  1.00  0.85           N  
ATOM   4527  CA  ASN A 559       1.245  78.330  38.064  1.00  0.85           C  
ATOM   4528  C   ASN A 559       1.740  76.949  37.613  1.00  0.85           C  
ATOM   4529  O   ASN A 559       2.776  76.902  36.955  1.00  0.85           O  
ATOM   4530  CB  ASN A 559       0.946  79.312  36.898  1.00  0.85           C  
ATOM   4531  CG  ASN A 559      -0.114  78.826  35.913  1.00  0.85           C  
ATOM   4532  OD1 ASN A 559      -0.517  77.665  35.870  1.00  0.85           O  
ATOM   4533  ND2 ASN A 559      -0.576  79.766  35.059  1.00  0.85           N  
ATOM   4534  N   PRO A 560       1.115  75.810  37.908  1.00  0.88           N  
ATOM   4535  CA  PRO A 560       1.648  74.507  37.499  1.00  0.88           C  
ATOM   4536  C   PRO A 560       1.512  74.237  36.009  1.00  0.88           C  
ATOM   4537  O   PRO A 560       2.278  73.459  35.446  1.00  0.88           O  
ATOM   4538  CB  PRO A 560       0.832  73.499  38.326  1.00  0.88           C  
ATOM   4539  CG  PRO A 560       0.395  74.295  39.557  1.00  0.88           C  
ATOM   4540  CD  PRO A 560       0.116  75.676  38.972  1.00  0.88           C  
ATOM   4541  N   SER A 561       0.533  74.862  35.331  1.00  0.88           N  
ATOM   4542  CA  SER A 561       0.281  74.652  33.907  1.00  0.88           C  
ATOM   4543  C   SER A 561       1.227  75.472  33.049  1.00  0.88           C  
ATOM   4544  O   SER A 561       1.384  75.247  31.848  1.00  0.88           O  
ATOM   4545  CB  SER A 561      -1.167  75.043  33.528  1.00  0.88           C  
ATOM   4546  OG  SER A 561      -2.093  74.191  34.201  1.00  0.88           O  
ATOM   4547  N   SER A 562       1.905  76.437  33.700  1.00  0.91           N  
ATOM   4548  CA  SER A 562       2.984  77.279  33.199  1.00  0.91           C  
ATOM   4549  C   SER A 562       4.116  76.525  32.531  1.00  0.91           C  
ATOM   4550  O   SER A 562       4.359  75.362  32.839  1.00  0.91           O  
ATOM   4551  CB  SER A 562       3.602  78.054  34.377  1.00  0.91           C  
ATOM   4552  OG  SER A 562       4.348  79.187  33.975  1.00  0.91           O  
ATOM   4553  N   MET A 563       4.860  77.153  31.600  1.00  0.91           N  
ATOM   4554  CA  MET A 563       5.921  76.478  30.870  1.00  0.91           C  
ATOM   4555  C   MET A 563       7.020  75.863  31.723  1.00  0.91           C  
ATOM   4556  O   MET A 563       7.255  74.672  31.623  1.00  0.91           O  
ATOM   4557  CB  MET A 563       6.544  77.442  29.831  1.00  0.91           C  
ATOM   4558  CG  MET A 563       7.555  76.774  28.872  1.00  0.91           C  
ATOM   4559  SD  MET A 563       8.344  77.916  27.699  1.00  0.91           S  
ATOM   4560  CE  MET A 563       6.953  78.041  26.541  1.00  0.91           C  
ATOM   4561  N   PHE A 564       7.666  76.631  32.621  1.00  0.93           N  
ATOM   4562  CA  PHE A 564       8.889  76.227  33.319  1.00  0.93           C  
ATOM   4563  C   PHE A 564      10.069  76.327  32.367  1.00  0.93           C  
ATOM   4564  O   PHE A 564      10.512  75.372  31.724  1.00  0.93           O  
ATOM   4565  CB  PHE A 564       8.908  74.875  34.094  1.00  0.93           C  
ATOM   4566  CG  PHE A 564       8.101  74.861  35.367  1.00  0.93           C  
ATOM   4567  CD1 PHE A 564       6.885  75.554  35.538  1.00  0.93           C  
ATOM   4568  CD2 PHE A 564       8.567  74.059  36.424  1.00  0.93           C  
ATOM   4569  CE1 PHE A 564       6.156  75.438  36.727  1.00  0.93           C  
ATOM   4570  CE2 PHE A 564       7.847  73.948  37.615  1.00  0.93           C  
ATOM   4571  CZ  PHE A 564       6.641  74.637  37.763  1.00  0.93           C  
ATOM   4572  N   ASP A 565      10.558  77.565  32.283  1.00  0.96           N  
ATOM   4573  CA  ASP A 565      11.546  78.092  31.393  1.00  0.96           C  
ATOM   4574  C   ASP A 565      12.776  78.312  32.257  1.00  0.96           C  
ATOM   4575  O   ASP A 565      12.747  79.135  33.171  1.00  0.96           O  
ATOM   4576  CB  ASP A 565      10.860  79.396  30.902  1.00  0.96           C  
ATOM   4577  CG  ASP A 565      11.647  80.213  29.913  1.00  0.96           C  
ATOM   4578  OD1 ASP A 565      12.812  79.875  29.640  1.00  0.96           O  
ATOM   4579  OD2 ASP A 565      11.040  81.193  29.403  1.00  0.96           O  
ATOM   4580  N   VAL A 566      13.853  77.506  32.089  1.00  0.97           N  
ATOM   4581  CA  VAL A 566      14.957  77.546  33.043  1.00  0.97           C  
ATOM   4582  C   VAL A 566      16.324  77.714  32.431  1.00  0.97           C  
ATOM   4583  O   VAL A 566      16.721  77.085  31.447  1.00  0.97           O  
ATOM   4584  CB  VAL A 566      14.991  76.464  34.140  1.00  0.97           C  
ATOM   4585  CG1 VAL A 566      13.571  75.949  34.448  1.00  0.97           C  
ATOM   4586  CG2 VAL A 566      15.962  75.304  33.835  1.00  0.97           C  
ATOM   4587  N   GLN A 567      17.119  78.567  33.092  1.00  0.94           N  
ATOM   4588  CA  GLN A 567      18.491  78.807  32.763  1.00  0.94           C  
ATOM   4589  C   GLN A 567      19.334  78.679  34.008  1.00  0.94           C  
ATOM   4590  O   GLN A 567      19.441  79.597  34.818  1.00  0.94           O  
ATOM   4591  CB  GLN A 567      18.615  80.234  32.220  1.00  0.94           C  
ATOM   4592  CG  GLN A 567      19.976  80.522  31.554  1.00  0.94           C  
ATOM   4593  CD  GLN A 567      20.022  81.917  30.948  1.00  0.94           C  
ATOM   4594  OE1 GLN A 567      20.908  82.265  30.167  1.00  0.94           O  
ATOM   4595  NE2 GLN A 567      19.056  82.772  31.338  1.00  0.94           N  
ATOM   4596  N   VAL A 568      19.981  77.519  34.194  1.00  0.95           N  
ATOM   4597  CA  VAL A 568      20.814  77.291  35.359  1.00  0.95           C  
ATOM   4598  C   VAL A 568      22.237  76.968  34.928  1.00  0.95           C  
ATOM   4599  O   VAL A 568      22.459  76.157  34.019  1.00  0.95           O  
ATOM   4600  CB  VAL A 568      20.237  76.269  36.330  1.00  0.95           C  
ATOM   4601  CG1 VAL A 568      18.977  76.841  37.009  1.00  0.95           C  
ATOM   4602  CG2 VAL A 568      19.860  74.973  35.606  1.00  0.95           C  
ATOM   4603  N   LYS A 569      23.224  77.672  35.539  1.00  0.85           N  
ATOM   4604  CA  LYS A 569      24.642  77.722  35.173  1.00  0.85           C  
ATOM   4605  C   LYS A 569      25.303  78.935  35.825  1.00  0.85           C  
ATOM   4606  O   LYS A 569      24.624  79.821  36.319  1.00  0.85           O  
ATOM   4607  CB  LYS A 569      24.921  77.791  33.641  1.00  0.85           C  
ATOM   4608  CG  LYS A 569      24.247  78.988  32.948  1.00  0.85           C  
ATOM   4609  CD  LYS A 569      24.020  78.819  31.435  1.00  0.85           C  
ATOM   4610  CE  LYS A 569      22.715  78.112  31.032  1.00  0.85           C  
ATOM   4611  NZ  LYS A 569      22.761  76.650  31.232  1.00  0.85           N  
ATOM   4612  N   ARG A 570      26.656  79.003  35.894  1.00  0.80           N  
ATOM   4613  CA  ARG A 570      27.358  80.148  36.475  1.00  0.80           C  
ATOM   4614  C   ARG A 570      27.061  81.497  35.819  1.00  0.80           C  
ATOM   4615  O   ARG A 570      26.954  81.612  34.597  1.00  0.80           O  
ATOM   4616  CB  ARG A 570      28.901  79.949  36.541  1.00  0.80           C  
ATOM   4617  CG  ARG A 570      29.633  79.754  35.190  1.00  0.80           C  
ATOM   4618  CD  ARG A 570      31.121  80.124  35.304  1.00  0.80           C  
ATOM   4619  NE  ARG A 570      31.863  79.632  34.093  1.00  0.80           N  
ATOM   4620  CZ  ARG A 570      33.159  79.898  33.872  1.00  0.80           C  
ATOM   4621  NH1 ARG A 570      33.819  80.799  34.591  1.00  0.80           N  
ATOM   4622  NH2 ARG A 570      33.801  79.273  32.886  1.00  0.80           N  
ATOM   4623  N   ILE A 571      26.949  82.563  36.638  1.00  0.89           N  
ATOM   4624  CA  ILE A 571      26.598  83.887  36.155  1.00  0.89           C  
ATOM   4625  C   ILE A 571      27.823  84.546  35.544  1.00  0.89           C  
ATOM   4626  O   ILE A 571      28.860  84.737  36.181  1.00  0.89           O  
ATOM   4627  CB  ILE A 571      25.978  84.783  37.222  1.00  0.89           C  
ATOM   4628  CG1 ILE A 571      24.839  84.069  37.994  1.00  0.89           C  
ATOM   4629  CG2 ILE A 571      25.471  86.093  36.578  1.00  0.89           C  
ATOM   4630  CD1 ILE A 571      23.659  83.582  37.144  1.00  0.89           C  
ATOM   4631  N   HIS A 572      27.742  84.858  34.242  1.00  0.87           N  
ATOM   4632  CA  HIS A 572      28.862  85.347  33.475  1.00  0.87           C  
ATOM   4633  C   HIS A 572      28.299  86.008  32.234  1.00  0.87           C  
ATOM   4634  O   HIS A 572      27.244  85.609  31.751  1.00  0.87           O  
ATOM   4635  CB  HIS A 572      29.787  84.159  33.077  1.00  0.87           C  
ATOM   4636  CG  HIS A 572      31.257  84.461  33.085  1.00  0.87           C  
ATOM   4637  ND1 HIS A 572      31.766  85.401  32.216  1.00  0.87           N  
ATOM   4638  CD2 HIS A 572      32.254  83.962  33.865  1.00  0.87           C  
ATOM   4639  CE1 HIS A 572      33.060  85.457  32.472  1.00  0.87           C  
ATOM   4640  NE2 HIS A 572      33.408  84.606  33.467  1.00  0.87           N  
ATOM   4641  N   GLU A 573      28.972  87.019  31.663  1.00  0.89           N  
ATOM   4642  CA  GLU A 573      28.505  87.716  30.477  1.00  0.89           C  
ATOM   4643  C   GLU A 573      28.374  86.852  29.222  1.00  0.89           C  
ATOM   4644  O   GLU A 573      27.388  86.948  28.491  1.00  0.89           O  
ATOM   4645  CB  GLU A 573      29.437  88.906  30.181  1.00  0.89           C  
ATOM   4646  CG  GLU A 573      29.390  90.019  31.254  1.00  0.89           C  
ATOM   4647  CD  GLU A 573      30.462  91.071  30.987  1.00  0.89           C  
ATOM   4648  OE1 GLU A 573      30.458  91.636  29.866  1.00  0.89           O  
ATOM   4649  OE2 GLU A 573      31.283  91.317  31.908  1.00  0.89           O  
ATOM   4650  N   TYR A 574      29.340  85.942  28.948  1.00  0.83           N  
ATOM   4651  CA  TYR A 574      29.285  85.055  27.784  1.00  0.83           C  
ATOM   4652  C   TYR A 574      28.110  84.097  27.779  1.00  0.83           C  
ATOM   4653  O   TYR A 574      27.485  83.864  26.748  1.00  0.83           O  
ATOM   4654  CB  TYR A 574      30.619  84.302  27.512  1.00  0.83           C  
ATOM   4655  CG  TYR A 574      30.894  83.110  28.392  1.00  0.83           C  
ATOM   4656  CD1 TYR A 574      30.638  81.798  27.953  1.00  0.83           C  
ATOM   4657  CD2 TYR A 574      31.463  83.298  29.654  1.00  0.83           C  
ATOM   4658  CE1 TYR A 574      30.948  80.699  28.763  1.00  0.83           C  
ATOM   4659  CE2 TYR A 574      31.771  82.205  30.474  1.00  0.83           C  
ATOM   4660  CZ  TYR A 574      31.508  80.907  30.024  1.00  0.83           C  
ATOM   4661  OH  TYR A 574      31.847  79.823  30.850  1.00  0.83           O  
ATOM   4662  N   LYS A 575      27.752  83.598  28.982  1.00  0.86           N  
ATOM   4663  CA  LYS A 575      26.629  82.718  29.246  1.00  0.86           C  
ATOM   4664  C   LYS A 575      25.295  83.394  29.000  1.00  0.86           C  
ATOM   4665  O   LYS A 575      24.254  82.742  28.958  1.00  0.86           O  
ATOM   4666  CB  LYS A 575      26.641  82.278  30.736  1.00  0.86           C  
ATOM   4667  CG  LYS A 575      27.743  81.282  31.123  1.00  0.86           C  
ATOM   4668  CD  LYS A 575      27.585  79.949  30.384  1.00  0.86           C  
ATOM   4669  CE  LYS A 575      28.511  78.837  30.873  1.00  0.86           C  
ATOM   4670  NZ  LYS A 575      28.464  77.723  29.920  1.00  0.86           N  
ATOM   4671  N   ARG A 576      25.319  84.731  28.846  1.00  0.84           N  
ATOM   4672  CA  ARG A 576      24.180  85.591  28.689  1.00  0.84           C  
ATOM   4673  C   ARG A 576      23.431  85.766  29.999  1.00  0.84           C  
ATOM   4674  O   ARG A 576      23.862  86.554  30.838  1.00  0.84           O  
ATOM   4675  CB  ARG A 576      23.289  85.251  27.456  1.00  0.84           C  
ATOM   4676  CG  ARG A 576      23.619  86.017  26.155  1.00  0.84           C  
ATOM   4677  CD  ARG A 576      24.905  85.594  25.438  1.00  0.84           C  
ATOM   4678  NE  ARG A 576      25.011  86.423  24.185  1.00  0.84           N  
ATOM   4679  CZ  ARG A 576      24.483  86.124  22.990  1.00  0.84           C  
ATOM   4680  NH1 ARG A 576      23.717  85.069  22.754  1.00  0.84           N  
ATOM   4681  NH2 ARG A 576      24.738  86.923  21.957  1.00  0.84           N  
ATOM   4682  N   GLN A 577      22.245  85.137  30.164  1.00  0.89           N  
ATOM   4683  CA  GLN A 577      21.225  85.383  31.188  1.00  0.89           C  
ATOM   4684  C   GLN A 577      20.656  86.795  31.281  1.00  0.89           C  
ATOM   4685  O   GLN A 577      19.472  86.992  31.540  1.00  0.89           O  
ATOM   4686  CB  GLN A 577      21.428  84.721  32.578  1.00  0.89           C  
ATOM   4687  CG  GLN A 577      22.648  85.145  33.421  1.00  0.89           C  
ATOM   4688  CD  GLN A 577      23.719  84.057  33.391  1.00  0.89           C  
ATOM   4689  OE1 GLN A 577      23.507  82.934  33.847  1.00  0.89           O  
ATOM   4690  NE2 GLN A 577      24.909  84.369  32.844  1.00  0.89           N  
ATOM   4691  N   LEU A 578      21.461  87.806  30.930  1.00  0.92           N  
ATOM   4692  CA  LEU A 578      21.094  89.170  30.650  1.00  0.92           C  
ATOM   4693  C   LEU A 578      20.146  89.228  29.460  1.00  0.92           C  
ATOM   4694  O   LEU A 578      19.102  89.867  29.502  1.00  0.92           O  
ATOM   4695  CB  LEU A 578      22.401  89.936  30.345  1.00  0.92           C  
ATOM   4696  CG  LEU A 578      22.455  91.387  30.844  1.00  0.92           C  
ATOM   4697  CD1 LEU A 578      23.825  91.961  30.468  1.00  0.92           C  
ATOM   4698  CD2 LEU A 578      21.324  92.278  30.313  1.00  0.92           C  
ATOM   4699  N   LEU A 579      20.461  88.463  28.387  1.00  0.94           N  
ATOM   4700  CA  LEU A 579      19.620  88.296  27.209  1.00  0.94           C  
ATOM   4701  C   LEU A 579      18.254  87.697  27.530  1.00  0.94           C  
ATOM   4702  O   LEU A 579      17.223  88.177  27.061  1.00  0.94           O  
ATOM   4703  CB  LEU A 579      20.363  87.424  26.164  1.00  0.94           C  
ATOM   4704  CG  LEU A 579      19.626  87.165  24.835  1.00  0.94           C  
ATOM   4705  CD1 LEU A 579      19.221  88.463  24.130  1.00  0.94           C  
ATOM   4706  CD2 LEU A 579      20.479  86.314  23.883  1.00  0.94           C  
ATOM   4707  N   ASN A 580      18.212  86.670  28.409  1.00  0.94           N  
ATOM   4708  CA  ASN A 580      16.980  86.113  28.946  1.00  0.94           C  
ATOM   4709  C   ASN A 580      16.201  87.138  29.732  1.00  0.94           C  
ATOM   4710  O   ASN A 580      15.011  87.307  29.516  1.00  0.94           O  
ATOM   4711  CB  ASN A 580      17.297  84.870  29.811  1.00  0.94           C  
ATOM   4712  CG  ASN A 580      16.099  84.070  30.347  1.00  0.94           C  
ATOM   4713  OD1 ASN A 580      16.246  83.469  31.411  1.00  0.94           O  
ATOM   4714  ND2 ASN A 580      14.939  84.059  29.671  1.00  0.94           N  
ATOM   4715  N   CYS A 581      16.872  87.916  30.596  1.00  0.95           N  
ATOM   4716  CA  CYS A 581      16.240  88.996  31.328  1.00  0.95           C  
ATOM   4717  C   CYS A 581      15.659  90.097  30.444  1.00  0.95           C  
ATOM   4718  O   CYS A 581      14.569  90.591  30.714  1.00  0.95           O  
ATOM   4719  CB  CYS A 581      17.165  89.585  32.414  1.00  0.95           C  
ATOM   4720  SG  CYS A 581      16.167  90.231  33.802  1.00  0.95           S  
ATOM   4721  N   LEU A 582      16.317  90.463  29.316  1.00  0.94           N  
ATOM   4722  CA  LEU A 582      15.715  91.334  28.311  1.00  0.94           C  
ATOM   4723  C   LEU A 582      14.404  90.772  27.782  1.00  0.94           C  
ATOM   4724  O   LEU A 582      13.390  91.459  27.752  1.00  0.94           O  
ATOM   4725  CB  LEU A 582      16.618  91.542  27.062  1.00  0.94           C  
ATOM   4726  CG  LEU A 582      17.986  92.212  27.285  1.00  0.94           C  
ATOM   4727  CD1 LEU A 582      18.719  92.347  25.941  1.00  0.94           C  
ATOM   4728  CD2 LEU A 582      17.859  93.584  27.950  1.00  0.94           C  
ATOM   4729  N   HIS A 583      14.374  89.472  27.427  1.00  0.93           N  
ATOM   4730  CA  HIS A 583      13.157  88.793  27.016  1.00  0.93           C  
ATOM   4731  C   HIS A 583      12.079  88.734  28.091  1.00  0.93           C  
ATOM   4732  O   HIS A 583      10.905  88.942  27.800  1.00  0.93           O  
ATOM   4733  CB  HIS A 583      13.466  87.381  26.488  1.00  0.93           C  
ATOM   4734  CG  HIS A 583      12.266  86.621  26.015  1.00  0.93           C  
ATOM   4735  ND1 HIS A 583      11.881  85.493  26.703  1.00  0.93           N  
ATOM   4736  CD2 HIS A 583      11.394  86.876  25.008  1.00  0.93           C  
ATOM   4737  CE1 HIS A 583      10.783  85.080  26.110  1.00  0.93           C  
ATOM   4738  NE2 HIS A 583      10.441  85.884  25.073  1.00  0.93           N  
ATOM   4739  N   VAL A 584      12.440  88.506  29.368  1.00  0.96           N  
ATOM   4740  CA  VAL A 584      11.523  88.559  30.501  1.00  0.96           C  
ATOM   4741  C   VAL A 584      10.869  89.924  30.649  1.00  0.96           C  
ATOM   4742  O   VAL A 584       9.650  90.032  30.789  1.00  0.96           O  
ATOM   4743  CB  VAL A 584      12.242  88.210  31.800  1.00  0.96           C  
ATOM   4744  CG1 VAL A 584      11.318  88.348  33.022  1.00  0.96           C  
ATOM   4745  CG2 VAL A 584      12.735  86.757  31.736  1.00  0.96           C  
ATOM   4746  N   ILE A 585      11.656  91.017  30.557  1.00  0.94           N  
ATOM   4747  CA  ILE A 585      11.125  92.373  30.566  1.00  0.94           C  
ATOM   4748  C   ILE A 585      10.234  92.627  29.349  1.00  0.94           C  
ATOM   4749  O   ILE A 585       9.144  93.179  29.465  1.00  0.94           O  
ATOM   4750  CB  ILE A 585      12.220  93.430  30.676  1.00  0.94           C  
ATOM   4751  CG1 ILE A 585      13.070  93.227  31.952  1.00  0.94           C  
ATOM   4752  CG2 ILE A 585      11.580  94.833  30.713  1.00  0.94           C  
ATOM   4753  CD1 ILE A 585      14.337  94.092  31.977  1.00  0.94           C  
ATOM   4754  N   THR A 586      10.633  92.165  28.148  1.00  0.93           N  
ATOM   4755  CA  THR A 586       9.826  92.221  26.925  1.00  0.93           C  
ATOM   4756  C   THR A 586       8.506  91.495  27.046  1.00  0.93           C  
ATOM   4757  O   THR A 586       7.454  92.025  26.700  1.00  0.93           O  
ATOM   4758  CB  THR A 586      10.563  91.648  25.725  1.00  0.93           C  
ATOM   4759  OG1 THR A 586      11.728  92.419  25.532  1.00  0.93           O  
ATOM   4760  CG2 THR A 586       9.741  91.728  24.433  1.00  0.93           C  
ATOM   4761  N   MET A 587       8.495  90.275  27.609  1.00  0.90           N  
ATOM   4762  CA  MET A 587       7.286  89.535  27.905  1.00  0.90           C  
ATOM   4763  C   MET A 587       6.371  90.245  28.882  1.00  0.90           C  
ATOM   4764  O   MET A 587       5.163  90.307  28.663  1.00  0.90           O  
ATOM   4765  CB  MET A 587       7.626  88.145  28.470  1.00  0.90           C  
ATOM   4766  CG  MET A 587       8.093  87.161  27.388  1.00  0.90           C  
ATOM   4767  SD  MET A 587       8.045  85.430  27.927  1.00  0.90           S  
ATOM   4768  CE  MET A 587       9.317  85.547  29.220  1.00  0.90           C  
ATOM   4769  N   TYR A 588       6.937  90.841  29.947  1.00  0.91           N  
ATOM   4770  CA  TYR A 588       6.232  91.732  30.848  1.00  0.91           C  
ATOM   4771  C   TYR A 588       5.645  92.961  30.148  1.00  0.91           C  
ATOM   4772  O   TYR A 588       4.451  93.219  30.254  1.00  0.91           O  
ATOM   4773  CB  TYR A 588       7.220  92.143  31.975  1.00  0.91           C  
ATOM   4774  CG  TYR A 588       6.664  93.188  32.896  1.00  0.91           C  
ATOM   4775  CD1 TYR A 588       5.664  92.856  33.816  1.00  0.91           C  
ATOM   4776  CD2 TYR A 588       7.100  94.519  32.803  1.00  0.91           C  
ATOM   4777  CE1 TYR A 588       5.125  93.835  34.662  1.00  0.91           C  
ATOM   4778  CE2 TYR A 588       6.552  95.498  33.640  1.00  0.91           C  
ATOM   4779  CZ  TYR A 588       5.575  95.154  34.578  1.00  0.91           C  
ATOM   4780  OH  TYR A 588       5.013  96.134  35.417  1.00  0.91           O  
ATOM   4781  N   ASN A 589       6.436  93.704  29.350  1.00  0.88           N  
ATOM   4782  CA  ASN A 589       5.990  94.872  28.604  1.00  0.88           C  
ATOM   4783  C   ASN A 589       4.893  94.535  27.607  1.00  0.88           C  
ATOM   4784  O   ASN A 589       3.921  95.270  27.455  1.00  0.88           O  
ATOM   4785  CB  ASN A 589       7.171  95.539  27.862  1.00  0.88           C  
ATOM   4786  CG  ASN A 589       8.078  96.252  28.857  1.00  0.88           C  
ATOM   4787  OD1 ASN A 589       7.668  96.690  29.933  1.00  0.88           O  
ATOM   4788  ND2 ASN A 589       9.358  96.423  28.460  1.00  0.88           N  
ATOM   4789  N   ARG A 590       4.978  93.365  26.943  1.00  0.80           N  
ATOM   4790  CA  ARG A 590       3.899  92.853  26.125  1.00  0.80           C  
ATOM   4791  C   ARG A 590       2.609  92.630  26.911  1.00  0.80           C  
ATOM   4792  O   ARG A 590       1.532  92.884  26.396  1.00  0.80           O  
ATOM   4793  CB  ARG A 590       4.279  91.524  25.427  1.00  0.80           C  
ATOM   4794  CG  ARG A 590       5.320  91.658  24.299  1.00  0.80           C  
ATOM   4795  CD  ARG A 590       5.732  90.296  23.725  1.00  0.80           C  
ATOM   4796  NE  ARG A 590       6.688  90.541  22.620  1.00  0.80           N  
ATOM   4797  CZ  ARG A 590       7.045  89.645  21.691  1.00  0.80           C  
ATOM   4798  NH1 ARG A 590       6.630  88.384  21.751  1.00  0.80           N  
ATOM   4799  NH2 ARG A 590       7.846  90.021  20.706  1.00  0.80           N  
ATOM   4800  N   ILE A 591       2.655  92.138  28.167  1.00  0.83           N  
ATOM   4801  CA  ILE A 591       1.480  92.059  29.044  1.00  0.83           C  
ATOM   4802  C   ILE A 591       0.955  93.442  29.442  1.00  0.83           C  
ATOM   4803  O   ILE A 591      -0.251  93.662  29.528  1.00  0.83           O  
ATOM   4804  CB  ILE A 591       1.721  91.192  30.289  1.00  0.83           C  
ATOM   4805  CG1 ILE A 591       2.162  89.759  29.902  1.00  0.83           C  
ATOM   4806  CG2 ILE A 591       0.446  91.127  31.165  1.00  0.83           C  
ATOM   4807  CD1 ILE A 591       2.785  88.980  31.069  1.00  0.83           C  
ATOM   4808  N   LYS A 592       1.854  94.418  29.676  1.00  0.78           N  
ATOM   4809  CA  LYS A 592       1.510  95.779  30.061  1.00  0.78           C  
ATOM   4810  C   LYS A 592       0.951  96.643  28.933  1.00  0.78           C  
ATOM   4811  O   LYS A 592       0.401  97.709  29.195  1.00  0.78           O  
ATOM   4812  CB  LYS A 592       2.723  96.508  30.698  1.00  0.78           C  
ATOM   4813  CG  LYS A 592       3.298  95.832  31.957  1.00  0.78           C  
ATOM   4814  CD  LYS A 592       2.334  95.695  33.152  1.00  0.78           C  
ATOM   4815  CE  LYS A 592       2.051  97.015  33.872  1.00  0.78           C  
ATOM   4816  NZ  LYS A 592       1.298  96.770  35.107  1.00  0.78           N  
ATOM   4817  N   LYS A 593       1.048  96.194  27.662  1.00  0.75           N  
ATOM   4818  CA  LYS A 593       0.423  96.810  26.497  1.00  0.75           C  
ATOM   4819  C   LYS A 593      -1.089  96.947  26.615  1.00  0.75           C  
ATOM   4820  O   LYS A 593      -1.635  97.983  26.244  1.00  0.75           O  
ATOM   4821  CB  LYS A 593       0.677  95.905  25.260  1.00  0.75           C  
ATOM   4822  CG  LYS A 593       1.938  96.238  24.447  1.00  0.75           C  
ATOM   4823  CD  LYS A 593       1.671  97.254  23.321  1.00  0.75           C  
ATOM   4824  CE  LYS A 593       0.725  96.719  22.234  1.00  0.75           C  
ATOM   4825  NZ  LYS A 593       0.534  97.726  21.169  1.00  0.75           N  
ATOM   4826  N   ASP A 594      -1.730  95.873  27.116  1.00  0.65           N  
ATOM   4827  CA  ASP A 594      -3.151  95.676  27.315  1.00  0.65           C  
ATOM   4828  C   ASP A 594      -3.263  94.192  27.690  1.00  0.65           C  
ATOM   4829  O   ASP A 594      -2.533  93.372  27.113  1.00  0.65           O  
ATOM   4830  CB  ASP A 594      -4.031  95.981  26.062  1.00  0.65           C  
ATOM   4831  CG  ASP A 594      -5.456  96.377  26.436  1.00  0.65           C  
ATOM   4832  OD1 ASP A 594      -6.239  95.495  26.874  1.00  0.65           O  
ATOM   4833  OD2 ASP A 594      -5.777  97.583  26.286  1.00  0.65           O  
ATOM   4834  N   PRO A 595      -4.058  93.763  28.667  1.00  0.72           N  
ATOM   4835  CA  PRO A 595      -4.360  92.352  28.889  1.00  0.72           C  
ATOM   4836  C   PRO A 595      -5.196  91.726  27.767  1.00  0.72           C  
ATOM   4837  O   PRO A 595      -5.256  92.242  26.659  1.00  0.72           O  
ATOM   4838  CB  PRO A 595      -5.094  92.386  30.245  1.00  0.72           C  
ATOM   4839  CG  PRO A 595      -5.812  93.735  30.244  1.00  0.72           C  
ATOM   4840  CD  PRO A 595      -4.783  94.645  29.584  1.00  0.72           C  
ATOM   4841  N   LYS A 596      -5.808  90.544  28.009  1.00  0.68           N  
ATOM   4842  CA  LYS A 596      -6.729  89.867  27.095  1.00  0.68           C  
ATOM   4843  C   LYS A 596      -6.067  89.161  25.934  1.00  0.68           C  
ATOM   4844  O   LYS A 596      -6.446  88.046  25.586  1.00  0.68           O  
ATOM   4845  CB  LYS A 596      -7.912  90.733  26.579  1.00  0.68           C  
ATOM   4846  CG  LYS A 596      -8.848  91.256  27.677  1.00  0.68           C  
ATOM   4847  CD  LYS A 596      -9.581  90.121  28.411  1.00  0.68           C  
ATOM   4848  CE  LYS A 596     -10.606  90.601  29.438  1.00  0.68           C  
ATOM   4849  NZ  LYS A 596     -11.671  91.377  28.766  1.00  0.68           N  
ATOM   4850  N   LYS A 597      -5.039  89.776  25.328  1.00  0.71           N  
ATOM   4851  CA  LYS A 597      -4.216  89.159  24.317  1.00  0.71           C  
ATOM   4852  C   LYS A 597      -3.542  87.892  24.822  1.00  0.71           C  
ATOM   4853  O   LYS A 597      -3.086  87.798  25.966  1.00  0.71           O  
ATOM   4854  CB  LYS A 597      -3.184  90.171  23.759  1.00  0.71           C  
ATOM   4855  CG  LYS A 597      -2.081  90.589  24.744  1.00  0.71           C  
ATOM   4856  CD  LYS A 597      -0.817  89.724  24.621  1.00  0.71           C  
ATOM   4857  CE  LYS A 597       0.178  90.041  25.721  1.00  0.71           C  
ATOM   4858  NZ  LYS A 597       1.433  89.318  25.466  1.00  0.71           N  
ATOM   4859  N   LEU A 598      -3.480  86.857  23.969  1.00  0.74           N  
ATOM   4860  CA  LEU A 598      -2.952  85.572  24.362  1.00  0.74           C  
ATOM   4861  C   LEU A 598      -1.467  85.620  24.718  1.00  0.74           C  
ATOM   4862  O   LEU A 598      -0.619  86.200  24.036  1.00  0.74           O  
ATOM   4863  CB  LEU A 598      -3.259  84.470  23.317  1.00  0.74           C  
ATOM   4864  CG  LEU A 598      -4.702  83.903  23.371  1.00  0.74           C  
ATOM   4865  CD1 LEU A 598      -5.809  84.939  23.118  1.00  0.74           C  
ATOM   4866  CD2 LEU A 598      -4.862  82.744  22.378  1.00  0.74           C  
ATOM   4867  N   PHE A 599      -1.137  85.017  25.864  1.00  0.85           N  
ATOM   4868  CA  PHE A 599       0.207  84.853  26.346  1.00  0.85           C  
ATOM   4869  C   PHE A 599       0.198  83.499  27.014  1.00  0.85           C  
ATOM   4870  O   PHE A 599      -0.584  83.261  27.933  1.00  0.85           O  
ATOM   4871  CB  PHE A 599       0.544  85.984  27.355  1.00  0.85           C  
ATOM   4872  CG  PHE A 599       1.962  85.948  27.854  1.00  0.85           C  
ATOM   4873  CD1 PHE A 599       2.979  86.704  27.248  1.00  0.85           C  
ATOM   4874  CD2 PHE A 599       2.276  85.185  28.986  1.00  0.85           C  
ATOM   4875  CE1 PHE A 599       4.268  86.732  27.792  1.00  0.85           C  
ATOM   4876  CE2 PHE A 599       3.564  85.196  29.526  1.00  0.85           C  
ATOM   4877  CZ  PHE A 599       4.558  85.978  28.936  1.00  0.85           C  
ATOM   4878  N   VAL A 600       1.049  82.565  26.559  1.00  0.91           N  
ATOM   4879  CA  VAL A 600       1.211  81.289  27.225  1.00  0.91           C  
ATOM   4880  C   VAL A 600       1.915  81.488  28.568  1.00  0.91           C  
ATOM   4881  O   VAL A 600       2.912  82.215  28.601  1.00  0.91           O  
ATOM   4882  CB  VAL A 600       1.930  80.284  26.336  1.00  0.91           C  
ATOM   4883  CG1 VAL A 600       3.385  80.696  26.059  1.00  0.91           C  
ATOM   4884  CG2 VAL A 600       1.896  78.891  26.974  1.00  0.91           C  
ATOM   4885  N   PRO A 601       1.484  80.943  29.703  1.00  0.93           N  
ATOM   4886  CA  PRO A 601       2.099  81.295  30.970  1.00  0.93           C  
ATOM   4887  C   PRO A 601       3.499  80.731  31.107  1.00  0.93           C  
ATOM   4888  O   PRO A 601       3.751  79.588  30.719  1.00  0.93           O  
ATOM   4889  CB  PRO A 601       1.132  80.744  32.037  1.00  0.93           C  
ATOM   4890  CG  PRO A 601       0.277  79.712  31.295  1.00  0.93           C  
ATOM   4891  CD  PRO A 601       0.186  80.301  29.892  1.00  0.93           C  
ATOM   4892  N   ARG A 602       4.435  81.530  31.645  1.00  0.90           N  
ATOM   4893  CA  ARG A 602       5.803  81.102  31.838  1.00  0.90           C  
ATOM   4894  C   ARG A 602       6.286  81.336  33.256  1.00  0.90           C  
ATOM   4895  O   ARG A 602       6.037  82.353  33.899  1.00  0.90           O  
ATOM   4896  CB  ARG A 602       6.809  81.781  30.885  1.00  0.90           C  
ATOM   4897  CG  ARG A 602       6.691  81.392  29.398  1.00  0.90           C  
ATOM   4898  CD  ARG A 602       7.989  81.766  28.683  1.00  0.90           C  
ATOM   4899  NE  ARG A 602       7.907  81.420  27.234  1.00  0.90           N  
ATOM   4900  CZ  ARG A 602       9.006  81.327  26.477  1.00  0.90           C  
ATOM   4901  NH1 ARG A 602      10.231  81.503  26.955  1.00  0.90           N  
ATOM   4902  NH2 ARG A 602       8.890  81.081  25.176  1.00  0.90           N  
ATOM   4903  N   THR A 603       7.042  80.356  33.775  1.00  0.93           N  
ATOM   4904  CA  THR A 603       7.739  80.462  35.041  1.00  0.93           C  
ATOM   4905  C   THR A 603       9.175  80.509  34.628  1.00  0.93           C  
ATOM   4906  O   THR A 603       9.696  79.509  34.142  1.00  0.93           O  
ATOM   4907  CB  THR A 603       7.562  79.274  35.982  1.00  0.93           C  
ATOM   4908  OG1 THR A 603       6.182  79.025  36.211  1.00  0.93           O  
ATOM   4909  CG2 THR A 603       8.194  79.582  37.346  1.00  0.93           C  
ATOM   4910  N   VAL A 604       9.829  81.672  34.758  1.00  0.96           N  
ATOM   4911  CA  VAL A 604      11.186  81.877  34.296  1.00  0.96           C  
ATOM   4912  C   VAL A 604      12.114  81.724  35.475  1.00  0.96           C  
ATOM   4913  O   VAL A 604      12.058  82.470  36.451  1.00  0.96           O  
ATOM   4914  CB  VAL A 604      11.393  83.231  33.634  1.00  0.96           C  
ATOM   4915  CG1 VAL A 604      12.868  83.383  33.211  1.00  0.96           C  
ATOM   4916  CG2 VAL A 604      10.476  83.337  32.399  1.00  0.96           C  
ATOM   4917  N   ILE A 605      12.978  80.705  35.428  1.00  0.94           N  
ATOM   4918  CA  ILE A 605      13.826  80.326  36.534  1.00  0.94           C  
ATOM   4919  C   ILE A 605      15.264  80.486  36.101  1.00  0.94           C  
ATOM   4920  O   ILE A 605      15.786  79.746  35.271  1.00  0.94           O  
ATOM   4921  CB  ILE A 605      13.555  78.887  36.972  1.00  0.94           C  
ATOM   4922  CG1 ILE A 605      12.094  78.713  37.461  1.00  0.94           C  
ATOM   4923  CG2 ILE A 605      14.557  78.473  38.070  1.00  0.94           C  
ATOM   4924  CD1 ILE A 605      11.641  77.251  37.566  1.00  0.94           C  
ATOM   4925  N   ILE A 606      15.972  81.461  36.687  1.00  0.95           N  
ATOM   4926  CA  ILE A 606      17.373  81.691  36.393  1.00  0.95           C  
ATOM   4927  C   ILE A 606      18.124  81.324  37.652  1.00  0.95           C  
ATOM   4928  O   ILE A 606      17.685  81.606  38.758  1.00  0.95           O  
ATOM   4929  CB  ILE A 606      17.663  83.124  35.942  1.00  0.95           C  
ATOM   4930  CG1 ILE A 606      16.788  83.480  34.712  1.00  0.95           C  
ATOM   4931  CG2 ILE A 606      19.169  83.257  35.618  1.00  0.95           C  
ATOM   4932  CD1 ILE A 606      16.908  84.929  34.217  1.00  0.95           C  
ATOM   4933  N   GLY A 607      19.253  80.608  37.563  1.00  0.97           N  
ATOM   4934  CA  GLY A 607      19.964  80.223  38.775  1.00  0.97           C  
ATOM   4935  C   GLY A 607      21.415  79.993  38.531  1.00  0.97           C  
ATOM   4936  O   GLY A 607      21.826  79.457  37.509  1.00  0.97           O  
ATOM   4937  N   GLY A 608      22.263  80.369  39.490  1.00  0.94           N  
ATOM   4938  CA  GLY A 608      23.687  80.308  39.247  1.00  0.94           C  
ATOM   4939  C   GLY A 608      24.425  81.148  40.215  1.00  0.94           C  
ATOM   4940  O   GLY A 608      23.845  81.970  40.912  1.00  0.94           O  
ATOM   4941  N   LYS A 609      25.752  80.980  40.266  1.00  0.87           N  
ATOM   4942  CA  LYS A 609      26.597  81.719  41.174  1.00  0.87           C  
ATOM   4943  C   LYS A 609      27.544  82.613  40.395  1.00  0.87           C  
ATOM   4944  O   LYS A 609      28.082  82.223  39.358  1.00  0.87           O  
ATOM   4945  CB  LYS A 609      27.408  80.773  42.092  1.00  0.87           C  
ATOM   4946  CG  LYS A 609      26.535  79.802  42.911  1.00  0.87           C  
ATOM   4947  CD  LYS A 609      27.290  79.163  44.093  1.00  0.87           C  
ATOM   4948  CE  LYS A 609      28.499  78.318  43.677  1.00  0.87           C  
ATOM   4949  NZ  LYS A 609      29.330  78.018  44.855  1.00  0.87           N  
ATOM   4950  N   ALA A 610      27.746  83.853  40.874  1.00  0.88           N  
ATOM   4951  CA  ALA A 610      28.714  84.781  40.336  1.00  0.88           C  
ATOM   4952  C   ALA A 610      30.024  84.685  41.108  1.00  0.88           C  
ATOM   4953  O   ALA A 610      30.046  84.425  42.310  1.00  0.88           O  
ATOM   4954  CB  ALA A 610      28.168  86.218  40.427  1.00  0.88           C  
ATOM   4955  N   ALA A 611      31.176  84.873  40.435  1.00  0.82           N  
ATOM   4956  CA  ALA A 611      32.462  84.903  41.104  1.00  0.82           C  
ATOM   4957  C   ALA A 611      32.647  86.100  42.058  1.00  0.82           C  
ATOM   4958  O   ALA A 611      32.184  87.192  41.719  1.00  0.82           O  
ATOM   4959  CB  ALA A 611      33.585  84.879  40.054  1.00  0.82           C  
ATOM   4960  N   PRO A 612      33.312  85.988  43.219  1.00  0.81           N  
ATOM   4961  CA  PRO A 612      33.405  87.059  44.213  1.00  0.81           C  
ATOM   4962  C   PRO A 612      33.838  88.431  43.729  1.00  0.81           C  
ATOM   4963  O   PRO A 612      33.233  89.426  44.131  1.00  0.81           O  
ATOM   4964  CB  PRO A 612      34.346  86.488  45.277  1.00  0.81           C  
ATOM   4965  CG  PRO A 612      33.978  85.004  45.288  1.00  0.81           C  
ATOM   4966  CD  PRO A 612      33.696  84.700  43.814  1.00  0.81           C  
ATOM   4967  N   GLY A 613      34.878  88.494  42.872  1.00  0.78           N  
ATOM   4968  CA  GLY A 613      35.426  89.731  42.315  1.00  0.78           C  
ATOM   4969  C   GLY A 613      34.739  90.246  41.077  1.00  0.78           C  
ATOM   4970  O   GLY A 613      35.130  91.260  40.507  1.00  0.78           O  
ATOM   4971  N   TYR A 614      33.707  89.546  40.588  1.00  0.83           N  
ATOM   4972  CA  TYR A 614      33.087  89.845  39.317  1.00  0.83           C  
ATOM   4973  C   TYR A 614      31.921  90.802  39.498  1.00  0.83           C  
ATOM   4974  O   TYR A 614      30.795  90.407  39.796  1.00  0.83           O  
ATOM   4975  CB  TYR A 614      32.615  88.507  38.706  1.00  0.83           C  
ATOM   4976  CG  TYR A 614      32.293  88.485  37.237  1.00  0.83           C  
ATOM   4977  CD1 TYR A 614      32.255  89.605  36.379  1.00  0.83           C  
ATOM   4978  CD2 TYR A 614      32.016  87.219  36.706  1.00  0.83           C  
ATOM   4979  CE1 TYR A 614      31.943  89.443  35.019  1.00  0.83           C  
ATOM   4980  CE2 TYR A 614      31.727  87.060  35.350  1.00  0.83           C  
ATOM   4981  CZ  TYR A 614      31.690  88.169  34.506  1.00  0.83           C  
ATOM   4982  OH  TYR A 614      31.385  88.006  33.145  1.00  0.83           O  
ATOM   4983  N   HIS A 615      32.169  92.113  39.297  1.00  0.87           N  
ATOM   4984  CA  HIS A 615      31.145  93.142  39.435  1.00  0.87           C  
ATOM   4985  C   HIS A 615      29.970  92.971  38.487  1.00  0.87           C  
ATOM   4986  O   HIS A 615      28.821  92.956  38.920  1.00  0.87           O  
ATOM   4987  CB  HIS A 615      31.766  94.547  39.213  1.00  0.87           C  
ATOM   4988  CG  HIS A 615      30.812  95.716  39.224  1.00  0.87           C  
ATOM   4989  ND1 HIS A 615      30.307  96.161  38.018  1.00  0.87           N  
ATOM   4990  CD2 HIS A 615      30.413  96.535  40.233  1.00  0.87           C  
ATOM   4991  CE1 HIS A 615      29.617  97.249  38.313  1.00  0.87           C  
ATOM   4992  NE2 HIS A 615      29.648  97.517  39.640  1.00  0.87           N  
ATOM   4993  N   MET A 616      30.237  92.754  37.183  1.00  0.90           N  
ATOM   4994  CA  MET A 616      29.210  92.694  36.162  1.00  0.90           C  
ATOM   4995  C   MET A 616      28.202  91.566  36.353  1.00  0.90           C  
ATOM   4996  O   MET A 616      26.994  91.760  36.267  1.00  0.90           O  
ATOM   4997  CB  MET A 616      29.852  92.623  34.759  1.00  0.90           C  
ATOM   4998  CG  MET A 616      28.969  93.163  33.616  1.00  0.90           C  
ATOM   4999  SD  MET A 616      28.635  94.949  33.695  1.00  0.90           S  
ATOM   5000  CE  MET A 616      26.955  94.759  34.323  1.00  0.90           C  
ATOM   5001  N   ALA A 617      28.672  90.355  36.708  1.00  0.94           N  
ATOM   5002  CA  ALA A 617      27.820  89.237  37.057  1.00  0.94           C  
ATOM   5003  C   ALA A 617      26.928  89.465  38.276  1.00  0.94           C  
ATOM   5004  O   ALA A 617      25.749  89.116  38.274  1.00  0.94           O  
ATOM   5005  CB  ALA A 617      28.707  88.008  37.287  1.00  0.94           C  
ATOM   5006  N   LYS A 618      27.454  90.093  39.347  1.00  0.90           N  
ATOM   5007  CA  LYS A 618      26.665  90.477  40.509  1.00  0.90           C  
ATOM   5008  C   LYS A 618      25.605  91.533  40.200  1.00  0.90           C  
ATOM   5009  O   LYS A 618      24.482  91.462  40.703  1.00  0.90           O  
ATOM   5010  CB  LYS A 618      27.567  90.903  41.693  1.00  0.90           C  
ATOM   5011  CG  LYS A 618      28.430  89.739  42.213  1.00  0.90           C  
ATOM   5012  CD  LYS A 618      29.194  90.064  43.510  1.00  0.90           C  
ATOM   5013  CE  LYS A 618      29.980  88.852  44.035  1.00  0.90           C  
ATOM   5014  NZ  LYS A 618      30.571  89.110  45.365  1.00  0.90           N  
ATOM   5015  N   MET A 619      25.911  92.509  39.316  1.00  0.91           N  
ATOM   5016  CA  MET A 619      24.919  93.429  38.777  1.00  0.91           C  
ATOM   5017  C   MET A 619      23.808  92.725  38.004  1.00  0.91           C  
ATOM   5018  O   MET A 619      22.636  93.058  38.151  1.00  0.91           O  
ATOM   5019  CB  MET A 619      25.533  94.479  37.818  1.00  0.91           C  
ATOM   5020  CG  MET A 619      26.616  95.398  38.415  1.00  0.91           C  
ATOM   5021  SD  MET A 619      26.186  96.201  39.981  1.00  0.91           S  
ATOM   5022  CE  MET A 619      24.755  97.126  39.366  1.00  0.91           C  
ATOM   5023  N   ILE A 620      24.142  91.709  37.176  1.00  0.94           N  
ATOM   5024  CA  ILE A 620      23.168  90.888  36.458  1.00  0.94           C  
ATOM   5025  C   ILE A 620      22.241  90.118  37.403  1.00  0.94           C  
ATOM   5026  O   ILE A 620      21.033  90.071  37.181  1.00  0.94           O  
ATOM   5027  CB  ILE A 620      23.827  89.963  35.428  1.00  0.94           C  
ATOM   5028  CG1 ILE A 620      24.563  90.795  34.350  1.00  0.94           C  
ATOM   5029  CG2 ILE A 620      22.773  89.055  34.750  1.00  0.94           C  
ATOM   5030  CD1 ILE A 620      25.520  89.970  33.480  1.00  0.94           C  
ATOM   5031  N   ILE A 621      22.752  89.549  38.520  1.00  0.94           N  
ATOM   5032  CA  ILE A 621      21.913  88.942  39.562  1.00  0.94           C  
ATOM   5033  C   ILE A 621      20.937  89.944  40.184  1.00  0.94           C  
ATOM   5034  O   ILE A 621      19.740  89.677  40.285  1.00  0.94           O  
ATOM   5035  CB  ILE A 621      22.745  88.291  40.679  1.00  0.94           C  
ATOM   5036  CG1 ILE A 621      23.595  87.131  40.110  1.00  0.94           C  
ATOM   5037  CG2 ILE A 621      21.831  87.775  41.821  1.00  0.94           C  
ATOM   5038  CD1 ILE A 621      24.559  86.500  41.123  1.00  0.94           C  
ATOM   5039  N   LYS A 622      21.411  91.154  40.559  1.00  0.92           N  
ATOM   5040  CA  LYS A 622      20.566  92.222  41.083  1.00  0.92           C  
ATOM   5041  C   LYS A 622      19.548  92.753  40.072  1.00  0.92           C  
ATOM   5042  O   LYS A 622      18.431  93.144  40.413  1.00  0.92           O  
ATOM   5043  CB  LYS A 622      21.421  93.378  41.664  1.00  0.92           C  
ATOM   5044  CG  LYS A 622      20.634  94.520  42.350  1.00  0.92           C  
ATOM   5045  CD  LYS A 622      19.773  94.085  43.560  1.00  0.92           C  
ATOM   5046  CE  LYS A 622      19.089  95.266  44.280  1.00  0.92           C  
ATOM   5047  NZ  LYS A 622      18.265  94.831  45.438  1.00  0.92           N  
ATOM   5048  N   LEU A 623      19.912  92.793  38.778  1.00  0.93           N  
ATOM   5049  CA  LEU A 623      19.016  93.119  37.684  1.00  0.93           C  
ATOM   5050  C   LEU A 623      17.894  92.100  37.528  1.00  0.93           C  
ATOM   5051  O   LEU A 623      16.725  92.465  37.442  1.00  0.93           O  
ATOM   5052  CB  LEU A 623      19.871  93.289  36.395  1.00  0.93           C  
ATOM   5053  CG  LEU A 623      19.194  93.812  35.105  1.00  0.93           C  
ATOM   5054  CD1 LEU A 623      18.506  92.701  34.308  1.00  0.93           C  
ATOM   5055  CD2 LEU A 623      18.226  94.976  35.348  1.00  0.93           C  
ATOM   5056  N   ILE A 624      18.199  90.784  37.558  1.00  0.93           N  
ATOM   5057  CA  ILE A 624      17.189  89.727  37.501  1.00  0.93           C  
ATOM   5058  C   ILE A 624      16.257  89.721  38.701  1.00  0.93           C  
ATOM   5059  O   ILE A 624      15.041  89.612  38.545  1.00  0.93           O  
ATOM   5060  CB  ILE A 624      17.809  88.338  37.320  1.00  0.93           C  
ATOM   5061  CG1 ILE A 624      18.603  88.268  35.995  1.00  0.93           C  
ATOM   5062  CG2 ILE A 624      16.717  87.237  37.332  1.00  0.93           C  
ATOM   5063  CD1 ILE A 624      19.567  87.079  35.938  1.00  0.93           C  
ATOM   5064  N   THR A 625      16.780  89.869  39.935  1.00  0.93           N  
ATOM   5065  CA  THR A 625      15.945  89.931  41.135  1.00  0.93           C  
ATOM   5066  C   THR A 625      15.024  91.138  41.155  1.00  0.93           C  
ATOM   5067  O   THR A 625      13.829  91.001  41.376  1.00  0.93           O  
ATOM   5068  CB  THR A 625      16.739  89.872  42.431  1.00  0.93           C  
ATOM   5069  OG1 THR A 625      17.747  90.872  42.463  1.00  0.93           O  
ATOM   5070  CG2 THR A 625      17.436  88.504  42.545  1.00  0.93           C  
ATOM   5071  N   SER A 626      15.533  92.336  40.805  1.00  0.94           N  
ATOM   5072  CA  SER A 626      14.733  93.550  40.663  1.00  0.94           C  
ATOM   5073  C   SER A 626      13.633  93.441  39.606  1.00  0.94           C  
ATOM   5074  O   SER A 626      12.510  93.907  39.801  1.00  0.94           O  
ATOM   5075  CB  SER A 626      15.612  94.775  40.305  1.00  0.94           C  
ATOM   5076  OG  SER A 626      16.508  95.141  41.363  1.00  0.94           O  
ATOM   5077  N   VAL A 627      13.901  92.792  38.448  1.00  0.94           N  
ATOM   5078  CA  VAL A 627      12.854  92.460  37.481  1.00  0.94           C  
ATOM   5079  C   VAL A 627      11.828  91.505  38.065  1.00  0.94           C  
ATOM   5080  O   VAL A 627      10.622  91.696  37.915  1.00  0.94           O  
ATOM   5081  CB  VAL A 627      13.408  91.885  36.179  1.00  0.94           C  
ATOM   5082  CG1 VAL A 627      12.279  91.428  35.226  1.00  0.94           C  
ATOM   5083  CG2 VAL A 627      14.230  92.976  35.471  1.00  0.94           C  
ATOM   5084  N   ALA A 628      12.281  90.467  38.792  1.00  0.92           N  
ATOM   5085  CA  ALA A 628      11.413  89.508  39.434  1.00  0.92           C  
ATOM   5086  C   ALA A 628      10.465  90.122  40.448  1.00  0.92           C  
ATOM   5087  O   ALA A 628       9.263  89.870  40.395  1.00  0.92           O  
ATOM   5088  CB  ALA A 628      12.255  88.405  40.106  1.00  0.92           C  
ATOM   5089  N   ASP A 629      10.954  91.006  41.334  1.00  0.87           N  
ATOM   5090  CA  ASP A 629      10.137  91.683  42.323  1.00  0.87           C  
ATOM   5091  C   ASP A 629       9.014  92.509  41.686  1.00  0.87           C  
ATOM   5092  O   ASP A 629       7.851  92.424  42.078  1.00  0.87           O  
ATOM   5093  CB  ASP A 629      11.026  92.594  43.207  1.00  0.87           C  
ATOM   5094  CG  ASP A 629      12.077  91.793  43.964  1.00  0.87           C  
ATOM   5095  OD1 ASP A 629      11.802  90.613  44.303  1.00  0.87           O  
ATOM   5096  OD2 ASP A 629      13.165  92.370  44.229  1.00  0.87           O  
ATOM   5097  N   VAL A 630       9.318  93.277  40.616  1.00  0.90           N  
ATOM   5098  CA  VAL A 630       8.303  94.007  39.863  1.00  0.90           C  
ATOM   5099  C   VAL A 630       7.290  93.121  39.151  1.00  0.90           C  
ATOM   5100  O   VAL A 630       6.086  93.316  39.297  1.00  0.90           O  
ATOM   5101  CB  VAL A 630       8.933  94.955  38.842  1.00  0.90           C  
ATOM   5102  CG1 VAL A 630       7.878  95.662  37.958  1.00  0.90           C  
ATOM   5103  CG2 VAL A 630       9.750  96.017  39.600  1.00  0.90           C  
ATOM   5104  N   VAL A 631       7.707  92.096  38.376  1.00  0.91           N  
ATOM   5105  CA  VAL A 631       6.732  91.318  37.612  1.00  0.91           C  
ATOM   5106  C   VAL A 631       5.939  90.336  38.463  1.00  0.91           C  
ATOM   5107  O   VAL A 631       4.794  90.014  38.156  1.00  0.91           O  
ATOM   5108  CB  VAL A 631       7.299  90.623  36.375  1.00  0.91           C  
ATOM   5109  CG1 VAL A 631       8.215  91.592  35.604  1.00  0.91           C  
ATOM   5110  CG2 VAL A 631       8.057  89.332  36.721  1.00  0.91           C  
ATOM   5111  N   ASN A 632       6.506  89.864  39.595  1.00  0.87           N  
ATOM   5112  CA  ASN A 632       5.810  88.977  40.510  1.00  0.87           C  
ATOM   5113  C   ASN A 632       4.807  89.711  41.394  1.00  0.87           C  
ATOM   5114  O   ASN A 632       3.899  89.089  41.945  1.00  0.87           O  
ATOM   5115  CB  ASN A 632       6.801  88.266  41.470  1.00  0.87           C  
ATOM   5116  CG  ASN A 632       7.715  87.287  40.739  1.00  0.87           C  
ATOM   5117  OD1 ASN A 632       7.385  86.690  39.714  1.00  0.87           O  
ATOM   5118  ND2 ASN A 632       8.914  87.063  41.321  1.00  0.87           N  
ATOM   5119  N   ASN A 633       4.957  91.040  41.576  1.00  0.85           N  
ATOM   5120  CA  ASN A 633       4.052  91.826  42.401  1.00  0.85           C  
ATOM   5121  C   ASN A 633       3.129  92.723  41.585  1.00  0.85           C  
ATOM   5122  O   ASN A 633       2.217  93.323  42.149  1.00  0.85           O  
ATOM   5123  CB  ASN A 633       4.838  92.731  43.394  1.00  0.85           C  
ATOM   5124  CG  ASN A 633       5.624  91.983  44.475  1.00  0.85           C  
ATOM   5125  OD1 ASN A 633       6.387  92.597  45.218  1.00  0.85           O  
ATOM   5126  ND2 ASN A 633       5.415  90.658  44.636  1.00  0.85           N  
ATOM   5127  N   ASP A 634       3.297  92.824  40.249  1.00  0.85           N  
ATOM   5128  CA  ASP A 634       2.399  93.580  39.398  1.00  0.85           C  
ATOM   5129  C   ASP A 634       1.006  92.923  39.317  1.00  0.85           C  
ATOM   5130  O   ASP A 634       0.903  91.756  38.922  1.00  0.85           O  
ATOM   5131  CB  ASP A 634       3.000  93.743  37.982  1.00  0.85           C  
ATOM   5132  CG  ASP A 634       2.194  94.688  37.131  1.00  0.85           C  
ATOM   5133  OD1 ASP A 634       2.214  95.918  37.386  1.00  0.85           O  
ATOM   5134  OD2 ASP A 634       1.511  94.236  36.177  1.00  0.85           O  
ATOM   5135  N   PRO A 635      -0.097  93.603  39.641  1.00  0.84           N  
ATOM   5136  CA  PRO A 635      -1.413  92.969  39.671  1.00  0.84           C  
ATOM   5137  C   PRO A 635      -1.927  92.558  38.299  1.00  0.84           C  
ATOM   5138  O   PRO A 635      -2.773  91.672  38.209  1.00  0.84           O  
ATOM   5139  CB  PRO A 635      -2.315  94.028  40.332  1.00  0.84           C  
ATOM   5140  CG  PRO A 635      -1.360  94.840  41.207  1.00  0.84           C  
ATOM   5141  CD  PRO A 635      -0.093  94.881  40.365  1.00  0.84           C  
ATOM   5142  N   MET A 636      -1.466  93.214  37.217  1.00  0.81           N  
ATOM   5143  CA  MET A 636      -1.910  92.939  35.859  1.00  0.81           C  
ATOM   5144  C   MET A 636      -1.323  91.657  35.268  1.00  0.81           C  
ATOM   5145  O   MET A 636      -1.918  90.997  34.404  1.00  0.81           O  
ATOM   5146  CB  MET A 636      -1.525  94.120  34.934  1.00  0.81           C  
ATOM   5147  CG  MET A 636      -2.225  95.447  35.286  1.00  0.81           C  
ATOM   5148  SD  MET A 636      -3.977  95.515  34.815  1.00  0.81           S  
ATOM   5149  CE  MET A 636      -3.680  95.618  33.026  1.00  0.81           C  
ATOM   5150  N   VAL A 637      -0.102  91.287  35.697  1.00  0.85           N  
ATOM   5151  CA  VAL A 637       0.552  90.058  35.288  1.00  0.85           C  
ATOM   5152  C   VAL A 637      -0.072  88.817  35.904  1.00  0.85           C  
ATOM   5153  O   VAL A 637      -0.425  87.877  35.195  1.00  0.85           O  
ATOM   5154  CB  VAL A 637       2.036  90.105  35.611  1.00  0.85           C  
ATOM   5155  CG1 VAL A 637       2.733  88.796  35.203  1.00  0.85           C  
ATOM   5156  CG2 VAL A 637       2.685  91.269  34.847  1.00  0.85           C  
ATOM   5157  N   GLY A 638      -0.290  88.781  37.234  1.00  0.84           N  
ATOM   5158  CA  GLY A 638      -0.865  87.623  37.926  1.00  0.84           C  
ATOM   5159  C   GLY A 638      -0.174  86.293  37.695  1.00  0.84           C  
ATOM   5160  O   GLY A 638       1.024  86.134  37.894  1.00  0.84           O  
ATOM   5161  N   SER A 639      -0.901  85.237  37.298  1.00  0.86           N  
ATOM   5162  CA  SER A 639      -0.343  83.893  37.161  1.00  0.86           C  
ATOM   5163  C   SER A 639       0.201  83.621  35.768  1.00  0.86           C  
ATOM   5164  O   SER A 639       0.439  82.476  35.386  1.00  0.86           O  
ATOM   5165  CB  SER A 639      -1.411  82.821  37.483  1.00  0.86           C  
ATOM   5166  OG  SER A 639      -2.620  83.118  36.784  1.00  0.86           O  
ATOM   5167  N   LYS A 640       0.405  84.693  34.992  1.00  0.88           N  
ATOM   5168  CA  LYS A 640       0.826  84.686  33.607  1.00  0.88           C  
ATOM   5169  C   LYS A 640       2.338  84.624  33.422  1.00  0.88           C  
ATOM   5170  O   LYS A 640       2.854  83.892  32.585  1.00  0.88           O  
ATOM   5171  CB  LYS A 640       0.254  85.993  33.030  1.00  0.88           C  
ATOM   5172  CG  LYS A 640      -0.062  86.081  31.536  1.00  0.88           C  
ATOM   5173  CD  LYS A 640      -0.748  87.425  31.192  1.00  0.88           C  
ATOM   5174  CE  LYS A 640      -2.046  87.715  31.971  1.00  0.88           C  
ATOM   5175  NZ  LYS A 640      -2.466  89.126  31.813  1.00  0.88           N  
ATOM   5176  N   LEU A 641       3.103  85.382  34.225  1.00  0.92           N  
ATOM   5177  CA  LEU A 641       4.551  85.366  34.178  1.00  0.92           C  
ATOM   5178  C   LEU A 641       5.047  85.429  35.603  1.00  0.92           C  
ATOM   5179  O   LEU A 641       4.590  86.245  36.401  1.00  0.92           O  
ATOM   5180  CB  LEU A 641       5.113  86.548  33.341  1.00  0.92           C  
ATOM   5181  CG  LEU A 641       6.645  86.592  33.126  1.00  0.92           C  
ATOM   5182  CD1 LEU A 641       7.165  85.347  32.395  1.00  0.92           C  
ATOM   5183  CD2 LEU A 641       7.028  87.852  32.333  1.00  0.92           C  
ATOM   5184  N   LYS A 642       5.968  84.526  35.977  1.00  0.87           N  
ATOM   5185  CA  LYS A 642       6.582  84.526  37.287  1.00  0.87           C  
ATOM   5186  C   LYS A 642       8.059  84.328  37.102  1.00  0.87           C  
ATOM   5187  O   LYS A 642       8.485  83.499  36.304  1.00  0.87           O  
ATOM   5188  CB  LYS A 642       6.023  83.412  38.214  1.00  0.87           C  
ATOM   5189  CG  LYS A 642       4.599  83.703  38.704  1.00  0.87           C  
ATOM   5190  CD  LYS A 642       4.590  84.806  39.774  1.00  0.87           C  
ATOM   5191  CE  LYS A 642       3.243  85.475  40.006  1.00  0.87           C  
ATOM   5192  NZ  LYS A 642       2.183  84.453  40.051  1.00  0.87           N  
ATOM   5193  N   VAL A 643       8.884  85.110  37.814  1.00  0.92           N  
ATOM   5194  CA  VAL A 643      10.327  85.069  37.656  1.00  0.92           C  
ATOM   5195  C   VAL A 643      10.947  84.686  38.977  1.00  0.92           C  
ATOM   5196  O   VAL A 643      10.687  85.288  40.016  1.00  0.92           O  
ATOM   5197  CB  VAL A 643      10.905  86.397  37.191  1.00  0.92           C  
ATOM   5198  CG1 VAL A 643      12.433  86.317  36.990  1.00  0.92           C  
ATOM   5199  CG2 VAL A 643      10.239  86.813  35.870  1.00  0.92           C  
ATOM   5200  N   ILE A 644      11.783  83.641  38.964  1.00  0.91           N  
ATOM   5201  CA  ILE A 644      12.446  83.120  40.139  1.00  0.91           C  
ATOM   5202  C   ILE A 644      13.938  83.149  39.891  1.00  0.91           C  
ATOM   5203  O   ILE A 644      14.420  82.758  38.829  1.00  0.91           O  
ATOM   5204  CB  ILE A 644      12.011  81.684  40.444  1.00  0.91           C  
ATOM   5205  CG1 ILE A 644      10.478  81.564  40.649  1.00  0.91           C  
ATOM   5206  CG2 ILE A 644      12.788  81.114  41.653  1.00  0.91           C  
ATOM   5207  CD1 ILE A 644       9.931  82.323  41.864  1.00  0.91           C  
ATOM   5208  N   PHE A 645      14.726  83.597  40.888  1.00  0.93           N  
ATOM   5209  CA  PHE A 645      16.156  83.379  40.884  1.00  0.93           C  
ATOM   5210  C   PHE A 645      16.454  82.261  41.878  1.00  0.93           C  
ATOM   5211  O   PHE A 645      16.176  82.391  43.069  1.00  0.93           O  
ATOM   5212  CB  PHE A 645      16.942  84.674  41.213  1.00  0.93           C  
ATOM   5213  CG  PHE A 645      18.425  84.482  41.013  1.00  0.93           C  
ATOM   5214  CD1 PHE A 645      19.037  84.779  39.783  1.00  0.93           C  
ATOM   5215  CD2 PHE A 645      19.213  83.970  42.056  1.00  0.93           C  
ATOM   5216  CE1 PHE A 645      20.411  84.564  39.601  1.00  0.93           C  
ATOM   5217  CE2 PHE A 645      20.583  83.752  41.881  1.00  0.93           C  
ATOM   5218  CZ  PHE A 645      21.183  84.051  40.652  1.00  0.93           C  
ATOM   5219  N   LEU A 646      17.009  81.119  41.419  1.00  0.91           N  
ATOM   5220  CA  LEU A 646      17.341  80.016  42.306  1.00  0.91           C  
ATOM   5221  C   LEU A 646      18.606  80.289  43.103  1.00  0.91           C  
ATOM   5222  O   LEU A 646      19.717  80.332  42.574  1.00  0.91           O  
ATOM   5223  CB  LEU A 646      17.519  78.646  41.588  1.00  0.91           C  
ATOM   5224  CG  LEU A 646      16.226  77.876  41.247  1.00  0.91           C  
ATOM   5225  CD1 LEU A 646      16.572  76.564  40.522  1.00  0.91           C  
ATOM   5226  CD2 LEU A 646      15.384  77.563  42.492  1.00  0.91           C  
ATOM   5227  N   GLU A 647      18.437  80.442  44.429  1.00  0.88           N  
ATOM   5228  CA  GLU A 647      19.508  80.517  45.401  1.00  0.88           C  
ATOM   5229  C   GLU A 647      20.324  79.235  45.515  1.00  0.88           C  
ATOM   5230  O   GLU A 647      19.796  78.146  45.742  1.00  0.88           O  
ATOM   5231  CB  GLU A 647      18.977  80.875  46.819  1.00  0.88           C  
ATOM   5232  CG  GLU A 647      20.113  81.100  47.854  1.00  0.88           C  
ATOM   5233  CD  GLU A 647      19.669  81.431  49.274  1.00  0.88           C  
ATOM   5234  OE1 GLU A 647      19.661  80.506  50.131  1.00  0.88           O  
ATOM   5235  OE2 GLU A 647      19.450  82.634  49.563  1.00  0.88           O  
ATOM   5236  N   ASN A 648      21.662  79.354  45.392  1.00  0.89           N  
ATOM   5237  CA  ASN A 648      22.611  78.297  45.674  1.00  0.89           C  
ATOM   5238  C   ASN A 648      22.417  77.081  44.788  1.00  0.89           C  
ATOM   5239  O   ASN A 648      22.281  75.949  45.260  1.00  0.89           O  
ATOM   5240  CB  ASN A 648      22.635  77.944  47.189  1.00  0.89           C  
ATOM   5241  CG  ASN A 648      23.965  77.327  47.603  1.00  0.89           C  
ATOM   5242  OD1 ASN A 648      25.027  77.674  47.080  1.00  0.89           O  
ATOM   5243  ND2 ASN A 648      23.931  76.396  48.584  1.00  0.89           N  
ATOM   5244  N   TYR A 649      22.390  77.325  43.463  1.00  0.91           N  
ATOM   5245  CA  TYR A 649      22.384  76.298  42.443  1.00  0.91           C  
ATOM   5246  C   TYR A 649      23.613  75.382  42.511  1.00  0.91           C  
ATOM   5247  O   TYR A 649      24.763  75.820  42.531  1.00  0.91           O  
ATOM   5248  CB  TYR A 649      22.222  76.944  41.040  1.00  0.91           C  
ATOM   5249  CG  TYR A 649      22.084  75.895  39.970  1.00  0.91           C  
ATOM   5250  CD1 TYR A 649      20.961  75.052  39.941  1.00  0.91           C  
ATOM   5251  CD2 TYR A 649      23.123  75.685  39.049  1.00  0.91           C  
ATOM   5252  CE1 TYR A 649      20.896  73.994  39.025  1.00  0.91           C  
ATOM   5253  CE2 TYR A 649      23.055  74.633  38.126  1.00  0.91           C  
ATOM   5254  CZ  TYR A 649      21.943  73.783  38.120  1.00  0.91           C  
ATOM   5255  OH  TYR A 649      21.862  72.762  37.154  1.00  0.91           O  
ATOM   5256  N   ARG A 650      23.343  74.068  42.573  1.00  0.85           N  
ATOM   5257  CA  ARG A 650      24.305  73.030  42.863  1.00  0.85           C  
ATOM   5258  C   ARG A 650      23.671  71.713  42.477  1.00  0.85           C  
ATOM   5259  O   ARG A 650      22.529  71.687  42.018  1.00  0.85           O  
ATOM   5260  CB  ARG A 650      24.724  73.011  44.353  1.00  0.85           C  
ATOM   5261  CG  ARG A 650      23.574  72.646  45.311  1.00  0.85           C  
ATOM   5262  CD  ARG A 650      23.776  73.178  46.733  1.00  0.85           C  
ATOM   5263  NE  ARG A 650      22.482  73.819  47.127  1.00  0.85           N  
ATOM   5264  CZ  ARG A 650      21.580  73.290  47.961  1.00  0.85           C  
ATOM   5265  NH1 ARG A 650      21.769  72.142  48.600  1.00  0.85           N  
ATOM   5266  NH2 ARG A 650      20.441  73.957  48.161  1.00  0.85           N  
ATOM   5267  N   VAL A 651      24.388  70.585  42.635  1.00  0.93           N  
ATOM   5268  CA  VAL A 651      23.957  69.272  42.184  1.00  0.93           C  
ATOM   5269  C   VAL A 651      22.602  68.812  42.720  1.00  0.93           C  
ATOM   5270  O   VAL A 651      21.726  68.467  41.929  1.00  0.93           O  
ATOM   5271  CB  VAL A 651      25.043  68.249  42.508  1.00  0.93           C  
ATOM   5272  CG1 VAL A 651      24.654  66.829  42.054  1.00  0.93           C  
ATOM   5273  CG2 VAL A 651      26.359  68.666  41.824  1.00  0.93           C  
ATOM   5274  N   SER A 652      22.332  68.871  44.042  1.00  0.93           N  
ATOM   5275  CA  SER A 652      21.023  68.480  44.564  1.00  0.93           C  
ATOM   5276  C   SER A 652      19.864  69.371  44.128  1.00  0.93           C  
ATOM   5277  O   SER A 652      18.726  68.921  43.994  1.00  0.93           O  
ATOM   5278  CB  SER A 652      21.001  68.343  46.108  1.00  0.93           C  
ATOM   5279  OG  SER A 652      21.046  69.601  46.785  1.00  0.93           O  
ATOM   5280  N   LEU A 653      20.115  70.678  43.896  1.00  0.92           N  
ATOM   5281  CA  LEU A 653      19.133  71.577  43.313  1.00  0.92           C  
ATOM   5282  C   LEU A 653      18.873  71.265  41.843  1.00  0.92           C  
ATOM   5283  O   LEU A 653      17.736  71.289  41.378  1.00  0.92           O  
ATOM   5284  CB  LEU A 653      19.518  73.071  43.493  1.00  0.92           C  
ATOM   5285  CG  LEU A 653      18.431  73.955  44.152  1.00  0.92           C  
ATOM   5286  CD1 LEU A 653      18.831  75.434  44.070  1.00  0.92           C  
ATOM   5287  CD2 LEU A 653      17.029  73.779  43.548  1.00  0.92           C  
ATOM   5288  N   ALA A 654      19.930  70.919  41.078  1.00  0.97           N  
ATOM   5289  CA  ALA A 654      19.845  70.487  39.697  1.00  0.97           C  
ATOM   5290  C   ALA A 654      18.999  69.239  39.532  1.00  0.97           C  
ATOM   5291  O   ALA A 654      18.126  69.175  38.672  1.00  0.97           O  
ATOM   5292  CB  ALA A 654      21.264  70.246  39.152  1.00  0.97           C  
ATOM   5293  N   GLU A 655      19.178  68.252  40.428  1.00  0.93           N  
ATOM   5294  CA  GLU A 655      18.334  67.075  40.527  1.00  0.93           C  
ATOM   5295  C   GLU A 655      16.863  67.404  40.793  1.00  0.93           C  
ATOM   5296  O   GLU A 655      15.964  66.700  40.346  1.00  0.93           O  
ATOM   5297  CB  GLU A 655      18.868  66.114  41.620  1.00  0.93           C  
ATOM   5298  CG  GLU A 655      20.236  65.469  41.273  1.00  0.93           C  
ATOM   5299  CD  GLU A 655      20.805  64.657  42.431  1.00  0.93           C  
ATOM   5300  OE1 GLU A 655      21.988  64.883  42.813  1.00  0.93           O  
ATOM   5301  OE2 GLU A 655      20.107  63.753  42.938  1.00  0.93           O  
ATOM   5302  N   LYS A 656      16.558  68.493  41.522  1.00  0.90           N  
ATOM   5303  CA  LYS A 656      15.188  68.953  41.678  1.00  0.90           C  
ATOM   5304  C   LYS A 656      14.612  69.729  40.491  1.00  0.90           C  
ATOM   5305  O   LYS A 656      13.502  69.439  40.051  1.00  0.90           O  
ATOM   5306  CB  LYS A 656      15.057  69.821  42.952  1.00  0.90           C  
ATOM   5307  CG  LYS A 656      15.308  69.043  44.252  1.00  0.90           C  
ATOM   5308  CD  LYS A 656      15.216  69.956  45.484  1.00  0.90           C  
ATOM   5309  CE  LYS A 656      15.222  69.206  46.821  1.00  0.90           C  
ATOM   5310  NZ  LYS A 656      16.508  68.521  47.061  1.00  0.90           N  
ATOM   5311  N   VAL A 657      15.321  70.742  39.943  1.00  0.95           N  
ATOM   5312  CA  VAL A 657      14.784  71.556  38.855  1.00  0.95           C  
ATOM   5313  C   VAL A 657      14.745  70.854  37.508  1.00  0.95           C  
ATOM   5314  O   VAL A 657      13.741  70.934  36.807  1.00  0.95           O  
ATOM   5315  CB  VAL A 657      15.417  72.949  38.770  1.00  0.95           C  
ATOM   5316  CG1 VAL A 657      16.895  72.920  38.342  1.00  0.95           C  
ATOM   5317  CG2 VAL A 657      14.598  73.851  37.823  1.00  0.95           C  
ATOM   5318  N   ILE A 658      15.802  70.104  37.118  1.00  0.95           N  
ATOM   5319  CA  ILE A 658      15.943  69.497  35.791  1.00  0.95           C  
ATOM   5320  C   ILE A 658      14.797  68.561  35.377  1.00  0.95           C  
ATOM   5321  O   ILE A 658      14.331  68.686  34.241  1.00  0.95           O  
ATOM   5322  CB  ILE A 658      17.327  68.848  35.614  1.00  0.95           C  
ATOM   5323  CG1 ILE A 658      18.406  69.956  35.573  1.00  0.95           C  
ATOM   5324  CG2 ILE A 658      17.387  67.961  34.350  1.00  0.95           C  
ATOM   5325  CD1 ILE A 658      19.846  69.450  35.438  1.00  0.95           C  
ATOM   5326  N   PRO A 659      14.242  67.661  36.190  1.00  0.96           N  
ATOM   5327  CA  PRO A 659      13.057  66.882  35.830  1.00  0.96           C  
ATOM   5328  C   PRO A 659      11.823  67.706  35.544  1.00  0.96           C  
ATOM   5329  O   PRO A 659      10.958  67.276  34.783  1.00  0.96           O  
ATOM   5330  CB  PRO A 659      12.856  65.961  37.038  1.00  0.96           C  
ATOM   5331  CG  PRO A 659      14.277  65.755  37.547  1.00  0.96           C  
ATOM   5332  CD  PRO A 659      14.861  67.151  37.414  1.00  0.96           C  
ATOM   5333  N   ALA A 660      11.702  68.901  36.131  1.00  0.95           N  
ATOM   5334  CA  ALA A 660      10.508  69.700  36.024  1.00  0.95           C  
ATOM   5335  C   ALA A 660      10.549  70.742  34.918  1.00  0.95           C  
ATOM   5336  O   ALA A 660       9.598  71.489  34.724  1.00  0.95           O  
ATOM   5337  CB  ALA A 660      10.318  70.435  37.357  1.00  0.95           C  
ATOM   5338  N   THR A 661      11.637  70.832  34.140  1.00  0.95           N  
ATOM   5339  CA  THR A 661      11.739  71.849  33.093  1.00  0.95           C  
ATOM   5340  C   THR A 661      11.096  71.438  31.791  1.00  0.95           C  
ATOM   5341  O   THR A 661      11.177  70.282  31.385  1.00  0.95           O  
ATOM   5342  CB  THR A 661      13.162  72.309  32.792  1.00  0.95           C  
ATOM   5343  OG1 THR A 661      13.946  71.350  32.100  1.00  0.95           O  
ATOM   5344  CG2 THR A 661      13.877  72.519  34.117  1.00  0.95           C  
ATOM   5345  N   ASP A 662      10.465  72.384  31.079  1.00  0.95           N  
ATOM   5346  CA  ASP A 662      10.038  72.137  29.716  1.00  0.95           C  
ATOM   5347  C   ASP A 662      10.958  72.860  28.749  1.00  0.95           C  
ATOM   5348  O   ASP A 662      11.229  72.364  27.659  1.00  0.95           O  
ATOM   5349  CB  ASP A 662       8.587  72.621  29.521  1.00  0.95           C  
ATOM   5350  CG  ASP A 662       7.642  71.528  29.971  1.00  0.95           C  
ATOM   5351  OD1 ASP A 662       7.608  70.490  29.260  1.00  0.95           O  
ATOM   5352  OD2 ASP A 662       6.925  71.707  30.990  1.00  0.95           O  
ATOM   5353  N   LEU A 663      11.520  74.025  29.128  1.00  0.96           N  
ATOM   5354  CA  LEU A 663      12.377  74.792  28.240  1.00  0.96           C  
ATOM   5355  C   LEU A 663      13.737  75.006  28.869  1.00  0.96           C  
ATOM   5356  O   LEU A 663      13.884  75.432  30.015  1.00  0.96           O  
ATOM   5357  CB  LEU A 663      11.663  76.108  27.839  1.00  0.96           C  
ATOM   5358  CG  LEU A 663      12.118  76.891  26.581  1.00  0.96           C  
ATOM   5359  CD1 LEU A 663      13.005  78.093  26.907  1.00  0.96           C  
ATOM   5360  CD2 LEU A 663      12.727  76.045  25.456  1.00  0.96           C  
ATOM   5361  N   SER A 664      14.777  74.624  28.110  1.00  0.96           N  
ATOM   5362  CA  SER A 664      16.168  74.633  28.520  1.00  0.96           C  
ATOM   5363  C   SER A 664      16.902  75.735  27.803  1.00  0.96           C  
ATOM   5364  O   SER A 664      17.159  75.652  26.602  1.00  0.96           O  
ATOM   5365  CB  SER A 664      16.831  73.280  28.150  1.00  0.96           C  
ATOM   5366  OG  SER A 664      18.251  73.238  28.328  1.00  0.96           O  
ATOM   5367  N   GLU A 665      17.272  76.786  28.550  1.00  0.94           N  
ATOM   5368  CA  GLU A 665      17.970  77.940  28.022  1.00  0.94           C  
ATOM   5369  C   GLU A 665      19.480  77.741  27.954  1.00  0.94           C  
ATOM   5370  O   GLU A 665      20.191  77.648  28.962  1.00  0.94           O  
ATOM   5371  CB  GLU A 665      17.698  79.173  28.907  1.00  0.94           C  
ATOM   5372  CG  GLU A 665      16.261  79.745  28.844  1.00  0.94           C  
ATOM   5373  CD  GLU A 665      16.068  80.728  27.702  1.00  0.94           C  
ATOM   5374  OE1 GLU A 665      16.856  80.681  26.726  1.00  0.94           O  
ATOM   5375  OE2 GLU A 665      15.145  81.580  27.785  1.00  0.94           O  
ATOM   5376  N   GLN A 666      20.022  77.696  26.725  1.00  0.92           N  
ATOM   5377  CA  GLN A 666      21.432  77.480  26.468  1.00  0.92           C  
ATOM   5378  C   GLN A 666      21.907  78.523  25.475  1.00  0.92           C  
ATOM   5379  O   GLN A 666      22.416  78.235  24.394  1.00  0.92           O  
ATOM   5380  CB  GLN A 666      21.689  76.049  25.946  1.00  0.92           C  
ATOM   5381  CG  GLN A 666      21.095  74.934  26.844  1.00  0.92           C  
ATOM   5382  CD  GLN A 666      21.629  74.905  28.278  1.00  0.92           C  
ATOM   5383  OE1 GLN A 666      22.662  75.450  28.678  1.00  0.92           O  
ATOM   5384  NE2 GLN A 666      20.878  74.183  29.141  1.00  0.92           N  
ATOM   5385  N   ILE A 667      21.711  79.799  25.847  1.00  0.92           N  
ATOM   5386  CA  ILE A 667      21.731  80.952  24.956  1.00  0.92           C  
ATOM   5387  C   ILE A 667      23.036  81.721  24.926  1.00  0.92           C  
ATOM   5388  O   ILE A 667      23.106  82.893  24.543  1.00  0.92           O  
ATOM   5389  CB  ILE A 667      20.613  81.900  25.326  1.00  0.92           C  
ATOM   5390  CG1 ILE A 667      20.736  82.451  26.763  1.00  0.92           C  
ATOM   5391  CG2 ILE A 667      19.312  81.109  25.162  1.00  0.92           C  
ATOM   5392  CD1 ILE A 667      19.658  83.486  27.091  1.00  0.92           C  
ATOM   5393  N   SER A 668      24.118  81.047  25.330  1.00  0.91           N  
ATOM   5394  CA  SER A 668      25.489  81.535  25.303  1.00  0.91           C  
ATOM   5395  C   SER A 668      25.966  81.960  23.923  1.00  0.91           C  
ATOM   5396  O   SER A 668      25.490  81.453  22.911  1.00  0.91           O  
ATOM   5397  CB  SER A 668      26.432  80.446  25.843  1.00  0.91           C  
ATOM   5398  OG  SER A 668      27.655  80.984  26.329  1.00  0.91           O  
ATOM   5399  N   THR A 669      26.872  82.949  23.815  1.00  0.90           N  
ATOM   5400  CA  THR A 669      27.315  83.459  22.509  1.00  0.90           C  
ATOM   5401  C   THR A 669      27.958  82.388  21.634  1.00  0.90           C  
ATOM   5402  O   THR A 669      28.683  81.529  22.114  1.00  0.90           O  
ATOM   5403  CB  THR A 669      28.303  84.623  22.592  1.00  0.90           C  
ATOM   5404  OG1 THR A 669      27.890  85.568  23.559  1.00  0.90           O  
ATOM   5405  CG2 THR A 669      28.390  85.407  21.274  1.00  0.90           C  
ATOM   5406  N   ALA A 670      27.721  82.377  20.306  1.00  0.88           N  
ATOM   5407  CA  ALA A 670      28.407  81.436  19.440  1.00  0.88           C  
ATOM   5408  C   ALA A 670      29.921  81.650  19.368  1.00  0.88           C  
ATOM   5409  O   ALA A 670      30.404  82.717  18.989  1.00  0.88           O  
ATOM   5410  CB  ALA A 670      27.799  81.471  18.028  1.00  0.88           C  
ATOM   5411  N   GLY A 671      30.690  80.609  19.743  1.00  0.78           N  
ATOM   5412  CA  GLY A 671      32.143  80.601  19.777  1.00  0.78           C  
ATOM   5413  C   GLY A 671      32.707  80.648  21.169  1.00  0.78           C  
ATOM   5414  O   GLY A 671      33.914  80.812  21.336  1.00  0.78           O  
ATOM   5415  N   THR A 672      31.866  80.519  22.213  1.00  0.79           N  
ATOM   5416  CA  THR A 672      32.326  80.594  23.600  1.00  0.79           C  
ATOM   5417  C   THR A 672      32.090  79.330  24.406  1.00  0.79           C  
ATOM   5418  O   THR A 672      32.548  79.252  25.548  1.00  0.79           O  
ATOM   5419  CB  THR A 672      31.725  81.759  24.386  1.00  0.79           C  
ATOM   5420  OG1 THR A 672      30.310  81.680  24.435  1.00  0.79           O  
ATOM   5421  CG2 THR A 672      32.081  83.087  23.701  1.00  0.79           C  
ATOM   5422  N   GLU A 673      31.433  78.290  23.847  1.00  0.81           N  
ATOM   5423  CA  GLU A 673      31.160  77.059  24.581  1.00  0.81           C  
ATOM   5424  C   GLU A 673      31.812  75.850  23.944  1.00  0.81           C  
ATOM   5425  O   GLU A 673      31.521  75.448  22.825  1.00  0.81           O  
ATOM   5426  CB  GLU A 673      29.651  76.739  24.652  1.00  0.81           C  
ATOM   5427  CG  GLU A 673      28.833  77.797  25.415  1.00  0.81           C  
ATOM   5428  CD  GLU A 673      28.994  77.798  26.921  1.00  0.81           C  
ATOM   5429  OE1 GLU A 673      29.553  76.874  27.566  1.00  0.81           O  
ATOM   5430  OE2 GLU A 673      28.452  78.762  27.530  1.00  0.81           O  
ATOM   5431  N   ALA A 674      32.715  75.178  24.679  1.00  0.89           N  
ATOM   5432  CA  ALA A 674      33.299  73.931  24.229  1.00  0.89           C  
ATOM   5433  C   ALA A 674      32.336  72.750  24.236  1.00  0.89           C  
ATOM   5434  O   ALA A 674      32.366  71.894  23.360  1.00  0.89           O  
ATOM   5435  CB  ALA A 674      34.519  73.586  25.098  1.00  0.89           C  
ATOM   5436  N   SER A 675      31.470  72.669  25.261  1.00  0.91           N  
ATOM   5437  CA  SER A 675      30.611  71.521  25.505  1.00  0.91           C  
ATOM   5438  C   SER A 675      29.311  72.016  26.121  1.00  0.91           C  
ATOM   5439  O   SER A 675      28.811  73.086  25.790  1.00  0.91           O  
ATOM   5440  CB  SER A 675      31.334  70.470  26.402  1.00  0.91           C  
ATOM   5441  OG  SER A 675      30.566  69.293  26.679  1.00  0.91           O  
ATOM   5442  N   GLY A 676      28.688  71.239  27.018  1.00  0.85           N  
ATOM   5443  CA  GLY A 676      27.422  71.608  27.620  1.00  0.85           C  
ATOM   5444  C   GLY A 676      26.801  70.481  28.381  1.00  0.85           C  
ATOM   5445  O   GLY A 676      25.741  69.961  28.050  1.00  0.85           O  
ATOM   5446  N   THR A 677      27.455  70.104  29.486  1.00  0.92           N  
ATOM   5447  CA  THR A 677      27.049  69.070  30.435  1.00  0.92           C  
ATOM   5448  C   THR A 677      25.658  69.283  31.023  1.00  0.92           C  
ATOM   5449  O   THR A 677      24.929  68.341  31.317  1.00  0.92           O  
ATOM   5450  CB  THR A 677      28.111  68.975  31.535  1.00  0.92           C  
ATOM   5451  OG1 THR A 677      29.215  68.237  31.039  1.00  0.92           O  
ATOM   5452  CG2 THR A 677      27.651  68.284  32.825  1.00  0.92           C  
ATOM   5453  N   GLY A 678      25.200  70.536  31.222  1.00  0.96           N  
ATOM   5454  CA  GLY A 678      23.815  70.768  31.642  1.00  0.96           C  
ATOM   5455  C   GLY A 678      22.786  70.470  30.578  1.00  0.96           C  
ATOM   5456  O   GLY A 678      21.719  69.941  30.868  1.00  0.96           O  
ATOM   5457  N   ASN A 679      23.107  70.786  29.312  1.00  0.94           N  
ATOM   5458  CA  ASN A 679      22.252  70.726  28.139  1.00  0.94           C  
ATOM   5459  C   ASN A 679      21.735  69.313  27.898  1.00  0.94           C  
ATOM   5460  O   ASN A 679      20.550  69.083  27.662  1.00  0.94           O  
ATOM   5461  CB  ASN A 679      23.012  71.208  26.859  1.00  0.94           C  
ATOM   5462  CG  ASN A 679      23.845  72.483  27.037  1.00  0.94           C  
ATOM   5463  OD1 ASN A 679      24.387  72.813  28.095  1.00  0.94           O  
ATOM   5464  ND2 ASN A 679      24.017  73.234  25.926  1.00  0.94           N  
ATOM   5465  N   MET A 680      22.644  68.329  28.034  1.00  0.93           N  
ATOM   5466  CA  MET A 680      22.380  66.912  27.896  1.00  0.93           C  
ATOM   5467  C   MET A 680      21.373  66.381  28.912  1.00  0.93           C  
ATOM   5468  O   MET A 680      20.476  65.609  28.584  1.00  0.93           O  
ATOM   5469  CB  MET A 680      23.705  66.124  28.043  1.00  0.93           C  
ATOM   5470  CG  MET A 680      24.835  66.624  27.119  1.00  0.93           C  
ATOM   5471  SD  MET A 680      26.399  65.732  27.363  1.00  0.93           S  
ATOM   5472  CE  MET A 680      27.419  66.862  26.380  1.00  0.93           C  
ATOM   5473  N   LYS A 681      21.478  66.822  30.184  1.00  0.93           N  
ATOM   5474  CA  LYS A 681      20.586  66.430  31.265  1.00  0.93           C  
ATOM   5475  C   LYS A 681      19.146  66.843  31.035  1.00  0.93           C  
ATOM   5476  O   LYS A 681      18.216  66.073  31.267  1.00  0.93           O  
ATOM   5477  CB  LYS A 681      21.024  67.076  32.600  1.00  0.93           C  
ATOM   5478  CG  LYS A 681      22.437  66.702  33.043  1.00  0.93           C  
ATOM   5479  CD  LYS A 681      22.929  67.574  34.202  1.00  0.93           C  
ATOM   5480  CE  LYS A 681      24.399  67.322  34.510  1.00  0.93           C  
ATOM   5481  NZ  LYS A 681      24.852  68.326  35.486  1.00  0.93           N  
ATOM   5482  N   PHE A 682      18.928  68.077  30.548  1.00  0.94           N  
ATOM   5483  CA  PHE A 682      17.618  68.579  30.185  1.00  0.94           C  
ATOM   5484  C   PHE A 682      16.971  67.803  29.052  1.00  0.94           C  
ATOM   5485  O   PHE A 682      15.798  67.446  29.117  1.00  0.94           O  
ATOM   5486  CB  PHE A 682      17.741  70.041  29.716  1.00  0.94           C  
ATOM   5487  CG  PHE A 682      18.090  70.956  30.846  1.00  0.94           C  
ATOM   5488  CD1 PHE A 682      17.194  71.139  31.907  1.00  0.94           C  
ATOM   5489  CD2 PHE A 682      19.268  71.715  30.809  1.00  0.94           C  
ATOM   5490  CE1 PHE A 682      17.447  72.108  32.882  1.00  0.94           C  
ATOM   5491  CE2 PHE A 682      19.549  72.651  31.810  1.00  0.94           C  
ATOM   5492  CZ  PHE A 682      18.631  72.847  32.843  1.00  0.94           C  
ATOM   5493  N   MET A 683      17.755  67.484  28.003  1.00  0.94           N  
ATOM   5494  CA  MET A 683      17.326  66.688  26.867  1.00  0.94           C  
ATOM   5495  C   MET A 683      16.883  65.292  27.278  1.00  0.94           C  
ATOM   5496  O   MET A 683      15.834  64.794  26.872  1.00  0.94           O  
ATOM   5497  CB  MET A 683      18.517  66.582  25.889  1.00  0.94           C  
ATOM   5498  CG  MET A 683      18.213  65.906  24.544  1.00  0.94           C  
ATOM   5499  SD  MET A 683      19.719  65.623  23.572  1.00  0.94           S  
ATOM   5500  CE  MET A 683      18.862  65.509  21.983  1.00  0.94           C  
ATOM   5501  N   LEU A 684      17.662  64.656  28.174  1.00  0.95           N  
ATOM   5502  CA  LEU A 684      17.351  63.375  28.776  1.00  0.95           C  
ATOM   5503  C   LEU A 684      16.065  63.421  29.602  1.00  0.95           C  
ATOM   5504  O   LEU A 684      15.230  62.521  29.566  1.00  0.95           O  
ATOM   5505  CB  LEU A 684      18.545  62.953  29.675  1.00  0.95           C  
ATOM   5506  CG  LEU A 684      18.907  61.452  29.707  1.00  0.95           C  
ATOM   5507  CD1 LEU A 684      19.832  61.167  30.903  1.00  0.95           C  
ATOM   5508  CD2 LEU A 684      17.693  60.520  29.734  1.00  0.95           C  
ATOM   5509  N   ASN A 685      15.854  64.525  30.343  1.00  0.95           N  
ATOM   5510  CA  ASN A 685      14.731  64.686  31.248  1.00  0.95           C  
ATOM   5511  C   ASN A 685      13.506  65.307  30.599  1.00  0.95           C  
ATOM   5512  O   ASN A 685      12.558  65.712  31.273  1.00  0.95           O  
ATOM   5513  CB  ASN A 685      15.148  65.531  32.473  1.00  0.95           C  
ATOM   5514  CG  ASN A 685      15.823  64.602  33.467  1.00  0.95           C  
ATOM   5515  OD1 ASN A 685      15.139  63.972  34.272  1.00  0.95           O  
ATOM   5516  ND2 ASN A 685      17.164  64.499  33.392  1.00  0.95           N  
ATOM   5517  N   GLY A 686      13.455  65.359  29.260  1.00  0.97           N  
ATOM   5518  CA  GLY A 686      12.232  65.697  28.555  1.00  0.97           C  
ATOM   5519  C   GLY A 686      11.938  67.154  28.426  1.00  0.97           C  
ATOM   5520  O   GLY A 686      10.778  67.548  28.417  1.00  0.97           O  
ATOM   5521  N   ALA A 687      12.978  67.985  28.320  1.00  0.98           N  
ATOM   5522  CA  ALA A 687      12.834  69.391  28.040  1.00  0.98           C  
ATOM   5523  C   ALA A 687      13.302  69.692  26.629  1.00  0.98           C  
ATOM   5524  O   ALA A 687      14.168  69.017  26.074  1.00  0.98           O  
ATOM   5525  CB  ALA A 687      13.665  70.207  29.041  1.00  0.98           C  
ATOM   5526  N   LEU A 688      12.730  70.734  26.005  1.00  0.95           N  
ATOM   5527  CA  LEU A 688      13.159  71.202  24.708  1.00  0.95           C  
ATOM   5528  C   LEU A 688      14.220  72.268  24.875  1.00  0.95           C  
ATOM   5529  O   LEU A 688      14.174  73.107  25.773  1.00  0.95           O  
ATOM   5530  CB  LEU A 688      11.982  71.758  23.871  1.00  0.95           C  
ATOM   5531  CG  LEU A 688      10.901  70.706  23.556  1.00  0.95           C  
ATOM   5532  CD1 LEU A 688       9.803  71.285  22.659  1.00  0.95           C  
ATOM   5533  CD2 LEU A 688      11.489  69.470  22.872  1.00  0.95           C  
ATOM   5534  N   THR A 689      15.246  72.249  24.011  1.00  0.95           N  
ATOM   5535  CA  THR A 689      16.395  73.135  24.152  1.00  0.95           C  
ATOM   5536  C   THR A 689      16.262  74.319  23.241  1.00  0.95           C  
ATOM   5537  O   THR A 689      16.134  74.167  22.028  1.00  0.95           O  
ATOM   5538  CB  THR A 689      17.718  72.435  23.858  1.00  0.95           C  
ATOM   5539  OG1 THR A 689      17.873  71.327  24.734  1.00  0.95           O  
ATOM   5540  CG2 THR A 689      18.928  73.354  24.090  1.00  0.95           C  
ATOM   5541  N   ILE A 690      16.321  75.540  23.808  1.00  0.94           N  
ATOM   5542  CA  ILE A 690      16.508  76.765  23.055  1.00  0.94           C  
ATOM   5543  C   ILE A 690      17.967  77.135  23.213  1.00  0.94           C  
ATOM   5544  O   ILE A 690      18.553  77.106  24.296  1.00  0.94           O  
ATOM   5545  CB  ILE A 690      15.563  77.902  23.445  1.00  0.94           C  
ATOM   5546  CG1 ILE A 690      15.704  79.109  22.491  1.00  0.94           C  
ATOM   5547  CG2 ILE A 690      15.794  78.316  24.907  1.00  0.94           C  
ATOM   5548  CD1 ILE A 690      14.653  80.195  22.737  1.00  0.94           C  
ATOM   5549  N   GLY A 691      18.658  77.419  22.104  1.00  0.96           N  
ATOM   5550  CA  GLY A 691      20.088  77.594  22.230  1.00  0.96           C  
ATOM   5551  C   GLY A 691      20.730  78.006  20.961  1.00  0.96           C  
ATOM   5552  O   GLY A 691      20.238  77.773  19.864  1.00  0.96           O  
ATOM   5553  N   THR A 692      21.893  78.642  21.081  1.00  0.93           N  
ATOM   5554  CA  THR A 692      22.746  78.967  19.957  1.00  0.93           C  
ATOM   5555  C   THR A 692      23.367  77.702  19.389  1.00  0.93           C  
ATOM   5556  O   THR A 692      23.535  76.701  20.087  1.00  0.93           O  
ATOM   5557  CB  THR A 692      23.814  79.959  20.367  1.00  0.93           C  
ATOM   5558  OG1 THR A 692      24.526  79.448  21.485  1.00  0.93           O  
ATOM   5559  CG2 THR A 692      23.113  81.253  20.816  1.00  0.93           C  
ATOM   5560  N   MET A 693      23.694  77.670  18.084  1.00  0.85           N  
ATOM   5561  CA  MET A 693      24.354  76.509  17.501  1.00  0.85           C  
ATOM   5562  C   MET A 693      25.847  76.472  17.807  1.00  0.85           C  
ATOM   5563  O   MET A 693      26.687  76.741  16.949  1.00  0.85           O  
ATOM   5564  CB  MET A 693      24.114  76.408  15.981  1.00  0.85           C  
ATOM   5565  CG  MET A 693      24.380  75.008  15.392  1.00  0.85           C  
ATOM   5566  SD  MET A 693      23.251  73.722  16.005  1.00  0.85           S  
ATOM   5567  CE  MET A 693      23.635  72.564  14.661  1.00  0.85           C  
ATOM   5568  N   ASP A 694      26.181  76.139  19.063  1.00  0.83           N  
ATOM   5569  CA  ASP A 694      27.529  76.067  19.574  1.00  0.83           C  
ATOM   5570  C   ASP A 694      27.553  75.030  20.702  1.00  0.83           C  
ATOM   5571  O   ASP A 694      26.507  74.522  21.120  1.00  0.83           O  
ATOM   5572  CB  ASP A 694      27.988  77.468  20.066  1.00  0.83           C  
ATOM   5573  CG  ASP A 694      29.478  77.510  20.357  1.00  0.83           C  
ATOM   5574  OD1 ASP A 694      29.908  78.399  21.133  1.00  0.83           O  
ATOM   5575  OD2 ASP A 694      30.205  76.654  19.795  1.00  0.83           O  
ATOM   5576  N   GLY A 695      28.758  74.666  21.194  1.00  0.86           N  
ATOM   5577  CA  GLY A 695      29.003  73.659  22.226  1.00  0.86           C  
ATOM   5578  C   GLY A 695      28.249  72.357  22.085  1.00  0.86           C  
ATOM   5579  O   GLY A 695      28.249  71.706  21.042  1.00  0.86           O  
ATOM   5580  N   ALA A 696      27.562  71.925  23.161  1.00  0.83           N  
ATOM   5581  CA  ALA A 696      26.774  70.702  23.152  1.00  0.83           C  
ATOM   5582  C   ALA A 696      25.552  70.738  22.249  1.00  0.83           C  
ATOM   5583  O   ALA A 696      25.109  69.699  21.761  1.00  0.83           O  
ATOM   5584  CB  ALA A 696      26.307  70.330  24.569  1.00  0.83           C  
ATOM   5585  N   ASN A 697      24.985  71.935  21.977  1.00  0.87           N  
ATOM   5586  CA  ASN A 697      23.780  72.088  21.175  1.00  0.87           C  
ATOM   5587  C   ASN A 697      23.975  71.555  19.761  1.00  0.87           C  
ATOM   5588  O   ASN A 697      23.071  70.951  19.190  1.00  0.87           O  
ATOM   5589  CB  ASN A 697      23.290  73.557  21.104  1.00  0.87           C  
ATOM   5590  CG  ASN A 697      22.979  74.119  22.490  1.00  0.87           C  
ATOM   5591  OD1 ASN A 697      22.672  73.409  23.451  1.00  0.87           O  
ATOM   5592  ND2 ASN A 697      23.046  75.466  22.595  1.00  0.87           N  
ATOM   5593  N   VAL A 698      25.193  71.723  19.200  1.00  0.90           N  
ATOM   5594  CA  VAL A 698      25.611  71.144  17.931  1.00  0.90           C  
ATOM   5595  C   VAL A 698      25.425  69.636  17.858  1.00  0.90           C  
ATOM   5596  O   VAL A 698      24.681  69.143  17.017  1.00  0.90           O  
ATOM   5597  CB  VAL A 698      27.083  71.469  17.679  1.00  0.90           C  
ATOM   5598  CG1 VAL A 698      27.623  70.762  16.419  1.00  0.90           C  
ATOM   5599  CG2 VAL A 698      27.236  72.990  17.516  1.00  0.90           C  
ATOM   5600  N   GLU A 699      26.036  68.858  18.778  1.00  0.89           N  
ATOM   5601  CA  GLU A 699      25.911  67.407  18.783  1.00  0.89           C  
ATOM   5602  C   GLU A 699      24.502  66.924  19.093  1.00  0.89           C  
ATOM   5603  O   GLU A 699      24.012  65.969  18.501  1.00  0.89           O  
ATOM   5604  CB  GLU A 699      26.948  66.712  19.702  1.00  0.89           C  
ATOM   5605  CG  GLU A 699      28.409  66.945  19.239  1.00  0.89           C  
ATOM   5606  CD  GLU A 699      29.388  65.928  19.810  1.00  0.89           C  
ATOM   5607  OE1 GLU A 699      29.048  64.713  19.847  1.00  0.89           O  
ATOM   5608  OE2 GLU A 699      30.520  66.327  20.191  1.00  0.89           O  
ATOM   5609  N   MET A 700      23.779  67.593  20.013  1.00  0.90           N  
ATOM   5610  CA  MET A 700      22.384  67.291  20.306  1.00  0.90           C  
ATOM   5611  C   MET A 700      21.474  67.459  19.087  1.00  0.90           C  
ATOM   5612  O   MET A 700      20.588  66.645  18.824  1.00  0.90           O  
ATOM   5613  CB  MET A 700      21.893  68.199  21.456  1.00  0.90           C  
ATOM   5614  CG  MET A 700      22.594  67.925  22.803  1.00  0.90           C  
ATOM   5615  SD  MET A 700      22.469  69.285  24.000  1.00  0.90           S  
ATOM   5616  CE  MET A 700      20.665  69.451  24.039  1.00  0.90           C  
ATOM   5617  N   ALA A 701      21.714  68.518  18.288  1.00  0.92           N  
ATOM   5618  CA  ALA A 701      21.088  68.743  17.005  1.00  0.92           C  
ATOM   5619  C   ALA A 701      21.427  67.693  15.959  1.00  0.92           C  
ATOM   5620  O   ALA A 701      20.581  67.336  15.149  1.00  0.92           O  
ATOM   5621  CB  ALA A 701      21.453  70.142  16.491  1.00  0.92           C  
ATOM   5622  N   GLU A 702      22.654  67.143  15.934  1.00  0.87           N  
ATOM   5623  CA  GLU A 702      22.967  66.032  15.049  1.00  0.87           C  
ATOM   5624  C   GLU A 702      22.153  64.777  15.347  1.00  0.87           C  
ATOM   5625  O   GLU A 702      21.564  64.177  14.451  1.00  0.87           O  
ATOM   5626  CB  GLU A 702      24.461  65.652  15.116  1.00  0.87           C  
ATOM   5627  CG  GLU A 702      25.424  66.788  14.707  1.00  0.87           C  
ATOM   5628  CD  GLU A 702      26.852  66.289  14.639  1.00  0.87           C  
ATOM   5629  OE1 GLU A 702      27.089  65.081  14.379  1.00  0.87           O  
ATOM   5630  OE2 GLU A 702      27.805  67.086  14.844  1.00  0.87           O  
ATOM   5631  N   GLU A 703      22.067  64.382  16.631  1.00  0.88           N  
ATOM   5632  CA  GLU A 703      21.354  63.186  17.040  1.00  0.88           C  
ATOM   5633  C   GLU A 703      19.836  63.258  16.929  1.00  0.88           C  
ATOM   5634  O   GLU A 703      19.180  62.355  16.414  1.00  0.88           O  
ATOM   5635  CB  GLU A 703      21.679  62.876  18.515  1.00  0.88           C  
ATOM   5636  CG  GLU A 703      23.183  62.698  18.806  1.00  0.88           C  
ATOM   5637  CD  GLU A 703      23.800  61.432  18.214  1.00  0.88           C  
ATOM   5638  OE1 GLU A 703      23.311  60.320  18.540  1.00  0.88           O  
ATOM   5639  OE2 GLU A 703      24.863  61.565  17.549  1.00  0.88           O  
ATOM   5640  N   ALA A 704      19.213  64.346  17.431  1.00  0.92           N  
ATOM   5641  CA  ALA A 704      17.772  64.495  17.362  1.00  0.92           C  
ATOM   5642  C   ALA A 704      17.307  65.084  16.051  1.00  0.92           C  
ATOM   5643  O   ALA A 704      16.219  64.779  15.573  1.00  0.92           O  
ATOM   5644  CB  ALA A 704      17.273  65.406  18.501  1.00  0.92           C  
ATOM   5645  N   GLY A 705      18.116  65.967  15.448  1.00  0.90           N  
ATOM   5646  CA  GLY A 705      17.743  66.804  14.319  1.00  0.90           C  
ATOM   5647  C   GLY A 705      17.683  68.252  14.716  1.00  0.90           C  
ATOM   5648  O   GLY A 705      17.057  68.605  15.710  1.00  0.90           O  
ATOM   5649  N   GLU A 706      18.289  69.156  13.906  1.00  0.84           N  
ATOM   5650  CA  GLU A 706      18.293  70.605  14.118  1.00  0.84           C  
ATOM   5651  C   GLU A 706      16.873  71.171  14.160  1.00  0.84           C  
ATOM   5652  O   GLU A 706      16.566  72.088  14.911  1.00  0.84           O  
ATOM   5653  CB  GLU A 706      19.208  71.324  13.081  1.00  0.84           C  
ATOM   5654  CG  GLU A 706      19.318  72.863  13.285  1.00  0.84           C  
ATOM   5655  CD  GLU A 706      20.488  73.548  12.572  1.00  0.84           C  
ATOM   5656  OE1 GLU A 706      21.364  72.856  12.004  1.00  0.84           O  
ATOM   5657  OE2 GLU A 706      20.546  74.811  12.610  1.00  0.84           O  
ATOM   5658  N   GLU A 707      15.951  70.499  13.433  1.00  0.86           N  
ATOM   5659  CA  GLU A 707      14.497  70.602  13.517  1.00  0.86           C  
ATOM   5660  C   GLU A 707      13.926  70.569  14.935  1.00  0.86           C  
ATOM   5661  O   GLU A 707      12.972  71.271  15.260  1.00  0.86           O  
ATOM   5662  CB  GLU A 707      13.917  69.369  12.763  1.00  0.86           C  
ATOM   5663  CG  GLU A 707      12.376  69.171  12.788  1.00  0.86           C  
ATOM   5664  CD  GLU A 707      11.932  67.718  12.850  1.00  0.86           C  
ATOM   5665  OE1 GLU A 707      12.731  66.782  13.129  1.00  0.86           O  
ATOM   5666  OE2 GLU A 707      10.710  67.486  12.662  1.00  0.86           O  
ATOM   5667  N   ASN A 708      14.497  69.733  15.820  1.00  0.88           N  
ATOM   5668  CA  ASN A 708      13.922  69.433  17.114  1.00  0.88           C  
ATOM   5669  C   ASN A 708      14.532  70.242  18.238  1.00  0.88           C  
ATOM   5670  O   ASN A 708      14.174  70.058  19.403  1.00  0.88           O  
ATOM   5671  CB  ASN A 708      14.089  67.927  17.423  1.00  0.88           C  
ATOM   5672  CG  ASN A 708      13.321  67.189  16.346  1.00  0.88           C  
ATOM   5673  OD1 ASN A 708      12.098  67.316  16.253  1.00  0.88           O  
ATOM   5674  ND2 ASN A 708      14.029  66.408  15.506  1.00  0.88           N  
ATOM   5675  N   LEU A 709      15.443  71.179  17.919  1.00  0.89           N  
ATOM   5676  CA  LEU A 709      15.990  72.102  18.885  1.00  0.89           C  
ATOM   5677  C   LEU A 709      15.655  73.498  18.417  1.00  0.89           C  
ATOM   5678  O   LEU A 709      15.623  73.802  17.229  1.00  0.89           O  
ATOM   5679  CB  LEU A 709      17.532  72.038  19.035  1.00  0.89           C  
ATOM   5680  CG  LEU A 709      18.161  70.681  19.411  1.00  0.89           C  
ATOM   5681  CD1 LEU A 709      19.612  70.911  19.850  1.00  0.89           C  
ATOM   5682  CD2 LEU A 709      17.429  69.925  20.523  1.00  0.89           C  
ATOM   5683  N   PHE A 710      15.403  74.419  19.351  1.00  0.92           N  
ATOM   5684  CA  PHE A 710      15.121  75.801  19.033  1.00  0.92           C  
ATOM   5685  C   PHE A 710      16.394  76.603  18.810  1.00  0.92           C  
ATOM   5686  O   PHE A 710      16.771  77.480  19.590  1.00  0.92           O  
ATOM   5687  CB  PHE A 710      14.228  76.413  20.129  1.00  0.92           C  
ATOM   5688  CG  PHE A 710      12.808  76.004  19.896  1.00  0.92           C  
ATOM   5689  CD1 PHE A 710      12.286  74.832  20.468  1.00  0.92           C  
ATOM   5690  CD2 PHE A 710      11.979  76.801  19.090  1.00  0.92           C  
ATOM   5691  CE1 PHE A 710      10.950  74.474  20.253  1.00  0.92           C  
ATOM   5692  CE2 PHE A 710      10.647  76.441  18.872  1.00  0.92           C  
ATOM   5693  CZ  PHE A 710      10.131  75.284  19.459  1.00  0.92           C  
ATOM   5694  N   ILE A 711      17.100  76.294  17.708  1.00  0.91           N  
ATOM   5695  CA  ILE A 711      18.286  77.008  17.280  1.00  0.91           C  
ATOM   5696  C   ILE A 711      17.982  78.443  16.881  1.00  0.91           C  
ATOM   5697  O   ILE A 711      17.007  78.739  16.187  1.00  0.91           O  
ATOM   5698  CB  ILE A 711      19.056  76.280  16.184  1.00  0.91           C  
ATOM   5699  CG1 ILE A 711      19.385  74.819  16.579  1.00  0.91           C  
ATOM   5700  CG2 ILE A 711      20.361  77.031  15.839  1.00  0.91           C  
ATOM   5701  CD1 ILE A 711      20.141  74.645  17.904  1.00  0.91           C  
ATOM   5702  N   PHE A 712      18.830  79.390  17.317  1.00  0.92           N  
ATOM   5703  CA  PHE A 712      18.652  80.790  17.006  1.00  0.92           C  
ATOM   5704  C   PHE A 712      19.973  81.526  17.047  1.00  0.92           C  
ATOM   5705  O   PHE A 712      21.004  80.978  17.436  1.00  0.92           O  
ATOM   5706  CB  PHE A 712      17.611  81.492  17.936  1.00  0.92           C  
ATOM   5707  CG  PHE A 712      18.146  81.812  19.309  1.00  0.92           C  
ATOM   5708  CD1 PHE A 712      18.606  83.110  19.595  1.00  0.92           C  
ATOM   5709  CD2 PHE A 712      18.313  80.803  20.266  1.00  0.92           C  
ATOM   5710  CE1 PHE A 712      19.275  83.382  20.792  1.00  0.92           C  
ATOM   5711  CE2 PHE A 712      18.966  81.078  21.471  1.00  0.92           C  
ATOM   5712  CZ  PHE A 712      19.458  82.362  21.727  1.00  0.92           C  
ATOM   5713  N   GLY A 713      19.921  82.822  16.673  1.00  0.93           N  
ATOM   5714  CA  GLY A 713      21.048  83.725  16.805  1.00  0.93           C  
ATOM   5715  C   GLY A 713      22.127  83.503  15.799  1.00  0.93           C  
ATOM   5716  O   GLY A 713      22.046  82.645  14.919  1.00  0.93           O  
ATOM   5717  N   MET A 714      23.173  84.323  15.915  1.00  0.88           N  
ATOM   5718  CA  MET A 714      24.362  84.220  15.108  1.00  0.88           C  
ATOM   5719  C   MET A 714      25.078  82.881  15.246  1.00  0.88           C  
ATOM   5720  O   MET A 714      25.251  82.327  16.333  1.00  0.88           O  
ATOM   5721  CB  MET A 714      25.328  85.362  15.489  1.00  0.88           C  
ATOM   5722  CG  MET A 714      24.815  86.756  15.083  1.00  0.88           C  
ATOM   5723  SD  MET A 714      25.964  88.103  15.499  1.00  0.88           S  
ATOM   5724  CE  MET A 714      25.563  88.060  17.266  1.00  0.88           C  
ATOM   5725  N   ARG A 715      25.536  82.326  14.114  1.00  0.81           N  
ATOM   5726  CA  ARG A 715      26.430  81.193  14.077  1.00  0.81           C  
ATOM   5727  C   ARG A 715      27.854  81.687  14.328  1.00  0.81           C  
ATOM   5728  O   ARG A 715      28.117  82.886  14.406  1.00  0.81           O  
ATOM   5729  CB  ARG A 715      26.320  80.443  12.720  1.00  0.81           C  
ATOM   5730  CG  ARG A 715      24.886  79.984  12.344  1.00  0.81           C  
ATOM   5731  CD  ARG A 715      24.312  78.844  13.196  1.00  0.81           C  
ATOM   5732  NE  ARG A 715      22.878  78.643  12.790  1.00  0.81           N  
ATOM   5733  CZ  ARG A 715      22.270  77.467  12.578  1.00  0.81           C  
ATOM   5734  NH1 ARG A 715      22.907  76.310  12.458  1.00  0.81           N  
ATOM   5735  NH2 ARG A 715      20.945  77.423  12.497  1.00  0.81           N  
ATOM   5736  N   ILE A 716      28.833  80.778  14.506  1.00  0.80           N  
ATOM   5737  CA  ILE A 716      30.210  81.150  14.840  1.00  0.80           C  
ATOM   5738  C   ILE A 716      30.855  82.026  13.761  1.00  0.80           C  
ATOM   5739  O   ILE A 716      31.510  83.030  14.052  1.00  0.80           O  
ATOM   5740  CB  ILE A 716      31.073  79.923  15.154  1.00  0.80           C  
ATOM   5741  CG1 ILE A 716      30.371  79.005  16.190  1.00  0.80           C  
ATOM   5742  CG2 ILE A 716      32.442  80.391  15.698  1.00  0.80           C  
ATOM   5743  CD1 ILE A 716      31.115  77.698  16.491  1.00  0.80           C  
ATOM   5744  N   ASP A 717      30.603  81.701  12.479  1.00  0.78           N  
ATOM   5745  CA  ASP A 717      30.986  82.480  11.317  1.00  0.78           C  
ATOM   5746  C   ASP A 717      30.393  83.892  11.303  1.00  0.78           C  
ATOM   5747  O   ASP A 717      31.088  84.878  11.061  1.00  0.78           O  
ATOM   5748  CB  ASP A 717      30.504  81.717  10.063  1.00  0.78           C  
ATOM   5749  CG  ASP A 717      31.035  80.301  10.137  1.00  0.78           C  
ATOM   5750  OD1 ASP A 717      32.265  80.121   9.983  1.00  0.78           O  
ATOM   5751  OD2 ASP A 717      30.218  79.395  10.440  1.00  0.78           O  
ATOM   5752  N   ASP A 718      29.090  84.025  11.623  1.00  0.83           N  
ATOM   5753  CA  ASP A 718      28.349  85.272  11.709  1.00  0.83           C  
ATOM   5754  C   ASP A 718      28.938  86.222  12.753  1.00  0.83           C  
ATOM   5755  O   ASP A 718      29.127  87.417  12.517  1.00  0.83           O  
ATOM   5756  CB  ASP A 718      26.860  85.027  12.084  1.00  0.83           C  
ATOM   5757  CG  ASP A 718      26.177  83.920  11.297  1.00  0.83           C  
ATOM   5758  OD1 ASP A 718      26.761  83.371  10.336  1.00  0.83           O  
ATOM   5759  OD2 ASP A 718      25.050  83.558  11.726  1.00  0.83           O  
ATOM   5760  N   VAL A 719      29.289  85.688  13.945  1.00  0.85           N  
ATOM   5761  CA  VAL A 719      29.935  86.454  15.005  1.00  0.85           C  
ATOM   5762  C   VAL A 719      31.305  86.963  14.579  1.00  0.85           C  
ATOM   5763  O   VAL A 719      31.610  88.145  14.732  1.00  0.85           O  
ATOM   5764  CB  VAL A 719      30.063  85.653  16.302  1.00  0.85           C  
ATOM   5765  CG1 VAL A 719      30.738  86.481  17.414  1.00  0.85           C  
ATOM   5766  CG2 VAL A 719      28.673  85.227  16.803  1.00  0.85           C  
ATOM   5767  N   ALA A 720      32.124  86.093  13.952  1.00  0.81           N  
ATOM   5768  CA  ALA A 720      33.419  86.432  13.391  1.00  0.81           C  
ATOM   5769  C   ALA A 720      33.363  87.468  12.270  1.00  0.81           C  
ATOM   5770  O   ALA A 720      34.202  88.361  12.178  1.00  0.81           O  
ATOM   5771  CB  ALA A 720      34.117  85.145  12.912  1.00  0.81           C  
ATOM   5772  N   ALA A 721      32.339  87.397  11.398  1.00  0.78           N  
ATOM   5773  CA  ALA A 721      32.055  88.396  10.390  1.00  0.78           C  
ATOM   5774  C   ALA A 721      31.754  89.779  10.971  1.00  0.78           C  
ATOM   5775  O   ALA A 721      32.212  90.808  10.469  1.00  0.78           O  
ATOM   5776  CB  ALA A 721      30.857  87.911   9.554  1.00  0.78           C  
ATOM   5777  N   LEU A 722      30.979  89.830  12.075  1.00  0.77           N  
ATOM   5778  CA  LEU A 722      30.719  91.044  12.826  1.00  0.77           C  
ATOM   5779  C   LEU A 722      31.964  91.611  13.501  1.00  0.77           C  
ATOM   5780  O   LEU A 722      32.217  92.818  13.435  1.00  0.77           O  
ATOM   5781  CB  LEU A 722      29.573  90.811  13.841  1.00  0.77           C  
ATOM   5782  CG  LEU A 722      29.099  92.047  14.637  1.00  0.77           C  
ATOM   5783  CD1 LEU A 722      28.772  93.240  13.727  1.00  0.77           C  
ATOM   5784  CD2 LEU A 722      27.863  91.686  15.474  1.00  0.77           C  
ATOM   5785  N   ASP A 723      32.825  90.745  14.085  1.00  0.75           N  
ATOM   5786  CA  ASP A 723      34.099  91.113  14.703  1.00  0.75           C  
ATOM   5787  C   ASP A 723      35.210  91.435  13.698  1.00  0.75           C  
ATOM   5788  O   ASP A 723      36.407  91.305  13.946  1.00  0.75           O  
ATOM   5789  CB  ASP A 723      34.574  90.020  15.695  1.00  0.75           C  
ATOM   5790  CG  ASP A 723      33.647  90.016  16.882  1.00  0.75           C  
ATOM   5791  OD1 ASP A 723      33.322  91.111  17.414  1.00  0.75           O  
ATOM   5792  OD2 ASP A 723      33.127  88.943  17.275  1.00  0.75           O  
ATOM   5793  N   LYS A 724      34.805  91.947  12.530  1.00  0.70           N  
ATOM   5794  CA  LYS A 724      35.675  92.471  11.516  1.00  0.70           C  
ATOM   5795  C   LYS A 724      35.117  93.778  10.969  1.00  0.70           C  
ATOM   5796  O   LYS A 724      35.763  94.465  10.179  1.00  0.70           O  
ATOM   5797  CB  LYS A 724      35.770  91.407  10.396  1.00  0.70           C  
ATOM   5798  CG  LYS A 724      36.751  91.714   9.254  1.00  0.70           C  
ATOM   5799  CD  LYS A 724      38.189  91.923   9.756  1.00  0.70           C  
ATOM   5800  CE  LYS A 724      39.200  92.206   8.647  1.00  0.70           C  
ATOM   5801  NZ  LYS A 724      39.266  91.056   7.718  1.00  0.70           N  
ATOM   5802  N   LYS A 725      33.905  94.188  11.399  1.00  0.71           N  
ATOM   5803  CA  LYS A 725      33.321  95.440  10.955  1.00  0.71           C  
ATOM   5804  C   LYS A 725      33.068  96.384  12.102  1.00  0.71           C  
ATOM   5805  O   LYS A 725      33.383  97.567  12.015  1.00  0.71           O  
ATOM   5806  CB  LYS A 725      31.955  95.187  10.260  1.00  0.71           C  
ATOM   5807  CG  LYS A 725      32.065  94.609   8.840  1.00  0.71           C  
ATOM   5808  CD  LYS A 725      32.672  95.623   7.856  1.00  0.71           C  
ATOM   5809  CE  LYS A 725      32.833  95.110   6.424  1.00  0.71           C  
ATOM   5810  NZ  LYS A 725      31.514  94.771   5.843  1.00  0.71           N  
ATOM   5811  N   GLY A 726      32.501  95.884  13.211  1.00  0.76           N  
ATOM   5812  CA  GLY A 726      32.085  96.741  14.307  1.00  0.76           C  
ATOM   5813  C   GLY A 726      30.706  96.389  14.752  1.00  0.76           C  
ATOM   5814  O   GLY A 726      29.752  96.416  13.987  1.00  0.76           O  
ATOM   5815  N   TYR A 727      30.561  96.060  16.039  1.00  0.78           N  
ATOM   5816  CA  TYR A 727      29.268  95.925  16.667  1.00  0.78           C  
ATOM   5817  C   TYR A 727      28.933  97.247  17.331  1.00  0.78           C  
ATOM   5818  O   TYR A 727      29.350  97.498  18.462  1.00  0.78           O  
ATOM   5819  CB  TYR A 727      29.354  94.762  17.695  1.00  0.78           C  
ATOM   5820  CG  TYR A 727      28.164  94.627  18.611  1.00  0.78           C  
ATOM   5821  CD1 TYR A 727      26.855  94.364  18.161  1.00  0.78           C  
ATOM   5822  CD2 TYR A 727      28.389  94.784  19.984  1.00  0.78           C  
ATOM   5823  CE1 TYR A 727      25.801  94.215  19.087  1.00  0.78           C  
ATOM   5824  CE2 TYR A 727      27.335  94.677  20.884  1.00  0.78           C  
ATOM   5825  CZ  TYR A 727      26.057  94.346  20.458  1.00  0.78           C  
ATOM   5826  OH  TYR A 727      25.111  94.087  21.471  1.00  0.78           O  
ATOM   5827  N   GLU A 728      28.154  98.123  16.663  1.00  0.77           N  
ATOM   5828  CA  GLU A 728      27.646  99.291  17.349  1.00  0.77           C  
ATOM   5829  C   GLU A 728      26.281  98.983  17.937  1.00  0.77           C  
ATOM   5830  O   GLU A 728      25.229  98.954  17.305  1.00  0.77           O  
ATOM   5831  CB  GLU A 728      27.658 100.617  16.554  1.00  0.77           C  
ATOM   5832  CG  GLU A 728      27.459 101.814  17.525  1.00  0.77           C  
ATOM   5833  CD  GLU A 728      27.417 103.214  16.916  1.00  0.77           C  
ATOM   5834  OE1 GLU A 728      27.697 103.397  15.713  1.00  0.77           O  
ATOM   5835  OE2 GLU A 728      27.099 104.135  17.719  1.00  0.77           O  
ATOM   5836  N   ALA A 729      26.267  98.755  19.258  1.00  0.86           N  
ATOM   5837  CA  ALA A 729      25.108  98.351  20.021  1.00  0.86           C  
ATOM   5838  C   ALA A 729      23.986  99.398  20.037  1.00  0.86           C  
ATOM   5839  O   ALA A 729      22.813  99.106  20.268  1.00  0.86           O  
ATOM   5840  CB  ALA A 729      25.646  98.049  21.421  1.00  0.86           C  
ATOM   5841  N   LYS A 730      24.340 100.654  19.712  1.00  0.77           N  
ATOM   5842  CA  LYS A 730      23.442 101.766  19.489  1.00  0.77           C  
ATOM   5843  C   LYS A 730      22.477 101.567  18.322  1.00  0.77           C  
ATOM   5844  O   LYS A 730      21.323 101.985  18.400  1.00  0.77           O  
ATOM   5845  CB  LYS A 730      24.299 103.032  19.267  1.00  0.77           C  
ATOM   5846  CG  LYS A 730      23.549 104.371  19.339  1.00  0.77           C  
ATOM   5847  CD  LYS A 730      24.462 105.575  19.029  1.00  0.77           C  
ATOM   5848  CE  LYS A 730      25.708 105.722  19.918  1.00  0.77           C  
ATOM   5849  NZ  LYS A 730      25.332 105.805  21.344  1.00  0.77           N  
ATOM   5850  N   GLU A 731      22.909 100.910  17.220  1.00  0.75           N  
ATOM   5851  CA  GLU A 731      22.079 100.676  16.046  1.00  0.75           C  
ATOM   5852  C   GLU A 731      20.834  99.855  16.338  1.00  0.75           C  
ATOM   5853  O   GLU A 731      19.708 100.239  16.025  1.00  0.75           O  
ATOM   5854  CB  GLU A 731      22.864  99.865  14.984  1.00  0.75           C  
ATOM   5855  CG  GLU A 731      24.173 100.506  14.476  1.00  0.75           C  
ATOM   5856  CD  GLU A 731      24.883  99.530  13.538  1.00  0.75           C  
ATOM   5857  OE1 GLU A 731      24.411  99.394  12.379  1.00  0.75           O  
ATOM   5858  OE2 GLU A 731      25.871  98.887  13.984  1.00  0.75           O  
ATOM   5859  N   TYR A 732      21.017  98.707  17.021  1.00  0.81           N  
ATOM   5860  CA  TYR A 732      19.955  97.791  17.385  1.00  0.81           C  
ATOM   5861  C   TYR A 732      18.943  98.413  18.333  1.00  0.81           C  
ATOM   5862  O   TYR A 732      17.751  98.147  18.241  1.00  0.81           O  
ATOM   5863  CB  TYR A 732      20.524  96.518  18.056  1.00  0.81           C  
ATOM   5864  CG  TYR A 732      21.371  95.707  17.112  1.00  0.81           C  
ATOM   5865  CD1 TYR A 732      22.765  95.886  17.063  1.00  0.81           C  
ATOM   5866  CD2 TYR A 732      20.784  94.718  16.303  1.00  0.81           C  
ATOM   5867  CE1 TYR A 732      23.557  95.078  16.235  1.00  0.81           C  
ATOM   5868  CE2 TYR A 732      21.577  93.910  15.474  1.00  0.81           C  
ATOM   5869  CZ  TYR A 732      22.966  94.084  15.451  1.00  0.81           C  
ATOM   5870  OH  TYR A 732      23.775  93.241  14.664  1.00  0.81           O  
ATOM   5871  N   TYR A 733      19.405  99.263  19.271  1.00  0.79           N  
ATOM   5872  CA  TYR A 733      18.572  99.943  20.251  1.00  0.79           C  
ATOM   5873  C   TYR A 733      17.445 100.776  19.647  1.00  0.79           C  
ATOM   5874  O   TYR A 733      16.283 100.557  19.973  1.00  0.79           O  
ATOM   5875  CB  TYR A 733      19.532 100.828  21.091  1.00  0.79           C  
ATOM   5876  CG  TYR A 733      18.910 101.735  22.121  1.00  0.79           C  
ATOM   5877  CD1 TYR A 733      18.115 101.246  23.174  1.00  0.79           C  
ATOM   5878  CD2 TYR A 733      19.214 103.106  22.077  1.00  0.79           C  
ATOM   5879  CE1 TYR A 733      17.667 102.119  24.184  1.00  0.79           C  
ATOM   5880  CE2 TYR A 733      18.785 103.965  23.094  1.00  0.79           C  
ATOM   5881  CZ  TYR A 733      18.024 103.472  24.151  1.00  0.79           C  
ATOM   5882  OH  TYR A 733      17.643 104.378  25.160  1.00  0.79           O  
ATOM   5883  N   GLU A 734      17.759 101.698  18.714  1.00  0.69           N  
ATOM   5884  CA  GLU A 734      16.756 102.494  18.016  1.00  0.69           C  
ATOM   5885  C   GLU A 734      15.963 101.674  17.004  1.00  0.69           C  
ATOM   5886  O   GLU A 734      14.752 101.803  16.842  1.00  0.69           O  
ATOM   5887  CB  GLU A 734      17.433 103.708  17.332  1.00  0.69           C  
ATOM   5888  CG  GLU A 734      16.461 104.718  16.661  1.00  0.69           C  
ATOM   5889  CD  GLU A 734      15.665 105.578  17.648  1.00  0.69           C  
ATOM   5890  OE1 GLU A 734      15.869 106.820  17.609  1.00  0.69           O  
ATOM   5891  OE2 GLU A 734      14.848 105.026  18.427  1.00  0.69           O  
ATOM   5892  N   ALA A 735      16.641 100.748  16.293  1.00  0.80           N  
ATOM   5893  CA  ALA A 735      16.017  99.888  15.309  1.00  0.80           C  
ATOM   5894  C   ALA A 735      14.923  98.958  15.846  1.00  0.80           C  
ATOM   5895  O   ALA A 735      13.966  98.638  15.143  1.00  0.80           O  
ATOM   5896  CB  ALA A 735      17.105  99.070  14.587  1.00  0.80           C  
ATOM   5897  N   LEU A 736      15.044  98.485  17.102  1.00  0.80           N  
ATOM   5898  CA  LEU A 736      14.152  97.490  17.662  1.00  0.80           C  
ATOM   5899  C   LEU A 736      13.185  98.046  18.718  1.00  0.80           C  
ATOM   5900  O   LEU A 736      13.621  98.382  19.823  1.00  0.80           O  
ATOM   5901  CB  LEU A 736      14.986  96.363  18.300  1.00  0.80           C  
ATOM   5902  CG  LEU A 736      15.674  95.456  17.263  1.00  0.80           C  
ATOM   5903  CD1 LEU A 736      16.722  94.569  17.941  1.00  0.80           C  
ATOM   5904  CD2 LEU A 736      14.642  94.602  16.517  1.00  0.80           C  
ATOM   5905  N   PRO A 737      11.860  98.115  18.481  1.00  0.77           N  
ATOM   5906  CA  PRO A 737      10.922  98.861  19.327  1.00  0.77           C  
ATOM   5907  C   PRO A 737      10.842  98.370  20.757  1.00  0.77           C  
ATOM   5908  O   PRO A 737      10.874  99.164  21.697  1.00  0.77           O  
ATOM   5909  CB  PRO A 737       9.559  98.691  18.621  1.00  0.77           C  
ATOM   5910  CG  PRO A 737       9.912  98.440  17.154  1.00  0.77           C  
ATOM   5911  CD  PRO A 737      11.227  97.674  17.232  1.00  0.77           C  
ATOM   5912  N   GLU A 738      10.728  97.042  20.937  1.00  0.80           N  
ATOM   5913  CA  GLU A 738      10.674  96.406  22.235  1.00  0.80           C  
ATOM   5914  C   GLU A 738      11.979  96.543  22.995  1.00  0.80           C  
ATOM   5915  O   GLU A 738      11.989  96.816  24.193  1.00  0.80           O  
ATOM   5916  CB  GLU A 738      10.285  94.917  22.099  1.00  0.80           C  
ATOM   5917  CG  GLU A 738       8.873  94.721  21.498  1.00  0.80           C  
ATOM   5918  CD  GLU A 738       8.406  93.276  21.563  1.00  0.80           C  
ATOM   5919  OE1 GLU A 738       9.085  92.371  21.014  1.00  0.80           O  
ATOM   5920  OE2 GLU A 738       7.336  93.037  22.175  1.00  0.80           O  
ATOM   5921  N   LEU A 739      13.126  96.409  22.293  1.00  0.85           N  
ATOM   5922  CA  LEU A 739      14.440  96.519  22.897  1.00  0.85           C  
ATOM   5923  C   LEU A 739      14.703  97.882  23.497  1.00  0.85           C  
ATOM   5924  O   LEU A 739      15.161  97.993  24.632  1.00  0.85           O  
ATOM   5925  CB  LEU A 739      15.555  96.258  21.863  1.00  0.85           C  
ATOM   5926  CG  LEU A 739      16.982  96.270  22.444  1.00  0.85           C  
ATOM   5927  CD1 LEU A 739      17.187  95.161  23.483  1.00  0.85           C  
ATOM   5928  CD2 LEU A 739      18.005  96.160  21.309  1.00  0.85           C  
ATOM   5929  N   LYS A 740      14.344  98.954  22.759  1.00  0.79           N  
ATOM   5930  CA  LYS A 740      14.413 100.323  23.228  1.00  0.79           C  
ATOM   5931  C   LYS A 740      13.688 100.501  24.550  1.00  0.79           C  
ATOM   5932  O   LYS A 740      14.262 100.968  25.524  1.00  0.79           O  
ATOM   5933  CB  LYS A 740      13.759 101.238  22.167  1.00  0.79           C  
ATOM   5934  CG  LYS A 740      13.602 102.714  22.566  1.00  0.79           C  
ATOM   5935  CD  LYS A 740      12.365 103.335  21.898  1.00  0.79           C  
ATOM   5936  CE  LYS A 740      11.671 104.431  22.710  1.00  0.79           C  
ATOM   5937  NZ  LYS A 740      11.265 103.912  24.026  1.00  0.79           N  
ATOM   5938  N   LEU A 741      12.429 100.028  24.645  1.00  0.83           N  
ATOM   5939  CA  LEU A 741      11.630 100.125  25.853  1.00  0.83           C  
ATOM   5940  C   LEU A 741      12.247  99.425  27.057  1.00  0.83           C  
ATOM   5941  O   LEU A 741      12.317  99.997  28.142  1.00  0.83           O  
ATOM   5942  CB  LEU A 741      10.224  99.552  25.554  1.00  0.83           C  
ATOM   5943  CG  LEU A 741       9.215  99.551  26.721  1.00  0.83           C  
ATOM   5944  CD1 LEU A 741       9.001 100.940  27.336  1.00  0.83           C  
ATOM   5945  CD2 LEU A 741       7.874  98.970  26.252  1.00  0.83           C  
ATOM   5946  N   VAL A 742      12.771  98.195  26.878  1.00  0.86           N  
ATOM   5947  CA  VAL A 742      13.466  97.466  27.931  1.00  0.86           C  
ATOM   5948  C   VAL A 742      14.708  98.199  28.428  1.00  0.86           C  
ATOM   5949  O   VAL A 742      14.907  98.397  29.626  1.00  0.86           O  
ATOM   5950  CB  VAL A 742      13.859  96.072  27.433  1.00  0.86           C  
ATOM   5951  CG1 VAL A 742      14.694  95.307  28.476  1.00  0.86           C  
ATOM   5952  CG2 VAL A 742      12.588  95.266  27.117  1.00  0.86           C  
ATOM   5953  N   ILE A 743      15.566  98.672  27.509  1.00  0.83           N  
ATOM   5954  CA  ILE A 743      16.798  99.369  27.850  1.00  0.83           C  
ATOM   5955  C   ILE A 743      16.557 100.735  28.482  1.00  0.83           C  
ATOM   5956  O   ILE A 743      17.207 101.072  29.473  1.00  0.83           O  
ATOM   5957  CB  ILE A 743      17.769  99.366  26.677  1.00  0.83           C  
ATOM   5958  CG1 ILE A 743      18.077  97.916  26.221  1.00  0.83           C  
ATOM   5959  CG2 ILE A 743      19.082 100.104  27.013  1.00  0.83           C  
ATOM   5960  CD1 ILE A 743      18.592  96.969  27.316  1.00  0.83           C  
ATOM   5961  N   ASP A 744      15.552 101.508  28.003  1.00  0.85           N  
ATOM   5962  CA  ASP A 744      15.115 102.749  28.634  1.00  0.85           C  
ATOM   5963  C   ASP A 744      14.699 102.534  30.085  1.00  0.85           C  
ATOM   5964  O   ASP A 744      15.127 103.227  31.005  1.00  0.85           O  
ATOM   5965  CB  ASP A 744      13.851 103.313  27.947  1.00  0.85           C  
ATOM   5966  CG  ASP A 744      14.080 103.719  26.514  1.00  0.85           C  
ATOM   5967  OD1 ASP A 744      15.226 103.877  26.040  1.00  0.85           O  
ATOM   5968  OD2 ASP A 744      13.032 103.893  25.839  1.00  0.85           O  
ATOM   5969  N   GLN A 745      13.885 101.487  30.331  1.00  0.85           N  
ATOM   5970  CA  GLN A 745      13.419 101.104  31.649  1.00  0.85           C  
ATOM   5971  C   GLN A 745      14.540 100.750  32.616  1.00  0.85           C  
ATOM   5972  O   GLN A 745      14.495 101.118  33.790  1.00  0.85           O  
ATOM   5973  CB  GLN A 745      12.455  99.898  31.540  1.00  0.85           C  
ATOM   5974  CG  GLN A 745      11.046 100.273  31.029  1.00  0.85           C  
ATOM   5975  CD  GLN A 745      10.233  99.011  30.746  1.00  0.85           C  
ATOM   5976  OE1 GLN A 745      10.752  97.996  30.282  1.00  0.85           O  
ATOM   5977  NE2 GLN A 745       8.913  99.058  31.037  1.00  0.85           N  
ATOM   5978  N   ILE A 746      15.577 100.026  32.154  1.00  0.86           N  
ATOM   5979  CA  ILE A 746      16.753  99.722  32.957  1.00  0.86           C  
ATOM   5980  C   ILE A 746      17.588 100.969  33.288  1.00  0.86           C  
ATOM   5981  O   ILE A 746      17.963 101.160  34.443  1.00  0.86           O  
ATOM   5982  CB  ILE A 746      17.594  98.624  32.300  1.00  0.86           C  
ATOM   5983  CG1 ILE A 746      16.778  97.317  32.140  1.00  0.86           C  
ATOM   5984  CG2 ILE A 746      18.855  98.323  33.136  1.00  0.86           C  
ATOM   5985  CD1 ILE A 746      17.452  96.294  31.216  1.00  0.86           C  
ATOM   5986  N   ASP A 747      17.866 101.870  32.313  1.00  0.85           N  
ATOM   5987  CA  ASP A 747      18.597 103.119  32.549  1.00  0.85           C  
ATOM   5988  C   ASP A 747      17.837 104.143  33.401  1.00  0.85           C  
ATOM   5989  O   ASP A 747      18.404 104.839  34.241  1.00  0.85           O  
ATOM   5990  CB  ASP A 747      19.040 103.772  31.205  1.00  0.85           C  
ATOM   5991  CG  ASP A 747      20.097 104.833  31.427  1.00  0.85           C  
ATOM   5992  OD1 ASP A 747      21.257 104.474  31.759  1.00  0.85           O  
ATOM   5993  OD2 ASP A 747      19.810 106.052  31.308  1.00  0.85           O  
ATOM   5994  N   ASN A 748      16.508 104.265  33.209  1.00  0.85           N  
ATOM   5995  CA  ASN A 748      15.709 105.260  33.903  1.00  0.85           C  
ATOM   5996  C   ASN A 748      15.220 104.764  35.256  1.00  0.85           C  
ATOM   5997  O   ASN A 748      14.591 105.509  36.002  1.00  0.85           O  
ATOM   5998  CB  ASN A 748      14.439 105.638  33.087  1.00  0.85           C  
ATOM   5999  CG  ASN A 748      14.715 106.275  31.726  1.00  0.85           C  
ATOM   6000  OD1 ASN A 748      13.926 106.110  30.795  1.00  0.85           O  
ATOM   6001  ND2 ASN A 748      15.798 107.070  31.600  1.00  0.85           N  
ATOM   6002  N   GLY A 749      15.513 103.502  35.628  1.00  0.86           N  
ATOM   6003  CA  GLY A 749      15.236 103.019  36.974  1.00  0.86           C  
ATOM   6004  C   GLY A 749      13.853 102.512  37.225  1.00  0.86           C  
ATOM   6005  O   GLY A 749      13.375 102.523  38.354  1.00  0.86           O  
ATOM   6006  N   PHE A 750      13.161 102.009  36.192  1.00  0.89           N  
ATOM   6007  CA  PHE A 750      11.829 101.433  36.313  1.00  0.89           C  
ATOM   6008  C   PHE A 750      11.814 100.216  37.239  1.00  0.89           C  
ATOM   6009  O   PHE A 750      10.919 100.026  38.057  1.00  0.89           O  
ATOM   6010  CB  PHE A 750      11.332 101.079  34.889  1.00  0.89           C  
ATOM   6011  CG  PHE A 750       9.976 100.434  34.871  1.00  0.89           C  
ATOM   6012  CD1 PHE A 750       8.834 101.099  35.345  1.00  0.89           C  
ATOM   6013  CD2 PHE A 750       9.854  99.117  34.416  1.00  0.89           C  
ATOM   6014  CE1 PHE A 750       7.592 100.448  35.367  1.00  0.89           C  
ATOM   6015  CE2 PHE A 750       8.624  98.460  34.443  1.00  0.89           C  
ATOM   6016  CZ  PHE A 750       7.486  99.125  34.916  1.00  0.89           C  
ATOM   6017  N   PHE A 751      12.874  99.394  37.163  1.00  0.88           N  
ATOM   6018  CA  PHE A 751      13.035  98.241  38.027  1.00  0.88           C  
ATOM   6019  C   PHE A 751      13.822  98.585  39.281  1.00  0.88           C  
ATOM   6020  O   PHE A 751      14.105  97.733  40.113  1.00  0.88           O  
ATOM   6021  CB  PHE A 751      13.766  97.100  37.275  1.00  0.88           C  
ATOM   6022  CG  PHE A 751      12.867  96.582  36.195  1.00  0.88           C  
ATOM   6023  CD1 PHE A 751      11.763  95.794  36.546  1.00  0.88           C  
ATOM   6024  CD2 PHE A 751      13.083  96.893  34.843  1.00  0.88           C  
ATOM   6025  CE1 PHE A 751      10.877  95.323  35.572  1.00  0.88           C  
ATOM   6026  CE2 PHE A 751      12.186  96.444  33.864  1.00  0.88           C  
ATOM   6027  CZ  PHE A 751      11.080  95.664  34.233  1.00  0.88           C  
ATOM   6028  N   SER A 752      14.170  99.860  39.493  1.00  0.86           N  
ATOM   6029  CA  SER A 752      14.961 100.257  40.645  1.00  0.86           C  
ATOM   6030  C   SER A 752      14.614 101.655  41.128  1.00  0.86           C  
ATOM   6031  O   SER A 752      15.493 102.511  41.181  1.00  0.86           O  
ATOM   6032  CB  SER A 752      16.490 100.160  40.376  1.00  0.86           C  
ATOM   6033  OG  SER A 752      16.893 100.870  39.204  1.00  0.86           O  
ATOM   6034  N   PRO A 753      13.385 101.962  41.557  1.00  0.87           N  
ATOM   6035  CA  PRO A 753      12.928 103.334  41.804  1.00  0.87           C  
ATOM   6036  C   PRO A 753      13.641 104.022  42.950  1.00  0.87           C  
ATOM   6037  O   PRO A 753      13.546 105.236  43.083  1.00  0.87           O  
ATOM   6038  CB  PRO A 753      11.432 103.154  42.131  1.00  0.87           C  
ATOM   6039  CG  PRO A 753      11.326 101.719  42.655  1.00  0.87           C  
ATOM   6040  CD  PRO A 753      12.304 100.992  41.742  1.00  0.87           C  
ATOM   6041  N   LYS A 754      14.315 103.267  43.832  1.00  0.77           N  
ATOM   6042  CA  LYS A 754      15.098 103.838  44.908  1.00  0.77           C  
ATOM   6043  C   LYS A 754      16.480 104.301  44.460  1.00  0.77           C  
ATOM   6044  O   LYS A 754      17.058 105.201  45.057  1.00  0.77           O  
ATOM   6045  CB  LYS A 754      15.260 102.787  46.035  1.00  0.77           C  
ATOM   6046  CG  LYS A 754      13.937 102.211  46.580  1.00  0.77           C  
ATOM   6047  CD  LYS A 754      13.030 103.288  47.198  1.00  0.77           C  
ATOM   6048  CE  LYS A 754      11.733 102.759  47.819  1.00  0.77           C  
ATOM   6049  NZ  LYS A 754      10.876 102.135  46.784  1.00  0.77           N  
ATOM   6050  N   GLN A 755      17.008 103.715  43.370  1.00  0.79           N  
ATOM   6051  CA  GLN A 755      18.338 103.970  42.851  1.00  0.79           C  
ATOM   6052  C   GLN A 755      18.258 103.786  41.336  1.00  0.79           C  
ATOM   6053  O   GLN A 755      18.550 102.697  40.828  1.00  0.79           O  
ATOM   6054  CB  GLN A 755      19.391 102.995  43.455  1.00  0.79           C  
ATOM   6055  CG  GLN A 755      20.445 103.644  44.381  1.00  0.79           C  
ATOM   6056  CD  GLN A 755      19.849 104.072  45.717  1.00  0.79           C  
ATOM   6057  OE1 GLN A 755      19.302 103.266  46.472  1.00  0.79           O  
ATOM   6058  NE2 GLN A 755      19.975 105.381  46.027  1.00  0.79           N  
ATOM   6059  N   PRO A 756      17.823 104.766  40.553  1.00  0.83           N  
ATOM   6060  CA  PRO A 756      17.609 104.603  39.118  1.00  0.83           C  
ATOM   6061  C   PRO A 756      18.896 104.339  38.369  1.00  0.83           C  
ATOM   6062  O   PRO A 756      18.893 103.659  37.348  1.00  0.83           O  
ATOM   6063  CB  PRO A 756      16.937 105.921  38.698  1.00  0.83           C  
ATOM   6064  CG  PRO A 756      17.380 106.939  39.752  1.00  0.83           C  
ATOM   6065  CD  PRO A 756      17.445 106.100  41.024  1.00  0.83           C  
ATOM   6066  N   ASP A 757      20.010 104.837  38.904  1.00  0.84           N  
ATOM   6067  CA  ASP A 757      21.339 104.773  38.371  1.00  0.84           C  
ATOM   6068  C   ASP A 757      22.073 103.510  38.812  1.00  0.84           C  
ATOM   6069  O   ASP A 757      23.226 103.281  38.458  1.00  0.84           O  
ATOM   6070  CB  ASP A 757      22.089 106.050  38.844  1.00  0.84           C  
ATOM   6071  CG  ASP A 757      21.977 106.283  40.351  1.00  0.84           C  
ATOM   6072  OD1 ASP A 757      23.028 106.245  41.029  1.00  0.84           O  
ATOM   6073  OD2 ASP A 757      20.831 106.493  40.837  1.00  0.84           O  
ATOM   6074  N   LEU A 758      21.374 102.590  39.510  1.00  0.87           N  
ATOM   6075  CA  LEU A 758      21.897 101.296  39.925  1.00  0.87           C  
ATOM   6076  C   LEU A 758      22.414 100.480  38.760  1.00  0.87           C  
ATOM   6077  O   LEU A 758      23.482  99.879  38.799  1.00  0.87           O  
ATOM   6078  CB  LEU A 758      20.773 100.464  40.599  1.00  0.87           C  
ATOM   6079  CG  LEU A 758      21.131  99.026  41.029  1.00  0.87           C  
ATOM   6080  CD1 LEU A 758      22.353  98.983  41.954  1.00  0.87           C  
ATOM   6081  CD2 LEU A 758      19.920  98.371  41.709  1.00  0.87           C  
ATOM   6082  N   PHE A 759      21.667 100.476  37.650  1.00  0.89           N  
ATOM   6083  CA  PHE A 759      22.012  99.676  36.503  1.00  0.89           C  
ATOM   6084  C   PHE A 759      22.769 100.480  35.470  1.00  0.89           C  
ATOM   6085  O   PHE A 759      22.939 100.042  34.340  1.00  0.89           O  
ATOM   6086  CB  PHE A 759      20.744  99.068  35.868  1.00  0.89           C  
ATOM   6087  CG  PHE A 759      19.991  98.221  36.860  1.00  0.89           C  
ATOM   6088  CD1 PHE A 759      20.630  97.188  37.572  1.00  0.89           C  
ATOM   6089  CD2 PHE A 759      18.625  98.459  37.091  1.00  0.89           C  
ATOM   6090  CE1 PHE A 759      19.923  96.425  38.509  1.00  0.89           C  
ATOM   6091  CE2 PHE A 759      17.910  97.684  38.012  1.00  0.89           C  
ATOM   6092  CZ  PHE A 759      18.563  96.672  38.724  1.00  0.89           C  
ATOM   6093  N   LYS A 760      23.304 101.663  35.821  1.00  0.83           N  
ATOM   6094  CA  LYS A 760      23.995 102.536  34.881  1.00  0.83           C  
ATOM   6095  C   LYS A 760      25.187 101.860  34.219  1.00  0.83           C  
ATOM   6096  O   LYS A 760      25.389 101.927  33.006  1.00  0.83           O  
ATOM   6097  CB  LYS A 760      24.446 103.836  35.598  1.00  0.83           C  
ATOM   6098  CG  LYS A 760      24.689 105.038  34.671  1.00  0.83           C  
ATOM   6099  CD  LYS A 760      23.358 105.531  34.072  1.00  0.83           C  
ATOM   6100  CE  LYS A 760      23.463 106.660  33.044  1.00  0.83           C  
ATOM   6101  NZ  LYS A 760      22.146 106.856  32.418  1.00  0.83           N  
ATOM   6102  N   ASP A 761      25.943 101.090  35.015  1.00  0.88           N  
ATOM   6103  CA  ASP A 761      27.022 100.243  34.566  1.00  0.88           C  
ATOM   6104  C   ASP A 761      26.611  99.186  33.539  1.00  0.88           C  
ATOM   6105  O   ASP A 761      27.319  98.976  32.555  1.00  0.88           O  
ATOM   6106  CB  ASP A 761      27.656  99.543  35.788  1.00  0.88           C  
ATOM   6107  CG  ASP A 761      28.351 100.533  36.708  1.00  0.88           C  
ATOM   6108  OD1 ASP A 761      28.728 100.081  37.818  1.00  0.88           O  
ATOM   6109  OD2 ASP A 761      28.508 101.718  36.321  1.00  0.88           O  
ATOM   6110  N   ILE A 762      25.436  98.518  33.689  1.00  0.88           N  
ATOM   6111  CA  ILE A 762      24.971  97.533  32.711  1.00  0.88           C  
ATOM   6112  C   ILE A 762      24.749  98.156  31.348  1.00  0.88           C  
ATOM   6113  O   ILE A 762      25.197  97.616  30.345  1.00  0.88           O  
ATOM   6114  CB  ILE A 762      23.773  96.677  33.175  1.00  0.88           C  
ATOM   6115  CG1 ILE A 762      23.823  95.266  32.556  1.00  0.88           C  
ATOM   6116  CG2 ILE A 762      22.386  97.266  32.844  1.00  0.88           C  
ATOM   6117  CD1 ILE A 762      22.893  94.277  33.269  1.00  0.88           C  
ATOM   6118  N   ILE A 763      24.133  99.357  31.296  1.00  0.84           N  
ATOM   6119  CA  ILE A 763      23.879 100.126  30.084  1.00  0.84           C  
ATOM   6120  C   ILE A 763      25.158 100.567  29.395  1.00  0.84           C  
ATOM   6121  O   ILE A 763      25.339 100.374  28.192  1.00  0.84           O  
ATOM   6122  CB  ILE A 763      23.044 101.367  30.397  1.00  0.84           C  
ATOM   6123  CG1 ILE A 763      21.781 101.029  31.225  1.00  0.84           C  
ATOM   6124  CG2 ILE A 763      22.668 102.111  29.095  1.00  0.84           C  
ATOM   6125  CD1 ILE A 763      20.758 100.135  30.519  1.00  0.84           C  
ATOM   6126  N   ASN A 764      26.119 101.128  30.163  1.00  0.82           N  
ATOM   6127  CA  ASN A 764      27.384 101.598  29.623  1.00  0.82           C  
ATOM   6128  C   ASN A 764      28.196 100.477  28.996  1.00  0.82           C  
ATOM   6129  O   ASN A 764      28.732 100.616  27.894  1.00  0.82           O  
ATOM   6130  CB  ASN A 764      28.250 102.273  30.719  1.00  0.82           C  
ATOM   6131  CG  ASN A 764      27.572 103.532  31.248  1.00  0.82           C  
ATOM   6132  OD1 ASN A 764      26.922 104.282  30.520  1.00  0.82           O  
ATOM   6133  ND2 ASN A 764      27.767 103.810  32.558  1.00  0.82           N  
ATOM   6134  N   MET A 765      28.265  99.315  29.677  1.00  0.83           N  
ATOM   6135  CA  MET A 765      28.907  98.136  29.143  1.00  0.83           C  
ATOM   6136  C   MET A 765      28.173  97.541  27.949  1.00  0.83           C  
ATOM   6137  O   MET A 765      28.790  97.292  26.922  1.00  0.83           O  
ATOM   6138  CB  MET A 765      29.118  97.090  30.257  1.00  0.83           C  
ATOM   6139  CG  MET A 765      30.034  97.594  31.395  1.00  0.83           C  
ATOM   6140  SD  MET A 765      31.747  97.955  30.910  1.00  0.83           S  
ATOM   6141  CE  MET A 765      32.318  96.233  30.981  1.00  0.83           C  
ATOM   6142  N   LEU A 766      26.829  97.392  28.001  1.00  0.85           N  
ATOM   6143  CA  LEU A 766      26.025  96.854  26.903  1.00  0.85           C  
ATOM   6144  C   LEU A 766      26.163  97.653  25.611  1.00  0.85           C  
ATOM   6145  O   LEU A 766      26.171  97.095  24.517  1.00  0.85           O  
ATOM   6146  CB  LEU A 766      24.524  96.713  27.305  1.00  0.85           C  
ATOM   6147  CG  LEU A 766      23.873  95.326  27.100  1.00  0.85           C  
ATOM   6148  CD1 LEU A 766      24.684  94.186  27.732  1.00  0.85           C  
ATOM   6149  CD2 LEU A 766      22.465  95.323  27.723  1.00  0.85           C  
ATOM   6150  N   PHE A 767      26.299  98.994  25.697  1.00  0.78           N  
ATOM   6151  CA  PHE A 767      26.573  99.792  24.520  1.00  0.78           C  
ATOM   6152  C   PHE A 767      28.031  99.862  24.093  1.00  0.78           C  
ATOM   6153  O   PHE A 767      28.367  99.489  22.972  1.00  0.78           O  
ATOM   6154  CB  PHE A 767      26.080 101.254  24.708  1.00  0.78           C  
ATOM   6155  CG  PHE A 767      24.584 101.404  24.596  1.00  0.78           C  
ATOM   6156  CD1 PHE A 767      23.939 102.390  25.362  1.00  0.78           C  
ATOM   6157  CD2 PHE A 767      23.810 100.636  23.707  1.00  0.78           C  
ATOM   6158  CE1 PHE A 767      22.555 102.585  25.263  1.00  0.78           C  
ATOM   6159  CE2 PHE A 767      22.425 100.803  23.629  1.00  0.78           C  
ATOM   6160  CZ  PHE A 767      21.797 101.782  24.403  1.00  0.78           C  
ATOM   6161  N   TYR A 768      28.944 100.373  24.937  1.00  0.78           N  
ATOM   6162  CA  TYR A 768      30.245 100.793  24.428  1.00  0.78           C  
ATOM   6163  C   TYR A 768      31.357  99.814  24.750  1.00  0.78           C  
ATOM   6164  O   TYR A 768      32.494 100.029  24.342  1.00  0.78           O  
ATOM   6165  CB  TYR A 768      30.642 102.200  24.961  1.00  0.78           C  
ATOM   6166  CG  TYR A 768      29.783 103.290  24.365  1.00  0.78           C  
ATOM   6167  CD1 TYR A 768      28.756 103.893  25.110  1.00  0.78           C  
ATOM   6168  CD2 TYR A 768      30.047 103.769  23.069  1.00  0.78           C  
ATOM   6169  CE1 TYR A 768      28.023 104.968  24.581  1.00  0.78           C  
ATOM   6170  CE2 TYR A 768      29.325 104.852  22.542  1.00  0.78           C  
ATOM   6171  CZ  TYR A 768      28.319 105.456  23.303  1.00  0.78           C  
ATOM   6172  OH  TYR A 768      27.631 106.580  22.796  1.00  0.78           O  
ATOM   6173  N   HIS A 769      31.058  98.706  25.454  1.00  0.77           N  
ATOM   6174  CA  HIS A 769      32.091  97.790  25.925  1.00  0.77           C  
ATOM   6175  C   HIS A 769      31.608  96.345  25.992  1.00  0.77           C  
ATOM   6176  O   HIS A 769      32.133  95.535  26.752  1.00  0.77           O  
ATOM   6177  CB  HIS A 769      32.636  98.223  27.312  1.00  0.77           C  
ATOM   6178  CG  HIS A 769      33.527  99.431  27.255  1.00  0.77           C  
ATOM   6179  ND1 HIS A 769      34.825  99.281  26.806  1.00  0.77           N  
ATOM   6180  CD2 HIS A 769      33.283 100.737  27.549  1.00  0.77           C  
ATOM   6181  CE1 HIS A 769      35.342 100.491  26.826  1.00  0.77           C  
ATOM   6182  NE2 HIS A 769      34.453 101.412  27.270  1.00  0.77           N  
ATOM   6183  N   ASP A 770      30.601  95.973  25.170  1.00  0.84           N  
ATOM   6184  CA  ASP A 770      30.110  94.611  25.037  1.00  0.84           C  
ATOM   6185  C   ASP A 770      31.173  93.765  24.318  1.00  0.84           C  
ATOM   6186  O   ASP A 770      32.139  94.246  23.727  1.00  0.84           O  
ATOM   6187  CB  ASP A 770      28.722  94.613  24.300  1.00  0.84           C  
ATOM   6188  CG  ASP A 770      27.909  93.310  24.199  1.00  0.84           C  
ATOM   6189  OD1 ASP A 770      26.787  93.333  23.616  1.00  0.84           O  
ATOM   6190  OD2 ASP A 770      28.394  92.233  24.629  1.00  0.84           O  
ATOM   6191  N   ARG A 771      31.003  92.449  24.368  1.00  0.75           N  
ATOM   6192  CA  ARG A 771      31.927  91.482  23.845  1.00  0.75           C  
ATOM   6193  C   ARG A 771      31.191  90.228  23.422  1.00  0.75           C  
ATOM   6194  O   ARG A 771      31.732  89.372  22.725  1.00  0.75           O  
ATOM   6195  CB  ARG A 771      32.923  91.118  24.974  1.00  0.75           C  
ATOM   6196  CG  ARG A 771      34.381  91.265  24.528  1.00  0.75           C  
ATOM   6197  CD  ARG A 771      35.369  90.747  25.573  1.00  0.75           C  
ATOM   6198  NE  ARG A 771      36.757  91.027  25.075  1.00  0.75           N  
ATOM   6199  CZ  ARG A 771      37.388  90.325  24.122  1.00  0.75           C  
ATOM   6200  NH1 ARG A 771      36.799  89.331  23.466  1.00  0.75           N  
ATOM   6201  NH2 ARG A 771      38.650  90.627  23.828  1.00  0.75           N  
ATOM   6202  N   PHE A 772      29.917  90.094  23.833  1.00  0.84           N  
ATOM   6203  CA  PHE A 772      29.169  88.864  23.713  1.00  0.84           C  
ATOM   6204  C   PHE A 772      27.863  89.092  22.979  1.00  0.84           C  
ATOM   6205  O   PHE A 772      27.096  88.158  22.738  1.00  0.84           O  
ATOM   6206  CB  PHE A 772      28.945  88.284  25.130  1.00  0.84           C  
ATOM   6207  CG  PHE A 772      30.284  87.902  25.716  1.00  0.84           C  
ATOM   6208  CD1 PHE A 772      31.078  86.906  25.116  1.00  0.84           C  
ATOM   6209  CD2 PHE A 772      30.782  88.570  26.845  1.00  0.84           C  
ATOM   6210  CE1 PHE A 772      32.346  86.596  25.629  1.00  0.84           C  
ATOM   6211  CE2 PHE A 772      32.035  88.243  27.380  1.00  0.84           C  
ATOM   6212  CZ  PHE A 772      32.818  87.256  26.771  1.00  0.84           C  
ATOM   6213  N   LYS A 773      27.639  90.337  22.525  1.00  0.86           N  
ATOM   6214  CA  LYS A 773      26.703  90.737  21.490  1.00  0.86           C  
ATOM   6215  C   LYS A 773      25.247  90.578  21.866  1.00  0.86           C  
ATOM   6216  O   LYS A 773      24.465  89.958  21.145  1.00  0.86           O  
ATOM   6217  CB  LYS A 773      26.948  90.052  20.115  1.00  0.86           C  
ATOM   6218  CG  LYS A 773      28.404  89.876  19.662  1.00  0.86           C  
ATOM   6219  CD  LYS A 773      29.157  91.195  19.474  1.00  0.86           C  
ATOM   6220  CE  LYS A 773      30.645  90.998  19.169  1.00  0.86           C  
ATOM   6221  NZ  LYS A 773      30.831  90.242  17.919  1.00  0.86           N  
ATOM   6222  N   VAL A 774      24.848  91.118  23.030  1.00  0.92           N  
ATOM   6223  CA  VAL A 774      23.530  90.877  23.611  1.00  0.92           C  
ATOM   6224  C   VAL A 774      22.385  91.371  22.733  1.00  0.92           C  
ATOM   6225  O   VAL A 774      21.391  90.679  22.518  1.00  0.92           O  
ATOM   6226  CB  VAL A 774      23.416  91.457  25.023  1.00  0.92           C  
ATOM   6227  CG1 VAL A 774      22.078  91.057  25.678  1.00  0.92           C  
ATOM   6228  CG2 VAL A 774      24.581  90.924  25.882  1.00  0.92           C  
ATOM   6229  N   PHE A 775      22.507  92.578  22.154  1.00  0.89           N  
ATOM   6230  CA  PHE A 775      21.489  93.143  21.290  1.00  0.89           C  
ATOM   6231  C   PHE A 775      21.394  92.501  19.924  1.00  0.89           C  
ATOM   6232  O   PHE A 775      20.309  92.400  19.356  1.00  0.89           O  
ATOM   6233  CB  PHE A 775      21.720  94.652  21.087  1.00  0.89           C  
ATOM   6234  CG  PHE A 775      21.728  95.391  22.392  1.00  0.89           C  
ATOM   6235  CD1 PHE A 775      22.714  96.351  22.638  1.00  0.89           C  
ATOM   6236  CD2 PHE A 775      20.743  95.176  23.364  1.00  0.89           C  
ATOM   6237  CE1 PHE A 775      22.696  97.126  23.806  1.00  0.89           C  
ATOM   6238  CE2 PHE A 775      20.723  95.938  24.534  1.00  0.89           C  
ATOM   6239  CZ  PHE A 775      21.683  96.931  24.748  1.00  0.89           C  
ATOM   6240  N   ALA A 776      22.524  92.032  19.364  1.00  0.91           N  
ATOM   6241  CA  ALA A 776      22.572  91.423  18.050  1.00  0.91           C  
ATOM   6242  C   ALA A 776      21.719  90.167  17.942  1.00  0.91           C  
ATOM   6243  O   ALA A 776      21.007  89.962  16.961  1.00  0.91           O  
ATOM   6244  CB  ALA A 776      24.033  91.131  17.679  1.00  0.91           C  
ATOM   6245  N   ASP A 777      21.713  89.339  19.002  1.00  0.92           N  
ATOM   6246  CA  ASP A 777      20.877  88.156  19.030  1.00  0.92           C  
ATOM   6247  C   ASP A 777      19.507  88.421  19.642  1.00  0.92           C  
ATOM   6248  O   ASP A 777      18.675  87.519  19.676  1.00  0.92           O  
ATOM   6249  CB  ASP A 777      21.533  87.026  19.866  1.00  0.92           C  
ATOM   6250  CG  ASP A 777      22.662  86.349  19.123  1.00  0.92           C  
ATOM   6251  OD1 ASP A 777      22.635  86.273  17.874  1.00  0.92           O  
ATOM   6252  OD2 ASP A 777      23.567  85.845  19.843  1.00  0.92           O  
ATOM   6253  N   TYR A 778      19.193  89.646  20.126  1.00  0.91           N  
ATOM   6254  CA  TYR A 778      17.946  89.900  20.841  1.00  0.91           C  
ATOM   6255  C   TYR A 778      16.685  89.646  20.017  1.00  0.91           C  
ATOM   6256  O   TYR A 778      15.797  88.920  20.458  1.00  0.91           O  
ATOM   6257  CB  TYR A 778      17.947  91.334  21.472  1.00  0.91           C  
ATOM   6258  CG  TYR A 778      16.597  91.782  21.993  1.00  0.91           C  
ATOM   6259  CD1 TYR A 778      16.145  91.511  23.295  1.00  0.91           C  
ATOM   6260  CD2 TYR A 778      15.733  92.435  21.102  1.00  0.91           C  
ATOM   6261  CE1 TYR A 778      14.838  91.869  23.677  1.00  0.91           C  
ATOM   6262  CE2 TYR A 778      14.424  92.756  21.459  1.00  0.91           C  
ATOM   6263  CZ  TYR A 778      13.978  92.466  22.742  1.00  0.91           C  
ATOM   6264  OH  TYR A 778      12.639  92.746  23.040  1.00  0.91           O  
ATOM   6265  N   GLU A 779      16.578  90.196  18.792  1.00  0.84           N  
ATOM   6266  CA  GLU A 779      15.388  90.025  17.967  1.00  0.84           C  
ATOM   6267  C   GLU A 779      15.179  88.571  17.575  1.00  0.84           C  
ATOM   6268  O   GLU A 779      14.095  87.995  17.693  1.00  0.84           O  
ATOM   6269  CB  GLU A 779      15.497  90.882  16.692  1.00  0.84           C  
ATOM   6270  CG  GLU A 779      14.191  90.935  15.862  1.00  0.84           C  
ATOM   6271  CD  GLU A 779      14.444  91.383  14.425  1.00  0.84           C  
ATOM   6272  OE1 GLU A 779      13.629  90.987  13.555  1.00  0.84           O  
ATOM   6273  OE2 GLU A 779      15.446  92.105  14.193  1.00  0.84           O  
ATOM   6274  N   ALA A 780      16.290  87.918  17.189  1.00  0.90           N  
ATOM   6275  CA  ALA A 780      16.359  86.521  16.852  1.00  0.90           C  
ATOM   6276  C   ALA A 780      15.940  85.616  18.001  1.00  0.90           C  
ATOM   6277  O   ALA A 780      15.195  84.652  17.825  1.00  0.90           O  
ATOM   6278  CB  ALA A 780      17.815  86.226  16.451  1.00  0.90           C  
ATOM   6279  N   TYR A 781      16.389  85.940  19.224  1.00  0.91           N  
ATOM   6280  CA  TYR A 781      15.981  85.284  20.442  1.00  0.91           C  
ATOM   6281  C   TYR A 781      14.506  85.434  20.783  1.00  0.91           C  
ATOM   6282  O   TYR A 781      13.829  84.438  21.025  1.00  0.91           O  
ATOM   6283  CB  TYR A 781      16.846  85.857  21.585  1.00  0.91           C  
ATOM   6284  CG  TYR A 781      16.561  85.249  22.932  1.00  0.91           C  
ATOM   6285  CD1 TYR A 781      16.556  83.859  23.152  1.00  0.91           C  
ATOM   6286  CD2 TYR A 781      16.326  86.102  24.011  1.00  0.91           C  
ATOM   6287  CE1 TYR A 781      16.383  83.337  24.449  1.00  0.91           C  
ATOM   6288  CE2 TYR A 781      16.187  85.580  25.299  1.00  0.91           C  
ATOM   6289  CZ  TYR A 781      16.205  84.210  25.526  1.00  0.91           C  
ATOM   6290  OH  TYR A 781      16.115  83.831  26.882  1.00  0.91           O  
ATOM   6291  N   VAL A 782      13.939  86.660  20.762  1.00  0.90           N  
ATOM   6292  CA  VAL A 782      12.521  86.858  21.051  1.00  0.90           C  
ATOM   6293  C   VAL A 782      11.631  86.159  20.030  1.00  0.90           C  
ATOM   6294  O   VAL A 782      10.668  85.471  20.370  1.00  0.90           O  
ATOM   6295  CB  VAL A 782      12.133  88.328  21.162  1.00  0.90           C  
ATOM   6296  CG1 VAL A 782      10.650  88.446  21.559  1.00  0.90           C  
ATOM   6297  CG2 VAL A 782      12.982  89.028  22.239  1.00  0.90           C  
ATOM   6298  N   LYS A 783      11.984  86.240  18.731  1.00  0.85           N  
ATOM   6299  CA  LYS A 783      11.269  85.524  17.693  1.00  0.85           C  
ATOM   6300  C   LYS A 783      11.446  84.006  17.758  1.00  0.85           C  
ATOM   6301  O   LYS A 783      10.600  83.227  17.309  1.00  0.85           O  
ATOM   6302  CB  LYS A 783      11.644  86.050  16.285  1.00  0.85           C  
ATOM   6303  CG  LYS A 783      10.817  85.500  15.096  1.00  0.85           C  
ATOM   6304  CD  LYS A 783       9.347  85.981  15.034  1.00  0.85           C  
ATOM   6305  CE  LYS A 783       8.346  85.167  15.869  1.00  0.85           C  
ATOM   6306  NZ  LYS A 783       7.062  85.885  16.029  1.00  0.85           N  
ATOM   6307  N   CYS A 784      12.561  83.499  18.312  1.00  0.90           N  
ATOM   6308  CA  CYS A 784      12.667  82.095  18.662  1.00  0.90           C  
ATOM   6309  C   CYS A 784      11.755  81.700  19.811  1.00  0.90           C  
ATOM   6310  O   CYS A 784      11.022  80.720  19.722  1.00  0.90           O  
ATOM   6311  CB  CYS A 784      14.123  81.691  18.951  1.00  0.90           C  
ATOM   6312  SG  CYS A 784      14.332  79.886  18.807  1.00  0.90           S  
ATOM   6313  N   GLN A 785      11.720  82.514  20.877  1.00  0.90           N  
ATOM   6314  CA  GLN A 785      10.877  82.314  22.038  1.00  0.90           C  
ATOM   6315  C   GLN A 785       9.385  82.307  21.741  1.00  0.90           C  
ATOM   6316  O   GLN A 785       8.649  81.475  22.265  1.00  0.90           O  
ATOM   6317  CB  GLN A 785      11.183  83.381  23.109  1.00  0.90           C  
ATOM   6318  CG  GLN A 785      12.559  83.207  23.789  1.00  0.90           C  
ATOM   6319  CD  GLN A 785      12.522  82.104  24.844  1.00  0.90           C  
ATOM   6320  OE1 GLN A 785      11.787  81.117  24.741  1.00  0.90           O  
ATOM   6321  NE2 GLN A 785      13.299  82.318  25.920  1.00  0.90           N  
ATOM   6322  N   ASP A 786       8.893  83.189  20.849  1.00  0.89           N  
ATOM   6323  CA  ASP A 786       7.525  83.136  20.351  1.00  0.89           C  
ATOM   6324  C   ASP A 786       7.193  81.815  19.652  1.00  0.89           C  
ATOM   6325  O   ASP A 786       6.099  81.274  19.807  1.00  0.89           O  
ATOM   6326  CB  ASP A 786       7.257  84.273  19.342  1.00  0.89           C  
ATOM   6327  CG  ASP A 786       7.252  85.642  19.987  1.00  0.89           C  
ATOM   6328  OD1 ASP A 786       7.392  86.628  19.213  1.00  0.89           O  
ATOM   6329  OD2 ASP A 786       7.055  85.756  21.219  1.00  0.89           O  
ATOM   6330  N   LYS A 787       8.146  81.243  18.881  1.00  0.86           N  
ATOM   6331  CA  LYS A 787       7.995  79.920  18.295  1.00  0.86           C  
ATOM   6332  C   LYS A 787       7.899  78.801  19.332  1.00  0.86           C  
ATOM   6333  O   LYS A 787       7.091  77.883  19.202  1.00  0.86           O  
ATOM   6334  CB  LYS A 787       9.104  79.576  17.277  1.00  0.86           C  
ATOM   6335  CG  LYS A 787       9.072  80.432  16.001  1.00  0.86           C  
ATOM   6336  CD  LYS A 787      10.024  79.909  14.908  1.00  0.86           C  
ATOM   6337  CE  LYS A 787      11.518  80.012  15.237  1.00  0.86           C  
ATOM   6338  NZ  LYS A 787      11.934  81.431  15.290  1.00  0.86           N  
ATOM   6339  N   VAL A 788       8.693  78.868  20.422  1.00  0.91           N  
ATOM   6340  CA  VAL A 788       8.561  77.963  21.562  1.00  0.91           C  
ATOM   6341  C   VAL A 788       7.185  78.077  22.203  1.00  0.91           C  
ATOM   6342  O   VAL A 788       6.507  77.091  22.486  1.00  0.91           O  
ATOM   6343  CB  VAL A 788       9.587  78.270  22.651  1.00  0.91           C  
ATOM   6344  CG1 VAL A 788       9.477  77.258  23.799  1.00  0.91           C  
ATOM   6345  CG2 VAL A 788      11.022  78.209  22.108  1.00  0.91           C  
ATOM   6346  N   SER A 789       6.720  79.323  22.408  1.00  0.90           N  
ATOM   6347  CA  SER A 789       5.438  79.633  23.010  1.00  0.90           C  
ATOM   6348  C   SER A 789       4.253  79.097  22.232  1.00  0.90           C  
ATOM   6349  O   SER A 789       3.376  78.464  22.808  1.00  0.90           O  
ATOM   6350  CB  SER A 789       5.275  81.165  23.182  1.00  0.90           C  
ATOM   6351  OG  SER A 789       6.206  81.669  24.147  1.00  0.90           O  
ATOM   6352  N   GLN A 790       4.214  79.276  20.896  1.00  0.81           N  
ATOM   6353  CA  GLN A 790       3.181  78.694  20.050  1.00  0.81           C  
ATOM   6354  C   GLN A 790       3.245  77.172  19.947  1.00  0.81           C  
ATOM   6355  O   GLN A 790       2.211  76.511  19.920  1.00  0.81           O  
ATOM   6356  CB  GLN A 790       3.113  79.394  18.669  1.00  0.81           C  
ATOM   6357  CG  GLN A 790       4.370  79.199  17.796  1.00  0.81           C  
ATOM   6358  CD  GLN A 790       4.531  80.169  16.619  1.00  0.81           C  
ATOM   6359  OE1 GLN A 790       5.383  79.970  15.752  1.00  0.81           O  
ATOM   6360  NE2 GLN A 790       3.751  81.271  16.578  1.00  0.81           N  
ATOM   6361  N   LEU A 791       4.450  76.552  19.947  1.00  0.86           N  
ATOM   6362  CA  LEU A 791       4.582  75.101  20.025  1.00  0.86           C  
ATOM   6363  C   LEU A 791       4.007  74.529  21.317  1.00  0.86           C  
ATOM   6364  O   LEU A 791       3.311  73.516  21.311  1.00  0.86           O  
ATOM   6365  CB  LEU A 791       6.055  74.643  19.857  1.00  0.86           C  
ATOM   6366  CG  LEU A 791       6.256  73.108  19.825  1.00  0.86           C  
ATOM   6367  CD1 LEU A 791       5.560  72.464  18.628  1.00  0.86           C  
ATOM   6368  CD2 LEU A 791       7.737  72.725  19.807  1.00  0.86           C  
ATOM   6369  N   TYR A 792       4.227  75.212  22.461  1.00  0.87           N  
ATOM   6370  CA  TYR A 792       3.703  74.819  23.765  1.00  0.87           C  
ATOM   6371  C   TYR A 792       2.172  74.877  23.826  1.00  0.87           C  
ATOM   6372  O   TYR A 792       1.533  74.195  24.623  1.00  0.87           O  
ATOM   6373  CB  TYR A 792       4.359  75.702  24.868  1.00  0.87           C  
ATOM   6374  CG  TYR A 792       4.142  75.181  26.275  1.00  0.87           C  
ATOM   6375  CD1 TYR A 792       5.072  74.333  26.904  1.00  0.87           C  
ATOM   6376  CD2 TYR A 792       2.998  75.559  26.994  1.00  0.87           C  
ATOM   6377  CE1 TYR A 792       4.856  73.877  28.217  1.00  0.87           C  
ATOM   6378  CE2 TYR A 792       2.782  75.121  28.306  1.00  0.87           C  
ATOM   6379  CZ  TYR A 792       3.710  74.279  28.920  1.00  0.87           C  
ATOM   6380  OH  TYR A 792       3.483  73.873  30.254  1.00  0.87           O  
ATOM   6381  N   MET A 793       1.520  75.651  22.932  1.00  0.85           N  
ATOM   6382  CA  MET A 793       0.072  75.664  22.826  1.00  0.85           C  
ATOM   6383  C   MET A 793      -0.512  74.386  22.223  1.00  0.85           C  
ATOM   6384  O   MET A 793      -1.702  74.113  22.369  1.00  0.85           O  
ATOM   6385  CB  MET A 793      -0.424  76.868  21.990  1.00  0.85           C  
ATOM   6386  CG  MET A 793      -0.042  78.236  22.584  1.00  0.85           C  
ATOM   6387  SD  MET A 793      -0.637  79.639  21.597  1.00  0.85           S  
ATOM   6388  CE  MET A 793      -2.307  79.649  22.306  1.00  0.85           C  
ATOM   6389  N   ASN A 794       0.304  73.538  21.559  1.00  0.81           N  
ATOM   6390  CA  ASN A 794      -0.134  72.230  21.122  1.00  0.81           C  
ATOM   6391  C   ASN A 794       0.646  71.153  21.877  1.00  0.81           C  
ATOM   6392  O   ASN A 794       1.777  70.845  21.495  1.00  0.81           O  
ATOM   6393  CB  ASN A 794       0.085  72.083  19.588  1.00  0.81           C  
ATOM   6394  CG  ASN A 794      -0.438  70.777  18.985  1.00  0.81           C  
ATOM   6395  OD1 ASN A 794       0.017  70.309  17.944  1.00  0.81           O  
ATOM   6396  ND2 ASN A 794      -1.425  70.128  19.642  1.00  0.81           N  
ATOM   6397  N   PRO A 795       0.058  70.491  22.886  1.00  0.82           N  
ATOM   6398  CA  PRO A 795       0.708  69.417  23.631  1.00  0.82           C  
ATOM   6399  C   PRO A 795       1.300  68.322  22.778  1.00  0.82           C  
ATOM   6400  O   PRO A 795       2.460  67.975  22.958  1.00  0.82           O  
ATOM   6401  CB  PRO A 795      -0.387  68.912  24.580  1.00  0.82           C  
ATOM   6402  CG  PRO A 795      -1.194  70.174  24.889  1.00  0.82           C  
ATOM   6403  CD  PRO A 795      -1.162  70.944  23.567  1.00  0.82           C  
ATOM   6404  N   LYS A 796       0.549  67.796  21.794  1.00  0.77           N  
ATOM   6405  CA  LYS A 796       1.019  66.717  20.953  1.00  0.77           C  
ATOM   6406  C   LYS A 796       2.260  67.051  20.139  1.00  0.77           C  
ATOM   6407  O   LYS A 796       3.167  66.235  20.013  1.00  0.77           O  
ATOM   6408  CB  LYS A 796      -0.089  66.272  19.976  1.00  0.77           C  
ATOM   6409  CG  LYS A 796       0.172  64.864  19.421  1.00  0.77           C  
ATOM   6410  CD  LYS A 796      -0.558  64.561  18.105  1.00  0.77           C  
ATOM   6411  CE  LYS A 796       0.172  65.101  16.875  1.00  0.77           C  
ATOM   6412  NZ  LYS A 796       1.493  64.441  16.766  1.00  0.77           N  
ATOM   6413  N   ALA A 797       2.331  68.264  19.559  1.00  0.86           N  
ATOM   6414  CA  ALA A 797       3.507  68.741  18.860  1.00  0.86           C  
ATOM   6415  C   ALA A 797       4.712  68.975  19.769  1.00  0.86           C  
ATOM   6416  O   ALA A 797       5.839  68.608  19.436  1.00  0.86           O  
ATOM   6417  CB  ALA A 797       3.160  70.011  18.071  1.00  0.86           C  
ATOM   6418  N   TRP A 798       4.498  69.560  20.970  1.00  0.84           N  
ATOM   6419  CA  TRP A 798       5.532  69.686  21.986  1.00  0.84           C  
ATOM   6420  C   TRP A 798       6.047  68.324  22.442  1.00  0.84           C  
ATOM   6421  O   TRP A 798       7.244  68.050  22.439  1.00  0.84           O  
ATOM   6422  CB  TRP A 798       4.965  70.485  23.200  1.00  0.84           C  
ATOM   6423  CG  TRP A 798       5.949  70.810  24.316  1.00  0.84           C  
ATOM   6424  CD1 TRP A 798       6.271  70.087  25.436  1.00  0.84           C  
ATOM   6425  CD2 TRP A 798       6.757  72.002  24.372  1.00  0.84           C  
ATOM   6426  NE1 TRP A 798       7.247  70.733  26.175  1.00  0.84           N  
ATOM   6427  CE2 TRP A 798       7.565  71.900  25.507  1.00  0.84           C  
ATOM   6428  CE3 TRP A 798       6.832  73.109  23.527  1.00  0.84           C  
ATOM   6429  CZ2 TRP A 798       8.497  72.886  25.804  1.00  0.84           C  
ATOM   6430  CZ3 TRP A 798       7.723  74.139  23.868  1.00  0.84           C  
ATOM   6431  CH2 TRP A 798       8.560  74.021  24.983  1.00  0.84           C  
ATOM   6432  N   ASN A 799       5.141  67.390  22.783  1.00  0.86           N  
ATOM   6433  CA  ASN A 799       5.499  66.066  23.242  1.00  0.86           C  
ATOM   6434  C   ASN A 799       6.108  65.141  22.186  1.00  0.86           C  
ATOM   6435  O   ASN A 799       6.994  64.358  22.524  1.00  0.86           O  
ATOM   6436  CB  ASN A 799       4.350  65.385  24.026  1.00  0.86           C  
ATOM   6437  CG  ASN A 799       3.971  66.188  25.271  1.00  0.86           C  
ATOM   6438  OD1 ASN A 799       2.811  66.528  25.494  1.00  0.86           O  
ATOM   6439  ND2 ASN A 799       4.967  66.475  26.144  1.00  0.86           N  
ATOM   6440  N   THR A 800       5.724  65.208  20.885  1.00  0.85           N  
ATOM   6441  CA  THR A 800       6.453  64.489  19.826  1.00  0.85           C  
ATOM   6442  C   THR A 800       7.888  64.968  19.711  1.00  0.85           C  
ATOM   6443  O   THR A 800       8.815  64.165  19.612  1.00  0.85           O  
ATOM   6444  CB  THR A 800       5.850  64.524  18.410  1.00  0.85           C  
ATOM   6445  OG1 THR A 800       5.468  65.830  18.002  1.00  0.85           O  
ATOM   6446  CG2 THR A 800       4.582  63.663  18.347  1.00  0.85           C  
ATOM   6447  N   MET A 801       8.120  66.295  19.770  1.00  0.87           N  
ATOM   6448  CA  MET A 801       9.453  66.871  19.798  1.00  0.87           C  
ATOM   6449  C   MET A 801      10.251  66.492  21.048  1.00  0.87           C  
ATOM   6450  O   MET A 801      11.433  66.150  20.971  1.00  0.87           O  
ATOM   6451  CB  MET A 801       9.396  68.404  19.602  1.00  0.87           C  
ATOM   6452  CG  MET A 801      10.760  69.008  19.217  1.00  0.87           C  
ATOM   6453  SD  MET A 801      10.759  70.811  18.992  1.00  0.87           S  
ATOM   6454  CE  MET A 801      10.013  70.824  17.337  1.00  0.87           C  
ATOM   6455  N   VAL A 802       9.608  66.480  22.239  1.00  0.92           N  
ATOM   6456  CA  VAL A 802      10.197  66.006  23.491  1.00  0.92           C  
ATOM   6457  C   VAL A 802      10.622  64.556  23.384  1.00  0.92           C  
ATOM   6458  O   VAL A 802      11.745  64.200  23.733  1.00  0.92           O  
ATOM   6459  CB  VAL A 802       9.247  66.175  24.682  1.00  0.92           C  
ATOM   6460  CG1 VAL A 802       9.743  65.421  25.931  1.00  0.92           C  
ATOM   6461  CG2 VAL A 802       9.133  67.669  25.032  1.00  0.92           C  
ATOM   6462  N   LEU A 803       9.769  63.678  22.823  1.00  0.89           N  
ATOM   6463  CA  LEU A 803      10.129  62.293  22.602  1.00  0.89           C  
ATOM   6464  C   LEU A 803      11.292  62.109  21.641  1.00  0.89           C  
ATOM   6465  O   LEU A 803      12.205  61.330  21.904  1.00  0.89           O  
ATOM   6466  CB  LEU A 803       8.916  61.473  22.120  1.00  0.89           C  
ATOM   6467  CG  LEU A 803       9.182  59.956  22.068  1.00  0.89           C  
ATOM   6468  CD1 LEU A 803       9.687  59.431  23.420  1.00  0.89           C  
ATOM   6469  CD2 LEU A 803       7.926  59.206  21.616  1.00  0.89           C  
ATOM   6470  N   LYS A 804      11.335  62.882  20.533  1.00  0.86           N  
ATOM   6471  CA  LYS A 804      12.477  62.910  19.632  1.00  0.86           C  
ATOM   6472  C   LYS A 804      13.776  63.323  20.336  1.00  0.86           C  
ATOM   6473  O   LYS A 804      14.827  62.737  20.091  1.00  0.86           O  
ATOM   6474  CB  LYS A 804      12.231  63.864  18.433  1.00  0.86           C  
ATOM   6475  CG  LYS A 804      11.245  63.379  17.347  1.00  0.86           C  
ATOM   6476  CD  LYS A 804      11.115  64.478  16.278  1.00  0.86           C  
ATOM   6477  CE  LYS A 804      10.529  64.122  14.910  1.00  0.86           C  
ATOM   6478  NZ  LYS A 804      10.744  65.229  13.969  1.00  0.86           N  
ATOM   6479  N   ASN A 805      13.733  64.314  21.256  1.00  0.91           N  
ATOM   6480  CA  ASN A 805      14.867  64.658  22.106  1.00  0.91           C  
ATOM   6481  C   ASN A 805      15.281  63.554  23.084  1.00  0.91           C  
ATOM   6482  O   ASN A 805      16.455  63.200  23.153  1.00  0.91           O  
ATOM   6483  CB  ASN A 805      14.579  65.951  22.920  1.00  0.91           C  
ATOM   6484  CG  ASN A 805      14.875  67.193  22.089  1.00  0.91           C  
ATOM   6485  OD1 ASN A 805      15.967  67.752  22.182  1.00  0.91           O  
ATOM   6486  ND2 ASN A 805      13.901  67.645  21.272  1.00  0.91           N  
ATOM   6487  N   ILE A 806      14.344  62.937  23.839  1.00  0.93           N  
ATOM   6488  CA  ILE A 806      14.673  61.870  24.788  1.00  0.93           C  
ATOM   6489  C   ILE A 806      15.231  60.638  24.088  1.00  0.93           C  
ATOM   6490  O   ILE A 806      16.239  60.069  24.501  1.00  0.93           O  
ATOM   6491  CB  ILE A 806      13.487  61.462  25.665  1.00  0.93           C  
ATOM   6492  CG1 ILE A 806      12.977  62.669  26.484  1.00  0.93           C  
ATOM   6493  CG2 ILE A 806      13.890  60.320  26.633  1.00  0.93           C  
ATOM   6494  CD1 ILE A 806      11.649  62.380  27.192  1.00  0.93           C  
ATOM   6495  N   ALA A 807      14.622  60.236  22.956  1.00  0.92           N  
ATOM   6496  CA  ALA A 807      14.998  59.060  22.197  1.00  0.92           C  
ATOM   6497  C   ALA A 807      16.344  59.198  21.494  1.00  0.92           C  
ATOM   6498  O   ALA A 807      16.986  58.218  21.124  1.00  0.92           O  
ATOM   6499  CB  ALA A 807      13.887  58.759  21.174  1.00  0.92           C  
ATOM   6500  N   ALA A 808      16.829  60.440  21.334  1.00  0.91           N  
ATOM   6501  CA  ALA A 808      18.120  60.724  20.754  1.00  0.91           C  
ATOM   6502  C   ALA A 808      19.162  61.157  21.777  1.00  0.91           C  
ATOM   6503  O   ALA A 808      20.292  61.497  21.436  1.00  0.91           O  
ATOM   6504  CB  ALA A 808      17.937  61.847  19.734  1.00  0.91           C  
ATOM   6505  N   SER A 809      18.846  61.124  23.087  1.00  0.91           N  
ATOM   6506  CA  SER A 809      19.785  61.573  24.114  1.00  0.91           C  
ATOM   6507  C   SER A 809      20.812  60.510  24.457  1.00  0.91           C  
ATOM   6508  O   SER A 809      21.812  60.760  25.129  1.00  0.91           O  
ATOM   6509  CB  SER A 809      19.087  62.065  25.417  1.00  0.91           C  
ATOM   6510  OG  SER A 809      18.499  61.010  26.182  1.00  0.91           O  
ATOM   6511  N   GLY A 810      20.594  59.279  23.958  1.00  0.89           N  
ATOM   6512  CA  GLY A 810      21.311  58.077  24.343  1.00  0.89           C  
ATOM   6513  C   GLY A 810      22.807  58.042  24.164  1.00  0.89           C  
ATOM   6514  O   GLY A 810      23.516  57.373  24.912  1.00  0.89           O  
ATOM   6515  N   LYS A 811      23.372  58.785  23.195  1.00  0.83           N  
ATOM   6516  CA  LYS A 811      24.817  58.844  23.055  1.00  0.83           C  
ATOM   6517  C   LYS A 811      25.475  59.710  24.116  1.00  0.83           C  
ATOM   6518  O   LYS A 811      26.682  59.657  24.322  1.00  0.83           O  
ATOM   6519  CB  LYS A 811      25.285  59.355  21.673  1.00  0.83           C  
ATOM   6520  CG  LYS A 811      25.110  60.864  21.431  1.00  0.83           C  
ATOM   6521  CD  LYS A 811      26.115  61.428  20.411  1.00  0.83           C  
ATOM   6522  CE  LYS A 811      27.554  61.573  20.892  1.00  0.83           C  
ATOM   6523  NZ  LYS A 811      28.341  62.193  19.812  1.00  0.83           N  
ATOM   6524  N   PHE A 812      24.706  60.529  24.850  1.00  0.92           N  
ATOM   6525  CA  PHE A 812      25.256  61.474  25.803  1.00  0.92           C  
ATOM   6526  C   PHE A 812      25.381  60.861  27.180  1.00  0.92           C  
ATOM   6527  O   PHE A 812      25.614  61.550  28.165  1.00  0.92           O  
ATOM   6528  CB  PHE A 812      24.399  62.759  25.888  1.00  0.92           C  
ATOM   6529  CG  PHE A 812      24.459  63.487  24.576  1.00  0.92           C  
ATOM   6530  CD1 PHE A 812      25.649  64.114  24.165  1.00  0.92           C  
ATOM   6531  CD2 PHE A 812      23.347  63.513  23.721  1.00  0.92           C  
ATOM   6532  CE1 PHE A 812      25.737  64.720  22.906  1.00  0.92           C  
ATOM   6533  CE2 PHE A 812      23.430  64.108  22.458  1.00  0.92           C  
ATOM   6534  CZ  PHE A 812      24.629  64.702  22.051  1.00  0.92           C  
ATOM   6535  N   SER A 813      25.279  59.527  27.289  1.00  0.95           N  
ATOM   6536  CA  SER A 813      25.736  58.791  28.457  1.00  0.95           C  
ATOM   6537  C   SER A 813      27.238  58.874  28.686  1.00  0.95           C  
ATOM   6538  O   SER A 813      28.034  58.740  27.758  1.00  0.95           O  
ATOM   6539  CB  SER A 813      25.359  57.296  28.362  1.00  0.95           C  
ATOM   6540  OG  SER A 813      25.675  56.584  29.562  1.00  0.95           O  
ATOM   6541  N   SER A 814      27.680  59.024  29.951  1.00  0.96           N  
ATOM   6542  CA  SER A 814      29.094  58.968  30.308  1.00  0.96           C  
ATOM   6543  C   SER A 814      29.631  57.567  30.266  1.00  0.96           C  
ATOM   6544  O   SER A 814      30.837  57.367  30.162  1.00  0.96           O  
ATOM   6545  CB  SER A 814      29.470  59.590  31.680  1.00  0.96           C  
ATOM   6546  OG  SER A 814      28.609  59.182  32.738  1.00  0.96           O  
ATOM   6547  N   ASP A 815      28.754  56.548  30.261  1.00  0.93           N  
ATOM   6548  CA  ASP A 815      29.145  55.181  29.994  1.00  0.93           C  
ATOM   6549  C   ASP A 815      29.700  55.026  28.583  1.00  0.93           C  
ATOM   6550  O   ASP A 815      30.660  54.297  28.364  1.00  0.93           O  
ATOM   6551  CB  ASP A 815      27.968  54.194  30.135  1.00  0.93           C  
ATOM   6552  CG  ASP A 815      27.399  54.141  31.534  1.00  0.93           C  
ATOM   6553  OD1 ASP A 815      26.373  53.439  31.703  1.00  0.93           O  
ATOM   6554  OD2 ASP A 815      27.940  54.773  32.474  1.00  0.93           O  
ATOM   6555  N   ARG A 816      29.117  55.728  27.580  1.00  0.85           N  
ATOM   6556  CA  ARG A 816      29.673  55.781  26.233  1.00  0.85           C  
ATOM   6557  C   ARG A 816      31.048  56.429  26.222  1.00  0.85           C  
ATOM   6558  O   ARG A 816      32.010  55.882  25.692  1.00  0.85           O  
ATOM   6559  CB  ARG A 816      28.753  56.583  25.273  1.00  0.85           C  
ATOM   6560  CG  ARG A 816      29.173  56.502  23.786  1.00  0.85           C  
ATOM   6561  CD  ARG A 816      29.034  57.804  22.981  1.00  0.85           C  
ATOM   6562  NE  ARG A 816      30.213  58.657  23.293  1.00  0.85           N  
ATOM   6563  CZ  ARG A 816      30.303  59.812  23.956  1.00  0.85           C  
ATOM   6564  NH1 ARG A 816      29.262  60.453  24.474  1.00  0.85           N  
ATOM   6565  NH2 ARG A 816      31.506  60.369  24.061  1.00  0.85           N  
ATOM   6566  N   THR A 817      31.172  57.582  26.904  1.00  0.93           N  
ATOM   6567  CA  THR A 817      32.409  58.343  27.021  1.00  0.93           C  
ATOM   6568  C   THR A 817      33.527  57.567  27.691  1.00  0.93           C  
ATOM   6569  O   THR A 817      34.655  57.513  27.211  1.00  0.93           O  
ATOM   6570  CB  THR A 817      32.193  59.637  27.801  1.00  0.93           C  
ATOM   6571  OG1 THR A 817      31.021  60.302  27.358  1.00  0.93           O  
ATOM   6572  CG2 THR A 817      33.357  60.601  27.568  1.00  0.93           C  
ATOM   6573  N   ILE A 818      33.241  56.882  28.813  1.00  0.93           N  
ATOM   6574  CA  ILE A 818      34.185  56.014  29.501  1.00  0.93           C  
ATOM   6575  C   ILE A 818      34.602  54.804  28.681  1.00  0.93           C  
ATOM   6576  O   ILE A 818      35.779  54.447  28.687  1.00  0.93           O  
ATOM   6577  CB  ILE A 818      33.690  55.648  30.898  1.00  0.93           C  
ATOM   6578  CG1 ILE A 818      33.687  56.891  31.828  1.00  0.93           C  
ATOM   6579  CG2 ILE A 818      34.531  54.520  31.532  1.00  0.93           C  
ATOM   6580  CD1 ILE A 818      35.041  57.600  31.964  1.00  0.93           C  
ATOM   6581  N   LYS A 819      33.686  54.177  27.899  1.00  0.87           N  
ATOM   6582  CA  LYS A 819      34.040  53.121  26.950  1.00  0.87           C  
ATOM   6583  C   LYS A 819      35.089  53.619  25.947  1.00  0.87           C  
ATOM   6584  O   LYS A 819      36.113  52.973  25.732  1.00  0.87           O  
ATOM   6585  CB  LYS A 819      32.779  52.567  26.200  1.00  0.87           C  
ATOM   6586  CG  LYS A 819      31.830  51.688  27.055  1.00  0.87           C  
ATOM   6587  CD  LYS A 819      30.375  51.599  26.511  1.00  0.87           C  
ATOM   6588  CE  LYS A 819      29.374  50.876  27.450  1.00  0.87           C  
ATOM   6589  NZ  LYS A 819      27.943  50.993  27.021  1.00  0.87           N  
ATOM   6590  N   GLU A 820      34.917  54.832  25.390  1.00  0.88           N  
ATOM   6591  CA  GLU A 820      35.913  55.456  24.537  1.00  0.88           C  
ATOM   6592  C   GLU A 820      37.246  55.800  25.212  1.00  0.88           C  
ATOM   6593  O   GLU A 820      38.314  55.522  24.663  1.00  0.88           O  
ATOM   6594  CB  GLU A 820      35.344  56.758  23.950  1.00  0.88           C  
ATOM   6595  CG  GLU A 820      34.054  56.592  23.130  1.00  0.88           C  
ATOM   6596  CD  GLU A 820      33.391  57.934  22.888  1.00  0.88           C  
ATOM   6597  OE1 GLU A 820      32.395  57.945  22.127  1.00  0.88           O  
ATOM   6598  OE2 GLU A 820      33.778  58.979  23.475  1.00  0.88           O  
ATOM   6599  N   TYR A 821      37.259  56.407  26.427  1.00  0.92           N  
ATOM   6600  CA  TYR A 821      38.502  56.684  27.160  1.00  0.92           C  
ATOM   6601  C   TYR A 821      39.262  55.402  27.489  1.00  0.92           C  
ATOM   6602  O   TYR A 821      40.481  55.315  27.328  1.00  0.92           O  
ATOM   6603  CB  TYR A 821      38.278  57.416  28.519  1.00  0.92           C  
ATOM   6604  CG  TYR A 821      38.245  58.925  28.448  1.00  0.92           C  
ATOM   6605  CD1 TYR A 821      39.397  59.694  28.707  1.00  0.92           C  
ATOM   6606  CD2 TYR A 821      37.032  59.595  28.258  1.00  0.92           C  
ATOM   6607  CE1 TYR A 821      39.326  61.098  28.755  1.00  0.92           C  
ATOM   6608  CE2 TYR A 821      36.955  60.993  28.321  1.00  0.92           C  
ATOM   6609  CZ  TYR A 821      38.103  61.747  28.569  1.00  0.92           C  
ATOM   6610  OH  TYR A 821      38.013  63.155  28.641  1.00  0.92           O  
ATOM   6611  N   ALA A 822      38.543  54.356  27.933  1.00  0.92           N  
ATOM   6612  CA  ALA A 822      39.114  53.062  28.223  1.00  0.92           C  
ATOM   6613  C   ALA A 822      39.735  52.385  27.004  1.00  0.92           C  
ATOM   6614  O   ALA A 822      40.885  51.945  27.040  1.00  0.92           O  
ATOM   6615  CB  ALA A 822      38.001  52.193  28.834  1.00  0.92           C  
ATOM   6616  N   GLN A 823      39.001  52.367  25.875  1.00  0.83           N  
ATOM   6617  CA  GLN A 823      39.445  51.822  24.608  1.00  0.83           C  
ATOM   6618  C   GLN A 823      40.564  52.587  23.900  1.00  0.83           C  
ATOM   6619  O   GLN A 823      41.493  51.986  23.368  1.00  0.83           O  
ATOM   6620  CB  GLN A 823      38.216  51.694  23.673  1.00  0.83           C  
ATOM   6621  CG  GLN A 823      38.463  50.908  22.365  1.00  0.83           C  
ATOM   6622  CD  GLN A 823      37.176  50.777  21.549  1.00  0.83           C  
ATOM   6623  OE1 GLN A 823      36.096  51.240  21.909  1.00  0.83           O  
ATOM   6624  NE2 GLN A 823      37.296  50.135  20.364  1.00  0.83           N  
ATOM   6625  N   ASN A 824      40.521  53.938  23.837  1.00  0.86           N  
ATOM   6626  CA  ASN A 824      41.460  54.677  22.995  1.00  0.86           C  
ATOM   6627  C   ASN A 824      42.553  55.416  23.747  1.00  0.86           C  
ATOM   6628  O   ASN A 824      43.440  55.992  23.119  1.00  0.86           O  
ATOM   6629  CB  ASN A 824      40.750  55.802  22.196  1.00  0.86           C  
ATOM   6630  CG  ASN A 824      39.537  55.378  21.381  1.00  0.86           C  
ATOM   6631  OD1 ASN A 824      38.594  56.170  21.290  1.00  0.86           O  
ATOM   6632  ND2 ASN A 824      39.573  54.190  20.742  1.00  0.86           N  
ATOM   6633  N   ILE A 825      42.519  55.462  25.090  1.00  0.91           N  
ATOM   6634  CA  ILE A 825      43.506  56.242  25.836  1.00  0.91           C  
ATOM   6635  C   ILE A 825      44.130  55.399  26.919  1.00  0.91           C  
ATOM   6636  O   ILE A 825      45.353  55.270  27.000  1.00  0.91           O  
ATOM   6637  CB  ILE A 825      42.913  57.517  26.455  1.00  0.91           C  
ATOM   6638  CG1 ILE A 825      42.360  58.443  25.343  1.00  0.91           C  
ATOM   6639  CG2 ILE A 825      43.986  58.253  27.287  1.00  0.91           C  
ATOM   6640  CD1 ILE A 825      41.748  59.757  25.841  1.00  0.91           C  
ATOM   6641  N   TRP A 826      43.311  54.800  27.801  1.00  0.88           N  
ATOM   6642  CA  TRP A 826      43.828  54.069  28.941  1.00  0.88           C  
ATOM   6643  C   TRP A 826      44.317  52.669  28.615  1.00  0.88           C  
ATOM   6644  O   TRP A 826      45.208  52.161  29.298  1.00  0.88           O  
ATOM   6645  CB  TRP A 826      42.772  54.028  30.076  1.00  0.88           C  
ATOM   6646  CG  TRP A 826      42.357  55.413  30.565  1.00  0.88           C  
ATOM   6647  CD1 TRP A 826      43.115  56.554  30.581  1.00  0.88           C  
ATOM   6648  CD2 TRP A 826      41.056  55.777  31.054  1.00  0.88           C  
ATOM   6649  NE1 TRP A 826      42.362  57.604  31.023  1.00  0.88           N  
ATOM   6650  CE2 TRP A 826      41.105  57.177  31.330  1.00  0.88           C  
ATOM   6651  CE3 TRP A 826      39.884  55.057  31.269  1.00  0.88           C  
ATOM   6652  CZ2 TRP A 826      39.998  57.842  31.813  1.00  0.88           C  
ATOM   6653  CZ3 TRP A 826      38.760  55.744  31.750  1.00  0.88           C  
ATOM   6654  CH2 TRP A 826      38.819  57.122  32.025  1.00  0.88           C  
ATOM   6655  N   ASN A 827      43.779  52.023  27.554  1.00  0.87           N  
ATOM   6656  CA  ASN A 827      44.043  50.629  27.215  1.00  0.87           C  
ATOM   6657  C   ASN A 827      43.549  49.712  28.333  1.00  0.87           C  
ATOM   6658  O   ASN A 827      44.309  48.992  28.980  1.00  0.87           O  
ATOM   6659  CB  ASN A 827      45.518  50.379  26.783  1.00  0.87           C  
ATOM   6660  CG  ASN A 827      45.711  48.981  26.200  1.00  0.87           C  
ATOM   6661  OD1 ASN A 827      45.122  48.630  25.182  1.00  0.87           O  
ATOM   6662  ND2 ASN A 827      46.562  48.155  26.850  1.00  0.87           N  
ATOM   6663  N   VAL A 828      42.239  49.810  28.608  1.00  0.85           N  
ATOM   6664  CA  VAL A 828      41.548  49.118  29.677  1.00  0.85           C  
ATOM   6665  C   VAL A 828      40.243  48.613  29.092  1.00  0.85           C  
ATOM   6666  O   VAL A 828      39.557  49.348  28.390  1.00  0.85           O  
ATOM   6667  CB  VAL A 828      41.257  50.058  30.853  1.00  0.85           C  
ATOM   6668  CG1 VAL A 828      40.284  49.442  31.874  1.00  0.85           C  
ATOM   6669  CG2 VAL A 828      42.574  50.415  31.564  1.00  0.85           C  
ATOM   6670  N   GLU A 829      39.868  47.346  29.356  1.00  0.79           N  
ATOM   6671  CA  GLU A 829      38.618  46.780  28.869  1.00  0.79           C  
ATOM   6672  C   GLU A 829      37.509  46.877  29.923  1.00  0.79           C  
ATOM   6673  O   GLU A 829      37.731  46.471  31.070  1.00  0.79           O  
ATOM   6674  CB  GLU A 829      38.794  45.304  28.427  1.00  0.79           C  
ATOM   6675  CG  GLU A 829      38.743  45.113  26.890  1.00  0.79           C  
ATOM   6676  CD  GLU A 829      37.382  45.491  26.306  1.00  0.79           C  
ATOM   6677  OE1 GLU A 829      36.416  44.722  26.525  1.00  0.79           O  
ATOM   6678  OE2 GLU A 829      37.304  46.552  25.634  1.00  0.79           O  
ATOM   6679  N   PRO A 830      36.327  47.422  29.625  1.00  0.89           N  
ATOM   6680  CA  PRO A 830      35.133  47.296  30.455  1.00  0.89           C  
ATOM   6681  C   PRO A 830      34.698  45.886  30.809  1.00  0.89           C  
ATOM   6682  O   PRO A 830      35.107  44.913  30.185  1.00  0.89           O  
ATOM   6683  CB  PRO A 830      34.057  48.044  29.651  1.00  0.89           C  
ATOM   6684  CG  PRO A 830      34.855  49.115  28.909  1.00  0.89           C  
ATOM   6685  CD  PRO A 830      36.104  48.337  28.503  1.00  0.89           C  
ATOM   6686  N   SER A 831      33.849  45.746  31.836  1.00  0.81           N  
ATOM   6687  CA  SER A 831      33.297  44.455  32.200  1.00  0.81           C  
ATOM   6688  C   SER A 831      31.895  44.595  32.756  1.00  0.81           C  
ATOM   6689  O   SER A 831      31.623  45.442  33.603  1.00  0.81           O  
ATOM   6690  CB  SER A 831      34.154  43.752  33.282  1.00  0.81           C  
ATOM   6691  OG  SER A 831      33.646  42.453  33.617  1.00  0.81           O  
ATOM   6692  N   ASP A 832      30.979  43.704  32.329  1.00  0.72           N  
ATOM   6693  CA  ASP A 832      29.627  43.641  32.848  1.00  0.72           C  
ATOM   6694  C   ASP A 832      29.511  42.596  33.956  1.00  0.72           C  
ATOM   6695  O   ASP A 832      28.445  42.401  34.539  1.00  0.72           O  
ATOM   6696  CB  ASP A 832      28.662  43.252  31.690  1.00  0.72           C  
ATOM   6697  CG  ASP A 832      27.929  44.459  31.144  1.00  0.72           C  
ATOM   6698  OD1 ASP A 832      28.552  45.467  30.743  1.00  0.72           O  
ATOM   6699  OD2 ASP A 832      26.669  44.435  31.198  1.00  0.72           O  
ATOM   6700  N   LEU A 833      30.607  41.886  34.296  1.00  0.72           N  
ATOM   6701  CA  LEU A 833      30.575  40.916  35.374  1.00  0.72           C  
ATOM   6702  C   LEU A 833      30.374  41.530  36.757  1.00  0.72           C  
ATOM   6703  O   LEU A 833      31.018  42.492  37.169  1.00  0.72           O  
ATOM   6704  CB  LEU A 833      31.804  39.972  35.387  1.00  0.72           C  
ATOM   6705  CG  LEU A 833      31.976  39.098  34.124  1.00  0.72           C  
ATOM   6706  CD1 LEU A 833      33.243  38.238  34.245  1.00  0.72           C  
ATOM   6707  CD2 LEU A 833      30.764  38.186  33.873  1.00  0.72           C  
ATOM   6708  N   LYS A 834      29.444  40.932  37.516  1.00  0.75           N  
ATOM   6709  CA  LYS A 834      29.082  41.334  38.853  1.00  0.75           C  
ATOM   6710  C   LYS A 834      30.023  40.726  39.883  1.00  0.75           C  
ATOM   6711  O   LYS A 834      30.230  39.512  39.919  1.00  0.75           O  
ATOM   6712  CB  LYS A 834      27.629  40.857  39.112  1.00  0.75           C  
ATOM   6713  CG  LYS A 834      27.102  40.977  40.550  1.00  0.75           C  
ATOM   6714  CD  LYS A 834      25.839  40.120  40.738  1.00  0.75           C  
ATOM   6715  CE  LYS A 834      25.729  39.447  42.107  1.00  0.75           C  
ATOM   6716  NZ  LYS A 834      26.931  38.615  42.376  1.00  0.75           N  
ATOM   6717  N   ILE A 835      30.579  41.551  40.795  1.00  0.74           N  
ATOM   6718  CA  ILE A 835      31.424  41.096  41.891  1.00  0.74           C  
ATOM   6719  C   ILE A 835      30.679  40.113  42.805  1.00  0.74           C  
ATOM   6720  O   ILE A 835      29.489  40.267  43.128  1.00  0.74           O  
ATOM   6721  CB  ILE A 835      31.977  42.270  42.705  1.00  0.74           C  
ATOM   6722  CG1 ILE A 835      32.811  43.255  41.847  1.00  0.74           C  
ATOM   6723  CG2 ILE A 835      32.798  41.805  43.929  1.00  0.74           C  
ATOM   6724  CD1 ILE A 835      34.165  42.720  41.364  1.00  0.74           C  
ATOM   6725  N   SER A 836      31.360  39.028  43.236  1.00  0.70           N  
ATOM   6726  CA  SER A 836      30.762  38.061  44.139  1.00  0.70           C  
ATOM   6727  C   SER A 836      31.043  38.421  45.578  1.00  0.70           C  
ATOM   6728  O   SER A 836      32.182  38.475  46.037  1.00  0.70           O  
ATOM   6729  CB  SER A 836      31.185  36.588  43.935  1.00  0.70           C  
ATOM   6730  OG  SER A 836      30.208  35.745  44.553  1.00  0.70           O  
ATOM   6731  N   LEU A 837      29.971  38.699  46.334  1.00  0.67           N  
ATOM   6732  CA  LEU A 837      30.041  38.959  47.754  1.00  0.67           C  
ATOM   6733  C   LEU A 837      30.264  37.678  48.535  1.00  0.67           C  
ATOM   6734  O   LEU A 837      31.073  37.617  49.467  1.00  0.67           O  
ATOM   6735  CB  LEU A 837      28.770  39.712  48.211  1.00  0.67           C  
ATOM   6736  CG  LEU A 837      28.525  41.013  47.413  1.00  0.67           C  
ATOM   6737  CD1 LEU A 837      27.225  41.705  47.847  1.00  0.67           C  
ATOM   6738  CD2 LEU A 837      29.703  41.994  47.511  1.00  0.67           C  
ATOM   6739  N   SER A 838      29.568  36.623  48.080  1.00  0.48           N  
ATOM   6740  CA  SER A 838      29.627  35.268  48.588  1.00  0.48           C  
ATOM   6741  C   SER A 838      30.519  34.437  47.695  1.00  0.48           C  
ATOM   6742  O   SER A 838      30.062  33.720  46.806  1.00  0.48           O  
ATOM   6743  CB  SER A 838      28.226  34.609  48.657  1.00  0.48           C  
ATOM   6744  OG  SER A 838      27.325  35.460  49.367  1.00  0.48           O  
ATOM   6745  N   ASN A 839      31.832  34.571  47.912  1.00  0.60           N  
ATOM   6746  CA  ASN A 839      32.886  33.806  47.291  1.00  0.60           C  
ATOM   6747  C   ASN A 839      33.531  32.909  48.389  1.00  0.60           C  
ATOM   6748  O   ASN A 839      33.305  33.181  49.602  1.00  0.60           O  
ATOM   6749  CB  ASN A 839      33.950  34.802  46.757  1.00  0.60           C  
ATOM   6750  CG  ASN A 839      34.923  34.188  45.757  1.00  0.60           C  
ATOM   6751  OD1 ASN A 839      34.812  34.400  44.549  1.00  0.60           O  
ATOM   6752  ND2 ASN A 839      35.938  33.464  46.272  1.00  0.60           N  
ATOM   6753  OXT ASN A 839      34.316  31.996  48.021  1.00  0.60           O  
TER    6754      ASN A 839                                                      
ATOM   6755  N   THR B   6       4.544  63.019  64.241  1.00  0.50           N  
ATOM   6756  CA  THR B   6       6.027  62.775  64.001  1.00  0.50           C  
ATOM   6757  C   THR B   6       6.639  61.918  65.086  1.00  0.50           C  
ATOM   6758  O   THR B   6       7.639  62.254  65.715  1.00  0.50           O  
ATOM   6759  CB  THR B   6       6.821  64.082  63.887  1.00  0.50           C  
ATOM   6760  OG1 THR B   6       6.405  65.027  64.864  1.00  0.50           O  
ATOM   6761  CG2 THR B   6       6.591  64.714  62.509  1.00  0.50           C  
ATOM   6762  N   ASP B   7       6.003  60.758  65.307  1.00  0.60           N  
ATOM   6763  CA  ASP B   7       5.926  60.112  66.598  1.00  0.60           C  
ATOM   6764  C   ASP B   7       5.453  58.680  66.353  1.00  0.60           C  
ATOM   6765  O   ASP B   7       6.174  57.912  65.723  1.00  0.60           O  
ATOM   6766  CB  ASP B   7       4.971  60.922  67.537  1.00  0.60           C  
ATOM   6767  CG  ASP B   7       3.867  61.603  66.737  1.00  0.60           C  
ATOM   6768  OD1 ASP B   7       3.232  60.928  65.883  1.00  0.60           O  
ATOM   6769  OD2 ASP B   7       3.813  62.857  66.778  1.00  0.60           O  
ATOM   6770  N   GLN B   8       4.223  58.313  66.789  1.00  0.65           N  
ATOM   6771  CA  GLN B   8       3.576  57.036  66.524  1.00  0.65           C  
ATOM   6772  C   GLN B   8       4.184  55.827  67.240  1.00  0.65           C  
ATOM   6773  O   GLN B   8       5.377  55.749  67.522  1.00  0.65           O  
ATOM   6774  CB  GLN B   8       3.468  56.803  64.989  1.00  0.65           C  
ATOM   6775  CG  GLN B   8       2.553  55.661  64.493  1.00  0.65           C  
ATOM   6776  CD  GLN B   8       1.051  55.816  64.751  1.00  0.65           C  
ATOM   6777  OE1 GLN B   8       0.363  54.800  64.820  1.00  0.65           O  
ATOM   6778  NE2 GLN B   8       0.530  57.055  64.846  1.00  0.65           N  
ATOM   6779  N   GLU B   9       3.374  54.787  67.532  1.00  0.62           N  
ATOM   6780  CA  GLU B   9       3.870  53.578  68.167  1.00  0.62           C  
ATOM   6781  C   GLU B   9       4.768  52.727  67.273  1.00  0.62           C  
ATOM   6782  O   GLU B   9       5.543  51.896  67.735  1.00  0.62           O  
ATOM   6783  CB  GLU B   9       2.725  52.723  68.728  1.00  0.62           C  
ATOM   6784  CG  GLU B   9       1.959  53.463  69.847  1.00  0.62           C  
ATOM   6785  CD  GLU B   9       1.390  52.485  70.865  1.00  0.62           C  
ATOM   6786  OE1 GLU B   9       0.145  52.397  70.971  1.00  0.62           O  
ATOM   6787  OE2 GLU B   9       2.228  51.841  71.555  1.00  0.62           O  
ATOM   6788  N   LYS B  10       4.767  52.996  65.954  1.00  0.66           N  
ATOM   6789  CA  LYS B  10       5.771  52.520  65.015  1.00  0.66           C  
ATOM   6790  C   LYS B  10       7.182  52.970  65.388  1.00  0.66           C  
ATOM   6791  O   LYS B  10       8.146  52.228  65.247  1.00  0.66           O  
ATOM   6792  CB  LYS B  10       5.416  52.991  63.584  1.00  0.66           C  
ATOM   6793  CG  LYS B  10       4.304  52.134  62.953  1.00  0.66           C  
ATOM   6794  CD  LYS B  10       3.417  52.873  61.933  1.00  0.66           C  
ATOM   6795  CE  LYS B  10       4.168  53.562  60.787  1.00  0.66           C  
ATOM   6796  NZ  LYS B  10       3.211  54.330  59.960  1.00  0.66           N  
ATOM   6797  N   ARG B  11       7.345  54.177  65.967  1.00  0.57           N  
ATOM   6798  CA  ARG B  11       8.639  54.663  66.413  1.00  0.57           C  
ATOM   6799  C   ARG B  11       9.143  53.950  67.670  1.00  0.57           C  
ATOM   6800  O   ARG B  11      10.303  54.061  68.061  1.00  0.57           O  
ATOM   6801  CB  ARG B  11       8.608  56.199  66.559  1.00  0.57           C  
ATOM   6802  CG  ARG B  11       9.988  56.880  66.541  1.00  0.57           C  
ATOM   6803  CD  ARG B  11       9.952  58.413  66.502  1.00  0.57           C  
ATOM   6804  NE  ARG B  11       9.401  58.833  65.174  1.00  0.57           N  
ATOM   6805  CZ  ARG B  11       9.613  60.030  64.615  1.00  0.57           C  
ATOM   6806  NH1 ARG B  11      10.306  60.986  65.222  1.00  0.57           N  
ATOM   6807  NH2 ARG B  11       9.123  60.269  63.401  1.00  0.57           N  
ATOM   6808  N   ARG B  12       8.301  53.105  68.312  1.00  0.63           N  
ATOM   6809  CA  ARG B  12       8.732  52.221  69.382  1.00  0.63           C  
ATOM   6810  C   ARG B  12       9.602  51.076  68.876  1.00  0.63           C  
ATOM   6811  O   ARG B  12      10.326  50.447  69.654  1.00  0.63           O  
ATOM   6812  CB  ARG B  12       7.553  51.608  70.174  1.00  0.63           C  
ATOM   6813  CG  ARG B  12       6.633  52.655  70.831  1.00  0.63           C  
ATOM   6814  CD  ARG B  12       5.400  52.057  71.533  1.00  0.63           C  
ATOM   6815  NE  ARG B  12       5.876  51.244  72.706  1.00  0.63           N  
ATOM   6816  CZ  ARG B  12       6.153  51.757  73.912  1.00  0.63           C  
ATOM   6817  NH1 ARG B  12       6.058  53.060  74.153  1.00  0.63           N  
ATOM   6818  NH2 ARG B  12       6.564  50.947  74.886  1.00  0.63           N  
ATOM   6819  N   GLN B  13       9.588  50.817  67.547  1.00  0.55           N  
ATOM   6820  CA  GLN B  13      10.540  49.958  66.864  1.00  0.55           C  
ATOM   6821  C   GLN B  13      11.965  50.464  66.989  1.00  0.55           C  
ATOM   6822  O   GLN B  13      12.892  49.670  67.120  1.00  0.55           O  
ATOM   6823  CB  GLN B  13      10.210  49.785  65.365  1.00  0.55           C  
ATOM   6824  CG  GLN B  13       8.875  49.057  65.095  1.00  0.55           C  
ATOM   6825  CD  GLN B  13       8.944  47.579  65.460  1.00  0.55           C  
ATOM   6826  OE1 GLN B  13       9.708  46.813  64.869  1.00  0.55           O  
ATOM   6827  NE2 GLN B  13       8.115  47.147  66.438  1.00  0.55           N  
ATOM   6828  N   ILE B  14      12.169  51.802  67.001  1.00  0.58           N  
ATOM   6829  CA  ILE B  14      13.445  52.416  67.336  1.00  0.58           C  
ATOM   6830  C   ILE B  14      13.824  52.110  68.785  1.00  0.58           C  
ATOM   6831  O   ILE B  14      13.340  52.733  69.730  1.00  0.58           O  
ATOM   6832  CB  ILE B  14      13.478  53.920  67.070  1.00  0.58           C  
ATOM   6833  CG1 ILE B  14      12.991  54.227  65.633  1.00  0.58           C  
ATOM   6834  CG2 ILE B  14      14.911  54.445  67.291  1.00  0.58           C  
ATOM   6835  CD1 ILE B  14      13.135  55.694  65.215  1.00  0.58           C  
ATOM   6836  N   SER B  15      14.667  51.082  69.002  1.00  0.73           N  
ATOM   6837  CA  SER B  15      14.923  50.542  70.329  1.00  0.73           C  
ATOM   6838  C   SER B  15      16.162  49.675  70.308  1.00  0.73           C  
ATOM   6839  O   SER B  15      16.540  49.153  69.267  1.00  0.73           O  
ATOM   6840  CB  SER B  15      13.735  49.640  70.784  1.00  0.73           C  
ATOM   6841  OG  SER B  15      13.830  49.175  72.136  1.00  0.73           O  
ATOM   6842  N   ILE B  16      16.798  49.445  71.475  1.00  0.67           N  
ATOM   6843  CA  ILE B  16      17.942  48.543  71.573  1.00  0.67           C  
ATOM   6844  C   ILE B  16      17.536  47.141  71.978  1.00  0.67           C  
ATOM   6845  O   ILE B  16      18.371  46.262  72.152  1.00  0.67           O  
ATOM   6846  CB  ILE B  16      19.014  49.013  72.548  1.00  0.67           C  
ATOM   6847  CG1 ILE B  16      18.474  49.267  73.967  1.00  0.67           C  
ATOM   6848  CG2 ILE B  16      19.646  50.277  71.966  1.00  0.67           C  
ATOM   6849  CD1 ILE B  16      19.567  49.701  74.948  1.00  0.67           C  
ATOM   6850  N   ARG B  17      16.220  46.883  72.092  1.00  0.58           N  
ATOM   6851  CA  ARG B  17      15.612  45.671  72.624  1.00  0.58           C  
ATOM   6852  C   ARG B  17      16.170  44.335  72.132  1.00  0.58           C  
ATOM   6853  O   ARG B  17      16.366  43.427  72.930  1.00  0.58           O  
ATOM   6854  CB  ARG B  17      14.095  45.768  72.319  1.00  0.58           C  
ATOM   6855  CG  ARG B  17      13.235  44.525  72.637  1.00  0.58           C  
ATOM   6856  CD  ARG B  17      11.719  44.748  72.506  1.00  0.58           C  
ATOM   6857  NE  ARG B  17      11.483  45.370  71.160  1.00  0.58           N  
ATOM   6858  CZ  ARG B  17      10.314  45.872  70.747  1.00  0.58           C  
ATOM   6859  NH1 ARG B  17       9.194  45.697  71.440  1.00  0.58           N  
ATOM   6860  NH2 ARG B  17      10.276  46.579  69.619  1.00  0.58           N  
ATOM   6861  N   GLY B  18      16.446  44.179  70.818  1.00  0.60           N  
ATOM   6862  CA  GLY B  18      17.009  42.940  70.278  1.00  0.60           C  
ATOM   6863  C   GLY B  18      18.486  42.984  69.992  1.00  0.60           C  
ATOM   6864  O   GLY B  18      19.041  42.026  69.466  1.00  0.60           O  
ATOM   6865  N   ILE B  19      19.168  44.105  70.288  1.00  0.69           N  
ATOM   6866  CA  ILE B  19      20.590  44.269  69.994  1.00  0.69           C  
ATOM   6867  C   ILE B  19      21.400  44.440  71.265  1.00  0.69           C  
ATOM   6868  O   ILE B  19      22.595  44.720  71.219  1.00  0.69           O  
ATOM   6869  CB  ILE B  19      20.889  45.432  69.041  1.00  0.69           C  
ATOM   6870  CG1 ILE B  19      20.242  46.753  69.502  1.00  0.69           C  
ATOM   6871  CG2 ILE B  19      20.402  45.037  67.633  1.00  0.69           C  
ATOM   6872  CD1 ILE B  19      20.677  47.977  68.692  1.00  0.69           C  
ATOM   6873  N   VAL B  20      20.772  44.243  72.439  1.00  0.61           N  
ATOM   6874  CA  VAL B  20      21.422  44.366  73.734  1.00  0.61           C  
ATOM   6875  C   VAL B  20      21.258  43.088  74.554  1.00  0.61           C  
ATOM   6876  O   VAL B  20      20.204  42.459  74.570  1.00  0.61           O  
ATOM   6877  CB  VAL B  20      20.951  45.620  74.482  1.00  0.61           C  
ATOM   6878  CG1 VAL B  20      19.539  45.463  75.084  1.00  0.61           C  
ATOM   6879  CG2 VAL B  20      21.973  46.037  75.558  1.00  0.61           C  
ATOM   6880  N   GLY B  21      22.333  42.641  75.244  1.00  0.69           N  
ATOM   6881  CA  GLY B  21      22.294  41.505  76.173  1.00  0.69           C  
ATOM   6882  C   GLY B  21      22.853  40.204  75.653  1.00  0.69           C  
ATOM   6883  O   GLY B  21      23.158  39.298  76.423  1.00  0.69           O  
ATOM   6884  N   VAL B  22      23.041  40.058  74.331  1.00  0.67           N  
ATOM   6885  CA  VAL B  22      23.675  38.879  73.753  1.00  0.67           C  
ATOM   6886  C   VAL B  22      25.182  39.057  73.619  1.00  0.67           C  
ATOM   6887  O   VAL B  22      25.713  39.581  72.643  1.00  0.67           O  
ATOM   6888  CB  VAL B  22      23.068  38.435  72.425  1.00  0.67           C  
ATOM   6889  CG1 VAL B  22      21.731  37.726  72.705  1.00  0.67           C  
ATOM   6890  CG2 VAL B  22      22.838  39.627  71.476  1.00  0.67           C  
ATOM   6891  N   GLU B  23      25.931  38.591  74.632  1.00  0.68           N  
ATOM   6892  CA  GLU B  23      27.363  38.837  74.725  1.00  0.68           C  
ATOM   6893  C   GLU B  23      28.228  37.586  74.711  1.00  0.68           C  
ATOM   6894  O   GLU B  23      29.411  37.601  75.043  1.00  0.68           O  
ATOM   6895  CB  GLU B  23      27.660  39.799  75.894  1.00  0.68           C  
ATOM   6896  CG  GLU B  23      27.015  39.471  77.261  1.00  0.68           C  
ATOM   6897  CD  GLU B  23      26.936  40.702  78.163  1.00  0.68           C  
ATOM   6898  OE1 GLU B  23      26.883  41.864  77.669  1.00  0.68           O  
ATOM   6899  OE2 GLU B  23      26.868  40.519  79.401  1.00  0.68           O  
ATOM   6900  N   ASN B  24      27.663  36.453  74.244  1.00  0.77           N  
ATOM   6901  CA  ASN B  24      28.413  35.270  73.834  1.00  0.77           C  
ATOM   6902  C   ASN B  24      29.555  35.509  72.823  1.00  0.77           C  
ATOM   6903  O   ASN B  24      29.563  36.481  72.070  1.00  0.77           O  
ATOM   6904  CB  ASN B  24      27.469  34.126  73.348  1.00  0.77           C  
ATOM   6905  CG  ASN B  24      27.008  34.243  71.892  1.00  0.77           C  
ATOM   6906  OD1 ASN B  24      27.207  33.309  71.118  1.00  0.77           O  
ATOM   6907  ND2 ASN B  24      26.437  35.397  71.489  1.00  0.77           N  
ATOM   6908  N   VAL B  25      30.509  34.559  72.738  1.00  0.79           N  
ATOM   6909  CA  VAL B  25      31.669  34.606  71.851  1.00  0.79           C  
ATOM   6910  C   VAL B  25      31.343  34.778  70.369  1.00  0.79           C  
ATOM   6911  O   VAL B  25      32.010  35.534  69.663  1.00  0.79           O  
ATOM   6912  CB  VAL B  25      32.514  33.345  72.051  1.00  0.79           C  
ATOM   6913  CG1 VAL B  25      33.625  33.196  70.991  1.00  0.79           C  
ATOM   6914  CG2 VAL B  25      33.158  33.401  73.448  1.00  0.79           C  
ATOM   6915  N   ALA B  26      30.298  34.106  69.843  1.00  0.78           N  
ATOM   6916  CA  ALA B  26      29.926  34.208  68.444  1.00  0.78           C  
ATOM   6917  C   ALA B  26      29.513  35.610  67.988  1.00  0.78           C  
ATOM   6918  O   ALA B  26      29.971  36.094  66.952  1.00  0.78           O  
ATOM   6919  CB  ALA B  26      28.799  33.203  68.154  1.00  0.78           C  
ATOM   6920  N   GLU B  27      28.680  36.326  68.775  1.00  0.76           N  
ATOM   6921  CA  GLU B  27      28.357  37.716  68.481  1.00  0.76           C  
ATOM   6922  C   GLU B  27      29.513  38.678  68.715  1.00  0.76           C  
ATOM   6923  O   GLU B  27      29.654  39.657  67.986  1.00  0.76           O  
ATOM   6924  CB  GLU B  27      27.096  38.257  69.198  1.00  0.76           C  
ATOM   6925  CG  GLU B  27      25.754  37.700  68.658  1.00  0.76           C  
ATOM   6926  CD  GLU B  27      25.532  37.824  67.156  1.00  0.76           C  
ATOM   6927  OE1 GLU B  27      25.080  36.793  66.586  1.00  0.76           O  
ATOM   6928  OE2 GLU B  27      25.795  38.875  66.494  1.00  0.76           O  
ATOM   6929  N   LEU B  28      30.402  38.430  69.703  1.00  0.83           N  
ATOM   6930  CA  LEU B  28      31.606  39.237  69.877  1.00  0.83           C  
ATOM   6931  C   LEU B  28      32.540  39.197  68.673  1.00  0.83           C  
ATOM   6932  O   LEU B  28      33.033  40.231  68.227  1.00  0.83           O  
ATOM   6933  CB  LEU B  28      32.422  38.811  71.121  1.00  0.83           C  
ATOM   6934  CG  LEU B  28      31.765  39.118  72.478  1.00  0.83           C  
ATOM   6935  CD1 LEU B  28      32.617  38.526  73.603  1.00  0.83           C  
ATOM   6936  CD2 LEU B  28      31.594  40.624  72.721  1.00  0.83           C  
ATOM   6937  N   LYS B  29      32.767  38.008  68.072  1.00  0.83           N  
ATOM   6938  CA  LYS B  29      33.490  37.906  66.812  1.00  0.83           C  
ATOM   6939  C   LYS B  29      32.791  38.615  65.658  1.00  0.83           C  
ATOM   6940  O   LYS B  29      33.405  39.357  64.895  1.00  0.83           O  
ATOM   6941  CB  LYS B  29      33.702  36.435  66.389  1.00  0.83           C  
ATOM   6942  CG  LYS B  29      34.552  35.625  67.375  1.00  0.83           C  
ATOM   6943  CD  LYS B  29      35.219  34.401  66.727  1.00  0.83           C  
ATOM   6944  CE  LYS B  29      34.250  33.446  66.023  1.00  0.83           C  
ATOM   6945  NZ  LYS B  29      35.005  32.313  65.462  1.00  0.83           N  
ATOM   6946  N   LYS B  30      31.461  38.436  65.540  1.00  0.81           N  
ATOM   6947  CA  LYS B  30      30.647  39.064  64.517  1.00  0.81           C  
ATOM   6948  C   LYS B  30      30.664  40.588  64.581  1.00  0.81           C  
ATOM   6949  O   LYS B  30      30.818  41.272  63.571  1.00  0.81           O  
ATOM   6950  CB  LYS B  30      29.202  38.526  64.646  1.00  0.81           C  
ATOM   6951  CG  LYS B  30      28.271  38.905  63.484  1.00  0.81           C  
ATOM   6952  CD  LYS B  30      27.666  37.698  62.743  1.00  0.81           C  
ATOM   6953  CE  LYS B  30      26.828  36.735  63.599  1.00  0.81           C  
ATOM   6954  NZ  LYS B  30      25.681  37.422  64.199  1.00  0.81           N  
ATOM   6955  N   SER B  31      30.552  41.164  65.792  1.00  0.84           N  
ATOM   6956  CA  SER B  31      30.732  42.587  66.049  1.00  0.84           C  
ATOM   6957  C   SER B  31      32.134  43.092  65.782  1.00  0.84           C  
ATOM   6958  O   SER B  31      32.293  44.170  65.211  1.00  0.84           O  
ATOM   6959  CB  SER B  31      30.297  42.992  67.476  1.00  0.84           C  
ATOM   6960  OG  SER B  31      28.877  42.861  67.618  1.00  0.84           O  
ATOM   6961  N   PHE B  32      33.186  42.313  66.118  1.00  0.86           N  
ATOM   6962  CA  PHE B  32      34.567  42.636  65.779  1.00  0.86           C  
ATOM   6963  C   PHE B  32      34.767  42.766  64.275  1.00  0.86           C  
ATOM   6964  O   PHE B  32      35.380  43.719  63.793  1.00  0.86           O  
ATOM   6965  CB  PHE B  32      35.525  41.555  66.364  1.00  0.86           C  
ATOM   6966  CG  PHE B  32      36.988  41.862  66.141  1.00  0.86           C  
ATOM   6967  CD1 PHE B  32      37.621  41.496  64.937  1.00  0.86           C  
ATOM   6968  CD2 PHE B  32      37.747  42.491  67.140  1.00  0.86           C  
ATOM   6969  CE1 PHE B  32      38.981  41.762  64.732  1.00  0.86           C  
ATOM   6970  CE2 PHE B  32      39.109  42.749  66.942  1.00  0.86           C  
ATOM   6971  CZ  PHE B  32      39.721  42.393  65.737  1.00  0.86           C  
ATOM   6972  N   ASN B  33      34.207  41.828  63.486  1.00  0.84           N  
ATOM   6973  CA  ASN B  33      34.201  41.925  62.038  1.00  0.84           C  
ATOM   6974  C   ASN B  33      33.421  43.120  61.506  1.00  0.84           C  
ATOM   6975  O   ASN B  33      33.911  43.846  60.649  1.00  0.84           O  
ATOM   6976  CB  ASN B  33      33.699  40.611  61.386  1.00  0.84           C  
ATOM   6977  CG  ASN B  33      34.638  39.455  61.702  1.00  0.84           C  
ATOM   6978  OD1 ASN B  33      34.240  38.357  62.084  1.00  0.84           O  
ATOM   6979  ND2 ASN B  33      35.958  39.700  61.537  1.00  0.84           N  
ATOM   6980  N   ARG B  34      32.219  43.434  62.041  1.00  0.81           N  
ATOM   6981  CA  ARG B  34      31.517  44.647  61.627  1.00  0.81           C  
ATOM   6982  C   ARG B  34      32.320  45.915  61.905  1.00  0.81           C  
ATOM   6983  O   ARG B  34      32.437  46.790  61.054  1.00  0.81           O  
ATOM   6984  CB  ARG B  34      30.133  44.844  62.303  1.00  0.81           C  
ATOM   6985  CG  ARG B  34      29.096  43.734  62.052  1.00  0.81           C  
ATOM   6986  CD  ARG B  34      27.684  44.171  62.464  1.00  0.81           C  
ATOM   6987  NE  ARG B  34      26.917  42.965  62.942  1.00  0.81           N  
ATOM   6988  CZ  ARG B  34      26.836  42.591  64.232  1.00  0.81           C  
ATOM   6989  NH1 ARG B  34      27.455  43.273  65.187  1.00  0.81           N  
ATOM   6990  NH2 ARG B  34      26.092  41.536  64.563  1.00  0.81           N  
ATOM   6991  N   HIS B  35      32.938  46.034  63.093  1.00  0.84           N  
ATOM   6992  CA  HIS B  35      33.789  47.172  63.391  1.00  0.84           C  
ATOM   6993  C   HIS B  35      35.079  47.251  62.583  1.00  0.84           C  
ATOM   6994  O   HIS B  35      35.413  48.308  62.052  1.00  0.84           O  
ATOM   6995  CB  HIS B  35      34.073  47.292  64.901  1.00  0.84           C  
ATOM   6996  CG  HIS B  35      32.843  47.723  65.643  1.00  0.84           C  
ATOM   6997  ND1 HIS B  35      32.299  48.963  65.350  1.00  0.84           N  
ATOM   6998  CD2 HIS B  35      32.089  47.083  66.576  1.00  0.84           C  
ATOM   6999  CE1 HIS B  35      31.222  49.048  66.115  1.00  0.84           C  
ATOM   7000  NE2 HIS B  35      31.053  47.941  66.872  1.00  0.84           N  
ATOM   7001  N   LEU B  36      35.833  46.148  62.402  1.00  0.86           N  
ATOM   7002  CA  LEU B  36      37.028  46.182  61.571  1.00  0.86           C  
ATOM   7003  C   LEU B  36      36.731  46.508  60.113  1.00  0.86           C  
ATOM   7004  O   LEU B  36      37.343  47.372  59.486  1.00  0.86           O  
ATOM   7005  CB  LEU B  36      37.742  44.812  61.594  1.00  0.86           C  
ATOM   7006  CG  LEU B  36      39.112  44.830  60.890  1.00  0.86           C  
ATOM   7007  CD1 LEU B  36      40.180  45.493  61.765  1.00  0.86           C  
ATOM   7008  CD2 LEU B  36      39.537  43.414  60.519  1.00  0.86           C  
ATOM   7009  N   HIS B  37      35.742  45.818  59.532  1.00  0.81           N  
ATOM   7010  CA  HIS B  37      35.438  45.975  58.136  1.00  0.81           C  
ATOM   7011  C   HIS B  37      34.623  47.215  57.811  1.00  0.81           C  
ATOM   7012  O   HIS B  37      34.945  47.930  56.868  1.00  0.81           O  
ATOM   7013  CB  HIS B  37      34.786  44.689  57.601  1.00  0.81           C  
ATOM   7014  CG  HIS B  37      35.730  43.504  57.643  1.00  0.81           C  
ATOM   7015  ND1 HIS B  37      35.624  42.533  58.625  1.00  0.81           N  
ATOM   7016  CD2 HIS B  37      36.727  43.171  56.780  1.00  0.81           C  
ATOM   7017  CE1 HIS B  37      36.546  41.642  58.342  1.00  0.81           C  
ATOM   7018  NE2 HIS B  37      37.245  41.975  57.234  1.00  0.81           N  
ATOM   7019  N   PHE B  38      33.559  47.536  58.571  1.00  0.82           N  
ATOM   7020  CA  PHE B  38      32.663  48.631  58.221  1.00  0.82           C  
ATOM   7021  C   PHE B  38      33.009  49.956  58.904  1.00  0.82           C  
ATOM   7022  O   PHE B  38      33.082  50.999  58.251  1.00  0.82           O  
ATOM   7023  CB  PHE B  38      31.179  48.247  58.487  1.00  0.82           C  
ATOM   7024  CG  PHE B  38      30.747  46.942  57.837  1.00  0.82           C  
ATOM   7025  CD1 PHE B  38      31.292  46.465  56.627  1.00  0.82           C  
ATOM   7026  CD2 PHE B  38      29.731  46.185  58.450  1.00  0.82           C  
ATOM   7027  CE1 PHE B  38      30.866  45.251  56.074  1.00  0.82           C  
ATOM   7028  CE2 PHE B  38      29.291  44.978  57.892  1.00  0.82           C  
ATOM   7029  CZ  PHE B  38      29.865  44.507  56.706  1.00  0.82           C  
ATOM   7030  N   THR B  39      33.261  49.975  60.232  1.00  0.83           N  
ATOM   7031  CA  THR B  39      33.640  51.179  60.990  1.00  0.83           C  
ATOM   7032  C   THR B  39      35.018  51.709  60.610  1.00  0.83           C  
ATOM   7033  O   THR B  39      35.253  52.918  60.453  1.00  0.83           O  
ATOM   7034  CB  THR B  39      33.599  50.961  62.504  1.00  0.83           C  
ATOM   7035  OG1 THR B  39      32.308  50.517  62.885  1.00  0.83           O  
ATOM   7036  CG2 THR B  39      33.867  52.255  63.284  1.00  0.83           C  
ATOM   7037  N   LEU B  40      35.997  50.804  60.442  1.00  0.83           N  
ATOM   7038  CA  LEU B  40      37.365  51.177  60.132  1.00  0.83           C  
ATOM   7039  C   LEU B  40      37.669  51.167  58.639  1.00  0.83           C  
ATOM   7040  O   LEU B  40      38.619  51.822  58.205  1.00  0.83           O  
ATOM   7041  CB  LEU B  40      38.351  50.238  60.858  1.00  0.83           C  
ATOM   7042  CG  LEU B  40      38.674  50.593  62.325  1.00  0.83           C  
ATOM   7043  CD1 LEU B  40      37.471  50.693  63.271  1.00  0.83           C  
ATOM   7044  CD2 LEU B  40      39.630  49.528  62.855  1.00  0.83           C  
ATOM   7045  N   VAL B  41      36.836  50.496  57.813  1.00  0.82           N  
ATOM   7046  CA  VAL B  41      37.000  50.394  56.361  1.00  0.82           C  
ATOM   7047  C   VAL B  41      38.312  49.707  55.994  1.00  0.82           C  
ATOM   7048  O   VAL B  41      39.200  50.276  55.354  1.00  0.82           O  
ATOM   7049  CB  VAL B  41      36.758  51.703  55.603  1.00  0.82           C  
ATOM   7050  CG1 VAL B  41      36.604  51.463  54.088  1.00  0.82           C  
ATOM   7051  CG2 VAL B  41      35.474  52.372  56.131  1.00  0.82           C  
ATOM   7052  N   LYS B  42      38.473  48.468  56.484  1.00  0.80           N  
ATOM   7053  CA  LYS B  42      39.690  47.679  56.444  1.00  0.80           C  
ATOM   7054  C   LYS B  42      39.332  46.227  56.162  1.00  0.80           C  
ATOM   7055  O   LYS B  42      38.163  45.857  56.114  1.00  0.80           O  
ATOM   7056  CB  LYS B  42      40.410  47.712  57.818  1.00  0.80           C  
ATOM   7057  CG  LYS B  42      40.991  49.076  58.213  1.00  0.80           C  
ATOM   7058  CD  LYS B  42      42.324  49.375  57.512  1.00  0.80           C  
ATOM   7059  CE  LYS B  42      42.941  50.705  57.957  1.00  0.80           C  
ATOM   7060  NZ  LYS B  42      44.388  50.553  58.174  1.00  0.80           N  
ATOM   7061  N   ASP B  43      40.344  45.361  55.975  1.00  0.79           N  
ATOM   7062  CA  ASP B  43      40.186  43.926  55.870  1.00  0.79           C  
ATOM   7063  C   ASP B  43      41.328  43.278  56.644  1.00  0.79           C  
ATOM   7064  O   ASP B  43      42.136  43.969  57.255  1.00  0.79           O  
ATOM   7065  CB  ASP B  43      40.054  43.447  54.394  1.00  0.79           C  
ATOM   7066  CG  ASP B  43      41.312  43.589  53.551  1.00  0.79           C  
ATOM   7067  OD1 ASP B  43      42.386  43.934  54.103  1.00  0.79           O  
ATOM   7068  OD2 ASP B  43      41.236  43.253  52.344  1.00  0.79           O  
ATOM   7069  N   ARG B  44      41.456  41.935  56.668  1.00  0.75           N  
ATOM   7070  CA  ARG B  44      42.574  41.329  57.382  1.00  0.75           C  
ATOM   7071  C   ARG B  44      43.910  41.482  56.669  1.00  0.75           C  
ATOM   7072  O   ARG B  44      44.969  41.259  57.251  1.00  0.75           O  
ATOM   7073  CB  ARG B  44      42.342  39.816  57.626  1.00  0.75           C  
ATOM   7074  CG  ARG B  44      42.580  38.905  56.401  1.00  0.75           C  
ATOM   7075  CD  ARG B  44      42.569  37.418  56.745  1.00  0.75           C  
ATOM   7076  NE  ARG B  44      41.168  36.928  56.597  1.00  0.75           N  
ATOM   7077  CZ  ARG B  44      40.712  36.248  55.542  1.00  0.75           C  
ATOM   7078  NH1 ARG B  44      41.440  36.091  54.442  1.00  0.75           N  
ATOM   7079  NH2 ARG B  44      39.512  35.680  55.619  1.00  0.75           N  
ATOM   7080  N   ASN B  45      43.870  41.825  55.369  1.00  0.76           N  
ATOM   7081  CA  ASN B  45      45.024  41.899  54.507  1.00  0.76           C  
ATOM   7082  C   ASN B  45      45.793  43.187  54.770  1.00  0.76           C  
ATOM   7083  O   ASN B  45      47.022  43.204  54.784  1.00  0.76           O  
ATOM   7084  CB  ASN B  45      44.590  41.797  53.018  1.00  0.76           C  
ATOM   7085  CG  ASN B  45      43.679  40.588  52.792  1.00  0.76           C  
ATOM   7086  OD1 ASN B  45      44.002  39.437  53.104  1.00  0.76           O  
ATOM   7087  ND2 ASN B  45      42.475  40.839  52.228  1.00  0.76           N  
ATOM   7088  N   VAL B  46      45.066  44.301  54.998  1.00  0.76           N  
ATOM   7089  CA  VAL B  46      45.668  45.610  55.221  1.00  0.76           C  
ATOM   7090  C   VAL B  46      45.495  46.159  56.645  1.00  0.76           C  
ATOM   7091  O   VAL B  46      46.011  47.227  56.984  1.00  0.76           O  
ATOM   7092  CB  VAL B  46      45.105  46.576  54.176  1.00  0.76           C  
ATOM   7093  CG1 VAL B  46      43.686  47.053  54.547  1.00  0.76           C  
ATOM   7094  CG2 VAL B  46      46.072  47.751  53.934  1.00  0.76           C  
ATOM   7095  N   ALA B  47      44.763  45.468  57.544  1.00  0.84           N  
ATOM   7096  CA  ALA B  47      44.627  45.900  58.929  1.00  0.84           C  
ATOM   7097  C   ALA B  47      45.886  45.817  59.792  1.00  0.84           C  
ATOM   7098  O   ALA B  47      46.595  44.811  59.830  1.00  0.84           O  
ATOM   7099  CB  ALA B  47      43.499  45.149  59.653  1.00  0.84           C  
ATOM   7100  N   THR B  48      46.152  46.892  60.556  1.00  0.82           N  
ATOM   7101  CA  THR B  48      47.251  46.988  61.505  1.00  0.82           C  
ATOM   7102  C   THR B  48      46.875  46.433  62.873  1.00  0.82           C  
ATOM   7103  O   THR B  48      45.715  46.151  63.171  1.00  0.82           O  
ATOM   7104  CB  THR B  48      47.757  48.429  61.680  1.00  0.82           C  
ATOM   7105  OG1 THR B  48      46.782  49.290  62.255  1.00  0.82           O  
ATOM   7106  CG2 THR B  48      48.138  49.012  60.313  1.00  0.82           C  
ATOM   7107  N   THR B  49      47.855  46.289  63.801  1.00  0.83           N  
ATOM   7108  CA  THR B  49      47.586  45.972  65.212  1.00  0.83           C  
ATOM   7109  C   THR B  49      46.681  47.017  65.850  1.00  0.83           C  
ATOM   7110  O   THR B  49      45.779  46.718  66.632  1.00  0.83           O  
ATOM   7111  CB  THR B  49      48.845  45.835  66.069  1.00  0.83           C  
ATOM   7112  OG1 THR B  49      49.748  44.914  65.474  1.00  0.83           O  
ATOM   7113  CG2 THR B  49      48.513  45.284  67.459  1.00  0.83           C  
ATOM   7114  N   ARG B  50      46.870  48.298  65.473  1.00  0.80           N  
ATOM   7115  CA  ARG B  50      46.011  49.389  65.875  1.00  0.80           C  
ATOM   7116  C   ARG B  50      44.581  49.278  65.361  1.00  0.80           C  
ATOM   7117  O   ARG B  50      43.640  49.470  66.129  1.00  0.80           O  
ATOM   7118  CB  ARG B  50      46.644  50.732  65.469  1.00  0.80           C  
ATOM   7119  CG  ARG B  50      45.868  51.967  65.959  1.00  0.80           C  
ATOM   7120  CD  ARG B  50      46.581  53.287  65.659  1.00  0.80           C  
ATOM   7121  NE  ARG B  50      47.750  53.411  66.597  1.00  0.80           N  
ATOM   7122  CZ  ARG B  50      49.015  53.622  66.212  1.00  0.80           C  
ATOM   7123  NH1 ARG B  50      49.423  53.517  64.953  1.00  0.80           N  
ATOM   7124  NH2 ARG B  50      49.911  53.970  67.141  1.00  0.80           N  
ATOM   7125  N   ASP B  51      44.372  48.889  64.084  1.00  0.85           N  
ATOM   7126  CA  ASP B  51      43.050  48.602  63.546  1.00  0.85           C  
ATOM   7127  C   ASP B  51      42.322  47.497  64.329  1.00  0.85           C  
ATOM   7128  O   ASP B  51      41.154  47.618  64.701  1.00  0.85           O  
ATOM   7129  CB  ASP B  51      43.136  48.150  62.064  1.00  0.85           C  
ATOM   7130  CG  ASP B  51      43.499  49.272  61.124  1.00  0.85           C  
ATOM   7131  OD1 ASP B  51      42.842  50.341  61.153  1.00  0.85           O  
ATOM   7132  OD2 ASP B  51      44.372  49.022  60.249  1.00  0.85           O  
ATOM   7133  N   TYR B  52      43.021  46.397  64.667  1.00  0.85           N  
ATOM   7134  CA  TYR B  52      42.483  45.349  65.517  1.00  0.85           C  
ATOM   7135  C   TYR B  52      42.143  45.798  66.945  1.00  0.85           C  
ATOM   7136  O   TYR B  52      41.120  45.396  67.499  1.00  0.85           O  
ATOM   7137  CB  TYR B  52      43.447  44.137  65.569  1.00  0.85           C  
ATOM   7138  CG  TYR B  52      43.677  43.505  64.217  1.00  0.85           C  
ATOM   7139  CD1 TYR B  52      42.611  43.137  63.376  1.00  0.85           C  
ATOM   7140  CD2 TYR B  52      44.988  43.220  63.796  1.00  0.85           C  
ATOM   7141  CE1 TYR B  52      42.855  42.517  62.143  1.00  0.85           C  
ATOM   7142  CE2 TYR B  52      45.235  42.608  62.558  1.00  0.85           C  
ATOM   7143  CZ  TYR B  52      44.164  42.256  61.731  1.00  0.85           C  
ATOM   7144  OH  TYR B  52      44.386  41.641  60.482  1.00  0.85           O  
ATOM   7145  N   TYR B  53      42.963  46.670  67.580  1.00  0.88           N  
ATOM   7146  CA  TYR B  53      42.620  47.282  68.861  1.00  0.88           C  
ATOM   7147  C   TYR B  53      41.334  48.112  68.785  1.00  0.88           C  
ATOM   7148  O   TYR B  53      40.442  47.954  69.616  1.00  0.88           O  
ATOM   7149  CB  TYR B  53      43.812  48.146  69.402  1.00  0.88           C  
ATOM   7150  CG  TYR B  53      43.393  49.139  70.471  1.00  0.88           C  
ATOM   7151  CD1 TYR B  53      42.900  48.696  71.709  1.00  0.88           C  
ATOM   7152  CD2 TYR B  53      43.282  50.503  70.144  1.00  0.88           C  
ATOM   7153  CE1 TYR B  53      42.245  49.587  72.569  1.00  0.88           C  
ATOM   7154  CE2 TYR B  53      42.634  51.398  71.007  1.00  0.88           C  
ATOM   7155  CZ  TYR B  53      42.092  50.927  72.206  1.00  0.88           C  
ATOM   7156  OH  TYR B  53      41.360  51.781  73.046  1.00  0.88           O  
ATOM   7157  N   PHE B  54      41.192  48.993  67.774  1.00  0.88           N  
ATOM   7158  CA  PHE B  54      40.007  49.826  67.621  1.00  0.88           C  
ATOM   7159  C   PHE B  54      38.745  48.995  67.395  1.00  0.88           C  
ATOM   7160  O   PHE B  54      37.706  49.243  67.999  1.00  0.88           O  
ATOM   7161  CB  PHE B  54      40.181  50.872  66.486  1.00  0.88           C  
ATOM   7162  CG  PHE B  54      40.787  52.158  66.992  1.00  0.88           C  
ATOM   7163  CD1 PHE B  54      39.971  53.278  67.234  1.00  0.88           C  
ATOM   7164  CD2 PHE B  54      42.168  52.280  67.207  1.00  0.88           C  
ATOM   7165  CE1 PHE B  54      40.525  54.485  67.680  1.00  0.88           C  
ATOM   7166  CE2 PHE B  54      42.730  53.482  67.652  1.00  0.88           C  
ATOM   7167  CZ  PHE B  54      41.906  54.586  67.888  1.00  0.88           C  
ATOM   7168  N   ALA B  55      38.823  47.925  66.582  1.00  0.91           N  
ATOM   7169  CA  ALA B  55      37.746  46.967  66.408  1.00  0.91           C  
ATOM   7170  C   ALA B  55      37.310  46.234  67.686  1.00  0.91           C  
ATOM   7171  O   ALA B  55      36.119  46.009  67.927  1.00  0.91           O  
ATOM   7172  CB  ALA B  55      38.183  45.940  65.352  1.00  0.91           C  
ATOM   7173  N   LEU B  56      38.265  45.847  68.559  1.00  0.90           N  
ATOM   7174  CA  LEU B  56      37.957  45.355  69.895  1.00  0.90           C  
ATOM   7175  C   LEU B  56      37.356  46.418  70.809  1.00  0.90           C  
ATOM   7176  O   LEU B  56      36.347  46.179  71.473  1.00  0.90           O  
ATOM   7177  CB  LEU B  56      39.214  44.722  70.544  1.00  0.90           C  
ATOM   7178  CG  LEU B  56      39.038  44.137  71.967  1.00  0.90           C  
ATOM   7179  CD1 LEU B  56      37.860  43.157  72.099  1.00  0.90           C  
ATOM   7180  CD2 LEU B  56      40.339  43.456  72.417  1.00  0.90           C  
ATOM   7181  N   ALA B  57      37.921  47.642  70.825  1.00  0.94           N  
ATOM   7182  CA  ALA B  57      37.430  48.746  71.622  1.00  0.94           C  
ATOM   7183  C   ALA B  57      36.001  49.143  71.279  1.00  0.94           C  
ATOM   7184  O   ALA B  57      35.156  49.271  72.162  1.00  0.94           O  
ATOM   7185  CB  ALA B  57      38.371  49.952  71.452  1.00  0.94           C  
ATOM   7186  N   HIS B  58      35.666  49.264  69.979  1.00  0.86           N  
ATOM   7187  CA  HIS B  58      34.303  49.484  69.530  1.00  0.86           C  
ATOM   7188  C   HIS B  58      33.342  48.342  69.867  1.00  0.86           C  
ATOM   7189  O   HIS B  58      32.242  48.593  70.343  1.00  0.86           O  
ATOM   7190  CB  HIS B  58      34.243  49.840  68.029  1.00  0.86           C  
ATOM   7191  CG  HIS B  58      34.677  51.252  67.737  1.00  0.86           C  
ATOM   7192  ND1 HIS B  58      35.874  51.529  67.102  1.00  0.86           N  
ATOM   7193  CD2 HIS B  58      34.035  52.412  68.038  1.00  0.86           C  
ATOM   7194  CE1 HIS B  58      35.939  52.840  67.035  1.00  0.86           C  
ATOM   7195  NE2 HIS B  58      34.851  53.428  67.587  1.00  0.86           N  
ATOM   7196  N   THR B  59      33.746  47.058  69.722  1.00  0.86           N  
ATOM   7197  CA  THR B  59      32.926  45.902  70.131  1.00  0.86           C  
ATOM   7198  C   THR B  59      32.561  45.927  71.612  1.00  0.86           C  
ATOM   7199  O   THR B  59      31.414  45.722  72.009  1.00  0.86           O  
ATOM   7200  CB  THR B  59      33.631  44.564  69.868  1.00  0.86           C  
ATOM   7201  OG1 THR B  59      33.865  44.376  68.480  1.00  0.86           O  
ATOM   7202  CG2 THR B  59      32.803  43.362  70.365  1.00  0.86           C  
ATOM   7203  N   VAL B  60      33.538  46.227  72.489  1.00  0.88           N  
ATOM   7204  CA  VAL B  60      33.316  46.423  73.916  1.00  0.88           C  
ATOM   7205  C   VAL B  60      32.444  47.649  74.191  1.00  0.88           C  
ATOM   7206  O   VAL B  60      31.576  47.650  75.068  1.00  0.88           O  
ATOM   7207  CB  VAL B  60      34.656  46.476  74.646  1.00  0.88           C  
ATOM   7208  CG1 VAL B  60      34.490  46.842  76.131  1.00  0.88           C  
ATOM   7209  CG2 VAL B  60      35.330  45.093  74.534  1.00  0.88           C  
ATOM   7210  N   ARG B  61      32.629  48.729  73.411  1.00  0.83           N  
ATOM   7211  CA  ARG B  61      31.844  49.943  73.490  1.00  0.83           C  
ATOM   7212  C   ARG B  61      30.358  49.784  73.217  1.00  0.83           C  
ATOM   7213  O   ARG B  61      29.548  50.389  73.911  1.00  0.83           O  
ATOM   7214  CB  ARG B  61      32.393  51.040  72.560  1.00  0.83           C  
ATOM   7215  CG  ARG B  61      31.946  52.449  72.978  1.00  0.83           C  
ATOM   7216  CD  ARG B  61      32.391  53.527  71.998  1.00  0.83           C  
ATOM   7217  NE  ARG B  61      31.322  53.724  70.969  1.00  0.83           N  
ATOM   7218  CZ  ARG B  61      31.265  54.832  70.220  1.00  0.83           C  
ATOM   7219  NH1 ARG B  61      32.275  55.701  70.193  1.00  0.83           N  
ATOM   7220  NH2 ARG B  61      30.177  55.090  69.502  1.00  0.83           N  
ATOM   7221  N   ASP B  62      29.937  48.960  72.242  1.00  0.84           N  
ATOM   7222  CA  ASP B  62      28.527  48.708  71.972  1.00  0.84           C  
ATOM   7223  C   ASP B  62      27.790  48.147  73.201  1.00  0.84           C  
ATOM   7224  O   ASP B  62      26.721  48.613  73.603  1.00  0.84           O  
ATOM   7225  CB  ASP B  62      28.399  47.706  70.796  1.00  0.84           C  
ATOM   7226  CG  ASP B  62      28.878  48.281  69.471  1.00  0.84           C  
ATOM   7227  OD1 ASP B  62      29.206  49.491  69.393  1.00  0.84           O  
ATOM   7228  OD2 ASP B  62      28.908  47.487  68.491  1.00  0.84           O  
ATOM   7229  N   HIS B  63      28.426  47.182  73.897  1.00  0.82           N  
ATOM   7230  CA  HIS B  63      27.978  46.640  75.172  1.00  0.82           C  
ATOM   7231  C   HIS B  63      27.921  47.654  76.305  1.00  0.82           C  
ATOM   7232  O   HIS B  63      27.001  47.646  77.125  1.00  0.82           O  
ATOM   7233  CB  HIS B  63      28.903  45.490  75.614  1.00  0.82           C  
ATOM   7234  CG  HIS B  63      28.727  44.286  74.753  1.00  0.82           C  
ATOM   7235  ND1 HIS B  63      27.487  43.683  74.731  1.00  0.82           N  
ATOM   7236  CD2 HIS B  63      29.592  43.627  73.940  1.00  0.82           C  
ATOM   7237  CE1 HIS B  63      27.618  42.661  73.910  1.00  0.82           C  
ATOM   7238  NE2 HIS B  63      28.873  42.581  73.403  1.00  0.82           N  
ATOM   7239  N   LEU B  64      28.924  48.548  76.385  1.00  0.84           N  
ATOM   7240  CA  LEU B  64      28.972  49.672  77.304  1.00  0.84           C  
ATOM   7241  C   LEU B  64      27.867  50.700  77.059  1.00  0.84           C  
ATOM   7242  O   LEU B  64      27.157  51.113  77.976  1.00  0.84           O  
ATOM   7243  CB  LEU B  64      30.371  50.321  77.134  1.00  0.84           C  
ATOM   7244  CG  LEU B  64      30.694  51.564  77.977  1.00  0.84           C  
ATOM   7245  CD1 LEU B  64      30.810  51.240  79.467  1.00  0.84           C  
ATOM   7246  CD2 LEU B  64      32.000  52.204  77.479  1.00  0.84           C  
ATOM   7247  N   VAL B  65      27.663  51.104  75.792  1.00  0.80           N  
ATOM   7248  CA  VAL B  65      26.657  52.067  75.370  1.00  0.80           C  
ATOM   7249  C   VAL B  65      25.233  51.564  75.535  1.00  0.80           C  
ATOM   7250  O   VAL B  65      24.359  52.297  75.994  1.00  0.80           O  
ATOM   7251  CB  VAL B  65      26.916  52.562  73.951  1.00  0.80           C  
ATOM   7252  CG1 VAL B  65      25.771  53.462  73.450  1.00  0.80           C  
ATOM   7253  CG2 VAL B  65      28.223  53.379  73.945  1.00  0.80           C  
ATOM   7254  N   GLY B  66      24.945  50.282  75.221  1.00  0.81           N  
ATOM   7255  CA  GLY B  66      23.616  49.712  75.450  1.00  0.81           C  
ATOM   7256  C   GLY B  66      23.192  49.664  76.903  1.00  0.81           C  
ATOM   7257  O   GLY B  66      22.022  49.839  77.235  1.00  0.81           O  
ATOM   7258  N   ARG B  67      24.155  49.468  77.820  1.00  0.78           N  
ATOM   7259  CA  ARG B  67      23.956  49.642  79.249  1.00  0.78           C  
ATOM   7260  C   ARG B  67      23.758  51.101  79.661  1.00  0.78           C  
ATOM   7261  O   ARG B  67      22.856  51.415  80.431  1.00  0.78           O  
ATOM   7262  CB  ARG B  67      25.133  49.011  80.017  1.00  0.78           C  
ATOM   7263  CG  ARG B  67      25.170  47.475  79.909  1.00  0.78           C  
ATOM   7264  CD  ARG B  67      26.497  46.895  80.389  1.00  0.78           C  
ATOM   7265  NE  ARG B  67      26.350  45.419  80.552  1.00  0.78           N  
ATOM   7266  CZ  ARG B  67      26.482  44.498  79.589  1.00  0.78           C  
ATOM   7267  NH1 ARG B  67      26.642  44.791  78.307  1.00  0.78           N  
ATOM   7268  NH2 ARG B  67      26.427  43.221  79.942  1.00  0.78           N  
ATOM   7269  N   TRP B  68      24.557  52.038  79.100  1.00  0.84           N  
ATOM   7270  CA  TRP B  68      24.460  53.478  79.332  1.00  0.84           C  
ATOM   7271  C   TRP B  68      23.094  54.049  78.969  1.00  0.84           C  
ATOM   7272  O   TRP B  68      22.502  54.815  79.728  1.00  0.84           O  
ATOM   7273  CB  TRP B  68      25.587  54.207  78.543  1.00  0.84           C  
ATOM   7274  CG  TRP B  68      25.649  55.728  78.723  1.00  0.84           C  
ATOM   7275  CD1 TRP B  68      26.234  56.453  79.726  1.00  0.84           C  
ATOM   7276  CD2 TRP B  68      25.007  56.645  77.840  1.00  0.84           C  
ATOM   7277  NE1 TRP B  68      25.985  57.779  79.509  1.00  0.84           N  
ATOM   7278  CE2 TRP B  68      25.249  57.965  78.385  1.00  0.84           C  
ATOM   7279  CE3 TRP B  68      24.259  56.503  76.685  1.00  0.84           C  
ATOM   7280  CZ2 TRP B  68      24.740  59.072  77.752  1.00  0.84           C  
ATOM   7281  CZ3 TRP B  68      23.706  57.635  76.083  1.00  0.84           C  
ATOM   7282  CH2 TRP B  68      23.951  58.919  76.611  1.00  0.84           C  
ATOM   7283  N   ILE B  69      22.527  53.624  77.821  1.00  0.81           N  
ATOM   7284  CA  ILE B  69      21.175  53.966  77.395  1.00  0.81           C  
ATOM   7285  C   ILE B  69      20.136  53.498  78.407  1.00  0.81           C  
ATOM   7286  O   ILE B  69      19.259  54.252  78.822  1.00  0.81           O  
ATOM   7287  CB  ILE B  69      20.892  53.385  76.005  1.00  0.81           C  
ATOM   7288  CG1 ILE B  69      21.757  54.124  74.956  1.00  0.81           C  
ATOM   7289  CG2 ILE B  69      19.390  53.487  75.641  1.00  0.81           C  
ATOM   7290  CD1 ILE B  69      21.814  53.436  73.592  1.00  0.81           C  
ATOM   7291  N   ARG B  70      20.234  52.250  78.905  1.00  0.76           N  
ATOM   7292  CA  ARG B  70      19.348  51.759  79.945  1.00  0.76           C  
ATOM   7293  C   ARG B  70      19.463  52.493  81.275  1.00  0.76           C  
ATOM   7294  O   ARG B  70      18.446  52.838  81.880  1.00  0.76           O  
ATOM   7295  CB  ARG B  70      19.538  50.238  80.141  1.00  0.76           C  
ATOM   7296  CG  ARG B  70      19.035  49.411  78.943  1.00  0.76           C  
ATOM   7297  CD  ARG B  70      17.518  49.505  78.763  1.00  0.76           C  
ATOM   7298  NE  ARG B  70      17.107  48.511  77.725  1.00  0.76           N  
ATOM   7299  CZ  ARG B  70      16.305  48.780  76.690  1.00  0.76           C  
ATOM   7300  NH1 ARG B  70      16.057  50.023  76.282  1.00  0.76           N  
ATOM   7301  NH2 ARG B  70      15.735  47.754  76.065  1.00  0.76           N  
ATOM   7302  N   THR B  71      20.694  52.799  81.730  1.00  0.84           N  
ATOM   7303  CA  THR B  71      20.958  53.596  82.927  1.00  0.84           C  
ATOM   7304  C   THR B  71      20.360  54.987  82.854  1.00  0.84           C  
ATOM   7305  O   THR B  71      19.623  55.416  83.743  1.00  0.84           O  
ATOM   7306  CB  THR B  71      22.450  53.802  83.166  1.00  0.84           C  
ATOM   7307  OG1 THR B  71      23.101  52.572  83.381  1.00  0.84           O  
ATOM   7308  CG2 THR B  71      22.720  54.613  84.433  1.00  0.84           C  
ATOM   7309  N   GLN B  72      20.621  55.736  81.761  1.00  0.81           N  
ATOM   7310  CA  GLN B  72      20.129  57.095  81.609  1.00  0.81           C  
ATOM   7311  C   GLN B  72      18.614  57.176  81.450  1.00  0.81           C  
ATOM   7312  O   GLN B  72      17.974  58.064  82.016  1.00  0.81           O  
ATOM   7313  CB  GLN B  72      20.872  57.882  80.499  1.00  0.81           C  
ATOM   7314  CG  GLN B  72      22.412  57.995  80.694  1.00  0.81           C  
ATOM   7315  CD  GLN B  72      22.860  58.502  82.073  1.00  0.81           C  
ATOM   7316  OE1 GLN B  72      22.454  59.559  82.573  1.00  0.81           O  
ATOM   7317  NE2 GLN B  72      23.762  57.719  82.716  1.00  0.81           N  
ATOM   7318  N   GLN B  73      17.989  56.211  80.737  1.00  0.77           N  
ATOM   7319  CA  GLN B  73      16.540  56.048  80.709  1.00  0.77           C  
ATOM   7320  C   GLN B  73      15.934  55.760  82.091  1.00  0.77           C  
ATOM   7321  O   GLN B  73      14.931  56.358  82.471  1.00  0.77           O  
ATOM   7322  CB  GLN B  73      16.122  54.874  79.785  1.00  0.77           C  
ATOM   7323  CG  GLN B  73      16.272  55.092  78.251  1.00  0.77           C  
ATOM   7324  CD  GLN B  73      15.867  53.852  77.435  1.00  0.77           C  
ATOM   7325  OE1 GLN B  73      15.776  53.817  76.209  1.00  0.77           O  
ATOM   7326  NE2 GLN B  73      15.582  52.730  78.141  1.00  0.77           N  
ATOM   7327  N   HIS B  74      16.547  54.867  82.905  1.00  0.76           N  
ATOM   7328  CA  HIS B  74      16.141  54.600  84.288  1.00  0.76           C  
ATOM   7329  C   HIS B  74      16.238  55.833  85.176  1.00  0.76           C  
ATOM   7330  O   HIS B  74      15.338  56.143  85.955  1.00  0.76           O  
ATOM   7331  CB  HIS B  74      17.014  53.469  84.893  1.00  0.76           C  
ATOM   7332  CG  HIS B  74      16.826  53.160  86.359  1.00  0.76           C  
ATOM   7333  ND1 HIS B  74      15.823  52.309  86.799  1.00  0.76           N  
ATOM   7334  CD2 HIS B  74      17.628  53.508  87.400  1.00  0.76           C  
ATOM   7335  CE1 HIS B  74      16.050  52.151  88.085  1.00  0.76           C  
ATOM   7336  NE2 HIS B  74      17.125  52.857  88.505  1.00  0.76           N  
ATOM   7337  N   TYR B  75      17.326  56.618  85.048  1.00  0.82           N  
ATOM   7338  CA  TYR B  75      17.459  57.897  85.722  1.00  0.82           C  
ATOM   7339  C   TYR B  75      16.427  58.921  85.279  1.00  0.82           C  
ATOM   7340  O   TYR B  75      15.970  59.739  86.071  1.00  0.82           O  
ATOM   7341  CB  TYR B  75      18.862  58.526  85.530  1.00  0.82           C  
ATOM   7342  CG  TYR B  75      19.991  57.739  86.142  1.00  0.82           C  
ATOM   7343  CD1 TYR B  75      19.832  56.775  87.162  1.00  0.82           C  
ATOM   7344  CD2 TYR B  75      21.287  58.026  85.684  1.00  0.82           C  
ATOM   7345  CE1 TYR B  75      20.945  56.094  87.676  1.00  0.82           C  
ATOM   7346  CE2 TYR B  75      22.397  57.358  86.209  1.00  0.82           C  
ATOM   7347  CZ  TYR B  75      22.222  56.379  87.190  1.00  0.82           C  
ATOM   7348  OH  TYR B  75      23.333  55.675  87.683  1.00  0.82           O  
ATOM   7349  N   TYR B  76      16.031  58.953  83.994  1.00  0.81           N  
ATOM   7350  CA  TYR B  76      14.904  59.768  83.568  1.00  0.81           C  
ATOM   7351  C   TYR B  76      13.580  59.302  84.176  1.00  0.81           C  
ATOM   7352  O   TYR B  76      12.802  60.111  84.678  1.00  0.81           O  
ATOM   7353  CB  TYR B  76      14.803  59.810  82.019  1.00  0.81           C  
ATOM   7354  CG  TYR B  76      13.891  60.924  81.571  1.00  0.81           C  
ATOM   7355  CD1 TYR B  76      14.407  62.215  81.374  1.00  0.81           C  
ATOM   7356  CD2 TYR B  76      12.516  60.701  81.368  1.00  0.81           C  
ATOM   7357  CE1 TYR B  76      13.566  63.261  80.973  1.00  0.81           C  
ATOM   7358  CE2 TYR B  76      11.671  61.753  80.988  1.00  0.81           C  
ATOM   7359  CZ  TYR B  76      12.199  63.032  80.789  1.00  0.81           C  
ATOM   7360  OH  TYR B  76      11.359  64.087  80.391  1.00  0.81           O  
ATOM   7361  N   ASP B  77      13.309  57.978  84.177  1.00  0.80           N  
ATOM   7362  CA  ASP B  77      12.088  57.426  84.727  1.00  0.80           C  
ATOM   7363  C   ASP B  77      11.925  57.647  86.231  1.00  0.80           C  
ATOM   7364  O   ASP B  77      10.882  58.120  86.689  1.00  0.80           O  
ATOM   7365  CB  ASP B  77      11.980  55.912  84.395  1.00  0.80           C  
ATOM   7366  CG  ASP B  77      10.626  55.371  84.828  1.00  0.80           C  
ATOM   7367  OD1 ASP B  77       9.603  55.902  84.314  1.00  0.80           O  
ATOM   7368  OD2 ASP B  77      10.599  54.523  85.753  1.00  0.80           O  
ATOM   7369  N   LYS B  78      12.956  57.348  87.036  1.00  0.78           N  
ATOM   7370  CA  LYS B  78      12.818  57.407  88.478  1.00  0.78           C  
ATOM   7371  C   LYS B  78      13.111  58.776  89.032  1.00  0.78           C  
ATOM   7372  O   LYS B  78      12.777  59.073  90.174  1.00  0.78           O  
ATOM   7373  CB  LYS B  78      13.771  56.380  89.135  1.00  0.78           C  
ATOM   7374  CG  LYS B  78      13.528  54.930  88.678  1.00  0.78           C  
ATOM   7375  CD  LYS B  78      12.070  54.474  88.862  1.00  0.78           C  
ATOM   7376  CE  LYS B  78      11.787  53.053  88.375  1.00  0.78           C  
ATOM   7377  NZ  LYS B  78      12.537  52.091  89.206  1.00  0.78           N  
ATOM   7378  N   CYS B  79      13.729  59.640  88.210  1.00  0.83           N  
ATOM   7379  CA  CYS B  79      14.103  61.001  88.547  1.00  0.83           C  
ATOM   7380  C   CYS B  79      14.842  61.202  89.884  1.00  0.83           C  
ATOM   7381  O   CYS B  79      14.394  61.984  90.724  1.00  0.83           O  
ATOM   7382  CB  CYS B  79      12.881  61.940  88.389  1.00  0.83           C  
ATOM   7383  SG  CYS B  79      13.367  63.626  87.886  1.00  0.83           S  
ATOM   7384  N   PRO B  80      15.956  60.517  90.156  1.00  0.89           N  
ATOM   7385  CA  PRO B  80      16.683  60.690  91.400  1.00  0.89           C  
ATOM   7386  C   PRO B  80      17.470  61.983  91.414  1.00  0.89           C  
ATOM   7387  O   PRO B  80      17.731  62.579  90.366  1.00  0.89           O  
ATOM   7388  CB  PRO B  80      17.647  59.492  91.387  1.00  0.89           C  
ATOM   7389  CG  PRO B  80      18.017  59.352  89.909  1.00  0.89           C  
ATOM   7390  CD  PRO B  80      16.703  59.689  89.204  1.00  0.89           C  
ATOM   7391  N   LYS B  81      17.900  62.410  92.614  1.00  0.88           N  
ATOM   7392  CA  LYS B  81      18.873  63.465  92.766  1.00  0.88           C  
ATOM   7393  C   LYS B  81      20.205  63.142  92.088  1.00  0.88           C  
ATOM   7394  O   LYS B  81      20.748  62.045  92.220  1.00  0.88           O  
ATOM   7395  CB  LYS B  81      19.083  63.761  94.270  1.00  0.88           C  
ATOM   7396  CG  LYS B  81      20.019  64.945  94.525  1.00  0.88           C  
ATOM   7397  CD  LYS B  81      20.056  65.414  95.982  1.00  0.88           C  
ATOM   7398  CE  LYS B  81      20.859  66.709  96.076  1.00  0.88           C  
ATOM   7399  NZ  LYS B  81      20.905  67.219  97.455  1.00  0.88           N  
ATOM   7400  N   ARG B  82      20.755  64.105  91.324  1.00  0.87           N  
ATOM   7401  CA  ARG B  82      21.901  63.870  90.475  1.00  0.87           C  
ATOM   7402  C   ARG B  82      23.144  64.544  91.020  1.00  0.87           C  
ATOM   7403  O   ARG B  82      23.129  65.701  91.441  1.00  0.87           O  
ATOM   7404  CB  ARG B  82      21.632  64.362  89.031  1.00  0.87           C  
ATOM   7405  CG  ARG B  82      20.439  63.642  88.371  1.00  0.87           C  
ATOM   7406  CD  ARG B  82      20.152  64.107  86.942  1.00  0.87           C  
ATOM   7407  NE  ARG B  82      18.779  63.622  86.608  1.00  0.87           N  
ATOM   7408  CZ  ARG B  82      18.467  62.672  85.719  1.00  0.87           C  
ATOM   7409  NH1 ARG B  82      19.365  62.069  84.948  1.00  0.87           N  
ATOM   7410  NH2 ARG B  82      17.187  62.313  85.642  1.00  0.87           N  
ATOM   7411  N   VAL B  83      24.267  63.804  91.027  1.00  0.95           N  
ATOM   7412  CA  VAL B  83      25.525  64.266  91.586  1.00  0.95           C  
ATOM   7413  C   VAL B  83      26.453  64.691  90.473  1.00  0.95           C  
ATOM   7414  O   VAL B  83      26.835  63.914  89.603  1.00  0.95           O  
ATOM   7415  CB  VAL B  83      26.233  63.203  92.419  1.00  0.95           C  
ATOM   7416  CG1 VAL B  83      27.518  63.779  93.051  1.00  0.95           C  
ATOM   7417  CG2 VAL B  83      25.291  62.694  93.526  1.00  0.95           C  
ATOM   7418  N   TYR B  84      26.869  65.959  90.476  1.00  0.95           N  
ATOM   7419  CA  TYR B  84      27.735  66.492  89.454  1.00  0.95           C  
ATOM   7420  C   TYR B  84      29.100  66.741  90.051  1.00  0.95           C  
ATOM   7421  O   TYR B  84      29.291  67.595  90.915  1.00  0.95           O  
ATOM   7422  CB  TYR B  84      27.154  67.804  88.891  1.00  0.95           C  
ATOM   7423  CG  TYR B  84      25.859  67.507  88.189  1.00  0.95           C  
ATOM   7424  CD1 TYR B  84      25.885  66.967  86.902  1.00  0.95           C  
ATOM   7425  CD2 TYR B  84      24.617  67.733  88.799  1.00  0.95           C  
ATOM   7426  CE1 TYR B  84      24.699  66.678  86.214  1.00  0.95           C  
ATOM   7427  CE2 TYR B  84      23.421  67.478  88.107  1.00  0.95           C  
ATOM   7428  CZ  TYR B  84      23.464  66.974  86.798  1.00  0.95           C  
ATOM   7429  OH  TYR B  84      22.275  66.815  86.050  1.00  0.95           O  
ATOM   7430  N   TYR B  85      30.107  65.973  89.605  1.00  0.96           N  
ATOM   7431  CA  TYR B  85      31.454  66.098  90.114  1.00  0.96           C  
ATOM   7432  C   TYR B  85      32.248  67.042  89.232  1.00  0.96           C  
ATOM   7433  O   TYR B  85      32.631  66.713  88.108  1.00  0.96           O  
ATOM   7434  CB  TYR B  85      32.132  64.707  90.193  1.00  0.96           C  
ATOM   7435  CG  TYR B  85      33.285  64.714  91.162  1.00  0.96           C  
ATOM   7436  CD1 TYR B  85      33.040  64.476  92.524  1.00  0.96           C  
ATOM   7437  CD2 TYR B  85      34.604  64.953  90.737  1.00  0.96           C  
ATOM   7438  CE1 TYR B  85      34.094  64.464  93.444  1.00  0.96           C  
ATOM   7439  CE2 TYR B  85      35.660  64.950  91.664  1.00  0.96           C  
ATOM   7440  CZ  TYR B  85      35.404  64.697  93.017  1.00  0.96           C  
ATOM   7441  OH  TYR B  85      36.434  64.652  93.978  1.00  0.96           O  
ATOM   7442  N   LEU B  86      32.512  68.258  89.742  1.00  0.96           N  
ATOM   7443  CA  LEU B  86      33.228  69.281  89.014  1.00  0.96           C  
ATOM   7444  C   LEU B  86      34.701  69.154  89.314  1.00  0.96           C  
ATOM   7445  O   LEU B  86      35.141  69.316  90.451  1.00  0.96           O  
ATOM   7446  CB  LEU B  86      32.760  70.708  89.425  1.00  0.96           C  
ATOM   7447  CG  LEU B  86      31.908  71.461  88.388  1.00  0.96           C  
ATOM   7448  CD1 LEU B  86      32.729  71.865  87.155  1.00  0.96           C  
ATOM   7449  CD2 LEU B  86      30.685  70.638  87.987  1.00  0.96           C  
ATOM   7450  N   SER B  87      35.513  68.873  88.285  1.00  0.96           N  
ATOM   7451  CA  SER B  87      36.942  68.728  88.466  1.00  0.96           C  
ATOM   7452  C   SER B  87      37.630  69.232  87.229  1.00  0.96           C  
ATOM   7453  O   SER B  87      37.159  69.062  86.109  1.00  0.96           O  
ATOM   7454  CB  SER B  87      37.380  67.256  88.689  1.00  0.96           C  
ATOM   7455  OG  SER B  87      38.767  67.153  89.029  1.00  0.96           O  
ATOM   7456  N   LEU B  88      38.809  69.849  87.393  1.00  0.94           N  
ATOM   7457  CA  LEU B  88      39.588  70.325  86.266  1.00  0.94           C  
ATOM   7458  C   LEU B  88      40.565  69.243  85.835  1.00  0.94           C  
ATOM   7459  O   LEU B  88      41.329  69.416  84.888  1.00  0.94           O  
ATOM   7460  CB  LEU B  88      40.370  71.603  86.669  1.00  0.94           C  
ATOM   7461  CG  LEU B  88      39.681  72.938  86.313  1.00  0.94           C  
ATOM   7462  CD1 LEU B  88      39.768  73.221  84.808  1.00  0.94           C  
ATOM   7463  CD2 LEU B  88      38.232  73.036  86.816  1.00  0.94           C  
ATOM   7464  N   GLU B  89      40.523  68.081  86.508  1.00  0.91           N  
ATOM   7465  CA  GLU B  89      41.421  66.980  86.268  1.00  0.91           C  
ATOM   7466  C   GLU B  89      40.679  65.646  86.394  1.00  0.91           C  
ATOM   7467  O   GLU B  89      39.966  65.408  87.370  1.00  0.91           O  
ATOM   7468  CB  GLU B  89      42.573  67.041  87.311  1.00  0.91           C  
ATOM   7469  CG  GLU B  89      43.800  66.213  86.881  1.00  0.91           C  
ATOM   7470  CD  GLU B  89      44.856  65.939  87.945  1.00  0.91           C  
ATOM   7471  OE1 GLU B  89      45.525  66.860  88.454  1.00  0.91           O  
ATOM   7472  OE2 GLU B  89      45.073  64.718  88.186  1.00  0.91           O  
ATOM   7473  N   PHE B  90      40.830  64.732  85.411  1.00  0.92           N  
ATOM   7474  CA  PHE B  90      40.286  63.378  85.457  1.00  0.92           C  
ATOM   7475  C   PHE B  90      41.330  62.391  84.963  1.00  0.92           C  
ATOM   7476  O   PHE B  90      41.492  62.160  83.767  1.00  0.92           O  
ATOM   7477  CB  PHE B  90      39.037  63.202  84.549  1.00  0.92           C  
ATOM   7478  CG  PHE B  90      37.816  63.752  85.220  1.00  0.92           C  
ATOM   7479  CD1 PHE B  90      37.350  65.039  84.920  1.00  0.92           C  
ATOM   7480  CD2 PHE B  90      37.127  62.977  86.168  1.00  0.92           C  
ATOM   7481  CE1 PHE B  90      36.220  65.548  85.568  1.00  0.92           C  
ATOM   7482  CE2 PHE B  90      35.997  63.489  86.821  1.00  0.92           C  
ATOM   7483  CZ  PHE B  90      35.542  64.777  86.520  1.00  0.92           C  
ATOM   7484  N   TYR B  91      42.070  61.726  85.871  1.00  0.91           N  
ATOM   7485  CA  TYR B  91      43.197  60.884  85.501  1.00  0.91           C  
ATOM   7486  C   TYR B  91      42.738  59.457  85.263  1.00  0.91           C  
ATOM   7487  O   TYR B  91      42.995  58.527  86.029  1.00  0.91           O  
ATOM   7488  CB  TYR B  91      44.316  60.978  86.577  1.00  0.91           C  
ATOM   7489  CG  TYR B  91      45.740  60.781  86.102  1.00  0.91           C  
ATOM   7490  CD1 TYR B  91      46.156  60.824  84.754  1.00  0.91           C  
ATOM   7491  CD2 TYR B  91      46.728  60.661  87.095  1.00  0.91           C  
ATOM   7492  CE1 TYR B  91      47.520  60.809  84.426  1.00  0.91           C  
ATOM   7493  CE2 TYR B  91      48.089  60.647  86.770  1.00  0.91           C  
ATOM   7494  CZ  TYR B  91      48.482  60.753  85.436  1.00  0.91           C  
ATOM   7495  OH  TYR B  91      49.848  60.871  85.131  1.00  0.91           O  
ATOM   7496  N   MET B  92      41.978  59.275  84.173  1.00  0.91           N  
ATOM   7497  CA  MET B  92      41.320  58.035  83.820  1.00  0.91           C  
ATOM   7498  C   MET B  92      42.256  56.871  83.549  1.00  0.91           C  
ATOM   7499  O   MET B  92      42.035  55.773  84.063  1.00  0.91           O  
ATOM   7500  CB  MET B  92      40.394  58.256  82.599  1.00  0.91           C  
ATOM   7501  CG  MET B  92      39.303  59.317  82.847  1.00  0.91           C  
ATOM   7502  SD  MET B  92      38.200  58.952  84.250  1.00  0.91           S  
ATOM   7503  CE  MET B  92      37.183  57.712  83.395  1.00  0.91           C  
ATOM   7504  N   GLY B  93      43.345  57.106  82.786  1.00  0.94           N  
ATOM   7505  CA  GLY B  93      44.202  56.045  82.268  1.00  0.94           C  
ATOM   7506  C   GLY B  93      43.622  55.432  81.028  1.00  0.94           C  
ATOM   7507  O   GLY B  93      43.010  56.116  80.212  1.00  0.94           O  
ATOM   7508  N   ARG B  94      43.829  54.121  80.852  1.00  0.88           N  
ATOM   7509  CA  ARG B  94      43.228  53.343  79.785  1.00  0.88           C  
ATOM   7510  C   ARG B  94      41.832  52.837  80.142  1.00  0.88           C  
ATOM   7511  O   ARG B  94      41.458  52.765  81.315  1.00  0.88           O  
ATOM   7512  CB  ARG B  94      44.083  52.098  79.511  1.00  0.88           C  
ATOM   7513  CG  ARG B  94      45.470  52.388  78.922  1.00  0.88           C  
ATOM   7514  CD  ARG B  94      46.149  51.058  78.606  1.00  0.88           C  
ATOM   7515  NE  ARG B  94      47.461  51.337  77.961  1.00  0.88           N  
ATOM   7516  CZ  ARG B  94      48.468  50.458  77.938  1.00  0.88           C  
ATOM   7517  NH1 ARG B  94      48.372  49.313  78.607  1.00  0.88           N  
ATOM   7518  NH2 ARG B  94      49.565  50.722  77.234  1.00  0.88           N  
ATOM   7519  N   THR B  95      41.033  52.424  79.144  1.00  0.95           N  
ATOM   7520  CA  THR B  95      39.632  52.071  79.360  1.00  0.95           C  
ATOM   7521  C   THR B  95      39.317  50.624  78.997  1.00  0.95           C  
ATOM   7522  O   THR B  95      38.441  50.022  79.619  1.00  0.95           O  
ATOM   7523  CB  THR B  95      38.731  52.988  78.534  1.00  0.95           C  
ATOM   7524  OG1 THR B  95      38.876  54.338  78.956  1.00  0.95           O  
ATOM   7525  CG2 THR B  95      37.236  52.657  78.653  1.00  0.95           C  
ATOM   7526  N   LEU B  96      40.016  49.987  78.023  1.00  0.93           N  
ATOM   7527  CA  LEU B  96      39.599  48.709  77.424  1.00  0.93           C  
ATOM   7528  C   LEU B  96      39.384  47.542  78.396  1.00  0.93           C  
ATOM   7529  O   LEU B  96      38.273  47.027  78.546  1.00  0.93           O  
ATOM   7530  CB  LEU B  96      40.625  48.317  76.311  1.00  0.93           C  
ATOM   7531  CG  LEU B  96      40.257  47.241  75.249  1.00  0.93           C  
ATOM   7532  CD1 LEU B  96      41.187  46.019  75.335  1.00  0.93           C  
ATOM   7533  CD2 LEU B  96      38.787  46.804  75.240  1.00  0.93           C  
ATOM   7534  N   GLN B  97      40.421  47.134  79.154  1.00  0.90           N  
ATOM   7535  CA  GLN B  97      40.302  46.052  80.120  1.00  0.90           C  
ATOM   7536  C   GLN B  97      39.452  46.400  81.336  1.00  0.90           C  
ATOM   7537  O   GLN B  97      38.747  45.557  81.884  1.00  0.90           O  
ATOM   7538  CB  GLN B  97      41.676  45.548  80.594  1.00  0.90           C  
ATOM   7539  CG  GLN B  97      42.512  44.808  79.533  1.00  0.90           C  
ATOM   7540  CD  GLN B  97      41.997  43.408  79.181  1.00  0.90           C  
ATOM   7541  OE1 GLN B  97      40.938  42.972  79.638  1.00  0.90           O  
ATOM   7542  NE2 GLN B  97      42.779  42.670  78.363  1.00  0.90           N  
ATOM   7543  N   ASN B  98      39.476  47.671  81.792  1.00  0.92           N  
ATOM   7544  CA  ASN B  98      38.671  48.142  82.911  1.00  0.92           C  
ATOM   7545  C   ASN B  98      37.174  48.025  82.617  1.00  0.92           C  
ATOM   7546  O   ASN B  98      36.402  47.524  83.432  1.00  0.92           O  
ATOM   7547  CB  ASN B  98      39.104  49.600  83.246  1.00  0.92           C  
ATOM   7548  CG  ASN B  98      38.518  50.209  84.521  1.00  0.92           C  
ATOM   7549  OD1 ASN B  98      38.213  51.401  84.546  1.00  0.92           O  
ATOM   7550  ND2 ASN B  98      38.434  49.439  85.624  1.00  0.92           N  
ATOM   7551  N   THR B  99      36.754  48.408  81.396  1.00  0.94           N  
ATOM   7552  CA  THR B  99      35.410  48.160  80.882  1.00  0.94           C  
ATOM   7553  C   THR B  99      35.101  46.679  80.741  1.00  0.94           C  
ATOM   7554  O   THR B  99      34.043  46.212  81.151  1.00  0.94           O  
ATOM   7555  CB  THR B  99      35.175  48.849  79.545  1.00  0.94           C  
ATOM   7556  OG1 THR B  99      35.278  50.253  79.723  1.00  0.94           O  
ATOM   7557  CG2 THR B  99      33.757  48.600  79.021  1.00  0.94           C  
ATOM   7558  N   MET B 100      36.031  45.860  80.209  1.00  0.90           N  
ATOM   7559  CA  MET B 100      35.858  44.414  80.135  1.00  0.90           C  
ATOM   7560  C   MET B 100      35.671  43.721  81.486  1.00  0.90           C  
ATOM   7561  O   MET B 100      34.839  42.827  81.600  1.00  0.90           O  
ATOM   7562  CB  MET B 100      37.001  43.747  79.329  1.00  0.90           C  
ATOM   7563  CG  MET B 100      36.713  43.710  77.813  1.00  0.90           C  
ATOM   7564  SD  MET B 100      38.171  43.506  76.738  1.00  0.90           S  
ATOM   7565  CE  MET B 100      38.817  41.963  77.426  1.00  0.90           C  
ATOM   7566  N   ILE B 101      36.400  44.108  82.551  1.00  0.90           N  
ATOM   7567  CA  ILE B 101      36.121  43.631  83.905  1.00  0.90           C  
ATOM   7568  C   ILE B 101      34.797  44.126  84.462  1.00  0.90           C  
ATOM   7569  O   ILE B 101      33.982  43.330  84.923  1.00  0.90           O  
ATOM   7570  CB  ILE B 101      37.270  43.965  84.856  1.00  0.90           C  
ATOM   7571  CG1 ILE B 101      38.470  43.076  84.462  1.00  0.90           C  
ATOM   7572  CG2 ILE B 101      36.881  43.760  86.343  1.00  0.90           C  
ATOM   7573  CD1 ILE B 101      39.682  43.224  85.379  1.00  0.90           C  
ATOM   7574  N   ASN B 102      34.498  45.441  84.384  1.00  0.91           N  
ATOM   7575  CA  ASN B 102      33.303  45.989  85.012  1.00  0.91           C  
ATOM   7576  C   ASN B 102      32.011  45.535  84.329  1.00  0.91           C  
ATOM   7577  O   ASN B 102      30.966  45.443  84.970  1.00  0.91           O  
ATOM   7578  CB  ASN B 102      33.368  47.540  85.133  1.00  0.91           C  
ATOM   7579  CG  ASN B 102      34.342  47.971  86.237  1.00  0.91           C  
ATOM   7580  OD1 ASN B 102      35.157  47.195  86.741  1.00  0.91           O  
ATOM   7581  ND2 ASN B 102      34.236  49.253  86.661  1.00  0.91           N  
ATOM   7582  N   LEU B 103      32.064  45.177  83.028  1.00  0.88           N  
ATOM   7583  CA  LEU B 103      30.925  44.609  82.329  1.00  0.88           C  
ATOM   7584  C   LEU B 103      30.944  43.083  82.264  1.00  0.88           C  
ATOM   7585  O   LEU B 103      30.010  42.483  81.742  1.00  0.88           O  
ATOM   7586  CB  LEU B 103      30.863  45.115  80.865  1.00  0.88           C  
ATOM   7587  CG  LEU B 103      30.863  46.643  80.662  1.00  0.88           C  
ATOM   7588  CD1 LEU B 103      30.585  46.950  79.185  1.00  0.88           C  
ATOM   7589  CD2 LEU B 103      29.868  47.373  81.570  1.00  0.88           C  
ATOM   7590  N   GLY B 104      31.985  42.403  82.797  1.00  0.88           N  
ATOM   7591  CA  GLY B 104      32.045  40.937  82.825  1.00  0.88           C  
ATOM   7592  C   GLY B 104      32.480  40.263  81.547  1.00  0.88           C  
ATOM   7593  O   GLY B 104      32.416  39.045  81.411  1.00  0.88           O  
ATOM   7594  N   LEU B 105      32.963  41.028  80.562  1.00  0.85           N  
ATOM   7595  CA  LEU B 105      33.165  40.548  79.210  1.00  0.85           C  
ATOM   7596  C   LEU B 105      34.534  39.947  78.964  1.00  0.85           C  
ATOM   7597  O   LEU B 105      34.792  39.400  77.893  1.00  0.85           O  
ATOM   7598  CB  LEU B 105      33.054  41.739  78.228  1.00  0.85           C  
ATOM   7599  CG  LEU B 105      31.665  42.393  78.156  1.00  0.85           C  
ATOM   7600  CD1 LEU B 105      31.739  43.699  77.354  1.00  0.85           C  
ATOM   7601  CD2 LEU B 105      30.630  41.448  77.535  1.00  0.85           C  
ATOM   7602  N   GLN B 106      35.457  40.016  79.946  1.00  0.82           N  
ATOM   7603  CA  GLN B 106      36.858  39.680  79.744  1.00  0.82           C  
ATOM   7604  C   GLN B 106      37.105  38.260  79.250  1.00  0.82           C  
ATOM   7605  O   GLN B 106      37.802  38.047  78.266  1.00  0.82           O  
ATOM   7606  CB  GLN B 106      37.654  39.969  81.040  1.00  0.82           C  
ATOM   7607  CG  GLN B 106      39.192  39.922  80.870  1.00  0.82           C  
ATOM   7608  CD  GLN B 106      39.888  40.409  82.143  1.00  0.82           C  
ATOM   7609  OE1 GLN B 106      39.725  39.834  83.219  1.00  0.82           O  
ATOM   7610  NE2 GLN B 106      40.661  41.512  82.035  1.00  0.82           N  
ATOM   7611  N   ASN B 107      36.447  37.256  79.862  1.00  0.78           N  
ATOM   7612  CA  ASN B 107      36.561  35.864  79.460  1.00  0.78           C  
ATOM   7613  C   ASN B 107      36.067  35.573  78.036  1.00  0.78           C  
ATOM   7614  O   ASN B 107      36.721  34.881  77.260  1.00  0.78           O  
ATOM   7615  CB  ASN B 107      35.781  35.018  80.505  1.00  0.78           C  
ATOM   7616  CG  ASN B 107      36.003  33.515  80.363  1.00  0.78           C  
ATOM   7617  OD1 ASN B 107      35.063  32.757  80.136  1.00  0.78           O  
ATOM   7618  ND2 ASN B 107      37.266  33.064  80.527  1.00  0.78           N  
ATOM   7619  N   ALA B 108      34.898  36.124  77.653  1.00  0.83           N  
ATOM   7620  CA  ALA B 108      34.332  35.947  76.333  1.00  0.83           C  
ATOM   7621  C   ALA B 108      35.142  36.643  75.244  1.00  0.83           C  
ATOM   7622  O   ALA B 108      35.387  36.089  74.173  1.00  0.83           O  
ATOM   7623  CB  ALA B 108      32.868  36.425  76.352  1.00  0.83           C  
ATOM   7624  N   CYS B 109      35.616  37.878  75.508  1.00  0.84           N  
ATOM   7625  CA  CYS B 109      36.491  38.600  74.597  1.00  0.84           C  
ATOM   7626  C   CYS B 109      37.821  37.916  74.362  1.00  0.84           C  
ATOM   7627  O   CYS B 109      38.269  37.851  73.222  1.00  0.84           O  
ATOM   7628  CB  CYS B 109      36.768  40.042  75.064  1.00  0.84           C  
ATOM   7629  SG  CYS B 109      35.284  41.091  74.924  1.00  0.84           S  
ATOM   7630  N   ASP B 110      38.465  37.360  75.410  1.00  0.83           N  
ATOM   7631  CA  ASP B 110      39.710  36.617  75.292  1.00  0.83           C  
ATOM   7632  C   ASP B 110      39.621  35.452  74.306  1.00  0.83           C  
ATOM   7633  O   ASP B 110      40.398  35.352  73.356  1.00  0.83           O  
ATOM   7634  CB  ASP B 110      40.064  36.049  76.693  1.00  0.83           C  
ATOM   7635  CG  ASP B 110      41.278  36.744  77.274  1.00  0.83           C  
ATOM   7636  OD1 ASP B 110      41.222  37.986  77.450  1.00  0.83           O  
ATOM   7637  OD2 ASP B 110      42.269  36.025  77.553  1.00  0.83           O  
ATOM   7638  N   GLU B 111      38.592  34.595  74.464  1.00  0.81           N  
ATOM   7639  CA  GLU B 111      38.296  33.505  73.552  1.00  0.81           C  
ATOM   7640  C   GLU B 111      37.946  33.977  72.145  1.00  0.81           C  
ATOM   7641  O   GLU B 111      38.453  33.477  71.140  1.00  0.81           O  
ATOM   7642  CB  GLU B 111      37.148  32.659  74.156  1.00  0.81           C  
ATOM   7643  CG  GLU B 111      36.584  31.527  73.258  1.00  0.81           C  
ATOM   7644  CD  GLU B 111      37.593  30.465  72.819  1.00  0.81           C  
ATOM   7645  OE1 GLU B 111      38.759  30.468  73.275  1.00  0.81           O  
ATOM   7646  OE2 GLU B 111      37.168  29.631  71.974  1.00  0.81           O  
ATOM   7647  N   ALA B 112      37.107  35.026  72.017  1.00  0.86           N  
ATOM   7648  CA  ALA B 112      36.766  35.594  70.729  1.00  0.86           C  
ATOM   7649  C   ALA B 112      37.968  36.133  69.957  1.00  0.86           C  
ATOM   7650  O   ALA B 112      38.153  35.820  68.784  1.00  0.86           O  
ATOM   7651  CB  ALA B 112      35.715  36.706  70.925  1.00  0.86           C  
ATOM   7652  N   ILE B 113      38.853  36.900  70.619  1.00  0.83           N  
ATOM   7653  CA  ILE B 113      40.096  37.405  70.050  1.00  0.83           C  
ATOM   7654  C   ILE B 113      41.093  36.298  69.724  1.00  0.83           C  
ATOM   7655  O   ILE B 113      41.737  36.314  68.671  1.00  0.83           O  
ATOM   7656  CB  ILE B 113      40.682  38.490  70.951  1.00  0.83           C  
ATOM   7657  CG1 ILE B 113      39.744  39.725  71.005  1.00  0.83           C  
ATOM   7658  CG2 ILE B 113      42.097  38.925  70.521  1.00  0.83           C  
ATOM   7659  CD1 ILE B 113      39.598  40.498  69.685  1.00  0.83           C  
ATOM   7660  N   TYR B 114      41.206  35.261  70.582  1.00  0.83           N  
ATOM   7661  CA  TYR B 114      42.020  34.082  70.323  1.00  0.83           C  
ATOM   7662  C   TYR B 114      41.586  33.312  69.069  1.00  0.83           C  
ATOM   7663  O   TYR B 114      42.409  32.911  68.239  1.00  0.83           O  
ATOM   7664  CB  TYR B 114      41.992  33.134  71.557  1.00  0.83           C  
ATOM   7665  CG  TYR B 114      43.024  32.043  71.417  1.00  0.83           C  
ATOM   7666  CD1 TYR B 114      44.368  32.285  71.745  1.00  0.83           C  
ATOM   7667  CD2 TYR B 114      42.673  30.806  70.850  1.00  0.83           C  
ATOM   7668  CE1 TYR B 114      45.354  31.327  71.465  1.00  0.83           C  
ATOM   7669  CE2 TYR B 114      43.657  29.852  70.557  1.00  0.83           C  
ATOM   7670  CZ  TYR B 114      44.995  30.115  70.865  1.00  0.83           C  
ATOM   7671  OH  TYR B 114      45.980  29.170  70.515  1.00  0.83           O  
ATOM   7672  N   GLN B 115      40.264  33.127  68.870  1.00  0.80           N  
ATOM   7673  CA  GLN B 115      39.717  32.492  67.685  1.00  0.80           C  
ATOM   7674  C   GLN B 115      39.909  33.312  66.415  1.00  0.80           C  
ATOM   7675  O   GLN B 115      39.881  32.766  65.316  1.00  0.80           O  
ATOM   7676  CB  GLN B 115      38.200  32.222  67.826  1.00  0.80           C  
ATOM   7677  CG  GLN B 115      37.817  31.108  68.830  1.00  0.80           C  
ATOM   7678  CD  GLN B 115      36.317  30.817  68.746  1.00  0.80           C  
ATOM   7679  OE1 GLN B 115      35.679  31.067  67.714  1.00  0.80           O  
ATOM   7680  NE2 GLN B 115      35.719  30.280  69.824  1.00  0.80           N  
ATOM   7681  N   LEU B 116      40.148  34.632  66.531  1.00  0.82           N  
ATOM   7682  CA  LEU B 116      40.422  35.503  65.402  1.00  0.82           C  
ATOM   7683  C   LEU B 116      41.920  35.583  65.117  1.00  0.82           C  
ATOM   7684  O   LEU B 116      42.366  36.298  64.223  1.00  0.82           O  
ATOM   7685  CB  LEU B 116      39.901  36.933  65.698  1.00  0.82           C  
ATOM   7686  CG  LEU B 116      38.365  37.062  65.811  1.00  0.82           C  
ATOM   7687  CD1 LEU B 116      38.002  38.381  66.502  1.00  0.82           C  
ATOM   7688  CD2 LEU B 116      37.646  36.959  64.459  1.00  0.82           C  
ATOM   7689  N   GLY B 117      42.758  34.815  65.850  1.00  0.81           N  
ATOM   7690  CA  GLY B 117      44.178  34.687  65.535  1.00  0.81           C  
ATOM   7691  C   GLY B 117      45.022  35.842  65.985  1.00  0.81           C  
ATOM   7692  O   GLY B 117      46.094  36.098  65.432  1.00  0.81           O  
ATOM   7693  N   LEU B 118      44.550  36.585  66.989  1.00  0.80           N  
ATOM   7694  CA  LEU B 118      45.186  37.784  67.483  1.00  0.80           C  
ATOM   7695  C   LEU B 118      45.636  37.567  68.914  1.00  0.80           C  
ATOM   7696  O   LEU B 118      45.077  36.739  69.628  1.00  0.80           O  
ATOM   7697  CB  LEU B 118      44.172  38.948  67.469  1.00  0.80           C  
ATOM   7698  CG  LEU B 118      43.673  39.356  66.072  1.00  0.80           C  
ATOM   7699  CD1 LEU B 118      42.454  40.275  66.189  1.00  0.80           C  
ATOM   7700  CD2 LEU B 118      44.763  40.054  65.256  1.00  0.80           C  
ATOM   7701  N   ASP B 119      46.661  38.314  69.376  1.00  0.78           N  
ATOM   7702  CA  ASP B 119      47.013  38.342  70.783  1.00  0.78           C  
ATOM   7703  C   ASP B 119      46.292  39.507  71.446  1.00  0.78           C  
ATOM   7704  O   ASP B 119      46.422  40.656  71.035  1.00  0.78           O  
ATOM   7705  CB  ASP B 119      48.542  38.483  70.988  1.00  0.78           C  
ATOM   7706  CG  ASP B 119      48.857  38.630  72.470  1.00  0.78           C  
ATOM   7707  OD1 ASP B 119      48.267  37.863  73.268  1.00  0.78           O  
ATOM   7708  OD2 ASP B 119      49.578  39.590  72.820  1.00  0.78           O  
ATOM   7709  N   ILE B 120      45.517  39.237  72.508  1.00  0.80           N  
ATOM   7710  CA  ILE B 120      44.802  40.276  73.224  1.00  0.80           C  
ATOM   7711  C   ILE B 120      45.704  41.208  74.029  1.00  0.80           C  
ATOM   7712  O   ILE B 120      45.445  42.413  74.077  1.00  0.80           O  
ATOM   7713  CB  ILE B 120      43.614  39.732  74.011  1.00  0.80           C  
ATOM   7714  CG1 ILE B 120      42.626  40.865  74.382  1.00  0.80           C  
ATOM   7715  CG2 ILE B 120      44.080  38.909  75.228  1.00  0.80           C  
ATOM   7716  CD1 ILE B 120      41.250  40.358  74.829  1.00  0.80           C  
ATOM   7717  N   GLU B 121      46.819  40.705  74.620  1.00  0.76           N  
ATOM   7718  CA  GLU B 121      47.786  41.540  75.331  1.00  0.76           C  
ATOM   7719  C   GLU B 121      48.462  42.565  74.409  1.00  0.76           C  
ATOM   7720  O   GLU B 121      48.573  43.746  74.747  1.00  0.76           O  
ATOM   7721  CB  GLU B 121      48.848  40.716  76.124  1.00  0.76           C  
ATOM   7722  CG  GLU B 121      48.285  39.994  77.385  1.00  0.76           C  
ATOM   7723  CD  GLU B 121      49.336  39.597  78.437  1.00  0.76           C  
ATOM   7724  OE1 GLU B 121      49.517  38.372  78.660  1.00  0.76           O  
ATOM   7725  OE2 GLU B 121      49.930  40.506  79.086  1.00  0.76           O  
ATOM   7726  N   GLU B 122      48.855  42.175  73.173  1.00  0.77           N  
ATOM   7727  CA  GLU B 122      49.316  43.095  72.138  1.00  0.77           C  
ATOM   7728  C   GLU B 122      48.289  44.171  71.769  1.00  0.77           C  
ATOM   7729  O   GLU B 122      48.618  45.354  71.681  1.00  0.77           O  
ATOM   7730  CB  GLU B 122      49.747  42.334  70.846  1.00  0.77           C  
ATOM   7731  CG  GLU B 122      50.583  43.184  69.843  1.00  0.77           C  
ATOM   7732  CD  GLU B 122      50.735  42.587  68.434  1.00  0.77           C  
ATOM   7733  OE1 GLU B 122      50.718  41.341  68.275  1.00  0.77           O  
ATOM   7734  OE2 GLU B 122      50.857  43.404  67.476  1.00  0.77           O  
ATOM   7735  N   LEU B 123      46.990  43.817  71.599  1.00  0.85           N  
ATOM   7736  CA  LEU B 123      45.937  44.796  71.334  1.00  0.85           C  
ATOM   7737  C   LEU B 123      45.739  45.796  72.467  1.00  0.85           C  
ATOM   7738  O   LEU B 123      45.565  46.989  72.234  1.00  0.85           O  
ATOM   7739  CB  LEU B 123      44.553  44.151  71.033  1.00  0.85           C  
ATOM   7740  CG  LEU B 123      44.525  43.126  69.882  1.00  0.85           C  
ATOM   7741  CD1 LEU B 123      43.095  42.625  69.627  1.00  0.85           C  
ATOM   7742  CD2 LEU B 123      45.170  43.643  68.591  1.00  0.85           C  
ATOM   7743  N   GLU B 124      45.782  45.333  73.729  1.00  0.85           N  
ATOM   7744  CA  GLU B 124      45.631  46.154  74.919  1.00  0.85           C  
ATOM   7745  C   GLU B 124      46.677  47.253  75.058  1.00  0.85           C  
ATOM   7746  O   GLU B 124      46.365  48.402  75.375  1.00  0.85           O  
ATOM   7747  CB  GLU B 124      45.684  45.233  76.158  1.00  0.85           C  
ATOM   7748  CG  GLU B 124      45.607  45.966  77.518  1.00  0.85           C  
ATOM   7749  CD  GLU B 124      45.669  44.999  78.691  1.00  0.85           C  
ATOM   7750  OE1 GLU B 124      45.257  43.825  78.518  1.00  0.85           O  
ATOM   7751  OE2 GLU B 124      46.053  45.463  79.795  1.00  0.85           O  
ATOM   7752  N   GLU B 125      47.957  46.948  74.771  1.00  0.83           N  
ATOM   7753  CA  GLU B 125      49.031  47.916  74.909  1.00  0.83           C  
ATOM   7754  C   GLU B 125      49.046  49.008  73.840  1.00  0.83           C  
ATOM   7755  O   GLU B 125      49.722  50.021  74.006  1.00  0.83           O  
ATOM   7756  CB  GLU B 125      50.417  47.233  75.006  1.00  0.83           C  
ATOM   7757  CG  GLU B 125      50.717  46.572  76.381  1.00  0.83           C  
ATOM   7758  CD  GLU B 125      50.710  47.548  77.544  1.00  0.83           C  
ATOM   7759  OE1 GLU B 125      51.300  48.657  77.487  1.00  0.83           O  
ATOM   7760  OE2 GLU B 125      50.052  47.266  78.580  1.00  0.83           O  
ATOM   7761  N   ILE B 126      48.261  48.867  72.748  1.00  0.87           N  
ATOM   7762  CA  ILE B 126      48.004  49.931  71.777  1.00  0.87           C  
ATOM   7763  C   ILE B 126      47.320  51.148  72.400  1.00  0.87           C  
ATOM   7764  O   ILE B 126      47.538  52.283  71.982  1.00  0.87           O  
ATOM   7765  CB  ILE B 126      47.147  49.432  70.605  1.00  0.87           C  
ATOM   7766  CG1 ILE B 126      47.834  48.297  69.806  1.00  0.87           C  
ATOM   7767  CG2 ILE B 126      46.740  50.584  69.653  1.00  0.87           C  
ATOM   7768  CD1 ILE B 126      49.074  48.725  69.008  1.00  0.87           C  
ATOM   7769  N   GLU B 127      46.432  50.945  73.395  1.00  0.89           N  
ATOM   7770  CA  GLU B 127      45.689  52.027  74.012  1.00  0.89           C  
ATOM   7771  C   GLU B 127      46.543  53.053  74.762  1.00  0.89           C  
ATOM   7772  O   GLU B 127      47.265  52.755  75.715  1.00  0.89           O  
ATOM   7773  CB  GLU B 127      44.577  51.468  74.931  1.00  0.89           C  
ATOM   7774  CG  GLU B 127      43.599  52.539  75.477  1.00  0.89           C  
ATOM   7775  CD  GLU B 127      42.424  51.949  76.243  1.00  0.89           C  
ATOM   7776  OE1 GLU B 127      42.513  50.816  76.778  1.00  0.89           O  
ATOM   7777  OE2 GLU B 127      41.395  52.659  76.379  1.00  0.89           O  
ATOM   7778  N   GLU B 128      46.469  54.323  74.340  1.00  0.88           N  
ATOM   7779  CA  GLU B 128      47.049  55.448  75.045  1.00  0.88           C  
ATOM   7780  C   GLU B 128      46.399  55.685  76.409  1.00  0.88           C  
ATOM   7781  O   GLU B 128      45.200  55.469  76.585  1.00  0.88           O  
ATOM   7782  CB  GLU B 128      46.917  56.737  74.193  1.00  0.88           C  
ATOM   7783  CG  GLU B 128      47.423  56.610  72.728  1.00  0.88           C  
ATOM   7784  CD  GLU B 128      48.910  56.283  72.558  1.00  0.88           C  
ATOM   7785  OE1 GLU B 128      49.292  56.047  71.377  1.00  0.88           O  
ATOM   7786  OE2 GLU B 128      49.658  56.251  73.567  1.00  0.88           O  
ATOM   7787  N   ASP B 129      47.141  56.154  77.439  1.00  0.90           N  
ATOM   7788  CA  ASP B 129      46.492  56.717  78.616  1.00  0.90           C  
ATOM   7789  C   ASP B 129      45.724  57.990  78.242  1.00  0.90           C  
ATOM   7790  O   ASP B 129      46.196  58.811  77.461  1.00  0.90           O  
ATOM   7791  CB  ASP B 129      47.484  57.074  79.759  1.00  0.90           C  
ATOM   7792  CG  ASP B 129      48.091  55.857  80.416  1.00  0.90           C  
ATOM   7793  OD1 ASP B 129      47.691  55.516  81.560  1.00  0.90           O  
ATOM   7794  OD2 ASP B 129      49.041  55.275  79.828  1.00  0.90           O  
ATOM   7795  N   ALA B 130      44.508  58.206  78.781  1.00  0.93           N  
ATOM   7796  CA  ALA B 130      43.782  59.426  78.505  1.00  0.93           C  
ATOM   7797  C   ALA B 130      44.441  60.664  79.108  1.00  0.93           C  
ATOM   7798  O   ALA B 130      44.572  60.785  80.330  1.00  0.93           O  
ATOM   7799  CB  ALA B 130      42.329  59.295  78.997  1.00  0.93           C  
ATOM   7800  N   GLY B 131      44.836  61.635  78.249  1.00  0.74           N  
ATOM   7801  CA  GLY B 131      45.522  62.876  78.614  1.00  0.74           C  
ATOM   7802  C   GLY B 131      44.630  63.890  79.278  1.00  0.74           C  
ATOM   7803  O   GLY B 131      44.570  65.057  78.913  1.00  0.74           O  
ATOM   7804  N   LEU B 132      43.865  63.450  80.280  1.00  0.84           N  
ATOM   7805  CA  LEU B 132      42.840  64.241  80.915  1.00  0.84           C  
ATOM   7806  C   LEU B 132      43.164  64.503  82.373  1.00  0.84           C  
ATOM   7807  O   LEU B 132      42.414  65.172  83.086  1.00  0.84           O  
ATOM   7808  CB  LEU B 132      41.499  63.484  80.800  1.00  0.84           C  
ATOM   7809  CG  LEU B 132      41.044  63.224  79.349  1.00  0.84           C  
ATOM   7810  CD1 LEU B 132      39.869  62.239  79.341  1.00  0.84           C  
ATOM   7811  CD2 LEU B 132      40.678  64.526  78.621  1.00  0.84           C  
ATOM   7812  N   GLY B 133      44.319  64.004  82.861  1.00  0.86           N  
ATOM   7813  CA  GLY B 133      44.726  64.223  84.238  1.00  0.86           C  
ATOM   7814  C   GLY B 133      46.207  64.317  84.427  1.00  0.86           C  
ATOM   7815  O   GLY B 133      46.975  64.232  83.473  1.00  0.86           O  
ATOM   7816  N   ASN B 134      46.646  64.515  85.686  1.00  0.75           N  
ATOM   7817  CA  ASN B 134      48.048  64.754  85.974  1.00  0.75           C  
ATOM   7818  C   ASN B 134      48.519  64.071  87.254  1.00  0.75           C  
ATOM   7819  O   ASN B 134      49.678  63.666  87.355  1.00  0.75           O  
ATOM   7820  CB  ASN B 134      48.226  66.295  86.103  1.00  0.75           C  
ATOM   7821  CG  ASN B 134      49.651  66.739  86.420  1.00  0.75           C  
ATOM   7822  OD1 ASN B 134      50.646  66.268  85.862  1.00  0.75           O  
ATOM   7823  ND2 ASN B 134      49.752  67.720  87.346  1.00  0.75           N  
ATOM   7824  N   GLY B 135      47.654  63.880  88.267  1.00  0.87           N  
ATOM   7825  CA  GLY B 135      48.128  63.312  89.516  1.00  0.87           C  
ATOM   7826  C   GLY B 135      47.055  62.806  90.439  1.00  0.87           C  
ATOM   7827  O   GLY B 135      46.155  62.054  90.077  1.00  0.87           O  
ATOM   7828  N   GLY B 136      47.164  63.161  91.736  1.00  0.89           N  
ATOM   7829  CA  GLY B 136      46.297  62.616  92.776  1.00  0.89           C  
ATOM   7830  C   GLY B 136      44.897  63.145  92.743  1.00  0.89           C  
ATOM   7831  O   GLY B 136      43.953  62.400  92.976  1.00  0.89           O  
ATOM   7832  N   LEU B 137      44.743  64.442  92.430  1.00  0.87           N  
ATOM   7833  CA  LEU B 137      43.478  65.150  92.404  1.00  0.87           C  
ATOM   7834  C   LEU B 137      42.495  64.585  91.387  1.00  0.87           C  
ATOM   7835  O   LEU B 137      41.329  64.314  91.687  1.00  0.87           O  
ATOM   7836  CB  LEU B 137      43.778  66.634  92.076  1.00  0.87           C  
ATOM   7837  CG  LEU B 137      42.559  67.576  92.035  1.00  0.87           C  
ATOM   7838  CD1 LEU B 137      41.911  67.730  93.413  1.00  0.87           C  
ATOM   7839  CD2 LEU B 137      42.969  68.956  91.509  1.00  0.87           C  
ATOM   7840  N   GLY B 138      42.964  64.326  90.150  1.00  0.89           N  
ATOM   7841  CA  GLY B 138      42.128  63.752  89.114  1.00  0.89           C  
ATOM   7842  C   GLY B 138      42.040  62.266  89.171  1.00  0.89           C  
ATOM   7843  O   GLY B 138      41.102  61.675  88.642  1.00  0.89           O  
ATOM   7844  N   ARG B 139      43.007  61.580  89.808  1.00  0.86           N  
ATOM   7845  CA  ARG B 139      42.884  60.153  90.043  1.00  0.86           C  
ATOM   7846  C   ARG B 139      41.863  59.825  91.110  1.00  0.86           C  
ATOM   7847  O   ARG B 139      41.163  58.816  91.023  1.00  0.86           O  
ATOM   7848  CB  ARG B 139      44.236  59.468  90.358  1.00  0.86           C  
ATOM   7849  CG  ARG B 139      44.186  57.922  90.324  1.00  0.86           C  
ATOM   7850  CD  ARG B 139      43.676  57.358  88.986  1.00  0.86           C  
ATOM   7851  NE  ARG B 139      42.365  56.671  89.221  1.00  0.86           N  
ATOM   7852  CZ  ARG B 139      41.706  56.011  88.254  1.00  0.86           C  
ATOM   7853  NH1 ARG B 139      42.130  56.031  86.995  1.00  0.86           N  
ATOM   7854  NH2 ARG B 139      40.599  55.340  88.566  1.00  0.86           N  
ATOM   7855  N   LEU B 140      41.739  60.699  92.126  1.00  0.94           N  
ATOM   7856  CA  LEU B 140      40.702  60.657  93.138  1.00  0.94           C  
ATOM   7857  C   LEU B 140      39.327  60.824  92.502  1.00  0.94           C  
ATOM   7858  O   LEU B 140      38.427  60.015  92.719  1.00  0.94           O  
ATOM   7859  CB  LEU B 140      41.038  61.750  94.196  1.00  0.94           C  
ATOM   7860  CG  LEU B 140      40.395  61.667  95.598  1.00  0.94           C  
ATOM   7861  CD1 LEU B 140      39.126  62.520  95.699  1.00  0.94           C  
ATOM   7862  CD2 LEU B 140      40.147  60.226  96.064  1.00  0.94           C  
ATOM   7863  N   ALA B 141      39.183  61.797  91.575  1.00  0.96           N  
ATOM   7864  CA  ALA B 141      37.992  61.951  90.762  1.00  0.96           C  
ATOM   7865  C   ALA B 141      37.663  60.734  89.892  1.00  0.96           C  
ATOM   7866  O   ALA B 141      36.537  60.246  89.866  1.00  0.96           O  
ATOM   7867  CB  ALA B 141      38.182  63.183  89.859  1.00  0.96           C  
ATOM   7868  N   ALA B 142      38.666  60.169  89.195  1.00  0.96           N  
ATOM   7869  CA  ALA B 142      38.531  58.970  88.392  1.00  0.96           C  
ATOM   7870  C   ALA B 142      38.171  57.701  89.174  1.00  0.96           C  
ATOM   7871  O   ALA B 142      37.416  56.854  88.703  1.00  0.96           O  
ATOM   7872  CB  ALA B 142      39.826  58.768  87.589  1.00  0.96           C  
ATOM   7873  N   CYS B 143      38.710  57.517  90.400  1.00  0.96           N  
ATOM   7874  CA  CYS B 143      38.261  56.476  91.324  1.00  0.96           C  
ATOM   7875  C   CYS B 143      36.826  56.678  91.770  1.00  0.96           C  
ATOM   7876  O   CYS B 143      36.032  55.742  91.806  1.00  0.96           O  
ATOM   7877  CB  CYS B 143      39.149  56.398  92.592  1.00  0.96           C  
ATOM   7878  SG  CYS B 143      40.825  55.775  92.224  1.00  0.96           S  
ATOM   7879  N   PHE B 144      36.451  57.930  92.085  1.00  0.96           N  
ATOM   7880  CA  PHE B 144      35.103  58.289  92.473  1.00  0.96           C  
ATOM   7881  C   PHE B 144      34.064  58.014  91.393  1.00  0.96           C  
ATOM   7882  O   PHE B 144      32.987  57.514  91.701  1.00  0.96           O  
ATOM   7883  CB  PHE B 144      35.027  59.776  92.914  1.00  0.96           C  
ATOM   7884  CG  PHE B 144      35.573  60.062  94.298  1.00  0.96           C  
ATOM   7885  CD1 PHE B 144      36.248  59.129  95.111  1.00  0.96           C  
ATOM   7886  CD2 PHE B 144      35.350  61.348  94.814  1.00  0.96           C  
ATOM   7887  CE1 PHE B 144      36.675  59.475  96.400  1.00  0.96           C  
ATOM   7888  CE2 PHE B 144      35.768  61.702  96.101  1.00  0.96           C  
ATOM   7889  CZ  PHE B 144      36.432  60.761  96.895  1.00  0.96           C  
ATOM   7890  N   LEU B 145      34.352  58.276  90.098  1.00  0.95           N  
ATOM   7891  CA  LEU B 145      33.430  57.950  89.011  1.00  0.95           C  
ATOM   7892  C   LEU B 145      33.079  56.457  88.915  1.00  0.95           C  
ATOM   7893  O   LEU B 145      31.909  56.103  88.757  1.00  0.95           O  
ATOM   7894  CB  LEU B 145      33.939  58.420  87.621  1.00  0.95           C  
ATOM   7895  CG  LEU B 145      34.189  59.931  87.435  1.00  0.95           C  
ATOM   7896  CD1 LEU B 145      34.540  60.213  85.966  1.00  0.95           C  
ATOM   7897  CD2 LEU B 145      32.999  60.803  87.862  1.00  0.95           C  
ATOM   7898  N   ASP B 146      34.076  55.552  89.062  1.00  0.95           N  
ATOM   7899  CA  ASP B 146      33.885  54.106  89.146  1.00  0.95           C  
ATOM   7900  C   ASP B 146      33.022  53.706  90.350  1.00  0.95           C  
ATOM   7901  O   ASP B 146      32.050  52.959  90.236  1.00  0.95           O  
ATOM   7902  CB  ASP B 146      35.307  53.460  89.207  1.00  0.95           C  
ATOM   7903  CG  ASP B 146      35.356  51.957  89.455  1.00  0.95           C  
ATOM   7904  OD1 ASP B 146      35.852  51.195  88.594  1.00  0.95           O  
ATOM   7905  OD2 ASP B 146      35.007  51.538  90.590  1.00  0.95           O  
ATOM   7906  N   SER B 147      33.334  54.247  91.541  1.00  0.96           N  
ATOM   7907  CA  SER B 147      32.577  54.000  92.759  1.00  0.96           C  
ATOM   7908  C   SER B 147      31.153  54.512  92.743  1.00  0.96           C  
ATOM   7909  O   SER B 147      30.240  53.813  93.170  1.00  0.96           O  
ATOM   7910  CB  SER B 147      33.281  54.577  94.000  1.00  0.96           C  
ATOM   7911  OG  SER B 147      34.440  53.813  94.301  1.00  0.96           O  
ATOM   7912  N   MET B 148      30.887  55.728  92.224  1.00  0.93           N  
ATOM   7913  CA  MET B 148      29.532  56.234  92.061  1.00  0.93           C  
ATOM   7914  C   MET B 148      28.692  55.397  91.100  1.00  0.93           C  
ATOM   7915  O   MET B 148      27.524  55.121  91.363  1.00  0.93           O  
ATOM   7916  CB  MET B 148      29.528  57.729  91.648  1.00  0.93           C  
ATOM   7917  CG  MET B 148      30.098  58.657  92.746  1.00  0.93           C  
ATOM   7918  SD  MET B 148      29.869  60.444  92.501  1.00  0.93           S  
ATOM   7919  CE  MET B 148      31.023  60.662  91.120  1.00  0.93           C  
ATOM   7920  N   ALA B 149      29.271  54.924  89.979  1.00  0.96           N  
ATOM   7921  CA  ALA B 149      28.611  53.978  89.096  1.00  0.96           C  
ATOM   7922  C   ALA B 149      28.335  52.605  89.725  1.00  0.96           C  
ATOM   7923  O   ALA B 149      27.236  52.060  89.622  1.00  0.96           O  
ATOM   7924  CB  ALA B 149      29.444  53.855  87.811  1.00  0.96           C  
ATOM   7925  N   THR B 150      29.313  52.032  90.456  1.00  0.93           N  
ATOM   7926  CA  THR B 150      29.202  50.775  91.205  1.00  0.93           C  
ATOM   7927  C   THR B 150      28.145  50.819  92.292  1.00  0.93           C  
ATOM   7928  O   THR B 150      27.443  49.842  92.543  1.00  0.93           O  
ATOM   7929  CB  THR B 150      30.537  50.368  91.815  1.00  0.93           C  
ATOM   7930  OG1 THR B 150      31.439  50.026  90.771  1.00  0.93           O  
ATOM   7931  CG2 THR B 150      30.430  49.122  92.701  1.00  0.93           C  
ATOM   7932  N   LEU B 151      27.978  51.978  92.948  1.00  0.92           N  
ATOM   7933  CA  LEU B 151      27.000  52.173  94.006  1.00  0.92           C  
ATOM   7934  C   LEU B 151      25.668  52.688  93.475  1.00  0.92           C  
ATOM   7935  O   LEU B 151      24.800  53.080  94.250  1.00  0.92           O  
ATOM   7936  CB  LEU B 151      27.556  53.186  95.046  1.00  0.92           C  
ATOM   7937  CG  LEU B 151      28.410  52.587  96.189  1.00  0.92           C  
ATOM   7938  CD1 LEU B 151      29.319  51.420  95.779  1.00  0.92           C  
ATOM   7939  CD2 LEU B 151      29.266  53.696  96.809  1.00  0.92           C  
ATOM   7940  N   GLY B 152      25.448  52.688  92.141  1.00  0.93           N  
ATOM   7941  CA  GLY B 152      24.128  52.942  91.565  1.00  0.93           C  
ATOM   7942  C   GLY B 152      23.701  54.383  91.550  1.00  0.93           C  
ATOM   7943  O   GLY B 152      22.520  54.690  91.411  1.00  0.93           O  
ATOM   7944  N   LEU B 153      24.651  55.313  91.725  1.00  0.92           N  
ATOM   7945  CA  LEU B 153      24.345  56.717  91.880  1.00  0.92           C  
ATOM   7946  C   LEU B 153      24.227  57.420  90.547  1.00  0.92           C  
ATOM   7947  O   LEU B 153      25.048  57.227  89.651  1.00  0.92           O  
ATOM   7948  CB  LEU B 153      25.441  57.459  92.688  1.00  0.92           C  
ATOM   7949  CG  LEU B 153      25.759  56.859  94.071  1.00  0.92           C  
ATOM   7950  CD1 LEU B 153      26.689  57.788  94.863  1.00  0.92           C  
ATOM   7951  CD2 LEU B 153      24.492  56.581  94.878  1.00  0.92           C  
ATOM   7952  N   ALA B 154      23.224  58.312  90.399  1.00  0.95           N  
ATOM   7953  CA  ALA B 154      23.052  59.136  89.221  1.00  0.95           C  
ATOM   7954  C   ALA B 154      24.071  60.261  89.149  1.00  0.95           C  
ATOM   7955  O   ALA B 154      23.784  61.433  89.385  1.00  0.95           O  
ATOM   7956  CB  ALA B 154      21.613  59.675  89.153  1.00  0.95           C  
ATOM   7957  N   ALA B 155      25.323  59.893  88.846  1.00  0.97           N  
ATOM   7958  CA  ALA B 155      26.456  60.764  88.968  1.00  0.97           C  
ATOM   7959  C   ALA B 155      27.162  61.032  87.659  1.00  0.97           C  
ATOM   7960  O   ALA B 155      27.207  60.212  86.744  1.00  0.97           O  
ATOM   7961  CB  ALA B 155      27.460  60.185  89.969  1.00  0.97           C  
ATOM   7962  N   TYR B 156      27.722  62.244  87.552  1.00  0.94           N  
ATOM   7963  CA  TYR B 156      28.308  62.746  86.336  1.00  0.94           C  
ATOM   7964  C   TYR B 156      29.690  63.296  86.623  1.00  0.94           C  
ATOM   7965  O   TYR B 156      29.909  63.964  87.633  1.00  0.94           O  
ATOM   7966  CB  TYR B 156      27.473  63.909  85.732  1.00  0.94           C  
ATOM   7967  CG  TYR B 156      26.056  63.507  85.379  1.00  0.94           C  
ATOM   7968  CD1 TYR B 156      25.685  63.301  84.039  1.00  0.94           C  
ATOM   7969  CD2 TYR B 156      25.073  63.343  86.374  1.00  0.94           C  
ATOM   7970  CE1 TYR B 156      24.408  62.815  83.714  1.00  0.94           C  
ATOM   7971  CE2 TYR B 156      23.798  62.851  86.053  1.00  0.94           C  
ATOM   7972  CZ  TYR B 156      23.475  62.551  84.722  1.00  0.94           C  
ATOM   7973  OH  TYR B 156      22.231  61.969  84.375  1.00  0.94           O  
ATOM   7974  N   GLY B 157      30.663  63.058  85.723  1.00  0.97           N  
ATOM   7975  CA  GLY B 157      31.952  63.743  85.791  1.00  0.97           C  
ATOM   7976  C   GLY B 157      31.985  64.871  84.808  1.00  0.97           C  
ATOM   7977  O   GLY B 157      31.670  64.674  83.639  1.00  0.97           O  
ATOM   7978  N   TYR B 158      32.368  66.081  85.250  1.00  0.95           N  
ATOM   7979  CA  TYR B 158      32.398  67.250  84.388  1.00  0.95           C  
ATOM   7980  C   TYR B 158      33.740  67.961  84.443  1.00  0.95           C  
ATOM   7981  O   TYR B 158      34.218  68.363  85.505  1.00  0.95           O  
ATOM   7982  CB  TYR B 158      31.277  68.240  84.773  1.00  0.95           C  
ATOM   7983  CG  TYR B 158      30.008  67.916  84.038  1.00  0.95           C  
ATOM   7984  CD1 TYR B 158      29.012  67.112  84.614  1.00  0.95           C  
ATOM   7985  CD2 TYR B 158      29.780  68.474  82.770  1.00  0.95           C  
ATOM   7986  CE1 TYR B 158      27.797  66.907  83.942  1.00  0.95           C  
ATOM   7987  CE2 TYR B 158      28.555  68.289  82.116  1.00  0.95           C  
ATOM   7988  CZ  TYR B 158      27.565  67.504  82.707  1.00  0.95           C  
ATOM   7989  OH  TYR B 158      26.320  67.293  82.087  1.00  0.95           O  
ATOM   7990  N   GLY B 159      34.386  68.117  83.265  1.00  0.98           N  
ATOM   7991  CA  GLY B 159      35.727  68.681  83.154  1.00  0.98           C  
ATOM   7992  C   GLY B 159      36.014  69.241  81.784  1.00  0.98           C  
ATOM   7993  O   GLY B 159      35.117  69.495  80.983  1.00  0.98           O  
ATOM   7994  N   ILE B 160      37.305  69.434  81.462  1.00  0.95           N  
ATOM   7995  CA  ILE B 160      37.757  69.909  80.160  1.00  0.95           C  
ATOM   7996  C   ILE B 160      38.381  68.750  79.402  1.00  0.95           C  
ATOM   7997  O   ILE B 160      39.116  67.931  79.952  1.00  0.95           O  
ATOM   7998  CB  ILE B 160      38.776  71.050  80.268  1.00  0.95           C  
ATOM   7999  CG1 ILE B 160      38.137  72.305  80.901  1.00  0.95           C  
ATOM   8000  CG2 ILE B 160      39.387  71.400  78.889  1.00  0.95           C  
ATOM   8001  CD1 ILE B 160      39.132  73.453  81.129  1.00  0.95           C  
ATOM   8002  N   ARG B 161      38.109  68.646  78.086  1.00  0.89           N  
ATOM   8003  CA  ARG B 161      38.769  67.677  77.238  1.00  0.89           C  
ATOM   8004  C   ARG B 161      40.068  68.243  76.708  1.00  0.89           C  
ATOM   8005  O   ARG B 161      40.104  68.886  75.660  1.00  0.89           O  
ATOM   8006  CB  ARG B 161      37.884  67.279  76.039  1.00  0.89           C  
ATOM   8007  CG  ARG B 161      38.500  66.170  75.165  1.00  0.89           C  
ATOM   8008  CD  ARG B 161      37.492  65.659  74.145  1.00  0.89           C  
ATOM   8009  NE  ARG B 161      38.175  64.796  73.141  1.00  0.89           N  
ATOM   8010  CZ  ARG B 161      38.667  65.271  71.993  1.00  0.89           C  
ATOM   8011  NH1 ARG B 161      39.075  66.534  71.880  1.00  0.89           N  
ATOM   8012  NH2 ARG B 161      38.768  64.468  70.944  1.00  0.89           N  
ATOM   8013  N   TYR B 162      41.178  68.024  77.429  1.00  0.90           N  
ATOM   8014  CA  TYR B 162      42.478  68.508  77.014  1.00  0.90           C  
ATOM   8015  C   TYR B 162      43.006  67.841  75.744  1.00  0.90           C  
ATOM   8016  O   TYR B 162      43.175  66.625  75.669  1.00  0.90           O  
ATOM   8017  CB  TYR B 162      43.516  68.399  78.153  1.00  0.90           C  
ATOM   8018  CG  TYR B 162      43.012  69.119  79.377  1.00  0.90           C  
ATOM   8019  CD1 TYR B 162      42.996  70.524  79.431  1.00  0.90           C  
ATOM   8020  CD2 TYR B 162      42.527  68.395  80.479  1.00  0.90           C  
ATOM   8021  CE1 TYR B 162      42.546  71.187  80.583  1.00  0.90           C  
ATOM   8022  CE2 TYR B 162      42.065  69.056  81.624  1.00  0.90           C  
ATOM   8023  CZ  TYR B 162      42.097  70.452  81.682  1.00  0.90           C  
ATOM   8024  OH  TYR B 162      41.665  71.119  82.843  1.00  0.90           O  
ATOM   8025  N   GLU B 163      43.280  68.650  74.701  1.00  0.85           N  
ATOM   8026  CA  GLU B 163      43.763  68.227  73.396  1.00  0.85           C  
ATOM   8027  C   GLU B 163      45.112  67.522  73.483  1.00  0.85           C  
ATOM   8028  O   GLU B 163      45.325  66.489  72.853  1.00  0.85           O  
ATOM   8029  CB  GLU B 163      43.836  69.479  72.483  1.00  0.85           C  
ATOM   8030  CG  GLU B 163      44.038  69.273  70.953  1.00  0.85           C  
ATOM   8031  CD  GLU B 163      44.206  70.625  70.252  1.00  0.85           C  
ATOM   8032  OE1 GLU B 163      44.179  71.659  70.970  1.00  0.85           O  
ATOM   8033  OE2 GLU B 163      44.387  70.709  69.007  1.00  0.85           O  
ATOM   8034  N   TYR B 164      46.029  68.053  74.323  1.00  0.83           N  
ATOM   8035  CA  TYR B 164      47.374  67.518  74.480  1.00  0.83           C  
ATOM   8036  C   TYR B 164      47.777  67.251  75.921  1.00  0.83           C  
ATOM   8037  O   TYR B 164      48.962  67.306  76.253  1.00  0.83           O  
ATOM   8038  CB  TYR B 164      48.436  68.483  73.899  1.00  0.83           C  
ATOM   8039  CG  TYR B 164      48.251  68.612  72.426  1.00  0.83           C  
ATOM   8040  CD1 TYR B 164      47.612  69.741  71.902  1.00  0.83           C  
ATOM   8041  CD2 TYR B 164      48.704  67.607  71.557  1.00  0.83           C  
ATOM   8042  CE1 TYR B 164      47.410  69.858  70.524  1.00  0.83           C  
ATOM   8043  CE2 TYR B 164      48.500  67.723  70.174  1.00  0.83           C  
ATOM   8044  CZ  TYR B 164      47.841  68.842  69.663  1.00  0.83           C  
ATOM   8045  OH  TYR B 164      47.592  68.978  68.287  1.00  0.83           O  
ATOM   8046  N   GLY B 165      46.810  66.974  76.825  1.00  0.86           N  
ATOM   8047  CA  GLY B 165      47.053  66.738  78.254  1.00  0.86           C  
ATOM   8048  C   GLY B 165      47.939  67.729  78.958  1.00  0.86           C  
ATOM   8049  O   GLY B 165      47.871  68.924  78.704  1.00  0.86           O  
ATOM   8050  N   ILE B 166      48.774  67.285  79.915  1.00  0.70           N  
ATOM   8051  CA  ILE B 166      49.806  68.160  80.462  1.00  0.70           C  
ATOM   8052  C   ILE B 166      51.126  68.058  79.708  1.00  0.70           C  
ATOM   8053  O   ILE B 166      51.745  69.083  79.438  1.00  0.70           O  
ATOM   8054  CB  ILE B 166      49.978  67.983  81.966  1.00  0.70           C  
ATOM   8055  CG1 ILE B 166      50.811  69.144  82.555  1.00  0.70           C  
ATOM   8056  CG2 ILE B 166      50.576  66.605  82.312  1.00  0.70           C  
ATOM   8057  CD1 ILE B 166      50.566  69.377  84.045  1.00  0.70           C  
ATOM   8058  N   PHE B 167      51.544  66.822  79.332  1.00  0.80           N  
ATOM   8059  CA  PHE B 167      52.802  66.454  78.694  1.00  0.80           C  
ATOM   8060  C   PHE B 167      53.132  64.997  78.996  1.00  0.80           C  
ATOM   8061  O   PHE B 167      52.838  64.475  80.075  1.00  0.80           O  
ATOM   8062  CB  PHE B 167      54.074  67.336  78.992  1.00  0.80           C  
ATOM   8063  CG  PHE B 167      54.692  67.192  80.362  1.00  0.80           C  
ATOM   8064  CD1 PHE B 167      54.328  68.043  81.410  1.00  0.80           C  
ATOM   8065  CD2 PHE B 167      55.718  66.262  80.582  1.00  0.80           C  
ATOM   8066  CE1 PHE B 167      54.944  67.942  82.664  1.00  0.80           C  
ATOM   8067  CE2 PHE B 167      56.359  66.164  81.820  1.00  0.80           C  
ATOM   8068  CZ  PHE B 167      55.963  67.003  82.867  1.00  0.80           C  
ATOM   8069  N   ASN B 168      53.807  64.306  78.064  1.00  0.81           N  
ATOM   8070  CA  ASN B 168      54.417  63.023  78.346  1.00  0.81           C  
ATOM   8071  C   ASN B 168      55.877  63.269  78.662  1.00  0.81           C  
ATOM   8072  O   ASN B 168      56.532  64.110  78.060  1.00  0.81           O  
ATOM   8073  CB  ASN B 168      54.324  62.029  77.164  1.00  0.81           C  
ATOM   8074  CG  ASN B 168      52.941  61.406  76.972  1.00  0.81           C  
ATOM   8075  OD1 ASN B 168      52.682  60.853  75.909  1.00  0.81           O  
ATOM   8076  ND2 ASN B 168      52.068  61.407  78.003  1.00  0.81           N  
ATOM   8077  N   GLN B 169      56.434  62.580  79.663  1.00  0.84           N  
ATOM   8078  CA  GLN B 169      57.837  62.717  79.995  1.00  0.84           C  
ATOM   8079  C   GLN B 169      58.695  61.791  79.164  1.00  0.84           C  
ATOM   8080  O   GLN B 169      58.344  60.633  78.965  1.00  0.84           O  
ATOM   8081  CB  GLN B 169      58.035  62.317  81.474  1.00  0.84           C  
ATOM   8082  CG  GLN B 169      59.497  62.194  81.960  1.00  0.84           C  
ATOM   8083  CD  GLN B 169      59.546  61.658  83.383  1.00  0.84           C  
ATOM   8084  OE1 GLN B 169      59.077  60.549  83.642  1.00  0.84           O  
ATOM   8085  NE2 GLN B 169      60.094  62.445  84.328  1.00  0.84           N  
ATOM   8086  N   LYS B 170      59.873  62.267  78.727  1.00  0.83           N  
ATOM   8087  CA  LYS B 170      60.920  61.396  78.251  1.00  0.83           C  
ATOM   8088  C   LYS B 170      62.225  61.658  78.952  1.00  0.83           C  
ATOM   8089  O   LYS B 170      62.510  62.768  79.403  1.00  0.83           O  
ATOM   8090  CB  LYS B 170      61.107  61.440  76.724  1.00  0.83           C  
ATOM   8091  CG  LYS B 170      60.030  60.594  76.052  1.00  0.83           C  
ATOM   8092  CD  LYS B 170      60.428  60.091  74.664  1.00  0.83           C  
ATOM   8093  CE  LYS B 170      59.500  58.968  74.215  1.00  0.83           C  
ATOM   8094  NZ  LYS B 170      59.799  57.753  74.999  1.00  0.83           N  
ATOM   8095  N   ILE B 171      63.055  60.605  79.074  1.00  0.88           N  
ATOM   8096  CA  ILE B 171      64.382  60.719  79.650  1.00  0.88           C  
ATOM   8097  C   ILE B 171      65.420  60.455  78.576  1.00  0.88           C  
ATOM   8098  O   ILE B 171      65.609  59.355  78.063  1.00  0.88           O  
ATOM   8099  CB  ILE B 171      64.614  59.865  80.902  1.00  0.88           C  
ATOM   8100  CG1 ILE B 171      64.225  58.382  80.704  1.00  0.88           C  
ATOM   8101  CG2 ILE B 171      63.821  60.510  82.061  1.00  0.88           C  
ATOM   8102  CD1 ILE B 171      64.594  57.475  81.884  1.00  0.88           C  
ATOM   8103  N   ARG B 172      66.153  61.509  78.183  1.00  0.77           N  
ATOM   8104  CA  ARG B 172      67.202  61.385  77.191  1.00  0.77           C  
ATOM   8105  C   ARG B 172      68.437  62.099  77.693  1.00  0.77           C  
ATOM   8106  O   ARG B 172      68.385  63.256  78.100  1.00  0.77           O  
ATOM   8107  CB  ARG B 172      66.775  61.786  75.748  1.00  0.77           C  
ATOM   8108  CG  ARG B 172      65.916  63.058  75.550  1.00  0.77           C  
ATOM   8109  CD  ARG B 172      66.582  64.427  75.753  1.00  0.77           C  
ATOM   8110  NE  ARG B 172      67.763  64.515  74.828  1.00  0.77           N  
ATOM   8111  CZ  ARG B 172      68.088  65.575  74.077  1.00  0.77           C  
ATOM   8112  NH1 ARG B 172      67.356  66.684  74.053  1.00  0.77           N  
ATOM   8113  NH2 ARG B 172      69.181  65.517  73.319  1.00  0.77           N  
ATOM   8114  N   ASP B 173      69.578  61.373  77.747  1.00  0.86           N  
ATOM   8115  CA  ASP B 173      70.804  61.809  78.409  1.00  0.86           C  
ATOM   8116  C   ASP B 173      70.566  62.138  79.890  1.00  0.86           C  
ATOM   8117  O   ASP B 173      70.978  63.151  80.454  1.00  0.86           O  
ATOM   8118  CB  ASP B 173      71.488  62.933  77.595  1.00  0.86           C  
ATOM   8119  CG  ASP B 173      72.923  63.212  78.023  1.00  0.86           C  
ATOM   8120  OD1 ASP B 173      73.570  63.987  77.281  1.00  0.86           O  
ATOM   8121  OD2 ASP B 173      73.376  62.691  79.080  1.00  0.86           O  
ATOM   8122  N   GLY B 174      69.819  61.262  80.585  1.00  0.91           N  
ATOM   8123  CA  GLY B 174      69.566  61.350  82.019  1.00  0.91           C  
ATOM   8124  C   GLY B 174      68.671  62.466  82.497  1.00  0.91           C  
ATOM   8125  O   GLY B 174      68.196  62.435  83.628  1.00  0.91           O  
ATOM   8126  N   TRP B 175      68.426  63.485  81.663  1.00  0.87           N  
ATOM   8127  CA  TRP B 175      67.598  64.616  81.996  1.00  0.87           C  
ATOM   8128  C   TRP B 175      66.175  64.389  81.546  1.00  0.87           C  
ATOM   8129  O   TRP B 175      65.893  63.631  80.618  1.00  0.87           O  
ATOM   8130  CB  TRP B 175      68.068  65.916  81.297  1.00  0.87           C  
ATOM   8131  CG  TRP B 175      69.445  66.417  81.664  1.00  0.87           C  
ATOM   8132  CD1 TRP B 175      70.620  66.249  80.987  1.00  0.87           C  
ATOM   8133  CD2 TRP B 175      69.729  67.331  82.744  1.00  0.87           C  
ATOM   8134  NE1 TRP B 175      71.629  66.985  81.575  1.00  0.87           N  
ATOM   8135  CE2 TRP B 175      71.087  67.669  82.645  1.00  0.87           C  
ATOM   8136  CE3 TRP B 175      68.912  67.880  83.736  1.00  0.87           C  
ATOM   8137  CZ2 TRP B 175      71.666  68.573  83.526  1.00  0.87           C  
ATOM   8138  CZ3 TRP B 175      69.501  68.781  84.638  1.00  0.87           C  
ATOM   8139  CH2 TRP B 175      70.856  69.124  84.532  1.00  0.87           C  
ATOM   8140  N   GLN B 176      65.233  65.091  82.196  1.00  0.86           N  
ATOM   8141  CA  GLN B 176      63.868  65.160  81.730  1.00  0.86           C  
ATOM   8142  C   GLN B 176      63.702  66.049  80.503  1.00  0.86           C  
ATOM   8143  O   GLN B 176      64.177  67.183  80.468  1.00  0.86           O  
ATOM   8144  CB  GLN B 176      62.923  65.681  82.843  1.00  0.86           C  
ATOM   8145  CG  GLN B 176      61.438  65.613  82.424  1.00  0.86           C  
ATOM   8146  CD  GLN B 176      60.467  66.051  83.516  1.00  0.86           C  
ATOM   8147  OE1 GLN B 176      60.116  65.288  84.418  1.00  0.86           O  
ATOM   8148  NE2 GLN B 176      59.983  67.305  83.406  1.00  0.86           N  
ATOM   8149  N   VAL B 177      62.977  65.558  79.482  1.00  0.86           N  
ATOM   8150  CA  VAL B 177      62.412  66.396  78.441  1.00  0.86           C  
ATOM   8151  C   VAL B 177      60.907  66.155  78.396  1.00  0.86           C  
ATOM   8152  O   VAL B 177      60.415  65.032  78.504  1.00  0.86           O  
ATOM   8153  CB  VAL B 177      63.092  66.211  77.083  1.00  0.86           C  
ATOM   8154  CG1 VAL B 177      62.873  64.789  76.543  1.00  0.86           C  
ATOM   8155  CG2 VAL B 177      62.600  67.265  76.070  1.00  0.86           C  
ATOM   8156  N   GLU B 178      60.114  67.233  78.295  1.00  0.79           N  
ATOM   8157  CA  GLU B 178      58.669  67.170  78.244  1.00  0.79           C  
ATOM   8158  C   GLU B 178      58.167  67.111  76.800  1.00  0.79           C  
ATOM   8159  O   GLU B 178      58.429  68.021  76.021  1.00  0.79           O  
ATOM   8160  CB  GLU B 178      58.082  68.443  78.921  1.00  0.79           C  
ATOM   8161  CG  GLU B 178      58.429  68.596  80.428  1.00  0.79           C  
ATOM   8162  CD  GLU B 178      59.720  69.339  80.746  1.00  0.79           C  
ATOM   8163  OE1 GLU B 178      59.740  70.595  80.762  1.00  0.79           O  
ATOM   8164  OE2 GLU B 178      60.728  68.672  81.093  1.00  0.79           O  
ATOM   8165  N   GLU B 179      57.407  66.079  76.386  1.00  0.78           N  
ATOM   8166  CA  GLU B 179      56.838  65.969  75.045  1.00  0.78           C  
ATOM   8167  C   GLU B 179      55.343  66.240  75.056  1.00  0.78           C  
ATOM   8168  O   GLU B 179      54.676  66.122  76.079  1.00  0.78           O  
ATOM   8169  CB  GLU B 179      57.052  64.567  74.435  1.00  0.78           C  
ATOM   8170  CG  GLU B 179      58.543  64.184  74.318  1.00  0.78           C  
ATOM   8171  CD  GLU B 179      58.754  62.946  73.453  1.00  0.78           C  
ATOM   8172  OE1 GLU B 179      59.656  63.000  72.577  1.00  0.78           O  
ATOM   8173  OE2 GLU B 179      58.057  61.925  73.685  1.00  0.78           O  
ATOM   8174  N   ALA B 180      54.748  66.651  73.915  1.00  0.82           N  
ATOM   8175  CA  ALA B 180      53.308  66.825  73.829  1.00  0.82           C  
ATOM   8176  C   ALA B 180      52.571  65.495  73.883  1.00  0.82           C  
ATOM   8177  O   ALA B 180      52.931  64.546  73.203  1.00  0.82           O  
ATOM   8178  CB  ALA B 180      52.912  67.620  72.570  1.00  0.82           C  
ATOM   8179  N   ASP B 181      51.532  65.397  74.726  1.00  0.83           N  
ATOM   8180  CA  ASP B 181      50.765  64.184  74.896  1.00  0.83           C  
ATOM   8181  C   ASP B 181      49.666  64.143  73.835  1.00  0.83           C  
ATOM   8182  O   ASP B 181      48.518  64.504  74.076  1.00  0.83           O  
ATOM   8183  CB  ASP B 181      50.282  64.257  76.373  1.00  0.83           C  
ATOM   8184  CG  ASP B 181      49.506  63.088  76.948  1.00  0.83           C  
ATOM   8185  OD1 ASP B 181      49.036  62.207  76.198  1.00  0.83           O  
ATOM   8186  OD2 ASP B 181      49.396  63.090  78.207  1.00  0.83           O  
ATOM   8187  N   ASP B 182      49.983  63.738  72.583  1.00  0.82           N  
ATOM   8188  CA  ASP B 182      49.016  63.729  71.498  1.00  0.82           C  
ATOM   8189  C   ASP B 182      48.185  62.445  71.450  1.00  0.82           C  
ATOM   8190  O   ASP B 182      47.986  61.810  70.416  1.00  0.82           O  
ATOM   8191  CB  ASP B 182      49.629  64.156  70.133  1.00  0.82           C  
ATOM   8192  CG  ASP B 182      50.726  63.239  69.623  1.00  0.82           C  
ATOM   8193  OD1 ASP B 182      51.708  63.024  70.371  1.00  0.82           O  
ATOM   8194  OD2 ASP B 182      50.622  62.784  68.454  1.00  0.82           O  
ATOM   8195  N   TRP B 183      47.581  62.087  72.604  1.00  0.80           N  
ATOM   8196  CA  TRP B 183      46.750  60.913  72.839  1.00  0.80           C  
ATOM   8197  C   TRP B 183      45.576  60.748  71.869  1.00  0.80           C  
ATOM   8198  O   TRP B 183      45.074  59.654  71.621  1.00  0.80           O  
ATOM   8199  CB  TRP B 183      46.248  60.909  74.315  1.00  0.80           C  
ATOM   8200  CG  TRP B 183      45.228  61.971  74.706  1.00  0.80           C  
ATOM   8201  CD1 TRP B 183      45.394  63.316  74.893  1.00  0.80           C  
ATOM   8202  CD2 TRP B 183      43.833  61.704  74.961  1.00  0.80           C  
ATOM   8203  NE1 TRP B 183      44.191  63.912  75.225  1.00  0.80           N  
ATOM   8204  CE2 TRP B 183      43.229  62.931  75.268  1.00  0.80           C  
ATOM   8205  CE3 TRP B 183      43.100  60.517  74.938  1.00  0.80           C  
ATOM   8206  CZ2 TRP B 183      41.869  63.015  75.542  1.00  0.80           C  
ATOM   8207  CZ3 TRP B 183      41.729  60.596  75.236  1.00  0.80           C  
ATOM   8208  CH2 TRP B 183      41.120  61.826  75.524  1.00  0.80           C  
ATOM   8209  N   LEU B 184      45.127  61.860  71.262  1.00  0.85           N  
ATOM   8210  CA  LEU B 184      44.047  61.897  70.303  1.00  0.85           C  
ATOM   8211  C   LEU B 184      44.492  61.788  68.851  1.00  0.85           C  
ATOM   8212  O   LEU B 184      43.661  61.884  67.950  1.00  0.85           O  
ATOM   8213  CB  LEU B 184      43.306  63.244  70.452  1.00  0.85           C  
ATOM   8214  CG  LEU B 184      42.567  63.402  71.789  1.00  0.85           C  
ATOM   8215  CD1 LEU B 184      42.141  64.861  71.981  1.00  0.85           C  
ATOM   8216  CD2 LEU B 184      41.365  62.451  71.874  1.00  0.85           C  
ATOM   8217  N   ARG B 185      45.786  61.532  68.562  1.00  0.76           N  
ATOM   8218  CA  ARG B 185      46.335  61.462  67.210  1.00  0.76           C  
ATOM   8219  C   ARG B 185      45.644  60.465  66.290  1.00  0.76           C  
ATOM   8220  O   ARG B 185      45.430  60.710  65.104  1.00  0.76           O  
ATOM   8221  CB  ARG B 185      47.836  61.094  67.291  1.00  0.76           C  
ATOM   8222  CG  ARG B 185      48.532  60.928  65.927  1.00  0.76           C  
ATOM   8223  CD  ARG B 185      50.041  60.734  66.054  1.00  0.76           C  
ATOM   8224  NE  ARG B 185      50.550  60.531  64.663  1.00  0.76           N  
ATOM   8225  CZ  ARG B 185      51.838  60.310  64.384  1.00  0.76           C  
ATOM   8226  NH1 ARG B 185      52.746  60.202  65.349  1.00  0.76           N  
ATOM   8227  NH2 ARG B 185      52.215  60.201  63.112  1.00  0.76           N  
ATOM   8228  N   TYR B 186      45.254  59.305  66.836  1.00  0.84           N  
ATOM   8229  CA  TYR B 186      44.556  58.280  66.088  1.00  0.84           C  
ATOM   8230  C   TYR B 186      43.099  58.208  66.517  1.00  0.84           C  
ATOM   8231  O   TYR B 186      42.376  57.273  66.184  1.00  0.84           O  
ATOM   8232  CB  TYR B 186      45.246  56.915  66.309  1.00  0.84           C  
ATOM   8233  CG  TYR B 186      46.650  56.962  65.761  1.00  0.84           C  
ATOM   8234  CD1 TYR B 186      47.768  57.057  66.611  1.00  0.84           C  
ATOM   8235  CD2 TYR B 186      46.857  56.925  64.373  1.00  0.84           C  
ATOM   8236  CE1 TYR B 186      49.066  57.111  66.078  1.00  0.84           C  
ATOM   8237  CE2 TYR B 186      48.152  56.968  63.842  1.00  0.84           C  
ATOM   8238  CZ  TYR B 186      49.256  57.053  64.693  1.00  0.84           C  
ATOM   8239  OH  TYR B 186      50.553  57.057  64.145  1.00  0.84           O  
ATOM   8240  N   GLY B 187      42.630  59.239  67.246  1.00  0.86           N  
ATOM   8241  CA  GLY B 187      41.306  59.304  67.843  1.00  0.86           C  
ATOM   8242  C   GLY B 187      41.129  58.499  69.106  1.00  0.86           C  
ATOM   8243  O   GLY B 187      41.959  57.690  69.508  1.00  0.86           O  
ATOM   8244  N   ASN B 188      39.988  58.720  69.774  1.00  0.88           N  
ATOM   8245  CA  ASN B 188      39.614  58.056  71.002  1.00  0.88           C  
ATOM   8246  C   ASN B 188      38.317  57.310  70.707  1.00  0.88           C  
ATOM   8247  O   ASN B 188      37.336  57.957  70.340  1.00  0.88           O  
ATOM   8248  CB  ASN B 188      39.416  59.139  72.099  1.00  0.88           C  
ATOM   8249  CG  ASN B 188      38.896  58.613  73.435  1.00  0.88           C  
ATOM   8250  OD1 ASN B 188      38.816  57.410  73.688  1.00  0.88           O  
ATOM   8251  ND2 ASN B 188      38.504  59.552  74.327  1.00  0.88           N  
ATOM   8252  N   PRO B 189      38.205  55.990  70.827  1.00  0.92           N  
ATOM   8253  CA  PRO B 189      36.984  55.300  70.440  1.00  0.92           C  
ATOM   8254  C   PRO B 189      35.948  55.402  71.534  1.00  0.92           C  
ATOM   8255  O   PRO B 189      34.771  55.170  71.266  1.00  0.92           O  
ATOM   8256  CB  PRO B 189      37.445  53.849  70.222  1.00  0.92           C  
ATOM   8257  CG  PRO B 189      38.674  53.679  71.124  1.00  0.92           C  
ATOM   8258  CD  PRO B 189      39.311  55.069  71.115  1.00  0.92           C  
ATOM   8259  N   TRP B 190      36.352  55.720  72.774  1.00  0.88           N  
ATOM   8260  CA  TRP B 190      35.485  55.667  73.933  1.00  0.88           C  
ATOM   8261  C   TRP B 190      34.616  56.893  74.122  1.00  0.88           C  
ATOM   8262  O   TRP B 190      33.619  56.839  74.839  1.00  0.88           O  
ATOM   8263  CB  TRP B 190      36.336  55.475  75.209  1.00  0.88           C  
ATOM   8264  CG  TRP B 190      37.244  54.271  75.131  1.00  0.88           C  
ATOM   8265  CD1 TRP B 190      38.602  54.231  74.984  1.00  0.88           C  
ATOM   8266  CD2 TRP B 190      36.795  52.904  75.148  1.00  0.88           C  
ATOM   8267  NE1 TRP B 190      39.035  52.929  74.912  1.00  0.88           N  
ATOM   8268  CE2 TRP B 190      37.941  52.100  74.994  1.00  0.88           C  
ATOM   8269  CE3 TRP B 190      35.525  52.341  75.282  1.00  0.88           C  
ATOM   8270  CZ2 TRP B 190      37.841  50.719  74.964  1.00  0.88           C  
ATOM   8271  CZ3 TRP B 190      35.427  50.941  75.259  1.00  0.88           C  
ATOM   8272  CH2 TRP B 190      36.567  50.142  75.094  1.00  0.88           C  
ATOM   8273  N   GLU B 191      34.958  58.010  73.459  1.00  0.89           N  
ATOM   8274  CA  GLU B 191      34.232  59.258  73.566  1.00  0.89           C  
ATOM   8275  C   GLU B 191      33.238  59.443  72.426  1.00  0.89           C  
ATOM   8276  O   GLU B 191      33.312  58.820  71.363  1.00  0.89           O  
ATOM   8277  CB  GLU B 191      35.201  60.468  73.606  1.00  0.89           C  
ATOM   8278  CG  GLU B 191      35.953  60.729  72.275  1.00  0.89           C  
ATOM   8279  CD  GLU B 191      37.057  61.773  72.371  1.00  0.89           C  
ATOM   8280  OE1 GLU B 191      37.468  62.174  73.490  1.00  0.89           O  
ATOM   8281  OE2 GLU B 191      37.549  62.204  71.297  1.00  0.89           O  
ATOM   8282  N   LYS B 192      32.244  60.325  72.631  1.00  0.83           N  
ATOM   8283  CA  LYS B 192      31.358  60.762  71.578  1.00  0.83           C  
ATOM   8284  C   LYS B 192      31.122  62.262  71.638  1.00  0.83           C  
ATOM   8285  O   LYS B 192      30.523  62.783  72.576  1.00  0.83           O  
ATOM   8286  CB  LYS B 192      29.999  60.026  71.686  1.00  0.83           C  
ATOM   8287  CG  LYS B 192      28.977  60.392  70.597  1.00  0.83           C  
ATOM   8288  CD  LYS B 192      29.371  59.886  69.201  1.00  0.83           C  
ATOM   8289  CE  LYS B 192      28.558  60.558  68.094  1.00  0.83           C  
ATOM   8290  NZ  LYS B 192      28.841  59.906  66.797  1.00  0.83           N  
ATOM   8291  N   SER B 193      31.562  63.006  70.602  1.00  0.87           N  
ATOM   8292  CA  SER B 193      31.239  64.416  70.422  1.00  0.87           C  
ATOM   8293  C   SER B 193      29.766  64.703  70.165  1.00  0.87           C  
ATOM   8294  O   SER B 193      29.048  63.915  69.543  1.00  0.87           O  
ATOM   8295  CB  SER B 193      32.057  65.080  69.283  1.00  0.87           C  
ATOM   8296  OG  SER B 193      31.813  64.465  68.014  1.00  0.87           O  
ATOM   8297  N   ARG B 194      29.264  65.864  70.636  1.00  0.79           N  
ATOM   8298  CA  ARG B 194      27.897  66.292  70.373  1.00  0.79           C  
ATOM   8299  C   ARG B 194      27.822  67.605  69.582  1.00  0.79           C  
ATOM   8300  O   ARG B 194      27.525  68.644  70.172  1.00  0.79           O  
ATOM   8301  CB  ARG B 194      27.102  66.437  71.696  1.00  0.79           C  
ATOM   8302  CG  ARG B 194      27.194  65.214  72.639  1.00  0.79           C  
ATOM   8303  CD  ARG B 194      26.654  63.921  72.022  1.00  0.79           C  
ATOM   8304  NE  ARG B 194      26.652  62.889  73.092  1.00  0.79           N  
ATOM   8305  CZ  ARG B 194      26.006  61.724  73.017  1.00  0.79           C  
ATOM   8306  NH1 ARG B 194      25.487  61.257  71.891  1.00  0.79           N  
ATOM   8307  NH2 ARG B 194      25.865  61.030  74.140  1.00  0.79           N  
ATOM   8308  N   PRO B 195      28.043  67.658  68.263  1.00  0.77           N  
ATOM   8309  CA  PRO B 195      28.105  68.914  67.501  1.00  0.77           C  
ATOM   8310  C   PRO B 195      26.768  69.626  67.360  1.00  0.77           C  
ATOM   8311  O   PRO B 195      26.743  70.769  66.907  1.00  0.77           O  
ATOM   8312  CB  PRO B 195      28.649  68.465  66.132  1.00  0.77           C  
ATOM   8313  CG  PRO B 195      28.194  67.010  66.002  1.00  0.77           C  
ATOM   8314  CD  PRO B 195      28.362  66.497  67.428  1.00  0.77           C  
ATOM   8315  N   GLU B 196      25.645  69.001  67.761  1.00  0.75           N  
ATOM   8316  CA  GLU B 196      24.340  69.639  67.789  1.00  0.75           C  
ATOM   8317  C   GLU B 196      24.041  70.254  69.146  1.00  0.75           C  
ATOM   8318  O   GLU B 196      22.963  70.796  69.374  1.00  0.75           O  
ATOM   8319  CB  GLU B 196      23.217  68.618  67.497  1.00  0.75           C  
ATOM   8320  CG  GLU B 196      23.102  68.226  66.010  1.00  0.75           C  
ATOM   8321  CD  GLU B 196      21.789  67.512  65.729  1.00  0.75           C  
ATOM   8322  OE1 GLU B 196      21.117  67.934  64.749  1.00  0.75           O  
ATOM   8323  OE2 GLU B 196      21.440  66.550  66.452  1.00  0.75           O  
ATOM   8324  N   PHE B 197      24.999  70.213  70.087  1.00  0.79           N  
ATOM   8325  CA  PHE B 197      24.776  70.701  71.430  1.00  0.79           C  
ATOM   8326  C   PHE B 197      26.023  71.408  71.934  1.00  0.79           C  
ATOM   8327  O   PHE B 197      26.757  70.918  72.786  1.00  0.79           O  
ATOM   8328  CB  PHE B 197      24.346  69.529  72.359  1.00  0.79           C  
ATOM   8329  CG  PHE B 197      23.894  70.032  73.702  1.00  0.79           C  
ATOM   8330  CD1 PHE B 197      22.741  70.825  73.811  1.00  0.79           C  
ATOM   8331  CD2 PHE B 197      24.665  69.784  74.848  1.00  0.79           C  
ATOM   8332  CE1 PHE B 197      22.398  71.412  75.035  1.00  0.79           C  
ATOM   8333  CE2 PHE B 197      24.323  70.362  76.073  1.00  0.79           C  
ATOM   8334  CZ  PHE B 197      23.194  71.182  76.166  1.00  0.79           C  
ATOM   8335  N   MET B 198      26.285  72.612  71.398  1.00  0.79           N  
ATOM   8336  CA  MET B 198      27.421  73.421  71.785  1.00  0.79           C  
ATOM   8337  C   MET B 198      26.944  74.641  72.545  1.00  0.79           C  
ATOM   8338  O   MET B 198      26.024  75.338  72.120  1.00  0.79           O  
ATOM   8339  CB  MET B 198      28.243  73.888  70.562  1.00  0.79           C  
ATOM   8340  CG  MET B 198      28.820  72.720  69.742  1.00  0.79           C  
ATOM   8341  SD  MET B 198      30.059  73.229  68.512  1.00  0.79           S  
ATOM   8342  CE  MET B 198      28.888  73.936  67.318  1.00  0.79           C  
ATOM   8343  N   LEU B 199      27.549  74.917  73.715  1.00  0.88           N  
ATOM   8344  CA  LEU B 199      27.047  75.928  74.629  1.00  0.88           C  
ATOM   8345  C   LEU B 199      27.886  77.211  74.606  1.00  0.88           C  
ATOM   8346  O   LEU B 199      29.108  77.122  74.471  1.00  0.88           O  
ATOM   8347  CB  LEU B 199      26.978  75.373  76.073  1.00  0.88           C  
ATOM   8348  CG  LEU B 199      26.014  74.176  76.229  1.00  0.88           C  
ATOM   8349  CD1 LEU B 199      26.062  73.628  77.656  1.00  0.88           C  
ATOM   8350  CD2 LEU B 199      24.567  74.547  75.873  1.00  0.88           C  
ATOM   8351  N   PRO B 200      27.312  78.416  74.719  1.00  0.88           N  
ATOM   8352  CA  PRO B 200      28.072  79.650  74.521  1.00  0.88           C  
ATOM   8353  C   PRO B 200      28.645  80.206  75.816  1.00  0.88           C  
ATOM   8354  O   PRO B 200      27.920  80.678  76.691  1.00  0.88           O  
ATOM   8355  CB  PRO B 200      27.028  80.631  73.952  1.00  0.88           C  
ATOM   8356  CG  PRO B 200      25.704  80.151  74.550  1.00  0.88           C  
ATOM   8357  CD  PRO B 200      25.877  78.637  74.515  1.00  0.88           C  
ATOM   8358  N   VAL B 201      29.980  80.227  75.915  1.00  0.90           N  
ATOM   8359  CA  VAL B 201      30.722  80.736  77.051  1.00  0.90           C  
ATOM   8360  C   VAL B 201      31.204  82.143  76.743  1.00  0.90           C  
ATOM   8361  O   VAL B 201      31.949  82.383  75.797  1.00  0.90           O  
ATOM   8362  CB  VAL B 201      31.911  79.846  77.398  1.00  0.90           C  
ATOM   8363  CG1 VAL B 201      32.629  80.361  78.664  1.00  0.90           C  
ATOM   8364  CG2 VAL B 201      31.404  78.404  77.604  1.00  0.90           C  
ATOM   8365  N   HIS B 202      30.757  83.128  77.539  1.00  0.87           N  
ATOM   8366  CA  HIS B 202      31.041  84.535  77.314  1.00  0.87           C  
ATOM   8367  C   HIS B 202      32.250  85.034  78.083  1.00  0.87           C  
ATOM   8368  O   HIS B 202      32.464  84.686  79.240  1.00  0.87           O  
ATOM   8369  CB  HIS B 202      29.831  85.398  77.726  1.00  0.87           C  
ATOM   8370  CG  HIS B 202      28.625  85.111  76.888  1.00  0.87           C  
ATOM   8371  ND1 HIS B 202      28.363  85.897  75.787  1.00  0.87           N  
ATOM   8372  CD2 HIS B 202      27.708  84.113  76.979  1.00  0.87           C  
ATOM   8373  CE1 HIS B 202      27.293  85.367  75.226  1.00  0.87           C  
ATOM   8374  NE2 HIS B 202      26.856  84.282  75.909  1.00  0.87           N  
ATOM   8375  N   PHE B 203      33.063  85.896  77.453  1.00  0.88           N  
ATOM   8376  CA  PHE B 203      34.218  86.504  78.087  1.00  0.88           C  
ATOM   8377  C   PHE B 203      34.275  87.993  77.781  1.00  0.88           C  
ATOM   8378  O   PHE B 203      33.704  88.465  76.799  1.00  0.88           O  
ATOM   8379  CB  PHE B 203      35.538  85.880  77.566  1.00  0.88           C  
ATOM   8380  CG  PHE B 203      35.682  84.444  77.982  1.00  0.88           C  
ATOM   8381  CD1 PHE B 203      36.024  84.123  79.304  1.00  0.88           C  
ATOM   8382  CD2 PHE B 203      35.531  83.407  77.048  1.00  0.88           C  
ATOM   8383  CE1 PHE B 203      36.251  82.795  79.679  1.00  0.88           C  
ATOM   8384  CE2 PHE B 203      35.748  82.074  77.423  1.00  0.88           C  
ATOM   8385  CZ  PHE B 203      36.114  81.767  78.739  1.00  0.88           C  
ATOM   8386  N   TYR B 204      35.006  88.765  78.610  1.00  0.86           N  
ATOM   8387  CA  TYR B 204      35.184  90.208  78.508  1.00  0.86           C  
ATOM   8388  C   TYR B 204      33.879  90.998  78.528  1.00  0.86           C  
ATOM   8389  O   TYR B 204      32.999  90.746  79.343  1.00  0.86           O  
ATOM   8390  CB  TYR B 204      36.097  90.630  77.321  1.00  0.86           C  
ATOM   8391  CG  TYR B 204      37.380  89.844  77.323  1.00  0.86           C  
ATOM   8392  CD1 TYR B 204      37.532  88.758  76.449  1.00  0.86           C  
ATOM   8393  CD2 TYR B 204      38.433  90.169  78.195  1.00  0.86           C  
ATOM   8394  CE1 TYR B 204      38.702  87.992  76.460  1.00  0.86           C  
ATOM   8395  CE2 TYR B 204      39.610  89.402  78.209  1.00  0.86           C  
ATOM   8396  CZ  TYR B 204      39.737  88.310  77.341  1.00  0.86           C  
ATOM   8397  OH  TYR B 204      40.882  87.494  77.335  1.00  0.86           O  
ATOM   8398  N   GLY B 205      33.723  92.002  77.640  1.00  0.88           N  
ATOM   8399  CA  GLY B 205      32.552  92.868  77.637  1.00  0.88           C  
ATOM   8400  C   GLY B 205      32.393  93.789  78.813  1.00  0.88           C  
ATOM   8401  O   GLY B 205      33.355  94.235  79.435  1.00  0.88           O  
ATOM   8402  N   LYS B 206      31.139  94.147  79.115  1.00  0.82           N  
ATOM   8403  CA  LYS B 206      30.836  95.142  80.116  1.00  0.82           C  
ATOM   8404  C   LYS B 206      29.450  94.919  80.671  1.00  0.82           C  
ATOM   8405  O   LYS B 206      28.613  94.224  80.095  1.00  0.82           O  
ATOM   8406  CB  LYS B 206      30.932  96.582  79.542  1.00  0.82           C  
ATOM   8407  CG  LYS B 206      29.996  96.815  78.348  1.00  0.82           C  
ATOM   8408  CD  LYS B 206      30.242  98.130  77.598  1.00  0.82           C  
ATOM   8409  CE  LYS B 206      29.710  99.381  78.283  1.00  0.82           C  
ATOM   8410  NZ  LYS B 206      29.842 100.505  77.333  1.00  0.82           N  
ATOM   8411  N   VAL B 207      29.176  95.504  81.848  1.00  0.86           N  
ATOM   8412  CA  VAL B 207      27.886  95.386  82.495  1.00  0.86           C  
ATOM   8413  C   VAL B 207      27.022  96.583  82.160  1.00  0.86           C  
ATOM   8414  O   VAL B 207      27.460  97.732  82.198  1.00  0.86           O  
ATOM   8415  CB  VAL B 207      28.005  95.233  84.003  1.00  0.86           C  
ATOM   8416  CG1 VAL B 207      26.618  95.054  84.643  1.00  0.86           C  
ATOM   8417  CG2 VAL B 207      28.855  93.988  84.307  1.00  0.86           C  
ATOM   8418  N   GLU B 208      25.753  96.320  81.815  1.00  0.83           N  
ATOM   8419  CA  GLU B 208      24.749  97.327  81.581  1.00  0.83           C  
ATOM   8420  C   GLU B 208      23.607  97.061  82.544  1.00  0.83           C  
ATOM   8421  O   GLU B 208      23.009  95.988  82.566  1.00  0.83           O  
ATOM   8422  CB  GLU B 208      24.248  97.248  80.125  1.00  0.83           C  
ATOM   8423  CG  GLU B 208      23.136  98.254  79.755  1.00  0.83           C  
ATOM   8424  CD  GLU B 208      22.535  97.914  78.393  1.00  0.83           C  
ATOM   8425  OE1 GLU B 208      22.011  96.778  78.249  1.00  0.83           O  
ATOM   8426  OE2 GLU B 208      22.578  98.801  77.505  1.00  0.83           O  
ATOM   8427  N   HIS B 209      23.276  98.025  83.420  1.00  0.81           N  
ATOM   8428  CA  HIS B 209      22.190  97.845  84.369  1.00  0.81           C  
ATOM   8429  C   HIS B 209      20.904  98.416  83.782  1.00  0.81           C  
ATOM   8430  O   HIS B 209      20.662  99.619  83.847  1.00  0.81           O  
ATOM   8431  CB  HIS B 209      22.527  98.508  85.726  1.00  0.81           C  
ATOM   8432  CG  HIS B 209      23.640  97.801  86.464  1.00  0.81           C  
ATOM   8433  ND1 HIS B 209      23.312  96.923  87.481  1.00  0.81           N  
ATOM   8434  CD2 HIS B 209      24.993  97.844  86.306  1.00  0.81           C  
ATOM   8435  CE1 HIS B 209      24.466  96.458  87.921  1.00  0.81           C  
ATOM   8436  NE2 HIS B 209      25.513  96.977  87.245  1.00  0.81           N  
ATOM   8437  N   THR B 210      20.049  97.576  83.153  1.00  0.79           N  
ATOM   8438  CA  THR B 210      18.847  98.059  82.470  1.00  0.79           C  
ATOM   8439  C   THR B 210      17.626  98.094  83.367  1.00  0.79           C  
ATOM   8440  O   THR B 210      17.627  97.665  84.517  1.00  0.79           O  
ATOM   8441  CB  THR B 210      18.469  97.349  81.158  1.00  0.79           C  
ATOM   8442  OG1 THR B 210      17.826  96.091  81.336  1.00  0.79           O  
ATOM   8443  CG2 THR B 210      19.719  97.104  80.323  1.00  0.79           C  
ATOM   8444  N   ASN B 211      16.496  98.600  82.827  1.00  0.73           N  
ATOM   8445  CA  ASN B 211      15.208  98.616  83.501  1.00  0.73           C  
ATOM   8446  C   ASN B 211      14.711  97.203  83.815  1.00  0.73           C  
ATOM   8447  O   ASN B 211      14.060  96.948  84.822  1.00  0.73           O  
ATOM   8448  CB  ASN B 211      14.120  99.311  82.635  1.00  0.73           C  
ATOM   8449  CG  ASN B 211      14.481 100.689  82.073  1.00  0.73           C  
ATOM   8450  OD1 ASN B 211      13.818 101.139  81.141  1.00  0.73           O  
ATOM   8451  ND2 ASN B 211      15.516 101.384  82.592  1.00  0.73           N  
ATOM   8452  N   THR B 212      15.030  96.245  82.924  1.00  0.71           N  
ATOM   8453  CA  THR B 212      14.643  94.842  83.003  1.00  0.71           C  
ATOM   8454  C   THR B 212      15.797  93.970  83.467  1.00  0.71           C  
ATOM   8455  O   THR B 212      15.998  92.831  83.033  1.00  0.71           O  
ATOM   8456  CB  THR B 212      14.047  94.309  81.709  1.00  0.71           C  
ATOM   8457  OG1 THR B 212      14.893  94.558  80.591  1.00  0.71           O  
ATOM   8458  CG2 THR B 212      12.719  95.040  81.457  1.00  0.71           C  
ATOM   8459  N   GLY B 213      16.600  94.511  84.401  1.00  0.82           N  
ATOM   8460  CA  GLY B 213      17.641  93.804  85.130  1.00  0.82           C  
ATOM   8461  C   GLY B 213      19.004  93.968  84.535  1.00  0.82           C  
ATOM   8462  O   GLY B 213      19.190  94.467  83.427  1.00  0.82           O  
ATOM   8463  N   THR B 214      20.026  93.492  85.247  1.00  0.84           N  
ATOM   8464  CA  THR B 214      21.415  93.521  84.816  1.00  0.84           C  
ATOM   8465  C   THR B 214      21.672  92.736  83.539  1.00  0.84           C  
ATOM   8466  O   THR B 214      21.071  91.692  83.276  1.00  0.84           O  
ATOM   8467  CB  THR B 214      22.358  93.068  85.921  1.00  0.84           C  
ATOM   8468  OG1 THR B 214      21.887  93.552  87.169  1.00  0.84           O  
ATOM   8469  CG2 THR B 214      23.750  93.672  85.728  1.00  0.84           C  
ATOM   8470  N   LYS B 215      22.535  93.270  82.660  1.00  0.84           N  
ATOM   8471  CA  LYS B 215      22.911  92.669  81.401  1.00  0.84           C  
ATOM   8472  C   LYS B 215      24.419  92.651  81.296  1.00  0.84           C  
ATOM   8473  O   LYS B 215      25.118  93.532  81.791  1.00  0.84           O  
ATOM   8474  CB  LYS B 215      22.327  93.437  80.181  1.00  0.84           C  
ATOM   8475  CG  LYS B 215      20.792  93.527  80.149  1.00  0.84           C  
ATOM   8476  CD  LYS B 215      20.108  92.165  79.949  1.00  0.84           C  
ATOM   8477  CE  LYS B 215      18.629  92.150  80.350  1.00  0.84           C  
ATOM   8478  NZ  LYS B 215      18.499  92.336  81.807  1.00  0.84           N  
ATOM   8479  N   TRP B 216      24.960  91.614  80.641  1.00  0.81           N  
ATOM   8480  CA  TRP B 216      26.368  91.486  80.348  1.00  0.81           C  
ATOM   8481  C   TRP B 216      26.453  91.497  78.836  1.00  0.81           C  
ATOM   8482  O   TRP B 216      25.884  90.634  78.172  1.00  0.81           O  
ATOM   8483  CB  TRP B 216      26.912  90.169  80.962  1.00  0.81           C  
ATOM   8484  CG  TRP B 216      28.403  89.880  80.823  1.00  0.81           C  
ATOM   8485  CD1 TRP B 216      29.442  90.709  80.498  1.00  0.81           C  
ATOM   8486  CD2 TRP B 216      28.954  88.576  81.030  1.00  0.81           C  
ATOM   8487  NE1 TRP B 216      30.611  89.991  80.493  1.00  0.81           N  
ATOM   8488  CE2 TRP B 216      30.362  88.686  80.802  1.00  0.81           C  
ATOM   8489  CE3 TRP B 216      28.386  87.356  81.369  1.00  0.81           C  
ATOM   8490  CZ2 TRP B 216      31.177  87.578  80.909  1.00  0.81           C  
ATOM   8491  CZ3 TRP B 216      29.220  86.239  81.476  1.00  0.81           C  
ATOM   8492  CH2 TRP B 216      30.603  86.348  81.252  1.00  0.81           C  
ATOM   8493  N   ILE B 217      27.104  92.531  78.278  1.00  0.86           N  
ATOM   8494  CA  ILE B 217      27.068  92.842  76.857  1.00  0.86           C  
ATOM   8495  C   ILE B 217      28.481  93.056  76.349  1.00  0.86           C  
ATOM   8496  O   ILE B 217      29.429  93.077  77.133  1.00  0.86           O  
ATOM   8497  CB  ILE B 217      26.211  94.067  76.521  1.00  0.86           C  
ATOM   8498  CG1 ILE B 217      26.733  95.358  77.194  1.00  0.86           C  
ATOM   8499  CG2 ILE B 217      24.744  93.784  76.913  1.00  0.86           C  
ATOM   8500  CD1 ILE B 217      26.040  96.628  76.687  1.00  0.86           C  
ATOM   8501  N   ASP B 218      28.652  93.175  75.013  1.00  0.84           N  
ATOM   8502  CA  ASP B 218      29.913  93.405  74.317  1.00  0.84           C  
ATOM   8503  C   ASP B 218      30.942  92.289  74.530  1.00  0.84           C  
ATOM   8504  O   ASP B 218      32.153  92.499  74.595  1.00  0.84           O  
ATOM   8505  CB  ASP B 218      30.492  94.809  74.647  1.00  0.84           C  
ATOM   8506  CG  ASP B 218      29.558  95.944  74.249  1.00  0.84           C  
ATOM   8507  OD1 ASP B 218      28.497  95.680  73.630  1.00  0.84           O  
ATOM   8508  OD2 ASP B 218      29.914  97.110  74.570  1.00  0.84           O  
ATOM   8509  N   THR B 219      30.455  91.042  74.634  1.00  0.85           N  
ATOM   8510  CA  THR B 219      31.235  89.874  75.010  1.00  0.85           C  
ATOM   8511  C   THR B 219      31.881  89.152  73.844  1.00  0.85           C  
ATOM   8512  O   THR B 219      31.457  89.217  72.691  1.00  0.85           O  
ATOM   8513  CB  THR B 219      30.420  88.841  75.786  1.00  0.85           C  
ATOM   8514  OG1 THR B 219      29.244  88.471  75.076  1.00  0.85           O  
ATOM   8515  CG2 THR B 219      29.967  89.461  77.111  1.00  0.85           C  
ATOM   8516  N   GLN B 220      32.950  88.389  74.136  1.00  0.80           N  
ATOM   8517  CA  GLN B 220      33.517  87.439  73.202  1.00  0.80           C  
ATOM   8518  C   GLN B 220      32.963  86.067  73.524  1.00  0.80           C  
ATOM   8519  O   GLN B 220      33.125  85.570  74.636  1.00  0.80           O  
ATOM   8520  CB  GLN B 220      35.062  87.375  73.285  1.00  0.80           C  
ATOM   8521  CG  GLN B 220      35.733  88.718  72.910  1.00  0.80           C  
ATOM   8522  CD  GLN B 220      37.264  88.701  72.954  1.00  0.80           C  
ATOM   8523  OE1 GLN B 220      37.900  89.750  73.033  1.00  0.80           O  
ATOM   8524  NE2 GLN B 220      37.886  87.502  72.915  1.00  0.80           N  
ATOM   8525  N   VAL B 221      32.288  85.417  72.561  1.00  0.83           N  
ATOM   8526  CA  VAL B 221      31.729  84.091  72.760  1.00  0.83           C  
ATOM   8527  C   VAL B 221      32.733  83.023  72.357  1.00  0.83           C  
ATOM   8528  O   VAL B 221      33.371  83.090  71.310  1.00  0.83           O  
ATOM   8529  CB  VAL B 221      30.425  83.891  71.987  1.00  0.83           C  
ATOM   8530  CG1 VAL B 221      29.840  82.478  72.208  1.00  0.83           C  
ATOM   8531  CG2 VAL B 221      29.397  84.940  72.447  1.00  0.83           C  
ATOM   8532  N   VAL B 222      32.882  81.991  73.198  1.00  0.86           N  
ATOM   8533  CA  VAL B 222      33.613  80.773  72.911  1.00  0.86           C  
ATOM   8534  C   VAL B 222      32.597  79.656  73.021  1.00  0.86           C  
ATOM   8535  O   VAL B 222      31.741  79.667  73.899  1.00  0.86           O  
ATOM   8536  CB  VAL B 222      34.754  80.557  73.900  1.00  0.86           C  
ATOM   8537  CG1 VAL B 222      35.404  79.170  73.731  1.00  0.86           C  
ATOM   8538  CG2 VAL B 222      35.800  81.668  73.684  1.00  0.86           C  
ATOM   8539  N   LEU B 223      32.614  78.660  72.121  1.00  0.83           N  
ATOM   8540  CA  LEU B 223      31.693  77.546  72.209  1.00  0.83           C  
ATOM   8541  C   LEU B 223      32.285  76.386  72.979  1.00  0.83           C  
ATOM   8542  O   LEU B 223      33.459  76.044  72.847  1.00  0.83           O  
ATOM   8543  CB  LEU B 223      31.269  77.006  70.827  1.00  0.83           C  
ATOM   8544  CG  LEU B 223      30.500  77.996  69.935  1.00  0.83           C  
ATOM   8545  CD1 LEU B 223      30.085  77.283  68.642  1.00  0.83           C  
ATOM   8546  CD2 LEU B 223      29.265  78.595  70.625  1.00  0.83           C  
ATOM   8547  N   ALA B 224      31.449  75.728  73.795  1.00  0.92           N  
ATOM   8548  CA  ALA B 224      31.812  74.529  74.498  1.00  0.92           C  
ATOM   8549  C   ALA B 224      31.160  73.327  73.843  1.00  0.92           C  
ATOM   8550  O   ALA B 224      29.949  73.132  73.919  1.00  0.92           O  
ATOM   8551  CB  ALA B 224      31.372  74.645  75.965  1.00  0.92           C  
ATOM   8552  N   LEU B 225      31.972  72.482  73.180  1.00  0.89           N  
ATOM   8553  CA  LEU B 225      31.542  71.257  72.535  1.00  0.89           C  
ATOM   8554  C   LEU B 225      31.755  70.087  73.487  1.00  0.89           C  
ATOM   8555  O   LEU B 225      32.909  69.808  73.824  1.00  0.89           O  
ATOM   8556  CB  LEU B 225      32.392  71.040  71.252  1.00  0.89           C  
ATOM   8557  CG  LEU B 225      32.235  69.692  70.508  1.00  0.89           C  
ATOM   8558  CD1 LEU B 225      30.812  69.470  69.995  1.00  0.89           C  
ATOM   8559  CD2 LEU B 225      33.225  69.617  69.333  1.00  0.89           C  
ATOM   8560  N   PRO B 226      30.749  69.377  73.978  1.00  0.94           N  
ATOM   8561  CA  PRO B 226      30.954  68.272  74.891  1.00  0.94           C  
ATOM   8562  C   PRO B 226      31.292  66.984  74.191  1.00  0.94           C  
ATOM   8563  O   PRO B 226      30.845  66.711  73.073  1.00  0.94           O  
ATOM   8564  CB  PRO B 226      29.615  68.128  75.608  1.00  0.94           C  
ATOM   8565  CG  PRO B 226      28.586  68.591  74.584  1.00  0.94           C  
ATOM   8566  CD  PRO B 226      29.329  69.656  73.774  1.00  0.94           C  
ATOM   8567  N   TYR B 227      32.100  66.178  74.883  1.00  0.91           N  
ATOM   8568  CA  TYR B 227      32.430  64.833  74.504  1.00  0.91           C  
ATOM   8569  C   TYR B 227      32.003  63.941  75.650  1.00  0.91           C  
ATOM   8570  O   TYR B 227      32.453  64.112  76.784  1.00  0.91           O  
ATOM   8571  CB  TYR B 227      33.951  64.660  74.269  1.00  0.91           C  
ATOM   8572  CG  TYR B 227      34.393  65.266  72.956  1.00  0.91           C  
ATOM   8573  CD1 TYR B 227      34.875  64.445  71.922  1.00  0.91           C  
ATOM   8574  CD2 TYR B 227      34.401  66.658  72.759  1.00  0.91           C  
ATOM   8575  CE1 TYR B 227      35.367  64.997  70.729  1.00  0.91           C  
ATOM   8576  CE2 TYR B 227      34.845  67.207  71.549  1.00  0.91           C  
ATOM   8577  CZ  TYR B 227      35.335  66.381  70.537  1.00  0.91           C  
ATOM   8578  OH  TYR B 227      35.756  66.961  69.322  1.00  0.91           O  
ATOM   8579  N   ASP B 228      31.108  62.979  75.368  1.00  0.92           N  
ATOM   8580  CA  ASP B 228      30.569  62.080  76.365  1.00  0.92           C  
ATOM   8581  C   ASP B 228      31.318  60.755  76.352  1.00  0.92           C  
ATOM   8582  O   ASP B 228      31.403  60.083  75.326  1.00  0.92           O  
ATOM   8583  CB  ASP B 228      29.071  61.783  76.084  1.00  0.92           C  
ATOM   8584  CG  ASP B 228      28.190  62.991  76.293  1.00  0.92           C  
ATOM   8585  OD1 ASP B 228      27.028  62.955  75.796  1.00  0.92           O  
ATOM   8586  OD2 ASP B 228      28.594  63.986  76.933  1.00  0.92           O  
ATOM   8587  N   THR B 229      31.854  60.336  77.510  1.00  0.93           N  
ATOM   8588  CA  THR B 229      32.536  59.057  77.675  1.00  0.93           C  
ATOM   8589  C   THR B 229      31.775  58.262  78.726  1.00  0.93           C  
ATOM   8590  O   THR B 229      31.581  58.782  79.829  1.00  0.93           O  
ATOM   8591  CB  THR B 229      33.979  59.188  78.151  1.00  0.93           C  
ATOM   8592  OG1 THR B 229      34.765  59.872  77.185  1.00  0.93           O  
ATOM   8593  CG2 THR B 229      34.641  57.814  78.350  1.00  0.93           C  
ATOM   8594  N   PRO B 230      31.299  57.038  78.501  1.00  0.96           N  
ATOM   8595  CA  PRO B 230      30.576  56.283  79.520  1.00  0.96           C  
ATOM   8596  C   PRO B 230      31.494  55.691  80.589  1.00  0.96           C  
ATOM   8597  O   PRO B 230      32.584  55.220  80.270  1.00  0.96           O  
ATOM   8598  CB  PRO B 230      29.853  55.179  78.720  1.00  0.96           C  
ATOM   8599  CG  PRO B 230      29.932  55.597  77.249  1.00  0.96           C  
ATOM   8600  CD  PRO B 230      31.233  56.383  77.194  1.00  0.96           C  
ATOM   8601  N   VAL B 231      31.065  55.689  81.867  1.00  0.97           N  
ATOM   8602  CA  VAL B 231      31.831  55.150  82.986  1.00  0.97           C  
ATOM   8603  C   VAL B 231      31.112  53.934  83.576  1.00  0.97           C  
ATOM   8604  O   VAL B 231      30.013  54.102  84.113  1.00  0.97           O  
ATOM   8605  CB  VAL B 231      32.020  56.161  84.113  1.00  0.97           C  
ATOM   8606  CG1 VAL B 231      32.894  55.549  85.229  1.00  0.97           C  
ATOM   8607  CG2 VAL B 231      32.682  57.438  83.560  1.00  0.97           C  
ATOM   8608  N   PRO B 232      31.637  52.710  83.530  1.00  0.96           N  
ATOM   8609  CA  PRO B 232      30.875  51.526  83.925  1.00  0.96           C  
ATOM   8610  C   PRO B 232      31.055  51.128  85.376  1.00  0.96           C  
ATOM   8611  O   PRO B 232      32.176  50.922  85.834  1.00  0.96           O  
ATOM   8612  CB  PRO B 232      31.447  50.422  83.023  1.00  0.96           C  
ATOM   8613  CG  PRO B 232      32.901  50.838  82.777  1.00  0.96           C  
ATOM   8614  CD  PRO B 232      32.816  52.362  82.725  1.00  0.96           C  
ATOM   8615  N   GLY B 233      29.948  50.969  86.126  1.00  0.95           N  
ATOM   8616  CA  GLY B 233      29.958  50.317  87.431  1.00  0.95           C  
ATOM   8617  C   GLY B 233      30.262  48.844  87.375  1.00  0.95           C  
ATOM   8618  O   GLY B 233      30.053  48.178  86.364  1.00  0.95           O  
ATOM   8619  N   TYR B 234      30.754  48.274  88.486  1.00  0.90           N  
ATOM   8620  CA  TYR B 234      31.077  46.861  88.552  1.00  0.90           C  
ATOM   8621  C   TYR B 234      29.856  45.944  88.610  1.00  0.90           C  
ATOM   8622  O   TYR B 234      29.191  45.825  89.640  1.00  0.90           O  
ATOM   8623  CB  TYR B 234      31.997  46.601  89.771  1.00  0.90           C  
ATOM   8624  CG  TYR B 234      32.498  45.180  89.834  1.00  0.90           C  
ATOM   8625  CD1 TYR B 234      33.519  44.743  88.976  1.00  0.90           C  
ATOM   8626  CD2 TYR B 234      31.923  44.266  90.733  1.00  0.90           C  
ATOM   8627  CE1 TYR B 234      33.964  43.415  89.025  1.00  0.90           C  
ATOM   8628  CE2 TYR B 234      32.352  42.932  90.766  1.00  0.90           C  
ATOM   8629  CZ  TYR B 234      33.381  42.510  89.918  1.00  0.90           C  
ATOM   8630  OH  TYR B 234      33.845  41.182  89.945  1.00  0.90           O  
ATOM   8631  N   MET B 235      29.576  45.244  87.490  1.00  0.87           N  
ATOM   8632  CA  MET B 235      28.660  44.119  87.377  1.00  0.87           C  
ATOM   8633  C   MET B 235      27.193  44.405  87.674  1.00  0.87           C  
ATOM   8634  O   MET B 235      26.376  43.499  87.822  1.00  0.87           O  
ATOM   8635  CB  MET B 235      29.164  42.889  88.180  1.00  0.87           C  
ATOM   8636  CG  MET B 235      30.489  42.303  87.651  1.00  0.87           C  
ATOM   8637  SD  MET B 235      30.464  41.777  85.911  1.00  0.87           S  
ATOM   8638  CE  MET B 235      29.150  40.527  86.011  1.00  0.87           C  
ATOM   8639  N   ASN B 236      26.798  45.688  87.703  1.00  0.85           N  
ATOM   8640  CA  ASN B 236      25.440  46.093  88.012  1.00  0.85           C  
ATOM   8641  C   ASN B 236      24.715  46.634  86.788  1.00  0.85           C  
ATOM   8642  O   ASN B 236      23.559  47.037  86.864  1.00  0.85           O  
ATOM   8643  CB  ASN B 236      25.443  47.129  89.173  1.00  0.85           C  
ATOM   8644  CG  ASN B 236      26.221  48.405  88.853  1.00  0.85           C  
ATOM   8645  OD1 ASN B 236      26.839  48.564  87.798  1.00  0.85           O  
ATOM   8646  ND2 ASN B 236      26.185  49.369  89.799  1.00  0.85           N  
ATOM   8647  N   ASN B 237      25.401  46.657  85.627  1.00  0.82           N  
ATOM   8648  CA  ASN B 237      24.951  47.244  84.372  1.00  0.82           C  
ATOM   8649  C   ASN B 237      24.818  48.761  84.415  1.00  0.82           C  
ATOM   8650  O   ASN B 237      24.297  49.361  83.478  1.00  0.82           O  
ATOM   8651  CB  ASN B 237      23.624  46.644  83.821  1.00  0.82           C  
ATOM   8652  CG  ASN B 237      23.818  45.215  83.355  1.00  0.82           C  
ATOM   8653  OD1 ASN B 237      24.885  44.815  82.888  1.00  0.82           O  
ATOM   8654  ND2 ASN B 237      22.724  44.421  83.401  1.00  0.82           N  
ATOM   8655  N   THR B 238      25.320  49.434  85.464  1.00  0.89           N  
ATOM   8656  CA  THR B 238      25.095  50.861  85.637  1.00  0.89           C  
ATOM   8657  C   THR B 238      26.219  51.650  85.027  1.00  0.89           C  
ATOM   8658  O   THR B 238      27.298  51.793  85.598  1.00  0.89           O  
ATOM   8659  CB  THR B 238      24.969  51.291  87.088  1.00  0.89           C  
ATOM   8660  OG1 THR B 238      23.890  50.599  87.694  1.00  0.89           O  
ATOM   8661  CG2 THR B 238      24.645  52.786  87.204  1.00  0.89           C  
ATOM   8662  N   VAL B 239      26.001  52.208  83.826  1.00  0.93           N  
ATOM   8663  CA  VAL B 239      27.001  53.024  83.165  1.00  0.93           C  
ATOM   8664  C   VAL B 239      26.617  54.498  83.233  1.00  0.93           C  
ATOM   8665  O   VAL B 239      25.581  54.932  82.730  1.00  0.93           O  
ATOM   8666  CB  VAL B 239      27.240  52.569  81.737  1.00  0.93           C  
ATOM   8667  CG1 VAL B 239      28.454  53.294  81.143  1.00  0.93           C  
ATOM   8668  CG2 VAL B 239      27.489  51.048  81.705  1.00  0.93           C  
ATOM   8669  N   ASN B 240      27.461  55.303  83.904  1.00  0.94           N  
ATOM   8670  CA  ASN B 240      27.284  56.730  84.111  1.00  0.94           C  
ATOM   8671  C   ASN B 240      28.012  57.557  83.055  1.00  0.94           C  
ATOM   8672  O   ASN B 240      28.663  57.022  82.164  1.00  0.94           O  
ATOM   8673  CB  ASN B 240      27.763  57.132  85.527  1.00  0.94           C  
ATOM   8674  CG  ASN B 240      26.730  56.728  86.573  1.00  0.94           C  
ATOM   8675  OD1 ASN B 240      25.572  56.415  86.291  1.00  0.94           O  
ATOM   8676  ND2 ASN B 240      27.150  56.779  87.856  1.00  0.94           N  
ATOM   8677  N   THR B 241      27.901  58.902  83.112  1.00  0.94           N  
ATOM   8678  CA  THR B 241      28.426  59.792  82.070  1.00  0.94           C  
ATOM   8679  C   THR B 241      29.585  60.627  82.572  1.00  0.94           C  
ATOM   8680  O   THR B 241      29.484  61.335  83.572  1.00  0.94           O  
ATOM   8681  CB  THR B 241      27.386  60.801  81.568  1.00  0.94           C  
ATOM   8682  OG1 THR B 241      26.214  60.140  81.123  1.00  0.94           O  
ATOM   8683  CG2 THR B 241      27.900  61.621  80.374  1.00  0.94           C  
ATOM   8684  N   MET B 242      30.720  60.626  81.851  1.00  0.94           N  
ATOM   8685  CA  MET B 242      31.736  61.644  82.009  1.00  0.94           C  
ATOM   8686  C   MET B 242      31.639  62.555  80.796  1.00  0.94           C  
ATOM   8687  O   MET B 242      31.742  62.098  79.662  1.00  0.94           O  
ATOM   8688  CB  MET B 242      33.143  61.016  82.131  1.00  0.94           C  
ATOM   8689  CG  MET B 242      34.265  62.056  82.301  1.00  0.94           C  
ATOM   8690  SD  MET B 242      35.927  61.371  82.552  1.00  0.94           S  
ATOM   8691  CE  MET B 242      36.095  60.657  80.892  1.00  0.94           C  
ATOM   8692  N   ARG B 243      31.393  63.862  81.001  1.00  0.90           N  
ATOM   8693  CA  ARG B 243      31.204  64.816  79.925  1.00  0.90           C  
ATOM   8694  C   ARG B 243      32.267  65.890  80.004  1.00  0.90           C  
ATOM   8695  O   ARG B 243      32.377  66.642  80.972  1.00  0.90           O  
ATOM   8696  CB  ARG B 243      29.796  65.457  79.976  1.00  0.90           C  
ATOM   8697  CG  ARG B 243      29.592  66.624  78.984  1.00  0.90           C  
ATOM   8698  CD  ARG B 243      28.136  67.082  78.827  1.00  0.90           C  
ATOM   8699  NE  ARG B 243      27.421  66.050  78.026  1.00  0.90           N  
ATOM   8700  CZ  ARG B 243      26.286  66.268  77.360  1.00  0.90           C  
ATOM   8701  NH1 ARG B 243      25.491  67.300  77.621  1.00  0.90           N  
ATOM   8702  NH2 ARG B 243      25.932  65.408  76.409  1.00  0.90           N  
ATOM   8703  N   LEU B 244      33.109  65.978  78.963  1.00  0.95           N  
ATOM   8704  CA  LEU B 244      34.246  66.874  78.967  1.00  0.95           C  
ATOM   8705  C   LEU B 244      34.091  67.891  77.856  1.00  0.95           C  
ATOM   8706  O   LEU B 244      33.823  67.555  76.703  1.00  0.95           O  
ATOM   8707  CB  LEU B 244      35.564  66.097  78.730  1.00  0.95           C  
ATOM   8708  CG  LEU B 244      36.259  65.406  79.926  1.00  0.95           C  
ATOM   8709  CD1 LEU B 244      35.422  65.270  81.199  1.00  0.95           C  
ATOM   8710  CD2 LEU B 244      36.761  64.031  79.480  1.00  0.95           C  
ATOM   8711  N   TRP B 245      34.267  69.184  78.179  1.00  0.92           N  
ATOM   8712  CA  TRP B 245      34.076  70.266  77.232  1.00  0.92           C  
ATOM   8713  C   TRP B 245      35.331  70.570  76.424  1.00  0.92           C  
ATOM   8714  O   TRP B 245      36.451  70.598  76.932  1.00  0.92           O  
ATOM   8715  CB  TRP B 245      33.605  71.562  77.938  1.00  0.92           C  
ATOM   8716  CG  TRP B 245      32.396  71.375  78.830  1.00  0.92           C  
ATOM   8717  CD1 TRP B 245      32.360  71.240  80.190  1.00  0.92           C  
ATOM   8718  CD2 TRP B 245      31.025  71.287  78.386  1.00  0.92           C  
ATOM   8719  NE1 TRP B 245      31.066  71.058  80.626  1.00  0.92           N  
ATOM   8720  CE2 TRP B 245      30.239  71.073  79.526  1.00  0.92           C  
ATOM   8721  CE3 TRP B 245      30.451  71.387  77.117  1.00  0.92           C  
ATOM   8722  CZ2 TRP B 245      28.859  70.928  79.433  1.00  0.92           C  
ATOM   8723  CZ3 TRP B 245      29.050  71.300  77.033  1.00  0.92           C  
ATOM   8724  CH2 TRP B 245      28.272  71.046  78.166  1.00  0.92           C  
ATOM   8725  N   SER B 246      35.155  70.808  75.116  1.00  0.94           N  
ATOM   8726  CA  SER B 246      36.206  71.121  74.163  1.00  0.94           C  
ATOM   8727  C   SER B 246      35.912  72.483  73.582  1.00  0.94           C  
ATOM   8728  O   SER B 246      34.803  72.746  73.118  1.00  0.94           O  
ATOM   8729  CB  SER B 246      36.218  70.059  73.035  1.00  0.94           C  
ATOM   8730  OG  SER B 246      37.319  70.170  72.128  1.00  0.94           O  
ATOM   8731  N   ALA B 247      36.878  73.413  73.645  1.00  0.91           N  
ATOM   8732  CA  ALA B 247      36.674  74.781  73.228  1.00  0.91           C  
ATOM   8733  C   ALA B 247      36.727  74.948  71.719  1.00  0.91           C  
ATOM   8734  O   ALA B 247      37.565  74.367  71.032  1.00  0.91           O  
ATOM   8735  CB  ALA B 247      37.698  75.700  73.908  1.00  0.91           C  
ATOM   8736  N   ARG B 248      35.791  75.739  71.162  1.00  0.75           N  
ATOM   8737  CA  ARG B 248      35.677  75.977  69.739  1.00  0.75           C  
ATOM   8738  C   ARG B 248      35.254  77.415  69.533  1.00  0.75           C  
ATOM   8739  O   ARG B 248      34.673  78.047  70.411  1.00  0.75           O  
ATOM   8740  CB  ARG B 248      34.623  75.043  69.069  1.00  0.75           C  
ATOM   8741  CG  ARG B 248      34.947  73.537  69.180  1.00  0.75           C  
ATOM   8742  CD  ARG B 248      36.228  73.132  68.439  1.00  0.75           C  
ATOM   8743  NE  ARG B 248      36.700  71.846  69.048  1.00  0.75           N  
ATOM   8744  CZ  ARG B 248      36.718  70.663  68.425  1.00  0.75           C  
ATOM   8745  NH1 ARG B 248      36.027  70.448  67.311  1.00  0.75           N  
ATOM   8746  NH2 ARG B 248      37.429  69.671  68.956  1.00  0.75           N  
ATOM   8747  N   ALA B 249      35.549  78.001  68.363  1.00  0.77           N  
ATOM   8748  CA  ALA B 249      35.080  79.331  68.041  1.00  0.77           C  
ATOM   8749  C   ALA B 249      33.642  79.299  67.514  1.00  0.77           C  
ATOM   8750  O   ALA B 249      33.244  78.279  66.952  1.00  0.77           O  
ATOM   8751  CB  ALA B 249      36.011  79.972  67.006  1.00  0.77           C  
ATOM   8752  N   PRO B 250      32.818  80.344  67.655  1.00  0.72           N  
ATOM   8753  CA  PRO B 250      31.469  80.375  67.085  1.00  0.72           C  
ATOM   8754  C   PRO B 250      31.465  80.330  65.579  1.00  0.72           C  
ATOM   8755  O   PRO B 250      30.601  79.698  64.977  1.00  0.72           O  
ATOM   8756  CB  PRO B 250      30.870  81.686  67.612  1.00  0.72           C  
ATOM   8757  CG  PRO B 250      31.602  81.901  68.932  1.00  0.72           C  
ATOM   8758  CD  PRO B 250      33.017  81.416  68.630  1.00  0.72           C  
ATOM   8759  N   ASN B 251      32.444  81.004  64.969  1.00  0.67           N  
ATOM   8760  CA  ASN B 251      32.746  80.900  63.571  1.00  0.67           C  
ATOM   8761  C   ASN B 251      34.219  80.552  63.539  1.00  0.67           C  
ATOM   8762  O   ASN B 251      35.061  81.324  63.984  1.00  0.67           O  
ATOM   8763  CB  ASN B 251      32.485  82.245  62.848  1.00  0.67           C  
ATOM   8764  CG  ASN B 251      30.993  82.559  62.862  1.00  0.67           C  
ATOM   8765  OD1 ASN B 251      30.492  83.335  63.675  1.00  0.67           O  
ATOM   8766  ND2 ASN B 251      30.237  81.953  61.917  1.00  0.67           N  
ATOM   8767  N   ASP B 252      34.588  79.359  63.046  1.00  0.61           N  
ATOM   8768  CA  ASP B 252      35.962  78.899  63.118  1.00  0.61           C  
ATOM   8769  C   ASP B 252      36.718  79.176  61.832  1.00  0.61           C  
ATOM   8770  O   ASP B 252      37.911  78.885  61.709  1.00  0.61           O  
ATOM   8771  CB  ASP B 252      35.982  77.400  63.501  1.00  0.61           C  
ATOM   8772  CG  ASP B 252      35.186  76.499  62.566  1.00  0.61           C  
ATOM   8773  OD1 ASP B 252      34.801  76.947  61.453  1.00  0.61           O  
ATOM   8774  OD2 ASP B 252      34.962  75.337  62.973  1.00  0.61           O  
ATOM   8775  N   PHE B 253      36.006  79.781  60.873  1.00  0.48           N  
ATOM   8776  CA  PHE B 253      36.518  80.236  59.614  1.00  0.48           C  
ATOM   8777  C   PHE B 253      35.774  81.487  59.165  1.00  0.48           C  
ATOM   8778  O   PHE B 253      34.544  81.546  59.183  1.00  0.48           O  
ATOM   8779  CB  PHE B 253      36.337  79.114  58.563  1.00  0.48           C  
ATOM   8780  CG  PHE B 253      36.794  79.486  57.179  1.00  0.48           C  
ATOM   8781  CD1 PHE B 253      38.103  79.933  56.966  1.00  0.48           C  
ATOM   8782  CD2 PHE B 253      35.917  79.388  56.085  1.00  0.48           C  
ATOM   8783  CE1 PHE B 253      38.526  80.284  55.683  1.00  0.48           C  
ATOM   8784  CE2 PHE B 253      36.346  79.721  54.794  1.00  0.48           C  
ATOM   8785  CZ  PHE B 253      37.654  80.178  54.593  1.00  0.48           C  
ATOM   8786  N   ASN B 254      36.520  82.504  58.695  1.00  0.49           N  
ATOM   8787  CA  ASN B 254      35.973  83.662  58.020  1.00  0.49           C  
ATOM   8788  C   ASN B 254      36.398  83.644  56.555  1.00  0.49           C  
ATOM   8789  O   ASN B 254      37.570  83.747  56.193  1.00  0.49           O  
ATOM   8790  CB  ASN B 254      36.396  84.992  58.699  1.00  0.49           C  
ATOM   8791  CG  ASN B 254      35.472  86.143  58.300  1.00  0.49           C  
ATOM   8792  OD1 ASN B 254      34.919  86.186  57.194  1.00  0.49           O  
ATOM   8793  ND2 ASN B 254      35.255  87.082  59.245  1.00  0.49           N  
ATOM   8794  N   LEU B 255      35.401  83.515  55.661  1.00  0.46           N  
ATOM   8795  CA  LEU B 255      35.577  83.517  54.224  1.00  0.46           C  
ATOM   8796  C   LEU B 255      36.079  84.854  53.670  1.00  0.46           C  
ATOM   8797  O   LEU B 255      36.883  84.887  52.740  1.00  0.46           O  
ATOM   8798  CB  LEU B 255      34.250  83.093  53.540  1.00  0.46           C  
ATOM   8799  CG  LEU B 255      34.368  82.185  52.293  1.00  0.46           C  
ATOM   8800  CD1 LEU B 255      33.014  82.090  51.587  1.00  0.46           C  
ATOM   8801  CD2 LEU B 255      35.415  82.614  51.264  1.00  0.46           C  
ATOM   8802  N   ARG B 256      35.631  86.005  54.230  1.00  0.40           N  
ATOM   8803  CA  ARG B 256      36.019  87.323  53.727  1.00  0.40           C  
ATOM   8804  C   ARG B 256      37.507  87.562  53.811  1.00  0.40           C  
ATOM   8805  O   ARG B 256      38.151  87.907  52.825  1.00  0.40           O  
ATOM   8806  CB  ARG B 256      35.318  88.456  54.532  1.00  0.40           C  
ATOM   8807  CG  ARG B 256      34.083  89.110  53.877  1.00  0.40           C  
ATOM   8808  CD  ARG B 256      32.926  88.172  53.548  1.00  0.40           C  
ATOM   8809  NE  ARG B 256      33.245  87.513  52.243  1.00  0.40           N  
ATOM   8810  CZ  ARG B 256      32.738  86.335  51.877  1.00  0.40           C  
ATOM   8811  NH1 ARG B 256      31.829  85.742  52.641  1.00  0.40           N  
ATOM   8812  NH2 ARG B 256      33.143  85.755  50.755  1.00  0.40           N  
ATOM   8813  N   ASP B 257      38.074  87.285  54.988  1.00  0.40           N  
ATOM   8814  CA  ASP B 257      39.471  87.375  55.321  1.00  0.40           C  
ATOM   8815  C   ASP B 257      40.317  86.473  54.421  1.00  0.40           C  
ATOM   8816  O   ASP B 257      41.352  86.857  53.889  1.00  0.40           O  
ATOM   8817  CB  ASP B 257      39.648  86.945  56.803  1.00  0.40           C  
ATOM   8818  CG  ASP B 257      38.806  87.718  57.818  1.00  0.40           C  
ATOM   8819  OD1 ASP B 257      39.154  87.625  59.022  1.00  0.40           O  
ATOM   8820  OD2 ASP B 257      37.778  88.333  57.448  1.00  0.40           O  
ATOM   8821  N   PHE B 258      39.846  85.238  54.156  1.00  0.41           N  
ATOM   8822  CA  PHE B 258      40.489  84.318  53.233  1.00  0.41           C  
ATOM   8823  C   PHE B 258      40.553  84.821  51.787  1.00  0.41           C  
ATOM   8824  O   PHE B 258      41.539  84.620  51.080  1.00  0.41           O  
ATOM   8825  CB  PHE B 258      39.754  82.956  53.283  1.00  0.41           C  
ATOM   8826  CG  PHE B 258      40.640  81.842  52.803  1.00  0.41           C  
ATOM   8827  CD1 PHE B 258      41.403  81.097  53.715  1.00  0.41           C  
ATOM   8828  CD2 PHE B 258      40.749  81.554  51.434  1.00  0.41           C  
ATOM   8829  CE1 PHE B 258      42.250  80.075  53.273  1.00  0.41           C  
ATOM   8830  CE2 PHE B 258      41.620  80.554  50.991  1.00  0.41           C  
ATOM   8831  CZ  PHE B 258      42.354  79.799  51.909  1.00  0.41           C  
ATOM   8832  N   ASN B 259      39.486  85.490  51.302  1.00  0.42           N  
ATOM   8833  CA  ASN B 259      39.458  86.132  49.995  1.00  0.42           C  
ATOM   8834  C   ASN B 259      40.468  87.268  49.860  1.00  0.42           C  
ATOM   8835  O   ASN B 259      41.085  87.429  48.813  1.00  0.42           O  
ATOM   8836  CB  ASN B 259      38.041  86.673  49.651  1.00  0.42           C  
ATOM   8837  CG  ASN B 259      36.965  85.592  49.551  1.00  0.42           C  
ATOM   8838  OD1 ASN B 259      35.772  85.864  49.729  1.00  0.42           O  
ATOM   8839  ND2 ASN B 259      37.371  84.339  49.238  1.00  0.42           N  
ATOM   8840  N   VAL B 260      40.666  88.062  50.930  1.00  0.40           N  
ATOM   8841  CA  VAL B 260      41.619  89.169  50.970  1.00  0.40           C  
ATOM   8842  C   VAL B 260      43.065  88.690  51.096  1.00  0.40           C  
ATOM   8843  O   VAL B 260      44.008  89.369  50.697  1.00  0.40           O  
ATOM   8844  CB  VAL B 260      41.262  90.119  52.113  1.00  0.40           C  
ATOM   8845  CG1 VAL B 260      42.223  91.322  52.197  1.00  0.40           C  
ATOM   8846  CG2 VAL B 260      39.829  90.647  51.907  1.00  0.40           C  
ATOM   8847  N   GLY B 261      43.270  87.452  51.592  1.00  0.39           N  
ATOM   8848  CA  GLY B 261      44.593  86.863  51.782  1.00  0.39           C  
ATOM   8849  C   GLY B 261      45.017  86.840  53.216  1.00  0.39           C  
ATOM   8850  O   GLY B 261      46.079  86.327  53.567  1.00  0.39           O  
ATOM   8851  N   ASP B 262      44.155  87.348  54.105  1.00  0.49           N  
ATOM   8852  CA  ASP B 262      44.353  87.406  55.531  1.00  0.49           C  
ATOM   8853  C   ASP B 262      44.117  86.048  56.196  1.00  0.49           C  
ATOM   8854  O   ASP B 262      43.237  85.848  57.032  1.00  0.49           O  
ATOM   8855  CB  ASP B 262      43.444  88.486  56.150  1.00  0.49           C  
ATOM   8856  CG  ASP B 262      43.688  89.829  55.501  1.00  0.49           C  
ATOM   8857  OD1 ASP B 262      42.687  90.504  55.171  1.00  0.49           O  
ATOM   8858  OD2 ASP B 262      44.880  90.199  55.372  1.00  0.49           O  
ATOM   8859  N   TYR B 263      44.948  85.051  55.837  1.00  0.37           N  
ATOM   8860  CA  TYR B 263      44.819  83.654  56.221  1.00  0.37           C  
ATOM   8861  C   TYR B 263      44.855  83.414  57.720  1.00  0.37           C  
ATOM   8862  O   TYR B 263      44.137  82.575  58.252  1.00  0.37           O  
ATOM   8863  CB  TYR B 263      45.926  82.799  55.535  1.00  0.37           C  
ATOM   8864  CG  TYR B 263      45.828  82.862  54.029  1.00  0.37           C  
ATOM   8865  CD1 TYR B 263      46.943  83.166  53.222  1.00  0.37           C  
ATOM   8866  CD2 TYR B 263      44.596  82.619  53.402  1.00  0.37           C  
ATOM   8867  CE1 TYR B 263      46.809  83.260  51.826  1.00  0.37           C  
ATOM   8868  CE2 TYR B 263      44.457  82.731  52.015  1.00  0.37           C  
ATOM   8869  CZ  TYR B 263      45.561  83.058  51.231  1.00  0.37           C  
ATOM   8870  OH  TYR B 263      45.384  83.218  49.848  1.00  0.37           O  
ATOM   8871  N   ILE B 264      45.698  84.165  58.445  1.00  0.45           N  
ATOM   8872  CA  ILE B 264      45.759  84.156  59.894  1.00  0.45           C  
ATOM   8873  C   ILE B 264      44.482  84.710  60.524  1.00  0.45           C  
ATOM   8874  O   ILE B 264      43.940  84.135  61.461  1.00  0.45           O  
ATOM   8875  CB  ILE B 264      46.978  84.928  60.401  1.00  0.45           C  
ATOM   8876  CG1 ILE B 264      48.318  84.366  59.860  1.00  0.45           C  
ATOM   8877  CG2 ILE B 264      47.021  84.856  61.942  1.00  0.45           C  
ATOM   8878  CD1 ILE B 264      48.708  84.820  58.448  1.00  0.45           C  
ATOM   8879  N   GLN B 265      43.943  85.827  59.988  1.00  0.46           N  
ATOM   8880  CA  GLN B 265      42.701  86.452  60.430  1.00  0.46           C  
ATOM   8881  C   GLN B 265      41.497  85.547  60.251  1.00  0.46           C  
ATOM   8882  O   GLN B 265      40.679  85.378  61.152  1.00  0.46           O  
ATOM   8883  CB  GLN B 265      42.469  87.755  59.634  1.00  0.46           C  
ATOM   8884  CG  GLN B 265      42.690  89.067  60.414  1.00  0.46           C  
ATOM   8885  CD  GLN B 265      41.685  89.306  61.544  1.00  0.46           C  
ATOM   8886  OE1 GLN B 265      42.044  89.913  62.555  1.00  0.46           O  
ATOM   8887  NE2 GLN B 265      40.423  88.851  61.389  1.00  0.46           N  
ATOM   8888  N   ALA B 266      41.432  84.861  59.094  1.00  0.41           N  
ATOM   8889  CA  ALA B 266      40.376  83.947  58.724  1.00  0.41           C  
ATOM   8890  C   ALA B 266      40.144  82.832  59.731  1.00  0.41           C  
ATOM   8891  O   ALA B 266      39.039  82.316  59.862  1.00  0.41           O  
ATOM   8892  CB  ALA B 266      40.708  83.332  57.347  1.00  0.41           C  
ATOM   8893  N   VAL B 267      41.200  82.425  60.454  1.00  0.53           N  
ATOM   8894  CA  VAL B 267      41.163  81.346  61.425  1.00  0.53           C  
ATOM   8895  C   VAL B 267      41.571  81.867  62.821  1.00  0.53           C  
ATOM   8896  O   VAL B 267      41.866  81.124  63.758  1.00  0.53           O  
ATOM   8897  CB  VAL B 267      41.983  80.187  60.838  1.00  0.53           C  
ATOM   8898  CG1 VAL B 267      42.269  79.037  61.812  1.00  0.53           C  
ATOM   8899  CG2 VAL B 267      41.190  79.610  59.642  1.00  0.53           C  
ATOM   8900  N   LEU B 268      41.542  83.202  63.037  1.00  0.51           N  
ATOM   8901  CA  LEU B 268      41.994  83.852  64.270  1.00  0.51           C  
ATOM   8902  C   LEU B 268      41.242  83.436  65.525  1.00  0.51           C  
ATOM   8903  O   LEU B 268      41.835  83.001  66.519  1.00  0.51           O  
ATOM   8904  CB  LEU B 268      41.867  85.393  64.115  1.00  0.51           C  
ATOM   8905  CG  LEU B 268      42.232  86.263  65.341  1.00  0.51           C  
ATOM   8906  CD1 LEU B 268      43.692  86.078  65.778  1.00  0.51           C  
ATOM   8907  CD2 LEU B 268      41.949  87.743  65.046  1.00  0.51           C  
ATOM   8908  N   ASP B 269      39.898  83.483  65.470  1.00  0.53           N  
ATOM   8909  CA  ASP B 269      39.013  83.110  66.553  1.00  0.53           C  
ATOM   8910  C   ASP B 269      39.175  81.648  66.950  1.00  0.53           C  
ATOM   8911  O   ASP B 269      39.100  81.291  68.128  1.00  0.53           O  
ATOM   8912  CB  ASP B 269      37.541  83.381  66.159  1.00  0.53           C  
ATOM   8913  CG  ASP B 269      37.235  84.867  66.041  1.00  0.53           C  
ATOM   8914  OD1 ASP B 269      38.155  85.698  66.234  1.00  0.53           O  
ATOM   8915  OD2 ASP B 269      36.047  85.170  65.767  1.00  0.53           O  
ATOM   8916  N   ARG B 270      39.447  80.765  65.954  1.00  0.59           N  
ATOM   8917  CA  ARG B 270      39.677  79.341  66.148  1.00  0.59           C  
ATOM   8918  C   ARG B 270      40.827  79.089  67.112  1.00  0.59           C  
ATOM   8919  O   ARG B 270      40.676  78.386  68.105  1.00  0.59           O  
ATOM   8920  CB  ARG B 270      39.965  78.639  64.783  1.00  0.59           C  
ATOM   8921  CG  ARG B 270      39.983  77.092  64.830  1.00  0.59           C  
ATOM   8922  CD  ARG B 270      40.492  76.340  63.576  1.00  0.59           C  
ATOM   8923  NE  ARG B 270      39.605  76.632  62.398  1.00  0.59           N  
ATOM   8924  CZ  ARG B 270      39.470  75.837  61.328  1.00  0.59           C  
ATOM   8925  NH1 ARG B 270      40.216  74.769  61.079  1.00  0.59           N  
ATOM   8926  NH2 ARG B 270      38.535  76.119  60.430  1.00  0.59           N  
ATOM   8927  N   ASN B 271      41.987  79.750  66.909  1.00  0.71           N  
ATOM   8928  CA  ASN B 271      43.113  79.614  67.816  1.00  0.71           C  
ATOM   8929  C   ASN B 271      42.828  80.137  69.220  1.00  0.71           C  
ATOM   8930  O   ASN B 271      43.142  79.476  70.207  1.00  0.71           O  
ATOM   8931  CB  ASN B 271      44.362  80.330  67.234  1.00  0.71           C  
ATOM   8932  CG  ASN B 271      45.608  80.009  68.057  1.00  0.71           C  
ATOM   8933  OD1 ASN B 271      46.092  78.880  68.064  1.00  0.71           O  
ATOM   8934  ND2 ASN B 271      46.125  81.011  68.807  1.00  0.71           N  
ATOM   8935  N   LEU B 272      42.218  81.335  69.350  1.00  0.66           N  
ATOM   8936  CA  LEU B 272      42.000  81.956  70.647  1.00  0.66           C  
ATOM   8937  C   LEU B 272      41.104  81.131  71.554  1.00  0.66           C  
ATOM   8938  O   LEU B 272      41.411  80.921  72.729  1.00  0.66           O  
ATOM   8939  CB  LEU B 272      41.429  83.385  70.493  1.00  0.66           C  
ATOM   8940  CG  LEU B 272      41.460  84.221  71.793  1.00  0.66           C  
ATOM   8941  CD1 LEU B 272      42.890  84.607  72.203  1.00  0.66           C  
ATOM   8942  CD2 LEU B 272      40.597  85.481  71.648  1.00  0.66           C  
ATOM   8943  N   ALA B 273      40.005  80.595  70.996  1.00  0.77           N  
ATOM   8944  CA  ALA B 273      39.125  79.692  71.693  1.00  0.77           C  
ATOM   8945  C   ALA B 273      39.764  78.365  72.078  1.00  0.77           C  
ATOM   8946  O   ALA B 273      39.682  77.934  73.226  1.00  0.77           O  
ATOM   8947  CB  ALA B 273      37.930  79.417  70.771  1.00  0.77           C  
ATOM   8948  N   GLU B 274      40.473  77.704  71.143  1.00  0.78           N  
ATOM   8949  CA  GLU B 274      40.983  76.363  71.367  1.00  0.78           C  
ATOM   8950  C   GLU B 274      42.114  76.271  72.381  1.00  0.78           C  
ATOM   8951  O   GLU B 274      42.337  75.217  72.972  1.00  0.78           O  
ATOM   8952  CB  GLU B 274      41.497  75.733  70.062  1.00  0.78           C  
ATOM   8953  CG  GLU B 274      40.428  75.366  69.008  1.00  0.78           C  
ATOM   8954  CD  GLU B 274      41.073  74.842  67.725  1.00  0.78           C  
ATOM   8955  OE1 GLU B 274      42.334  74.783  67.654  1.00  0.78           O  
ATOM   8956  OE2 GLU B 274      40.309  74.495  66.791  1.00  0.78           O  
ATOM   8957  N   ASN B 275      42.825  77.383  72.680  1.00  0.79           N  
ATOM   8958  CA  ASN B 275      43.846  77.428  73.723  1.00  0.79           C  
ATOM   8959  C   ASN B 275      43.327  77.005  75.092  1.00  0.79           C  
ATOM   8960  O   ASN B 275      44.055  76.431  75.899  1.00  0.79           O  
ATOM   8961  CB  ASN B 275      44.450  78.845  73.863  1.00  0.79           C  
ATOM   8962  CG  ASN B 275      45.296  79.155  72.637  1.00  0.79           C  
ATOM   8963  OD1 ASN B 275      46.089  78.333  72.175  1.00  0.79           O  
ATOM   8964  ND2 ASN B 275      45.142  80.380  72.089  1.00  0.79           N  
ATOM   8965  N   ILE B 276      42.033  77.257  75.368  1.00  0.86           N  
ATOM   8966  CA  ILE B 276      41.359  76.886  76.600  1.00  0.86           C  
ATOM   8967  C   ILE B 276      41.371  75.381  76.854  1.00  0.86           C  
ATOM   8968  O   ILE B 276      41.661  74.919  77.953  1.00  0.86           O  
ATOM   8969  CB  ILE B 276      39.933  77.425  76.572  1.00  0.86           C  
ATOM   8970  CG1 ILE B 276      39.947  78.974  76.501  1.00  0.86           C  
ATOM   8971  CG2 ILE B 276      39.139  76.947  77.803  1.00  0.86           C  
ATOM   8972  CD1 ILE B 276      38.559  79.571  76.249  1.00  0.86           C  
ATOM   8973  N   SER B 277      41.116  74.545  75.838  1.00  0.88           N  
ATOM   8974  CA  SER B 277      41.136  73.098  76.017  1.00  0.88           C  
ATOM   8975  C   SER B 277      42.381  72.472  75.433  1.00  0.88           C  
ATOM   8976  O   SER B 277      42.419  71.278  75.160  1.00  0.88           O  
ATOM   8977  CB  SER B 277      39.878  72.400  75.441  1.00  0.88           C  
ATOM   8978  OG  SER B 277      39.668  72.691  74.060  1.00  0.88           O  
ATOM   8979  N   ARG B 278      43.445  73.260  75.216  1.00  0.80           N  
ATOM   8980  CA  ARG B 278      44.677  72.764  74.632  1.00  0.80           C  
ATOM   8981  C   ARG B 278      45.541  71.925  75.566  1.00  0.80           C  
ATOM   8982  O   ARG B 278      45.913  70.803  75.227  1.00  0.80           O  
ATOM   8983  CB  ARG B 278      45.484  73.963  74.093  1.00  0.80           C  
ATOM   8984  CG  ARG B 278      46.672  73.593  73.184  1.00  0.80           C  
ATOM   8985  CD  ARG B 278      46.712  74.400  71.880  1.00  0.80           C  
ATOM   8986  NE  ARG B 278      45.573  73.916  71.053  1.00  0.80           N  
ATOM   8987  CZ  ARG B 278      44.948  74.566  70.067  1.00  0.80           C  
ATOM   8988  NH1 ARG B 278      45.086  75.861  69.825  1.00  0.80           N  
ATOM   8989  NH2 ARG B 278      44.132  73.840  69.311  1.00  0.80           N  
ATOM   8990  N   VAL B 279      45.840  72.418  76.789  1.00  0.83           N  
ATOM   8991  CA  VAL B 279      46.665  71.688  77.748  1.00  0.83           C  
ATOM   8992  C   VAL B 279      46.144  71.870  79.160  1.00  0.83           C  
ATOM   8993  O   VAL B 279      45.432  72.821  79.481  1.00  0.83           O  
ATOM   8994  CB  VAL B 279      48.163  72.038  77.771  1.00  0.83           C  
ATOM   8995  CG1 VAL B 279      48.810  71.766  76.400  1.00  0.83           C  
ATOM   8996  CG2 VAL B 279      48.397  73.487  78.227  1.00  0.83           C  
ATOM   8997  N   LEU B 280      46.508  70.937  80.049  1.00  0.86           N  
ATOM   8998  CA  LEU B 280      46.187  70.940  81.457  1.00  0.86           C  
ATOM   8999  C   LEU B 280      47.258  71.689  82.232  1.00  0.86           C  
ATOM   9000  O   LEU B 280      48.450  71.481  82.027  1.00  0.86           O  
ATOM   9001  CB  LEU B 280      46.084  69.468  81.916  1.00  0.86           C  
ATOM   9002  CG  LEU B 280      45.926  69.181  83.421  1.00  0.86           C  
ATOM   9003  CD1 LEU B 280      44.705  69.849  84.064  1.00  0.86           C  
ATOM   9004  CD2 LEU B 280      45.833  67.666  83.618  1.00  0.86           C  
ATOM   9005  N   TYR B 281      46.846  72.615  83.126  1.00  0.75           N  
ATOM   9006  CA  TYR B 281      47.741  73.462  83.908  1.00  0.75           C  
ATOM   9007  C   TYR B 281      48.766  74.289  83.108  1.00  0.75           C  
ATOM   9008  O   TYR B 281      49.974  74.147  83.317  1.00  0.75           O  
ATOM   9009  CB  TYR B 281      48.437  72.680  85.061  1.00  0.75           C  
ATOM   9010  CG  TYR B 281      47.454  72.098  86.049  1.00  0.75           C  
ATOM   9011  CD1 TYR B 281      47.527  70.744  86.430  1.00  0.75           C  
ATOM   9012  CD2 TYR B 281      46.474  72.911  86.646  1.00  0.75           C  
ATOM   9013  CE1 TYR B 281      46.618  70.210  87.358  1.00  0.75           C  
ATOM   9014  CE2 TYR B 281      45.558  72.378  87.563  1.00  0.75           C  
ATOM   9015  CZ  TYR B 281      45.623  71.026  87.907  1.00  0.75           C  
ATOM   9016  OH  TYR B 281      44.675  70.492  88.800  1.00  0.75           O  
ATOM   9017  N   PRO B 282      48.360  75.168  82.183  1.00  0.50           N  
ATOM   9018  CA  PRO B 282      49.274  76.040  81.441  1.00  0.50           C  
ATOM   9019  C   PRO B 282      50.141  76.922  82.325  1.00  0.50           C  
ATOM   9020  O   PRO B 282      49.744  77.249  83.443  1.00  0.50           O  
ATOM   9021  CB  PRO B 282      48.327  76.861  80.555  1.00  0.50           C  
ATOM   9022  CG  PRO B 282      47.053  76.977  81.384  1.00  0.50           C  
ATOM   9023  CD  PRO B 282      46.966  75.593  82.020  1.00  0.50           C  
ATOM   9024  N   ASN B 283      51.351  77.298  81.856  1.00  0.54           N  
ATOM   9025  CA  ASN B 283      52.303  78.083  82.630  1.00  0.54           C  
ATOM   9026  C   ASN B 283      51.770  79.473  82.964  1.00  0.54           C  
ATOM   9027  O   ASN B 283      51.511  80.300  82.099  1.00  0.54           O  
ATOM   9028  CB  ASN B 283      53.689  78.197  81.927  1.00  0.54           C  
ATOM   9029  CG  ASN B 283      54.497  76.897  81.874  1.00  0.54           C  
ATOM   9030  OD1 ASN B 283      55.585  76.854  81.304  1.00  0.54           O  
ATOM   9031  ND2 ASN B 283      53.994  75.786  82.456  1.00  0.54           N  
ATOM   9032  N   ASP B 284      51.564  79.733  84.261  1.00  0.55           N  
ATOM   9033  CA  ASP B 284      50.857  80.863  84.805  1.00  0.55           C  
ATOM   9034  C   ASP B 284      51.776  81.945  85.355  1.00  0.55           C  
ATOM   9035  O   ASP B 284      51.336  82.956  85.908  1.00  0.55           O  
ATOM   9036  CB  ASP B 284      49.818  80.373  85.857  1.00  0.55           C  
ATOM   9037  CG  ASP B 284      50.224  79.223  86.784  1.00  0.55           C  
ATOM   9038  OD1 ASP B 284      51.204  78.477  86.525  1.00  0.55           O  
ATOM   9039  OD2 ASP B 284      49.435  78.999  87.736  1.00  0.55           O  
ATOM   9040  N   ASN B 285      53.091  81.803  85.117  1.00  0.51           N  
ATOM   9041  CA  ASN B 285      54.165  82.697  85.525  1.00  0.51           C  
ATOM   9042  C   ASN B 285      54.075  84.120  84.953  1.00  0.51           C  
ATOM   9043  O   ASN B 285      54.703  85.046  85.453  1.00  0.51           O  
ATOM   9044  CB  ASN B 285      55.521  82.074  85.095  1.00  0.51           C  
ATOM   9045  CG  ASN B 285      55.699  80.702  85.738  1.00  0.51           C  
ATOM   9046  OD1 ASN B 285      55.152  79.706  85.265  1.00  0.51           O  
ATOM   9047  ND2 ASN B 285      56.482  80.644  86.838  1.00  0.51           N  
ATOM   9048  N   PHE B 286      53.253  84.329  83.912  1.00  0.43           N  
ATOM   9049  CA  PHE B 286      53.107  85.567  83.158  1.00  0.43           C  
ATOM   9050  C   PHE B 286      51.617  85.886  83.027  1.00  0.43           C  
ATOM   9051  O   PHE B 286      50.787  85.129  83.528  1.00  0.43           O  
ATOM   9052  CB  PHE B 286      53.869  85.527  81.805  1.00  0.43           C  
ATOM   9053  CG  PHE B 286      53.602  84.274  81.018  1.00  0.43           C  
ATOM   9054  CD1 PHE B 286      52.730  84.306  79.926  1.00  0.43           C  
ATOM   9055  CD2 PHE B 286      54.255  83.068  81.326  1.00  0.43           C  
ATOM   9056  CE1 PHE B 286      52.476  83.154  79.176  1.00  0.43           C  
ATOM   9057  CE2 PHE B 286      54.009  81.911  80.580  1.00  0.43           C  
ATOM   9058  CZ  PHE B 286      53.111  81.953  79.508  1.00  0.43           C  
ATOM   9059  N   PHE B 287      51.198  87.051  82.476  1.00  0.56           N  
ATOM   9060  CA  PHE B 287      49.788  87.445  82.472  1.00  0.56           C  
ATOM   9061  C   PHE B 287      48.916  86.527  81.618  1.00  0.56           C  
ATOM   9062  O   PHE B 287      47.857  86.075  82.043  1.00  0.56           O  
ATOM   9063  CB  PHE B 287      49.664  88.932  82.003  1.00  0.56           C  
ATOM   9064  CG  PHE B 287      48.251  89.397  81.724  1.00  0.56           C  
ATOM   9065  CD1 PHE B 287      47.434  89.947  82.725  1.00  0.56           C  
ATOM   9066  CD2 PHE B 287      47.735  89.272  80.422  1.00  0.56           C  
ATOM   9067  CE1 PHE B 287      46.118  90.335  82.433  1.00  0.56           C  
ATOM   9068  CE2 PHE B 287      46.415  89.629  80.133  1.00  0.56           C  
ATOM   9069  CZ  PHE B 287      45.601  90.151  81.143  1.00  0.56           C  
ATOM   9070  N   GLU B 288      49.387  86.217  80.410  1.00  0.60           N  
ATOM   9071  CA  GLU B 288      48.705  85.537  79.336  1.00  0.60           C  
ATOM   9072  C   GLU B 288      48.289  84.119  79.714  1.00  0.60           C  
ATOM   9073  O   GLU B 288      47.145  83.703  79.521  1.00  0.60           O  
ATOM   9074  CB  GLU B 288      49.651  85.537  78.101  1.00  0.60           C  
ATOM   9075  CG  GLU B 288      50.062  86.934  77.531  1.00  0.60           C  
ATOM   9076  CD  GLU B 288      50.817  87.897  78.461  1.00  0.60           C  
ATOM   9077  OE1 GLU B 288      51.533  87.431  79.388  1.00  0.60           O  
ATOM   9078  OE2 GLU B 288      50.618  89.123  78.298  1.00  0.60           O  
ATOM   9079  N   GLY B 289      49.202  83.355  80.353  1.00  0.66           N  
ATOM   9080  CA  GLY B 289      48.911  82.012  80.845  1.00  0.66           C  
ATOM   9081  C   GLY B 289      48.110  81.987  82.120  1.00  0.66           C  
ATOM   9082  O   GLY B 289      47.327  81.076  82.377  1.00  0.66           O  
ATOM   9083  N   LYS B 290      48.264  83.031  82.953  1.00  0.76           N  
ATOM   9084  CA  LYS B 290      47.468  83.257  84.148  1.00  0.76           C  
ATOM   9085  C   LYS B 290      46.019  83.577  83.810  1.00  0.76           C  
ATOM   9086  O   LYS B 290      45.087  83.004  84.369  1.00  0.76           O  
ATOM   9087  CB  LYS B 290      48.144  84.384  84.959  1.00  0.76           C  
ATOM   9088  CG  LYS B 290      47.596  84.672  86.358  1.00  0.76           C  
ATOM   9089  CD  LYS B 290      48.318  85.828  87.081  1.00  0.76           C  
ATOM   9090  CE  LYS B 290      49.766  85.561  87.538  1.00  0.76           C  
ATOM   9091  NZ  LYS B 290      50.744  85.579  86.426  1.00  0.76           N  
ATOM   9092  N   GLU B 291      45.790  84.447  82.806  1.00  0.79           N  
ATOM   9093  CA  GLU B 291      44.480  84.686  82.232  1.00  0.79           C  
ATOM   9094  C   GLU B 291      43.898  83.437  81.596  1.00  0.79           C  
ATOM   9095  O   GLU B 291      42.714  83.143  81.726  1.00  0.79           O  
ATOM   9096  CB  GLU B 291      44.494  85.797  81.156  1.00  0.79           C  
ATOM   9097  CG  GLU B 291      43.056  86.213  80.748  1.00  0.79           C  
ATOM   9098  CD  GLU B 291      42.996  86.952  79.422  1.00  0.79           C  
ATOM   9099  OE1 GLU B 291      43.346  86.346  78.387  1.00  0.79           O  
ATOM   9100  OE2 GLU B 291      42.531  88.109  79.355  1.00  0.79           O  
ATOM   9101  N   LEU B 292      44.723  82.636  80.893  1.00  0.82           N  
ATOM   9102  CA  LEU B 292      44.286  81.376  80.323  1.00  0.82           C  
ATOM   9103  C   LEU B 292      43.741  80.379  81.339  1.00  0.82           C  
ATOM   9104  O   LEU B 292      42.697  79.787  81.088  1.00  0.82           O  
ATOM   9105  CB  LEU B 292      45.397  80.712  79.480  1.00  0.82           C  
ATOM   9106  CG  LEU B 292      44.948  79.447  78.717  1.00  0.82           C  
ATOM   9107  CD1 LEU B 292      43.769  79.713  77.770  1.00  0.82           C  
ATOM   9108  CD2 LEU B 292      46.115  78.845  77.933  1.00  0.82           C  
ATOM   9109  N   ARG B 293      44.364  80.211  82.526  1.00  0.81           N  
ATOM   9110  CA  ARG B 293      43.782  79.393  83.591  1.00  0.81           C  
ATOM   9111  C   ARG B 293      42.417  79.879  84.066  1.00  0.81           C  
ATOM   9112  O   ARG B 293      41.477  79.100  84.166  1.00  0.81           O  
ATOM   9113  CB  ARG B 293      44.703  79.296  84.827  1.00  0.81           C  
ATOM   9114  CG  ARG B 293      45.962  78.454  84.579  1.00  0.81           C  
ATOM   9115  CD  ARG B 293      46.658  78.027  85.871  1.00  0.81           C  
ATOM   9116  NE  ARG B 293      47.800  77.144  85.472  1.00  0.81           N  
ATOM   9117  CZ  ARG B 293      48.511  76.459  86.376  1.00  0.81           C  
ATOM   9118  NH1 ARG B 293      48.073  76.243  87.609  1.00  0.81           N  
ATOM   9119  NH2 ARG B 293      49.737  76.066  86.057  1.00  0.81           N  
ATOM   9120  N   LEU B 294      42.242  81.199  84.272  1.00  0.89           N  
ATOM   9121  CA  LEU B 294      40.950  81.785  84.601  1.00  0.89           C  
ATOM   9122  C   LEU B 294      39.900  81.570  83.503  1.00  0.89           C  
ATOM   9123  O   LEU B 294      38.736  81.257  83.765  1.00  0.89           O  
ATOM   9124  CB  LEU B 294      41.132  83.292  84.907  1.00  0.89           C  
ATOM   9125  CG  LEU B 294      39.911  83.999  85.533  1.00  0.89           C  
ATOM   9126  CD1 LEU B 294      39.538  83.420  86.904  1.00  0.89           C  
ATOM   9127  CD2 LEU B 294      40.184  85.505  85.662  1.00  0.89           C  
ATOM   9128  N   LYS B 295      40.304  81.675  82.212  1.00  0.88           N  
ATOM   9129  CA  LYS B 295      39.465  81.298  81.084  1.00  0.88           C  
ATOM   9130  C   LYS B 295      39.077  79.821  81.101  1.00  0.88           C  
ATOM   9131  O   LYS B 295      37.920  79.489  80.858  1.00  0.88           O  
ATOM   9132  CB  LYS B 295      40.065  81.690  79.697  1.00  0.88           C  
ATOM   9133  CG  LYS B 295      40.251  83.210  79.528  1.00  0.88           C  
ATOM   9134  CD  LYS B 295      40.264  83.736  78.079  1.00  0.88           C  
ATOM   9135  CE  LYS B 295      41.495  83.401  77.223  1.00  0.88           C  
ATOM   9136  NZ  LYS B 295      42.719  83.999  77.756  1.00  0.88           N  
ATOM   9137  N   GLN B 296      40.008  78.901  81.437  1.00  0.90           N  
ATOM   9138  CA  GLN B 296      39.714  77.486  81.613  1.00  0.90           C  
ATOM   9139  C   GLN B 296      38.724  77.196  82.718  1.00  0.90           C  
ATOM   9140  O   GLN B 296      37.758  76.469  82.507  1.00  0.90           O  
ATOM   9141  CB  GLN B 296      40.993  76.666  81.922  1.00  0.90           C  
ATOM   9142  CG  GLN B 296      41.955  76.583  80.723  1.00  0.90           C  
ATOM   9143  CD  GLN B 296      43.170  75.701  81.018  1.00  0.90           C  
ATOM   9144  OE1 GLN B 296      43.832  75.811  82.051  1.00  0.90           O  
ATOM   9145  NE2 GLN B 296      43.491  74.808  80.057  1.00  0.90           N  
ATOM   9146  N   GLU B 297      38.909  77.794  83.904  1.00  0.92           N  
ATOM   9147  CA  GLU B 297      38.039  77.626  85.051  1.00  0.92           C  
ATOM   9148  C   GLU B 297      36.628  78.115  84.804  1.00  0.92           C  
ATOM   9149  O   GLU B 297      35.654  77.417  85.083  1.00  0.92           O  
ATOM   9150  CB  GLU B 297      38.669  78.342  86.257  1.00  0.92           C  
ATOM   9151  CG  GLU B 297      39.985  77.652  86.689  1.00  0.92           C  
ATOM   9152  CD  GLU B 297      40.824  78.491  87.642  1.00  0.92           C  
ATOM   9153  OE1 GLU B 297      40.318  79.506  88.189  1.00  0.92           O  
ATOM   9154  OE2 GLU B 297      42.022  78.129  87.765  1.00  0.92           O  
ATOM   9155  N   TYR B 298      36.464  79.301  84.183  1.00  0.94           N  
ATOM   9156  CA  TYR B 298      35.159  79.763  83.755  1.00  0.94           C  
ATOM   9157  C   TYR B 298      34.515  78.875  82.690  1.00  0.94           C  
ATOM   9158  O   TYR B 298      33.318  78.600  82.732  1.00  0.94           O  
ATOM   9159  CB  TYR B 298      35.239  81.227  83.264  1.00  0.94           C  
ATOM   9160  CG  TYR B 298      33.853  81.777  83.074  1.00  0.94           C  
ATOM   9161  CD1 TYR B 298      32.978  81.883  84.168  1.00  0.94           C  
ATOM   9162  CD2 TYR B 298      33.384  82.094  81.791  1.00  0.94           C  
ATOM   9163  CE1 TYR B 298      31.657  82.302  83.975  1.00  0.94           C  
ATOM   9164  CE2 TYR B 298      32.069  82.536  81.603  1.00  0.94           C  
ATOM   9165  CZ  TYR B 298      31.210  82.651  82.698  1.00  0.94           C  
ATOM   9166  OH  TYR B 298      29.903  83.134  82.517  1.00  0.94           O  
ATOM   9167  N   PHE B 299      35.304  78.379  81.722  1.00  0.94           N  
ATOM   9168  CA  PHE B 299      34.830  77.525  80.651  1.00  0.94           C  
ATOM   9169  C   PHE B 299      34.185  76.229  81.138  1.00  0.94           C  
ATOM   9170  O   PHE B 299      33.104  75.861  80.679  1.00  0.94           O  
ATOM   9171  CB  PHE B 299      36.023  77.264  79.699  1.00  0.94           C  
ATOM   9172  CG  PHE B 299      35.664  76.445  78.501  1.00  0.94           C  
ATOM   9173  CD1 PHE B 299      34.908  76.996  77.456  1.00  0.94           C  
ATOM   9174  CD2 PHE B 299      36.111  75.118  78.407  1.00  0.94           C  
ATOM   9175  CE1 PHE B 299      34.575  76.218  76.342  1.00  0.94           C  
ATOM   9176  CE2 PHE B 299      35.788  74.340  77.293  1.00  0.94           C  
ATOM   9177  CZ  PHE B 299      35.004  74.887  76.272  1.00  0.94           C  
ATOM   9178  N   VAL B 300      34.791  75.531  82.126  1.00  0.96           N  
ATOM   9179  CA  VAL B 300      34.176  74.341  82.708  1.00  0.96           C  
ATOM   9180  C   VAL B 300      32.886  74.658  83.416  1.00  0.96           C  
ATOM   9181  O   VAL B 300      31.888  73.956  83.298  1.00  0.96           O  
ATOM   9182  CB  VAL B 300      35.019  73.626  83.762  1.00  0.96           C  
ATOM   9183  CG1 VAL B 300      34.828  72.114  83.584  1.00  0.96           C  
ATOM   9184  CG2 VAL B 300      36.489  74.013  83.658  1.00  0.96           C  
ATOM   9185  N   VAL B 301      32.914  75.751  84.192  1.00  0.96           N  
ATOM   9186  CA  VAL B 301      31.819  76.226  85.001  1.00  0.96           C  
ATOM   9187  C   VAL B 301      30.598  76.626  84.198  1.00  0.96           C  
ATOM   9188  O   VAL B 301      29.502  76.124  84.443  1.00  0.96           O  
ATOM   9189  CB  VAL B 301      32.333  77.401  85.828  1.00  0.96           C  
ATOM   9190  CG1 VAL B 301      31.198  78.315  86.314  1.00  0.96           C  
ATOM   9191  CG2 VAL B 301      33.156  76.834  87.001  1.00  0.96           C  
ATOM   9192  N   ALA B 302      30.756  77.508  83.193  1.00  0.97           N  
ATOM   9193  CA  ALA B 302      29.640  78.047  82.447  1.00  0.97           C  
ATOM   9194  C   ALA B 302      28.918  76.996  81.626  1.00  0.97           C  
ATOM   9195  O   ALA B 302      27.703  76.827  81.710  1.00  0.97           O  
ATOM   9196  CB  ALA B 302      30.172  79.163  81.534  1.00  0.97           C  
ATOM   9197  N   ALA B 303      29.688  76.189  80.875  1.00  0.96           N  
ATOM   9198  CA  ALA B 303      29.156  75.116  80.073  1.00  0.96           C  
ATOM   9199  C   ALA B 303      28.496  74.011  80.893  1.00  0.96           C  
ATOM   9200  O   ALA B 303      27.390  73.557  80.595  1.00  0.96           O  
ATOM   9201  CB  ALA B 303      30.305  74.551  79.229  1.00  0.96           C  
ATOM   9202  N   THR B 304      29.142  73.582  82.000  1.00  0.96           N  
ATOM   9203  CA  THR B 304      28.581  72.574  82.898  1.00  0.96           C  
ATOM   9204  C   THR B 304      27.297  73.019  83.554  1.00  0.96           C  
ATOM   9205  O   THR B 304      26.304  72.294  83.547  1.00  0.96           O  
ATOM   9206  CB  THR B 304      29.521  72.150  84.017  1.00  0.96           C  
ATOM   9207  OG1 THR B 304      30.717  71.611  83.473  1.00  0.96           O  
ATOM   9208  CG2 THR B 304      28.863  71.070  84.888  1.00  0.96           C  
ATOM   9209  N   LEU B 305      27.247  74.249  84.106  1.00  0.95           N  
ATOM   9210  CA  LEU B 305      26.056  74.746  84.770  1.00  0.95           C  
ATOM   9211  C   LEU B 305      24.869  74.894  83.839  1.00  0.95           C  
ATOM   9212  O   LEU B 305      23.769  74.473  84.182  1.00  0.95           O  
ATOM   9213  CB  LEU B 305      26.315  76.064  85.531  1.00  0.95           C  
ATOM   9214  CG  LEU B 305      27.204  75.901  86.781  1.00  0.95           C  
ATOM   9215  CD1 LEU B 305      27.492  77.274  87.385  1.00  0.95           C  
ATOM   9216  CD2 LEU B 305      26.573  75.004  87.851  1.00  0.95           C  
ATOM   9217  N   GLN B 306      25.063  75.402  82.605  1.00  0.91           N  
ATOM   9218  CA  GLN B 306      24.014  75.446  81.594  1.00  0.91           C  
ATOM   9219  C   GLN B 306      23.434  74.070  81.263  1.00  0.91           C  
ATOM   9220  O   GLN B 306      22.218  73.905  81.167  1.00  0.91           O  
ATOM   9221  CB  GLN B 306      24.558  76.041  80.274  1.00  0.91           C  
ATOM   9222  CG  GLN B 306      24.860  77.553  80.311  1.00  0.91           C  
ATOM   9223  CD  GLN B 306      25.445  77.995  78.971  1.00  0.91           C  
ATOM   9224  OE1 GLN B 306      26.645  78.181  78.786  1.00  0.91           O  
ATOM   9225  NE2 GLN B 306      24.555  78.149  77.963  1.00  0.91           N  
ATOM   9226  N   ASP B 307      24.290  73.037  81.119  1.00  0.91           N  
ATOM   9227  CA  ASP B 307      23.871  71.666  80.893  1.00  0.91           C  
ATOM   9228  C   ASP B 307      23.071  71.080  82.065  1.00  0.91           C  
ATOM   9229  O   ASP B 307      22.048  70.416  81.880  1.00  0.91           O  
ATOM   9230  CB  ASP B 307      25.131  70.823  80.556  1.00  0.91           C  
ATOM   9231  CG  ASP B 307      24.799  69.539  79.836  1.00  0.91           C  
ATOM   9232  OD1 ASP B 307      23.818  69.495  79.057  1.00  0.91           O  
ATOM   9233  OD2 ASP B 307      25.540  68.536  80.017  1.00  0.91           O  
ATOM   9234  N   ILE B 308      23.495  71.355  83.319  1.00  0.92           N  
ATOM   9235  CA  ILE B 308      22.759  70.974  84.520  1.00  0.92           C  
ATOM   9236  C   ILE B 308      21.393  71.644  84.600  1.00  0.92           C  
ATOM   9237  O   ILE B 308      20.392  70.974  84.850  1.00  0.92           O  
ATOM   9238  CB  ILE B 308      23.560  71.248  85.795  1.00  0.92           C  
ATOM   9239  CG1 ILE B 308      24.868  70.423  85.799  1.00  0.92           C  
ATOM   9240  CG2 ILE B 308      22.718  70.915  87.051  1.00  0.92           C  
ATOM   9241  CD1 ILE B 308      25.835  70.817  86.922  1.00  0.92           C  
ATOM   9242  N   ILE B 309      21.295  72.966  84.325  1.00  0.88           N  
ATOM   9243  CA  ILE B 309      20.026  73.695  84.294  1.00  0.88           C  
ATOM   9244  C   ILE B 309      19.087  73.133  83.228  1.00  0.88           C  
ATOM   9245  O   ILE B 309      17.903  72.903  83.472  1.00  0.88           O  
ATOM   9246  CB  ILE B 309      20.220  75.201  84.057  1.00  0.88           C  
ATOM   9247  CG1 ILE B 309      21.062  75.894  85.160  1.00  0.88           C  
ATOM   9248  CG2 ILE B 309      18.862  75.925  83.919  1.00  0.88           C  
ATOM   9249  CD1 ILE B 309      20.424  75.966  86.550  1.00  0.88           C  
ATOM   9250  N   ARG B 310      19.615  72.842  82.021  1.00  0.80           N  
ATOM   9251  CA  ARG B 310      18.876  72.261  80.914  1.00  0.80           C  
ATOM   9252  C   ARG B 310      18.284  70.891  81.223  1.00  0.80           C  
ATOM   9253  O   ARG B 310      17.116  70.617  80.958  1.00  0.80           O  
ATOM   9254  CB  ARG B 310      19.833  72.122  79.705  1.00  0.80           C  
ATOM   9255  CG  ARG B 310      19.153  71.806  78.358  1.00  0.80           C  
ATOM   9256  CD  ARG B 310      19.906  70.756  77.536  1.00  0.80           C  
ATOM   9257  NE  ARG B 310      19.388  69.421  77.973  1.00  0.80           N  
ATOM   9258  CZ  ARG B 310      20.133  68.388  78.378  1.00  0.80           C  
ATOM   9259  NH1 ARG B 310      21.448  68.436  78.532  1.00  0.80           N  
ATOM   9260  NH2 ARG B 310      19.530  67.221  78.610  1.00  0.80           N  
ATOM   9261  N   ARG B 311      19.079  69.994  81.831  1.00  0.80           N  
ATOM   9262  CA  ARG B 311      18.622  68.688  82.256  1.00  0.80           C  
ATOM   9263  C   ARG B 311      17.697  68.727  83.461  1.00  0.80           C  
ATOM   9264  O   ARG B 311      16.790  67.908  83.576  1.00  0.80           O  
ATOM   9265  CB  ARG B 311      19.852  67.788  82.487  1.00  0.80           C  
ATOM   9266  CG  ARG B 311      19.553  66.334  82.911  1.00  0.80           C  
ATOM   9267  CD  ARG B 311      20.710  65.345  82.678  1.00  0.80           C  
ATOM   9268  NE  ARG B 311      21.963  65.936  83.258  1.00  0.80           N  
ATOM   9269  CZ  ARG B 311      22.937  66.525  82.547  1.00  0.80           C  
ATOM   9270  NH1 ARG B 311      23.150  66.275  81.260  1.00  0.80           N  
ATOM   9271  NH2 ARG B 311      23.734  67.384  83.168  1.00  0.80           N  
ATOM   9272  N   PHE B 312      17.872  69.692  84.383  1.00  0.83           N  
ATOM   9273  CA  PHE B 312      16.933  69.930  85.464  1.00  0.83           C  
ATOM   9274  C   PHE B 312      15.545  70.363  84.963  1.00  0.83           C  
ATOM   9275  O   PHE B 312      14.527  69.790  85.355  1.00  0.83           O  
ATOM   9276  CB  PHE B 312      17.555  70.986  86.421  1.00  0.83           C  
ATOM   9277  CG  PHE B 312      16.611  71.360  87.522  1.00  0.83           C  
ATOM   9278  CD1 PHE B 312      16.380  70.488  88.595  1.00  0.83           C  
ATOM   9279  CD2 PHE B 312      15.871  72.549  87.422  1.00  0.83           C  
ATOM   9280  CE1 PHE B 312      15.395  70.790  89.542  1.00  0.83           C  
ATOM   9281  CE2 PHE B 312      14.893  72.853  88.373  1.00  0.83           C  
ATOM   9282  CZ  PHE B 312      14.651  71.967  89.430  1.00  0.83           C  
ATOM   9283  N   LYS B 313      15.487  71.346  84.032  1.00  0.75           N  
ATOM   9284  CA  LYS B 313      14.254  71.830  83.422  1.00  0.75           C  
ATOM   9285  C   LYS B 313      13.544  70.751  82.625  1.00  0.75           C  
ATOM   9286  O   LYS B 313      12.321  70.717  82.559  1.00  0.75           O  
ATOM   9287  CB  LYS B 313      14.475  73.063  82.497  1.00  0.75           C  
ATOM   9288  CG  LYS B 313      14.841  74.359  83.238  1.00  0.75           C  
ATOM   9289  CD  LYS B 313      14.988  75.570  82.291  1.00  0.75           C  
ATOM   9290  CE  LYS B 313      15.316  76.849  83.069  1.00  0.75           C  
ATOM   9291  NZ  LYS B 313      15.517  78.032  82.210  1.00  0.75           N  
ATOM   9292  N   ALA B 314      14.309  69.830  82.019  1.00  0.78           N  
ATOM   9293  CA  ALA B 314      13.764  68.740  81.246  1.00  0.78           C  
ATOM   9294  C   ALA B 314      13.521  67.487  82.071  1.00  0.78           C  
ATOM   9295  O   ALA B 314      13.214  66.431  81.532  1.00  0.78           O  
ATOM   9296  CB  ALA B 314      14.752  68.421  80.106  1.00  0.78           C  
ATOM   9297  N   SER B 315      13.646  67.548  83.407  1.00  0.74           N  
ATOM   9298  CA  SER B 315      13.415  66.382  84.241  1.00  0.74           C  
ATOM   9299  C   SER B 315      11.939  66.093  84.480  1.00  0.74           C  
ATOM   9300  O   SER B 315      11.076  66.937  84.275  1.00  0.74           O  
ATOM   9301  CB  SER B 315      14.206  66.456  85.569  1.00  0.74           C  
ATOM   9302  OG  SER B 315      13.622  67.335  86.531  1.00  0.74           O  
ATOM   9303  N   LYS B 316      11.595  64.864  84.920  1.00  0.63           N  
ATOM   9304  CA  LYS B 316      10.223  64.367  84.967  1.00  0.63           C  
ATOM   9305  C   LYS B 316       9.242  65.146  85.846  1.00  0.63           C  
ATOM   9306  O   LYS B 316       8.072  65.291  85.505  1.00  0.63           O  
ATOM   9307  CB  LYS B 316      10.218  62.879  85.401  1.00  0.63           C  
ATOM   9308  CG  LYS B 316       9.429  61.934  84.477  1.00  0.63           C  
ATOM   9309  CD  LYS B 316       9.320  60.551  85.140  1.00  0.63           C  
ATOM   9310  CE  LYS B 316       8.727  59.430  84.280  1.00  0.63           C  
ATOM   9311  NZ  LYS B 316       8.681  58.207  85.098  1.00  0.63           N  
ATOM   9312  N   PHE B 317       9.699  65.651  87.012  1.00  0.53           N  
ATOM   9313  CA  PHE B 317       8.908  66.523  87.873  1.00  0.53           C  
ATOM   9314  C   PHE B 317       9.421  67.953  87.725  1.00  0.53           C  
ATOM   9315  O   PHE B 317       8.978  68.892  88.382  1.00  0.53           O  
ATOM   9316  CB  PHE B 317       9.041  66.038  89.349  1.00  0.53           C  
ATOM   9317  CG  PHE B 317       8.125  66.767  90.305  1.00  0.53           C  
ATOM   9318  CD1 PHE B 317       8.653  67.529  91.362  1.00  0.53           C  
ATOM   9319  CD2 PHE B 317       6.731  66.713  90.139  1.00  0.53           C  
ATOM   9320  CE1 PHE B 317       7.808  68.242  92.223  1.00  0.53           C  
ATOM   9321  CE2 PHE B 317       5.882  67.425  90.997  1.00  0.53           C  
ATOM   9322  CZ  PHE B 317       6.421  68.193  92.037  1.00  0.53           C  
ATOM   9323  N   GLY B 318      10.409  68.145  86.836  1.00  0.58           N  
ATOM   9324  CA  GLY B 318      10.976  69.442  86.525  1.00  0.58           C  
ATOM   9325  C   GLY B 318      10.052  70.371  85.768  1.00  0.58           C  
ATOM   9326  O   GLY B 318       9.102  69.968  85.106  1.00  0.58           O  
ATOM   9327  N   SER B 319      10.361  71.679  85.795  1.00  0.56           N  
ATOM   9328  CA  SER B 319       9.576  72.716  85.141  1.00  0.56           C  
ATOM   9329  C   SER B 319       8.109  72.908  85.512  1.00  0.56           C  
ATOM   9330  O   SER B 319       7.591  72.422  86.514  1.00  0.56           O  
ATOM   9331  CB  SER B 319       9.793  72.693  83.602  1.00  0.56           C  
ATOM   9332  OG  SER B 319       9.595  73.972  82.985  1.00  0.56           O  
ATOM   9333  N   THR B 320       7.418  73.744  84.720  1.00  0.49           N  
ATOM   9334  CA  THR B 320       6.015  74.101  84.894  1.00  0.49           C  
ATOM   9335  C   THR B 320       5.727  74.968  86.110  1.00  0.49           C  
ATOM   9336  O   THR B 320       6.353  74.912  87.168  1.00  0.49           O  
ATOM   9337  CB  THR B 320       5.010  72.939  84.924  1.00  0.49           C  
ATOM   9338  OG1 THR B 320       5.504  71.782  84.273  1.00  0.49           O  
ATOM   9339  CG2 THR B 320       3.743  73.323  84.152  1.00  0.49           C  
ATOM   9340  N   ARG B 321       4.669  75.790  86.008  1.00  0.44           N  
ATOM   9341  CA  ARG B 321       3.962  76.332  87.158  1.00  0.44           C  
ATOM   9342  C   ARG B 321       3.144  75.279  87.875  1.00  0.44           C  
ATOM   9343  O   ARG B 321       1.939  75.118  87.716  1.00  0.44           O  
ATOM   9344  CB  ARG B 321       3.078  77.558  86.842  1.00  0.44           C  
ATOM   9345  CG  ARG B 321       2.463  78.247  88.089  1.00  0.44           C  
ATOM   9346  CD  ARG B 321       3.484  78.867  89.051  1.00  0.44           C  
ATOM   9347  NE  ARG B 321       2.722  79.364  90.240  1.00  0.44           N  
ATOM   9348  CZ  ARG B 321       3.247  80.168  91.175  1.00  0.44           C  
ATOM   9349  NH1 ARG B 321       4.511  80.571  91.118  1.00  0.44           N  
ATOM   9350  NH2 ARG B 321       2.479  80.558  92.190  1.00  0.44           N  
ATOM   9351  N   GLY B 322       3.869  74.552  88.716  1.00  0.54           N  
ATOM   9352  CA  GLY B 322       3.350  73.525  89.599  1.00  0.54           C  
ATOM   9353  C   GLY B 322       4.331  73.310  90.708  1.00  0.54           C  
ATOM   9354  O   GLY B 322       3.974  73.110  91.860  1.00  0.54           O  
ATOM   9355  N   ALA B 323       5.618  73.463  90.355  1.00  0.54           N  
ATOM   9356  CA  ALA B 323       6.731  73.734  91.236  1.00  0.54           C  
ATOM   9357  C   ALA B 323       6.592  75.022  92.056  1.00  0.54           C  
ATOM   9358  O   ALA B 323       7.078  75.123  93.175  1.00  0.54           O  
ATOM   9359  CB  ALA B 323       7.975  73.839  90.335  1.00  0.54           C  
ATOM   9360  N   GLY B 324       5.929  76.057  91.491  1.00  0.55           N  
ATOM   9361  CA  GLY B 324       5.894  77.402  92.051  1.00  0.55           C  
ATOM   9362  C   GLY B 324       6.918  78.218  91.327  1.00  0.55           C  
ATOM   9363  O   GLY B 324       6.599  78.854  90.320  1.00  0.55           O  
ATOM   9364  N   THR B 325       8.172  78.160  91.797  1.00  0.59           N  
ATOM   9365  CA  THR B 325       9.353  78.541  91.038  1.00  0.59           C  
ATOM   9366  C   THR B 325      10.004  77.231  90.694  1.00  0.59           C  
ATOM   9367  O   THR B 325      10.210  76.373  91.544  1.00  0.59           O  
ATOM   9368  CB  THR B 325      10.356  79.383  91.823  1.00  0.59           C  
ATOM   9369  OG1 THR B 325       9.855  80.699  91.995  1.00  0.59           O  
ATOM   9370  CG2 THR B 325      11.722  79.521  91.132  1.00  0.59           C  
ATOM   9371  N   VAL B 326      10.369  76.996  89.419  1.00  0.68           N  
ATOM   9372  CA  VAL B 326      10.875  75.696  88.987  1.00  0.68           C  
ATOM   9373  C   VAL B 326      12.139  75.260  89.705  1.00  0.68           C  
ATOM   9374  O   VAL B 326      12.393  74.080  89.906  1.00  0.68           O  
ATOM   9375  CB  VAL B 326      11.024  75.604  87.478  1.00  0.68           C  
ATOM   9376  CG1 VAL B 326       9.618  75.750  86.866  1.00  0.68           C  
ATOM   9377  CG2 VAL B 326      11.988  76.668  86.926  1.00  0.68           C  
ATOM   9378  N   PHE B 327      12.925  76.231  90.186  1.00  0.79           N  
ATOM   9379  CA  PHE B 327      14.144  76.002  90.915  1.00  0.79           C  
ATOM   9380  C   PHE B 327      13.978  75.890  92.421  1.00  0.79           C  
ATOM   9381  O   PHE B 327      14.976  75.756  93.120  1.00  0.79           O  
ATOM   9382  CB  PHE B 327      15.118  77.169  90.654  1.00  0.79           C  
ATOM   9383  CG  PHE B 327      15.417  77.246  89.192  1.00  0.79           C  
ATOM   9384  CD1 PHE B 327      14.887  78.277  88.398  1.00  0.79           C  
ATOM   9385  CD2 PHE B 327      16.242  76.278  88.601  1.00  0.79           C  
ATOM   9386  CE1 PHE B 327      15.218  78.362  87.044  1.00  0.79           C  
ATOM   9387  CE2 PHE B 327      16.590  76.370  87.250  1.00  0.79           C  
ATOM   9388  CZ  PHE B 327      16.087  77.423  86.481  1.00  0.79           C  
ATOM   9389  N   ASP B 328      12.745  75.863  92.978  1.00  0.79           N  
ATOM   9390  CA  ASP B 328      12.535  75.629  94.403  1.00  0.79           C  
ATOM   9391  C   ASP B 328      13.101  74.279  94.842  1.00  0.79           C  
ATOM   9392  O   ASP B 328      13.776  74.173  95.862  1.00  0.79           O  
ATOM   9393  CB  ASP B 328      11.025  75.711  94.767  1.00  0.79           C  
ATOM   9394  CG  ASP B 328      10.573  77.150  94.911  1.00  0.79           C  
ATOM   9395  OD1 ASP B 328      11.273  77.888  95.658  1.00  0.79           O  
ATOM   9396  OD2 ASP B 328       9.545  77.549  94.313  1.00  0.79           O  
ATOM   9397  N   ALA B 329      12.909  73.236  94.014  1.00  0.83           N  
ATOM   9398  CA  ALA B 329      13.410  71.903  94.275  1.00  0.83           C  
ATOM   9399  C   ALA B 329      14.757  71.615  93.616  1.00  0.83           C  
ATOM   9400  O   ALA B 329      15.201  70.470  93.533  1.00  0.83           O  
ATOM   9401  CB  ALA B 329      12.356  70.902  93.775  1.00  0.83           C  
ATOM   9402  N   PHE B 330      15.475  72.654  93.141  1.00  0.85           N  
ATOM   9403  CA  PHE B 330      16.792  72.500  92.535  1.00  0.85           C  
ATOM   9404  C   PHE B 330      17.847  71.848  93.439  1.00  0.85           C  
ATOM   9405  O   PHE B 330      18.439  70.867  92.988  1.00  0.85           O  
ATOM   9406  CB  PHE B 330      17.276  73.875  91.991  1.00  0.85           C  
ATOM   9407  CG  PHE B 330      18.554  73.801  91.198  1.00  0.85           C  
ATOM   9408  CD1 PHE B 330      18.527  73.430  89.847  1.00  0.85           C  
ATOM   9409  CD2 PHE B 330      19.786  74.121  91.789  1.00  0.85           C  
ATOM   9410  CE1 PHE B 330      19.704  73.386  89.091  1.00  0.85           C  
ATOM   9411  CE2 PHE B 330      20.967  74.083  91.036  1.00  0.85           C  
ATOM   9412  CZ  PHE B 330      20.927  73.718  89.685  1.00  0.85           C  
ATOM   9413  N   PRO B 331      18.106  72.214  94.697  1.00  0.94           N  
ATOM   9414  CA  PRO B 331      19.132  71.552  95.503  1.00  0.94           C  
ATOM   9415  C   PRO B 331      18.716  70.177  95.969  1.00  0.94           C  
ATOM   9416  O   PRO B 331      19.503  69.488  96.617  1.00  0.94           O  
ATOM   9417  CB  PRO B 331      19.309  72.500  96.690  1.00  0.94           C  
ATOM   9418  CG  PRO B 331      17.956  73.192  96.837  1.00  0.94           C  
ATOM   9419  CD  PRO B 331      17.555  73.391  95.382  1.00  0.94           C  
ATOM   9420  N   ASP B 332      17.478  69.762  95.686  1.00  0.88           N  
ATOM   9421  CA  ASP B 332      16.966  68.484  96.100  1.00  0.88           C  
ATOM   9422  C   ASP B 332      16.944  67.536  94.898  1.00  0.88           C  
ATOM   9423  O   ASP B 332      16.717  66.336  95.026  1.00  0.88           O  
ATOM   9424  CB  ASP B 332      15.592  68.733  96.760  1.00  0.88           C  
ATOM   9425  CG  ASP B 332      15.775  69.797  97.847  1.00  0.88           C  
ATOM   9426  OD1 ASP B 332      16.631  69.628  98.764  1.00  0.88           O  
ATOM   9427  OD2 ASP B 332      15.125  70.862  97.723  1.00  0.88           O  
ATOM   9428  N   GLN B 333      17.286  68.056  93.698  1.00  0.86           N  
ATOM   9429  CA  GLN B 333      17.509  67.276  92.491  1.00  0.86           C  
ATOM   9430  C   GLN B 333      18.936  67.394  91.970  1.00  0.86           C  
ATOM   9431  O   GLN B 333      19.379  66.585  91.155  1.00  0.86           O  
ATOM   9432  CB  GLN B 333      16.566  67.779  91.378  1.00  0.86           C  
ATOM   9433  CG  GLN B 333      15.076  67.487  91.658  1.00  0.86           C  
ATOM   9434  CD  GLN B 333      14.799  65.988  91.569  1.00  0.86           C  
ATOM   9435  OE1 GLN B 333      14.929  65.388  90.503  1.00  0.86           O  
ATOM   9436  NE2 GLN B 333      14.413  65.365  92.705  1.00  0.86           N  
ATOM   9437  N   VAL B 334      19.712  68.380  92.450  1.00  0.94           N  
ATOM   9438  CA  VAL B 334      21.070  68.642  92.000  1.00  0.94           C  
ATOM   9439  C   VAL B 334      22.014  68.730  93.192  1.00  0.94           C  
ATOM   9440  O   VAL B 334      21.743  69.404  94.182  1.00  0.94           O  
ATOM   9441  CB  VAL B 334      21.130  69.946  91.198  1.00  0.94           C  
ATOM   9442  CG1 VAL B 334      22.561  70.308  90.762  1.00  0.94           C  
ATOM   9443  CG2 VAL B 334      20.229  69.821  89.952  1.00  0.94           C  
ATOM   9444  N   ALA B 335      23.166  68.033  93.135  1.00  0.96           N  
ATOM   9445  CA  ALA B 335      24.291  68.277  94.019  1.00  0.96           C  
ATOM   9446  C   ALA B 335      25.502  68.550  93.152  1.00  0.96           C  
ATOM   9447  O   ALA B 335      25.732  67.838  92.176  1.00  0.96           O  
ATOM   9448  CB  ALA B 335      24.620  67.062  94.914  1.00  0.96           C  
ATOM   9449  N   ILE B 336      26.310  69.583  93.462  1.00  0.95           N  
ATOM   9450  CA  ILE B 336      27.525  69.859  92.704  1.00  0.95           C  
ATOM   9451  C   ILE B 336      28.726  69.863  93.634  1.00  0.95           C  
ATOM   9452  O   ILE B 336      28.851  70.690  94.535  1.00  0.95           O  
ATOM   9453  CB  ILE B 336      27.474  71.163  91.904  1.00  0.95           C  
ATOM   9454  CG1 ILE B 336      26.215  71.209  91.002  1.00  0.95           C  
ATOM   9455  CG2 ILE B 336      28.764  71.283  91.059  1.00  0.95           C  
ATOM   9456  CD1 ILE B 336      26.020  72.525  90.241  1.00  0.95           C  
ATOM   9457  N   GLN B 337      29.671  68.926  93.425  1.00  0.95           N  
ATOM   9458  CA  GLN B 337      30.866  68.839  94.241  1.00  0.95           C  
ATOM   9459  C   GLN B 337      32.009  69.592  93.594  1.00  0.95           C  
ATOM   9460  O   GLN B 337      32.433  69.292  92.479  1.00  0.95           O  
ATOM   9461  CB  GLN B 337      31.299  67.371  94.480  1.00  0.95           C  
ATOM   9462  CG  GLN B 337      32.392  67.179  95.567  1.00  0.95           C  
ATOM   9463  CD  GLN B 337      31.868  67.543  96.959  1.00  0.95           C  
ATOM   9464  OE1 GLN B 337      30.740  67.215  97.313  1.00  0.95           O  
ATOM   9465  NE2 GLN B 337      32.702  68.213  97.783  1.00  0.95           N  
ATOM   9466  N   LEU B 338      32.543  70.592  94.309  1.00  0.95           N  
ATOM   9467  CA  LEU B 338      33.678  71.391  93.905  1.00  0.95           C  
ATOM   9468  C   LEU B 338      34.948  70.691  94.352  1.00  0.95           C  
ATOM   9469  O   LEU B 338      35.349  70.748  95.516  1.00  0.95           O  
ATOM   9470  CB  LEU B 338      33.601  72.814  94.538  1.00  0.95           C  
ATOM   9471  CG  LEU B 338      32.990  73.941  93.672  1.00  0.95           C  
ATOM   9472  CD1 LEU B 338      31.907  73.470  92.693  1.00  0.95           C  
ATOM   9473  CD2 LEU B 338      32.434  75.057  94.569  1.00  0.95           C  
ATOM   9474  N   ASN B 339      35.614  69.992  93.410  1.00  0.94           N  
ATOM   9475  CA  ASN B 339      36.897  69.362  93.646  1.00  0.94           C  
ATOM   9476  C   ASN B 339      38.000  70.412  93.558  1.00  0.94           C  
ATOM   9477  O   ASN B 339      38.289  70.927  92.479  1.00  0.94           O  
ATOM   9478  CB  ASN B 339      37.114  68.238  92.595  1.00  0.94           C  
ATOM   9479  CG  ASN B 339      38.190  67.236  92.983  1.00  0.94           C  
ATOM   9480  OD1 ASN B 339      38.252  66.769  94.122  1.00  0.94           O  
ATOM   9481  ND2 ASN B 339      39.013  66.812  92.000  1.00  0.94           N  
ATOM   9482  N   ASP B 340      38.616  70.734  94.712  1.00  0.91           N  
ATOM   9483  CA  ASP B 340      39.496  71.873  94.912  1.00  0.91           C  
ATOM   9484  C   ASP B 340      38.871  73.247  94.600  1.00  0.91           C  
ATOM   9485  O   ASP B 340      37.652  73.397  94.493  1.00  0.91           O  
ATOM   9486  CB  ASP B 340      40.857  71.644  94.203  1.00  0.91           C  
ATOM   9487  CG  ASP B 340      41.986  72.067  95.119  1.00  0.91           C  
ATOM   9488  OD1 ASP B 340      41.990  73.256  95.521  1.00  0.91           O  
ATOM   9489  OD2 ASP B 340      42.816  71.200  95.484  1.00  0.91           O  
ATOM   9490  N   THR B 341      39.677  74.322  94.493  1.00  0.92           N  
ATOM   9491  CA  THR B 341      39.126  75.667  94.278  1.00  0.92           C  
ATOM   9492  C   THR B 341      39.018  76.062  92.824  1.00  0.92           C  
ATOM   9493  O   THR B 341      38.354  77.045  92.511  1.00  0.92           O  
ATOM   9494  CB  THR B 341      39.810  76.795  95.018  1.00  0.92           C  
ATOM   9495  OG1 THR B 341      41.195  76.806  94.720  1.00  0.92           O  
ATOM   9496  CG2 THR B 341      39.620  76.581  96.530  1.00  0.92           C  
ATOM   9497  N   HIS B 342      39.556  75.256  91.887  1.00  0.89           N  
ATOM   9498  CA  HIS B 342      39.489  75.525  90.452  1.00  0.89           C  
ATOM   9499  C   HIS B 342      38.071  75.712  89.881  1.00  0.89           C  
ATOM   9500  O   HIS B 342      37.905  76.512  88.964  1.00  0.89           O  
ATOM   9501  CB  HIS B 342      40.240  74.454  89.615  1.00  0.89           C  
ATOM   9502  CG  HIS B 342      41.515  73.965  90.234  1.00  0.89           C  
ATOM   9503  ND1 HIS B 342      41.763  72.603  90.343  1.00  0.89           N  
ATOM   9504  CD2 HIS B 342      42.499  74.671  90.841  1.00  0.89           C  
ATOM   9505  CE1 HIS B 342      42.888  72.519  91.032  1.00  0.89           C  
ATOM   9506  NE2 HIS B 342      43.373  73.740  91.356  1.00  0.89           N  
ATOM   9507  N   PRO B 343      36.981  75.084  90.341  1.00  0.97           N  
ATOM   9508  CA  PRO B 343      35.666  75.400  89.787  1.00  0.97           C  
ATOM   9509  C   PRO B 343      34.895  76.299  90.743  1.00  0.97           C  
ATOM   9510  O   PRO B 343      33.666  76.307  90.705  1.00  0.97           O  
ATOM   9511  CB  PRO B 343      35.023  74.010  89.656  1.00  0.97           C  
ATOM   9512  CG  PRO B 343      35.592  73.207  90.826  1.00  0.97           C  
ATOM   9513  CD  PRO B 343      37.013  73.746  90.955  1.00  0.97           C  
ATOM   9514  N   ALA B 344      35.578  77.153  91.540  1.00  0.96           N  
ATOM   9515  CA  ALA B 344      34.977  78.124  92.448  1.00  0.96           C  
ATOM   9516  C   ALA B 344      34.043  79.120  91.784  1.00  0.96           C  
ATOM   9517  O   ALA B 344      33.038  79.548  92.353  1.00  0.96           O  
ATOM   9518  CB  ALA B 344      36.077  78.928  93.159  1.00  0.96           C  
ATOM   9519  N   LEU B 345      34.337  79.475  90.519  1.00  0.94           N  
ATOM   9520  CA  LEU B 345      33.528  80.338  89.677  1.00  0.94           C  
ATOM   9521  C   LEU B 345      32.103  79.830  89.452  1.00  0.94           C  
ATOM   9522  O   LEU B 345      31.224  80.586  89.046  1.00  0.94           O  
ATOM   9523  CB  LEU B 345      34.258  80.547  88.323  1.00  0.94           C  
ATOM   9524  CG  LEU B 345      35.023  81.885  88.184  1.00  0.94           C  
ATOM   9525  CD1 LEU B 345      35.795  82.301  89.442  1.00  0.94           C  
ATOM   9526  CD2 LEU B 345      36.005  81.807  87.008  1.00  0.94           C  
ATOM   9527  N   ALA B 346      31.810  78.551  89.773  1.00  0.97           N  
ATOM   9528  CA  ALA B 346      30.473  77.997  89.739  1.00  0.97           C  
ATOM   9529  C   ALA B 346      29.482  78.705  90.653  1.00  0.97           C  
ATOM   9530  O   ALA B 346      28.322  78.900  90.296  1.00  0.97           O  
ATOM   9531  CB  ALA B 346      30.522  76.486  90.036  1.00  0.97           C  
ATOM   9532  N   ILE B 347      29.926  79.137  91.846  1.00  0.94           N  
ATOM   9533  CA  ILE B 347      29.101  79.883  92.785  1.00  0.94           C  
ATOM   9534  C   ILE B 347      28.662  81.259  92.260  1.00  0.94           C  
ATOM   9535  O   ILE B 347      27.455  81.518  92.297  1.00  0.94           O  
ATOM   9536  CB  ILE B 347      29.787  79.935  94.151  1.00  0.94           C  
ATOM   9537  CG1 ILE B 347      29.914  78.512  94.739  1.00  0.94           C  
ATOM   9538  CG2 ILE B 347      29.035  80.857  95.134  1.00  0.94           C  
ATOM   9539  CD1 ILE B 347      31.061  78.394  95.741  1.00  0.94           C  
ATOM   9540  N   PRO B 348      29.485  82.163  91.702  1.00  0.97           N  
ATOM   9541  CA  PRO B 348      28.980  83.376  91.065  1.00  0.97           C  
ATOM   9542  C   PRO B 348      28.212  83.102  89.793  1.00  0.97           C  
ATOM   9543  O   PRO B 348      27.239  83.803  89.533  1.00  0.97           O  
ATOM   9544  CB  PRO B 348      30.228  84.234  90.800  1.00  0.97           C  
ATOM   9545  CG  PRO B 348      31.224  83.753  91.851  1.00  0.97           C  
ATOM   9546  CD  PRO B 348      30.924  82.262  91.946  1.00  0.97           C  
ATOM   9547  N   GLU B 349      28.611  82.105  88.981  1.00  0.93           N  
ATOM   9548  CA  GLU B 349      27.900  81.780  87.756  1.00  0.93           C  
ATOM   9549  C   GLU B 349      26.489  81.269  87.973  1.00  0.93           C  
ATOM   9550  O   GLU B 349      25.547  81.724  87.330  1.00  0.93           O  
ATOM   9551  CB  GLU B 349      28.713  80.792  86.890  1.00  0.93           C  
ATOM   9552  CG  GLU B 349      28.064  80.356  85.543  1.00  0.93           C  
ATOM   9553  CD  GLU B 349      27.794  81.476  84.546  1.00  0.93           C  
ATOM   9554  OE1 GLU B 349      28.104  82.660  84.827  1.00  0.93           O  
ATOM   9555  OE2 GLU B 349      27.241  81.191  83.451  1.00  0.93           O  
ATOM   9556  N   LEU B 350      26.262  80.360  88.943  1.00  0.95           N  
ATOM   9557  CA  LEU B 350      24.921  79.902  89.266  1.00  0.95           C  
ATOM   9558  C   LEU B 350      24.033  81.037  89.762  1.00  0.95           C  
ATOM   9559  O   LEU B 350      22.875  81.171  89.370  1.00  0.95           O  
ATOM   9560  CB  LEU B 350      24.964  78.730  90.274  1.00  0.95           C  
ATOM   9561  CG  LEU B 350      23.607  78.036  90.516  1.00  0.95           C  
ATOM   9562  CD1 LEU B 350      22.982  77.483  89.226  1.00  0.95           C  
ATOM   9563  CD2 LEU B 350      23.744  76.908  91.546  1.00  0.95           C  
ATOM   9564  N   MET B 351      24.606  81.953  90.569  1.00  0.92           N  
ATOM   9565  CA  MET B 351      23.961  83.203  90.927  1.00  0.92           C  
ATOM   9566  C   MET B 351      23.635  84.099  89.740  1.00  0.92           C  
ATOM   9567  O   MET B 351      22.537  84.642  89.656  1.00  0.92           O  
ATOM   9568  CB  MET B 351      24.841  83.996  91.919  1.00  0.92           C  
ATOM   9569  CG  MET B 351      24.860  83.381  93.325  1.00  0.92           C  
ATOM   9570  SD  MET B 351      23.223  83.286  94.090  1.00  0.92           S  
ATOM   9571  CE  MET B 351      22.942  85.064  94.306  1.00  0.92           C  
ATOM   9572  N   ARG B 352      24.555  84.248  88.771  1.00  0.89           N  
ATOM   9573  CA  ARG B 352      24.320  84.981  87.541  1.00  0.89           C  
ATOM   9574  C   ARG B 352      23.190  84.404  86.692  1.00  0.89           C  
ATOM   9575  O   ARG B 352      22.327  85.127  86.198  1.00  0.89           O  
ATOM   9576  CB  ARG B 352      25.617  85.022  86.701  1.00  0.89           C  
ATOM   9577  CG  ARG B 352      25.565  86.053  85.561  1.00  0.89           C  
ATOM   9578  CD  ARG B 352      26.781  86.006  84.636  1.00  0.89           C  
ATOM   9579  NE  ARG B 352      26.753  84.712  83.890  1.00  0.89           N  
ATOM   9580  CZ  ARG B 352      26.003  84.437  82.821  1.00  0.89           C  
ATOM   9581  NH1 ARG B 352      25.149  85.319  82.307  1.00  0.89           N  
ATOM   9582  NH2 ARG B 352      26.107  83.243  82.249  1.00  0.89           N  
ATOM   9583  N   ILE B 353      23.132  83.065  86.531  1.00  0.92           N  
ATOM   9584  CA  ILE B 353      22.034  82.398  85.842  1.00  0.92           C  
ATOM   9585  C   ILE B 353      20.708  82.604  86.568  1.00  0.92           C  
ATOM   9586  O   ILE B 353      19.715  83.022  85.976  1.00  0.92           O  
ATOM   9587  CB  ILE B 353      22.299  80.902  85.657  1.00  0.92           C  
ATOM   9588  CG1 ILE B 353      23.608  80.649  84.868  1.00  0.92           C  
ATOM   9589  CG2 ILE B 353      21.112  80.242  84.915  1.00  0.92           C  
ATOM   9590  CD1 ILE B 353      24.128  79.212  85.012  1.00  0.92           C  
ATOM   9591  N   PHE B 354      20.667  82.382  87.896  1.00  0.91           N  
ATOM   9592  CA  PHE B 354      19.456  82.567  88.677  1.00  0.91           C  
ATOM   9593  C   PHE B 354      18.935  83.999  88.724  1.00  0.91           C  
ATOM   9594  O   PHE B 354      17.744  84.236  88.521  1.00  0.91           O  
ATOM   9595  CB  PHE B 354      19.654  82.070  90.138  1.00  0.91           C  
ATOM   9596  CG  PHE B 354      19.653  80.569  90.309  1.00  0.91           C  
ATOM   9597  CD1 PHE B 354      20.279  80.035  91.451  1.00  0.91           C  
ATOM   9598  CD2 PHE B 354      18.989  79.683  89.436  1.00  0.91           C  
ATOM   9599  CE1 PHE B 354      20.240  78.662  91.721  1.00  0.91           C  
ATOM   9600  CE2 PHE B 354      18.959  78.310  89.699  1.00  0.91           C  
ATOM   9601  CZ  PHE B 354      19.574  77.799  90.844  1.00  0.91           C  
ATOM   9602  N   VAL B 355      19.802  84.996  88.973  1.00  0.90           N  
ATOM   9603  CA  VAL B 355      19.363  86.377  89.123  1.00  0.90           C  
ATOM   9604  C   VAL B 355      19.144  87.068  87.784  1.00  0.90           C  
ATOM   9605  O   VAL B 355      18.061  87.584  87.513  1.00  0.90           O  
ATOM   9606  CB  VAL B 355      20.342  87.181  89.987  1.00  0.90           C  
ATOM   9607  CG1 VAL B 355      19.869  88.641  90.150  1.00  0.90           C  
ATOM   9608  CG2 VAL B 355      20.438  86.519  91.377  1.00  0.90           C  
ATOM   9609  N   ASP B 356      20.144  87.069  86.880  1.00  0.90           N  
ATOM   9610  CA  ASP B 356      20.065  87.837  85.648  1.00  0.90           C  
ATOM   9611  C   ASP B 356      19.197  87.167  84.580  1.00  0.90           C  
ATOM   9612  O   ASP B 356      18.409  87.814  83.887  1.00  0.90           O  
ATOM   9613  CB  ASP B 356      21.480  88.124  85.067  1.00  0.90           C  
ATOM   9614  CG  ASP B 356      22.376  88.858  86.048  1.00  0.90           C  
ATOM   9615  OD1 ASP B 356      23.620  88.656  85.978  1.00  0.90           O  
ATOM   9616  OD2 ASP B 356      21.885  89.667  86.871  1.00  0.90           O  
ATOM   9617  N   ILE B 357      19.329  85.834  84.404  1.00  0.88           N  
ATOM   9618  CA  ILE B 357      18.630  85.108  83.348  1.00  0.88           C  
ATOM   9619  C   ILE B 357      17.277  84.589  83.798  1.00  0.88           C  
ATOM   9620  O   ILE B 357      16.259  84.818  83.142  1.00  0.88           O  
ATOM   9621  CB  ILE B 357      19.490  83.980  82.779  1.00  0.88           C  
ATOM   9622  CG1 ILE B 357      20.721  84.580  82.059  1.00  0.88           C  
ATOM   9623  CG2 ILE B 357      18.672  83.098  81.804  1.00  0.88           C  
ATOM   9624  CD1 ILE B 357      21.865  83.579  81.867  1.00  0.88           C  
ATOM   9625  N   GLU B 358      17.185  83.890  84.942  1.00  0.82           N  
ATOM   9626  CA  GLU B 358      15.915  83.329  85.377  1.00  0.82           C  
ATOM   9627  C   GLU B 358      15.021  84.358  86.074  1.00  0.82           C  
ATOM   9628  O   GLU B 358      13.797  84.253  86.022  1.00  0.82           O  
ATOM   9629  CB  GLU B 358      16.122  82.064  86.237  1.00  0.82           C  
ATOM   9630  CG  GLU B 358      16.981  80.971  85.528  1.00  0.82           C  
ATOM   9631  CD  GLU B 358      16.380  80.241  84.324  1.00  0.82           C  
ATOM   9632  OE1 GLU B 358      17.155  79.537  83.620  1.00  0.82           O  
ATOM   9633  OE2 GLU B 358      15.150  80.270  84.071  1.00  0.82           O  
ATOM   9634  N   LYS B 359      15.601  85.453  86.620  1.00  0.81           N  
ATOM   9635  CA  LYS B 359      14.921  86.545  87.328  1.00  0.81           C  
ATOM   9636  C   LYS B 359      14.437  86.137  88.712  1.00  0.81           C  
ATOM   9637  O   LYS B 359      13.371  86.534  89.180  1.00  0.81           O  
ATOM   9638  CB  LYS B 359      13.792  87.304  86.554  1.00  0.81           C  
ATOM   9639  CG  LYS B 359      14.254  88.368  85.540  1.00  0.81           C  
ATOM   9640  CD  LYS B 359      15.038  87.882  84.310  1.00  0.81           C  
ATOM   9641  CE  LYS B 359      14.201  87.225  83.206  1.00  0.81           C  
ATOM   9642  NZ  LYS B 359      13.809  85.854  83.581  1.00  0.81           N  
ATOM   9643  N   LEU B 360      15.249  85.352  89.436  1.00  0.82           N  
ATOM   9644  CA  LEU B 360      14.973  85.016  90.814  1.00  0.82           C  
ATOM   9645  C   LEU B 360      15.510  86.104  91.738  1.00  0.82           C  
ATOM   9646  O   LEU B 360      16.567  86.671  91.450  1.00  0.82           O  
ATOM   9647  CB  LEU B 360      15.603  83.655  91.200  1.00  0.82           C  
ATOM   9648  CG  LEU B 360      15.119  82.470  90.338  1.00  0.82           C  
ATOM   9649  CD1 LEU B 360      15.785  81.163  90.791  1.00  0.82           C  
ATOM   9650  CD2 LEU B 360      13.593  82.326  90.360  1.00  0.82           C  
ATOM   9651  N   PRO B 361      14.852  86.459  92.848  1.00  0.85           N  
ATOM   9652  CA  PRO B 361      15.422  87.310  93.889  1.00  0.85           C  
ATOM   9653  C   PRO B 361      16.807  86.890  94.340  1.00  0.85           C  
ATOM   9654  O   PRO B 361      17.050  85.695  94.495  1.00  0.85           O  
ATOM   9655  CB  PRO B 361      14.394  87.259  95.033  1.00  0.85           C  
ATOM   9656  CG  PRO B 361      13.076  86.907  94.339  1.00  0.85           C  
ATOM   9657  CD  PRO B 361      13.522  85.974  93.217  1.00  0.85           C  
ATOM   9658  N   TRP B 362      17.727  87.844  94.593  1.00  0.83           N  
ATOM   9659  CA  TRP B 362      19.109  87.542  94.938  1.00  0.83           C  
ATOM   9660  C   TRP B 362      19.225  86.657  96.171  1.00  0.83           C  
ATOM   9661  O   TRP B 362      19.966  85.679  96.194  1.00  0.83           O  
ATOM   9662  CB  TRP B 362      19.895  88.868  95.164  1.00  0.83           C  
ATOM   9663  CG  TRP B 362      21.411  88.767  95.121  1.00  0.83           C  
ATOM   9664  CD1 TRP B 362      22.238  89.126  94.091  1.00  0.83           C  
ATOM   9665  CD2 TRP B 362      22.287  88.259  96.161  1.00  0.83           C  
ATOM   9666  NE1 TRP B 362      23.561  88.882  94.410  1.00  0.83           N  
ATOM   9667  CE2 TRP B 362      23.590  88.334  95.675  1.00  0.83           C  
ATOM   9668  CE3 TRP B 362      22.016  87.743  97.435  1.00  0.83           C  
ATOM   9669  CZ2 TRP B 362      24.675  87.887  96.426  1.00  0.83           C  
ATOM   9670  CZ3 TRP B 362      23.100  87.228  98.166  1.00  0.83           C  
ATOM   9671  CH2 TRP B 362      24.406  87.301  97.675  1.00  0.83           C  
ATOM   9672  N   SER B 363      18.440  86.958  97.224  1.00  0.84           N  
ATOM   9673  CA  SER B 363      18.401  86.168  98.446  1.00  0.84           C  
ATOM   9674  C   SER B 363      17.959  84.738  98.223  1.00  0.84           C  
ATOM   9675  O   SER B 363      18.602  83.802  98.684  1.00  0.84           O  
ATOM   9676  CB  SER B 363      17.432  86.786  99.480  1.00  0.84           C  
ATOM   9677  OG  SER B 363      17.753  88.163  99.692  1.00  0.84           O  
ATOM   9678  N   LYS B 364      16.890  84.550  97.424  1.00  0.80           N  
ATOM   9679  CA  LYS B 364      16.368  83.255  97.033  1.00  0.80           C  
ATOM   9680  C   LYS B 364      17.353  82.435  96.215  1.00  0.80           C  
ATOM   9681  O   LYS B 364      17.552  81.244  96.435  1.00  0.80           O  
ATOM   9682  CB  LYS B 364      15.079  83.469  96.200  1.00  0.80           C  
ATOM   9683  CG  LYS B 364      14.452  82.191  95.625  1.00  0.80           C  
ATOM   9684  CD  LYS B 364      14.078  81.182  96.721  1.00  0.80           C  
ATOM   9685  CE  LYS B 364      13.492  79.908  96.131  1.00  0.80           C  
ATOM   9686  NZ  LYS B 364      13.048  78.988  97.191  1.00  0.80           N  
ATOM   9687  N   ALA B 365      18.036  83.073  95.251  1.00  0.90           N  
ATOM   9688  CA  ALA B 365      19.099  82.457  94.491  1.00  0.90           C  
ATOM   9689  C   ALA B 365      20.266  82.006  95.365  1.00  0.90           C  
ATOM   9690  O   ALA B 365      20.795  80.910  95.202  1.00  0.90           O  
ATOM   9691  CB  ALA B 365      19.569  83.458  93.422  1.00  0.90           C  
ATOM   9692  N   TRP B 366      20.672  82.828  96.351  1.00  0.86           N  
ATOM   9693  CA  TRP B 366      21.713  82.498  97.306  1.00  0.86           C  
ATOM   9694  C   TRP B 366      21.383  81.306  98.202  1.00  0.86           C  
ATOM   9695  O   TRP B 366      22.230  80.442  98.437  1.00  0.86           O  
ATOM   9696  CB  TRP B 366      22.089  83.764  98.115  1.00  0.86           C  
ATOM   9697  CG  TRP B 366      23.280  83.623  99.035  1.00  0.86           C  
ATOM   9698  CD1 TRP B 366      23.316  83.697 100.399  1.00  0.86           C  
ATOM   9699  CD2 TRP B 366      24.627  83.312  98.618  1.00  0.86           C  
ATOM   9700  NE1 TRP B 366      24.592  83.447 100.866  1.00  0.86           N  
ATOM   9701  CE2 TRP B 366      25.399  83.200  99.775  1.00  0.86           C  
ATOM   9702  CE3 TRP B 366      25.181  83.116  97.351  1.00  0.86           C  
ATOM   9703  CZ2 TRP B 366      26.751  82.873  99.712  1.00  0.86           C  
ATOM   9704  CZ3 TRP B 366      26.538  82.768  97.281  1.00  0.86           C  
ATOM   9705  CH2 TRP B 366      27.311  82.650  98.442  1.00  0.86           C  
ATOM   9706  N   GLU B 367      20.124  81.190  98.678  1.00  0.85           N  
ATOM   9707  CA  GLU B 367      19.641  80.023  99.402  1.00  0.85           C  
ATOM   9708  C   GLU B 367      19.761  78.739  98.586  1.00  0.85           C  
ATOM   9709  O   GLU B 367      20.270  77.720  99.055  1.00  0.85           O  
ATOM   9710  CB  GLU B 367      18.139  80.192  99.736  1.00  0.85           C  
ATOM   9711  CG  GLU B 367      17.792  81.318 100.737  1.00  0.85           C  
ATOM   9712  CD  GLU B 367      16.299  81.657 100.710  1.00  0.85           C  
ATOM   9713  OE1 GLU B 367      15.547  81.067  99.884  1.00  0.85           O  
ATOM   9714  OE2 GLU B 367      15.903  82.542 101.508  1.00  0.85           O  
ATOM   9715  N   LEU B 368      19.335  78.780  97.306  1.00  0.90           N  
ATOM   9716  CA  LEU B 368      19.451  77.665  96.385  1.00  0.90           C  
ATOM   9717  C   LEU B 368      20.894  77.291  96.073  1.00  0.90           C  
ATOM   9718  O   LEU B 368      21.262  76.119  96.096  1.00  0.90           O  
ATOM   9719  CB  LEU B 368      18.735  77.988  95.053  1.00  0.90           C  
ATOM   9720  CG  LEU B 368      17.222  78.256  95.164  1.00  0.90           C  
ATOM   9721  CD1 LEU B 368      16.707  78.743  93.803  1.00  0.90           C  
ATOM   9722  CD2 LEU B 368      16.442  77.022  95.631  1.00  0.90           C  
ATOM   9723  N   THR B 369      21.755  78.294  95.808  1.00  0.92           N  
ATOM   9724  CA  THR B 369      23.173  78.126  95.497  1.00  0.92           C  
ATOM   9725  C   THR B 369      23.943  77.451  96.605  1.00  0.92           C  
ATOM   9726  O   THR B 369      24.646  76.472  96.360  1.00  0.92           O  
ATOM   9727  CB  THR B 369      23.819  79.470  95.170  1.00  0.92           C  
ATOM   9728  OG1 THR B 369      23.315  79.927  93.923  1.00  0.92           O  
ATOM   9729  CG2 THR B 369      25.341  79.404  95.006  1.00  0.92           C  
ATOM   9730  N   GLN B 370      23.773  77.888  97.872  1.00  0.89           N  
ATOM   9731  CA  GLN B 370      24.461  77.278  99.001  1.00  0.89           C  
ATOM   9732  C   GLN B 370      24.117  75.810  99.210  1.00  0.89           C  
ATOM   9733  O   GLN B 370      24.991  75.005  99.491  1.00  0.89           O  
ATOM   9734  CB  GLN B 370      24.204  78.043 100.320  1.00  0.89           C  
ATOM   9735  CG  GLN B 370      24.852  79.446 100.380  1.00  0.89           C  
ATOM   9736  CD  GLN B 370      24.447  80.153 101.672  1.00  0.89           C  
ATOM   9737  OE1 GLN B 370      25.206  80.316 102.625  1.00  0.89           O  
ATOM   9738  NE2 GLN B 370      23.166  80.586 101.721  1.00  0.89           N  
ATOM   9739  N   LYS B 371      22.840  75.410  99.042  1.00  0.89           N  
ATOM   9740  CA  LYS B 371      22.419  74.025  99.220  1.00  0.89           C  
ATOM   9741  C   LYS B 371      22.837  73.096  98.079  1.00  0.89           C  
ATOM   9742  O   LYS B 371      22.755  71.872  98.195  1.00  0.89           O  
ATOM   9743  CB  LYS B 371      20.875  73.934  99.340  1.00  0.89           C  
ATOM   9744  CG  LYS B 371      20.258  74.567 100.591  1.00  0.89           C  
ATOM   9745  CD  LYS B 371      18.720  74.412 100.638  1.00  0.89           C  
ATOM   9746  CE  LYS B 371      18.153  73.058 101.137  1.00  0.89           C  
ATOM   9747  NZ  LYS B 371      18.173  71.959 100.129  1.00  0.89           N  
ATOM   9748  N   THR B 372      23.239  73.666  96.932  1.00  0.94           N  
ATOM   9749  CA  THR B 372      23.690  72.927  95.759  1.00  0.94           C  
ATOM   9750  C   THR B 372      25.155  72.566  95.828  1.00  0.94           C  
ATOM   9751  O   THR B 372      25.550  71.456  95.466  1.00  0.94           O  
ATOM   9752  CB  THR B 372      23.440  73.738  94.494  1.00  0.94           C  
ATOM   9753  OG1 THR B 372      22.049  73.734  94.211  1.00  0.94           O  
ATOM   9754  CG2 THR B 372      24.141  73.171  93.253  1.00  0.94           C  
ATOM   9755  N   PHE B 373      26.012  73.507  96.264  1.00  0.95           N  
ATOM   9756  CA  PHE B 373      27.448  73.332  96.209  1.00  0.95           C  
ATOM   9757  C   PHE B 373      28.048  72.738  97.471  1.00  0.95           C  
ATOM   9758  O   PHE B 373      27.680  73.045  98.601  1.00  0.95           O  
ATOM   9759  CB  PHE B 373      28.168  74.672  95.908  1.00  0.95           C  
ATOM   9760  CG  PHE B 373      27.932  75.109  94.489  1.00  0.95           C  
ATOM   9761  CD1 PHE B 373      27.195  76.266  94.195  1.00  0.95           C  
ATOM   9762  CD2 PHE B 373      28.481  74.372  93.429  1.00  0.95           C  
ATOM   9763  CE1 PHE B 373      26.995  76.667  92.867  1.00  0.95           C  
ATOM   9764  CE2 PHE B 373      28.278  74.766  92.101  1.00  0.95           C  
ATOM   9765  CZ  PHE B 373      27.527  75.911  91.819  1.00  0.95           C  
ATOM   9766  N   ALA B 374      29.051  71.870  97.285  1.00  0.97           N  
ATOM   9767  CA  ALA B 374      29.854  71.348  98.360  1.00  0.97           C  
ATOM   9768  C   ALA B 374      31.315  71.411  97.964  1.00  0.97           C  
ATOM   9769  O   ALA B 374      31.663  71.150  96.817  1.00  0.97           O  
ATOM   9770  CB  ALA B 374      29.432  69.911  98.665  1.00  0.97           C  
ATOM   9771  N   TYR B 375      32.211  71.784  98.897  1.00  0.93           N  
ATOM   9772  CA  TYR B 375      33.605  72.091  98.610  1.00  0.93           C  
ATOM   9773  C   TYR B 375      34.560  71.060  99.203  1.00  0.93           C  
ATOM   9774  O   TYR B 375      34.520  70.734 100.387  1.00  0.93           O  
ATOM   9775  CB  TYR B 375      33.920  73.520  99.163  1.00  0.93           C  
ATOM   9776  CG  TYR B 375      35.382  73.940  99.197  1.00  0.93           C  
ATOM   9777  CD1 TYR B 375      36.274  73.687  98.136  1.00  0.93           C  
ATOM   9778  CD2 TYR B 375      35.867  74.622 100.328  1.00  0.93           C  
ATOM   9779  CE1 TYR B 375      37.632  74.026  98.250  1.00  0.93           C  
ATOM   9780  CE2 TYR B 375      37.218  74.975 100.437  1.00  0.93           C  
ATOM   9781  CZ  TYR B 375      38.104  74.652  99.409  1.00  0.93           C  
ATOM   9782  OH  TYR B 375      39.465  74.984  99.557  1.00  0.93           O  
ATOM   9783  N   THR B 376      35.498  70.557  98.377  1.00  0.93           N  
ATOM   9784  CA  THR B 376      36.545  69.639  98.823  1.00  0.93           C  
ATOM   9785  C   THR B 376      37.887  70.336  98.857  1.00  0.93           C  
ATOM   9786  O   THR B 376      38.418  70.751  97.830  1.00  0.93           O  
ATOM   9787  CB  THR B 376      36.730  68.410  97.938  1.00  0.93           C  
ATOM   9788  OG1 THR B 376      35.516  67.686  97.831  1.00  0.93           O  
ATOM   9789  CG2 THR B 376      37.759  67.444  98.547  1.00  0.93           C  
ATOM   9790  N   ASN B 377      38.505  70.446 100.048  1.00  0.86           N  
ATOM   9791  CA  ASN B 377      39.825  71.018 100.228  1.00  0.86           C  
ATOM   9792  C   ASN B 377      40.890  69.926 100.181  1.00  0.86           C  
ATOM   9793  O   ASN B 377      40.939  69.051 101.046  1.00  0.86           O  
ATOM   9794  CB  ASN B 377      39.869  71.767 101.592  1.00  0.86           C  
ATOM   9795  CG  ASN B 377      41.243  72.352 101.912  1.00  0.86           C  
ATOM   9796  OD1 ASN B 377      42.099  71.664 102.464  1.00  0.86           O  
ATOM   9797  ND2 ASN B 377      41.477  73.625 101.537  1.00  0.86           N  
ATOM   9798  N   HIS B 378      41.798  69.984  99.185  1.00  0.83           N  
ATOM   9799  CA  HIS B 378      42.906  69.042  99.104  1.00  0.83           C  
ATOM   9800  C   HIS B 378      44.225  69.641  99.566  1.00  0.83           C  
ATOM   9801  O   HIS B 378      45.176  68.921  99.859  1.00  0.83           O  
ATOM   9802  CB  HIS B 378      43.123  68.602  97.643  1.00  0.83           C  
ATOM   9803  CG  HIS B 378      41.968  67.838  97.076  1.00  0.83           C  
ATOM   9804  ND1 HIS B 378      41.971  66.457  97.136  1.00  0.83           N  
ATOM   9805  CD2 HIS B 378      40.837  68.278  96.467  1.00  0.83           C  
ATOM   9806  CE1 HIS B 378      40.847  66.085  96.564  1.00  0.83           C  
ATOM   9807  NE2 HIS B 378      40.122  67.146  96.141  1.00  0.83           N  
ATOM   9808  N   THR B 379      44.315  70.981  99.674  1.00  0.74           N  
ATOM   9809  CA  THR B 379      45.542  71.674 100.056  1.00  0.74           C  
ATOM   9810  C   THR B 379      45.346  72.387 101.383  1.00  0.74           C  
ATOM   9811  O   THR B 379      44.539  73.303 101.544  1.00  0.74           O  
ATOM   9812  CB  THR B 379      46.104  72.607  98.976  1.00  0.74           C  
ATOM   9813  OG1 THR B 379      47.269  73.300  99.410  1.00  0.74           O  
ATOM   9814  CG2 THR B 379      45.086  73.651  98.495  1.00  0.74           C  
ATOM   9815  N   VAL B 380      46.103  71.936 102.404  1.00  0.70           N  
ATOM   9816  CA  VAL B 380      46.026  72.448 103.765  1.00  0.70           C  
ATOM   9817  C   VAL B 380      46.812  73.734 103.971  1.00  0.70           C  
ATOM   9818  O   VAL B 380      46.635  74.468 104.940  1.00  0.70           O  
ATOM   9819  CB  VAL B 380      46.524  71.389 104.751  1.00  0.70           C  
ATOM   9820  CG1 VAL B 380      48.057  71.211 104.737  1.00  0.70           C  
ATOM   9821  CG2 VAL B 380      45.999  71.693 106.164  1.00  0.70           C  
ATOM   9822  N   LEU B 381      47.733  74.053 103.047  1.00  0.64           N  
ATOM   9823  CA  LEU B 381      48.672  75.134 103.224  1.00  0.64           C  
ATOM   9824  C   LEU B 381      48.026  76.481 102.914  1.00  0.64           C  
ATOM   9825  O   LEU B 381      47.634  76.693 101.765  1.00  0.64           O  
ATOM   9826  CB  LEU B 381      49.895  74.887 102.305  1.00  0.64           C  
ATOM   9827  CG  LEU B 381      51.041  75.919 102.386  1.00  0.64           C  
ATOM   9828  CD1 LEU B 381      51.714  75.943 103.763  1.00  0.64           C  
ATOM   9829  CD2 LEU B 381      52.101  75.649 101.308  1.00  0.64           C  
ATOM   9830  N   PRO B 382      47.897  77.447 103.836  1.00  0.72           N  
ATOM   9831  CA  PRO B 382      47.186  78.697 103.577  1.00  0.72           C  
ATOM   9832  C   PRO B 382      47.895  79.550 102.548  1.00  0.72           C  
ATOM   9833  O   PRO B 382      47.255  80.372 101.898  1.00  0.72           O  
ATOM   9834  CB  PRO B 382      47.095  79.376 104.953  1.00  0.72           C  
ATOM   9835  CG  PRO B 382      48.237  78.760 105.762  1.00  0.72           C  
ATOM   9836  CD  PRO B 382      48.248  77.322 105.254  1.00  0.72           C  
ATOM   9837  N   GLU B 383      49.208  79.343 102.373  1.00  0.70           N  
ATOM   9838  CA  GLU B 383      50.031  79.981 101.368  1.00  0.70           C  
ATOM   9839  C   GLU B 383      49.727  79.484  99.953  1.00  0.70           C  
ATOM   9840  O   GLU B 383      50.009  80.134  98.952  1.00  0.70           O  
ATOM   9841  CB  GLU B 383      51.503  79.651 101.704  1.00  0.70           C  
ATOM   9842  CG  GLU B 383      52.506  80.710 101.204  1.00  0.70           C  
ATOM   9843  CD  GLU B 383      52.530  81.904 102.152  1.00  0.70           C  
ATOM   9844  OE1 GLU B 383      51.851  82.918 101.855  1.00  0.70           O  
ATOM   9845  OE2 GLU B 383      53.216  81.781 103.200  1.00  0.70           O  
ATOM   9846  N   ALA B 384      49.103  78.292  99.838  1.00  0.74           N  
ATOM   9847  CA  ALA B 384      48.803  77.662  98.570  1.00  0.74           C  
ATOM   9848  C   ALA B 384      47.315  77.644  98.275  1.00  0.74           C  
ATOM   9849  O   ALA B 384      46.849  76.920  97.397  1.00  0.74           O  
ATOM   9850  CB  ALA B 384      49.335  76.219  98.570  1.00  0.74           C  
ATOM   9851  N   LEU B 385      46.518  78.461  98.990  1.00  0.80           N  
ATOM   9852  CA  LEU B 385      45.144  78.706  98.596  1.00  0.80           C  
ATOM   9853  C   LEU B 385      45.096  79.619  97.387  1.00  0.80           C  
ATOM   9854  O   LEU B 385      45.786  80.631  97.321  1.00  0.80           O  
ATOM   9855  CB  LEU B 385      44.279  79.348  99.705  1.00  0.80           C  
ATOM   9856  CG  LEU B 385      44.203  78.546 101.014  1.00  0.80           C  
ATOM   9857  CD1 LEU B 385      43.419  79.345 102.066  1.00  0.80           C  
ATOM   9858  CD2 LEU B 385      43.585  77.154 100.820  1.00  0.80           C  
ATOM   9859  N   GLU B 386      44.274  79.275  96.392  1.00  0.83           N  
ATOM   9860  CA  GLU B 386      44.139  80.030  95.171  1.00  0.83           C  
ATOM   9861  C   GLU B 386      43.622  81.453  95.309  1.00  0.83           C  
ATOM   9862  O   GLU B 386      42.639  81.743  96.002  1.00  0.83           O  
ATOM   9863  CB  GLU B 386      43.221  79.202  94.286  1.00  0.83           C  
ATOM   9864  CG  GLU B 386      43.037  79.647  92.828  1.00  0.83           C  
ATOM   9865  CD  GLU B 386      42.606  78.401  92.065  1.00  0.83           C  
ATOM   9866  OE1 GLU B 386      41.492  77.882  92.339  1.00  0.83           O  
ATOM   9867  OE2 GLU B 386      43.467  77.876  91.319  1.00  0.83           O  
ATOM   9868  N   ARG B 387      44.320  82.387  94.634  1.00  0.78           N  
ATOM   9869  CA  ARG B 387      44.049  83.800  94.698  1.00  0.78           C  
ATOM   9870  C   ARG B 387      44.036  84.388  93.301  1.00  0.78           C  
ATOM   9871  O   ARG B 387      45.032  84.326  92.583  1.00  0.78           O  
ATOM   9872  CB  ARG B 387      45.117  84.577  95.522  1.00  0.78           C  
ATOM   9873  CG  ARG B 387      45.446  84.015  96.921  1.00  0.78           C  
ATOM   9874  CD  ARG B 387      44.290  84.088  97.920  1.00  0.78           C  
ATOM   9875  NE  ARG B 387      44.597  83.272  99.140  1.00  0.78           N  
ATOM   9876  CZ  ARG B 387      45.626  83.458  99.975  1.00  0.78           C  
ATOM   9877  NH1 ARG B 387      46.356  84.559  99.980  1.00  0.78           N  
ATOM   9878  NH2 ARG B 387      45.809  82.559 100.937  1.00  0.78           N  
ATOM   9879  N   TRP B 388      42.925  85.022  92.889  1.00  0.82           N  
ATOM   9880  CA  TRP B 388      42.853  85.688  91.600  1.00  0.82           C  
ATOM   9881  C   TRP B 388      42.931  87.193  91.805  1.00  0.82           C  
ATOM   9882  O   TRP B 388      42.241  87.686  92.695  1.00  0.82           O  
ATOM   9883  CB  TRP B 388      41.550  85.327  90.838  1.00  0.82           C  
ATOM   9884  CG  TRP B 388      41.586  83.931  90.236  1.00  0.82           C  
ATOM   9885  CD1 TRP B 388      40.864  82.810  90.537  1.00  0.82           C  
ATOM   9886  CD2 TRP B 388      42.475  83.561  89.178  1.00  0.82           C  
ATOM   9887  NE1 TRP B 388      41.286  81.752  89.766  1.00  0.82           N  
ATOM   9888  CE2 TRP B 388      42.284  82.177  88.943  1.00  0.82           C  
ATOM   9889  CE3 TRP B 388      43.388  84.291  88.435  1.00  0.82           C  
ATOM   9890  CZ2 TRP B 388      43.026  81.510  87.988  1.00  0.82           C  
ATOM   9891  CZ3 TRP B 388      44.127  83.615  87.462  1.00  0.82           C  
ATOM   9892  CH2 TRP B 388      43.957  82.242  87.248  1.00  0.82           C  
ATOM   9893  N   PRO B 389      43.731  87.987  91.085  1.00  0.88           N  
ATOM   9894  CA  PRO B 389      43.617  89.444  91.069  1.00  0.88           C  
ATOM   9895  C   PRO B 389      42.226  89.926  90.710  1.00  0.88           C  
ATOM   9896  O   PRO B 389      41.656  89.407  89.748  1.00  0.88           O  
ATOM   9897  CB  PRO B 389      44.663  89.906  90.040  1.00  0.88           C  
ATOM   9898  CG  PRO B 389      45.662  88.749  89.972  1.00  0.88           C  
ATOM   9899  CD  PRO B 389      44.767  87.528  90.161  1.00  0.88           C  
ATOM   9900  N   VAL B 390      41.655  90.914  91.429  1.00  0.88           N  
ATOM   9901  CA  VAL B 390      40.325  91.430  91.111  1.00  0.88           C  
ATOM   9902  C   VAL B 390      40.289  92.035  89.725  1.00  0.88           C  
ATOM   9903  O   VAL B 390      39.326  91.870  88.991  1.00  0.88           O  
ATOM   9904  CB  VAL B 390      39.754  92.437  92.107  1.00  0.88           C  
ATOM   9905  CG1 VAL B 390      39.717  91.822  93.515  1.00  0.88           C  
ATOM   9906  CG2 VAL B 390      40.528  93.766  92.101  1.00  0.88           C  
ATOM   9907  N   ASP B 391      41.399  92.678  89.334  1.00  0.85           N  
ATOM   9908  CA  ASP B 391      41.681  93.392  88.117  1.00  0.85           C  
ATOM   9909  C   ASP B 391      41.544  92.486  86.893  1.00  0.85           C  
ATOM   9910  O   ASP B 391      40.963  92.822  85.860  1.00  0.85           O  
ATOM   9911  CB  ASP B 391      43.151  93.925  88.220  1.00  0.85           C  
ATOM   9912  CG  ASP B 391      43.570  94.315  89.641  1.00  0.85           C  
ATOM   9913  OD1 ASP B 391      43.777  95.521  89.901  1.00  0.85           O  
ATOM   9914  OD2 ASP B 391      43.709  93.381  90.482  1.00  0.85           O  
ATOM   9915  N   LEU B 392      42.071  91.250  87.015  1.00  0.85           N  
ATOM   9916  CA  LEU B 392      41.941  90.209  86.015  1.00  0.85           C  
ATOM   9917  C   LEU B 392      40.512  89.697  85.878  1.00  0.85           C  
ATOM   9918  O   LEU B 392      39.984  89.546  84.776  1.00  0.85           O  
ATOM   9919  CB  LEU B 392      42.903  89.045  86.354  1.00  0.85           C  
ATOM   9920  CG  LEU B 392      43.022  87.951  85.272  1.00  0.85           C  
ATOM   9921  CD1 LEU B 392      43.551  88.501  83.946  1.00  0.85           C  
ATOM   9922  CD2 LEU B 392      43.939  86.820  85.750  1.00  0.85           C  
ATOM   9923  N   VAL B 393      39.824  89.462  87.015  1.00  0.89           N  
ATOM   9924  CA  VAL B 393      38.419  89.078  87.045  1.00  0.89           C  
ATOM   9925  C   VAL B 393      37.515  90.172  86.494  1.00  0.89           C  
ATOM   9926  O   VAL B 393      36.601  89.891  85.729  1.00  0.89           O  
ATOM   9927  CB  VAL B 393      37.967  88.655  88.440  1.00  0.89           C  
ATOM   9928  CG1 VAL B 393      36.493  88.195  88.431  1.00  0.89           C  
ATOM   9929  CG2 VAL B 393      38.854  87.490  88.920  1.00  0.89           C  
ATOM   9930  N   GLU B 394      37.779  91.450  86.822  1.00  0.86           N  
ATOM   9931  CA  GLU B 394      37.072  92.617  86.325  1.00  0.86           C  
ATOM   9932  C   GLU B 394      37.140  92.746  84.819  1.00  0.86           C  
ATOM   9933  O   GLU B 394      36.141  92.974  84.141  1.00  0.86           O  
ATOM   9934  CB  GLU B 394      37.680  93.900  86.946  1.00  0.86           C  
ATOM   9935  CG  GLU B 394      36.818  95.172  86.758  1.00  0.86           C  
ATOM   9936  CD  GLU B 394      37.289  96.356  87.605  1.00  0.86           C  
ATOM   9937  OE1 GLU B 394      38.129  96.159  88.520  1.00  0.86           O  
ATOM   9938  OE2 GLU B 394      36.769  97.472  87.351  1.00  0.86           O  
ATOM   9939  N   LYS B 395      38.340  92.554  84.238  1.00  0.85           N  
ATOM   9940  CA  LYS B 395      38.497  92.569  82.801  1.00  0.85           C  
ATOM   9941  C   LYS B 395      37.847  91.395  82.081  1.00  0.85           C  
ATOM   9942  O   LYS B 395      37.177  91.571  81.065  1.00  0.85           O  
ATOM   9943  CB  LYS B 395      40.001  92.626  82.425  1.00  0.85           C  
ATOM   9944  CG  LYS B 395      40.273  92.998  80.956  1.00  0.85           C  
ATOM   9945  CD  LYS B 395      39.796  94.425  80.636  1.00  0.85           C  
ATOM   9946  CE  LYS B 395      40.074  94.866  79.201  1.00  0.85           C  
ATOM   9947  NZ  LYS B 395      39.617  96.264  79.034  1.00  0.85           N  
ATOM   9948  N   LEU B 396      38.049  90.163  82.585  1.00  0.91           N  
ATOM   9949  CA  LEU B 396      37.575  88.958  81.934  1.00  0.91           C  
ATOM   9950  C   LEU B 396      36.117  88.623  82.190  1.00  0.91           C  
ATOM   9951  O   LEU B 396      35.400  88.230  81.273  1.00  0.91           O  
ATOM   9952  CB  LEU B 396      38.464  87.761  82.338  1.00  0.91           C  
ATOM   9953  CG  LEU B 396      38.176  86.452  81.574  1.00  0.91           C  
ATOM   9954  CD1 LEU B 396      38.536  86.566  80.089  1.00  0.91           C  
ATOM   9955  CD2 LEU B 396      38.924  85.287  82.224  1.00  0.91           C  
ATOM   9956  N   LEU B 397      35.629  88.768  83.433  1.00  0.91           N  
ATOM   9957  CA  LEU B 397      34.278  88.405  83.819  1.00  0.91           C  
ATOM   9958  C   LEU B 397      33.631  89.542  84.629  1.00  0.91           C  
ATOM   9959  O   LEU B 397      33.345  89.340  85.814  1.00  0.91           O  
ATOM   9960  CB  LEU B 397      34.231  87.137  84.731  1.00  0.91           C  
ATOM   9961  CG  LEU B 397      34.571  85.733  84.175  1.00  0.91           C  
ATOM   9962  CD1 LEU B 397      34.201  85.540  82.703  1.00  0.91           C  
ATOM   9963  CD2 LEU B 397      36.024  85.341  84.463  1.00  0.91           C  
ATOM   9964  N   PRO B 398      33.355  90.734  84.094  1.00  0.91           N  
ATOM   9965  CA  PRO B 398      32.966  91.922  84.868  1.00  0.91           C  
ATOM   9966  C   PRO B 398      31.736  91.742  85.748  1.00  0.91           C  
ATOM   9967  O   PRO B 398      31.737  92.168  86.901  1.00  0.91           O  
ATOM   9968  CB  PRO B 398      32.763  93.006  83.788  1.00  0.91           C  
ATOM   9969  CG  PRO B 398      32.481  92.227  82.501  1.00  0.91           C  
ATOM   9970  CD  PRO B 398      33.394  91.014  82.657  1.00  0.91           C  
ATOM   9971  N   ARG B 399      30.685  91.074  85.237  1.00  0.85           N  
ATOM   9972  CA  ARG B 399      29.462  90.747  85.956  1.00  0.85           C  
ATOM   9973  C   ARG B 399      29.710  89.854  87.167  1.00  0.85           C  
ATOM   9974  O   ARG B 399      29.122  90.011  88.234  1.00  0.85           O  
ATOM   9975  CB  ARG B 399      28.516  90.033  84.957  1.00  0.85           C  
ATOM   9976  CG  ARG B 399      27.111  89.625  85.461  1.00  0.85           C  
ATOM   9977  CD  ARG B 399      26.093  90.764  85.613  1.00  0.85           C  
ATOM   9978  NE  ARG B 399      26.227  91.344  86.982  1.00  0.85           N  
ATOM   9979  CZ  ARG B 399      25.383  91.149  88.003  1.00  0.85           C  
ATOM   9980  NH1 ARG B 399      24.444  90.215  88.028  1.00  0.85           N  
ATOM   9981  NH2 ARG B 399      25.506  91.989  89.031  1.00  0.85           N  
ATOM   9982  N   HIS B 400      30.638  88.888  87.034  1.00  0.91           N  
ATOM   9983  CA  HIS B 400      31.044  88.015  88.121  1.00  0.91           C  
ATOM   9984  C   HIS B 400      31.734  88.725  89.268  1.00  0.91           C  
ATOM   9985  O   HIS B 400      31.491  88.397  90.425  1.00  0.91           O  
ATOM   9986  CB  HIS B 400      31.942  86.868  87.636  1.00  0.91           C  
ATOM   9987  CG  HIS B 400      31.200  85.954  86.716  1.00  0.91           C  
ATOM   9988  ND1 HIS B 400      30.639  84.822  87.259  1.00  0.91           N  
ATOM   9989  CD2 HIS B 400      30.917  86.033  85.386  1.00  0.91           C  
ATOM   9990  CE1 HIS B 400      30.030  84.226  86.256  1.00  0.91           C  
ATOM   9991  NE2 HIS B 400      30.169  84.916  85.100  1.00  0.91           N  
ATOM   9992  N   LEU B 401      32.593  89.736  89.007  1.00  0.90           N  
ATOM   9993  CA  LEU B 401      33.213  90.515  90.071  1.00  0.90           C  
ATOM   9994  C   LEU B 401      32.204  91.278  90.922  1.00  0.90           C  
ATOM   9995  O   LEU B 401      32.298  91.291  92.150  1.00  0.90           O  
ATOM   9996  CB  LEU B 401      34.298  91.476  89.532  1.00  0.90           C  
ATOM   9997  CG  LEU B 401      35.131  92.157  90.644  1.00  0.90           C  
ATOM   9998  CD1 LEU B 401      35.837  91.145  91.560  1.00  0.90           C  
ATOM   9999  CD2 LEU B 401      36.173  93.105  90.054  1.00  0.90           C  
ATOM  10000  N   GLU B 402      31.154  91.860  90.294  1.00  0.87           N  
ATOM  10001  CA  GLU B 402      30.036  92.458  91.014  1.00  0.87           C  
ATOM  10002  C   GLU B 402      29.337  91.454  91.929  1.00  0.87           C  
ATOM  10003  O   GLU B 402      29.062  91.729  93.095  1.00  0.87           O  
ATOM  10004  CB  GLU B 402      28.924  92.986  90.065  1.00  0.87           C  
ATOM  10005  CG  GLU B 402      29.325  94.088  89.054  1.00  0.87           C  
ATOM  10006  CD  GLU B 402      28.116  94.511  88.226  1.00  0.87           C  
ATOM  10007  OE1 GLU B 402      27.883  95.727  88.022  1.00  0.87           O  
ATOM  10008  OE2 GLU B 402      27.368  93.586  87.802  1.00  0.87           O  
ATOM  10009  N   ILE B 403      29.069  90.231  91.423  1.00  0.91           N  
ATOM  10010  CA  ILE B 403      28.482  89.151  92.205  1.00  0.91           C  
ATOM  10011  C   ILE B 403      29.376  88.690  93.352  1.00  0.91           C  
ATOM  10012  O   ILE B 403      28.901  88.523  94.472  1.00  0.91           O  
ATOM  10013  CB  ILE B 403      28.037  87.984  91.323  1.00  0.91           C  
ATOM  10014  CG1 ILE B 403      26.922  88.468  90.364  1.00  0.91           C  
ATOM  10015  CG2 ILE B 403      27.543  86.795  92.182  1.00  0.91           C  
ATOM  10016  CD1 ILE B 403      26.420  87.395  89.393  1.00  0.91           C  
ATOM  10017  N   ILE B 404      30.701  88.528  93.142  1.00  0.91           N  
ATOM  10018  CA  ILE B 404      31.653  88.206  94.207  1.00  0.91           C  
ATOM  10019  C   ILE B 404      31.692  89.284  95.285  1.00  0.91           C  
ATOM  10020  O   ILE B 404      31.679  88.984  96.479  1.00  0.91           O  
ATOM  10021  CB  ILE B 404      33.065  87.943  93.667  1.00  0.91           C  
ATOM  10022  CG1 ILE B 404      33.070  86.687  92.762  1.00  0.91           C  
ATOM  10023  CG2 ILE B 404      34.079  87.751  94.823  1.00  0.91           C  
ATOM  10024  CD1 ILE B 404      34.364  86.498  91.957  1.00  0.91           C  
ATOM  10025  N   TYR B 405      31.691  90.578  94.906  1.00  0.89           N  
ATOM  10026  CA  TYR B 405      31.571  91.671  95.855  1.00  0.89           C  
ATOM  10027  C   TYR B 405      30.258  91.696  96.628  1.00  0.89           C  
ATOM  10028  O   TYR B 405      30.275  91.878  97.842  1.00  0.89           O  
ATOM  10029  CB  TYR B 405      31.769  93.048  95.163  1.00  0.89           C  
ATOM  10030  CG  TYR B 405      33.194  93.343  94.747  1.00  0.89           C  
ATOM  10031  CD1 TYR B 405      34.318  92.823  95.420  1.00  0.89           C  
ATOM  10032  CD2 TYR B 405      33.410  94.256  93.699  1.00  0.89           C  
ATOM  10033  CE1 TYR B 405      35.613  93.213  95.057  1.00  0.89           C  
ATOM  10034  CE2 TYR B 405      34.708  94.647  93.335  1.00  0.89           C  
ATOM  10035  CZ  TYR B 405      35.812  94.125  94.018  1.00  0.89           C  
ATOM  10036  OH  TYR B 405      37.119  94.517  93.658  1.00  0.89           O  
ATOM  10037  N   GLU B 406      29.100  91.480  95.976  1.00  0.86           N  
ATOM  10038  CA  GLU B 406      27.805  91.392  96.642  1.00  0.86           C  
ATOM  10039  C   GLU B 406      27.669  90.188  97.577  1.00  0.86           C  
ATOM  10040  O   GLU B 406      27.157  90.288  98.693  1.00  0.86           O  
ATOM  10041  CB  GLU B 406      26.655  91.460  95.604  1.00  0.86           C  
ATOM  10042  CG  GLU B 406      25.242  91.642  96.211  1.00  0.86           C  
ATOM  10043  CD  GLU B 406      25.146  92.884  97.090  1.00  0.86           C  
ATOM  10044  OE1 GLU B 406      25.785  93.908  96.766  1.00  0.86           O  
ATOM  10045  OE2 GLU B 406      24.383  92.798  98.090  1.00  0.86           O  
ATOM  10046  N   ILE B 407      28.204  89.008  97.176  1.00  0.91           N  
ATOM  10047  CA  ILE B 407      28.342  87.833  98.040  1.00  0.91           C  
ATOM  10048  C   ILE B 407      29.203  88.156  99.256  1.00  0.91           C  
ATOM  10049  O   ILE B 407      28.837  87.863 100.395  1.00  0.91           O  
ATOM  10050  CB  ILE B 407      28.936  86.636  97.274  1.00  0.91           C  
ATOM  10051  CG1 ILE B 407      27.906  86.065  96.267  1.00  0.91           C  
ATOM  10052  CG2 ILE B 407      29.406  85.519  98.236  1.00  0.91           C  
ATOM  10053  CD1 ILE B 407      28.481  85.006  95.316  1.00  0.91           C  
ATOM  10054  N   ASN B 408      30.354  88.832  99.044  1.00  0.89           N  
ATOM  10055  CA  ASN B 408      31.226  89.283 100.112  1.00  0.89           C  
ATOM  10056  C   ASN B 408      30.563  90.293 101.040  1.00  0.89           C  
ATOM  10057  O   ASN B 408      30.695  90.192 102.254  1.00  0.89           O  
ATOM  10058  CB  ASN B 408      32.544  89.866  99.531  1.00  0.89           C  
ATOM  10059  CG  ASN B 408      33.596  90.024 100.624  1.00  0.89           C  
ATOM  10060  OD1 ASN B 408      33.895  89.081 101.348  1.00  0.89           O  
ATOM  10061  ND2 ASN B 408      34.188  91.227 100.754  1.00  0.89           N  
ATOM  10062  N   GLN B 409      29.808  91.277 100.509  1.00  0.83           N  
ATOM  10063  CA  GLN B 409      29.140  92.281 101.321  1.00  0.83           C  
ATOM  10064  C   GLN B 409      28.155  91.662 102.300  1.00  0.83           C  
ATOM  10065  O   GLN B 409      28.247  91.848 103.507  1.00  0.83           O  
ATOM  10066  CB  GLN B 409      28.401  93.288 100.400  1.00  0.83           C  
ATOM  10067  CG  GLN B 409      28.153  94.683 101.037  1.00  0.83           C  
ATOM  10068  CD  GLN B 409      29.393  95.582 101.159  1.00  0.83           C  
ATOM  10069  OE1 GLN B 409      29.399  96.630 101.801  1.00  0.83           O  
ATOM  10070  NE2 GLN B 409      30.502  95.206 100.479  1.00  0.83           N  
ATOM  10071  N   LYS B 410      27.278  90.769 101.798  1.00  0.83           N  
ATOM  10072  CA  LYS B 410      26.339  90.038 102.625  1.00  0.83           C  
ATOM  10073  C   LYS B 410      26.989  89.096 103.631  1.00  0.83           C  
ATOM  10074  O   LYS B 410      26.491  88.907 104.742  1.00  0.83           O  
ATOM  10075  CB  LYS B 410      25.298  89.304 101.752  1.00  0.83           C  
ATOM  10076  CG  LYS B 410      24.449  90.301 100.948  1.00  0.83           C  
ATOM  10077  CD  LYS B 410      23.025  89.787 100.714  1.00  0.83           C  
ATOM  10078  CE  LYS B 410      22.092  90.806 100.055  1.00  0.83           C  
ATOM  10079  NZ  LYS B 410      22.536  91.114  98.685  1.00  0.83           N  
ATOM  10080  N   HIS B 411      28.138  88.485 103.281  1.00  0.85           N  
ATOM  10081  CA  HIS B 411      28.951  87.758 104.242  1.00  0.85           C  
ATOM  10082  C   HIS B 411      29.521  88.624 105.367  1.00  0.85           C  
ATOM  10083  O   HIS B 411      29.343  88.316 106.544  1.00  0.85           O  
ATOM  10084  CB  HIS B 411      30.120  87.075 103.499  1.00  0.85           C  
ATOM  10085  CG  HIS B 411      31.019  86.240 104.360  1.00  0.85           C  
ATOM  10086  ND1 HIS B 411      32.380  86.428 104.267  1.00  0.85           N  
ATOM  10087  CD2 HIS B 411      30.742  85.242 105.237  1.00  0.85           C  
ATOM  10088  CE1 HIS B 411      32.913  85.548 105.086  1.00  0.85           C  
ATOM  10089  NE2 HIS B 411      31.963  84.801 105.702  1.00  0.85           N  
ATOM  10090  N   LEU B 412      30.173  89.758 105.039  1.00  0.82           N  
ATOM  10091  CA  LEU B 412      30.759  90.666 106.012  1.00  0.82           C  
ATOM  10092  C   LEU B 412      29.756  91.387 106.901  1.00  0.82           C  
ATOM  10093  O   LEU B 412      29.967  91.509 108.111  1.00  0.82           O  
ATOM  10094  CB  LEU B 412      31.694  91.702 105.343  1.00  0.82           C  
ATOM  10095  CG  LEU B 412      32.939  91.118 104.638  1.00  0.82           C  
ATOM  10096  CD1 LEU B 412      33.896  92.250 104.238  1.00  0.82           C  
ATOM  10097  CD2 LEU B 412      33.693  90.088 105.490  1.00  0.82           C  
ATOM  10098  N   ASP B 413      28.611  91.829 106.346  1.00  0.80           N  
ATOM  10099  CA  ASP B 413      27.518  92.448 107.079  1.00  0.80           C  
ATOM  10100  C   ASP B 413      26.969  91.538 108.177  1.00  0.80           C  
ATOM  10101  O   ASP B 413      26.654  91.962 109.289  1.00  0.80           O  
ATOM  10102  CB  ASP B 413      26.370  92.826 106.110  1.00  0.80           C  
ATOM  10103  CG  ASP B 413      26.749  93.982 105.195  1.00  0.80           C  
ATOM  10104  OD1 ASP B 413      27.773  94.658 105.462  1.00  0.80           O  
ATOM  10105  OD2 ASP B 413      25.970  94.205 104.233  1.00  0.80           O  
ATOM  10106  N   ARG B 414      26.875  90.217 107.925  1.00  0.70           N  
ATOM  10107  CA  ARG B 414      26.499  89.287 108.971  1.00  0.70           C  
ATOM  10108  C   ARG B 414      27.601  88.965 109.964  1.00  0.70           C  
ATOM  10109  O   ARG B 414      27.307  88.593 111.098  1.00  0.70           O  
ATOM  10110  CB  ARG B 414      25.880  87.993 108.389  1.00  0.70           C  
ATOM  10111  CG  ARG B 414      24.359  88.117 108.156  1.00  0.70           C  
ATOM  10112  CD  ARG B 414      23.569  88.337 109.456  1.00  0.70           C  
ATOM  10113  NE  ARG B 414      22.109  88.325 109.127  1.00  0.70           N  
ATOM  10114  CZ  ARG B 414      21.335  87.232 109.157  1.00  0.70           C  
ATOM  10115  NH1 ARG B 414      21.838  86.025 109.391  1.00  0.70           N  
ATOM  10116  NH2 ARG B 414      20.028  87.354 108.938  1.00  0.70           N  
ATOM  10117  N   ILE B 415      28.888  89.148 109.618  1.00  0.76           N  
ATOM  10118  CA  ILE B 415      29.964  89.083 110.600  1.00  0.76           C  
ATOM  10119  C   ILE B 415      29.904  90.255 111.575  1.00  0.76           C  
ATOM  10120  O   ILE B 415      30.012  90.057 112.780  1.00  0.76           O  
ATOM  10121  CB  ILE B 415      31.341  88.917 109.972  1.00  0.76           C  
ATOM  10122  CG1 ILE B 415      31.382  87.614 109.145  1.00  0.76           C  
ATOM  10123  CG2 ILE B 415      32.444  88.880 111.059  1.00  0.76           C  
ATOM  10124  CD1 ILE B 415      32.611  87.527 108.241  1.00  0.76           C  
ATOM  10125  N   VAL B 416      29.632  91.505 111.131  1.00  0.74           N  
ATOM  10126  CA  VAL B 416      29.460  92.629 112.063  1.00  0.74           C  
ATOM  10127  C   VAL B 416      28.163  92.558 112.852  1.00  0.74           C  
ATOM  10128  O   VAL B 416      28.011  93.197 113.886  1.00  0.74           O  
ATOM  10129  CB  VAL B 416      29.577  94.031 111.466  1.00  0.74           C  
ATOM  10130  CG1 VAL B 416      30.935  94.172 110.777  1.00  0.74           C  
ATOM  10131  CG2 VAL B 416      28.446  94.365 110.480  1.00  0.74           C  
ATOM  10132  N   ALA B 417      27.206  91.713 112.434  1.00  0.74           N  
ATOM  10133  CA  ALA B 417      25.968  91.511 113.158  1.00  0.74           C  
ATOM  10134  C   ALA B 417      26.094  90.422 114.221  1.00  0.74           C  
ATOM  10135  O   ALA B 417      25.134  90.082 114.907  1.00  0.74           O  
ATOM  10136  CB  ALA B 417      24.874  91.131 112.146  1.00  0.74           C  
ATOM  10137  N   LEU B 418      27.315  89.890 114.407  1.00  0.72           N  
ATOM  10138  CA  LEU B 418      27.642  88.962 115.474  1.00  0.72           C  
ATOM  10139  C   LEU B 418      28.903  89.409 116.192  1.00  0.72           C  
ATOM  10140  O   LEU B 418      29.074  89.194 117.390  1.00  0.72           O  
ATOM  10141  CB  LEU B 418      27.878  87.552 114.880  1.00  0.72           C  
ATOM  10142  CG  LEU B 418      26.583  86.833 114.455  1.00  0.72           C  
ATOM  10143  CD1 LEU B 418      26.913  85.577 113.644  1.00  0.72           C  
ATOM  10144  CD2 LEU B 418      25.721  86.466 115.671  1.00  0.72           C  
ATOM  10145  N   PHE B 419      29.801  90.115 115.486  1.00  0.76           N  
ATOM  10146  CA  PHE B 419      31.067  90.581 116.003  1.00  0.76           C  
ATOM  10147  C   PHE B 419      31.244  92.084 115.752  1.00  0.76           C  
ATOM  10148  O   PHE B 419      32.221  92.463 115.105  1.00  0.76           O  
ATOM  10149  CB  PHE B 419      32.238  89.835 115.299  1.00  0.76           C  
ATOM  10150  CG  PHE B 419      32.178  88.345 115.494  1.00  0.76           C  
ATOM  10151  CD1 PHE B 419      31.481  87.529 114.587  1.00  0.76           C  
ATOM  10152  CD2 PHE B 419      32.857  87.741 116.564  1.00  0.76           C  
ATOM  10153  CE1 PHE B 419      31.434  86.141 114.760  1.00  0.76           C  
ATOM  10154  CE2 PHE B 419      32.817  86.352 116.741  1.00  0.76           C  
ATOM  10155  CZ  PHE B 419      32.099  85.553 115.842  1.00  0.76           C  
ATOM  10156  N   PRO B 420      30.396  93.011 116.225  1.00  0.75           N  
ATOM  10157  CA  PRO B 420      30.365  94.402 115.753  1.00  0.75           C  
ATOM  10158  C   PRO B 420      31.569  95.241 116.133  1.00  0.75           C  
ATOM  10159  O   PRO B 420      31.639  96.395 115.726  1.00  0.75           O  
ATOM  10160  CB  PRO B 420      29.079  94.976 116.387  1.00  0.75           C  
ATOM  10161  CG  PRO B 420      28.794  94.081 117.595  1.00  0.75           C  
ATOM  10162  CD  PRO B 420      29.255  92.717 117.098  1.00  0.75           C  
ATOM  10163  N   LYS B 421      32.509  94.722 116.939  1.00  0.74           N  
ATOM  10164  CA  LYS B 421      33.741  95.428 117.244  1.00  0.74           C  
ATOM  10165  C   LYS B 421      34.964  94.662 116.737  1.00  0.74           C  
ATOM  10166  O   LYS B 421      36.091  95.118 116.917  1.00  0.74           O  
ATOM  10167  CB  LYS B 421      33.889  95.661 118.778  1.00  0.74           C  
ATOM  10168  CG  LYS B 421      33.124  96.873 119.360  1.00  0.74           C  
ATOM  10169  CD  LYS B 421      31.590  96.755 119.476  1.00  0.74           C  
ATOM  10170  CE  LYS B 421      31.067  95.571 120.297  1.00  0.74           C  
ATOM  10171  NZ  LYS B 421      31.605  95.598 121.675  1.00  0.74           N  
ATOM  10172  N   ASP B 422      34.801  93.498 116.067  1.00  0.79           N  
ATOM  10173  CA  ASP B 422      35.938  92.712 115.603  1.00  0.79           C  
ATOM  10174  C   ASP B 422      36.280  93.095 114.167  1.00  0.79           C  
ATOM  10175  O   ASP B 422      35.880  92.481 113.175  1.00  0.79           O  
ATOM  10176  CB  ASP B 422      35.681  91.197 115.775  1.00  0.79           C  
ATOM  10177  CG  ASP B 422      36.933  90.340 115.643  1.00  0.79           C  
ATOM  10178  OD1 ASP B 422      36.839  89.137 116.008  1.00  0.79           O  
ATOM  10179  OD2 ASP B 422      37.966  90.825 115.108  1.00  0.79           O  
ATOM  10180  N   VAL B 423      37.055  94.183 114.056  1.00  0.80           N  
ATOM  10181  CA  VAL B 423      37.528  94.750 112.809  1.00  0.80           C  
ATOM  10182  C   VAL B 423      38.496  93.824 112.073  1.00  0.80           C  
ATOM  10183  O   VAL B 423      38.458  93.713 110.846  1.00  0.80           O  
ATOM  10184  CB  VAL B 423      38.127  96.134 113.046  1.00  0.80           C  
ATOM  10185  CG1 VAL B 423      38.524  96.804 111.715  1.00  0.80           C  
ATOM  10186  CG2 VAL B 423      37.080  97.013 113.764  1.00  0.80           C  
ATOM  10187  N   ASP B 424      39.388  93.105 112.799  1.00  0.83           N  
ATOM  10188  CA  ASP B 424      40.293  92.140 112.182  1.00  0.83           C  
ATOM  10189  C   ASP B 424      39.564  90.933 111.585  1.00  0.83           C  
ATOM  10190  O   ASP B 424      39.873  90.509 110.473  1.00  0.83           O  
ATOM  10191  CB  ASP B 424      41.457  91.702 113.119  1.00  0.83           C  
ATOM  10192  CG  ASP B 424      42.578  91.022 112.340  1.00  0.83           C  
ATOM  10193  OD1 ASP B 424      43.374  91.753 111.698  1.00  0.83           O  
ATOM  10194  OD2 ASP B 424      42.668  89.767 112.336  1.00  0.83           O  
ATOM  10195  N   ARG B 425      38.535  90.374 112.266  1.00  0.79           N  
ATOM  10196  CA  ARG B 425      37.764  89.245 111.754  1.00  0.79           C  
ATOM  10197  C   ARG B 425      37.113  89.501 110.407  1.00  0.79           C  
ATOM  10198  O   ARG B 425      37.096  88.625 109.547  1.00  0.79           O  
ATOM  10199  CB  ARG B 425      36.712  88.789 112.785  1.00  0.79           C  
ATOM  10200  CG  ARG B 425      36.065  87.408 112.560  1.00  0.79           C  
ATOM  10201  CD  ARG B 425      35.120  87.023 113.710  1.00  0.79           C  
ATOM  10202  NE  ARG B 425      34.720  85.581 113.550  1.00  0.79           N  
ATOM  10203  CZ  ARG B 425      35.134  84.575 114.327  1.00  0.79           C  
ATOM  10204  NH1 ARG B 425      36.073  84.698 115.256  1.00  0.79           N  
ATOM  10205  NH2 ARG B 425      34.641  83.354 114.151  1.00  0.79           N  
ATOM  10206  N   LEU B 426      36.627  90.734 110.141  1.00  0.82           N  
ATOM  10207  CA  LEU B 426      36.163  91.090 108.807  1.00  0.82           C  
ATOM  10208  C   LEU B 426      37.212  90.957 107.716  1.00  0.82           C  
ATOM  10209  O   LEU B 426      36.965  90.348 106.681  1.00  0.82           O  
ATOM  10210  CB  LEU B 426      35.685  92.562 108.720  1.00  0.82           C  
ATOM  10211  CG  LEU B 426      34.320  92.895 109.343  1.00  0.82           C  
ATOM  10212  CD1 LEU B 426      33.911  94.282 108.823  1.00  0.82           C  
ATOM  10213  CD2 LEU B 426      33.258  91.850 108.988  1.00  0.82           C  
ATOM  10214  N   ARG B 427      38.436  91.476 107.915  1.00  0.78           N  
ATOM  10215  CA  ARG B 427      39.443  91.431 106.866  1.00  0.78           C  
ATOM  10216  C   ARG B 427      40.096  90.058 106.761  1.00  0.78           C  
ATOM  10217  O   ARG B 427      40.809  89.756 105.810  1.00  0.78           O  
ATOM  10218  CB  ARG B 427      40.534  92.512 107.068  1.00  0.78           C  
ATOM  10219  CG  ARG B 427      41.405  92.287 108.315  1.00  0.78           C  
ATOM  10220  CD  ARG B 427      42.786  92.937 108.235  1.00  0.78           C  
ATOM  10221  NE  ARG B 427      43.669  92.141 109.133  1.00  0.78           N  
ATOM  10222  CZ  ARG B 427      44.277  90.998 108.795  1.00  0.78           C  
ATOM  10223  NH1 ARG B 427      44.287  90.542 107.548  1.00  0.78           N  
ATOM  10224  NH2 ARG B 427      44.844  90.299 109.773  1.00  0.78           N  
ATOM  10225  N   ARG B 428      39.886  89.199 107.773  1.00  0.81           N  
ATOM  10226  CA  ARG B 428      40.430  87.864 107.820  1.00  0.81           C  
ATOM  10227  C   ARG B 428      39.488  86.847 107.184  1.00  0.81           C  
ATOM  10228  O   ARG B 428      39.924  85.835 106.640  1.00  0.81           O  
ATOM  10229  CB  ARG B 428      40.687  87.570 109.314  1.00  0.81           C  
ATOM  10230  CG  ARG B 428      41.651  86.419 109.634  1.00  0.81           C  
ATOM  10231  CD  ARG B 428      42.142  86.472 111.090  1.00  0.81           C  
ATOM  10232  NE  ARG B 428      40.964  86.171 111.947  1.00  0.81           N  
ATOM  10233  CZ  ARG B 428      40.476  86.899 112.958  1.00  0.81           C  
ATOM  10234  NH1 ARG B 428      40.990  88.042 113.390  1.00  0.81           N  
ATOM  10235  NH2 ARG B 428      39.380  86.418 113.543  1.00  0.81           N  
ATOM  10236  N   MET B 429      38.168  87.138 107.182  1.00  0.87           N  
ATOM  10237  CA  MET B 429      37.163  86.291 106.561  1.00  0.87           C  
ATOM  10238  C   MET B 429      36.642  86.827 105.232  1.00  0.87           C  
ATOM  10239  O   MET B 429      35.867  86.156 104.555  1.00  0.87           O  
ATOM  10240  CB  MET B 429      35.944  86.151 107.508  1.00  0.87           C  
ATOM  10241  CG  MET B 429      36.247  85.391 108.814  1.00  0.87           C  
ATOM  10242  SD  MET B 429      34.799  85.165 109.899  1.00  0.87           S  
ATOM  10243  CE  MET B 429      33.937  83.957 108.861  1.00  0.87           C  
ATOM  10244  N   SER B 430      37.047  88.043 104.818  1.00  0.90           N  
ATOM  10245  CA  SER B 430      36.676  88.640 103.535  1.00  0.90           C  
ATOM  10246  C   SER B 430      37.137  87.841 102.335  1.00  0.90           C  
ATOM  10247  O   SER B 430      38.268  87.368 102.275  1.00  0.90           O  
ATOM  10248  CB  SER B 430      37.251  90.080 103.384  1.00  0.90           C  
ATOM  10249  OG  SER B 430      36.809  90.760 102.202  1.00  0.90           O  
ATOM  10250  N   LEU B 431      36.281  87.729 101.296  1.00  0.92           N  
ATOM  10251  CA  LEU B 431      36.636  87.084 100.048  1.00  0.92           C  
ATOM  10252  C   LEU B 431      37.731  87.838  99.315  1.00  0.92           C  
ATOM  10253  O   LEU B 431      38.481  87.258  98.538  1.00  0.92           O  
ATOM  10254  CB  LEU B 431      35.458  86.965  99.039  1.00  0.92           C  
ATOM  10255  CG  LEU B 431      34.151  86.317  99.538  1.00  0.92           C  
ATOM  10256  CD1 LEU B 431      33.265  85.979  98.331  1.00  0.92           C  
ATOM  10257  CD2 LEU B 431      34.384  85.064 100.381  1.00  0.92           C  
ATOM  10258  N   ILE B 432      37.828  89.160  99.535  1.00  0.90           N  
ATOM  10259  CA  ILE B 432      38.833  90.018  98.935  1.00  0.90           C  
ATOM  10260  C   ILE B 432      39.922  90.370  99.942  1.00  0.90           C  
ATOM  10261  O   ILE B 432      39.672  90.713 101.096  1.00  0.90           O  
ATOM  10262  CB  ILE B 432      38.245  91.278  98.282  1.00  0.90           C  
ATOM  10263  CG1 ILE B 432      39.344  92.260  97.801  1.00  0.90           C  
ATOM  10264  CG2 ILE B 432      37.270  91.965  99.257  1.00  0.90           C  
ATOM  10265  CD1 ILE B 432      38.832  93.478  97.034  1.00  0.90           C  
ATOM  10266  N   GLU B 433      41.189  90.287  99.490  1.00  0.83           N  
ATOM  10267  CA  GLU B 433      42.345  90.769 100.207  1.00  0.83           C  
ATOM  10268  C   GLU B 433      42.765  92.123  99.643  1.00  0.83           C  
ATOM  10269  O   GLU B 433      43.408  92.205  98.589  1.00  0.83           O  
ATOM  10270  CB  GLU B 433      43.557  89.817 100.030  1.00  0.83           C  
ATOM  10271  CG  GLU B 433      43.326  88.344 100.428  1.00  0.83           C  
ATOM  10272  CD  GLU B 433      44.539  87.470 100.155  1.00  0.83           C  
ATOM  10273  OE1 GLU B 433      45.653  87.970  99.843  1.00  0.83           O  
ATOM  10274  OE2 GLU B 433      44.373  86.233 100.227  1.00  0.83           O  
ATOM  10275  N   GLU B 434      42.432  93.233 100.328  1.00  0.75           N  
ATOM  10276  CA  GLU B 434      42.879  94.559  99.946  1.00  0.75           C  
ATOM  10277  C   GLU B 434      44.318  94.869 100.350  1.00  0.75           C  
ATOM  10278  O   GLU B 434      44.601  95.220 101.489  1.00  0.75           O  
ATOM  10279  CB  GLU B 434      41.954  95.659 100.525  1.00  0.75           C  
ATOM  10280  CG  GLU B 434      40.635  95.852  99.742  1.00  0.75           C  
ATOM  10281  CD  GLU B 434      39.433  95.046 100.217  1.00  0.75           C  
ATOM  10282  OE1 GLU B 434      39.571  94.174 101.105  1.00  0.75           O  
ATOM  10283  OE2 GLU B 434      38.354  95.324  99.622  1.00  0.75           O  
ATOM  10284  N   GLU B 435      45.251  94.786  99.378  1.00  0.70           N  
ATOM  10285  CA  GLU B 435      46.665  95.078  99.576  1.00  0.70           C  
ATOM  10286  C   GLU B 435      47.186  95.897  98.411  1.00  0.70           C  
ATOM  10287  O   GLU B 435      46.415  96.456  97.630  1.00  0.70           O  
ATOM  10288  CB  GLU B 435      47.479  93.760  99.655  1.00  0.70           C  
ATOM  10289  CG  GLU B 435      47.215  92.958 100.950  1.00  0.70           C  
ATOM  10290  CD  GLU B 435      47.787  93.621 102.204  1.00  0.70           C  
ATOM  10291  OE1 GLU B 435      48.623  94.551 102.062  1.00  0.70           O  
ATOM  10292  OE2 GLU B 435      47.417  93.153 103.311  1.00  0.70           O  
ATOM  10293  N   GLY B 436      48.529  95.957  98.215  1.00  0.67           N  
ATOM  10294  CA  GLY B 436      49.188  96.561  97.049  1.00  0.67           C  
ATOM  10295  C   GLY B 436      49.020  95.768  95.767  1.00  0.67           C  
ATOM  10296  O   GLY B 436      49.974  95.500  95.044  1.00  0.67           O  
ATOM  10297  N   SER B 437      47.768  95.373  95.514  1.00  0.79           N  
ATOM  10298  CA  SER B 437      47.202  94.519  94.492  1.00  0.79           C  
ATOM  10299  C   SER B 437      46.070  93.801  95.186  1.00  0.79           C  
ATOM  10300  O   SER B 437      46.219  93.218  96.262  1.00  0.79           O  
ATOM  10301  CB  SER B 437      48.115  93.496  93.746  1.00  0.79           C  
ATOM  10302  OG  SER B 437      48.673  92.482  94.589  1.00  0.79           O  
ATOM  10303  N   LYS B 438      44.858  93.871  94.622  1.00  0.83           N  
ATOM  10304  CA  LYS B 438      43.689  93.316  95.270  1.00  0.83           C  
ATOM  10305  C   LYS B 438      43.485  91.899  94.777  1.00  0.83           C  
ATOM  10306  O   LYS B 438      43.497  91.635  93.580  1.00  0.83           O  
ATOM  10307  CB  LYS B 438      42.422  94.137  94.945  1.00  0.83           C  
ATOM  10308  CG  LYS B 438      42.220  95.445  95.726  1.00  0.83           C  
ATOM  10309  CD  LYS B 438      40.889  96.106  95.311  1.00  0.83           C  
ATOM  10310  CE  LYS B 438      40.397  97.194  96.272  1.00  0.83           C  
ATOM  10311  NZ  LYS B 438      38.916  97.255  96.270  1.00  0.83           N  
ATOM  10312  N   ARG B 439      43.297  90.932  95.687  1.00  0.82           N  
ATOM  10313  CA  ARG B 439      43.150  89.542  95.295  1.00  0.82           C  
ATOM  10314  C   ARG B 439      41.878  88.970  95.881  1.00  0.82           C  
ATOM  10315  O   ARG B 439      41.378  89.449  96.890  1.00  0.82           O  
ATOM  10316  CB  ARG B 439      44.317  88.654  95.788  1.00  0.82           C  
ATOM  10317  CG  ARG B 439      45.650  88.750  95.001  1.00  0.82           C  
ATOM  10318  CD  ARG B 439      46.543  90.001  95.172  1.00  0.82           C  
ATOM  10319  NE  ARG B 439      46.611  90.503  96.586  1.00  0.82           N  
ATOM  10320  CZ  ARG B 439      46.828  89.800  97.702  1.00  0.82           C  
ATOM  10321  NH1 ARG B 439      47.159  88.516  97.708  1.00  0.82           N  
ATOM  10322  NH2 ARG B 439      46.593  90.354  98.886  1.00  0.82           N  
ATOM  10323  N   ILE B 440      41.329  87.912  95.263  1.00  0.91           N  
ATOM  10324  CA  ILE B 440      40.138  87.219  95.724  1.00  0.91           C  
ATOM  10325  C   ILE B 440      40.554  85.846  96.209  1.00  0.91           C  
ATOM  10326  O   ILE B 440      41.174  85.087  95.469  1.00  0.91           O  
ATOM  10327  CB  ILE B 440      39.100  87.027  94.617  1.00  0.91           C  
ATOM  10328  CG1 ILE B 440      38.787  88.369  93.923  1.00  0.91           C  
ATOM  10329  CG2 ILE B 440      37.817  86.380  95.195  1.00  0.91           C  
ATOM  10330  CD1 ILE B 440      37.924  88.218  92.668  1.00  0.91           C  
ATOM  10331  N   ASN B 441      40.222  85.472  97.459  1.00  0.91           N  
ATOM  10332  CA  ASN B 441      40.528  84.176  98.024  1.00  0.91           C  
ATOM  10333  C   ASN B 441      39.418  83.184  97.688  1.00  0.91           C  
ATOM  10334  O   ASN B 441      38.352  83.144  98.305  1.00  0.91           O  
ATOM  10335  CB  ASN B 441      40.788  84.301  99.558  1.00  0.91           C  
ATOM  10336  CG  ASN B 441      41.226  82.990 100.211  1.00  0.91           C  
ATOM  10337  OD1 ASN B 441      42.379  82.698 100.518  1.00  0.91           O  
ATOM  10338  ND2 ASN B 441      40.250  82.086 100.400  1.00  0.91           N  
ATOM  10339  N   MET B 442      39.682  82.302  96.709  1.00  0.93           N  
ATOM  10340  CA  MET B 442      38.708  81.373  96.162  1.00  0.93           C  
ATOM  10341  C   MET B 442      38.198  80.320  97.129  1.00  0.93           C  
ATOM  10342  O   MET B 442      37.032  79.944  97.097  1.00  0.93           O  
ATOM  10343  CB  MET B 442      39.222  80.727  94.860  1.00  0.93           C  
ATOM  10344  CG  MET B 442      39.722  81.761  93.830  1.00  0.93           C  
ATOM  10345  SD  MET B 442      38.638  83.212  93.582  1.00  0.93           S  
ATOM  10346  CE  MET B 442      37.485  82.465  92.402  1.00  0.93           C  
ATOM  10347  N   ALA B 443      39.037  79.843  98.070  1.00  0.94           N  
ATOM  10348  CA  ALA B 443      38.607  78.922  99.110  1.00  0.94           C  
ATOM  10349  C   ALA B 443      37.507  79.466 100.015  1.00  0.94           C  
ATOM  10350  O   ALA B 443      36.567  78.765 100.360  1.00  0.94           O  
ATOM  10351  CB  ALA B 443      39.815  78.493  99.963  1.00  0.94           C  
ATOM  10352  N   HIS B 444      37.575  80.753 100.390  1.00  0.89           N  
ATOM  10353  CA  HIS B 444      36.529  81.451 101.117  1.00  0.89           C  
ATOM  10354  C   HIS B 444      35.241  81.570 100.322  1.00  0.89           C  
ATOM  10355  O   HIS B 444      34.163  81.352 100.863  1.00  0.89           O  
ATOM  10356  CB  HIS B 444      36.946  82.880 101.512  1.00  0.89           C  
ATOM  10357  CG  HIS B 444      38.099  82.979 102.458  1.00  0.89           C  
ATOM  10358  ND1 HIS B 444      38.598  84.237 102.667  1.00  0.89           N  
ATOM  10359  CD2 HIS B 444      38.719  82.087 103.275  1.00  0.89           C  
ATOM  10360  CE1 HIS B 444      39.504  84.112 103.613  1.00  0.89           C  
ATOM  10361  NE2 HIS B 444      39.622  82.823 104.016  1.00  0.89           N  
ATOM  10362  N   LEU B 445      35.325  81.868  99.001  1.00  0.94           N  
ATOM  10363  CA  LEU B 445      34.178  81.886  98.098  1.00  0.94           C  
ATOM  10364  C   LEU B 445      33.491  80.526  98.069  1.00  0.94           C  
ATOM  10365  O   LEU B 445      32.275  80.415  98.214  1.00  0.94           O  
ATOM  10366  CB  LEU B 445      34.625  82.305  96.670  1.00  0.94           C  
ATOM  10367  CG  LEU B 445      33.541  82.282  95.567  1.00  0.94           C  
ATOM  10368  CD1 LEU B 445      32.407  83.287  95.820  1.00  0.94           C  
ATOM  10369  CD2 LEU B 445      34.190  82.542  94.199  1.00  0.94           C  
ATOM  10370  N   CYS B 446      34.290  79.445  97.985  1.00  0.95           N  
ATOM  10371  CA  CYS B 446      33.814  78.083  98.110  1.00  0.95           C  
ATOM  10372  C   CYS B 446      33.172  77.752  99.455  1.00  0.95           C  
ATOM  10373  O   CYS B 446      32.149  77.083  99.494  1.00  0.95           O  
ATOM  10374  CB  CYS B 446      34.929  77.055  97.820  1.00  0.95           C  
ATOM  10375  SG  CYS B 446      35.552  77.138  96.115  1.00  0.95           S  
ATOM  10376  N   ILE B 447      33.731  78.210 100.595  1.00  0.93           N  
ATOM  10377  CA  ILE B 447      33.147  78.044 101.930  1.00  0.93           C  
ATOM  10378  C   ILE B 447      31.837  78.803 102.130  1.00  0.93           C  
ATOM  10379  O   ILE B 447      30.869  78.259 102.665  1.00  0.93           O  
ATOM  10380  CB  ILE B 447      34.136  78.438 103.035  1.00  0.93           C  
ATOM  10381  CG1 ILE B 447      35.363  77.499 103.031  1.00  0.93           C  
ATOM  10382  CG2 ILE B 447      33.471  78.404 104.433  1.00  0.93           C  
ATOM  10383  CD1 ILE B 447      36.545  78.043 103.836  1.00  0.93           C  
ATOM  10384  N   VAL B 448      31.745  80.085 101.711  1.00  0.92           N  
ATOM  10385  CA  VAL B 448      30.508  80.852 101.833  1.00  0.92           C  
ATOM  10386  C   VAL B 448      29.412  80.337 100.913  1.00  0.92           C  
ATOM  10387  O   VAL B 448      28.246  80.291 101.287  1.00  0.92           O  
ATOM  10388  CB  VAL B 448      30.664  82.371 101.711  1.00  0.92           C  
ATOM  10389  CG1 VAL B 448      31.699  82.862 102.739  1.00  0.92           C  
ATOM  10390  CG2 VAL B 448      31.059  82.828 100.296  1.00  0.92           C  
ATOM  10391  N   GLY B 449      29.765  79.912  99.683  1.00  0.94           N  
ATOM  10392  CA  GLY B 449      28.808  79.459  98.681  1.00  0.94           C  
ATOM  10393  C   GLY B 449      28.429  78.008  98.705  1.00  0.94           C  
ATOM  10394  O   GLY B 449      27.698  77.568  97.826  1.00  0.94           O  
ATOM  10395  N   SER B 450      28.926  77.232  99.682  1.00  0.95           N  
ATOM  10396  CA  SER B 450      28.658  75.802  99.810  1.00  0.95           C  
ATOM  10397  C   SER B 450      27.996  75.505 101.132  1.00  0.95           C  
ATOM  10398  O   SER B 450      28.204  76.230 102.101  1.00  0.95           O  
ATOM  10399  CB  SER B 450      29.948  74.944  99.824  1.00  0.95           C  
ATOM  10400  OG  SER B 450      30.656  75.066  98.594  1.00  0.95           O  
ATOM  10401  N   HIS B 451      27.209  74.411 101.246  1.00  0.92           N  
ATOM  10402  CA  HIS B 451      26.633  73.995 102.521  1.00  0.92           C  
ATOM  10403  C   HIS B 451      27.542  73.047 103.274  1.00  0.92           C  
ATOM  10404  O   HIS B 451      27.348  72.792 104.460  1.00  0.92           O  
ATOM  10405  CB  HIS B 451      25.262  73.284 102.371  1.00  0.92           C  
ATOM  10406  CG  HIS B 451      25.298  71.948 101.685  1.00  0.92           C  
ATOM  10407  ND1 HIS B 451      25.473  71.920 100.326  1.00  0.92           N  
ATOM  10408  CD2 HIS B 451      25.200  70.681 102.171  1.00  0.92           C  
ATOM  10409  CE1 HIS B 451      25.480  70.649  99.994  1.00  0.92           C  
ATOM  10410  NE2 HIS B 451      25.318  69.848 101.075  1.00  0.92           N  
ATOM  10411  N   ALA B 452      28.580  72.525 102.605  1.00  0.96           N  
ATOM  10412  CA  ALA B 452      29.486  71.573 103.193  1.00  0.96           C  
ATOM  10413  C   ALA B 452      30.890  71.807 102.681  1.00  0.96           C  
ATOM  10414  O   ALA B 452      31.109  72.177 101.528  1.00  0.96           O  
ATOM  10415  CB  ALA B 452      29.054  70.134 102.861  1.00  0.96           C  
ATOM  10416  N   VAL B 453      31.879  71.615 103.564  1.00  0.94           N  
ATOM  10417  CA  VAL B 453      33.286  71.729 103.251  1.00  0.94           C  
ATOM  10418  C   VAL B 453      33.942  70.497 103.817  1.00  0.94           C  
ATOM  10419  O   VAL B 453      33.695  70.137 104.965  1.00  0.94           O  
ATOM  10420  CB  VAL B 453      33.932  72.953 103.892  1.00  0.94           C  
ATOM  10421  CG1 VAL B 453      35.446  73.012 103.587  1.00  0.94           C  
ATOM  10422  CG2 VAL B 453      33.234  74.222 103.376  1.00  0.94           C  
ATOM  10423  N   ASN B 454      34.803  69.792 103.066  1.00  0.90           N  
ATOM  10424  CA  ASN B 454      35.525  68.682 103.656  1.00  0.90           C  
ATOM  10425  C   ASN B 454      36.987  68.628 103.294  1.00  0.90           C  
ATOM  10426  O   ASN B 454      37.432  69.114 102.258  1.00  0.90           O  
ATOM  10427  CB  ASN B 454      34.857  67.303 103.385  1.00  0.90           C  
ATOM  10428  CG  ASN B 454      34.893  66.863 101.922  1.00  0.90           C  
ATOM  10429  OD1 ASN B 454      33.953  67.086 101.164  1.00  0.90           O  
ATOM  10430  ND2 ASN B 454      35.980  66.159 101.529  1.00  0.90           N  
ATOM  10431  N   GLY B 455      37.766  67.973 104.171  1.00  0.90           N  
ATOM  10432  CA  GLY B 455      39.117  67.541 103.865  1.00  0.90           C  
ATOM  10433  C   GLY B 455      39.207  66.073 103.519  1.00  0.90           C  
ATOM  10434  O   GLY B 455      38.228  65.331 103.602  1.00  0.90           O  
ATOM  10435  N   VAL B 456      40.416  65.633 103.126  1.00  0.91           N  
ATOM  10436  CA  VAL B 456      40.703  64.345 102.527  1.00  0.91           C  
ATOM  10437  C   VAL B 456      41.340  63.285 103.424  1.00  0.91           C  
ATOM  10438  O   VAL B 456      41.599  62.170 102.972  1.00  0.91           O  
ATOM  10439  CB  VAL B 456      41.656  64.563 101.363  1.00  0.91           C  
ATOM  10440  CG1 VAL B 456      40.930  65.386 100.287  1.00  0.91           C  
ATOM  10441  CG2 VAL B 456      42.949  65.280 101.804  1.00  0.91           C  
ATOM  10442  N   ALA B 457      41.597  63.588 104.707  1.00  0.92           N  
ATOM  10443  CA  ALA B 457      42.145  62.659 105.679  1.00  0.92           C  
ATOM  10444  C   ALA B 457      41.820  63.255 107.025  1.00  0.92           C  
ATOM  10445  O   ALA B 457      41.548  64.456 107.090  1.00  0.92           O  
ATOM  10446  CB  ALA B 457      43.669  62.490 105.554  1.00  0.92           C  
ATOM  10447  N   LYS B 458      41.791  62.464 108.120  1.00  0.82           N  
ATOM  10448  CA  LYS B 458      41.310  62.973 109.404  1.00  0.82           C  
ATOM  10449  C   LYS B 458      42.058  64.190 109.946  1.00  0.82           C  
ATOM  10450  O   LYS B 458      41.460  65.242 110.157  1.00  0.82           O  
ATOM  10451  CB  LYS B 458      41.348  61.882 110.498  1.00  0.82           C  
ATOM  10452  CG  LYS B 458      40.376  60.713 110.262  1.00  0.82           C  
ATOM  10453  CD  LYS B 458      40.314  59.750 111.461  1.00  0.82           C  
ATOM  10454  CE  LYS B 458      41.674  59.132 111.795  1.00  0.82           C  
ATOM  10455  NZ  LYS B 458      41.581  58.300 112.999  1.00  0.82           N  
ATOM  10456  N   ILE B 459      43.406  64.120 110.090  1.00  0.76           N  
ATOM  10457  CA  ILE B 459      44.190  65.233 110.627  1.00  0.76           C  
ATOM  10458  C   ILE B 459      44.126  66.452 109.730  1.00  0.76           C  
ATOM  10459  O   ILE B 459      44.049  67.584 110.190  1.00  0.76           O  
ATOM  10460  CB  ILE B 459      45.644  64.909 111.024  1.00  0.76           C  
ATOM  10461  CG1 ILE B 459      46.735  65.330 109.999  1.00  0.76           C  
ATOM  10462  CG2 ILE B 459      45.756  63.416 111.402  1.00  0.76           C  
ATOM  10463  CD1 ILE B 459      48.164  65.184 110.528  1.00  0.76           C  
ATOM  10464  N   HIS B 460      44.119  66.240 108.399  1.00  0.80           N  
ATOM  10465  CA  HIS B 460      43.976  67.292 107.414  1.00  0.80           C  
ATOM  10466  C   HIS B 460      42.659  68.037 107.565  1.00  0.80           C  
ATOM  10467  O   HIS B 460      42.633  69.262 107.616  1.00  0.80           O  
ATOM  10468  CB  HIS B 460      44.084  66.683 106.001  1.00  0.80           C  
ATOM  10469  CG  HIS B 460      43.713  67.621 104.897  1.00  0.80           C  
ATOM  10470  ND1 HIS B 460      44.583  68.585 104.467  1.00  0.80           N  
ATOM  10471  CD2 HIS B 460      42.532  67.746 104.257  1.00  0.80           C  
ATOM  10472  CE1 HIS B 460      43.917  69.281 103.563  1.00  0.80           C  
ATOM  10473  NE2 HIS B 460      42.664  68.809 103.397  1.00  0.80           N  
ATOM  10474  N   SER B 461      41.529  67.319 107.731  1.00  0.85           N  
ATOM  10475  CA  SER B 461      40.239  67.941 108.002  1.00  0.85           C  
ATOM  10476  C   SER B 461      40.208  68.737 109.284  1.00  0.85           C  
ATOM  10477  O   SER B 461      39.683  69.847 109.311  1.00  0.85           O  
ATOM  10478  CB  SER B 461      39.079  66.936 108.100  1.00  0.85           C  
ATOM  10479  OG  SER B 461      38.877  66.295 106.845  1.00  0.85           O  
ATOM  10480  N   ASP B 462      40.804  68.217 110.368  1.00  0.78           N  
ATOM  10481  CA  ASP B 462      40.951  68.914 111.630  1.00  0.78           C  
ATOM  10482  C   ASP B 462      41.790  70.188 111.517  1.00  0.78           C  
ATOM  10483  O   ASP B 462      41.492  71.208 112.147  1.00  0.78           O  
ATOM  10484  CB  ASP B 462      41.573  67.964 112.679  1.00  0.78           C  
ATOM  10485  CG  ASP B 462      40.621  66.833 113.039  1.00  0.78           C  
ATOM  10486  OD1 ASP B 462      41.134  65.828 113.592  1.00  0.78           O  
ATOM  10487  OD2 ASP B 462      39.396  66.978 112.801  1.00  0.78           O  
ATOM  10488  N   ILE B 463      42.870  70.182 110.704  1.00  0.76           N  
ATOM  10489  CA  ILE B 463      43.640  71.374 110.371  1.00  0.76           C  
ATOM  10490  C   ILE B 463      42.849  72.384 109.544  1.00  0.76           C  
ATOM  10491  O   ILE B 463      42.837  73.578 109.846  1.00  0.76           O  
ATOM  10492  CB  ILE B 463      44.983  71.061 109.717  1.00  0.76           C  
ATOM  10493  CG1 ILE B 463      45.852  70.134 110.601  1.00  0.76           C  
ATOM  10494  CG2 ILE B 463      45.768  72.368 109.466  1.00  0.76           C  
ATOM  10495  CD1 ILE B 463      46.998  69.474 109.823  1.00  0.76           C  
ATOM  10496  N   VAL B 464      42.109  71.918 108.519  1.00  0.80           N  
ATOM  10497  CA  VAL B 464      41.195  72.725 107.709  1.00  0.80           C  
ATOM  10498  C   VAL B 464      40.108  73.366 108.569  1.00  0.80           C  
ATOM  10499  O   VAL B 464      39.876  74.571 108.503  1.00  0.80           O  
ATOM  10500  CB  VAL B 464      40.580  71.869 106.586  1.00  0.80           C  
ATOM  10501  CG1 VAL B 464      39.418  72.538 105.818  1.00  0.80           C  
ATOM  10502  CG2 VAL B 464      41.689  71.527 105.576  1.00  0.80           C  
ATOM  10503  N   LYS B 465      39.456  72.586 109.454  1.00  0.73           N  
ATOM  10504  CA  LYS B 465      38.441  73.069 110.370  1.00  0.73           C  
ATOM  10505  C   LYS B 465      38.940  74.006 111.469  1.00  0.73           C  
ATOM  10506  O   LYS B 465      38.387  75.083 111.675  1.00  0.73           O  
ATOM  10507  CB  LYS B 465      37.725  71.841 111.002  1.00  0.73           C  
ATOM  10508  CG  LYS B 465      36.440  72.142 111.795  1.00  0.73           C  
ATOM  10509  CD  LYS B 465      35.760  70.848 112.283  1.00  0.73           C  
ATOM  10510  CE  LYS B 465      34.265  70.969 112.612  1.00  0.73           C  
ATOM  10511  NZ  LYS B 465      34.013  71.968 113.675  1.00  0.73           N  
ATOM  10512  N   THR B 466      40.004  73.642 112.217  1.00  0.73           N  
ATOM  10513  CA  THR B 466      40.318  74.337 113.470  1.00  0.73           C  
ATOM  10514  C   THR B 466      41.527  75.238 113.404  1.00  0.73           C  
ATOM  10515  O   THR B 466      41.797  75.972 114.357  1.00  0.73           O  
ATOM  10516  CB  THR B 466      40.502  73.387 114.665  1.00  0.73           C  
ATOM  10517  OG1 THR B 466      41.587  72.464 114.521  1.00  0.73           O  
ATOM  10518  CG2 THR B 466      39.206  72.591 114.899  1.00  0.73           C  
ATOM  10519  N   LYS B 467      42.279  75.224 112.287  1.00  0.77           N  
ATOM  10520  CA  LYS B 467      43.426  76.097 112.099  1.00  0.77           C  
ATOM  10521  C   LYS B 467      43.138  77.035 110.939  1.00  0.77           C  
ATOM  10522  O   LYS B 467      42.929  78.225 111.148  1.00  0.77           O  
ATOM  10523  CB  LYS B 467      44.772  75.343 111.866  1.00  0.77           C  
ATOM  10524  CG  LYS B 467      45.429  74.678 113.101  1.00  0.77           C  
ATOM  10525  CD  LYS B 467      44.659  73.448 113.598  1.00  0.77           C  
ATOM  10526  CE  LYS B 467      45.250  72.673 114.770  1.00  0.77           C  
ATOM  10527  NZ  LYS B 467      44.293  71.596 115.116  1.00  0.77           N  
ATOM  10528  N   VAL B 468      43.138  76.535 109.683  1.00  0.81           N  
ATOM  10529  CA  VAL B 468      43.069  77.372 108.484  1.00  0.81           C  
ATOM  10530  C   VAL B 468      41.788  78.175 108.328  1.00  0.81           C  
ATOM  10531  O   VAL B 468      41.816  79.364 108.020  1.00  0.81           O  
ATOM  10532  CB  VAL B 468      43.267  76.556 107.207  1.00  0.81           C  
ATOM  10533  CG1 VAL B 468      43.332  77.470 105.963  1.00  0.81           C  
ATOM  10534  CG2 VAL B 468      44.573  75.753 107.314  1.00  0.81           C  
ATOM  10535  N   PHE B 469      40.622  77.548 108.557  1.00  0.88           N  
ATOM  10536  CA  PHE B 469      39.335  78.198 108.389  1.00  0.88           C  
ATOM  10537  C   PHE B 469      38.630  78.259 109.720  1.00  0.88           C  
ATOM  10538  O   PHE B 469      37.428  78.015 109.841  1.00  0.88           O  
ATOM  10539  CB  PHE B 469      38.455  77.457 107.359  1.00  0.88           C  
ATOM  10540  CG  PHE B 469      39.155  77.396 106.030  1.00  0.88           C  
ATOM  10541  CD1 PHE B 469      39.522  76.158 105.490  1.00  0.88           C  
ATOM  10542  CD2 PHE B 469      39.461  78.566 105.315  1.00  0.88           C  
ATOM  10543  CE1 PHE B 469      40.192  76.075 104.263  1.00  0.88           C  
ATOM  10544  CE2 PHE B 469      40.128  78.493 104.084  1.00  0.88           C  
ATOM  10545  CZ  PHE B 469      40.495  77.247 103.559  1.00  0.88           C  
ATOM  10546  N   LYS B 470      39.401  78.606 110.765  1.00  0.84           N  
ATOM  10547  CA  LYS B 470      38.968  78.663 112.142  1.00  0.84           C  
ATOM  10548  C   LYS B 470      37.754  79.541 112.365  1.00  0.84           C  
ATOM  10549  O   LYS B 470      36.750  79.106 112.921  1.00  0.84           O  
ATOM  10550  CB  LYS B 470      40.131  79.241 112.983  1.00  0.84           C  
ATOM  10551  CG  LYS B 470      39.858  79.293 114.489  1.00  0.84           C  
ATOM  10552  CD  LYS B 470      40.989  80.010 115.242  1.00  0.84           C  
ATOM  10553  CE  LYS B 470      40.870  79.910 116.761  1.00  0.84           C  
ATOM  10554  NZ  LYS B 470      40.827  78.485 117.142  1.00  0.84           N  
ATOM  10555  N   ASP B 471      37.779  80.788 111.874  1.00  0.89           N  
ATOM  10556  CA  ASP B 471      36.726  81.741 112.119  1.00  0.89           C  
ATOM  10557  C   ASP B 471      35.475  81.499 111.290  1.00  0.89           C  
ATOM  10558  O   ASP B 471      34.369  81.875 111.690  1.00  0.89           O  
ATOM  10559  CB  ASP B 471      37.240  83.200 112.015  1.00  0.89           C  
ATOM  10560  CG  ASP B 471      38.362  83.433 111.026  1.00  0.89           C  
ATOM  10561  OD1 ASP B 471      38.471  82.703 110.013  1.00  0.89           O  
ATOM  10562  OD2 ASP B 471      39.153  84.365 111.337  1.00  0.89           O  
ATOM  10563  N   PHE B 472      35.614  80.797 110.155  1.00  0.90           N  
ATOM  10564  CA  PHE B 472      34.508  80.176 109.453  1.00  0.90           C  
ATOM  10565  C   PHE B 472      33.876  79.002 110.199  1.00  0.90           C  
ATOM  10566  O   PHE B 472      32.654  78.919 110.312  1.00  0.90           O  
ATOM  10567  CB  PHE B 472      34.956  79.666 108.062  1.00  0.90           C  
ATOM  10568  CG  PHE B 472      35.218  80.802 107.114  1.00  0.90           C  
ATOM  10569  CD1 PHE B 472      36.498  81.370 106.992  1.00  0.90           C  
ATOM  10570  CD2 PHE B 472      34.175  81.294 106.310  1.00  0.90           C  
ATOM  10571  CE1 PHE B 472      36.729  82.412 106.086  1.00  0.90           C  
ATOM  10572  CE2 PHE B 472      34.410  82.325 105.392  1.00  0.90           C  
ATOM  10573  CZ  PHE B 472      35.687  82.884 105.281  1.00  0.90           C  
ATOM  10574  N   SER B 473      34.665  78.055 110.756  1.00  0.89           N  
ATOM  10575  CA  SER B 473      34.077  76.894 111.426  1.00  0.89           C  
ATOM  10576  C   SER B 473      33.566  77.181 112.825  1.00  0.89           C  
ATOM  10577  O   SER B 473      32.713  76.463 113.336  1.00  0.89           O  
ATOM  10578  CB  SER B 473      34.977  75.622 111.418  1.00  0.89           C  
ATOM  10579  OG  SER B 473      35.880  75.502 112.522  1.00  0.89           O  
ATOM  10580  N   GLU B 474      34.032  78.271 113.461  1.00  0.79           N  
ATOM  10581  CA  GLU B 474      33.429  78.838 114.655  1.00  0.79           C  
ATOM  10582  C   GLU B 474      32.010  79.336 114.404  1.00  0.79           C  
ATOM  10583  O   GLU B 474      31.119  79.165 115.231  1.00  0.79           O  
ATOM  10584  CB  GLU B 474      34.275  80.027 115.172  1.00  0.79           C  
ATOM  10585  CG  GLU B 474      35.606  79.617 115.853  1.00  0.79           C  
ATOM  10586  CD  GLU B 474      36.548  80.791 116.111  1.00  0.79           C  
ATOM  10587  OE1 GLU B 474      36.214  81.950 115.734  1.00  0.79           O  
ATOM  10588  OE2 GLU B 474      37.642  80.533 116.675  1.00  0.79           O  
ATOM  10589  N   LEU B 475      31.771  79.977 113.238  1.00  0.77           N  
ATOM  10590  CA  LEU B 475      30.475  80.508 112.850  1.00  0.77           C  
ATOM  10591  C   LEU B 475      29.435  79.420 112.616  1.00  0.77           C  
ATOM  10592  O   LEU B 475      28.301  79.493 113.087  1.00  0.77           O  
ATOM  10593  CB  LEU B 475      30.678  81.360 111.562  1.00  0.77           C  
ATOM  10594  CG  LEU B 475      29.593  82.398 111.190  1.00  0.77           C  
ATOM  10595  CD1 LEU B 475      28.305  81.791 110.613  1.00  0.77           C  
ATOM  10596  CD2 LEU B 475      29.277  83.330 112.362  1.00  0.77           C  
ATOM  10597  N   GLU B 476      29.829  78.358 111.894  1.00  0.77           N  
ATOM  10598  CA  GLU B 476      28.946  77.268 111.532  1.00  0.77           C  
ATOM  10599  C   GLU B 476      29.706  75.934 111.614  1.00  0.77           C  
ATOM  10600  O   GLU B 476      30.287  75.476 110.625  1.00  0.77           O  
ATOM  10601  CB  GLU B 476      28.322  77.537 110.133  1.00  0.77           C  
ATOM  10602  CG  GLU B 476      29.331  78.045 109.070  1.00  0.77           C  
ATOM  10603  CD  GLU B 476      28.699  78.530 107.779  1.00  0.77           C  
ATOM  10604  OE1 GLU B 476      29.455  79.139 106.971  1.00  0.77           O  
ATOM  10605  OE2 GLU B 476      27.511  78.250 107.497  1.00  0.77           O  
ATOM  10606  N   PRO B 477      29.751  75.251 112.774  1.00  0.90           N  
ATOM  10607  CA  PRO B 477      30.617  74.086 112.974  1.00  0.90           C  
ATOM  10608  C   PRO B 477      30.344  72.912 112.075  1.00  0.90           C  
ATOM  10609  O   PRO B 477      31.287  72.190 111.744  1.00  0.90           O  
ATOM  10610  CB  PRO B 477      30.390  73.706 114.446  1.00  0.90           C  
ATOM  10611  CG  PRO B 477      30.135  75.054 115.114  1.00  0.90           C  
ATOM  10612  CD  PRO B 477      29.306  75.797 114.065  1.00  0.90           C  
ATOM  10613  N   ASP B 478      29.069  72.714 111.721  1.00  0.84           N  
ATOM  10614  CA  ASP B 478      28.532  71.536 111.080  1.00  0.84           C  
ATOM  10615  C   ASP B 478      28.809  71.499 109.579  1.00  0.84           C  
ATOM  10616  O   ASP B 478      28.707  70.466 108.919  1.00  0.84           O  
ATOM  10617  CB  ASP B 478      27.006  71.538 111.339  1.00  0.84           C  
ATOM  10618  CG  ASP B 478      26.680  71.562 112.829  1.00  0.84           C  
ATOM  10619  OD1 ASP B 478      27.576  71.264 113.661  1.00  0.84           O  
ATOM  10620  OD2 ASP B 478      25.523  71.934 113.140  1.00  0.84           O  
ATOM  10621  N   LYS B 479      29.217  72.649 109.003  1.00  0.87           N  
ATOM  10622  CA  LYS B 479      29.649  72.766 107.623  1.00  0.87           C  
ATOM  10623  C   LYS B 479      30.907  71.958 107.318  1.00  0.87           C  
ATOM  10624  O   LYS B 479      31.053  71.368 106.248  1.00  0.87           O  
ATOM  10625  CB  LYS B 479      29.874  74.263 107.274  1.00  0.87           C  
ATOM  10626  CG  LYS B 479      30.332  74.514 105.825  1.00  0.87           C  
ATOM  10627  CD  LYS B 479      30.327  75.996 105.407  1.00  0.87           C  
ATOM  10628  CE  LYS B 479      28.911  76.520 105.135  1.00  0.87           C  
ATOM  10629  NZ  LYS B 479      28.931  77.936 104.716  1.00  0.87           N  
ATOM  10630  N   PHE B 480      31.863  71.918 108.262  1.00  0.87           N  
ATOM  10631  CA  PHE B 480      33.182  71.369 108.023  1.00  0.87           C  
ATOM  10632  C   PHE B 480      33.298  69.913 108.448  1.00  0.87           C  
ATOM  10633  O   PHE B 480      33.138  69.559 109.615  1.00  0.87           O  
ATOM  10634  CB  PHE B 480      34.268  72.176 108.767  1.00  0.87           C  
ATOM  10635  CG  PHE B 480      34.475  73.524 108.140  1.00  0.87           C  
ATOM  10636  CD1 PHE B 480      33.591  74.587 108.395  1.00  0.87           C  
ATOM  10637  CD2 PHE B 480      35.586  73.746 107.311  1.00  0.87           C  
ATOM  10638  CE1 PHE B 480      33.808  75.847 107.826  1.00  0.87           C  
ATOM  10639  CE2 PHE B 480      35.806  75.003 106.737  1.00  0.87           C  
ATOM  10640  CZ  PHE B 480      34.916  76.052 106.994  1.00  0.87           C  
ATOM  10641  N   GLN B 481      33.616  69.032 107.483  1.00  0.87           N  
ATOM  10642  CA  GLN B 481      33.582  67.596 107.643  1.00  0.87           C  
ATOM  10643  C   GLN B 481      34.896  66.918 107.244  1.00  0.87           C  
ATOM  10644  O   GLN B 481      35.840  67.504 106.712  1.00  0.87           O  
ATOM  10645  CB  GLN B 481      32.461  66.979 106.759  1.00  0.87           C  
ATOM  10646  CG  GLN B 481      31.050  67.587 106.960  1.00  0.87           C  
ATOM  10647  CD  GLN B 481      30.025  66.831 106.111  1.00  0.87           C  
ATOM  10648  OE1 GLN B 481      30.248  65.674 105.730  1.00  0.87           O  
ATOM  10649  NE2 GLN B 481      28.881  67.483 105.807  1.00  0.87           N  
ATOM  10650  N   ASN B 482      34.977  65.596 107.476  1.00  0.88           N  
ATOM  10651  CA  ASN B 482      36.024  64.741 106.962  1.00  0.88           C  
ATOM  10652  C   ASN B 482      35.422  63.771 105.963  1.00  0.88           C  
ATOM  10653  O   ASN B 482      34.301  63.298 106.143  1.00  0.88           O  
ATOM  10654  CB  ASN B 482      36.733  64.007 108.140  1.00  0.88           C  
ATOM  10655  CG  ASN B 482      37.685  62.898 107.699  1.00  0.88           C  
ATOM  10656  OD1 ASN B 482      37.500  61.734 108.044  1.00  0.88           O  
ATOM  10657  ND2 ASN B 482      38.694  63.250 106.878  1.00  0.88           N  
ATOM  10658  N   LYS B 483      36.159  63.506 104.866  1.00  0.89           N  
ATOM  10659  CA  LYS B 483      35.921  62.387 103.984  1.00  0.89           C  
ATOM  10660  C   LYS B 483      37.281  61.850 103.571  1.00  0.89           C  
ATOM  10661  O   LYS B 483      37.877  62.324 102.604  1.00  0.89           O  
ATOM  10662  CB  LYS B 483      35.161  62.802 102.696  1.00  0.89           C  
ATOM  10663  CG  LYS B 483      33.749  63.361 102.921  1.00  0.89           C  
ATOM  10664  CD  LYS B 483      32.779  62.272 103.393  1.00  0.89           C  
ATOM  10665  CE  LYS B 483      31.470  62.815 103.958  1.00  0.89           C  
ATOM  10666  NZ  LYS B 483      31.677  63.397 105.290  1.00  0.89           N  
ATOM  10667  N   THR B 484      37.836  60.855 104.297  1.00  0.92           N  
ATOM  10668  CA  THR B 484      39.137  60.266 103.966  1.00  0.92           C  
ATOM  10669  C   THR B 484      39.169  59.652 102.581  1.00  0.92           C  
ATOM  10670  O   THR B 484      38.259  58.930 102.178  1.00  0.92           O  
ATOM  10671  CB  THR B 484      39.630  59.243 104.981  1.00  0.92           C  
ATOM  10672  OG1 THR B 484      39.770  59.881 106.240  1.00  0.92           O  
ATOM  10673  CG2 THR B 484      41.005  58.651 104.628  1.00  0.92           C  
ATOM  10674  N   ASN B 485      40.218  59.930 101.781  1.00  0.92           N  
ATOM  10675  CA  ASN B 485      40.353  59.399 100.434  1.00  0.92           C  
ATOM  10676  C   ASN B 485      40.263  57.882 100.326  1.00  0.92           C  
ATOM  10677  O   ASN B 485      40.446  57.129 101.283  1.00  0.92           O  
ATOM  10678  CB  ASN B 485      41.637  59.870  99.704  1.00  0.92           C  
ATOM  10679  CG  ASN B 485      41.695  61.369  99.435  1.00  0.92           C  
ATOM  10680  OD1 ASN B 485      42.791  61.907  99.277  1.00  0.92           O  
ATOM  10681  ND2 ASN B 485      40.539  62.061  99.354  1.00  0.92           N  
ATOM  10682  N   GLY B 486      39.904  57.406  99.124  1.00  0.96           N  
ATOM  10683  CA  GLY B 486      39.814  55.986  98.880  1.00  0.96           C  
ATOM  10684  C   GLY B 486      40.159  55.667  97.462  1.00  0.96           C  
ATOM  10685  O   GLY B 486      40.232  56.542  96.601  1.00  0.96           O  
ATOM  10686  N   ILE B 487      40.361  54.374  97.201  1.00  0.95           N  
ATOM  10687  CA  ILE B 487      40.846  53.795  95.970  1.00  0.95           C  
ATOM  10688  C   ILE B 487      39.810  52.820  95.443  1.00  0.95           C  
ATOM  10689  O   ILE B 487      39.192  52.079  96.200  1.00  0.95           O  
ATOM  10690  CB  ILE B 487      42.192  53.119  96.267  1.00  0.95           C  
ATOM  10691  CG1 ILE B 487      43.358  54.009  95.805  1.00  0.95           C  
ATOM  10692  CG2 ILE B 487      42.341  51.687  95.714  1.00  0.95           C  
ATOM  10693  CD1 ILE B 487      43.442  55.312  96.594  1.00  0.95           C  
ATOM  10694  N   THR B 488      39.550  52.777  94.117  1.00  0.96           N  
ATOM  10695  CA  THR B 488      38.679  51.729  93.577  1.00  0.96           C  
ATOM  10696  C   THR B 488      39.378  50.365  93.573  1.00  0.96           C  
ATOM  10697  O   THR B 488      40.472  50.237  93.013  1.00  0.96           O  
ATOM  10698  CB  THR B 488      38.031  52.014  92.217  1.00  0.96           C  
ATOM  10699  OG1 THR B 488      37.285  50.898  91.740  1.00  0.96           O  
ATOM  10700  CG2 THR B 488      39.069  52.328  91.138  1.00  0.96           C  
ATOM  10701  N   PRO B 489      38.812  49.306  94.149  1.00  0.97           N  
ATOM  10702  CA  PRO B 489      39.406  47.979  94.092  1.00  0.97           C  
ATOM  10703  C   PRO B 489      39.202  47.331  92.739  1.00  0.97           C  
ATOM  10704  O   PRO B 489      39.764  46.266  92.500  1.00  0.97           O  
ATOM  10705  CB  PRO B 489      38.663  47.222  95.200  1.00  0.97           C  
ATOM  10706  CG  PRO B 489      37.278  47.868  95.246  1.00  0.97           C  
ATOM  10707  CD  PRO B 489      37.591  49.334  94.967  1.00  0.97           C  
ATOM  10708  N   ARG B 490      38.407  47.910  91.816  1.00  0.91           N  
ATOM  10709  CA  ARG B 490      38.288  47.337  90.485  1.00  0.91           C  
ATOM  10710  C   ARG B 490      39.542  47.566  89.671  1.00  0.91           C  
ATOM  10711  O   ARG B 490      40.187  46.632  89.206  1.00  0.91           O  
ATOM  10712  CB  ARG B 490      37.091  47.930  89.708  1.00  0.91           C  
ATOM  10713  CG  ARG B 490      35.752  47.230  90.004  1.00  0.91           C  
ATOM  10714  CD  ARG B 490      35.220  47.349  91.431  1.00  0.91           C  
ATOM  10715  NE  ARG B 490      34.883  48.784  91.634  1.00  0.91           N  
ATOM  10716  CZ  ARG B 490      34.306  49.255  92.743  1.00  0.91           C  
ATOM  10717  NH1 ARG B 490      34.034  48.489  93.789  1.00  0.91           N  
ATOM  10718  NH2 ARG B 490      33.992  50.542  92.797  1.00  0.91           N  
ATOM  10719  N   ARG B 491      39.963  48.832  89.533  1.00  0.91           N  
ATOM  10720  CA  ARG B 491      41.199  49.167  88.864  1.00  0.91           C  
ATOM  10721  C   ARG B 491      42.438  48.786  89.653  1.00  0.91           C  
ATOM  10722  O   ARG B 491      43.403  48.255  89.112  1.00  0.91           O  
ATOM  10723  CB  ARG B 491      41.203  50.667  88.520  1.00  0.91           C  
ATOM  10724  CG  ARG B 491      42.490  51.134  87.823  1.00  0.91           C  
ATOM  10725  CD  ARG B 491      42.322  52.477  87.115  1.00  0.91           C  
ATOM  10726  NE  ARG B 491      42.833  52.311  85.736  1.00  0.91           N  
ATOM  10727  CZ  ARG B 491      42.161  52.392  84.587  1.00  0.91           C  
ATOM  10728  NH1 ARG B 491      40.885  52.739  84.470  1.00  0.91           N  
ATOM  10729  NH2 ARG B 491      42.853  52.080  83.499  1.00  0.91           N  
ATOM  10730  N   TRP B 492      42.435  49.025  90.977  1.00  0.92           N  
ATOM  10731  CA  TRP B 492      43.642  48.883  91.769  1.00  0.92           C  
ATOM  10732  C   TRP B 492      43.734  47.569  92.516  1.00  0.92           C  
ATOM  10733  O   TRP B 492      44.587  47.402  93.384  1.00  0.92           O  
ATOM  10734  CB  TRP B 492      43.811  50.081  92.730  1.00  0.92           C  
ATOM  10735  CG  TRP B 492      43.808  51.412  92.012  1.00  0.92           C  
ATOM  10736  CD1 TRP B 492      42.833  52.368  91.970  1.00  0.92           C  
ATOM  10737  CD2 TRP B 492      44.842  51.872  91.111  1.00  0.92           C  
ATOM  10738  NE1 TRP B 492      43.179  53.401  91.113  1.00  0.92           N  
ATOM  10739  CE2 TRP B 492      44.414  53.080  90.574  1.00  0.92           C  
ATOM  10740  CE3 TRP B 492      46.064  51.295  90.748  1.00  0.92           C  
ATOM  10741  CZ2 TRP B 492      45.183  53.773  89.639  1.00  0.92           C  
ATOM  10742  CZ3 TRP B 492      46.844  51.989  89.806  1.00  0.92           C  
ATOM  10743  CH2 TRP B 492      46.411  53.202  89.258  1.00  0.92           C  
ATOM  10744  N   LEU B 493      42.896  46.584  92.152  1.00  0.95           N  
ATOM  10745  CA  LEU B 493      43.100  45.218  92.584  1.00  0.95           C  
ATOM  10746  C   LEU B 493      42.736  44.282  91.449  1.00  0.95           C  
ATOM  10747  O   LEU B 493      43.608  43.634  90.888  1.00  0.95           O  
ATOM  10748  CB  LEU B 493      42.279  44.884  93.857  1.00  0.95           C  
ATOM  10749  CG  LEU B 493      42.858  43.813  94.811  1.00  0.95           C  
ATOM  10750  CD1 LEU B 493      41.713  43.049  95.475  1.00  0.95           C  
ATOM  10751  CD2 LEU B 493      43.862  42.827  94.203  1.00  0.95           C  
ATOM  10752  N   LEU B 494      41.449  44.197  91.039  1.00  0.92           N  
ATOM  10753  CA  LEU B 494      40.998  43.192  90.079  1.00  0.92           C  
ATOM  10754  C   LEU B 494      41.670  43.282  88.714  1.00  0.92           C  
ATOM  10755  O   LEU B 494      42.063  42.280  88.125  1.00  0.92           O  
ATOM  10756  CB  LEU B 494      39.460  43.254  89.858  1.00  0.92           C  
ATOM  10757  CG  LEU B 494      38.582  43.219  91.127  1.00  0.92           C  
ATOM  10758  CD1 LEU B 494      37.099  43.145  90.732  1.00  0.92           C  
ATOM  10759  CD2 LEU B 494      38.931  42.050  92.053  1.00  0.92           C  
ATOM  10760  N   LEU B 495      41.814  44.511  88.193  1.00  0.92           N  
ATOM  10761  CA  LEU B 495      42.425  44.776  86.911  1.00  0.92           C  
ATOM  10762  C   LEU B 495      43.935  44.668  86.896  1.00  0.92           C  
ATOM  10763  O   LEU B 495      44.512  43.916  86.112  1.00  0.92           O  
ATOM  10764  CB  LEU B 495      42.013  46.212  86.518  1.00  0.92           C  
ATOM  10765  CG  LEU B 495      42.478  46.700  85.142  1.00  0.92           C  
ATOM  10766  CD1 LEU B 495      41.815  45.903  84.024  1.00  0.92           C  
ATOM  10767  CD2 LEU B 495      42.187  48.196  84.984  1.00  0.92           C  
ATOM  10768  N   CYS B 496      44.627  45.404  87.786  1.00  0.94           N  
ATOM  10769  CA  CYS B 496      46.076  45.413  87.812  1.00  0.94           C  
ATOM  10770  C   CYS B 496      46.671  44.123  88.345  1.00  0.94           C  
ATOM  10771  O   CYS B 496      47.709  43.649  87.884  1.00  0.94           O  
ATOM  10772  CB  CYS B 496      46.619  46.655  88.568  1.00  0.94           C  
ATOM  10773  SG  CYS B 496      46.271  46.715  90.358  1.00  0.94           S  
ATOM  10774  N   ASN B 497      45.997  43.504  89.330  1.00  0.92           N  
ATOM  10775  CA  ASN B 497      46.497  42.343  90.024  1.00  0.92           C  
ATOM  10776  C   ASN B 497      45.458  41.227  90.094  1.00  0.92           C  
ATOM  10777  O   ASN B 497      44.958  40.902  91.179  1.00  0.92           O  
ATOM  10778  CB  ASN B 497      46.933  42.782  91.436  1.00  0.92           C  
ATOM  10779  CG  ASN B 497      47.934  41.803  92.026  1.00  0.92           C  
ATOM  10780  OD1 ASN B 497      48.001  40.627  91.653  1.00  0.92           O  
ATOM  10781  ND2 ASN B 497      48.745  42.308  92.983  1.00  0.92           N  
ATOM  10782  N   PRO B 498      45.122  40.568  88.983  1.00  0.92           N  
ATOM  10783  CA  PRO B 498      44.146  39.485  88.971  1.00  0.92           C  
ATOM  10784  C   PRO B 498      44.570  38.315  89.832  1.00  0.92           C  
ATOM  10785  O   PRO B 498      43.707  37.632  90.373  1.00  0.92           O  
ATOM  10786  CB  PRO B 498      44.017  39.115  87.484  1.00  0.92           C  
ATOM  10787  CG  PRO B 498      45.333  39.579  86.850  1.00  0.92           C  
ATOM  10788  CD  PRO B 498      45.644  40.845  87.639  1.00  0.92           C  
ATOM  10789  N   GLY B 499      45.888  38.080  89.998  1.00  0.91           N  
ATOM  10790  CA  GLY B 499      46.397  36.973  90.798  1.00  0.91           C  
ATOM  10791  C   GLY B 499      46.185  37.149  92.276  1.00  0.91           C  
ATOM  10792  O   GLY B 499      45.805  36.211  92.966  1.00  0.91           O  
ATOM  10793  N   LEU B 500      46.395  38.363  92.825  1.00  0.90           N  
ATOM  10794  CA  LEU B 500      46.081  38.645  94.220  1.00  0.90           C  
ATOM  10795  C   LEU B 500      44.576  38.629  94.451  1.00  0.90           C  
ATOM  10796  O   LEU B 500      44.078  38.067  95.424  1.00  0.90           O  
ATOM  10797  CB  LEU B 500      46.691  40.001  94.650  1.00  0.90           C  
ATOM  10798  CG  LEU B 500      47.123  40.180  96.125  1.00  0.90           C  
ATOM  10799  CD1 LEU B 500      47.194  41.678  96.443  1.00  0.90           C  
ATOM  10800  CD2 LEU B 500      46.234  39.484  97.156  1.00  0.90           C  
ATOM  10801  N   ALA B 501      43.798  39.205  93.512  1.00  0.92           N  
ATOM  10802  CA  ALA B 501      42.351  39.190  93.576  1.00  0.92           C  
ATOM  10803  C   ALA B 501      41.742  37.790  93.595  1.00  0.92           C  
ATOM  10804  O   ALA B 501      40.910  37.475  94.443  1.00  0.92           O  
ATOM  10805  CB  ALA B 501      41.793  39.939  92.355  1.00  0.92           C  
ATOM  10806  N   GLU B 502      42.205  36.896  92.702  1.00  0.84           N  
ATOM  10807  CA  GLU B 502      41.827  35.496  92.670  1.00  0.84           C  
ATOM  10808  C   GLU B 502      42.208  34.747  93.936  1.00  0.84           C  
ATOM  10809  O   GLU B 502      41.406  34.011  94.506  1.00  0.84           O  
ATOM  10810  CB  GLU B 502      42.487  34.838  91.443  1.00  0.84           C  
ATOM  10811  CG  GLU B 502      42.141  33.348  91.216  1.00  0.84           C  
ATOM  10812  CD  GLU B 502      42.568  32.910  89.817  1.00  0.84           C  
ATOM  10813  OE1 GLU B 502      43.787  33.007  89.515  1.00  0.84           O  
ATOM  10814  OE2 GLU B 502      41.673  32.499  89.034  1.00  0.84           O  
ATOM  10815  N   LEU B 503      43.424  34.990  94.470  1.00  0.85           N  
ATOM  10816  CA  LEU B 503      43.874  34.419  95.729  1.00  0.85           C  
ATOM  10817  C   LEU B 503      42.995  34.815  96.924  1.00  0.85           C  
ATOM  10818  O   LEU B 503      42.613  33.985  97.745  1.00  0.85           O  
ATOM  10819  CB  LEU B 503      45.343  34.856  95.995  1.00  0.85           C  
ATOM  10820  CG  LEU B 503      46.289  33.850  96.692  1.00  0.85           C  
ATOM  10821  CD1 LEU B 503      47.211  34.588  97.670  1.00  0.85           C  
ATOM  10822  CD2 LEU B 503      45.604  32.679  97.400  1.00  0.85           C  
ATOM  10823  N   ILE B 504      42.603  36.102  97.043  1.00  0.87           N  
ATOM  10824  CA  ILE B 504      41.662  36.550  98.066  1.00  0.87           C  
ATOM  10825  C   ILE B 504      40.270  35.944  97.899  1.00  0.87           C  
ATOM  10826  O   ILE B 504      39.678  35.432  98.851  1.00  0.87           O  
ATOM  10827  CB  ILE B 504      41.571  38.076  98.063  1.00  0.87           C  
ATOM  10828  CG1 ILE B 504      42.931  38.670  98.499  1.00  0.87           C  
ATOM  10829  CG2 ILE B 504      40.426  38.584  98.969  1.00  0.87           C  
ATOM  10830  CD1 ILE B 504      42.969  40.203  98.501  1.00  0.87           C  
ATOM  10831  N   ALA B 505      39.732  35.943  96.662  1.00  0.88           N  
ATOM  10832  CA  ALA B 505      38.427  35.408  96.315  1.00  0.88           C  
ATOM  10833  C   ALA B 505      38.291  33.922  96.598  1.00  0.88           C  
ATOM  10834  O   ALA B 505      37.279  33.452  97.116  1.00  0.88           O  
ATOM  10835  CB  ALA B 505      38.124  35.686  94.831  1.00  0.88           C  
ATOM  10836  N   GLU B 506      39.353  33.147  96.323  1.00  0.83           N  
ATOM  10837  CA  GLU B 506      39.402  31.722  96.565  1.00  0.83           C  
ATOM  10838  C   GLU B 506      39.332  31.359  98.047  1.00  0.83           C  
ATOM  10839  O   GLU B 506      38.934  30.258  98.421  1.00  0.83           O  
ATOM  10840  CB  GLU B 506      40.697  31.154  95.941  1.00  0.83           C  
ATOM  10841  CG  GLU B 506      40.678  29.624  95.751  1.00  0.83           C  
ATOM  10842  CD  GLU B 506      42.077  29.104  95.499  1.00  0.83           C  
ATOM  10843  OE1 GLU B 506      42.693  28.699  96.517  1.00  0.83           O  
ATOM  10844  OE2 GLU B 506      42.551  29.111  94.343  1.00  0.83           O  
ATOM  10845  N   LYS B 507      39.695  32.295  98.949  1.00  0.84           N  
ATOM  10846  CA  LYS B 507      39.678  32.023 100.370  1.00  0.84           C  
ATOM  10847  C   LYS B 507      38.527  32.703 101.114  1.00  0.84           C  
ATOM  10848  O   LYS B 507      38.051  32.159 102.108  1.00  0.84           O  
ATOM  10849  CB  LYS B 507      41.036  32.444 100.986  1.00  0.84           C  
ATOM  10850  CG  LYS B 507      42.287  31.805 100.332  1.00  0.84           C  
ATOM  10851  CD  LYS B 507      42.288  30.264 100.283  1.00  0.84           C  
ATOM  10852  CE  LYS B 507      43.596  29.593  99.798  1.00  0.84           C  
ATOM  10853  NZ  LYS B 507      43.980  29.879  98.400  1.00  0.84           N  
ATOM  10854  N   ILE B 508      38.017  33.882 100.669  1.00  0.86           N  
ATOM  10855  CA  ILE B 508      36.917  34.562 101.375  1.00  0.86           C  
ATOM  10856  C   ILE B 508      35.686  34.874 100.533  1.00  0.86           C  
ATOM  10857  O   ILE B 508      34.773  35.559 100.996  1.00  0.86           O  
ATOM  10858  CB  ILE B 508      37.340  35.843 102.109  1.00  0.86           C  
ATOM  10859  CG1 ILE B 508      37.809  36.980 101.172  1.00  0.86           C  
ATOM  10860  CG2 ILE B 508      38.424  35.470 103.141  1.00  0.86           C  
ATOM  10861  CD1 ILE B 508      37.959  38.328 101.888  1.00  0.86           C  
ATOM  10862  N   GLY B 509      35.593  34.358  99.290  1.00  0.86           N  
ATOM  10863  CA  GLY B 509      34.510  34.691  98.361  1.00  0.86           C  
ATOM  10864  C   GLY B 509      34.654  36.061  97.745  1.00  0.86           C  
ATOM  10865  O   GLY B 509      35.619  36.770  98.001  1.00  0.86           O  
ATOM  10866  N   GLU B 510      33.716  36.475  96.870  1.00  0.81           N  
ATOM  10867  CA  GLU B 510      33.909  37.665  96.046  1.00  0.81           C  
ATOM  10868  C   GLU B 510      33.251  38.943  96.540  1.00  0.81           C  
ATOM  10869  O   GLU B 510      33.421  40.000  95.937  1.00  0.81           O  
ATOM  10870  CB  GLU B 510      33.446  37.401  94.597  1.00  0.81           C  
ATOM  10871  CG  GLU B 510      34.395  36.446  93.836  1.00  0.81           C  
ATOM  10872  CD  GLU B 510      33.917  36.137  92.419  1.00  0.81           C  
ATOM  10873  OE1 GLU B 510      34.397  35.111  91.876  1.00  0.81           O  
ATOM  10874  OE2 GLU B 510      33.086  36.910  91.876  1.00  0.81           O  
ATOM  10875  N   ASP B 511      32.549  38.938  97.689  1.00  0.81           N  
ATOM  10876  CA  ASP B 511      31.856  40.110  98.223  1.00  0.81           C  
ATOM  10877  C   ASP B 511      32.759  41.317  98.481  1.00  0.81           C  
ATOM  10878  O   ASP B 511      32.352  42.475  98.362  1.00  0.81           O  
ATOM  10879  CB  ASP B 511      31.142  39.766  99.543  1.00  0.81           C  
ATOM  10880  CG  ASP B 511      30.206  38.599  99.330  1.00  0.81           C  
ATOM  10881  OD1 ASP B 511      30.423  37.577 100.027  1.00  0.81           O  
ATOM  10882  OD2 ASP B 511      29.301  38.714  98.472  1.00  0.81           O  
ATOM  10883  N   TYR B 512      34.049  41.062  98.790  1.00  0.86           N  
ATOM  10884  CA  TYR B 512      35.059  42.073  99.050  1.00  0.86           C  
ATOM  10885  C   TYR B 512      35.227  43.126  97.942  1.00  0.86           C  
ATOM  10886  O   TYR B 512      35.655  44.250  98.185  1.00  0.86           O  
ATOM  10887  CB  TYR B 512      36.424  41.420  99.441  1.00  0.86           C  
ATOM  10888  CG  TYR B 512      37.173  40.886  98.250  1.00  0.86           C  
ATOM  10889  CD1 TYR B 512      36.854  39.636  97.708  1.00  0.86           C  
ATOM  10890  CD2 TYR B 512      38.132  41.681  97.605  1.00  0.86           C  
ATOM  10891  CE1 TYR B 512      37.440  39.205  96.510  1.00  0.86           C  
ATOM  10892  CE2 TYR B 512      38.698  41.266  96.394  1.00  0.86           C  
ATOM  10893  CZ  TYR B 512      38.341  40.034  95.841  1.00  0.86           C  
ATOM  10894  OH  TYR B 512      38.850  39.644  94.592  1.00  0.86           O  
ATOM  10895  N   VAL B 513      34.873  42.800  96.683  1.00  0.89           N  
ATOM  10896  CA  VAL B 513      35.020  43.699  95.549  1.00  0.89           C  
ATOM  10897  C   VAL B 513      34.095  44.912  95.572  1.00  0.89           C  
ATOM  10898  O   VAL B 513      34.386  45.920  94.926  1.00  0.89           O  
ATOM  10899  CB  VAL B 513      34.853  42.979  94.214  1.00  0.89           C  
ATOM  10900  CG1 VAL B 513      35.778  41.751  94.178  1.00  0.89           C  
ATOM  10901  CG2 VAL B 513      33.391  42.564  93.971  1.00  0.89           C  
ATOM  10902  N   LYS B 514      32.962  44.855  96.316  1.00  0.81           N  
ATOM  10903  CA  LYS B 514      32.094  46.010  96.529  1.00  0.81           C  
ATOM  10904  C   LYS B 514      31.992  46.374  98.006  1.00  0.81           C  
ATOM  10905  O   LYS B 514      31.321  47.336  98.389  1.00  0.81           O  
ATOM  10906  CB  LYS B 514      30.658  45.762  95.997  1.00  0.81           C  
ATOM  10907  CG  LYS B 514      30.600  45.428  94.498  1.00  0.81           C  
ATOM  10908  CD  LYS B 514      29.272  45.772  93.786  1.00  0.81           C  
ATOM  10909  CE  LYS B 514      27.990  45.081  94.287  1.00  0.81           C  
ATOM  10910  NZ  LYS B 514      27.493  45.720  95.520  1.00  0.81           N  
ATOM  10911  N   ASP B 515      32.693  45.618  98.869  1.00  0.83           N  
ATOM  10912  CA  ASP B 515      32.705  45.851 100.296  1.00  0.83           C  
ATOM  10913  C   ASP B 515      34.062  45.431 100.837  1.00  0.83           C  
ATOM  10914  O   ASP B 515      34.271  44.358 101.393  1.00  0.83           O  
ATOM  10915  CB  ASP B 515      31.538  45.131 101.012  1.00  0.83           C  
ATOM  10916  CG  ASP B 515      31.226  45.859 102.306  1.00  0.83           C  
ATOM  10917  OD1 ASP B 515      31.279  45.216 103.379  1.00  0.83           O  
ATOM  10918  OD2 ASP B 515      30.940  47.093 102.213  1.00  0.83           O  
ATOM  10919  N   LEU B 516      35.072  46.292 100.629  1.00  0.88           N  
ATOM  10920  CA  LEU B 516      36.474  45.939 100.783  1.00  0.88           C  
ATOM  10921  C   LEU B 516      36.899  45.735 102.232  1.00  0.88           C  
ATOM  10922  O   LEU B 516      37.901  45.093 102.529  1.00  0.88           O  
ATOM  10923  CB  LEU B 516      37.329  47.022 100.083  1.00  0.88           C  
ATOM  10924  CG  LEU B 516      38.758  46.611  99.674  1.00  0.88           C  
ATOM  10925  CD1 LEU B 516      38.737  45.611  98.512  1.00  0.88           C  
ATOM  10926  CD2 LEU B 516      39.604  47.840  99.305  1.00  0.88           C  
ATOM  10927  N   SER B 517      36.091  46.206 103.197  1.00  0.86           N  
ATOM  10928  CA  SER B 517      36.242  45.981 104.628  1.00  0.86           C  
ATOM  10929  C   SER B 517      36.176  44.515 105.016  1.00  0.86           C  
ATOM  10930  O   SER B 517      36.795  44.095 105.991  1.00  0.86           O  
ATOM  10931  CB  SER B 517      35.165  46.768 105.407  1.00  0.86           C  
ATOM  10932  OG  SER B 517      33.917  46.688 104.726  1.00  0.86           O  
ATOM  10933  N   GLN B 518      35.494  43.689 104.195  1.00  0.81           N  
ATOM  10934  CA  GLN B 518      35.462  42.234 104.239  1.00  0.81           C  
ATOM  10935  C   GLN B 518      36.847  41.568 104.202  1.00  0.81           C  
ATOM  10936  O   GLN B 518      37.006  40.407 104.578  1.00  0.81           O  
ATOM  10937  CB  GLN B 518      34.618  41.771 103.018  1.00  0.81           C  
ATOM  10938  CG  GLN B 518      34.188  40.284 102.934  1.00  0.81           C  
ATOM  10939  CD  GLN B 518      32.887  40.022 103.690  1.00  0.81           C  
ATOM  10940  OE1 GLN B 518      32.789  40.168 104.908  1.00  0.81           O  
ATOM  10941  NE2 GLN B 518      31.839  39.528 102.991  1.00  0.81           N  
ATOM  10942  N   LEU B 519      37.914  42.303 103.804  1.00  0.87           N  
ATOM  10943  CA  LEU B 519      39.285  41.818 103.802  1.00  0.87           C  
ATOM  10944  C   LEU B 519      39.849  41.458 105.176  1.00  0.87           C  
ATOM  10945  O   LEU B 519      40.829  40.722 105.262  1.00  0.87           O  
ATOM  10946  CB  LEU B 519      40.248  42.838 103.141  1.00  0.87           C  
ATOM  10947  CG  LEU B 519      40.119  42.960 101.610  1.00  0.87           C  
ATOM  10948  CD1 LEU B 519      41.080  44.032 101.078  1.00  0.87           C  
ATOM  10949  CD2 LEU B 519      40.409  41.634 100.904  1.00  0.87           C  
ATOM  10950  N   THR B 520      39.209  41.877 106.289  1.00  0.84           N  
ATOM  10951  CA  THR B 520      39.573  41.464 107.653  1.00  0.84           C  
ATOM  10952  C   THR B 520      39.394  39.970 107.891  1.00  0.84           C  
ATOM  10953  O   THR B 520      39.983  39.363 108.782  1.00  0.84           O  
ATOM  10954  CB  THR B 520      38.797  42.196 108.743  1.00  0.84           C  
ATOM  10955  OG1 THR B 520      37.390  42.051 108.580  1.00  0.84           O  
ATOM  10956  CG2 THR B 520      39.114  43.696 108.669  1.00  0.84           C  
ATOM  10957  N   LYS B 521      38.620  39.288 107.027  1.00  0.80           N  
ATOM  10958  CA  LYS B 521      38.481  37.844 107.044  1.00  0.80           C  
ATOM  10959  C   LYS B 521      39.741  37.124 106.578  1.00  0.80           C  
ATOM  10960  O   LYS B 521      39.918  35.930 106.813  1.00  0.80           O  
ATOM  10961  CB  LYS B 521      37.247  37.412 106.223  1.00  0.80           C  
ATOM  10962  CG  LYS B 521      35.959  37.966 106.848  1.00  0.80           C  
ATOM  10963  CD  LYS B 521      34.686  37.489 106.139  1.00  0.80           C  
ATOM  10964  CE  LYS B 521      33.428  37.926 106.894  1.00  0.80           C  
ATOM  10965  NZ  LYS B 521      32.231  37.732 106.052  1.00  0.80           N  
ATOM  10966  N   LEU B 522      40.702  37.849 105.970  1.00  0.83           N  
ATOM  10967  CA  LEU B 522      42.013  37.307 105.681  1.00  0.83           C  
ATOM  10968  C   LEU B 522      42.879  37.125 106.931  1.00  0.83           C  
ATOM  10969  O   LEU B 522      43.832  36.347 106.922  1.00  0.83           O  
ATOM  10970  CB  LEU B 522      42.780  38.167 104.655  1.00  0.83           C  
ATOM  10971  CG  LEU B 522      42.198  38.181 103.228  1.00  0.83           C  
ATOM  10972  CD1 LEU B 522      43.034  39.133 102.362  1.00  0.83           C  
ATOM  10973  CD2 LEU B 522      42.154  36.785 102.585  1.00  0.83           C  
ATOM  10974  N   HIS B 523      42.543  37.757 108.082  1.00  0.80           N  
ATOM  10975  CA  HIS B 523      43.262  37.541 109.334  1.00  0.80           C  
ATOM  10976  C   HIS B 523      43.068  36.132 109.889  1.00  0.80           C  
ATOM  10977  O   HIS B 523      43.880  35.635 110.665  1.00  0.80           O  
ATOM  10978  CB  HIS B 523      42.878  38.571 110.424  1.00  0.80           C  
ATOM  10979  CG  HIS B 523      43.334  39.973 110.119  1.00  0.80           C  
ATOM  10980  ND1 HIS B 523      42.404  40.950 109.830  1.00  0.80           N  
ATOM  10981  CD2 HIS B 523      44.582  40.515 110.146  1.00  0.80           C  
ATOM  10982  CE1 HIS B 523      43.093  42.062 109.688  1.00  0.80           C  
ATOM  10983  NE2 HIS B 523      44.419  41.857 109.870  1.00  0.80           N  
ATOM  10984  N   SER B 524      42.041  35.396 109.417  1.00  0.78           N  
ATOM  10985  CA  SER B 524      41.817  33.995 109.759  1.00  0.78           C  
ATOM  10986  C   SER B 524      42.842  33.072 109.125  1.00  0.78           C  
ATOM  10987  O   SER B 524      42.942  31.902 109.477  1.00  0.78           O  
ATOM  10988  CB  SER B 524      40.400  33.507 109.366  1.00  0.78           C  
ATOM  10989  OG  SER B 524      39.419  34.275 110.064  1.00  0.78           O  
ATOM  10990  N   PHE B 525      43.670  33.594 108.200  1.00  0.81           N  
ATOM  10991  CA  PHE B 525      44.712  32.847 107.523  1.00  0.81           C  
ATOM  10992  C   PHE B 525      46.082  33.311 107.995  1.00  0.81           C  
ATOM  10993  O   PHE B 525      47.112  32.972 107.427  1.00  0.81           O  
ATOM  10994  CB  PHE B 525      44.621  33.033 105.985  1.00  0.81           C  
ATOM  10995  CG  PHE B 525      43.298  32.533 105.468  1.00  0.81           C  
ATOM  10996  CD1 PHE B 525      42.166  33.364 105.503  1.00  0.81           C  
ATOM  10997  CD2 PHE B 525      43.164  31.228 104.964  1.00  0.81           C  
ATOM  10998  CE1 PHE B 525      40.915  32.898 105.090  1.00  0.81           C  
ATOM  10999  CE2 PHE B 525      41.913  30.757 104.539  1.00  0.81           C  
ATOM  11000  CZ  PHE B 525      40.786  31.588 104.615  1.00  0.81           C  
ATOM  11001  N   LEU B 526      46.150  34.102 109.084  1.00  0.77           N  
ATOM  11002  CA  LEU B 526      47.386  34.708 109.554  1.00  0.77           C  
ATOM  11003  C   LEU B 526      48.381  33.721 110.154  1.00  0.77           C  
ATOM  11004  O   LEU B 526      49.595  33.923 110.122  1.00  0.77           O  
ATOM  11005  CB  LEU B 526      47.028  35.834 110.550  1.00  0.77           C  
ATOM  11006  CG  LEU B 526      48.144  36.841 110.887  1.00  0.77           C  
ATOM  11007  CD1 LEU B 526      48.752  37.492 109.634  1.00  0.77           C  
ATOM  11008  CD2 LEU B 526      47.585  37.922 111.824  1.00  0.77           C  
ATOM  11009  N   GLY B 527      47.871  32.593 110.693  1.00  0.75           N  
ATOM  11010  CA  GLY B 527      48.686  31.455 111.108  1.00  0.75           C  
ATOM  11011  C   GLY B 527      48.937  30.439 110.025  1.00  0.75           C  
ATOM  11012  O   GLY B 527      49.627  29.452 110.261  1.00  0.75           O  
ATOM  11013  N   ASP B 528      48.376  30.634 108.818  1.00  0.78           N  
ATOM  11014  CA  ASP B 528      48.489  29.687 107.731  1.00  0.78           C  
ATOM  11015  C   ASP B 528      49.700  30.018 106.866  1.00  0.78           C  
ATOM  11016  O   ASP B 528      49.788  31.053 106.208  1.00  0.78           O  
ATOM  11017  CB  ASP B 528      47.179  29.687 106.902  1.00  0.78           C  
ATOM  11018  CG  ASP B 528      47.150  28.648 105.792  1.00  0.78           C  
ATOM  11019  OD1 ASP B 528      46.139  28.635 105.051  1.00  0.78           O  
ATOM  11020  OD2 ASP B 528      48.142  27.891 105.637  1.00  0.78           O  
ATOM  11021  N   ASP B 529      50.675  29.100 106.840  1.00  0.71           N  
ATOM  11022  CA  ASP B 529      51.876  29.262 106.058  1.00  0.71           C  
ATOM  11023  C   ASP B 529      51.671  28.781 104.617  1.00  0.71           C  
ATOM  11024  O   ASP B 529      52.359  29.195 103.683  1.00  0.71           O  
ATOM  11025  CB  ASP B 529      52.991  28.480 106.791  1.00  0.71           C  
ATOM  11026  CG  ASP B 529      54.371  28.950 106.375  1.00  0.71           C  
ATOM  11027  OD1 ASP B 529      55.201  28.090 105.993  1.00  0.71           O  
ATOM  11028  OD2 ASP B 529      54.615  30.178 106.487  1.00  0.71           O  
ATOM  11029  N   VAL B 530      50.647  27.934 104.371  1.00  0.78           N  
ATOM  11030  CA  VAL B 530      50.321  27.430 103.045  1.00  0.78           C  
ATOM  11031  C   VAL B 530      49.737  28.539 102.183  1.00  0.78           C  
ATOM  11032  O   VAL B 530      50.121  28.738 101.030  1.00  0.78           O  
ATOM  11033  CB  VAL B 530      49.370  26.236 103.087  1.00  0.78           C  
ATOM  11034  CG1 VAL B 530      49.323  25.551 101.706  1.00  0.78           C  
ATOM  11035  CG2 VAL B 530      49.855  25.234 104.154  1.00  0.78           C  
ATOM  11036  N   PHE B 531      48.832  29.346 102.769  1.00  0.77           N  
ATOM  11037  CA  PHE B 531      48.317  30.572 102.186  1.00  0.77           C  
ATOM  11038  C   PHE B 531      49.401  31.634 101.959  1.00  0.77           C  
ATOM  11039  O   PHE B 531      49.483  32.270 100.908  1.00  0.77           O  
ATOM  11040  CB  PHE B 531      47.171  31.093 103.096  1.00  0.77           C  
ATOM  11041  CG  PHE B 531      46.604  32.404 102.630  1.00  0.77           C  
ATOM  11042  CD1 PHE B 531      45.872  32.496 101.438  1.00  0.77           C  
ATOM  11043  CD2 PHE B 531      46.886  33.574 103.344  1.00  0.77           C  
ATOM  11044  CE1 PHE B 531      45.433  33.739 100.962  1.00  0.77           C  
ATOM  11045  CE2 PHE B 531      46.447  34.812 102.870  1.00  0.77           C  
ATOM  11046  CZ  PHE B 531      45.712  34.902 101.685  1.00  0.77           C  
ATOM  11047  N   LEU B 532      50.314  31.843 102.927  1.00  0.82           N  
ATOM  11048  CA  LEU B 532      51.432  32.768 102.773  1.00  0.82           C  
ATOM  11049  C   LEU B 532      52.390  32.372 101.652  1.00  0.82           C  
ATOM  11050  O   LEU B 532      52.865  33.219 100.891  1.00  0.82           O  
ATOM  11051  CB  LEU B 532      52.175  32.978 104.109  1.00  0.82           C  
ATOM  11052  CG  LEU B 532      51.662  34.175 104.940  1.00  0.82           C  
ATOM  11053  CD1 LEU B 532      50.137  34.251 105.090  1.00  0.82           C  
ATOM  11054  CD2 LEU B 532      52.313  34.138 106.323  1.00  0.82           C  
ATOM  11055  N   ARG B 533      52.618  31.054 101.469  1.00  0.76           N  
ATOM  11056  CA  ARG B 533      53.281  30.468 100.318  1.00  0.76           C  
ATOM  11057  C   ARG B 533      52.618  30.852  99.004  1.00  0.76           C  
ATOM  11058  O   ARG B 533      53.316  31.133  98.030  1.00  0.76           O  
ATOM  11059  CB  ARG B 533      53.347  28.919 100.499  1.00  0.76           C  
ATOM  11060  CG  ARG B 533      53.752  28.035  99.292  1.00  0.76           C  
ATOM  11061  CD  ARG B 533      52.640  27.776  98.248  1.00  0.76           C  
ATOM  11062  NE  ARG B 533      53.158  26.885  97.152  1.00  0.76           N  
ATOM  11063  CZ  ARG B 533      54.064  27.248  96.231  1.00  0.76           C  
ATOM  11064  NH1 ARG B 533      54.671  28.429  96.262  1.00  0.76           N  
ATOM  11065  NH2 ARG B 533      54.367  26.399  95.249  1.00  0.76           N  
ATOM  11066  N   GLU B 534      51.267  30.858  98.910  1.00  0.81           N  
ATOM  11067  CA  GLU B 534      50.547  31.335  97.736  1.00  0.81           C  
ATOM  11068  C   GLU B 534      50.716  32.836  97.523  1.00  0.81           C  
ATOM  11069  O   GLU B 534      50.980  33.303  96.416  1.00  0.81           O  
ATOM  11070  CB  GLU B 534      49.027  31.057  97.834  1.00  0.81           C  
ATOM  11071  CG  GLU B 534      48.601  29.577  97.981  1.00  0.81           C  
ATOM  11072  CD  GLU B 534      47.104  29.499  98.246  1.00  0.81           C  
ATOM  11073  OE1 GLU B 534      46.352  28.932  97.424  1.00  0.81           O  
ATOM  11074  OE2 GLU B 534      46.643  30.048  99.275  1.00  0.81           O  
ATOM  11075  N   LEU B 535      50.599  33.624  98.609  1.00  0.88           N  
ATOM  11076  CA  LEU B 535      50.661  35.077  98.622  1.00  0.88           C  
ATOM  11077  C   LEU B 535      51.991  35.636  98.128  1.00  0.88           C  
ATOM  11078  O   LEU B 535      52.049  36.527  97.278  1.00  0.88           O  
ATOM  11079  CB  LEU B 535      50.368  35.532 100.074  1.00  0.88           C  
ATOM  11080  CG  LEU B 535      50.085  37.030 100.292  1.00  0.88           C  
ATOM  11081  CD1 LEU B 535      48.793  37.470  99.589  1.00  0.88           C  
ATOM  11082  CD2 LEU B 535      49.987  37.316 101.799  1.00  0.88           C  
ATOM  11083  N   ALA B 536      53.111  35.055  98.600  1.00  0.88           N  
ATOM  11084  CA  ALA B 536      54.443  35.337  98.101  1.00  0.88           C  
ATOM  11085  C   ALA B 536      54.646  34.917  96.646  1.00  0.88           C  
ATOM  11086  O   ALA B 536      55.311  35.596  95.865  1.00  0.88           O  
ATOM  11087  CB  ALA B 536      55.484  34.655  99.003  1.00  0.88           C  
ATOM  11088  N   LYS B 537      54.042  33.779  96.236  1.00  0.83           N  
ATOM  11089  CA  LYS B 537      54.077  33.287  94.867  1.00  0.83           C  
ATOM  11090  C   LYS B 537      53.433  34.253  93.891  1.00  0.83           C  
ATOM  11091  O   LYS B 537      54.013  34.566  92.860  1.00  0.83           O  
ATOM  11092  CB  LYS B 537      53.385  31.899  94.768  1.00  0.83           C  
ATOM  11093  CG  LYS B 537      54.120  30.850  93.918  1.00  0.83           C  
ATOM  11094  CD  LYS B 537      53.837  30.899  92.408  1.00  0.83           C  
ATOM  11095  CE  LYS B 537      52.439  30.404  92.016  1.00  0.83           C  
ATOM  11096  NZ  LYS B 537      52.337  30.253  90.553  1.00  0.83           N  
ATOM  11097  N   VAL B 538      52.253  34.811  94.238  1.00  0.89           N  
ATOM  11098  CA  VAL B 538      51.557  35.840  93.468  1.00  0.89           C  
ATOM  11099  C   VAL B 538      52.397  37.091  93.275  1.00  0.89           C  
ATOM  11100  O   VAL B 538      52.497  37.631  92.173  1.00  0.89           O  
ATOM  11101  CB  VAL B 538      50.243  36.212  94.151  1.00  0.89           C  
ATOM  11102  CG1 VAL B 538      49.630  37.508  93.584  1.00  0.89           C  
ATOM  11103  CG2 VAL B 538      49.247  35.051  93.970  1.00  0.89           C  
ATOM  11104  N   LYS B 539      53.079  37.556  94.341  1.00  0.89           N  
ATOM  11105  CA  LYS B 539      54.009  38.665  94.250  1.00  0.89           C  
ATOM  11106  C   LYS B 539      55.166  38.388  93.300  1.00  0.89           C  
ATOM  11107  O   LYS B 539      55.510  39.217  92.463  1.00  0.89           O  
ATOM  11108  CB  LYS B 539      54.560  38.998  95.657  1.00  0.89           C  
ATOM  11109  CG  LYS B 539      55.504  40.213  95.726  1.00  0.89           C  
ATOM  11110  CD  LYS B 539      54.891  41.541  95.248  1.00  0.89           C  
ATOM  11111  CE  LYS B 539      53.686  41.978  96.083  1.00  0.89           C  
ATOM  11112  NZ  LYS B 539      53.212  43.292  95.628  1.00  0.89           N  
ATOM  11113  N   GLN B 540      55.756  37.180  93.358  1.00  0.85           N  
ATOM  11114  CA  GLN B 540      56.786  36.754  92.428  1.00  0.85           C  
ATOM  11115  C   GLN B 540      56.334  36.660  90.966  1.00  0.85           C  
ATOM  11116  O   GLN B 540      57.051  37.093  90.070  1.00  0.85           O  
ATOM  11117  CB  GLN B 540      57.456  35.448  92.919  1.00  0.85           C  
ATOM  11118  CG  GLN B 540      58.792  35.106  92.211  1.00  0.85           C  
ATOM  11119  CD  GLN B 540      59.829  36.234  92.284  1.00  0.85           C  
ATOM  11120  OE1 GLN B 540      60.077  36.953  91.320  1.00  0.85           O  
ATOM  11121  NE2 GLN B 540      60.466  36.414  93.462  1.00  0.85           N  
ATOM  11122  N   GLU B 541      55.105  36.173  90.674  1.00  0.85           N  
ATOM  11123  CA  GLU B 541      54.525  36.203  89.328  1.00  0.85           C  
ATOM  11124  C   GLU B 541      54.428  37.617  88.764  1.00  0.85           C  
ATOM  11125  O   GLU B 541      54.773  37.914  87.619  1.00  0.85           O  
ATOM  11126  CB  GLU B 541      53.073  35.652  89.327  1.00  0.85           C  
ATOM  11127  CG  GLU B 541      52.930  34.181  89.781  1.00  0.85           C  
ATOM  11128  CD  GLU B 541      53.542  33.166  88.828  1.00  0.85           C  
ATOM  11129  OE1 GLU B 541      53.762  32.019  89.312  1.00  0.85           O  
ATOM  11130  OE2 GLU B 541      53.704  33.468  87.629  1.00  0.85           O  
ATOM  11131  N   ASN B 542      53.970  38.562  89.609  1.00  0.89           N  
ATOM  11132  CA  ASN B 542      53.886  39.968  89.265  1.00  0.89           C  
ATOM  11133  C   ASN B 542      55.269  40.575  89.009  1.00  0.89           C  
ATOM  11134  O   ASN B 542      55.478  41.315  88.048  1.00  0.89           O  
ATOM  11135  CB  ASN B 542      53.177  40.772  90.389  1.00  0.89           C  
ATOM  11136  CG  ASN B 542      51.732  40.363  90.701  1.00  0.89           C  
ATOM  11137  OD1 ASN B 542      51.154  40.869  91.663  1.00  0.89           O  
ATOM  11138  ND2 ASN B 542      51.107  39.472  89.902  1.00  0.89           N  
ATOM  11139  N   LYS B 543      56.256  40.233  89.861  1.00  0.88           N  
ATOM  11140  CA  LYS B 543      57.652  40.606  89.712  1.00  0.88           C  
ATOM  11141  C   LYS B 543      58.347  40.046  88.482  1.00  0.88           C  
ATOM  11142  O   LYS B 543      59.088  40.770  87.826  1.00  0.88           O  
ATOM  11143  CB  LYS B 543      58.462  40.251  90.980  1.00  0.88           C  
ATOM  11144  CG  LYS B 543      58.056  41.136  92.163  1.00  0.88           C  
ATOM  11145  CD  LYS B 543      58.595  40.694  93.532  1.00  0.88           C  
ATOM  11146  CE  LYS B 543      60.099  40.883  93.704  1.00  0.88           C  
ATOM  11147  NZ  LYS B 543      60.467  40.745  95.123  1.00  0.88           N  
ATOM  11148  N   LEU B 544      58.115  38.773  88.092  1.00  0.87           N  
ATOM  11149  CA  LEU B 544      58.623  38.220  86.838  1.00  0.87           C  
ATOM  11150  C   LEU B 544      58.139  38.993  85.616  1.00  0.87           C  
ATOM  11151  O   LEU B 544      58.932  39.384  84.760  1.00  0.87           O  
ATOM  11152  CB  LEU B 544      58.205  36.735  86.639  1.00  0.87           C  
ATOM  11153  CG  LEU B 544      59.306  35.707  86.967  1.00  0.87           C  
ATOM  11154  CD1 LEU B 544      59.384  35.419  88.466  1.00  0.87           C  
ATOM  11155  CD2 LEU B 544      59.068  34.401  86.195  1.00  0.87           C  
ATOM  11156  N   LYS B 545      56.825  39.294  85.542  1.00  0.81           N  
ATOM  11157  CA  LYS B 545      56.247  40.091  84.471  1.00  0.81           C  
ATOM  11158  C   LYS B 545      56.824  41.502  84.417  1.00  0.81           C  
ATOM  11159  O   LYS B 545      57.177  42.015  83.354  1.00  0.81           O  
ATOM  11160  CB  LYS B 545      54.703  40.155  84.633  1.00  0.81           C  
ATOM  11161  CG  LYS B 545      53.968  40.865  83.479  1.00  0.81           C  
ATOM  11162  CD  LYS B 545      52.478  41.126  83.775  1.00  0.81           C  
ATOM  11163  CE  LYS B 545      51.809  41.967  82.676  1.00  0.81           C  
ATOM  11164  NZ  LYS B 545      50.385  42.239  82.981  1.00  0.81           N  
ATOM  11165  N   PHE B 546      56.971  42.172  85.578  1.00  0.86           N  
ATOM  11166  CA  PHE B 546      57.577  43.488  85.632  1.00  0.86           C  
ATOM  11167  C   PHE B 546      59.079  43.494  85.324  1.00  0.86           C  
ATOM  11168  O   PHE B 546      59.573  44.405  84.666  1.00  0.86           O  
ATOM  11169  CB  PHE B 546      57.202  44.218  86.946  1.00  0.86           C  
ATOM  11170  CG  PHE B 546      57.331  45.710  86.776  1.00  0.86           C  
ATOM  11171  CD1 PHE B 546      56.452  46.398  85.920  1.00  0.86           C  
ATOM  11172  CD2 PHE B 546      58.351  46.428  87.419  1.00  0.86           C  
ATOM  11173  CE1 PHE B 546      56.616  47.767  85.675  1.00  0.86           C  
ATOM  11174  CE2 PHE B 546      58.517  47.799  87.176  1.00  0.86           C  
ATOM  11175  CZ  PHE B 546      57.656  48.465  86.297  1.00  0.86           C  
ATOM  11176  N   SER B 547      59.842  42.445  85.709  1.00  0.83           N  
ATOM  11177  CA  SER B 547      61.236  42.262  85.298  1.00  0.83           C  
ATOM  11178  C   SER B 547      61.386  42.221  83.795  1.00  0.83           C  
ATOM  11179  O   SER B 547      62.263  42.875  83.242  1.00  0.83           O  
ATOM  11180  CB  SER B 547      61.874  40.946  85.817  1.00  0.83           C  
ATOM  11181  OG  SER B 547      62.053  40.996  87.228  1.00  0.83           O  
ATOM  11182  N   GLN B 548      60.487  41.509  83.079  1.00  0.77           N  
ATOM  11183  CA  GLN B 548      60.468  41.506  81.623  1.00  0.77           C  
ATOM  11184  C   GLN B 548      60.236  42.886  81.031  1.00  0.77           C  
ATOM  11185  O   GLN B 548      60.918  43.290  80.095  1.00  0.77           O  
ATOM  11186  CB  GLN B 548      59.368  40.578  81.051  1.00  0.77           C  
ATOM  11187  CG  GLN B 548      59.543  39.085  81.406  1.00  0.77           C  
ATOM  11188  CD  GLN B 548      58.358  38.231  80.947  1.00  0.77           C  
ATOM  11189  OE1 GLN B 548      57.988  37.247  81.584  1.00  0.77           O  
ATOM  11190  NE2 GLN B 548      57.731  38.608  79.809  1.00  0.77           N  
ATOM  11191  N   PHE B 549      59.292  43.667  81.600  1.00  0.81           N  
ATOM  11192  CA  PHE B 549      59.053  45.044  81.198  1.00  0.81           C  
ATOM  11193  C   PHE B 549      60.305  45.903  81.386  1.00  0.81           C  
ATOM  11194  O   PHE B 549      60.736  46.619  80.488  1.00  0.81           O  
ATOM  11195  CB  PHE B 549      57.852  45.596  82.023  1.00  0.81           C  
ATOM  11196  CG  PHE B 549      57.508  47.023  81.692  1.00  0.81           C  
ATOM  11197  CD1 PHE B 549      56.716  47.331  80.576  1.00  0.81           C  
ATOM  11198  CD2 PHE B 549      58.009  48.069  82.486  1.00  0.81           C  
ATOM  11199  CE1 PHE B 549      56.442  48.665  80.247  1.00  0.81           C  
ATOM  11200  CE2 PHE B 549      57.741  49.403  82.159  1.00  0.81           C  
ATOM  11201  CZ  PHE B 549      56.960  49.701  81.035  1.00  0.81           C  
ATOM  11202  N   LEU B 550      60.966  45.786  82.549  1.00  0.79           N  
ATOM  11203  CA  LEU B 550      62.210  46.468  82.829  1.00  0.79           C  
ATOM  11204  C   LEU B 550      63.381  46.068  81.928  1.00  0.79           C  
ATOM  11205  O   LEU B 550      64.084  46.939  81.412  1.00  0.79           O  
ATOM  11206  CB  LEU B 550      62.588  46.262  84.310  1.00  0.79           C  
ATOM  11207  CG  LEU B 550      61.655  46.957  85.323  1.00  0.79           C  
ATOM  11208  CD1 LEU B 550      61.924  46.422  86.737  1.00  0.79           C  
ATOM  11209  CD2 LEU B 550      61.828  48.479  85.291  1.00  0.79           C  
ATOM  11210  N   GLU B 551      63.606  44.759  81.667  1.00  0.74           N  
ATOM  11211  CA  GLU B 551      64.633  44.303  80.734  1.00  0.74           C  
ATOM  11212  C   GLU B 551      64.380  44.784  79.305  1.00  0.74           C  
ATOM  11213  O   GLU B 551      65.275  45.333  78.661  1.00  0.74           O  
ATOM  11214  CB  GLU B 551      64.864  42.758  80.789  1.00  0.74           C  
ATOM  11215  CG  GLU B 551      65.507  42.322  82.134  1.00  0.74           C  
ATOM  11216  CD  GLU B 551      66.051  40.906  82.245  1.00  0.74           C  
ATOM  11217  OE1 GLU B 551      66.295  40.178  81.253  1.00  0.74           O  
ATOM  11218  OE2 GLU B 551      66.349  40.526  83.413  1.00  0.74           O  
ATOM  11219  N   THR B 552      63.136  44.673  78.791  1.00  0.75           N  
ATOM  11220  CA  THR B 552      62.765  45.168  77.462  1.00  0.75           C  
ATOM  11221  C   THR B 552      62.859  46.672  77.313  1.00  0.75           C  
ATOM  11222  O   THR B 552      63.531  47.172  76.408  1.00  0.75           O  
ATOM  11223  CB  THR B 552      61.344  44.762  77.083  1.00  0.75           C  
ATOM  11224  OG1 THR B 552      61.265  43.346  77.007  1.00  0.75           O  
ATOM  11225  CG2 THR B 552      60.915  45.293  75.706  1.00  0.75           C  
ATOM  11226  N   GLU B 553      62.238  47.459  78.213  1.00  0.74           N  
ATOM  11227  CA  GLU B 553      62.233  48.907  78.093  1.00  0.74           C  
ATOM  11228  C   GLU B 553      63.569  49.556  78.417  1.00  0.74           C  
ATOM  11229  O   GLU B 553      64.047  50.412  77.670  1.00  0.74           O  
ATOM  11230  CB  GLU B 553      61.052  49.547  78.870  1.00  0.74           C  
ATOM  11231  CG  GLU B 553      59.948  50.139  77.950  1.00  0.74           C  
ATOM  11232  CD  GLU B 553      59.294  49.112  77.023  1.00  0.74           C  
ATOM  11233  OE1 GLU B 553      59.934  48.755  75.999  1.00  0.74           O  
ATOM  11234  OE2 GLU B 553      58.141  48.708  77.317  1.00  0.74           O  
ATOM  11235  N   TYR B 554      64.262  49.134  79.492  1.00  0.73           N  
ATOM  11236  CA  TYR B 554      65.430  49.862  79.964  1.00  0.73           C  
ATOM  11237  C   TYR B 554      66.754  49.202  79.634  1.00  0.73           C  
ATOM  11238  O   TYR B 554      67.788  49.856  79.723  1.00  0.73           O  
ATOM  11239  CB  TYR B 554      65.353  50.041  81.505  1.00  0.73           C  
ATOM  11240  CG  TYR B 554      64.198  50.949  81.838  1.00  0.73           C  
ATOM  11241  CD1 TYR B 554      62.916  50.431  82.094  1.00  0.73           C  
ATOM  11242  CD2 TYR B 554      64.368  52.342  81.799  1.00  0.73           C  
ATOM  11243  CE1 TYR B 554      61.812  51.284  82.228  1.00  0.73           C  
ATOM  11244  CE2 TYR B 554      63.264  53.200  81.929  1.00  0.73           C  
ATOM  11245  CZ  TYR B 554      61.985  52.664  82.112  1.00  0.73           C  
ATOM  11246  OH  TYR B 554      60.850  53.494  82.102  1.00  0.73           O  
ATOM  11247  N   LYS B 555      66.768  47.919  79.208  1.00  0.69           N  
ATOM  11248  CA  LYS B 555      67.989  47.173  78.889  1.00  0.69           C  
ATOM  11249  C   LYS B 555      68.916  47.020  80.100  1.00  0.69           C  
ATOM  11250  O   LYS B 555      70.140  47.080  80.013  1.00  0.69           O  
ATOM  11251  CB  LYS B 555      68.747  47.722  77.640  1.00  0.69           C  
ATOM  11252  CG  LYS B 555      68.251  47.207  76.272  1.00  0.69           C  
ATOM  11253  CD  LYS B 555      66.787  47.515  75.908  1.00  0.69           C  
ATOM  11254  CE  LYS B 555      66.453  49.005  75.782  1.00  0.69           C  
ATOM  11255  NZ  LYS B 555      65.029  49.163  75.428  1.00  0.69           N  
ATOM  11256  N   VAL B 556      68.323  46.777  81.280  1.00  0.74           N  
ATOM  11257  CA  VAL B 556      69.041  46.630  82.532  1.00  0.74           C  
ATOM  11258  C   VAL B 556      68.724  45.265  83.083  1.00  0.74           C  
ATOM  11259  O   VAL B 556      67.562  44.910  83.240  1.00  0.74           O  
ATOM  11260  CB  VAL B 556      68.623  47.690  83.551  1.00  0.74           C  
ATOM  11261  CG1 VAL B 556      69.168  47.384  84.959  1.00  0.74           C  
ATOM  11262  CG2 VAL B 556      69.142  49.063  83.091  1.00  0.74           C  
ATOM  11263  N   LYS B 557      69.751  44.440  83.399  1.00  0.71           N  
ATOM  11264  CA  LYS B 557      69.515  43.123  83.959  1.00  0.71           C  
ATOM  11265  C   LYS B 557      68.952  43.177  85.368  1.00  0.71           C  
ATOM  11266  O   LYS B 557      69.641  43.577  86.316  1.00  0.71           O  
ATOM  11267  CB  LYS B 557      70.787  42.225  83.935  1.00  0.71           C  
ATOM  11268  CG  LYS B 557      70.530  40.743  84.288  1.00  0.71           C  
ATOM  11269  CD  LYS B 557      69.608  40.081  83.247  1.00  0.71           C  
ATOM  11270  CE  LYS B 557      69.028  38.720  83.638  1.00  0.71           C  
ATOM  11271  NZ  LYS B 557      67.847  38.453  82.795  1.00  0.71           N  
ATOM  11272  N   ILE B 558      67.682  42.764  85.519  1.00  0.82           N  
ATOM  11273  CA  ILE B 558      66.964  42.771  86.776  1.00  0.82           C  
ATOM  11274  C   ILE B 558      67.147  41.434  87.476  1.00  0.82           C  
ATOM  11275  O   ILE B 558      67.294  40.379  86.864  1.00  0.82           O  
ATOM  11276  CB  ILE B 558      65.486  43.117  86.575  1.00  0.82           C  
ATOM  11277  CG1 ILE B 558      65.317  44.469  85.842  1.00  0.82           C  
ATOM  11278  CG2 ILE B 558      64.681  43.145  87.895  1.00  0.82           C  
ATOM  11279  CD1 ILE B 558      65.902  45.698  86.555  1.00  0.82           C  
ATOM  11280  N   ASN B 559      67.187  41.447  88.819  1.00  0.85           N  
ATOM  11281  CA  ASN B 559      67.214  40.243  89.616  1.00  0.85           C  
ATOM  11282  C   ASN B 559      65.770  39.981  90.067  1.00  0.85           C  
ATOM  11283  O   ASN B 559      65.211  40.855  90.725  1.00  0.85           O  
ATOM  11284  CB  ASN B 559      68.214  40.475  90.782  1.00  0.85           C  
ATOM  11285  CG  ASN B 559      68.323  39.314  91.767  1.00  0.85           C  
ATOM  11286  OD1 ASN B 559      67.518  38.385  91.810  1.00  0.85           O  
ATOM  11287  ND2 ASN B 559      69.367  39.384  92.621  1.00  0.85           N  
ATOM  11288  N   PRO B 560      65.095  38.871  89.772  1.00  0.88           N  
ATOM  11289  CA  PRO B 560      63.700  38.681  90.181  1.00  0.88           C  
ATOM  11290  C   PRO B 560      63.535  38.428  91.672  1.00  0.88           C  
ATOM  11291  O   PRO B 560      62.478  38.702  92.234  1.00  0.88           O  
ATOM  11292  CB  PRO B 560      63.236  37.470  89.354  1.00  0.88           C  
ATOM  11293  CG  PRO B 560      64.144  37.490  88.123  1.00  0.88           C  
ATOM  11294  CD  PRO B 560      65.479  37.938  88.708  1.00  0.88           C  
ATOM  11295  N   SER B 561      64.566  37.892  92.349  1.00  0.88           N  
ATOM  11296  CA  SER B 561      64.510  37.570  93.773  1.00  0.88           C  
ATOM  11297  C   SER B 561      64.747  38.799  94.631  1.00  0.88           C  
ATOM  11298  O   SER B 561      64.474  38.822  95.832  1.00  0.88           O  
ATOM  11299  CB  SER B 561      65.572  36.510  94.152  1.00  0.88           C  
ATOM  11300  OG  SER B 561      65.297  35.283  93.479  1.00  0.88           O  
ATOM  11301  N   SER B 562      65.244  39.868  93.980  1.00  0.91           N  
ATOM  11302  CA  SER B 562      65.434  41.223  94.481  1.00  0.91           C  
ATOM  11303  C   SER B 562      64.215  41.827  95.149  1.00  0.91           C  
ATOM  11304  O   SER B 562      63.086  41.456  94.840  1.00  0.91           O  
ATOM  11305  CB  SER B 562      65.795  42.146  93.303  1.00  0.91           C  
ATOM  11306  OG  SER B 562      66.405  43.359  93.705  1.00  0.91           O  
ATOM  11307  N   MET B 563      64.386  42.785  96.080  1.00  0.91           N  
ATOM  11308  CA  MET B 563      63.271  43.366  96.810  1.00  0.91           C  
ATOM  11309  C   MET B 563      62.189  44.011  95.957  1.00  0.91           C  
ATOM  11310  O   MET B 563      61.040  43.619  96.057  1.00  0.91           O  
ATOM  11311  CB  MET B 563      63.794  44.388  97.849  1.00  0.91           C  
ATOM  11312  CG  MET B 563      62.711  44.930  98.808  1.00  0.91           C  
ATOM  11313  SD  MET B 563      63.305  46.184  99.981  1.00  0.91           S  
ATOM  11314  CE  MET B 563      64.109  45.042 101.139  1.00  0.91           C  
ATOM  11315  N   PHE B 564      62.532  44.954  95.059  1.00  0.93           N  
ATOM  11316  CA  PHE B 564      61.570  45.812  94.361  1.00  0.93           C  
ATOM  11317  C   PHE B 564      61.067  46.883  95.313  1.00  0.93           C  
ATOM  11318  O   PHE B 564      60.018  46.790  95.956  1.00  0.93           O  
ATOM  11319  CB  PHE B 564      60.390  45.152  93.586  1.00  0.93           C  
ATOM  11320  CG  PHE B 564      60.781  44.446  92.313  1.00  0.93           C  
ATOM  11321  CD1 PHE B 564      61.989  43.739  92.142  1.00  0.93           C  
ATOM  11322  CD2 PHE B 564      59.853  44.449  91.256  1.00  0.93           C  
ATOM  11323  CE1 PHE B 564      62.253  43.050  90.953  1.00  0.93           C  
ATOM  11324  CE2 PHE B 564      60.118  43.770  90.065  1.00  0.93           C  
ATOM  11325  CZ  PHE B 564      61.317  43.070  89.918  1.00  0.93           C  
ATOM  11326  N   ASP B 565      61.894  47.926  95.397  1.00  0.96           N  
ATOM  11327  CA  ASP B 565      61.857  49.045  96.287  1.00  0.96           C  
ATOM  11328  C   ASP B 565      61.432  50.220  95.423  1.00  0.96           C  
ATOM  11329  O   ASP B 565      62.160  50.607  94.509  1.00  0.96           O  
ATOM  11330  CB  ASP B 565      63.329  49.103  96.778  1.00  0.96           C  
ATOM  11331  CG  ASP B 565      63.643  50.193  97.767  1.00  0.96           C  
ATOM  11332  OD1 ASP B 565      62.768  51.033  98.040  1.00  0.96           O  
ATOM  11333  OD2 ASP B 565      64.795  50.158  98.277  1.00  0.96           O  
ATOM  11334  N   VAL B 566      60.196  50.751  95.591  1.00  0.97           N  
ATOM  11335  CA  VAL B 566      59.679  51.726  94.637  1.00  0.97           C  
ATOM  11336  C   VAL B 566      59.140  52.994  95.249  1.00  0.97           C  
ATOM  11337  O   VAL B 566      58.397  53.023  96.233  1.00  0.97           O  
ATOM  11338  CB  VAL B 566      58.724  51.214  93.540  1.00  0.97           C  
ATOM  11339  CG1 VAL B 566      58.988  49.727  93.232  1.00  0.97           C  
ATOM  11340  CG2 VAL B 566      57.234  51.475  93.845  1.00  0.97           C  
ATOM  11341  N   GLN B 567      59.482  54.109  94.588  1.00  0.94           N  
ATOM  11342  CA  GLN B 567      59.003  55.417  94.917  1.00  0.94           C  
ATOM  11343  C   GLN B 567      58.471  56.083  93.671  1.00  0.94           C  
ATOM  11344  O   GLN B 567      59.213  56.634  92.862  1.00  0.94           O  
ATOM  11345  CB  GLN B 567      60.177  56.238  95.460  1.00  0.94           C  
ATOM  11346  CG  GLN B 567      59.747  57.560  96.126  1.00  0.94           C  
ATOM  11347  CD  GLN B 567      60.931  58.298  96.732  1.00  0.94           C  
ATOM  11348  OE1 GLN B 567      60.789  59.240  97.513  1.00  0.94           O  
ATOM  11349  NE2 GLN B 567      62.155  57.889  96.342  1.00  0.94           N  
ATOM  11350  N   VAL B 568      57.143  56.064  93.486  1.00  0.95           N  
ATOM  11351  CA  VAL B 568      56.529  56.671  92.321  1.00  0.95           C  
ATOM  11352  C   VAL B 568      55.538  57.742  92.752  1.00  0.95           C  
ATOM  11353  O   VAL B 568      54.724  57.529  93.661  1.00  0.95           O  
ATOM  11354  CB  VAL B 568      55.933  55.660  91.350  1.00  0.95           C  
ATOM  11355  CG1 VAL B 568      57.058  54.855  90.671  1.00  0.95           C  
ATOM  11356  CG2 VAL B 568      54.999  54.686  92.074  1.00  0.95           C  
ATOM  11357  N   LYS B 569      55.654  58.949  92.141  1.00  0.85           N  
ATOM  11358  CA  LYS B 569      54.988  60.202  92.507  1.00  0.85           C  
ATOM  11359  C   LYS B 569      55.708  61.380  91.855  1.00  0.85           C  
ATOM  11360  O   LYS B 569      56.815  61.235  91.361  1.00  0.85           O  
ATOM  11361  CB  LYS B 569      54.908  60.478  94.039  1.00  0.85           C  
ATOM  11362  CG  LYS B 569      56.282  60.493  94.732  1.00  0.85           C  
ATOM  11363  CD  LYS B 569      56.249  60.211  96.245  1.00  0.85           C  
ATOM  11364  CE  LYS B 569      56.289  58.728  96.648  1.00  0.85           C  
ATOM  11365  NZ  LYS B 569      55.000  58.037  96.448  1.00  0.85           N  
ATOM  11366  N   ARG B 570      55.091  62.587  91.786  1.00  0.80           N  
ATOM  11367  CA  ARG B 570      55.731  63.767  91.205  1.00  0.80           C  
ATOM  11368  C   ARG B 570      57.048  64.184  91.861  1.00  0.80           C  
ATOM  11369  O   ARG B 570      57.201  64.149  93.083  1.00  0.80           O  
ATOM  11370  CB  ARG B 570      54.787  65.003  91.139  1.00  0.80           C  
ATOM  11371  CG  ARG B 570      54.252  65.540  92.490  1.00  0.80           C  
ATOM  11372  CD  ARG B 570      53.828  67.013  92.376  1.00  0.80           C  
ATOM  11373  NE  ARG B 570      53.031  67.410  93.587  1.00  0.80           N  
ATOM  11374  CZ  ARG B 570      52.614  68.666  93.808  1.00  0.80           C  
ATOM  11375  NH1 ARG B 570      53.065  69.687  93.089  1.00  0.80           N  
ATOM  11376  NH2 ARG B 570      51.752  68.909  94.794  1.00  0.80           N  
ATOM  11377  N   ILE B 571      58.027  64.620  91.042  1.00  0.89           N  
ATOM  11378  CA  ILE B 571      59.349  64.978  91.525  1.00  0.89           C  
ATOM  11379  C   ILE B 571      59.307  66.369  92.136  1.00  0.89           C  
ATOM  11380  O   ILE B 571      58.954  67.362  91.499  1.00  0.89           O  
ATOM  11381  CB  ILE B 571      60.435  64.889  90.458  1.00  0.89           C  
ATOM  11382  CG1 ILE B 571      60.387  63.546  89.686  1.00  0.89           C  
ATOM  11383  CG2 ILE B 571      61.823  65.105  91.102  1.00  0.89           C  
ATOM  11384  CD1 ILE B 571      60.555  62.280  90.536  1.00  0.89           C  
ATOM  11385  N   HIS B 572      59.619  66.454  93.438  1.00  0.87           N  
ATOM  11386  CA  HIS B 572      59.481  67.669  94.205  1.00  0.87           C  
ATOM  11387  C   HIS B 572      60.336  67.512  95.446  1.00  0.87           C  
ATOM  11388  O   HIS B 572      60.518  66.399  95.929  1.00  0.87           O  
ATOM  11389  CB  HIS B 572      57.990  67.875  94.603  1.00  0.87           C  
ATOM  11390  CG  HIS B 572      57.517  69.299  94.595  1.00  0.87           C  
ATOM  11391  ND1 HIS B 572      58.076  70.210  95.464  1.00  0.87           N  
ATOM  11392  CD2 HIS B 572      56.586  69.914  93.815  1.00  0.87           C  
ATOM  11393  CE1 HIS B 572      57.478  71.359  95.208  1.00  0.87           C  
ATOM  11394  NE2 HIS B 572      56.567  71.235  94.213  1.00  0.87           N  
ATOM  11395  N   GLU B 573      60.875  68.600  96.017  1.00  0.89           N  
ATOM  11396  CA  GLU B 573      61.711  68.544  97.203  1.00  0.89           C  
ATOM  11397  C   GLU B 573      61.029  67.998  98.458  1.00  0.89           C  
ATOM  11398  O   GLU B 573      61.605  67.193  99.189  1.00  0.89           O  
ATOM  11399  CB  GLU B 573      62.277  69.946  97.499  1.00  0.89           C  
ATOM  11400  CG  GLU B 573      63.263  70.462  96.426  1.00  0.89           C  
ATOM  11401  CD  GLU B 573      63.639  71.916  96.693  1.00  0.89           C  
ATOM  11402  OE1 GLU B 573      64.131  72.196  97.814  1.00  0.89           O  
ATOM  11403  OE2 GLU B 573      63.441  72.750  95.772  1.00  0.89           O  
ATOM  11404  N   TYR B 574      59.758  68.381  98.732  1.00  0.83           N  
ATOM  11405  CA  TYR B 574      59.017  67.890  99.896  1.00  0.83           C  
ATOM  11406  C   TYR B 574      58.775  66.392  99.901  1.00  0.83           C  
ATOM  11407  O   TYR B 574      58.886  65.735 100.932  1.00  0.83           O  
ATOM  11408  CB  TYR B 574      57.698  68.668 100.168  1.00  0.83           C  
ATOM  11409  CG  TYR B 574      56.528  68.310  99.288  1.00  0.83           C  
ATOM  11410  CD1 TYR B 574      55.521  67.432  99.727  1.00  0.83           C  
ATOM  11411  CD2 TYR B 574      56.407  68.897  98.026  1.00  0.83           C  
ATOM  11412  CE1 TYR B 574      54.413  67.151  98.916  1.00  0.83           C  
ATOM  11413  CE2 TYR B 574      55.306  68.617  97.206  1.00  0.83           C  
ATOM  11414  CZ  TYR B 574      54.313  67.740  97.656  1.00  0.83           C  
ATOM  11415  OH  TYR B 574      53.205  67.492  96.829  1.00  0.83           O  
ATOM  11416  N   LYS B 575      58.522  65.833  98.698  1.00  0.86           N  
ATOM  11417  CA  LYS B 575      58.321  64.421  98.435  1.00  0.86           C  
ATOM  11418  C   LYS B 575      59.573  63.603  98.680  1.00  0.86           C  
ATOM  11419  O   LYS B 575      59.529  62.376  98.722  1.00  0.86           O  
ATOM  11420  CB  LYS B 575      57.935  64.211  96.944  1.00  0.86           C  
ATOM  11421  CG  LYS B 575      56.521  64.668  96.557  1.00  0.86           C  
ATOM  11422  CD  LYS B 575      55.445  63.863  97.296  1.00  0.86           C  
ATOM  11423  CE  LYS B 575      54.019  64.110  96.807  1.00  0.86           C  
ATOM  11424  NZ  LYS B 575      53.078  63.512  97.760  1.00  0.86           N  
ATOM  11425  N   ARG B 576      60.719  64.293  98.834  1.00  0.84           N  
ATOM  11426  CA  ARG B 576      62.034  63.736  98.991  1.00  0.84           C  
ATOM  11427  C   ARG B 576      62.560  63.175  97.681  1.00  0.84           C  
ATOM  11428  O   ARG B 576      63.027  63.942  96.842  1.00  0.84           O  
ATOM  11429  CB  ARG B 576      62.185  62.794 100.224  1.00  0.84           C  
ATOM  11430  CG  ARG B 576      62.683  63.463 101.525  1.00  0.84           C  
ATOM  11431  CD  ARG B 576      61.674  64.365 102.242  1.00  0.84           C  
ATOM  11432  NE  ARG B 576      62.339  64.872 103.495  1.00  0.84           N  
ATOM  11433  CZ  ARG B 576      62.344  64.265 104.690  1.00  0.84           C  
ATOM  11434  NH1 ARG B 576      61.813  63.074 104.926  1.00  0.84           N  
ATOM  11435  NH2 ARG B 576      62.909  64.885 105.723  1.00  0.84           N  
ATOM  11436  N   GLN B 577      62.608  61.833  97.516  1.00  0.89           N  
ATOM  11437  CA  GLN B 577      63.332  61.073  96.492  1.00  0.89           C  
ATOM  11438  C   GLN B 577      64.838  61.286  96.399  1.00  0.89           C  
ATOM  11439  O   GLN B 577      65.601  60.359  96.140  1.00  0.89           O  
ATOM  11440  CB  GLN B 577      62.656  60.918  95.102  1.00  0.89           C  
ATOM  11441  CG  GLN B 577      62.414  62.186  94.259  1.00  0.89           C  
ATOM  11442  CD  GLN B 577      60.936  62.570  94.289  1.00  0.89           C  
ATOM  11443  OE1 GLN B 577      60.070  61.826  93.833  1.00  0.89           O  
ATOM  11444  NE2 GLN B 577      60.611  63.756  94.836  1.00  0.89           N  
ATOM  11445  N   LEU B 578      65.311  62.489  96.750  1.00  0.92           N  
ATOM  11446  CA  LEU B 578      66.676  62.853  97.029  1.00  0.92           C  
ATOM  11447  C   LEU B 578      67.201  62.061  98.220  1.00  0.92           C  
ATOM  11448  O   LEU B 578      68.276  61.476  98.178  1.00  0.92           O  
ATOM  11449  CB  LEU B 578      66.686  64.368  97.335  1.00  0.92           C  
ATOM  11450  CG  LEU B 578      67.916  65.140  96.836  1.00  0.92           C  
ATOM  11451  CD1 LEU B 578      67.727  66.614  97.212  1.00  0.92           C  
ATOM  11452  CD2 LEU B 578      69.253  64.606  97.367  1.00  0.92           C  
ATOM  11453  N   LEU B 579      66.381  61.951  99.292  1.00  0.94           N  
ATOM  11454  CA  LEU B 579      66.656  61.139 100.471  1.00  0.94           C  
ATOM  11455  C   LEU B 579      66.821  59.657 100.150  1.00  0.94           C  
ATOM  11456  O   LEU B 579      67.752  59.004 100.619  1.00  0.94           O  
ATOM  11457  CB  LEU B 579      65.530  61.347 101.516  1.00  0.94           C  
ATOM  11458  CG  LEU B 579      65.675  60.579 102.845  1.00  0.94           C  
ATOM  11459  CD1 LEU B 579      67.000  60.878 103.550  1.00  0.94           C  
ATOM  11460  CD2 LEU B 579      64.511  60.892 103.797  1.00  0.94           C  
ATOM  11461  N   ASN B 580      65.953  59.107  99.271  1.00  0.94           N  
ATOM  11462  CA  ASN B 580      66.086  57.761  98.734  1.00  0.94           C  
ATOM  11463  C   ASN B 580      67.363  57.599  97.948  1.00  0.94           C  
ATOM  11464  O   ASN B 580      68.105  56.654  98.164  1.00  0.94           O  
ATOM  11465  CB  ASN B 580      64.851  57.415  97.869  1.00  0.94           C  
ATOM  11466  CG  ASN B 580      64.757  55.977  97.333  1.00  0.94           C  
ATOM  11467  OD1 ASN B 580      64.163  55.804  96.270  1.00  0.94           O  
ATOM  11468  ND2 ASN B 580      65.327  54.967  98.009  1.00  0.94           N  
ATOM  11469  N   CYS B 581      67.701  58.569  97.084  1.00  0.95           N  
ATOM  11470  CA  CYS B 581      68.952  58.562  96.352  1.00  0.95           C  
ATOM  11471  C   CYS B 581      70.196  58.610  97.236  1.00  0.95           C  
ATOM  11472  O   CYS B 581      71.169  57.913  96.966  1.00  0.95           O  
ATOM  11473  CB  CYS B 581      69.000  59.658  95.266  1.00  0.95           C  
ATOM  11474  SG  CYS B 581      70.059  59.117  93.878  1.00  0.95           S  
ATOM  11475  N   LEU B 582      70.184  59.363  98.364  1.00  0.94           N  
ATOM  11476  CA  LEU B 582      71.240  59.276  99.369  1.00  0.94           C  
ATOM  11477  C   LEU B 582      71.409  57.860  99.898  1.00  0.94           C  
ATOM  11478  O   LEU B 582      72.511  57.326  99.928  1.00  0.94           O  
ATOM  11479  CB  LEU B 582      70.969  60.163 100.618  1.00  0.94           C  
ATOM  11480  CG  LEU B 582      70.865  61.682 100.395  1.00  0.94           C  
ATOM  11481  CD1 LEU B 582      70.615  62.385 101.739  1.00  0.94           C  
ATOM  11482  CD2 LEU B 582      72.117  62.259  99.730  1.00  0.94           C  
ATOM  11483  N   HIS B 583      70.298  57.184 100.253  1.00  0.93           N  
ATOM  11484  CA  HIS B 583      70.319  55.791 100.664  1.00  0.93           C  
ATOM  11485  C   HIS B 583      70.807  54.828  99.589  1.00  0.93           C  
ATOM  11486  O   HIS B 583      71.573  53.915  99.880  1.00  0.93           O  
ATOM  11487  CB  HIS B 583      68.941  55.353 101.192  1.00  0.93           C  
ATOM  11488  CG  HIS B 583      68.883  53.933 101.665  1.00  0.93           C  
ATOM  11489  ND1 HIS B 583      68.099  53.036 100.977  1.00  0.93           N  
ATOM  11490  CD2 HIS B 583      69.539  53.306 102.672  1.00  0.93           C  
ATOM  11491  CE1 HIS B 583      68.290  51.878 101.570  1.00  0.93           C  
ATOM  11492  NE2 HIS B 583      69.157  51.984 102.608  1.00  0.93           N  
ATOM  11493  N   VAL B 584      70.428  55.027  98.312  1.00  0.96           N  
ATOM  11494  CA  VAL B 584      70.933  54.259  97.179  1.00  0.96           C  
ATOM  11495  C   VAL B 584      72.442  54.375  97.031  1.00  0.96           C  
ATOM  11496  O   VAL B 584      73.146  53.373  96.891  1.00  0.96           O  
ATOM  11497  CB  VAL B 584      70.271  54.707  95.880  1.00  0.96           C  
ATOM  11498  CG1 VAL B 584      70.852  53.976  94.658  1.00  0.96           C  
ATOM  11499  CG2 VAL B 584      68.767  54.408  95.944  1.00  0.96           C  
ATOM  11500  N   ILE B 585      72.995  55.603  97.123  1.00  0.94           N  
ATOM  11501  CA  ILE B 585      74.434  55.821  97.114  1.00  0.94           C  
ATOM  11502  C   ILE B 585      75.100  55.176  98.331  1.00  0.94           C  
ATOM  11503  O   ILE B 585      76.124  54.509  98.215  1.00  0.94           O  
ATOM  11504  CB  ILE B 585      74.803  57.297  97.004  1.00  0.94           C  
ATOM  11505  CG1 ILE B 585      74.202  57.933  95.728  1.00  0.94           C  
ATOM  11506  CG2 ILE B 585      76.338  57.445  96.967  1.00  0.94           C  
ATOM  11507  CD1 ILE B 585      74.318  59.462  95.703  1.00  0.94           C  
ATOM  11508  N   THR B 586      74.501  55.291  99.533  1.00  0.93           N  
ATOM  11509  CA  THR B 586      74.953  54.620 100.755  1.00  0.93           C  
ATOM  11510  C   THR B 586      74.984  53.114 100.635  1.00  0.93           C  
ATOM  11511  O   THR B 586      75.969  52.468 100.980  1.00  0.93           O  
ATOM  11512  CB  THR B 586      74.088  54.971 101.955  1.00  0.93           C  
ATOM  11513  OG1 THR B 586      74.173  56.367 102.148  1.00  0.93           O  
ATOM  11514  CG2 THR B 586      74.568  54.300 103.248  1.00  0.93           C  
ATOM  11515  N   MET B 587      73.933  52.495 100.071  1.00  0.90           N  
ATOM  11516  CA  MET B 587      73.897  51.077  99.775  1.00  0.90           C  
ATOM  11517  C   MET B 587      74.969  50.640  98.798  1.00  0.90           C  
ATOM  11518  O   MET B 587      75.627  49.625  99.017  1.00  0.90           O  
ATOM  11519  CB  MET B 587      72.522  50.677  99.210  1.00  0.90           C  
ATOM  11520  CG  MET B 587      71.437  50.589 100.293  1.00  0.90           C  
ATOM  11521  SD  MET B 587      69.962  49.683  99.753  1.00  0.90           S  
ATOM  11522  CE  MET B 587      69.428  50.842  98.460  1.00  0.90           C  
ATOM  11523  N   TYR B 588      75.202  51.428  97.733  1.00  0.91           N  
ATOM  11524  CA  TYR B 588      76.326  51.264  96.832  1.00  0.91           C  
ATOM  11525  C   TYR B 588      77.684  51.369  97.532  1.00  0.91           C  
ATOM  11526  O   TYR B 588      78.505  50.464  97.426  1.00  0.91           O  
ATOM  11527  CB  TYR B 588      76.188  52.324  95.705  1.00  0.91           C  
ATOM  11528  CG  TYR B 588      77.371  52.365  94.784  1.00  0.91           C  
ATOM  11529  CD1 TYR B 588      77.584  51.333  93.864  1.00  0.91           C  
ATOM  11530  CD2 TYR B 588      78.306  53.408  94.877  1.00  0.91           C  
ATOM  11531  CE1 TYR B 588      78.701  51.356  93.018  1.00  0.91           C  
ATOM  11532  CE2 TYR B 588      79.428  53.423  94.041  1.00  0.91           C  
ATOM  11533  CZ  TYR B 588      79.619  52.405  93.102  1.00  0.91           C  
ATOM  11534  OH  TYR B 588      80.748  52.409  92.263  1.00  0.91           O  
ATOM  11535  N   ASN B 589      77.932  52.426  98.331  1.00  0.88           N  
ATOM  11536  CA  ASN B 589      79.167  52.624  99.076  1.00  0.88           C  
ATOM  11537  C   ASN B 589      79.423  51.505 100.073  1.00  0.88           C  
ATOM  11538  O   ASN B 589      80.546  51.030 100.225  1.00  0.88           O  
ATOM  11539  CB  ASN B 589      79.154  53.980  99.818  1.00  0.88           C  
ATOM  11540  CG  ASN B 589      79.318  55.122  98.823  1.00  0.88           C  
ATOM  11541  OD1 ASN B 589      79.902  54.985  97.747  1.00  0.88           O  
ATOM  11542  ND2 ASN B 589      78.826  56.316  99.220  1.00  0.88           N  
ATOM  11543  N   ARG B 590      78.368  50.993 100.737  1.00  0.80           N  
ATOM  11544  CA  ARG B 590      78.463  49.803 101.555  1.00  0.80           C  
ATOM  11545  C   ARG B 590      78.915  48.575 100.769  1.00  0.80           C  
ATOM  11546  O   ARG B 590      79.674  47.769 101.284  1.00  0.80           O  
ATOM  11547  CB  ARG B 590      77.122  49.468 102.254  1.00  0.80           C  
ATOM  11548  CG  ARG B 590      76.718  50.436 103.381  1.00  0.80           C  
ATOM  11549  CD  ARG B 590      75.333  50.112 103.955  1.00  0.80           C  
ATOM  11550  NE  ARG B 590      75.067  51.062 105.060  1.00  0.80           N  
ATOM  11551  CZ  ARG B 590      74.112  50.924 105.989  1.00  0.80           C  
ATOM  11552  NH1 ARG B 590      73.228  49.934 105.929  1.00  0.80           N  
ATOM  11553  NH2 ARG B 590      74.038  51.805 106.974  1.00  0.80           N  
ATOM  11554  N   ILE B 591      78.467  48.368  99.513  1.00  0.83           N  
ATOM  11555  CA  ILE B 591      78.985  47.311  98.636  1.00  0.83           C  
ATOM  11556  C   ILE B 591      80.445  47.548  98.237  1.00  0.83           C  
ATOM  11557  O   ILE B 591      81.239  46.614  98.151  1.00  0.83           O  
ATOM  11558  CB  ILE B 591      78.114  47.087  97.391  1.00  0.83           C  
ATOM  11559  CG1 ILE B 591      76.652  46.751  97.778  1.00  0.83           C  
ATOM  11560  CG2 ILE B 591      78.696  45.950  96.515  1.00  0.83           C  
ATOM  11561  CD1 ILE B 591      75.667  46.902  96.611  1.00  0.83           C  
ATOM  11562  N   LYS B 592      80.841  48.815  98.004  1.00  0.78           N  
ATOM  11563  CA  LYS B 592      82.192  49.197  97.619  1.00  0.78           C  
ATOM  11564  C   LYS B 592      83.220  49.145  98.747  1.00  0.78           C  
ATOM  11565  O   LYS B 592      84.418  49.202  98.485  1.00  0.78           O  
ATOM  11566  CB  LYS B 592      82.217  50.612  96.982  1.00  0.78           C  
ATOM  11567  CG  LYS B 592      81.344  50.772  95.723  1.00  0.78           C  
ATOM  11568  CD  LYS B 592      81.707  49.869  94.528  1.00  0.78           C  
ATOM  11569  CE  LYS B 592      82.992  50.284  93.808  1.00  0.78           C  
ATOM  11570  NZ  LYS B 592      83.156  49.509  92.573  1.00  0.78           N  
ATOM  11571  N   LYS B 593      82.782  49.004 100.018  1.00  0.75           N  
ATOM  11572  CA  LYS B 593      83.629  48.771 101.183  1.00  0.75           C  
ATOM  11573  C   LYS B 593      84.503  47.531 101.065  1.00  0.75           C  
ATOM  11574  O   LYS B 593      85.673  47.576 101.436  1.00  0.75           O  
ATOM  11575  CB  LYS B 593      82.718  48.539 102.420  1.00  0.75           C  
ATOM  11576  CG  LYS B 593      82.375  49.797 103.233  1.00  0.75           C  
ATOM  11577  CD  LYS B 593      83.389  50.075 104.359  1.00  0.75           C  
ATOM  11578  CE  LYS B 593      83.399  48.988 105.446  1.00  0.75           C  
ATOM  11579  NZ  LYS B 593      84.367  49.325 106.511  1.00  0.75           N  
ATOM  11580  N   ASP B 594      83.894  46.438 100.564  1.00  0.65           N  
ATOM  11581  CA  ASP B 594      84.433  45.109 100.365  1.00  0.65           C  
ATOM  11582  C   ASP B 594      83.204  44.270  99.990  1.00  0.65           C  
ATOM  11583  O   ASP B 594      82.129  44.492 100.567  1.00  0.65           O  
ATOM  11584  CB  ASP B 594      85.137  44.499 101.618  1.00  0.65           C  
ATOM  11585  CG  ASP B 594      86.193  43.463 101.244  1.00  0.65           C  
ATOM  11586  OD1 ASP B 594      85.821  42.345 100.806  1.00  0.65           O  
ATOM  11587  OD2 ASP B 594      87.398  43.789 101.394  1.00  0.65           O  
ATOM  11588  N   PRO B 595      83.230  43.367  99.013  1.00  0.72           N  
ATOM  11589  CA  PRO B 595      82.160  42.400  98.791  1.00  0.72           C  
ATOM  11590  C   PRO B 595      82.035  41.364  99.913  1.00  0.72           C  
ATOM  11591  O   PRO B 595      82.512  41.569 101.021  1.00  0.72           O  
ATOM  11592  CB  PRO B 595      82.556  41.781  97.435  1.00  0.72           C  
ATOM  11593  CG  PRO B 595      84.083  41.834  97.436  1.00  0.72           C  
ATOM  11594  CD  PRO B 595      84.356  43.181  98.096  1.00  0.72           C  
ATOM  11595  N   LYS B 596      81.317  40.242  99.671  1.00  0.68           N  
ATOM  11596  CA  LYS B 596      81.192  39.106 100.585  1.00  0.68           C  
ATOM  11597  C   LYS B 596      80.249  39.327 101.746  1.00  0.68           C  
ATOM  11598  O   LYS B 596      79.473  38.441 102.094  1.00  0.68           O  
ATOM  11599  CB  LYS B 596      82.533  38.515 101.101  1.00  0.68           C  
ATOM  11600  CG  LYS B 596      83.454  37.965 100.003  1.00  0.68           C  
ATOM  11601  CD  LYS B 596      82.837  36.763  99.269  1.00  0.68           C  
ATOM  11602  CE  LYS B 596      83.765  36.116  98.242  1.00  0.68           C  
ATOM  11603  NZ  LYS B 596      84.970  35.581  98.914  1.00  0.68           N  
ATOM  11604  N   LYS B 597      80.268  40.524 102.352  1.00  0.71           N  
ATOM  11605  CA  LYS B 597      79.322  40.928 103.363  1.00  0.71           C  
ATOM  11606  C   LYS B 597      77.888  40.878 102.858  1.00  0.71           C  
ATOM  11607  O   LYS B 597      77.578  41.226 101.714  1.00  0.71           O  
ATOM  11608  CB  LYS B 597      79.683  42.328 103.921  1.00  0.71           C  
ATOM  11609  CG  LYS B 597      79.493  43.492 102.936  1.00  0.71           C  
ATOM  11610  CD  LYS B 597      78.112  44.155 103.059  1.00  0.71           C  
ATOM  11611  CE  LYS B 597      77.888  45.174 101.959  1.00  0.71           C  
ATOM  11612  NZ  LYS B 597      76.635  45.900 102.213  1.00  0.71           N  
ATOM  11613  N   LEU B 598      76.960  40.415 103.711  1.00  0.74           N  
ATOM  11614  CA  LEU B 598      75.584  40.229 103.318  1.00  0.74           C  
ATOM  11615  C   LEU B 598      74.883  41.540 102.962  1.00  0.74           C  
ATOM  11616  O   LEU B 598      74.961  42.564 103.644  1.00  0.74           O  
ATOM  11617  CB  LEU B 598      74.782  39.412 104.363  1.00  0.74           C  
ATOM  11618  CG  LEU B 598      75.014  37.880 104.309  1.00  0.74           C  
ATOM  11619  CD1 LEU B 598      76.464  37.439 104.562  1.00  0.74           C  
ATOM  11620  CD2 LEU B 598      74.089  37.162 105.302  1.00  0.74           C  
ATOM  11621  N   PHE B 599      74.195  41.524 101.816  1.00  0.85           N  
ATOM  11622  CA  PHE B 599      73.381  42.606 101.334  1.00  0.85           C  
ATOM  11623  C   PHE B 599      72.213  41.921 100.666  1.00  0.85           C  
ATOM  11624  O   PHE B 599      72.398  41.125  99.747  1.00  0.85           O  
ATOM  11625  CB  PHE B 599      74.193  43.464 100.325  1.00  0.85           C  
ATOM  11626  CG  PHE B 599      73.452  44.674  99.826  1.00  0.85           C  
ATOM  11627  CD1 PHE B 599      73.599  45.932 100.432  1.00  0.85           C  
ATOM  11628  CD2 PHE B 599      72.634  44.563  98.694  1.00  0.85           C  
ATOM  11629  CE1 PHE B 599      72.978  47.062  99.888  1.00  0.85           C  
ATOM  11630  CE2 PHE B 599      71.999  45.685  98.154  1.00  0.85           C  
ATOM  11631  CZ  PHE B 599      72.180  46.936  98.744  1.00  0.85           C  
ATOM  11632  N   VAL B 600      70.979  42.191 101.121  1.00  0.91           N  
ATOM  11633  CA  VAL B 600      69.792  41.693 100.455  1.00  0.91           C  
ATOM  11634  C   VAL B 600      69.614  42.403  99.112  1.00  0.91           C  
ATOM  11635  O   VAL B 600      69.744  43.629  99.079  1.00  0.91           O  
ATOM  11636  CB  VAL B 600      68.562  41.813 101.344  1.00  0.91           C  
ATOM  11637  CG1 VAL B 600      68.192  43.279 101.621  1.00  0.91           C  
ATOM  11638  CG2 VAL B 600      67.373  41.088 100.706  1.00  0.91           C  
ATOM  11639  N   PRO B 601      69.357  41.757  97.977  1.00  0.93           N  
ATOM  11640  CA  PRO B 601      69.354  42.465  96.710  1.00  0.93           C  
ATOM  11641  C   PRO B 601      68.165  43.395  96.573  1.00  0.93           C  
ATOM  11642  O   PRO B 601      67.050  43.042  96.961  1.00  0.93           O  
ATOM  11643  CB  PRO B 601      69.360  41.353  95.644  1.00  0.93           C  
ATOM  11644  CG  PRO B 601      68.894  40.095  96.385  1.00  0.93           C  
ATOM  11645  CD  PRO B 601      69.450  40.312  97.789  1.00  0.93           C  
ATOM  11646  N   ARG B 602      68.389  44.606  96.035  1.00  0.90           N  
ATOM  11647  CA  ARG B 602      67.335  45.576  95.842  1.00  0.90           C  
ATOM  11648  C   ARG B 602      67.296  46.111  94.424  1.00  0.90           C  
ATOM  11649  O   ARG B 602      68.301  46.405  93.782  1.00  0.90           O  
ATOM  11650  CB  ARG B 602      67.420  46.787  96.795  1.00  0.90           C  
ATOM  11651  CG  ARG B 602      67.142  46.491  98.282  1.00  0.90           C  
ATOM  11652  CD  ARG B 602      66.817  47.801  98.997  1.00  0.90           C  
ATOM  11653  NE  ARG B 602      66.558  47.557 100.446  1.00  0.90           N  
ATOM  11654  CZ  ARG B 602      65.928  48.463 101.203  1.00  0.90           C  
ATOM  11655  NH1 ARG B 602      65.468  49.611 100.725  1.00  0.90           N  
ATOM  11656  NH2 ARG B 602      65.774  48.239 102.504  1.00  0.90           N  
ATOM  11657  N   THR B 603      66.069  46.276  93.905  1.00  0.93           N  
ATOM  11658  CA  THR B 603      65.813  46.933  92.639  1.00  0.93           C  
ATOM  11659  C   THR B 603      65.136  48.200  93.052  1.00  0.93           C  
ATOM  11660  O   THR B 603      64.009  48.151  93.538  1.00  0.93           O  
ATOM  11661  CB  THR B 603      64.872  46.186  91.698  1.00  0.93           C  
ATOM  11662  OG1 THR B 603      65.346  44.866  91.468  1.00  0.93           O  
ATOM  11663  CG2 THR B 603      64.823  46.888  90.334  1.00  0.93           C  
ATOM  11664  N   VAL B 604      65.815  49.348  92.922  1.00  0.96           N  
ATOM  11665  CA  VAL B 604      65.314  50.626  93.384  1.00  0.96           C  
ATOM  11666  C   VAL B 604      64.718  51.353  92.205  1.00  0.96           C  
ATOM  11667  O   VAL B 604      65.392  51.677  91.229  1.00  0.96           O  
ATOM  11668  CB  VAL B 604      66.384  51.482  94.046  1.00  0.96           C  
ATOM  11669  CG1 VAL B 604      65.778  52.836  94.469  1.00  0.96           C  
ATOM  11670  CG2 VAL B 604      66.934  50.741  95.281  1.00  0.96           C  
ATOM  11671  N   ILE B 605      63.403  51.592  92.252  1.00  0.94           N  
ATOM  11672  CA  ILE B 605      62.652  52.136  91.146  1.00  0.94           C  
ATOM  11673  C   ILE B 605      62.071  53.463  91.579  1.00  0.94           C  
ATOM  11674  O   ILE B 605      61.169  53.545  92.409  1.00  0.94           O  
ATOM  11675  CB  ILE B 605      61.540  51.183  90.708  1.00  0.94           C  
ATOM  11676  CG1 ILE B 605      62.120  49.831  90.219  1.00  0.94           C  
ATOM  11677  CG2 ILE B 605      60.681  51.843  89.610  1.00  0.94           C  
ATOM  11678  CD1 ILE B 605      61.081  48.707  90.114  1.00  0.94           C  
ATOM  11679  N   ILE B 606      62.561  54.562  90.993  1.00  0.95           N  
ATOM  11680  CA  ILE B 606      62.060  55.891  91.287  1.00  0.95           C  
ATOM  11681  C   ILE B 606      61.366  56.358  90.028  1.00  0.95           C  
ATOM  11682  O   ILE B 606      61.831  56.119  88.922  1.00  0.95           O  
ATOM  11683  CB  ILE B 606      63.156  56.859  91.738  1.00  0.95           C  
ATOM  11684  CG1 ILE B 606      63.902  56.279  92.968  1.00  0.95           C  
ATOM  11685  CG2 ILE B 606      62.519  58.229  92.062  1.00  0.95           C  
ATOM  11686  CD1 ILE B 606      65.097  57.107  93.463  1.00  0.95           C  
ATOM  11687  N   GLY B 607      60.182  56.977  90.116  1.00  0.97           N  
ATOM  11688  CA  GLY B 607      59.493  57.400  88.905  1.00  0.97           C  
ATOM  11689  C   GLY B 607      58.568  58.542  89.149  1.00  0.97           C  
ATOM  11690  O   GLY B 607      57.899  58.630  90.172  1.00  0.97           O  
ATOM  11691  N   GLY B 608      58.470  59.465  88.190  1.00  0.94           N  
ATOM  11692  CA  GLY B 608      57.705  60.668  88.433  1.00  0.94           C  
ATOM  11693  C   GLY B 608      58.064  61.727  87.465  1.00  0.94           C  
ATOM  11694  O   GLY B 608      59.065  61.635  86.768  1.00  0.94           O  
ATOM  11695  N   LYS B 609      57.255  62.792  87.414  1.00  0.87           N  
ATOM  11696  CA  LYS B 609      57.473  63.893  86.506  1.00  0.87           C  
ATOM  11697  C   LYS B 609      57.773  65.160  87.285  1.00  0.87           C  
ATOM  11698  O   LYS B 609      57.166  65.431  88.323  1.00  0.87           O  
ATOM  11699  CB  LYS B 609      56.248  64.122  85.588  1.00  0.87           C  
ATOM  11700  CG  LYS B 609      55.843  62.881  84.769  1.00  0.87           C  
ATOM  11701  CD  LYS B 609      54.913  63.215  83.587  1.00  0.87           C  
ATOM  11702  CE  LYS B 609      53.576  63.839  84.002  1.00  0.87           C  
ATOM  11703  NZ  LYS B 609      52.901  64.410  82.825  1.00  0.87           N  
ATOM  11704  N   ALA B 610      58.746  65.955  86.806  1.00  0.88           N  
ATOM  11705  CA  ALA B 610      59.065  67.258  87.344  1.00  0.88           C  
ATOM  11706  C   ALA B 610      58.327  68.344  86.572  1.00  0.88           C  
ATOM  11707  O   ALA B 610      58.092  68.233  85.370  1.00  0.88           O  
ATOM  11708  CB  ALA B 610      60.583  67.503  87.253  1.00  0.88           C  
ATOM  11709  N   ALA B 611      57.914  69.436  87.244  1.00  0.82           N  
ATOM  11710  CA  ALA B 611      57.297  70.565  86.576  1.00  0.82           C  
ATOM  11711  C   ALA B 611      58.241  71.324  85.622  1.00  0.82           C  
ATOM  11712  O   ALA B 611      59.418  71.468  85.961  1.00  0.82           O  
ATOM  11713  CB  ALA B 611      56.715  71.525  87.626  1.00  0.82           C  
ATOM  11714  N   PRO B 612      57.811  71.843  84.461  1.00  0.81           N  
ATOM  11715  CA  PRO B 612      58.693  72.460  83.467  1.00  0.81           C  
ATOM  11716  C   PRO B 612      59.665  73.520  83.951  1.00  0.81           C  
ATOM  11717  O   PRO B 612      60.829  73.494  83.549  1.00  0.81           O  
ATOM  11718  CB  PRO B 612      57.728  72.988  82.403  1.00  0.81           C  
ATOM  11719  CG  PRO B 612      56.627  71.929  82.393  1.00  0.81           C  
ATOM  11720  CD  PRO B 612      56.504  71.532  83.866  1.00  0.81           C  
ATOM  11721  N   GLY B 613      59.199  74.452  84.808  1.00  0.78           N  
ATOM  11722  CA  GLY B 613      59.997  75.545  85.365  1.00  0.78           C  
ATOM  11723  C   GLY B 613      60.786  75.208  86.602  1.00  0.78           C  
ATOM  11724  O   GLY B 613      61.468  76.053  87.173  1.00  0.78           O  
ATOM  11725  N   TYR B 614      60.696  73.964  87.092  1.00  0.83           N  
ATOM  11726  CA  TYR B 614      61.265  73.577  88.363  1.00  0.83           C  
ATOM  11727  C   TYR B 614      62.677  73.045  88.182  1.00  0.83           C  
ATOM  11728  O   TYR B 614      62.897  71.872  87.885  1.00  0.83           O  
ATOM  11729  CB  TYR B 614      60.341  72.499  88.974  1.00  0.83           C  
ATOM  11730  CG  TYR B 614      60.484  72.209  90.443  1.00  0.83           C  
ATOM  11731  CD1 TYR B 614      61.473  72.736  91.301  1.00  0.83           C  
ATOM  11732  CD2 TYR B 614      59.526  71.336  90.974  1.00  0.83           C  
ATOM  11733  CE1 TYR B 614      61.488  72.385  92.661  1.00  0.83           C  
ATOM  11734  CE2 TYR B 614      59.533  71.006  92.330  1.00  0.83           C  
ATOM  11735  CZ  TYR B 614      60.512  71.528  93.174  1.00  0.83           C  
ATOM  11736  OH  TYR B 614      60.523  71.183  94.535  1.00  0.83           O  
ATOM  11737  N   HIS B 615      63.687  73.915  88.383  1.00  0.87           N  
ATOM  11738  CA  HIS B 615      65.091  73.543  88.245  1.00  0.87           C  
ATOM  11739  C   HIS B 615      65.530  72.440  89.193  1.00  0.87           C  
ATOM  11740  O   HIS B 615      66.091  71.437  88.760  1.00  0.87           O  
ATOM  11741  CB  HIS B 615      65.997  74.783  88.467  1.00  0.87           C  
ATOM  11742  CG  HIS B 615      67.486  74.542  88.456  1.00  0.87           C  
ATOM  11743  ND1 HIS B 615      68.124  74.327  89.662  1.00  0.87           N  
ATOM  11744  CD2 HIS B 615      68.395  74.606  87.447  1.00  0.87           C  
ATOM  11745  CE1 HIS B 615      69.412  74.273  89.367  1.00  0.87           C  
ATOM  11746  NE2 HIS B 615      69.628  74.434  88.040  1.00  0.87           N  
ATOM  11747  N   MET B 616      65.209  72.563  90.497  1.00  0.90           N  
ATOM  11748  CA  MET B 616      65.671  71.643  91.518  1.00  0.90           C  
ATOM  11749  C   MET B 616      65.197  70.207  91.326  1.00  0.90           C  
ATOM  11750  O   MET B 616      65.970  69.257  91.413  1.00  0.90           O  
ATOM  11751  CB  MET B 616      65.288  72.163  92.921  1.00  0.90           C  
ATOM  11752  CG  MET B 616      66.197  71.669  94.065  1.00  0.90           C  
ATOM  11753  SD  MET B 616      67.911  72.274  93.985  1.00  0.90           S  
ATOM  11754  CE  MET B 616      68.587  70.723  93.357  1.00  0.90           C  
ATOM  11755  N   ALA B 617      63.914  70.008  90.972  1.00  0.94           N  
ATOM  11756  CA  ALA B 617      63.371  68.711  90.623  1.00  0.94           C  
ATOM  11757  C   ALA B 617      64.015  68.053  89.404  1.00  0.94           C  
ATOM  11758  O   ALA B 617      64.302  66.857  89.406  1.00  0.94           O  
ATOM  11759  CB  ALA B 617      61.863  68.865  90.393  1.00  0.94           C  
ATOM  11760  N   LYS B 618      64.296  68.822  88.333  1.00  0.90           N  
ATOM  11761  CA  LYS B 618      65.023  68.331  87.171  1.00  0.90           C  
ATOM  11762  C   LYS B 618      66.468  67.941  87.480  1.00  0.90           C  
ATOM  11763  O   LYS B 618      66.967  66.933  86.977  1.00  0.90           O  
ATOM  11764  CB  LYS B 618      64.941  69.325  85.987  1.00  0.90           C  
ATOM  11765  CG  LYS B 618      63.501  69.491  85.467  1.00  0.90           C  
ATOM  11766  CD  LYS B 618      63.401  70.314  84.170  1.00  0.90           C  
ATOM  11767  CE  LYS B 618      61.958  70.390  83.645  1.00  0.90           C  
ATOM  11768  NZ  LYS B 618      61.886  71.030  82.315  1.00  0.90           N  
ATOM  11769  N   MET B 619      67.160  68.694  88.364  1.00  0.91           N  
ATOM  11770  CA  MET B 619      68.453  68.295  88.903  1.00  0.91           C  
ATOM  11771  C   MET B 619      68.398  66.981  89.676  1.00  0.91           C  
ATOM  11772  O   MET B 619      69.272  66.133  89.529  1.00  0.91           O  
ATOM  11773  CB  MET B 619      69.055  69.352  89.862  1.00  0.91           C  
ATOM  11774  CG  MET B 619      69.309  70.749  89.265  1.00  0.91           C  
ATOM  11775  SD  MET B 619      70.220  70.778  87.699  1.00  0.91           S  
ATOM  11776  CE  MET B 619      71.736  70.002  88.314  1.00  0.91           C  
ATOM  11777  N   ILE B 620      67.352  66.762  90.504  1.00  0.94           N  
ATOM  11778  CA  ILE B 620      67.127  65.508  91.222  1.00  0.94           C  
ATOM  11779  C   ILE B 620      66.924  64.321  90.277  1.00  0.94           C  
ATOM  11780  O   ILE B 620      67.487  63.251  90.499  1.00  0.94           O  
ATOM  11781  CB  ILE B 620      65.997  65.616  92.252  1.00  0.94           C  
ATOM  11782  CG1 ILE B 620      66.350  66.670  93.330  1.00  0.94           C  
ATOM  11783  CG2 ILE B 620      65.737  64.250  92.930  1.00  0.94           C  
ATOM  11784  CD1 ILE B 620      65.156  67.086  94.200  1.00  0.94           C  
ATOM  11785  N   ILE B 621      66.176  64.479  89.160  1.00  0.94           N  
ATOM  11786  CA  ILE B 621      66.070  63.448  88.118  1.00  0.94           C  
ATOM  11787  C   ILE B 621      67.425  63.104  87.496  1.00  0.94           C  
ATOM  11788  O   ILE B 621      67.793  61.934  87.395  1.00  0.94           O  
ATOM  11789  CB  ILE B 621      65.090  63.843  87.001  1.00  0.94           C  
ATOM  11790  CG1 ILE B 621      63.660  63.999  87.570  1.00  0.94           C  
ATOM  11791  CG2 ILE B 621      65.100  62.794  85.859  1.00  0.94           C  
ATOM  11792  CD1 ILE B 621      62.631  64.518  86.557  1.00  0.94           C  
ATOM  11793  N   LYS B 622      68.236  64.119  87.121  1.00  0.92           N  
ATOM  11794  CA  LYS B 622      69.584  63.922  86.597  1.00  0.92           C  
ATOM  11795  C   LYS B 622      70.553  63.305  87.608  1.00  0.92           C  
ATOM  11796  O   LYS B 622      71.449  62.533  87.267  1.00  0.92           O  
ATOM  11797  CB  LYS B 622      70.157  65.240  86.016  1.00  0.92           C  
ATOM  11798  CG  LYS B 622      71.539  65.129  85.330  1.00  0.92           C  
ATOM  11799  CD  LYS B 622      71.593  64.167  84.120  1.00  0.92           C  
ATOM  11800  CE  LYS B 622      72.958  64.165  83.400  1.00  0.92           C  
ATOM  11801  NZ  LYS B 622      72.994  63.234  82.242  1.00  0.92           N  
ATOM  11802  N   LEU B 623      70.405  63.641  88.902  1.00  0.93           N  
ATOM  11803  CA  LEU B 623      71.135  63.028  89.996  1.00  0.93           C  
ATOM  11804  C   LEU B 623      70.814  61.546  90.152  1.00  0.93           C  
ATOM  11805  O   LEU B 623      71.714  60.717  90.238  1.00  0.93           O  
ATOM  11806  CB  LEU B 623      70.855  63.853  91.285  1.00  0.93           C  
ATOM  11807  CG  LEU B 623      71.646  63.529  92.575  1.00  0.93           C  
ATOM  11808  CD1 LEU B 623      71.028  62.377  93.372  1.00  0.93           C  
ATOM  11809  CD2 LEU B 623      73.138  63.272  92.332  1.00  0.93           C  
ATOM  11810  N   ILE B 624      69.522  61.153  90.122  1.00  0.93           N  
ATOM  11811  CA  ILE B 624      69.111  59.750  90.179  1.00  0.93           C  
ATOM  11812  C   ILE B 624      69.572  58.940  88.979  1.00  0.93           C  
ATOM  11813  O   ILE B 624      70.085  57.832  89.135  1.00  0.93           O  
ATOM  11814  CB  ILE B 624      67.599  59.592  90.360  1.00  0.93           C  
ATOM  11815  CG1 ILE B 624      67.141  60.244  91.685  1.00  0.93           C  
ATOM  11816  CG2 ILE B 624      67.191  58.096  90.348  1.00  0.93           C  
ATOM  11817  CD1 ILE B 624      65.629  60.485  91.742  1.00  0.93           C  
ATOM  11818  N   THR B 625      69.439  59.466  87.745  1.00  0.93           N  
ATOM  11819  CA  THR B 625      69.910  58.774  86.545  1.00  0.93           C  
ATOM  11820  C   THR B 625      71.416  58.581  86.525  1.00  0.93           C  
ATOM  11821  O   THR B 625      71.895  57.477  86.304  1.00  0.93           O  
ATOM  11822  CB  THR B 625      69.462  59.432  85.249  1.00  0.93           C  
ATOM  11823  OG1 THR B 625      69.824  60.805  85.217  1.00  0.93           O  
ATOM  11824  CG2 THR B 625      67.929  59.352  85.135  1.00  0.93           C  
ATOM  11825  N   SER B 626      72.199  59.620  86.875  1.00  0.94           N  
ATOM  11826  CA  SER B 626      73.650  59.534  87.017  1.00  0.94           C  
ATOM  11827  C   SER B 626      74.106  58.527  88.074  1.00  0.94           C  
ATOM  11828  O   SER B 626      75.071  57.788  87.879  1.00  0.94           O  
ATOM  11829  CB  SER B 626      74.272  60.908  87.375  1.00  0.94           C  
ATOM  11830  OG  SER B 626      74.141  61.866  86.316  1.00  0.94           O  
ATOM  11831  N   VAL B 627      73.410  58.435  89.232  1.00  0.94           N  
ATOM  11832  CA  VAL B 627      73.645  57.362  90.199  1.00  0.94           C  
ATOM  11833  C   VAL B 627      73.331  55.996  89.615  1.00  0.94           C  
ATOM  11834  O   VAL B 627      74.100  55.047  89.765  1.00  0.94           O  
ATOM  11835  CB  VAL B 627      72.871  57.555  91.501  1.00  0.94           C  
ATOM  11836  CG1 VAL B 627      73.039  56.348  92.454  1.00  0.94           C  
ATOM  11837  CG2 VAL B 627      73.405  58.812  92.209  1.00  0.94           C  
ATOM  11838  N   ALA B 628      72.206  55.869  88.888  1.00  0.92           N  
ATOM  11839  CA  ALA B 628      71.809  54.638  88.246  1.00  0.92           C  
ATOM  11840  C   ALA B 628      72.815  54.124  87.232  1.00  0.92           C  
ATOM  11841  O   ALA B 628      73.198  52.957  87.285  1.00  0.92           O  
ATOM  11842  CB  ALA B 628      70.434  54.816  87.574  1.00  0.92           C  
ATOM  11843  N   ASP B 629      73.336  54.990  86.346  1.00  0.87           N  
ATOM  11844  CA  ASP B 629      74.331  54.621  85.357  1.00  0.87           C  
ATOM  11845  C   ASP B 629      75.608  54.061  85.994  1.00  0.87           C  
ATOM  11846  O   ASP B 629      76.116  53.011  85.602  1.00  0.87           O  
ATOM  11847  CB  ASP B 629      74.676  55.846  84.473  1.00  0.87           C  
ATOM  11848  CG  ASP B 629      73.456  56.356  83.716  1.00  0.87           C  
ATOM  11849  OD1 ASP B 629      72.572  55.527  83.378  1.00  0.87           O  
ATOM  11850  OD2 ASP B 629      73.412  57.586  83.451  1.00  0.87           O  
ATOM  11851  N   VAL B 630      76.121  54.708  87.064  1.00  0.90           N  
ATOM  11852  CA  VAL B 630      77.261  54.194  87.817  1.00  0.90           C  
ATOM  11853  C   VAL B 630      77.000  52.874  88.529  1.00  0.90           C  
ATOM  11854  O   VAL B 630      77.771  51.928  88.383  1.00  0.90           O  
ATOM  11855  CB  VAL B 630      77.767  55.214  88.838  1.00  0.90           C  
ATOM  11856  CG1 VAL B 630      78.907  54.653  89.722  1.00  0.90           C  
ATOM  11857  CG2 VAL B 630      78.278  56.452  88.080  1.00  0.90           C  
ATOM  11858  N   VAL B 631      75.904  52.723  89.304  1.00  0.91           N  
ATOM  11859  CA  VAL B 631      75.718  51.489  90.068  1.00  0.91           C  
ATOM  11860  C   VAL B 631      75.263  50.311  89.217  1.00  0.91           C  
ATOM  11861  O   VAL B 631      75.557  49.159  89.524  1.00  0.91           O  
ATOM  11862  CB  VAL B 631      74.832  51.633  91.305  1.00  0.91           C  
ATOM  11863  CG1 VAL B 631      75.214  52.910  92.076  1.00  0.91           C  
ATOM  11864  CG2 VAL B 631      73.336  51.644  90.959  1.00  0.91           C  
ATOM  11865  N   ASN B 632      74.572  50.566  88.085  1.00  0.87           N  
ATOM  11866  CA  ASN B 632      74.152  49.520  87.170  1.00  0.87           C  
ATOM  11867  C   ASN B 632      75.288  49.019  86.286  1.00  0.87           C  
ATOM  11868  O   ASN B 632      75.204  47.921  85.735  1.00  0.87           O  
ATOM  11869  CB  ASN B 632      73.040  50.023  86.210  1.00  0.87           C  
ATOM  11870  CG  ASN B 632      71.735  50.325  86.941  1.00  0.87           C  
ATOM  11871  OD1 ASN B 632      71.383  49.741  87.966  1.00  0.87           O  
ATOM  11872  ND2 ASN B 632      70.941  51.251  86.359  1.00  0.87           N  
ATOM  11873  N   ASN B 633      76.365  49.813  86.104  1.00  0.85           N  
ATOM  11874  CA  ASN B 633      77.498  49.422  85.279  1.00  0.85           C  
ATOM  11875  C   ASN B 633      78.736  49.072  86.095  1.00  0.85           C  
ATOM  11876  O   ASN B 633      79.711  48.582  85.531  1.00  0.85           O  
ATOM  11877  CB  ASN B 633      77.889  50.556  84.286  1.00  0.85           C  
ATOM  11878  CG  ASN B 633      76.848  50.862  83.205  1.00  0.85           C  
ATOM  11879  OD1 ASN B 633      76.997  51.830  82.462  1.00  0.85           O  
ATOM  11880  ND2 ASN B 633      75.805  50.018  83.044  1.00  0.85           N  
ATOM  11881  N   ASP B 634      78.739  49.268  87.431  1.00  0.85           N  
ATOM  11882  CA  ASP B 634      79.843  48.867  88.282  1.00  0.85           C  
ATOM  11883  C   ASP B 634      79.971  47.332  88.363  1.00  0.85           C  
ATOM  11884  O   ASP B 634      79.011  46.660  88.758  1.00  0.85           O  
ATOM  11885  CB  ASP B 634      79.684  49.470  89.698  1.00  0.85           C  
ATOM  11886  CG  ASP B 634      80.905  49.244  90.549  1.00  0.85           C  
ATOM  11887  OD1 ASP B 634      81.960  49.877  90.295  1.00  0.85           O  
ATOM  11888  OD2 ASP B 634      80.856  48.426  91.502  1.00  0.85           O  
ATOM  11889  N   PRO B 635      81.111  46.717  88.039  1.00  0.85           N  
ATOM  11890  CA  PRO B 635      81.220  45.261  88.009  1.00  0.85           C  
ATOM  11891  C   PRO B 635      81.121  44.610  89.381  1.00  0.85           C  
ATOM  11892  O   PRO B 635      80.777  43.435  89.471  1.00  0.85           O  
ATOM  11893  CB  PRO B 635      82.588  45.009  87.348  1.00  0.85           C  
ATOM  11894  CG  PRO B 635      82.814  46.242  86.473  1.00  0.85           C  
ATOM  11895  CD  PRO B 635      82.216  47.360  87.315  1.00  0.85           C  
ATOM  11896  N   MET B 636      81.459  45.337  90.463  1.00  0.81           N  
ATOM  11897  CA  MET B 636      81.443  44.815  91.821  1.00  0.81           C  
ATOM  11898  C   MET B 636      80.039  44.683  92.412  1.00  0.81           C  
ATOM  11899  O   MET B 636      79.765  43.837  93.276  1.00  0.81           O  
ATOM  11900  CB  MET B 636      82.272  45.739  92.746  1.00  0.81           C  
ATOM  11901  CG  MET B 636      83.772  45.797  92.394  1.00  0.81           C  
ATOM  11902  SD  MET B 636      84.707  44.313  92.865  1.00  0.81           S  
ATOM  11903  CE  MET B 636      84.648  44.622  94.654  1.00  0.81           C  
ATOM  11904  N   VAL B 637      79.108  45.555  91.983  1.00  0.85           N  
ATOM  11905  CA  VAL B 637      77.716  45.508  92.392  1.00  0.85           C  
ATOM  11906  C   VAL B 637      76.954  44.346  91.776  1.00  0.85           C  
ATOM  11907  O   VAL B 637      76.316  43.570  92.485  1.00  0.85           O  
ATOM  11908  CB  VAL B 637      77.015  46.816  92.069  1.00  0.85           C  
ATOM  11909  CG1 VAL B 637      75.533  46.765  92.478  1.00  0.85           C  
ATOM  11910  CG2 VAL B 637      77.699  47.960  92.832  1.00  0.85           C  
ATOM  11911  N   GLY B 638      77.032  44.139  90.446  1.00  0.84           N  
ATOM  11912  CA  GLY B 638      76.316  43.063  89.754  1.00  0.84           C  
ATOM  11913  C   GLY B 638      74.819  42.996  89.985  1.00  0.84           C  
ATOM  11914  O   GLY B 638      74.083  43.953  89.786  1.00  0.84           O  
ATOM  11915  N   SER B 639      74.268  41.839  90.382  1.00  0.86           N  
ATOM  11916  CA  SER B 639      72.825  41.650  90.519  1.00  0.86           C  
ATOM  11917  C   SER B 639      72.317  41.984  91.912  1.00  0.86           C  
ATOM  11918  O   SER B 639      71.207  41.618  92.294  1.00  0.86           O  
ATOM  11919  CB  SER B 639      72.431  40.188  90.197  1.00  0.86           C  
ATOM  11920  OG  SER B 639      73.293  39.290  90.896  1.00  0.86           O  
ATOM  11921  N   LYS B 640      73.144  42.697  92.688  1.00  0.88           N  
ATOM  11922  CA  LYS B 640      72.927  43.059  94.073  1.00  0.88           C  
ATOM  11923  C   LYS B 640      72.117  44.337  94.258  1.00  0.88           C  
ATOM  11924  O   LYS B 640      71.226  44.418  95.095  1.00  0.88           O  
ATOM  11925  CB  LYS B 640      74.345  43.217  94.650  1.00  0.88           C  
ATOM  11926  CG  LYS B 640      74.579  42.987  96.144  1.00  0.88           C  
ATOM  11927  CD  LYS B 640      76.086  43.065  96.488  1.00  0.88           C  
ATOM  11928  CE  LYS B 640      76.986  42.085  95.709  1.00  0.88           C  
ATOM  11929  NZ  LYS B 640      78.418  42.428  95.867  1.00  0.88           N  
ATOM  11930  N   LEU B 641      72.392  45.379  93.455  1.00  0.92           N  
ATOM  11931  CA  LEU B 641      71.654  46.624  93.502  1.00  0.92           C  
ATOM  11932  C   LEU B 641      71.460  47.085  92.077  1.00  0.92           C  
ATOM  11933  O   LEU B 641      72.395  47.098  91.280  1.00  0.92           O  
ATOM  11934  CB  LEU B 641      72.396  47.703  94.339  1.00  0.92           C  
ATOM  11935  CG  LEU B 641      71.668  49.051  94.554  1.00  0.92           C  
ATOM  11936  CD1 LEU B 641      70.330  48.879  95.285  1.00  0.92           C  
ATOM  11937  CD2 LEU B 641      72.569  50.012  95.346  1.00  0.92           C  
ATOM  11938  N   LYS B 642      70.218  47.431  91.703  1.00  0.87           N  
ATOM  11939  CA  LYS B 642      69.911  47.963  90.393  1.00  0.87           C  
ATOM  11940  C   LYS B 642      69.000  49.144  90.578  1.00  0.87           C  
ATOM  11941  O   LYS B 642      68.069  49.097  91.376  1.00  0.87           O  
ATOM  11942  CB  LYS B 642      69.225  46.922  89.466  1.00  0.87           C  
ATOM  11943  CG  LYS B 642      70.189  45.835  88.976  1.00  0.87           C  
ATOM  11944  CD  LYS B 642      71.149  46.378  87.906  1.00  0.87           C  
ATOM  11945  CE  LYS B 642      72.402  45.546  87.674  1.00  0.87           C  
ATOM  11946  NZ  LYS B 642      72.046  44.117  87.628  1.00  0.87           N  
ATOM  11947  N   VAL B 643      69.265  50.249  89.866  1.00  0.93           N  
ATOM  11948  CA  VAL B 643      68.509  51.478  90.024  1.00  0.93           C  
ATOM  11949  C   VAL B 643      67.867  51.823  88.703  1.00  0.93           C  
ATOM  11950  O   VAL B 643      68.519  51.899  87.664  1.00  0.93           O  
ATOM  11951  CB  VAL B 643      69.370  52.642  90.489  1.00  0.93           C  
ATOM  11952  CG1 VAL B 643      68.536  53.926  90.690  1.00  0.93           C  
ATOM  11953  CG2 VAL B 643      70.062  52.274  91.810  1.00  0.93           C  
ATOM  11954  N   ILE B 644      66.544  52.025  88.716  1.00  0.91           N  
ATOM  11955  CA  ILE B 644      65.761  52.338  87.541  1.00  0.91           C  
ATOM  11956  C   ILE B 644      65.040  53.645  87.789  1.00  0.91           C  
ATOM  11957  O   ILE B 644      64.460  53.867  88.851  1.00  0.91           O  
ATOM  11958  CB  ILE B 644      64.735  51.244  87.237  1.00  0.91           C  
ATOM  11959  CG1 ILE B 644      65.397  49.856  87.031  1.00  0.91           C  
ATOM  11960  CG2 ILE B 644      63.853  51.632  86.027  1.00  0.91           C  
ATOM  11961  CD1 ILE B 644      66.328  49.762  85.816  1.00  0.91           C  
ATOM  11962  N   PHE B 645      65.034  54.551  86.792  1.00  0.93           N  
ATOM  11963  CA  PHE B 645      64.131  55.681  86.796  1.00  0.93           C  
ATOM  11964  C   PHE B 645      63.013  55.380  85.802  1.00  0.93           C  
ATOM  11965  O   PHE B 645      63.265  55.204  84.611  1.00  0.93           O  
ATOM  11966  CB  PHE B 645      64.859  57.009  86.467  1.00  0.93           C  
ATOM  11967  CG  PHE B 645      63.951  58.197  86.667  1.00  0.93           C  
ATOM  11968  CD1 PHE B 645      63.902  58.876  87.897  1.00  0.93           C  
ATOM  11969  CD2 PHE B 645      63.114  58.624  85.624  1.00  0.93           C  
ATOM  11970  CE1 PHE B 645      63.030  59.958  88.079  1.00  0.93           C  
ATOM  11971  CE2 PHE B 645      62.240  59.702  85.799  1.00  0.93           C  
ATOM  11972  CZ  PHE B 645      62.199  60.370  87.028  1.00  0.93           C  
ATOM  11973  N   LEU B 646      61.747  55.290  86.261  1.00  0.91           N  
ATOM  11974  CA  LEU B 646      60.625  55.026  85.374  1.00  0.91           C  
ATOM  11975  C   LEU B 646      60.229  56.258  84.577  1.00  0.91           C  
ATOM  11976  O   LEU B 646      59.711  57.241  85.106  1.00  0.91           O  
ATOM  11977  CB  LEU B 646      59.350  54.495  86.092  1.00  0.91           C  
ATOM  11978  CG  LEU B 646      59.330  52.990  86.433  1.00  0.91           C  
ATOM  11979  CD1 LEU B 646      58.021  52.634  87.158  1.00  0.91           C  
ATOM  11980  CD2 LEU B 646      59.480  52.104  85.187  1.00  0.91           C  
ATOM  11981  N   GLU B 647      60.446  56.187  83.251  1.00  0.88           N  
ATOM  11982  CA  GLU B 647      59.975  57.153  82.279  1.00  0.88           C  
ATOM  11983  C   GLU B 647      58.458  57.218  82.165  1.00  0.88           C  
ATOM  11984  O   GLU B 647      57.778  56.217  81.938  1.00  0.88           O  
ATOM  11985  CB  GLU B 647      60.552  56.873  80.861  1.00  0.88           C  
ATOM  11986  CG  GLU B 647      60.178  57.968  79.827  1.00  0.88           C  
ATOM  11987  CD  GLU B 647      60.687  57.750  78.406  1.00  0.88           C  
ATOM  11988  OE1 GLU B 647      59.890  57.279  77.549  1.00  0.88           O  
ATOM  11989  OE2 GLU B 647      61.838  58.161  78.117  1.00  0.88           O  
ATOM  11990  N   ASN B 648      57.892  58.437  82.288  1.00  0.89           N  
ATOM  11991  CA  ASN B 648      56.502  58.730  82.006  1.00  0.89           C  
ATOM  11992  C   ASN B 648      55.546  57.955  82.892  1.00  0.89           C  
ATOM  11993  O   ASN B 648      54.633  57.270  82.420  1.00  0.89           O  
ATOM  11994  CB  ASN B 648      56.184  58.575  80.491  1.00  0.89           C  
ATOM  11995  CG  ASN B 648      54.984  59.417  80.077  1.00  0.89           C  
ATOM  11996  OD1 ASN B 648      54.754  60.511  80.600  1.00  0.89           O  
ATOM  11997  ND2 ASN B 648      54.196  58.923  79.096  1.00  0.89           N  
ATOM  11998  N   TYR B 649      55.770  58.053  84.217  1.00  0.91           N  
ATOM  11999  CA  TYR B 649      54.884  57.534  85.237  1.00  0.91           C  
ATOM  12000  C   TYR B 649      53.476  58.140  85.169  1.00  0.91           C  
ATOM  12001  O   TYR B 649      53.281  59.356  85.149  1.00  0.91           O  
ATOM  12002  CB  TYR B 649      55.525  57.716  86.640  1.00  0.91           C  
ATOM  12003  CG  TYR B 649      54.685  57.073  87.709  1.00  0.91           C  
ATOM  12004  CD1 TYR B 649      54.517  55.679  87.739  1.00  0.91           C  
ATOM  12005  CD2 TYR B 649      53.984  57.868  88.631  1.00  0.91           C  
ATOM  12006  CE1 TYR B 649      53.632  55.093  88.655  1.00  0.91           C  
ATOM  12007  CE2 TYR B 649      53.106  57.282  89.554  1.00  0.91           C  
ATOM  12008  CZ  TYR B 649      52.926  55.895  89.560  1.00  0.91           C  
ATOM  12009  OH  TYR B 649      52.082  55.314  90.526  1.00  0.91           O  
ATOM  12010  N   ARG B 650      52.473  57.249  85.107  1.00  0.85           N  
ATOM  12011  CA  ARG B 650      51.093  57.563  84.817  1.00  0.85           C  
ATOM  12012  C   ARG B 650      50.270  56.356  85.203  1.00  0.85           C  
ATOM  12013  O   ARG B 650      50.818  55.354  85.662  1.00  0.85           O  
ATOM  12014  CB  ARG B 650      50.868  57.917  83.327  1.00  0.85           C  
ATOM  12015  CG  ARG B 650      51.126  56.739  82.369  1.00  0.85           C  
ATOM  12016  CD  ARG B 650      51.486  57.179  80.947  1.00  0.85           C  
ATOM  12017  NE  ARG B 650      52.688  56.380  80.553  1.00  0.85           N  
ATOM  12018  CZ  ARG B 650      52.681  55.334  79.719  1.00  0.85           C  
ATOM  12019  NH1 ARG B 650      51.592  54.924  79.081  1.00  0.85           N  
ATOM  12020  NH2 ARG B 650      53.828  54.681  79.519  1.00  0.85           N  
ATOM  12021  N   VAL B 651      48.935  56.414  85.045  1.00  0.93           N  
ATOM  12022  CA  VAL B 651      48.013  55.383  85.496  1.00  0.93           C  
ATOM  12023  C   VAL B 651      48.292  53.980  84.960  1.00  0.93           C  
ATOM  12024  O   VAL B 651      48.431  53.049  85.751  1.00  0.93           O  
ATOM  12025  CB  VAL B 651      46.584  55.812  85.172  1.00  0.93           C  
ATOM  12026  CG1 VAL B 651      45.549  54.766  85.626  1.00  0.93           C  
ATOM  12027  CG2 VAL B 651      46.287  57.161  85.856  1.00  0.93           C  
ATOM  12028  N   SER B 652      48.478  53.776  83.638  1.00  0.93           N  
ATOM  12029  CA  SER B 652      48.794  52.447  83.117  1.00  0.93           C  
ATOM  12030  C   SER B 652      50.144  51.888  83.552  1.00  0.93           C  
ATOM  12031  O   SER B 652      50.324  50.678  83.686  1.00  0.93           O  
ATOM  12032  CB  SER B 652      48.686  52.359  81.572  1.00  0.93           C  
ATOM  12033  OG  SER B 652      49.754  53.026  80.895  1.00  0.93           O  
ATOM  12034  N   LEU B 653      51.152  52.759  83.784  1.00  0.92           N  
ATOM  12035  CA  LEU B 653      52.421  52.358  84.367  1.00  0.92           C  
ATOM  12036  C   LEU B 653      52.281  51.977  85.837  1.00  0.92           C  
ATOM  12037  O   LEU B 653      52.870  51.004  86.302  1.00  0.92           O  
ATOM  12038  CB  LEU B 653      53.522  53.439  84.187  1.00  0.92           C  
ATOM  12039  CG  LEU B 653      54.831  52.939  83.528  1.00  0.92           C  
ATOM  12040  CD1 LEU B 653      55.912  54.025  83.610  1.00  0.92           C  
ATOM  12041  CD2 LEU B 653      55.380  51.637  84.132  1.00  0.92           C  
ATOM  12042  N   ALA B 654      51.453  52.719  86.602  1.00  0.97           N  
ATOM  12043  CA  ALA B 654      51.122  52.430  87.983  1.00  0.97           C  
ATOM  12044  C   ALA B 654      50.463  51.073  88.148  1.00  0.97           C  
ATOM  12045  O   ALA B 654      50.845  50.285  89.008  1.00  0.97           O  
ATOM  12046  CB  ALA B 654      50.203  53.538  88.528  1.00  0.97           C  
ATOM  12047  N   GLU B 655      49.519  50.735  87.252  1.00  0.93           N  
ATOM  12048  CA  GLU B 655      48.921  49.415  87.153  1.00  0.93           C  
ATOM  12049  C   GLU B 655      49.942  48.306  86.887  1.00  0.93           C  
ATOM  12050  O   GLU B 655      49.782  47.176  87.334  1.00  0.93           O  
ATOM  12051  CB  GLU B 655      47.823  49.398  86.060  1.00  0.93           C  
ATOM  12052  CG  GLU B 655      46.580  50.260  86.407  1.00  0.93           C  
ATOM  12053  CD  GLU B 655      45.592  50.346  85.249  1.00  0.93           C  
ATOM  12054  OE1 GLU B 655      45.197  51.483  84.867  1.00  0.93           O  
ATOM  12055  OE2 GLU B 655      45.158  49.290  84.742  1.00  0.93           O  
ATOM  12056  N   LYS B 656      51.038  48.586  86.158  1.00  0.90           N  
ATOM  12057  CA  LYS B 656      52.121  47.629  86.002  1.00  0.90           C  
ATOM  12058  C   LYS B 656      53.081  47.519  87.189  1.00  0.90           C  
ATOM  12059  O   LYS B 656      53.385  46.412  87.629  1.00  0.90           O  
ATOM  12060  CB  LYS B 656      52.938  47.951  84.728  1.00  0.90           C  
ATOM  12061  CG  LYS B 656      52.139  47.778  83.428  1.00  0.90           C  
ATOM  12062  CD  LYS B 656      52.975  48.155  82.196  1.00  0.90           C  
ATOM  12063  CE  LYS B 656      52.323  47.786  80.859  1.00  0.90           C  
ATOM  12064  NZ  LYS B 656      51.087  48.557  80.619  1.00  0.90           N  
ATOM  12065  N   VAL B 657      53.604  48.639  87.737  1.00  0.95           N  
ATOM  12066  CA  VAL B 657      54.577  48.582  88.825  1.00  0.95           C  
ATOM  12067  C   VAL B 657      53.989  48.197  90.172  1.00  0.95           C  
ATOM  12068  O   VAL B 657      54.560  47.367  90.873  1.00  0.95           O  
ATOM  12069  CB  VAL B 657      55.467  49.826  88.910  1.00  0.95           C  
ATOM  12070  CG1 VAL B 657      54.703  51.092  89.338  1.00  0.95           C  
ATOM  12071  CG2 VAL B 657      56.658  49.567  89.857  1.00  0.95           C  
ATOM  12072  N   ILE B 658      52.811  48.736  90.562  1.00  0.95           N  
ATOM  12073  CA  ILE B 658      52.215  48.555  91.889  1.00  0.95           C  
ATOM  12074  C   ILE B 658      51.977  47.095  92.303  1.00  0.95           C  
ATOM  12075  O   ILE B 658      52.318  46.754  93.439  1.00  0.95           O  
ATOM  12076  CB  ILE B 658      50.961  49.429  92.066  1.00  0.95           C  
ATOM  12077  CG1 ILE B 658      51.380  50.918  92.107  1.00  0.95           C  
ATOM  12078  CG2 ILE B 658      50.162  49.039  93.330  1.00  0.95           C  
ATOM  12079  CD1 ILE B 658      50.222  51.913  92.242  1.00  0.95           C  
ATOM  12080  N   PRO B 659      51.475  46.165  91.490  1.00  0.96           N  
ATOM  12081  CA  PRO B 659      51.393  44.749  91.850  1.00  0.96           C  
ATOM  12082  C   PRO B 659      52.724  44.092  92.136  1.00  0.96           C  
ATOM  12083  O   PRO B 659      52.784  43.128  92.897  1.00  0.96           O  
ATOM  12084  CB  PRO B 659      50.696  44.114  90.642  1.00  0.96           C  
ATOM  12085  CG  PRO B 659      49.807  45.241  90.133  1.00  0.96           C  
ATOM  12086  CD  PRO B 659      50.724  46.446  90.266  1.00  0.96           C  
ATOM  12087  N   ALA B 660      53.819  44.585  91.549  1.00  0.95           N  
ATOM  12088  CA  ALA B 660      55.109  43.950  91.656  1.00  0.95           C  
ATOM  12089  C   ALA B 660      55.989  44.507  92.762  1.00  0.95           C  
ATOM  12090  O   ALA B 660      57.112  44.057  92.956  1.00  0.95           O  
ATOM  12091  CB  ALA B 660      55.839  44.154  90.323  1.00  0.95           C  
ATOM  12092  N   THR B 661      55.524  45.494  93.540  1.00  0.95           N  
ATOM  12093  CA  THR B 661      56.354  46.091  94.587  1.00  0.95           C  
ATOM  12094  C   THR B 661      56.319  45.328  95.889  1.00  0.95           C  
ATOM  12095  O   THR B 661      55.277  44.821  96.295  1.00  0.95           O  
ATOM  12096  CB  THR B 661      56.040  47.553  94.887  1.00  0.95           C  
ATOM  12097  OG1 THR B 661      54.818  47.753  95.580  1.00  0.95           O  
ATOM  12098  CG2 THR B 661      55.864  48.278  93.563  1.00  0.95           C  
ATOM  12099  N   ASP B 662      57.454  45.254  96.601  1.00  0.95           N  
ATOM  12100  CA  ASP B 662      57.454  44.762  97.964  1.00  0.95           C  
ATOM  12101  C   ASP B 662      57.620  45.920  98.931  1.00  0.95           C  
ATOM  12102  O   ASP B 662      57.055  45.907 100.021  1.00  0.95           O  
ATOM  12103  CB  ASP B 662      58.598  43.747  98.159  1.00  0.95           C  
ATOM  12104  CG  ASP B 662      58.125  42.382  97.709  1.00  0.95           C  
ATOM  12105  OD1 ASP B 662      57.242  41.833  98.420  1.00  0.95           O  
ATOM  12106  OD2 ASP B 662      58.637  41.851  96.690  1.00  0.95           O  
ATOM  12107  N   LEU B 663      58.348  46.989  98.552  1.00  0.96           N  
ATOM  12108  CA  LEU B 663      58.583  48.114  99.440  1.00  0.96           C  
ATOM  12109  C   LEU B 663      58.088  49.400  98.811  1.00  0.96           C  
ATOM  12110  O   LEU B 663      58.384  49.740  97.665  1.00  0.96           O  
ATOM  12111  CB  LEU B 663      60.080  48.155  99.841  1.00  0.96           C  
ATOM  12112  CG  LEU B 663      60.530  48.940 101.098  1.00  0.96           C  
ATOM  12113  CD1 LEU B 663      61.128  50.309 100.773  1.00  0.96           C  
ATOM  12114  CD2 LEU B 663      59.494  49.044 102.224  1.00  0.96           C  
ATOM  12115  N   SER B 664      57.238  50.110  99.570  1.00  0.96           N  
ATOM  12116  CA  SER B 664      56.551  51.318  99.160  1.00  0.96           C  
ATOM  12117  C   SER B 664      57.137  52.505  99.877  1.00  0.96           C  
ATOM  12118  O   SER B 664      56.937  52.686 101.078  1.00  0.96           O  
ATOM  12119  CB  SER B 664      55.047  51.215  99.530  1.00  0.96           C  
ATOM  12120  OG  SER B 664      54.300  52.425  99.352  1.00  0.96           O  
ATOM  12121  N   GLU B 665      57.863  53.351  99.130  1.00  0.94           N  
ATOM  12122  CA  GLU B 665      58.513  54.532  99.658  1.00  0.94           C  
ATOM  12123  C   GLU B 665      57.586  55.740  99.726  1.00  0.94           C  
ATOM  12124  O   GLU B 665      57.150  56.310  98.718  1.00  0.94           O  
ATOM  12125  CB  GLU B 665      59.717  54.914  98.773  1.00  0.94           C  
ATOM  12126  CG  GLU B 665      60.931  53.955  98.836  1.00  0.94           C  
ATOM  12127  CD  GLU B 665      61.879  54.280  99.978  1.00  0.94           C  
ATOM  12128  OE1 GLU B 665      61.444  54.939 100.954  1.00  0.94           O  
ATOM  12129  OE2 GLU B 665      63.078  53.906  99.895  1.00  0.94           O  
ATOM  12130  N   GLN B 666      57.276  56.187 100.955  1.00  0.92           N  
ATOM  12131  CA  GLN B 666      56.384  57.300 101.212  1.00  0.92           C  
ATOM  12132  C   GLN B 666      57.049  58.234 102.205  1.00  0.92           C  
ATOM  12133  O   GLN B 666      56.546  58.530 103.286  1.00  0.92           O  
ATOM  12134  CB  GLN B 666      55.016  56.807 101.734  1.00  0.92           C  
ATOM  12135  CG  GLN B 666      54.347  55.736 100.836  1.00  0.92           C  
ATOM  12136  CD  GLN B 666      54.056  56.184  99.402  1.00  0.92           C  
ATOM  12137  OE1 GLN B 666      54.011  57.351  99.002  1.00  0.92           O  
ATOM  12138  NE2 GLN B 666      53.805  55.173  98.539  1.00  0.92           N  
ATOM  12139  N   ILE B 667      58.252  58.702 101.833  1.00  0.92           N  
ATOM  12140  CA  ILE B 667      59.241  59.296 102.724  1.00  0.92           C  
ATOM  12141  C   ILE B 667      59.254  60.810 102.754  1.00  0.92           C  
ATOM  12142  O   ILE B 667      60.234  61.457 103.137  1.00  0.92           O  
ATOM  12143  CB  ILE B 667      60.621  58.802 102.354  1.00  0.92           C  
ATOM  12144  CG1 ILE B 667      61.037  59.183 100.917  1.00  0.92           C  
ATOM  12145  CG2 ILE B 667      60.587  57.279 102.519  1.00  0.92           C  
ATOM  12146  CD1 ILE B 667      62.472  58.767 100.589  1.00  0.92           C  
ATOM  12147  N   SER B 668      58.129  61.410 102.350  1.00  0.91           N  
ATOM  12148  CA  SER B 668      57.867  62.841 102.377  1.00  0.91           C  
ATOM  12149  C   SER B 668      57.996  63.467 103.757  1.00  0.91           C  
ATOM  12150  O   SER B 668      57.796  62.802 104.769  1.00  0.91           O  
ATOM  12151  CB  SER B 668      56.453  63.114 101.837  1.00  0.91           C  
ATOM  12152  OG  SER B 668      56.306  64.442 101.351  1.00  0.91           O  
ATOM  12153  N   THR B 669      58.400  64.746 103.865  1.00  0.90           N  
ATOM  12154  CA  THR B 669      58.621  65.385 105.171  1.00  0.90           C  
ATOM  12155  C   THR B 669      57.371  65.406 106.046  1.00  0.90           C  
ATOM  12156  O   THR B 669      56.265  65.605 105.566  1.00  0.90           O  
ATOM  12157  CB  THR B 669      59.134  66.822 105.088  1.00  0.90           C  
ATOM  12158  OG1 THR B 669      60.159  66.937 104.121  1.00  0.90           O  
ATOM  12159  CG2 THR B 669      59.769  67.290 106.406  1.00  0.90           C  
ATOM  12160  N   ALA B 670      57.480  65.196 107.374  1.00  0.88           N  
ATOM  12161  CA  ALA B 670      56.322  65.319 108.240  1.00  0.88           C  
ATOM  12162  C   ALA B 670      55.750  66.737 108.312  1.00  0.88           C  
ATOM  12163  O   ALA B 670      56.433  67.689 108.691  1.00  0.88           O  
ATOM  12164  CB  ALA B 670      56.656  64.810 109.652  1.00  0.88           C  
ATOM  12165  N   GLY B 671      54.465  66.883 107.937  1.00  0.78           N  
ATOM  12166  CA  GLY B 671      53.731  68.136 107.903  1.00  0.78           C  
ATOM  12167  C   GLY B 671      53.490  68.649 106.511  1.00  0.78           C  
ATOM  12168  O   GLY B 671      53.028  69.776 106.344  1.00  0.78           O  
ATOM  12169  N   THR B 672      53.799  67.856 105.467  1.00  0.79           N  
ATOM  12170  CA  THR B 672      53.633  68.292 104.080  1.00  0.79           C  
ATOM  12171  C   THR B 672      52.657  67.456 103.274  1.00  0.79           C  
ATOM  12172  O   THR B 672      52.360  67.814 102.132  1.00  0.79           O  
ATOM  12173  CB  THR B 672      54.943  68.354 103.294  1.00  0.79           C  
ATOM  12174  OG1 THR B 672      55.582  67.089 103.245  1.00  0.79           O  
ATOM  12175  CG2 THR B 672      55.915  69.326 103.979  1.00  0.79           C  
ATOM  12176  N   GLU B 673      52.084  66.367 103.833  1.00  0.81           N  
ATOM  12177  CA  GLU B 673      51.155  65.515 103.099  1.00  0.81           C  
ATOM  12178  C   GLU B 673      49.782  65.475 103.736  1.00  0.81           C  
ATOM  12179  O   GLU B 673      49.580  65.022 104.855  1.00  0.81           O  
ATOM  12180  CB  GLU B 673      51.632  64.048 103.028  1.00  0.81           C  
ATOM  12181  CG  GLU B 673      52.958  63.869 102.265  1.00  0.81           C  
ATOM  12182  CD  GLU B 673      52.878  64.009 100.759  1.00  0.81           C  
ATOM  12183  OE1 GLU B 673      51.799  64.030 100.113  1.00  0.81           O  
ATOM  12184  OE2 GLU B 673      53.984  64.021 100.150  1.00  0.81           O  
ATOM  12185  N   ALA B 674      48.748  65.921 103.001  1.00  0.89           N  
ATOM  12186  CA  ALA B 674      47.376  65.803 103.451  1.00  0.89           C  
ATOM  12187  C   ALA B 674      46.836  64.378 103.444  1.00  0.89           C  
ATOM  12188  O   ALA B 674      46.079  63.976 104.320  1.00  0.89           O  
ATOM  12189  CB  ALA B 674      46.468  66.687 102.582  1.00  0.89           C  
ATOM  12190  N   SER B 675      47.199  63.588 102.419  1.00  0.91           N  
ATOM  12191  CA  SER B 675      46.633  62.270 102.175  1.00  0.91           C  
ATOM  12192  C   SER B 675      47.712  61.392 101.559  1.00  0.91           C  
ATOM  12193  O   SER B 675      48.889  61.494 101.890  1.00  0.91           O  
ATOM  12194  CB  SER B 675      45.361  62.371 101.278  1.00  0.91           C  
ATOM  12195  OG  SER B 675      44.727  61.118 101.001  1.00  0.91           O  
ATOM  12196  N   GLY B 676      47.351  60.464 100.662  1.00  0.85           N  
ATOM  12197  CA  GLY B 676      48.304  59.552 100.060  1.00  0.85           C  
ATOM  12198  C   GLY B 676      47.638  58.450  99.299  1.00  0.85           C  
ATOM  12199  O   GLY B 676      47.718  57.273  99.630  1.00  0.85           O  
ATOM  12200  N   THR B 677      46.984  58.828  98.194  1.00  0.92           N  
ATOM  12201  CA  THR B 677      46.292  57.960  97.245  1.00  0.92           C  
ATOM  12202  C   THR B 677      47.172  56.862  96.657  1.00  0.92           C  
ATOM  12203  O   THR B 677      46.720  55.760  96.363  1.00  0.92           O  
ATOM  12204  CB  THR B 677      45.679  58.832  96.146  1.00  0.92           C  
ATOM  12205  OG1 THR B 677      44.487  59.420  96.641  1.00  0.92           O  
ATOM  12206  CG2 THR B 677      45.310  58.088  94.855  1.00  0.92           C  
ATOM  12207  N   GLY B 678      48.486  57.091  96.458  1.00  0.96           N  
ATOM  12208  CA  GLY B 678      49.379  56.008  96.038  1.00  0.96           C  
ATOM  12209  C   GLY B 678      49.636  54.968  97.102  1.00  0.96           C  
ATOM  12210  O   GLY B 678      49.711  53.780  96.812  1.00  0.96           O  
ATOM  12211  N   ASN B 679      49.749  55.404  98.368  1.00  0.94           N  
ATOM  12212  CA  ASN B 679      50.125  54.634  99.541  1.00  0.94           C  
ATOM  12213  C   ASN B 679      49.160  53.480  99.782  1.00  0.94           C  
ATOM  12214  O   ASN B 679      49.553  52.338 100.018  1.00  0.94           O  
ATOM  12215  CB  ASN B 679      50.162  55.533 100.821  1.00  0.94           C  
ATOM  12216  CG  ASN B 679      50.850  56.892 100.643  1.00  0.94           C  
ATOM  12217  OD1 ASN B 679      50.865  57.526  99.585  1.00  0.94           O  
ATOM  12218  ND2 ASN B 679      51.414  57.416 101.754  1.00  0.94           N  
ATOM  12219  N   MET B 680      47.853  53.775  99.646  1.00  0.93           N  
ATOM  12220  CA  MET B 680      46.757  52.838  99.784  1.00  0.93           C  
ATOM  12221  C   MET B 680      46.801  51.700  98.768  1.00  0.93           C  
ATOM  12222  O   MET B 680      46.581  50.537  99.096  1.00  0.93           O  
ATOM  12223  CB  MET B 680      45.412  53.591  99.637  1.00  0.93           C  
ATOM  12224  CG  MET B 680      45.281  54.820 100.561  1.00  0.93           C  
ATOM  12225  SD  MET B 680      43.726  55.729 100.317  1.00  0.93           S  
ATOM  12226  CE  MET B 680      44.195  57.176 101.300  1.00  0.93           C  
ATOM  12227  N   LYS B 681      47.130  52.011  97.496  1.00  0.93           N  
ATOM  12228  CA  LYS B 681      47.237  51.043  96.415  1.00  0.93           C  
ATOM  12229  C   LYS B 681      48.315  50.002  96.645  1.00  0.93           C  
ATOM  12230  O   LYS B 681      48.113  48.813  96.413  1.00  0.93           O  
ATOM  12231  CB  LYS B 681      47.578  51.745  95.080  1.00  0.93           C  
ATOM  12232  CG  LYS B 681      46.547  52.782  94.637  1.00  0.93           C  
ATOM  12233  CD  LYS B 681      47.056  53.644  93.478  1.00  0.93           C  
ATOM  12234  CE  LYS B 681      46.103  54.791  93.170  1.00  0.93           C  
ATOM  12235  NZ  LYS B 681      46.747  55.686  92.194  1.00  0.93           N  
ATOM  12236  N   PHE B 682      49.492  50.431  97.132  1.00  0.94           N  
ATOM  12237  CA  PHE B 682      50.582  49.547  97.495  1.00  0.94           C  
ATOM  12238  C   PHE B 682      50.234  48.599  98.628  1.00  0.94           C  
ATOM  12239  O   PHE B 682      50.511  47.404  98.563  1.00  0.94           O  
ATOM  12240  CB  PHE B 682      51.787  50.384  97.964  1.00  0.94           C  
ATOM  12241  CG  PHE B 682      52.404  51.145  96.835  1.00  0.94           C  
ATOM  12242  CD1 PHE B 682      53.011  50.460  95.773  1.00  0.94           C  
ATOM  12243  CD2 PHE B 682      52.473  52.544  96.871  1.00  0.94           C  
ATOM  12244  CE1 PHE B 682      53.724  51.163  94.798  1.00  0.94           C  
ATOM  12245  CE2 PHE B 682      53.143  53.255  95.870  1.00  0.94           C  
ATOM  12246  CZ  PHE B 682      53.772  52.558  94.837  1.00  0.94           C  
ATOM  12247  N   MET B 683      49.565  49.118  99.677  1.00  0.94           N  
ATOM  12248  CA  MET B 683      49.090  48.349 100.813  1.00  0.94           C  
ATOM  12249  C   MET B 683      48.103  47.267 100.402  1.00  0.94           C  
ATOM  12250  O   MET B 683      48.196  46.110 100.808  1.00  0.94           O  
ATOM  12251  CB  MET B 683      48.403  49.328 101.791  1.00  0.94           C  
ATOM  12252  CG  MET B 683      47.969  48.725 103.136  1.00  0.94           C  
ATOM  12253  SD  MET B 683      46.972  49.889 104.108  1.00  0.94           S  
ATOM  12254  CE  MET B 683      47.302  49.089 105.697  1.00  0.94           C  
ATOM  12255  N   LEU B 684      47.163  47.623  99.506  1.00  0.95           N  
ATOM  12256  CA  LEU B 684      46.209  46.714  98.904  1.00  0.95           C  
ATOM  12257  C   LEU B 684      46.892  45.623  98.078  1.00  0.95           C  
ATOM  12258  O   LEU B 684      46.530  44.451  98.114  1.00  0.95           O  
ATOM  12259  CB  LEU B 684      45.247  47.537  98.005  1.00  0.95           C  
ATOM  12260  CG  LEU B 684      43.765  47.100  97.973  1.00  0.95           C  
ATOM  12261  CD1 LEU B 684      43.056  47.759  96.777  1.00  0.95           C  
ATOM  12262  CD2 LEU B 684      43.566  45.583  97.946  1.00  0.95           C  
ATOM  12263  N   ASN B 685      47.954  45.993  97.337  1.00  0.95           N  
ATOM  12264  CA  ASN B 685      48.654  45.100  96.432  1.00  0.95           C  
ATOM  12265  C   ASN B 685      49.804  44.350  97.081  1.00  0.95           C  
ATOM  12266  O   ASN B 685      50.630  43.731  96.407  1.00  0.95           O  
ATOM  12267  CB  ASN B 685      49.178  45.884  95.207  1.00  0.95           C  
ATOM  12268  CG  ASN B 685      48.035  46.004  94.214  1.00  0.95           C  
ATOM  12269  OD1 ASN B 685      47.831  45.096  93.408  1.00  0.95           O  
ATOM  12270  ND2 ASN B 685      47.275  47.114  94.288  1.00  0.95           N  
ATOM  12271  N   GLY B 686      49.875  44.332  98.420  1.00  0.97           N  
ATOM  12272  CA  GLY B 686      50.780  43.442  99.125  1.00  0.97           C  
ATOM  12273  C   GLY B 686      52.188  43.916  99.254  1.00  0.97           C  
ATOM  12274  O   GLY B 686      53.109  43.108  99.263  1.00  0.97           O  
ATOM  12275  N   ALA B 687      52.388  45.231  99.360  1.00  0.98           N  
ATOM  12276  CA  ALA B 687      53.678  45.810  99.640  1.00  0.98           C  
ATOM  12277  C   ALA B 687      53.704  46.366 101.051  1.00  0.98           C  
ATOM  12278  O   ALA B 687      52.686  46.778 101.606  1.00  0.98           O  
ATOM  12279  CB  ALA B 687      53.968  46.938  98.639  1.00  0.98           C  
ATOM  12280  N   LEU B 688      54.893  46.391 101.675  1.00  0.95           N  
ATOM  12281  CA  LEU B 688      55.084  46.997 102.972  1.00  0.95           C  
ATOM  12282  C   LEU B 688      55.476  48.449 102.805  1.00  0.95           C  
ATOM  12283  O   LEU B 688      56.225  48.828 101.907  1.00  0.95           O  
ATOM  12284  CB  LEU B 688      56.153  46.256 103.809  1.00  0.95           C  
ATOM  12285  CG  LEU B 688      55.783  44.793 104.124  1.00  0.95           C  
ATOM  12286  CD1 LEU B 688      56.833  44.132 105.021  1.00  0.95           C  
ATOM  12287  CD2 LEU B 688      54.419  44.685 104.808  1.00  0.95           C  
ATOM  12288  N   THR B 689      54.947  49.327 103.669  1.00  0.95           N  
ATOM  12289  CA  THR B 689      55.139  50.766 103.528  1.00  0.95           C  
ATOM  12290  C   THR B 689      56.231  51.243 104.439  1.00  0.95           C  
ATOM  12291  O   THR B 689      56.163  51.056 105.652  1.00  0.95           O  
ATOM  12292  CB  THR B 689      53.872  51.562 103.822  1.00  0.95           C  
ATOM  12293  OG1 THR B 689      52.834  51.142 102.946  1.00  0.95           O  
ATOM  12294  CG2 THR B 689      54.062  53.069 103.590  1.00  0.95           C  
ATOM  12295  N   ILE B 690      57.259  51.904 103.872  1.00  0.94           N  
ATOM  12296  CA  ILE B 690      58.226  52.679 104.625  1.00  0.94           C  
ATOM  12297  C   ILE B 690      57.817  54.127 104.467  1.00  0.94           C  
ATOM  12298  O   ILE B 690      57.500  54.620 103.384  1.00  0.94           O  
ATOM  12299  CB  ILE B 690      59.683  52.429 104.234  1.00  0.94           C  
ATOM  12300  CG1 ILE B 690      60.659  53.155 105.189  1.00  0.94           C  
ATOM  12301  CG2 ILE B 690      59.926  52.836 102.773  1.00  0.94           C  
ATOM  12302  CD1 ILE B 690      62.124  52.787 104.943  1.00  0.94           C  
ATOM  12303  N   GLY B 691      57.718  54.868 105.576  1.00  0.96           N  
ATOM  12304  CA  GLY B 691      57.155  56.194 105.450  1.00  0.96           C  
ATOM  12305  C   GLY B 691      57.190  56.955 106.719  1.00  0.96           C  
ATOM  12306  O   GLY B 691      57.235  56.413 107.816  1.00  0.96           O  
ATOM  12307  N   THR B 692      57.159  58.281 106.599  1.00  0.93           N  
ATOM  12308  CA  THR B 692      57.014  59.182 107.723  1.00  0.93           C  
ATOM  12309  C   THR B 692      55.608  59.087 108.291  1.00  0.93           C  
ATOM  12310  O   THR B 692      54.657  58.732 107.593  1.00  0.93           O  
ATOM  12311  CB  THR B 692      57.339  60.604 107.313  1.00  0.93           C  
ATOM  12312  OG1 THR B 692      56.541  60.964 106.195  1.00  0.93           O  
ATOM  12313  CG2 THR B 692      58.810  60.643 106.864  1.00  0.93           C  
ATOM  12314  N   MET B 693      55.417  59.354 109.596  1.00  0.85           N  
ATOM  12315  CA  MET B 693      54.082  59.346 110.179  1.00  0.85           C  
ATOM  12316  C   MET B 693      53.303  60.620 109.873  1.00  0.85           C  
ATOM  12317  O   MET B 693      53.116  61.482 110.731  1.00  0.85           O  
ATOM  12318  CB  MET B 693      54.115  59.087 111.699  1.00  0.85           C  
ATOM  12319  CG  MET B 693      52.768  58.618 112.288  1.00  0.85           C  
ATOM  12320  SD  MET B 693      52.220  56.997 111.675  1.00  0.85           S  
ATOM  12321  CE  MET B 693      51.025  56.750 113.019  1.00  0.85           C  
ATOM  12322  N   ASP B 694      52.848  60.743 108.617  1.00  0.83           N  
ATOM  12323  CA  ASP B 694      52.111  61.874 108.106  1.00  0.83           C  
ATOM  12324  C   ASP B 694      51.201  61.376 106.978  1.00  0.83           C  
ATOM  12325  O   ASP B 694      51.284  60.216 106.560  1.00  0.83           O  
ATOM  12326  CB  ASP B 694      53.095  62.972 107.614  1.00  0.83           C  
ATOM  12327  CG  ASP B 694      52.387  64.284 107.323  1.00  0.83           C  
ATOM  12328  OD1 ASP B 694      52.942  65.100 106.547  1.00  0.83           O  
ATOM  12329  OD2 ASP B 694      51.282  64.485 107.885  1.00  0.83           O  
ATOM  12330  N   GLY B 695      50.284  62.238 106.486  1.00  0.86           N  
ATOM  12331  CA  GLY B 695      49.288  61.947 105.454  1.00  0.86           C  
ATOM  12332  C   GLY B 695      48.539  60.643 105.595  1.00  0.86           C  
ATOM  12333  O   GLY B 695      47.975  60.318 106.638  1.00  0.86           O  
ATOM  12334  N   ALA B 696      48.508  59.832 104.519  1.00  0.83           N  
ATOM  12335  CA  ALA B 696      47.843  58.538 104.528  1.00  0.83           C  
ATOM  12336  C   ALA B 696      48.485  57.498 105.431  1.00  0.83           C  
ATOM  12337  O   ALA B 696      47.807  56.595 105.919  1.00  0.83           O  
ATOM  12338  CB  ALA B 696      47.754  57.948 103.111  1.00  0.83           C  
ATOM  12339  N   ASN B 697      49.805  57.606 105.703  1.00  0.87           N  
ATOM  12340  CA  ASN B 697      50.540  56.638 106.505  1.00  0.87           C  
ATOM  12341  C   ASN B 697      49.981  56.540 107.919  1.00  0.87           C  
ATOM  12342  O   ASN B 697      49.910  55.456 108.489  1.00  0.87           O  
ATOM  12343  CB  ASN B 697      52.057  56.948 106.575  1.00  0.87           C  
ATOM  12344  CG  ASN B 697      52.699  56.959 105.190  1.00  0.87           C  
ATOM  12345  OD1 ASN B 697      52.239  56.339 104.229  1.00  0.87           O  
ATOM  12346  ND2 ASN B 697      53.832  57.692 105.085  1.00  0.87           N  
ATOM  12347  N   VAL B 698      49.517  57.679 108.479  1.00  0.90           N  
ATOM  12348  CA  VAL B 698      48.807  57.752 109.749  1.00  0.90           C  
ATOM  12349  C   VAL B 698      47.594  56.836 109.822  1.00  0.90           C  
ATOM  12350  O   VAL B 698      47.539  55.945 110.662  1.00  0.90           O  
ATOM  12351  CB  VAL B 698      48.352  59.189 110.001  1.00  0.90           C  
ATOM  12352  CG1 VAL B 698      47.470  59.303 111.261  1.00  0.90           C  
ATOM  12353  CG2 VAL B 698      49.593  60.082 110.164  1.00  0.90           C  
ATOM  12354  N   GLU B 699      46.614  56.976 108.902  1.00  0.89           N  
ATOM  12355  CA  GLU B 699      45.421  56.143 108.897  1.00  0.89           C  
ATOM  12356  C   GLU B 699      45.707  54.681 108.587  1.00  0.89           C  
ATOM  12357  O   GLU B 699      45.125  53.779 109.180  1.00  0.89           O  
ATOM  12358  CB  GLU B 699      44.301  56.693 107.978  1.00  0.89           C  
ATOM  12359  CG  GLU B 699      43.771  58.075 108.441  1.00  0.89           C  
ATOM  12360  CD  GLU B 699      42.401  58.415 107.870  1.00  0.89           C  
ATOM  12361  OE1 GLU B 699      41.519  57.512 107.833  1.00  0.89           O  
ATOM  12362  OE2 GLU B 699      42.180  59.595 107.489  1.00  0.89           O  
ATOM  12363  N   MET B 700      46.647  54.390 107.667  1.00  0.90           N  
ATOM  12364  CA  MET B 700      47.083  53.031 107.374  1.00  0.90           C  
ATOM  12365  C   MET B 700      47.684  52.327 108.593  1.00  0.90           C  
ATOM  12366  O   MET B 700      47.423  51.152 108.856  1.00  0.90           O  
ATOM  12367  CB  MET B 700      48.115  53.060 106.224  1.00  0.90           C  
ATOM  12368  CG  MET B 700      47.528  53.529 104.877  1.00  0.90           C  
ATOM  12369  SD  MET B 700      48.768  54.101 103.680  1.00  0.90           S  
ATOM  12370  CE  MET B 700      49.814  52.622 103.641  1.00  0.90           C  
ATOM  12371  N   ALA B 701      48.481  53.063 109.392  1.00  0.92           N  
ATOM  12372  CA  ALA B 701      48.989  52.634 110.675  1.00  0.92           C  
ATOM  12373  C   ALA B 701      47.910  52.403 111.721  1.00  0.92           C  
ATOM  12374  O   ALA B 701      48.024  51.492 112.531  1.00  0.92           O  
ATOM  12375  CB  ALA B 701      50.019  53.650 111.189  1.00  0.92           C  
ATOM  12376  N   GLU B 702      46.821  53.191 111.746  1.00  0.87           N  
ATOM  12377  CA  GLU B 702      45.702  52.905 112.631  1.00  0.87           C  
ATOM  12378  C   GLU B 702      45.021  51.574 112.333  1.00  0.87           C  
ATOM  12379  O   GLU B 702      44.797  50.764 113.229  1.00  0.87           O  
ATOM  12380  CB  GLU B 702      44.626  54.010 112.564  1.00  0.87           C  
ATOM  12381  CG  GLU B 702      45.128  55.412 112.973  1.00  0.87           C  
ATOM  12382  CD  GLU B 702      43.982  56.399 113.041  1.00  0.87           C  
ATOM  12383  OE1 GLU B 702      42.817  56.000 113.301  1.00  0.87           O  
ATOM  12384  OE2 GLU B 702      44.196  57.622 112.835  1.00  0.87           O  
ATOM  12385  N   GLU B 703      44.723  51.302 111.049  1.00  0.88           N  
ATOM  12386  CA  GLU B 703      44.044  50.086 110.640  1.00  0.88           C  
ATOM  12387  C   GLU B 703      44.865  48.807 110.751  1.00  0.88           C  
ATOM  12388  O   GLU B 703      44.411  47.788 111.266  1.00  0.88           O  
ATOM  12389  CB  GLU B 703      43.613  50.212 109.165  1.00  0.88           C  
ATOM  12390  CG  GLU B 703      42.706  51.426 108.874  1.00  0.88           C  
ATOM  12391  CD  GLU B 703      41.301  51.327 109.466  1.00  0.88           C  
ATOM  12392  OE1 GLU B 703      40.584  50.348 109.140  1.00  0.88           O  
ATOM  12393  OE2 GLU B 703      40.886  52.315 110.131  1.00  0.88           O  
ATOM  12394  N   ALA B 704      46.119  48.812 110.249  1.00  0.92           N  
ATOM  12395  CA  ALA B 704      46.968  47.639 110.317  1.00  0.92           C  
ATOM  12396  C   ALA B 704      47.711  47.530 111.628  1.00  0.92           C  
ATOM  12397  O   ALA B 704      47.991  46.436 112.106  1.00  0.92           O  
ATOM  12398  CB  ALA B 704      48.007  47.662 109.179  1.00  0.92           C  
ATOM  12399  N   GLY B 705      48.071  48.673 112.232  1.00  0.90           N  
ATOM  12400  CA  GLY B 705      48.982  48.767 113.361  1.00  0.90           C  
ATOM  12401  C   GLY B 705      50.266  49.440 112.964  1.00  0.90           C  
ATOM  12402  O   GLY B 705      50.885  49.074 111.970  1.00  0.90           O  
ATOM  12403  N   GLU B 706      50.746  50.417 113.774  1.00  0.84           N  
ATOM  12404  CA  GLU B 706      51.999  51.144 113.562  1.00  0.84           C  
ATOM  12405  C   GLU B 706      53.199  50.197 113.520  1.00  0.84           C  
ATOM  12406  O   GLU B 706      54.147  50.391 112.769  1.00  0.84           O  
ATOM  12407  CB  GLU B 706      52.165  52.297 114.599  1.00  0.84           C  
ATOM  12408  CG  GLU B 706      53.442  53.161 114.395  1.00  0.84           C  
ATOM  12409  CD  GLU B 706      53.450  54.517 115.108  1.00  0.84           C  
ATOM  12410  OE1 GLU B 706      52.413  54.930 115.676  1.00  0.84           O  
ATOM  12411  OE2 GLU B 706      54.515  55.199 115.070  1.00  0.84           O  
ATOM  12412  N   GLU B 707      53.078  49.063 114.247  1.00  0.86           N  
ATOM  12413  CA  GLU B 707      53.894  47.856 114.163  1.00  0.86           C  
ATOM  12414  C   GLU B 707      54.151  47.344 112.745  1.00  0.86           C  
ATOM  12415  O   GLU B 707      55.237  46.869 112.420  1.00  0.86           O  
ATOM  12416  CB  GLU B 707      53.117  46.737 114.917  1.00  0.86           C  
ATOM  12417  CG  GLU B 707      53.716  45.303 114.892  1.00  0.86           C  
ATOM  12418  CD  GLU B 707      52.680  44.193 114.830  1.00  0.86           C  
ATOM  12419  OE1 GLU B 707      51.469  44.416 114.551  1.00  0.86           O  
ATOM  12420  OE2 GLU B 707      53.090  43.018 115.018  1.00  0.86           O  
ATOM  12421  N   ASN B 708      53.142  47.422 111.860  1.00  0.88           N  
ATOM  12422  CA  ASN B 708      53.170  46.773 110.566  1.00  0.88           C  
ATOM  12423  C   ASN B 708      53.566  47.706 109.442  1.00  0.88           C  
ATOM  12424  O   ASN B 708      53.585  47.304 108.277  1.00  0.88           O  
ATOM  12425  CB  ASN B 708      51.782  46.165 110.257  1.00  0.88           C  
ATOM  12426  CG  ASN B 708      51.527  45.131 111.334  1.00  0.88           C  
ATOM  12427  OD1 ASN B 708      52.248  44.135 111.427  1.00  0.88           O  
ATOM  12428  ND2 ASN B 708      50.497  45.353 112.174  1.00  0.88           N  
ATOM  12429  N   LEU B 709      53.922  48.963 109.761  1.00  0.89           N  
ATOM  12430  CA  LEU B 709      54.448  49.899 108.795  1.00  0.89           C  
ATOM  12431  C   LEU B 709      55.824  50.306 109.263  1.00  0.89           C  
ATOM  12432  O   LEU B 709      56.104  50.431 110.451  1.00  0.89           O  
ATOM  12433  CB  LEU B 709      53.621  51.202 108.645  1.00  0.89           C  
ATOM  12434  CG  LEU B 709      52.131  51.068 108.269  1.00  0.89           C  
ATOM  12435  CD1 LEU B 709      51.605  52.440 107.829  1.00  0.89           C  
ATOM  12436  CD2 LEU B 709      51.842  50.057 107.157  1.00  0.89           C  
ATOM  12437  N   PHE B 710      56.747  50.550 108.329  1.00  0.92           N  
ATOM  12438  CA  PHE B 710      58.085  50.996 108.647  1.00  0.92           C  
ATOM  12439  C   PHE B 710      58.143  52.499 108.870  1.00  0.92           C  
ATOM  12440  O   PHE B 710      58.714  53.264 108.090  1.00  0.92           O  
ATOM  12441  CB  PHE B 710      59.062  50.529 107.551  1.00  0.92           C  
ATOM  12442  CG  PHE B 710      59.418  49.094 107.784  1.00  0.92           C  
ATOM  12443  CD1 PHE B 710      58.663  48.056 107.212  1.00  0.92           C  
ATOM  12444  CD2 PHE B 710      60.522  48.775 108.590  1.00  0.92           C  
ATOM  12445  CE1 PHE B 710      59.021  46.720 107.427  1.00  0.92           C  
ATOM  12446  CE2 PHE B 710      60.876  47.441 108.808  1.00  0.92           C  
ATOM  12447  CZ  PHE B 710      60.133  46.416 108.221  1.00  0.92           C  
ATOM  12448  N   ILE B 711      57.522  52.956 109.972  1.00  0.91           N  
ATOM  12449  CA  ILE B 711      57.548  54.340 110.400  1.00  0.91           C  
ATOM  12450  C   ILE B 711      58.943  54.794 110.799  1.00  0.91           C  
ATOM  12451  O   ILE B 711      59.686  54.098 111.493  1.00  0.91           O  
ATOM  12452  CB  ILE B 711      56.533  54.643 111.496  1.00  0.91           C  
ATOM  12453  CG1 ILE B 711      55.103  54.198 111.101  1.00  0.91           C  
ATOM  12454  CG2 ILE B 711      56.530  56.148 111.841  1.00  0.91           C  
ATOM  12455  CD1 ILE B 711      54.574  54.765 109.776  1.00  0.91           C  
ATOM  12456  N   PHE B 712      59.339  56.002 110.363  1.00  0.92           N  
ATOM  12457  CA  PHE B 712      60.640  56.548 110.674  1.00  0.92           C  
ATOM  12458  C   PHE B 712      60.617  58.060 110.633  1.00  0.92           C  
ATOM  12459  O   PHE B 712      59.627  58.679 110.244  1.00  0.92           O  
ATOM  12460  CB  PHE B 712      61.768  55.998 109.744  1.00  0.92           C  
ATOM  12461  CG  PHE B 712      61.778  56.621 108.371  1.00  0.92           C  
ATOM  12462  CD1 PHE B 712      62.672  57.668 108.085  1.00  0.92           C  
ATOM  12463  CD2 PHE B 712      60.821  56.261 107.414  1.00  0.92           C  
ATOM  12464  CE1 PHE B 712      62.573  58.383 106.888  1.00  0.92           C  
ATOM  12465  CE2 PHE B 712      60.732  56.964 106.209  1.00  0.92           C  
ATOM  12466  CZ  PHE B 712      61.599  58.032 105.953  1.00  0.92           C  
ATOM  12467  N   GLY B 713      61.765  58.663 111.007  1.00  0.93           N  
ATOM  12468  CA  GLY B 713      61.983  60.091 110.875  1.00  0.93           C  
ATOM  12469  C   GLY B 713      61.252  60.914 111.881  1.00  0.93           C  
ATOM  12470  O   GLY B 713      60.550  60.415 112.762  1.00  0.93           O  
ATOM  12471  N   MET B 714      61.440  62.230 111.765  1.00  0.88           N  
ATOM  12472  CA  MET B 714      60.756  63.208 112.572  1.00  0.88           C  
ATOM  12473  C   MET B 714      59.238  63.158 112.434  1.00  0.88           C  
ATOM  12474  O   MET B 714      58.672  63.032 111.348  1.00  0.88           O  
ATOM  12475  CB  MET B 714      61.262  64.616 112.191  1.00  0.88           C  
ATOM  12476  CG  MET B 714      62.725  64.869 112.598  1.00  0.88           C  
ATOM  12477  SD  MET B 714      63.317  66.537 112.181  1.00  0.88           S  
ATOM  12478  CE  MET B 714      63.481  66.168 110.414  1.00  0.88           C  
ATOM  12479  N   ARG B 715      58.529  63.278 113.566  1.00  0.81           N  
ATOM  12480  CA  ARG B 715      57.100  63.486 113.603  1.00  0.81           C  
ATOM  12481  C   ARG B 715      56.817  64.966 113.352  1.00  0.81           C  
ATOM  12482  O   ARG B 715      57.723  65.793 113.274  1.00  0.81           O  
ATOM  12483  CB  ARG B 715      56.506  63.015 114.960  1.00  0.81           C  
ATOM  12484  CG  ARG B 715      56.825  61.544 115.336  1.00  0.81           C  
ATOM  12485  CD  ARG B 715      56.125  60.477 114.484  1.00  0.81           C  
ATOM  12486  NE  ARG B 715      56.668  59.135 114.890  1.00  0.81           N  
ATOM  12487  CZ  ARG B 715      55.953  58.020 115.102  1.00  0.81           C  
ATOM  12488  NH1 ARG B 715      54.633  57.993 115.222  1.00  0.81           N  
ATOM  12489  NH2 ARG B 715      56.578  56.850 115.183  1.00  0.81           N  
ATOM  12490  N   ILE B 716      55.539  65.359 113.174  1.00  0.80           N  
ATOM  12491  CA  ILE B 716      55.173  66.737 112.840  1.00  0.80           C  
ATOM  12492  C   ILE B 716      55.609  67.735 113.919  1.00  0.80           C  
ATOM  12493  O   ILE B 716      56.152  68.803 113.628  1.00  0.80           O  
ATOM  12494  CB  ILE B 716      53.679  66.871 112.526  1.00  0.80           C  
ATOM  12495  CG1 ILE B 716      53.235  65.804 111.490  1.00  0.80           C  
ATOM  12496  CG2 ILE B 716      53.399  68.292 111.982  1.00  0.80           C  
ATOM  12497  CD1 ILE B 716      51.731  65.795 111.189  1.00  0.80           C  
ATOM  12498  N   ASP B 717      55.454  67.353 115.201  1.00  0.78           N  
ATOM  12499  CA  ASP B 717      55.937  68.075 116.363  1.00  0.78           C  
ATOM  12500  C   ASP B 717      57.456  68.267 116.377  1.00  0.78           C  
ATOM  12501  O   ASP B 717      57.963  69.362 116.619  1.00  0.78           O  
ATOM  12502  CB  ASP B 717      55.517  67.276 117.617  1.00  0.78           C  
ATOM  12503  CG  ASP B 717      54.025  67.027 117.543  1.00  0.78           C  
ATOM  12504  OD1 ASP B 717      53.255  68.003 117.697  1.00  0.78           O  
ATOM  12505  OD2 ASP B 717      53.650  65.867 117.241  1.00  0.78           O  
ATOM  12506  N   ASP B 718      58.223  67.206 116.057  1.00  0.83           N  
ATOM  12507  CA  ASP B 718      59.674  67.187 115.971  1.00  0.83           C  
ATOM  12508  C   ASP B 718      60.201  68.172 114.927  1.00  0.83           C  
ATOM  12509  O   ASP B 718      61.141  68.933 115.163  1.00  0.83           O  
ATOM  12510  CB  ASP B 718      60.206  65.775 115.596  1.00  0.83           C  
ATOM  12511  CG  ASP B 718      59.589  64.630 116.383  1.00  0.83           C  
ATOM  12512  OD1 ASP B 718      58.821  64.861 117.344  1.00  0.83           O  
ATOM  12513  OD2 ASP B 718      59.839  63.473 115.954  1.00  0.83           O  
ATOM  12514  N   VAL B 719      59.563  68.209 113.735  1.00  0.85           N  
ATOM  12515  CA  VAL B 719      59.904  69.151 112.675  1.00  0.85           C  
ATOM  12516  C   VAL B 719      59.660  70.593 113.101  1.00  0.85           C  
ATOM  12517  O   VAL B 719      60.531  71.448 112.948  1.00  0.85           O  
ATOM  12518  CB  VAL B 719      59.146  68.862 111.378  1.00  0.85           C  
ATOM  12519  CG1 VAL B 719      59.526  69.860 110.266  1.00  0.85           C  
ATOM  12520  CG2 VAL B 719      59.472  67.445 110.877  1.00  0.85           C  
ATOM  12521  N   ALA B 720      58.497  70.866 113.728  1.00  0.81           N  
ATOM  12522  CA  ALA B 720      58.143  72.158 114.289  1.00  0.81           C  
ATOM  12523  C   ALA B 720      59.068  72.627 115.410  1.00  0.81           C  
ATOM  12524  O   ALA B 720      59.422  73.801 115.502  1.00  0.81           O  
ATOM  12525  CB  ALA B 720      56.679  72.119 114.768  1.00  0.81           C  
ATOM  12526  N   ALA B 721      59.518  71.705 116.282  1.00  0.78           N  
ATOM  12527  CA  ALA B 721      60.526  71.959 117.290  1.00  0.78           C  
ATOM  12528  C   ALA B 721      61.874  72.389 116.709  1.00  0.78           C  
ATOM  12529  O   ALA B 721      62.536  73.300 117.211  1.00  0.78           O  
ATOM  12530  CB  ALA B 721      60.704  70.679 118.126  1.00  0.78           C  
ATOM  12531  N   LEU B 722      62.305  71.743 115.605  1.00  0.77           N  
ATOM  12532  CA  LEU B 722      63.487  72.126 114.854  1.00  0.77           C  
ATOM  12533  C   LEU B 722      63.355  73.487 114.179  1.00  0.77           C  
ATOM  12534  O   LEU B 722      64.274  74.310 114.245  1.00  0.77           O  
ATOM  12535  CB  LEU B 722      63.858  71.016 113.839  1.00  0.77           C  
ATOM  12536  CG  LEU B 722      65.165  71.224 113.043  1.00  0.77           C  
ATOM  12537  CD1 LEU B 722      66.362  71.537 113.953  1.00  0.77           C  
ATOM  12538  CD2 LEU B 722      65.470  69.973 112.206  1.00  0.77           C  
ATOM  12539  N   ASP B 723      62.175  73.800 113.595  1.00  0.75           N  
ATOM  12540  CA  ASP B 723      61.856  75.087 112.977  1.00  0.75           C  
ATOM  12541  C   ASP B 723      61.580  76.210 113.983  1.00  0.75           C  
ATOM  12542  O   ASP B 723      60.868  77.182 113.734  1.00  0.75           O  
ATOM  12543  CB  ASP B 723      60.673  74.952 111.985  1.00  0.75           C  
ATOM  12544  CG  ASP B 723      61.132  74.147 110.799  1.00  0.75           C  
ATOM  12545  OD1 ASP B 723      62.244  74.414 110.266  1.00  0.75           O  
ATOM  12546  OD2 ASP B 723      60.464  73.160 110.405  1.00  0.75           O  
ATOM  12547  N   LYS B 724      62.226  76.116 115.149  1.00  0.70           N  
ATOM  12548  CA  LYS B 724      62.245  77.131 116.164  1.00  0.70           C  
ATOM  12549  C   LYS B 724      63.655  77.301 116.711  1.00  0.70           C  
ATOM  12550  O   LYS B 724      63.928  78.204 117.501  1.00  0.70           O  
ATOM  12551  CB  LYS B 724      61.276  76.681 117.284  1.00  0.70           C  
ATOM  12552  CG  LYS B 724      61.051  77.684 118.426  1.00  0.70           C  
ATOM  12553  CD  LYS B 724      60.513  79.034 117.924  1.00  0.70           C  
ATOM  12554  CE  LYS B 724      60.253  80.051 119.033  1.00  0.70           C  
ATOM  12555  NZ  LYS B 724      59.224  79.534 119.962  1.00  0.70           N  
ATOM  12556  N   LYS B 725      64.616  76.457 116.281  1.00  0.71           N  
ATOM  12557  CA  LYS B 725      65.993  76.577 116.725  1.00  0.71           C  
ATOM  12558  C   LYS B 725      66.937  76.830 115.578  1.00  0.71           C  
ATOM  12559  O   LYS B 725      67.804  77.694 115.664  1.00  0.71           O  
ATOM  12560  CB  LYS B 725      66.457  75.268 117.420  1.00  0.71           C  
ATOM  12561  CG  LYS B 725      65.901  75.074 118.840  1.00  0.71           C  
ATOM  12562  CD  LYS B 725      66.476  76.106 119.824  1.00  0.71           C  
ATOM  12563  CE  LYS B 725      65.951  75.989 121.256  1.00  0.71           C  
ATOM  12564  NZ  LYS B 725      66.316  74.677 121.837  1.00  0.71           N  
ATOM  12565  N   GLY B 726      66.787  76.088 114.469  1.00  0.76           N  
ATOM  12566  CA  GLY B 726      67.737  76.157 113.373  1.00  0.76           C  
ATOM  12567  C   GLY B 726      68.123  74.787 112.928  1.00  0.76           C  
ATOM  12568  O   GLY B 726      68.623  73.974 113.693  1.00  0.76           O  
ATOM  12569  N   TYR B 727      67.910  74.497 111.641  1.00  0.78           N  
ATOM  12570  CA  TYR B 727      68.439  73.310 111.013  1.00  0.78           C  
ATOM  12571  C   TYR B 727      69.751  73.680 110.349  1.00  0.78           C  
ATOM  12572  O   TYR B 727      69.761  74.167 109.218  1.00  0.78           O  
ATOM  12573  CB  TYR B 727      67.390  72.802 109.986  1.00  0.78           C  
ATOM  12574  CG  TYR B 727      67.867  71.704 109.069  1.00  0.78           C  
ATOM  12575  CD1 TYR B 727      68.294  70.439 109.519  1.00  0.78           C  
ATOM  12576  CD2 TYR B 727      67.891  71.978 107.696  1.00  0.78           C  
ATOM  12577  CE1 TYR B 727      68.692  69.452 108.593  1.00  0.78           C  
ATOM  12578  CE2 TYR B 727      68.326  71.011 106.796  1.00  0.78           C  
ATOM  12579  CZ  TYR B 727      68.678  69.739 107.221  1.00  0.78           C  
ATOM  12580  OH  TYR B 727      68.926  68.790 106.209  1.00  0.78           O  
ATOM  12581  N   GLU B 728      70.900  73.443 111.017  1.00  0.77           N  
ATOM  12582  CA  GLU B 728      72.166  73.587 110.331  1.00  0.77           C  
ATOM  12583  C   GLU B 728      72.581  72.251 109.743  1.00  0.77           C  
ATOM  12584  O   GLU B 728      73.083  71.326 110.375  1.00  0.77           O  
ATOM  12585  CB  GLU B 728      73.308  74.261 111.126  1.00  0.77           C  
ATOM  12586  CG  GLU B 728      74.444  74.687 110.155  1.00  0.77           C  
ATOM  12587  CD  GLU B 728      75.677  75.350 110.764  1.00  0.77           C  
ATOM  12588  OE1 GLU B 728      75.696  75.684 111.967  1.00  0.77           O  
ATOM  12589  OE2 GLU B 728      76.634  75.536 109.961  1.00  0.77           O  
ATOM  12590  N   ALA B 729      72.391  72.125 108.422  1.00  0.86           N  
ATOM  12591  CA  ALA B 729      72.621  70.919 107.659  1.00  0.86           C  
ATOM  12592  C   ALA B 729      74.088  70.472 107.643  1.00  0.86           C  
ATOM  12593  O   ALA B 729      74.422  69.310 107.412  1.00  0.86           O  
ATOM  12594  CB  ALA B 729      72.090  71.234 106.259  1.00  0.86           C  
ATOM  12595  N   LYS B 730      74.999  71.406 107.968  1.00  0.77           N  
ATOM  12596  CA  LYS B 730      76.410  71.185 108.192  1.00  0.77           C  
ATOM  12597  C   LYS B 730      76.721  70.249 109.358  1.00  0.77           C  
ATOM  12598  O   LYS B 730      77.661  69.459 109.280  1.00  0.77           O  
ATOM  12599  CB  LYS B 730      77.078  72.560 108.413  1.00  0.77           C  
ATOM  12600  CG  LYS B 730      78.613  72.579 108.341  1.00  0.77           C  
ATOM  12601  CD  LYS B 730      79.199  73.972 108.652  1.00  0.77           C  
ATOM  12602  CE  LYS B 730      78.704  75.125 107.763  1.00  0.77           C  
ATOM  12603  NZ  LYS B 730      78.964  74.841 106.336  1.00  0.77           N  
ATOM  12604  N   GLU B 731      75.936  70.295 110.460  1.00  0.75           N  
ATOM  12605  CA  GLU B 731      76.149  69.459 111.635  1.00  0.75           C  
ATOM  12606  C   GLU B 731      76.060  67.970 111.343  1.00  0.75           C  
ATOM  12607  O   GLU B 731      76.956  67.187 111.655  1.00  0.75           O  
ATOM  12608  CB  GLU B 731      75.054  69.733 112.696  1.00  0.75           C  
ATOM  12609  CG  GLU B 731      74.954  71.187 113.204  1.00  0.75           C  
ATOM  12610  CD  GLU B 731      73.753  71.314 114.142  1.00  0.75           C  
ATOM  12611  OE1 GLU B 731      73.873  70.837 115.301  1.00  0.75           O  
ATOM  12612  OE2 GLU B 731      72.703  71.849 113.696  1.00  0.75           O  
ATOM  12613  N   TYR B 732      74.975  67.555 110.659  1.00  0.81           N  
ATOM  12614  CA  TYR B 732      74.712  66.177 110.295  1.00  0.81           C  
ATOM  12615  C   TYR B 732      75.756  65.612 109.347  1.00  0.81           C  
ATOM  12616  O   TYR B 732      76.123  64.446 109.439  1.00  0.81           O  
ATOM  12617  CB  TYR B 732      73.325  66.033 109.624  1.00  0.81           C  
ATOM  12618  CG  TYR B 732      72.200  66.361 110.568  1.00  0.81           C  
ATOM  12619  CD1 TYR B 732      71.657  67.658 110.617  1.00  0.81           C  
ATOM  12620  CD2 TYR B 732      71.636  65.358 111.377  1.00  0.81           C  
ATOM  12621  CE1 TYR B 732      70.562  67.940 111.445  1.00  0.81           C  
ATOM  12622  CE2 TYR B 732      70.540  65.641 112.206  1.00  0.81           C  
ATOM  12623  CZ  TYR B 732      69.996  66.931 112.229  1.00  0.81           C  
ATOM  12624  OH  TYR B 732      68.862  67.210 113.016  1.00  0.81           O  
ATOM  12625  N   TYR B 733      76.262  66.437 108.409  1.00  0.79           N  
ATOM  12626  CA  TYR B 733      77.267  66.055 107.429  1.00  0.79           C  
ATOM  12627  C   TYR B 733      78.553  65.496 108.033  1.00  0.79           C  
ATOM  12628  O   TYR B 733      78.944  64.381 107.707  1.00  0.79           O  
ATOM  12629  CB  TYR B 733      77.553  67.329 106.589  1.00  0.79           C  
ATOM  12630  CG  TYR B 733      78.650  67.244 105.559  1.00  0.79           C  
ATOM  12631  CD1 TYR B 733      78.624  66.311 104.506  1.00  0.79           C  
ATOM  12632  CD2 TYR B 733      79.686  68.193 105.603  1.00  0.79           C  
ATOM  12633  CE1 TYR B 733      79.605  66.359 103.497  1.00  0.79           C  
ATOM  12634  CE2 TYR B 733      80.643  68.251 104.586  1.00  0.79           C  
ATOM  12635  CZ  TYR B 733      80.597  67.345 103.529  1.00  0.79           C  
ATOM  12636  OH  TYR B 733      81.572  67.468 102.520  1.00  0.79           O  
ATOM  12637  N   GLU B 734      79.193  66.229 108.966  1.00  0.69           N  
ATOM  12638  CA  GLU B 734      80.384  65.758 109.664  1.00  0.69           C  
ATOM  12639  C   GLU B 734      80.071  64.661 110.676  1.00  0.69           C  
ATOM  12640  O   GLU B 734      80.788  63.677 110.838  1.00  0.69           O  
ATOM  12641  CB  GLU B 734      81.097  66.951 110.348  1.00  0.69           C  
ATOM  12642  CG  GLU B 734      82.458  66.615 111.019  1.00  0.69           C  
ATOM  12643  CD  GLU B 734      83.601  66.355 110.032  1.00  0.69           C  
ATOM  12644  OE1 GLU B 734      84.574  67.153 110.071  1.00  0.69           O  
ATOM  12645  OE2 GLU B 734      83.531  65.372 109.253  1.00  0.69           O  
ATOM  12646  N   ALA B 735      78.930  64.785 111.387  1.00  0.80           N  
ATOM  12647  CA  ALA B 735      78.497  63.815 112.371  1.00  0.80           C  
ATOM  12648  C   ALA B 735      78.239  62.403 111.834  1.00  0.80           C  
ATOM  12649  O   ALA B 735      78.441  61.414 112.537  1.00  0.80           O  
ATOM  12650  CB  ALA B 735      77.245  64.348 113.093  1.00  0.80           C  
ATOM  12651  N   LEU B 736      77.769  62.271 110.578  1.00  0.80           N  
ATOM  12652  CA  LEU B 736      77.353  61.001 110.018  1.00  0.80           C  
ATOM  12653  C   LEU B 736      78.318  60.442 108.962  1.00  0.80           C  
ATOM  12654  O   LEU B 736      78.391  60.987 107.857  1.00  0.80           O  
ATOM  12655  CB  LEU B 736      75.960  61.160 109.380  1.00  0.80           C  
ATOM  12656  CG  LEU B 736      74.831  61.302 110.417  1.00  0.80           C  
ATOM  12657  CD1 LEU B 736      73.538  61.766 109.739  1.00  0.80           C  
ATOM  12658  CD2 LEU B 736      74.606  59.981 111.163  1.00  0.80           C  
ATOM  12659  N   PRO B 737      79.040  59.328 109.199  1.00  0.77           N  
ATOM  12660  CA  PRO B 737      80.156  58.889 108.353  1.00  0.77           C  
ATOM  12661  C   PRO B 737      79.770  58.574 106.923  1.00  0.77           C  
ATOM  12662  O   PRO B 737      80.442  58.999 105.983  1.00  0.77           O  
ATOM  12663  CB  PRO B 737      80.689  57.624 109.059  1.00  0.77           C  
ATOM  12664  CG  PRO B 737      80.296  57.804 110.526  1.00  0.77           C  
ATOM  12665  CD  PRO B 737      78.975  58.559 110.448  1.00  0.77           C  
ATOM  12666  N   GLU B 738      78.677  57.812 106.743  1.00  0.80           N  
ATOM  12667  CA  GLU B 738      78.153  57.447 105.445  1.00  0.80           C  
ATOM  12668  C   GLU B 738      77.620  58.646 104.685  1.00  0.80           C  
ATOM  12669  O   GLU B 738      77.851  58.790 103.487  1.00  0.80           O  
ATOM  12670  CB  GLU B 738      77.058  56.366 105.581  1.00  0.80           C  
ATOM  12671  CG  GLU B 738      77.594  55.045 106.182  1.00  0.80           C  
ATOM  12672  CD  GLU B 738      76.577  53.918 106.117  1.00  0.80           C  
ATOM  12673  OE1 GLU B 738      75.453  54.053 106.666  1.00  0.80           O  
ATOM  12674  OE2 GLU B 738      76.904  52.871 105.505  1.00  0.80           O  
ATOM  12675  N   LEU B 739      76.930  59.572 105.387  1.00  0.84           N  
ATOM  12676  CA  LEU B 739      76.368  60.765 104.783  1.00  0.84           C  
ATOM  12677  C   LEU B 739      77.417  61.674 104.183  1.00  0.84           C  
ATOM  12678  O   LEU B 739      77.284  62.126 103.048  1.00  0.84           O  
ATOM  12679  CB  LEU B 739      75.585  61.599 105.817  1.00  0.84           C  
ATOM  12680  CG  LEU B 739      74.881  62.841 105.236  1.00  0.84           C  
ATOM  12681  CD1 LEU B 739      73.818  62.465 104.197  1.00  0.84           C  
ATOM  12682  CD2 LEU B 739      74.275  63.672 106.372  1.00  0.84           C  
ATOM  12683  N   LYS B 740      78.525  61.899 104.921  1.00  0.79           N  
ATOM  12684  CA  LYS B 740      79.676  62.643 104.452  1.00  0.79           C  
ATOM  12685  C   LYS B 740      80.192  62.104 103.130  1.00  0.79           C  
ATOM  12686  O   LYS B 740      80.310  62.835 102.156  1.00  0.79           O  
ATOM  12687  CB  LYS B 740      80.795  62.535 105.513  1.00  0.79           C  
ATOM  12688  CG  LYS B 740      82.152  63.137 105.114  1.00  0.79           C  
ATOM  12689  CD  LYS B 740      83.308  62.376 105.782  1.00  0.79           C  
ATOM  12690  CE  LYS B 740      84.605  62.323 104.970  1.00  0.79           C  
ATOM  12691  NZ  LYS B 740      84.358  61.713 103.654  1.00  0.79           N  
ATOM  12692  N   LEU B 741      80.413  60.778 103.035  1.00  0.83           N  
ATOM  12693  CA  LEU B 741      80.896  60.135 101.827  1.00  0.83           C  
ATOM  12694  C   LEU B 741      79.981  60.319 100.623  1.00  0.83           C  
ATOM  12695  O   LEU B 741      80.442  60.665  99.538  1.00  0.83           O  
ATOM  12696  CB  LEU B 741      81.103  58.630 102.126  1.00  0.83           C  
ATOM  12697  CG  LEU B 741      81.606  57.756 100.959  1.00  0.83           C  
ATOM  12698  CD1 LEU B 741      82.916  58.266 100.344  1.00  0.83           C  
ATOM  12699  CD2 LEU B 741      81.773  56.304 101.428  1.00  0.83           C  
ATOM  12700  N   VAL B 742      78.654  60.157 100.802  1.00  0.86           N  
ATOM  12701  CA  VAL B 742      77.675  60.395  99.749  1.00  0.86           C  
ATOM  12702  C   VAL B 742      77.689  61.837  99.252  1.00  0.86           C  
ATOM  12703  O   VAL B 742      77.761  62.109  98.055  1.00  0.86           O  
ATOM  12704  CB  VAL B 742      76.271  60.039 100.247  1.00  0.86           C  
ATOM  12705  CG1 VAL B 742      75.191  60.378  99.204  1.00  0.86           C  
ATOM  12706  CG2 VAL B 742      76.209  58.534 100.563  1.00  0.86           C  
ATOM  12707  N   ILE B 743      77.669  62.817 100.172  1.00  0.83           N  
ATOM  12708  CA  ILE B 743      77.657  64.232  99.830  1.00  0.83           C  
ATOM  12709  C   ILE B 743      78.961  64.706  99.198  1.00  0.83           C  
ATOM  12710  O   ILE B 743      78.927  65.438  98.207  1.00  0.83           O  
ATOM  12711  CB  ILE B 743      77.169  65.072 101.003  1.00  0.83           C  
ATOM  12712  CG1 ILE B 743      75.759  64.613 101.459  1.00  0.83           C  
ATOM  12713  CG2 ILE B 743      77.152  66.578 100.667  1.00  0.83           C  
ATOM  12714  CD1 ILE B 743      74.682  64.585 100.364  1.00  0.83           C  
ATOM  12715  N   ASP B 744      80.132  64.223  99.677  1.00  0.85           N  
ATOM  12716  CA  ASP B 744      81.425  64.465  99.046  1.00  0.85           C  
ATOM  12717  C   ASP B 744      81.448  63.996  97.595  1.00  0.85           C  
ATOM  12718  O   ASP B 744      81.834  64.714  96.675  1.00  0.85           O  
ATOM  12719  CB  ASP B 744      82.546  63.651  99.733  1.00  0.85           C  
ATOM  12720  CG  ASP B 744      82.784  64.053 101.166  1.00  0.85           C  
ATOM  12721  OD1 ASP B 744      82.347  65.125 101.640  1.00  0.85           O  
ATOM  12722  OD2 ASP B 744      83.458  63.233 101.841  1.00  0.85           O  
ATOM  12723  N   GLN B 745      80.948  62.768  97.349  1.00  0.85           N  
ATOM  12724  CA  GLN B 745      80.850  62.173  96.031  1.00  0.85           C  
ATOM  12725  C   GLN B 745      79.982  62.968  95.064  1.00  0.85           C  
ATOM  12726  O   GLN B 745      80.323  63.112  93.890  1.00  0.85           O  
ATOM  12727  CB  GLN B 745      80.286  60.735  96.140  1.00  0.85           C  
ATOM  12728  CG  GLN B 745      81.316  59.703  96.651  1.00  0.85           C  
ATOM  12729  CD  GLN B 745      80.630  58.367  96.934  1.00  0.85           C  
ATOM  12730  OE1 GLN B 745      79.491  58.310  97.398  1.00  0.85           O  
ATOM  12731  NE2 GLN B 745      81.330  57.248  96.643  1.00  0.85           N  
ATOM  12732  N   ILE B 746      78.836  63.503  95.526  1.00  0.86           N  
ATOM  12733  CA  ILE B 746      77.985  64.370  94.723  1.00  0.86           C  
ATOM  12734  C   ILE B 746      78.647  65.716  94.392  1.00  0.86           C  
ATOM  12735  O   ILE B 746      78.625  66.136  93.237  1.00  0.86           O  
ATOM  12736  CB  ILE B 746      76.614  64.548  95.380  1.00  0.86           C  
ATOM  12737  CG1 ILE B 746      75.890  63.189  95.540  1.00  0.86           C  
ATOM  12738  CG2 ILE B 746      75.723  65.490  94.544  1.00  0.86           C  
ATOM  12739  CD1 ILE B 746      74.667  63.261  96.464  1.00  0.86           C  
ATOM  12740  N   ASP B 747      79.289  66.408  95.367  1.00  0.85           N  
ATOM  12741  CA  ASP B 747      80.005  67.665  95.131  1.00  0.85           C  
ATOM  12742  C   ASP B 747      81.272  67.518  94.279  1.00  0.85           C  
ATOM  12743  O   ASP B 747      81.591  68.358  93.439  1.00  0.85           O  
ATOM  12744  CB  ASP B 747      80.349  68.375  96.475  1.00  0.85           C  
ATOM  12745  CG  ASP B 747      80.740  69.821  96.253  1.00  0.85           C  
ATOM  12746  OD1 ASP B 747      79.849  70.646  95.921  1.00  0.85           O  
ATOM  12747  OD2 ASP B 747      81.939  70.182  96.372  1.00  0.85           O  
ATOM  12748  N   ASN B 748      82.042  66.428  94.471  1.00  0.85           N  
ATOM  12749  CA  ASN B 748      83.303  66.234  93.777  1.00  0.85           C  
ATOM  12750  C   ASN B 748      83.118  65.563  92.424  1.00  0.85           C  
ATOM  12751  O   ASN B 748      84.079  65.391  91.678  1.00  0.85           O  
ATOM  12752  CB  ASN B 748      84.266  65.324  94.593  1.00  0.85           C  
ATOM  12753  CG  ASN B 748      84.680  65.881  95.954  1.00  0.85           C  
ATOM  12754  OD1 ASN B 748      84.931  65.115  96.885  1.00  0.85           O  
ATOM  12755  ND2 ASN B 748      84.826  67.217  96.080  1.00  0.85           N  
ATOM  12756  N   GLY B 749      81.879  65.186  92.052  1.00  0.86           N  
ATOM  12757  CA  GLY B 749      81.599  64.704  90.706  1.00  0.86           C  
ATOM  12758  C   GLY B 749      81.852  63.253  90.455  1.00  0.86           C  
ATOM  12759  O   GLY B 749      82.100  62.844  89.326  1.00  0.86           O  
ATOM  12760  N   PHE B 750      81.761  62.402  91.488  1.00  0.89           N  
ATOM  12761  CA  PHE B 750      81.929  60.961  91.367  1.00  0.89           C  
ATOM  12762  C   PHE B 750      80.883  60.340  90.441  1.00  0.89           C  
ATOM  12763  O   PHE B 750      81.166  59.469  89.623  1.00  0.89           O  
ATOM  12764  CB  PHE B 750      81.871  60.353  92.791  1.00  0.89           C  
ATOM  12765  CG  PHE B 750      81.991  58.856  92.809  1.00  0.89           C  
ATOM  12766  CD1 PHE B 750      83.137  58.200  92.335  1.00  0.89           C  
ATOM  12767  CD2 PHE B 750      80.911  58.092  93.264  1.00  0.89           C  
ATOM  12768  CE1 PHE B 750      83.195  56.799  92.313  1.00  0.89           C  
ATOM  12769  CE2 PHE B 750      80.957  56.699  93.237  1.00  0.89           C  
ATOM  12770  CZ  PHE B 750      82.102  56.046  92.764  1.00  0.89           C  
ATOM  12771  N   PHE B 751      79.641  60.846  90.517  1.00  0.88           N  
ATOM  12772  CA  PHE B 751      78.562  60.409  89.653  1.00  0.88           C  
ATOM  12773  C   PHE B 751      78.466  61.